1F1AA

Crystal structure of yeast h48q cuznsod fals mutant analog
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
153
structure length
153
Chain Sequence
VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIQEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords COPPER-ZINC SUPEROXIDE DISMUTASE
publication title A structure-based mechanism for copper-zinc superoxide dismutase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 38
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1f1aA00
2AEOA 4A7UA 1BA9A 1N18A 5CU9A 1KMGA 1S4IA 2XJLA 1SRDA 3SODB 2V0AA 1IBFA 1ESOA 3HW7A 1BZOA 1YAZA 4A7GF 4A7SA 3RE0A 1DSWA 3L9EA 1SDAB 1MFMA 4A7QA 4U4IA 1RK7A 2ZKWA 2R27A 1N19A 4A7VA 3H2PA 1F1DA 2APSA 2AQNA 1TO4A 2E47A 2WKOA 2C9UA 1E9QB 2ZKYA 3KM1A 1EQWA 1Z9NA 3GZPA 5KBLA 1P1VA 2ZKXA 1PU0A 1JCVA 2JLPA 1B4LA 1COBA 1PZSA 3F7KA 1F1GA 1IBBA 1F18A 3PU7A 3ECVA 1L3NA 2K4WA 2SODB 1SPDA 5KBKA 1SXBA 4B3EA 3T5WA 3HOGA 4BCYA 2E46A 2VR8A 1QUPA 3K91A 3KBFA 2Q2LA 4N3TA 3MNDA 1SXSA 3KM2A 2AQRA 2AQQA 2GBUA 2VR6A 1HL4A 1IB5A 1Q0EA 1CBJA 1E9QA 1UXLA 1FUNA 2Z7ZA 3KH4A 2Z7UA 1E9PA 1XTLA 1XTMA 1XSOA 1OAJA 2GBTA 1AZVA 1E9PB 2Z7YA 3ECWA 2WZ0A 3L9YA 2WZ5A 1Z9PA 1F1AA 4OH2A 1SXCA 4MCNA 1SOSA 4A7TA 2XJKA 1YSOA 1UXMA 1YAIA 3F7LA 1SXZA 2AQPA 2C9VA 1OALA 1B4TA 2GBVA 2C9SA 2WKOF 2WZ6A 1EJ8A 3ECUA 5KBMA 1OEZW 4A7GA 3S0PA 1E9OA 3GTTA 1PTZA 4BD4A 3GTVA 2WWNA 2WYZA 2AF2A 3CQQA 1E9OB 1IBHA 4OJAA 3GZQA 4L05A 1OZUA 2WWOA 2WYTA 3GZOA 1DO5A 3GQFA 2AQSA 1OZTG 4BCZA 2Z7WA 3CQPA 2JCWA 3QQDA 2AQTA 3LTVA 4MCMA 3H2QA 1SXAA 1JK9A 4N3UA 2NNXA 3QQDB 1SDYA 4FF9A 3KBEA 1CB4A 2VR7A 1IBDA 1U3NA 1JK9B 1SXNA 3MKGA 2ZOWA 3CE1A 3KH3A 2LU5A 1HL5A 1TO5A 3HFFA
chains in the Genus database with same CATH superfamily
1O6SA 4ODXB 4YO0B 4A6YB 1EHLH 2HJKB 2J7LA 3VFMB 4PWJA 1BFVH 1KCBA 4JRYB 4ZTOH 1KZYA 4HWEH 4ABWA 3KJ4C 3I9IA 1TZGL 3H3PL 1VFOA 4PBDA 2KPNA 5E5LA 2CIKB 3VXQA 3A5VA 1K3IA 2WJ7A 2JCCA 3L9RA 3VYNA 4PJAF 3VXUB 3HAEH 4KVCL 3ULSB 3HNSL 1IM3B 5DGRA 2J5LB 4AYSA 3UDWA 4ANWA 3FUHA 2R23B 3NZHL 4BFEA 1QFUL 4NQXA 3H3PH 4ZAKB 3HHSB 2V17L 3ZZQA 4W6XB 4CMHC 2EC9U 1XXFC 4M6AA 4QRSB 4WFHD 2CJ3A 2I7SA 5HDBE 1E90A 1JYNA 3C60C 2H8PA 1S7SA 1KV3A 2FO1A 1FJ1B 4HUXA 4KVCH 3SBQA 2AAAA 3HNSH 1KJVB 4P5KA 1TKWB 1JF6A 3ES6A 3OB0H 3A4EA 3IGAB 3NZHH 4P5TD 1ZTMA 1QFUH 3QZWG 4WEEA 2V17H 2AJYL 4CN6A 2BP8B 3FL7A 4C83B 1J8HD 3VFSA 3LN5A 3ZRSA 5EU3A 4F7TB 3TZVB 5AVQB 3CQFA 4ZMPA 3DHPA 3NGBB 4OZ4A 1Z9PA 2ZICA 3GHBL 3TBWA 1EEYA 4U05A 2YD4A 5DVNA 3LNGA 4LE8A 2AJYH 2J57A 4OBRA 5IG7A 4QD2E 1NFDA 2JJTC 2YRZA 2J8UE 5E94A 3AREC 2WZ6A 4LKCB 5DRWB 4AW7A 4G9FB 4LNRA 4LDLB 3WNMA 5AZEL 4FNUA 1BG9A 5CJOH 3PL6D 4KKRA 1QEXA 4TN9A 1S46A 4MSWB 1AY1L 2XQYK 1E7VA 4NI3A 3GTTA 4UANA 2YWYA 5C08E 4BKLB 1S9YA 4WRLA 4OJAA 2QEJA 4R83A 3MCKB 3SGJA 4U1SB 3FQTB 1A6VL 2MNUA 3CVBA 3F3HA 3NRFA 1YUKB 4P2YA 4QF1B 3SYPA 3CFKB 4OD2A 1UQSA 4NN5B 4OLVH 4QRTB 1DDHB 4DFHA 3VVWA 1NGWA 1JTPA 1AY1H 3WTTA 2AQ1A 3K81A 1M3JA 3MRIA 3MRRA 1AO7D 2IV9A 5FS5A 3X12B 3O0RL 2JLLA 5F71A 2XNAB 1INEL 3F04A 2BNRB 4XGZA 2IQAA 4OAWA 5TE4L 1QWUA 3WNOA 2DMHA 4LSRL 3SKNA 4I0PC 5J56B 1WWAX 1P69B 1QPKA 3HFFA 5E1IA 3W3BA 5CIPA 2H6PA 1G7JB 2BNQA 5D96B 3APNA 4HLJA 2OXGB 4NPYB 3O0RH 4YHZH 1INEH 2C26A 2X4NA 4JREC 5TE4H 5KS9F 3ULUH 1PCXA 1DJWA 4LSRH 4HS3B 5HI5D 3RX7A 4HK3N 5FDWA 3HC0B 3P54A 4DT2A 2Y36L 4AQEB 4Y2NA 2F8IA 4R4FH 3SYAA 1T20B 3ZL4H 2DQMA 2YHGA 1F11B 3Q2NA 1KNOB 1BV8A 1TEFA 3MI6A 3IK2A 2OW7A 2YEQA 1KJ2H 1MVUB 2CA4A 3VWJB 5J12B 3NCYP 3QDGB 3GTNA 2EE2A 3DX2A 5C7XH 5FK9A 2Y36H 3D69A 4OT1H 1M7IA 4AK1A 1XEDA 3MMEB 1ZVSB 2PO6C 4NZDA 3FCTA 4POZC 3CWGA 3N42B 1FYHB 1QUPA 2AJVL 1CF8L 4Y19E 2X4QB 2VLJA 2VXVH 4QRRB 5TD4A 1U8QB 2DW5A 2OTUB 3LZOA 3COOA 4H5SA 3IJSA 3QXDB 5FYLL 1N10A 4UZUA 3DDGA 2J2ZA 5GGRB 1MUJB 1T1WB 2PWHA 2ZX5A 1G9EA 1UT9A 1MPAL 2X38A 2APBA 2AJVH 4F2MB 1CF8H 1MHCB 3H8NA 1J0YA 3BLKA 4ZUUB 2F53B 3BISA 1WC7A 4JY4A 4NN6B 5FYLH 1J12A 4Z7QE 3U0TB 1ROCA 4X6CF 1LEGA 2VJ8A 5CIPH 4FG4A 9PCYA 3VG9B 2OSLA 4JFQB 2XC8A 1HKLL 3KL5A 1LEIB 5B38B 1FIGL 1ZXQA 1BM7A 4L23A 4QRQB 2FLMA 1HWWA 1V54B 2JKSA 4KKBD 3B9VA 5J1AA 5C0BE 1CU4L 5CCJA 2A7BA 2JJSC 1H8NA 2D7NA 3BPLC 4BM7A 1J9CT 1A9EA 1HKLH 2BSSB 3EYUL 3MLSL 4P2QA 1T1ZA 1XGPA 2ATKB 3TA3B 2AQTA 3QI9A 3LDBB 1FIGH 5JW5B 3N40F 4AIOA 3JWOL 2ICWI 2P8LB 1W80A 3D2UB 3MGOA 1CU4H 4X7SL 2IAMA 3ZDYF 1KB9K 5T5FA 3TBCA 4OCNC 4WQOA 3EYUH 1NIAA 4F7EB 1T3FA 1JZ8A 3POCA 4WI2A 5IQNA 3DHUA 4K7FB 4XI5C 4H8WH 4NN5C 1SEBA 3QIBA 4IBSA 3WLWD 4NX0A 4A68A 1WIPA 4KQ3L 3UTSB 4YXKL 1IZJA 5HYSB 3JWOH 4X7SH 1EAPB 1XDTT 3FOLA 3DX3A 1OGAB 3GMLA 3QDMA 4L8SC 4PMEA 3ISYA 1B6UA 4LSQL 4KQ3H 4FXKB 4HA1A 4N90D 3U1SL 4R7DB 4YBLC 3IKCB 1ZT7A 4G8EA 3QRLA 5BZXA 3LPGA 4Z7OF 3V5DB 5BRZB 2Z8RA 2R51A 4HUUA 1BVNP 1W2KT 3CFUA 1LP9B 5DQJA 3WY4A 3KHOA 4AGOA 3GS0A 4IGBA 4LSQH 1U30A 5GGUB 5GQBA 3RPBA 4AC4A 2EUWA 2NY2C 5KANG 1WFUA 1FN4B 2VSCA 1YEGH 3L3OB 4HWBL 4JGJA 2EIEA 2DQIL 2LR4A 5C86A 5T5FL 2J56A 2Z7ZA 2NQDA 4A2GA 4DVBB 1KXVA 3VWJC 3LRMA 4NGHH 5L9DH 1QPPA 1GPOL 4HP5A 2ADGA 4Y5YA 2EINB 4X99A 4AQ1B 1QD0A 5ID1B 4KRLB 1H9VA 1U3HA 3OHMB 2GBAA 2VDPH 5I5IA 5CINL 1WFIA 5HD8C 3WG7B 4ZS7L 3OKNA 3H85A 4HWBH 4LOUC 3O2DA 5T5FH 5I1AA 2AQ2A 3WTSA 4KO5A 1HCVA 3VWKC 2G0LA 1CFQB 3DV4A 4FLRA 4P4KA 3KPNA 3N55A 3IJ9A 1CGSL 5KSBB 3ZE1B 1GPOH 3KS0J 4U1MA 1IGML 1ILSA 2YA2A 4TLTA 2EILB 2V5SA 2WBJC 4RFNB 4TNFA 3ZZ1A 5CINH 1OE1A 3VXRD 4H0LC 3BMVA 1UJTA 3O2VL 4IJTA 4ZS7H 3VFPA 5MERA 4PRBA 1F0LA 1H3WM 2OMWB 1TZ8A 2YMXL 3W9DB 4PJ9B 4FQJL 2A9ML 4KMQA 4CUCA 4KMTH 3C8HA 2VXTL 4GAGL 3SJVA 3T2OA 3ZIYA 2YLKA 4MMZA 1CGSH 2H6UA 3LZPA 3O8XA 3SDXF 1IGMH 3LKSA 4KO9A 1MI5E 5KVFH 3RZCC 2VN3A 4EZLA 4RLDA 3FO9A 2QV2A 1I7RB 3QJSB 1VADB 5JYMA 3HPLB 4KI1A 3OBAA 4OFKA 2YMXH 1HVXA 3MRMA 1L5GB 2B0SL 1I9RH 1ED3B 2VXTH 3NIDE 1KXTA 4ZXBD 3G6JE 2A0LD 5DT1L 4DETA 1CLVA 4N25A 4B41A 2ZP8A 4PJXB 4R9HA 3BW9B 2R9HD 2X6AA 1EEZA 2XG4A 5BUPA 2V3FA 2D73A 4UOJA 1KN2L 3MC0A 3O2DL 5KBPA 3Q06A 2R1XB 1UKTA 1DBBL 2VIRA 4HK3J 5C0IB 4R90L 1I3VA 4MD0B 1A8JH 4IBTA 4QXGL 2B0SH 1BDYA 4N0CD 1PCSA 4L5FE 4M3KB 3T2NL 2WUCL 1UASA 1YPZA 1UZ8B 2D0FA 3P0YH 4KXCA 3TU6A 1IJNA 2A99A 4KJYB 4GXVL 2IPKB 4OM0L 3EFOA 3EOTL 2CUMA 2ZUTA 1KN2H 2EEAA 2VW4A 3O2DH 1TJIH 4R90H 2ED9A 4CVXB 4F93B 4LPCA 4P2OB 3T2NH 5HHOD 2WUCH 5H35A 2VDOL 4AENB 3TV8A 5HI3D 4I18A 1F2QA 1HQRA 3CFBB 1ZGLA 2ZKMX 4M43H 2ZOTA 1RZQA 1TQVA 3T0AA 2A9DA 4OM0H 3EOTH 1PLCA 2CGRL 4Y2OB 1RZGB 1HH6B 2AKRA 1VFBA 4U2ZA 5EFIA 2AV7A 3RP1A 3IRZA 5CLYA 4ZS6D 4XNXL 2QQLL 5AW3B 4WV1C 2VDOH 5IUCA 4JDEB 4GSUA 3RWJB 3T4AC 1RJZB 3AXIA 4GSDH 4YZWA 3TJEL 4QRAA 2BSDA 3ULVE 1UJ3B 2E9GA 1EZLA 2VDNL 3OR7A 4P5TC 1BIIB 1SF5A 2C3VA 4JGMA 1NDMB 1WAAE 4X6FA 4XNXH 2QQLH 3HPJB 3HG0A 2WKOF 2W9LA 4OLZL 2IH9A 4ISVB 4BSVA 1JDAA 3K6NA 4WI0A 3FRPB 3TJEH 3DPDA 3FSZA 1U42A 1J5DA 4PUBL 4YWGL 4JZOB 3V9CA 2V5RA 2WN2A 4L1BA 1GW6A 3HEIB 2W59A 2ARJB 4OFPA 4IKKA 5DTFB 3NRQA 1OLLA 1OOWA 5C0CB 5TQ0L 4N2LA 4OLZH 4NENA 4OCSL 5HHVH 4PJCE 2DKUA 5IB1B 2G9KA 2HKHL 3K74B 1I9IL 5F1OB 2OP4H 3MLTA 2J1YA 3ZGHA 2IBZX 1R3HB 2CH8A 4PUBH 2C3GA 4APQB 1TTCA 3BEVB 3LNDA 1I1AD 3D39A 3FBKA 2GKIA 3IDNB 1PQZA 4RFNC 1MCNA 3KPRA 1JK9B 4PR5B 5TQ0H 1JWSA 4L29B 2CO4A 3DVNA 3TCLA 3VGDA 2YEVB 4OCSH 3P4NA 1TPXB 1C08A 1I9IH 3C9NB 5DHVA 3ZYOA 2FE0A 1HEHC 5IW1B 3KLAB 1GIGH 1J86A 1HWGB 2WLLA 3LEXB 5JO5A 3TESA 1JGVL 3PRZA 2NZ1A 2WCSA 2GTZB 1ZPUA 3SDDB 3L1OL 3MV8A 3AT9A 1ERNA 1SYVA 3OM3B 4J3XA 2ENYA 2M8XA 5CLWA 2BIIA 5SWSB 3CFQA 2FL5B 4ZFOA 1JZDC 1AD9B 2JK5A 4UTBH 4WO4D 2NY3B 2FX9L 3NA9L 3NQKA 3OAYK 3WKQA 5BQ7A 3OJ2C 2Q7YA 2OS7A 3UTPE 5I6NA 3MRKA 1JGVH 5BZDB 1CFBA 4HJ1A 1MCOL 4LCUB 3L1OH 2Q86A 3ATEA 4AYFB 3PGCB 2NTFB 5LBGA 3DDFA 5JTWA 1XGTB 1QA9A 1F13A 3C6SA 3H54A 3TJPA 3NA9H 4AGQA 4DHLA 4OKDA 2GW5A 2D2CC 4K7PX 3ARDA 2XCMC 5IHZB 2ZJSL 5ICZA 1AFVL 2DLHA 5CEYA 2BXYA 1MCOH 1UH2A 1YEFL 2YGOA 3L08A 4LVHB 4M6NL 4A55A 2J20A 3B9KA 1S78C 1V27A 1OAJA 1ACZA 1DVYA 1BFOB 5A2JH 3AS3A 4QTIL 3DX7B 3KPSA 2W5PA 1J0ZA 3CK0L 4YPJA 2A9BA 4UF7C 4JRYE 1FFQA 2ZJSH 1NCHA 3Q5YA 1AFVH 5IMMA 3MRNB 3U2SB 4M6NH 1HXMA 2EAEA 2MIZA 4GRLA 4J39A 1KTBA 4EN2A 2IEPA 3QZWA 4ZFOL 5DYOB 3V6FA 4AYBA 2JKLA 2BVPB 5TDNB 4QTIH 4HUMB 1A6TB 4TUKL 3VXUE 3WOVA 3CK0H 2X4SA 4HH8A 4UMGA 2WYZA 2Q9OA 4MHHG 1QR4A 1IAKB 1UWYA 1FHNA 5K9KB 4J3WA 2AK1L 2VMFA 5FCSH 3N41B 1P4BH 4C47A 3GK8L 1ZLVK 1TITA 1QNZL 2X0WA 3V52L 4I9WE 4UM9B 4FFVC 1M05B 4K94H 4UU9B 4HJGB 1F3DH 4TUKH 1P5VB 4C4BA 3X1EA 3GSQA 2XYCA 4OGXH 4R7NB 1IVTA 4N3UA 1SNRA 4IBWA 3AS1A 3MTXA 1CK0L 5I17A 4H8QA 5DD6A 3GK8H 4KK9C 1QNZH 4X5WB 4WFGD 4EEEA 3OSVA 1KCRH 3BP6B 2CNYA 2MMXA 3IXTB 3BAXA 4NKIL 4W9DC 3WTUA 3K2KA 4WHTA 1AOHA 3WUZA 4PJ7A 2IJ0C 1OARL 4NSKA 4B9PA 4WNQB 3VXNA 4E9YA 1TLKA 1CK0H 5D2LF 3VYOA 3L4YA 3FQNB 2EXSA 1JDDA 5EZLA 3OJMB 1OP4A 1Q0XL 1T1YA 4U1LA 4G9FE 4ZOAA 4P5SA 5C2BL 2R2HA 4NKIH 3BYYA 3OMIB 3S37H 5DJAB 4YC2C 2W38A 1I9JL 4Q4EA 3SBRA 4JCMA 4ADIA 2V9QA 3Q6GL 5A40E 2X88A 2A6IA 1M6OA 3WUWB 4XMPL 1X5AA 2DZEA 2ZSVB 2WLNA 3AWEA 4PGEA 4BELD 1Q0XH 3LKOB 3P77A 2RD0A 4LDCA 3TJHC 1L0QA 5C2BH 5AAWC 1ZAGA 1J8SA 5F1NB 5BQDA 4F33A 2B16A 3OLGA 43C9B 1HQ4B 1SHMA 3DK0A 5CSZB 3Q6GH 4R6UA 5GSRB 3UBHA 2BNRE 1G7LA 2EZ0D 2J1XA 1RZKC 1MCCA 2BOBA 2QPFA 2BVYA 1FH5H 2WVUA 3VI4F 5EBLA 4PJDB 2HLAA 2OMTB 1NPJA 3FYIB 1UATA 3MBEA 4FFWC 4I1RA 3G5VB 2VDLL 5HTSA 1NPNA 2DYRB 3FSVA 3C6EA 3N0PB 3HE6A 1DJZA 1E2ZA 4PJ8B 1NMCC 1BJMA 4KDTA 3HZVB 5E51A 2V2TA 3P11H 3TASA 5GS1B 1FL6B 4YDIL 3ZX1A 4X9GA 2N7AA 3MCG1 4HKBB 3LKQA 4E41A 1BFTA 3UAJC 3KLHC 2AXGB 4C56B 2VDLH 3TFKD 5T1KA 1P7HL 4Q74A 1KY7A 2XQ0A 4ZOEA 5KOVC 2Y1VA 5M95B 2E8ZA 4U3SA 4BFJA 2XWJB 5JHMA 2P5ED 2GABA 5D2NB 4K3EH 5TJWK 3QDGE 2FQFA 5E8OA 2XVBA 4PW3A 3I6SA 4ELMF 1JV5A 4YDIH 1ZCRA 1I8MA 4BCZA 3ZHFA 2DMGA 3NCYS 3CXHK 4KROD 4AEHL 1AI1L 5L8KB 3K2MC 2Z92B 2K6ZA 3CDGB 1MG3C 1MVFA 3GMPA 3IT8D 4KKLD 2K9FB 1L4IA 3O3UN 5DS1A 2OTWA 2PCPB 3QQDB 4QRRE 3S36X 4QY8A 1WH0A 1VB9A 4PRNB 3TBSB 3RY6C 2AMUA 3DRQA 5D1ZA 1OXYA 4GRWF 3FUMA 3VRLF 5EO1A 1AI1H 3AB0B 1NZRA 5I8OL 3H6AA 4YZFE 3FTXA 4F2ME 5LHDA 5E2WH 4HHGA 4QO1A 2F53E 4MQTB 3QJQB 1RZJL 4GKNB 1XEUA 3PQYA 3DO7A 4EAEA 5C92A 5E8PB 3EZJB 1SVBA 3FF8A 4ZXBC 1S7XB 2L0DA 5BS0A 3UZVB 3ZN6A 5KBDA 5I8OH 5F9WB 3RTQB 1A66A 3LN9A 1VFAA 5JR1L 4RNRB 4PIRF 2C7FA 1RZJH 2ZKXA 4ZTEA 4X4ME 5GGSA 4LEXL 3U2IA 1YC8A 3VNYA 4EI5A 4FG2A 4BWUA 3ZJAA 3ZT5A 1CICC 3OZLA 5E5MA 2WB1A 4KKNA 4UNVA 1HAWA 1M9WA 1WBYA 4HC1A 2Q1EA 2EKSB 3D0VA 3TM6A 3WV0A 2ZWNA 5AVSB 3VO0A 3UP1A 5IJCC 5JR1H 1P7KB 5J3HC 4PRID 3SE4C 4MQXD 4LPXA 1X4YA 4PWHA 2X4OB 2YXMA 1GTNA 1CLZL 1FYTD 4LEXH 3F01A 3VW3L 3S2AA 3IM1A 2NXYB 4Y0GA 5LG1A 5HI3C 2PN5A 2K4AA 3Q2WA 3NZUA 1KYOJ 4X5QA 3QEHA 3QO0B 3EGSA 4RA0C 4FYQA 5DUBB 2NLJA 4O2EB 1C8QA 3SOTA 4ZX4A 2UYLA 4GRMB 3UTSE 4YE4L 2J4WL 3D9AL 1CLZH 3N43B 4M5YL 2NX5B 1EWHA 3EHBC 3VW3H 2BINA 4N22A 2UY6B 2EYRA 4ZMAT 1OGAE 1AP2A 1GOFA 3S35L 5AVTB 1MJUL 1A5FL 3ATFA 4LSSL 4LPWA 3U9WA 4J3UA 1F6LL 5EU6A 1I53A 4YE4H 5DJ6A 5SX5K 2F58L 2J4WH 2X4UB 3MRQA 2F5AL 2WAHA 4N86A 3BKCL 3BJ91 2FB4H 1MQ8A 3D08A 3EIFA 2LOEA 5BRZE 4HC1L 1MFUA 3S35H 1MJUH 2E9WA 1A5FH 1DCLA 3S9DB 4LSSH 4D0CA 2J25A 5BUGA 2EVHA 1LP9E 5GS1C 3V0VB 4EF3A 5AW6B 1OCZB 3UG3A 2F58H 5AVWB 3GEFA 3ESPA 2F5AH 1U3NA 1ZLWK 3BKCH 1U2YA 3C5ZD 3ARTA 4Q6IC 3VU1A 2FR4B 2BOCA 4OTXH 1DVFB 3C8KB 1ZEAL 3ZKMD 1D6VH 1ZTXE 3QQ3B 4N8VA 4MXWL 4EDWL 5IFHL 3BZEB 2JKIS 3G6AA 3NACL 1Q94B 4XP9L 1I1AC 4G9DB 1UM4L 2C3WA 2HKFH 3SE9L 5TF0A 1S3KL 2G0KA 3B8SA 3NP3A 5I9QC 1FCGA 1ZEAH 4NZUL 1Z0MA 1AR1B 4HUVA 5DI8A 5ACZB 5KSBE 4MXWH 4EDWH 3MRCA 1TQWA 5IOPB 1QP1A 1LJMA 5IVXB 4OB5L 3NACH 5GS0D 1WPCA 3RNKB 2C9XA 3AB0C 1UM4H 3NCMA 4XPGL 3QAQA 3SE9H 4YDVB 1CDIA 1NBCA 3KJ6L 1S3KH 1EFXB 1VLXA 2NUPB 4NZUH 5CD5D 3HBQA 4D9RE 2IBZY 3ZLQC 4DZ8A 2G60L 3BVWA 3QQXA 3QA3A 4WO4C 3SCMA 3S98A 1X5ZA 2NDGA 5CEZE 3VFOB 1G9HA 1M7DB 2VISA 1NBZA 2HT2C 4OB5H 3MNDA 2FGZA 4LL9A 4XPGH 1BQLL 3KJ6H 3UBXG 1Q9LB 4H26A 2FQGA 2DQDL 3NJHA 1ACXA 3FRUA 5DR5H 5IROD 3MRGA 1SDDA 4ZO7A 3Q48A 2G60H 2KMWA 4PJXE 4JPWL 4GMTL 4NZFA 3GPEA 4FERA 2AK4A 2Y1YA 5CBAA 5EZPA 1N0LA 4M62L 1VGKA 1C9SA 2YMTA 1YAIA 1ZA6B 4FQCL 1BQLH 4JM2F 4LU5L 2VTFA 4X8CA 1LDPL 2DQDH 2WBXA 3D3VE 5LAXB 3ULVD 3B37A 4AOFA 3P73A 2XV2A 1T1XA 4GMTH 2NXYC 3B1TA 3GSVB 1ICTA 1AQMA 2GSIB 3M8OL 1MSPA 1MJJA 5T3XD 1LO5B 3D09A 4H2AA 4M1CC 2QVKA 4M62H 1UZ6E 5CWSB 3GSRA 4XO5A 5SWZB 4FQCH 4YK4C 1VJSA 1KELL 4DFIA 1LDPH 3WFEH 3WL9A 5D70L 5GRUH 3WFCL 4KRPD 4K7PY 5E4OA 3ZHDA 3M8OH 4AZ8B 4JFPB 1J11A 4B50A 2VR3A 3IJ8A 5DMGC 1JFHA 5HHXL 4NT6A 1A1OA 3AG4B 4URTB 1KELH 1CGVA 4PWIA 3ET9F 3Q8CA 2H9GB 1QABA 4TULL 5D70H 3WFCH 4HZLB 4IOSD 5HI4D 3C09C 3L95A 4KHTL 4YHOL 4XP4L 5HHXH 4L1SA 3SBWA 2KQMA 5EN3A 3QRFM 3VXRA 2BVEA 4OZIA 5SWQB 4PH8A 4PJEB 2YOAA 4FG6D 4LNVA 5E8NA 3VXOB 2WXRA 3MA9H 2ID5A 3P9MA 3GJFA 2DQUL 1CFMA 4HS8L 4YHOH 1P7QD 1KFGA 4H44C 4XP4H 1DDTA 5AL8A 4Y2DB 3ZQWA 5HHMD 2O6PA 1URIA 4GUCA 1I7UB 3HI1A 5BJTB 2RA1A 5C0CE 5JHAA 1CXLA 1OAKL 3F7YB 1FNGB 3QSKB 3SKOA 1IC1A 1ZSDA 3QBTB 3DV6A 1MCPL 1ZHBA 3MODL 2DQUH 4HS8H 4U1JA 3KPOA 1V7NL 2CLZA 1MZZA 3W0WA 3ZL1A 1NC2D 2AV1A 1OVZA 3JV4B 1T89A 1GJWA 3K6SA 1QLFB 3O6KL 5HJ3B 1OAKH 4YEFA 3RWEA 1Y6NR 4GW1A 2WVTA 1L3WA 5LNGA 1MCPH 3GRWH 3MODH 2KZWA 4AEIL 2YMOA 5IMOA 1V7NH 1WICA 1SOXA 3HHRB 3RB5A 3CFNA 1K8DA 2ZOOA 2WTOA 2XKSA 2EZ0C 4GP4B 2N7BA 1RK0A 4GLRH 4YHNB 3O6KH 2B1HH 1U93A 2CKNA 3TEZA 3MRFA 4OUUA 4IHOA 3NBNA 1OB1A 2HJLA 2HJFB 3FQXA 1U3YA 3U36B 1E40A 4AEIH 4X4XA 4BDVA 2ZE0A 4QPEA 4ZI8A 2WD0A 3BDYL 2BC4A 3K72A 3IVKB 3VXUD 4JPIA 3CN1A 1X9LA 1IM3D 5IMLA 2AQSA 3ZHKA 2XN9A 1XZWA 3GJFH 5I75B 2BHUA 5J57B 1MCSA 4WWNA 4QHPA 2CHNA 3TYFA 3VFUB 4WI4A 3U6RB 1AG0A 2JH2A 3OGCB 1JG9A 3RJDA 3BDYH 4HMCA 1G6RB 2EDMA 4JQVC 4LL4A 4TKWA 3CN3A 3PDGA 4ZPVA 5IQOA 1ZDSA 1A9BA 3EG9A 3UAEA 2QBWA 3I75A 2EDRA 3FQRA 1OCRB 4KXBA 4YDLC 3T9WA 4AQ8C 4FQXC 4KROC 4Z0BL 1U8LA 2XY2A 3CPLA 1OAXL 2XSKA 1KIRA 3PWLB 2NQCA 1VKXA 3BKML 2GI7A 1QOKA 3N04A 2HH0L 5TTRA 3HZ3A 5FECA 1NFIB 3GBNH 4XHJC 3RWDA 5CGBA 5IB5A 4NRZA 1GGBL 3DHJA 4Z0BH 2GK0A 4Y9EA 5EO0A 5FFOA 2J88H 1OAXH 2A73A 2EDDA 3QWOB 2NW3B 1DN0B 3Q8FA 1E9QB 1SOQA 2X53A 5JA9A 5I1LA 1UURA 3BKMH 4QXWA 5GRWA 5DJ8B 3WIFA 5EIVA 4O00A 4WWOA 1PDKB 2NMSA 2LQRA 1IBBA 5HVHB 4WU7A 1XT5A 1S9XB 4RX4D 5C7ZA 1NH6A 4OFQA 1KYDA 3NRPA 4R3SA 3NMEA 1P9MC 2E46A 1BG1A 2DY2A 4W9KC 3BN3B 1XR9B 1E2WA 4UB0L 5AKSA 1UCTA 4AX3A 2ZCKH 3GMOA 1JSYA 1S5IL 2B59B 1KTKE 4JDZB 1JAEA 4RAVB 5KG9A 3WU1A 2OULB 4N2OA 5EF1A 3L1EA 4OGAC 1J0HA 1PBYA 3OKOA 2BNRD 2GIMA 3EUUA 3MU3A 4H2CA 4KPHH 2E7DA 4FFTA 1A3RL 2EDJA 5I1IL 4UB0H 5HGAB 4OGZA 4Y4FD 3OV6A 2BPBA 2CSPA 2Y06L 1EAQA 2HRPL 1NGXB 4CU6A 1VACB 5I1HL 2EDBA 4FMFA 1AQDB 3F65A 1FFTB 4U6YB 4ZFZB 4Y4HD 1TVHB 4LLUB 4HOWA 1A3RH 3DGDA 1NCNA 4OF0A 3HFML 4YSRA 2FQDA 4AMXA 1CURA 4YSEA 2PTUA 3CAFA 2CDGB 2OJEB 4X8JA 2HRPH 2APFA 2QGDA 3HI6H 1J9SA 3QORA 4H4NA 1I8KB 4HJEA 4LRNL 3QAZB 3FO0L 5HJBA 3ROLB 1Y0LA 4BK5C 1FSKC 1CDYA 3O11A 3RBGA 1CG9B 3QDGD 5CGYD 3BQUB 3DO4A 3IF1B 3QR0A 4FKHA 3BAIA 4K8RD 2XX0A 4NM8H 2PTVA 4KZCA 2AMGA 3MKGA 4H8VA 1UEMA 5A2IH 2V33A 3DX8A 4PJDE 4AKPA 4JFVA 5C0JB 4QRRD 5K1VA 4LRNH 5A2LH 3FO0H 4Y8DC 4U7KA 1G7IA 3TNNA 3GSWB 1AKJB 3JTSB 4YSCA 4NNYB 3P9LA 4WUUB 1IAOB 2J8UA 5A2AA 1IC7L 3C5ZC 4GSRA 3I9PA 3L2NA 4FYTA 3T04D 4ZMLA 1SN5A 4L4TD 3DWTA 2X10A 5JXED 1Z9LA 5C08A 3CN0A 2XBTA 4BE5A 3MFFA 3FZUD 3KXFB 5G5DB 2HLEB 3DLQR 3IJ7A 4C56E 2AXHA 3BEWA 1J1PL 1DQDL 2WW8A 4PN6A 1IC7H 3T0EC 3RWCB 1ECZA 5GXBB 1GZQB 2PTTB 5D2NE 4MZ3A 1HU8A 1JHLH 1UTDA 3DJSA 5KANI 3HE7A 5JOFB 1RIHH 1R5WB 4WAFA 3QPXL 2OYPA 1NC4A 4BCYA 1WG3A 4F92B 1WQVT 4LL1A 2H5UA 1WD8A 1LGVA 1J1PH 4HKXB 2Y7NA 4JFFD 1XZ0B 1N8ZA 2C9PA 1WRFA 5D4JA 3S3BB 5F93C 4GQPH 1W0WB 2V2WA 4ODBD 1UB6B 2GJZB 4DP2X 3TVMB 3D2UD 3QPXH 5FHBL 4YGVA 3S4SB 1MFCL 3THML 1QLEL 1G4RA 5EOCL 1ID2A 5F70A 1OK0A 4F9PC 3HZYA 2VQ4A 3PJLA 1J9TA 4WW1A 3SDAB 3VM7A 2ZTBA 4FQQB 4LBEB 5DJ0A 3T3MB 1AQ8A 2HB0A 2BWDA 3B2PA 3FFDB 2HN7A 2V7HA 3RAJL 2UXFA 3CBKB 1C16A 3FK3A 5FHBH 3APCA 1MFCH 4G1EB 3BE1H 1QLEH 4XC3H 3M1CA 3THMH 3VXPB 4CVZB 1HEZA 5KW9L 1CFTB 5EOCH 4MRCA 3OKKA 1OGAD 1ASPA 5IBUB 3TXAA 3PGFL 5DLML 3F83A 4PJFB 1FZJA 3GZOA 3L3IB 1AHWA 3SEPA 5CD3B 1H6FA 4ONHA 3RAJH 2CXGA 2YPLB 4FAAB 5F6HI 3AROA 1TYRA 5FF6A 1HHGB 2CHDA 4Y19A 4XX1E 2JCWA 1JZ6A 3S3PA 3LXAA 2CBTA 5KW9H 1YNTA 3CC1A 3KWTA 4E5XG 1BX2A 5BRZD 1U8MB 3QCTH 3PGFH 1IBDA 2Z9TA 1J88A 2DPKA 2X44D 3PHOA 3KCPB 1QW8A 5GZND 5E9AA 3N9GL 1XH0A 4JFOA 3CFMA 1JGEA 1L0XA 2ADIA 5L4JA 5E7BA 1N4XL 4YHIA 4Z3IA 2ICWB 5IVNA 1N18A 1JS4A 4G7VL 1E5CA 5DEGA 4TVUA 3A67L 4XOAA 3TNMA 3IETB 2VLLB 4WWPA 4NAJA 3QB7C 2VKWA 1BQ5A 3AW5A 3P4OA 4FXGC 2KS0A 1GOGA 5IV2B 3DXAE 3UPRA 4N28A 2NX5E 1LL1A 1U91A 5C97A 3SY0A 1KTJA 3N9GH 4U1NA 2OL3B 3KL0A 4NC0B 1N4XH 4NDMA 5DO8A 2W0KA 1R47A 1PAMA 2XA8L 4DJMA 4G7VH 2Z1KA 3MX0A 1CGWA 3PE9A 3CFEA 3P4MA 5C0BA 5DHEA 3G3LA 1XF3A 2F54D 4TNEA 4ZMTA 1X5IA 2KZ1B 3CH1A 3ECQA 3TIDA 3CZLA 1EK3A 5CF3A 5I8CA 1IC4L 2GJ6B 2Z64C 4N8UA 1JVKA 3FTGA 3T2PA 4F7MA 2EDWA 5GS3A 2YD9A 5D7KE 4Q9BA 4X5XB 5FCUL 1CFSB 2XA8H 2Q6WB 4BSJA 1O9WA 2DIEA 2UY7A 1N64L 3BI9X 4XP5L 3UAFA 5I26A 3SO5A 4D9RD 1BYPA 3VNZA 2GJPA 1IC4H 1WA0X 2P45B 3FCBA 5TGBA 1SF3A 2VZVA 2ZF9A 1SLUA 3T1WA 4JM4L 4OCWL 3AM8C 2Z4TA 5CJ5A 4IRJB 5FCUH 4EN3D 4IU2B 3KLQA 4J3OD 2DL2A 5HY9B 1FC2D 1A4KA 1NINA 2OI9C 4PJ6A 4XP5H 4DEPC 5IJVA 1T5XA 3FU6A 4JK0D 5FOBA 5KVDE 4DP0X 4IHBA 4UBDC 3ZE2B 1BYOA 3FB5A 3ZZSA 1CI3M 1S8DA 1AGDA 3NFNB 3JQOB 4OCWH 3VD5A 3NSYA 2ODIA 1IGJA 5KUMA 2E76C 1J8KA 1NAMA 4GLRI 4AQAB 4ZMXA 5IEHA 1OF2B 2K3TA 3GTVA 2FSEB 1RZFL 2NR6D 5J06A 5IVXE 3U4EB 2RCSL 4A39A 2P7TA 1FORL 1NA8A 4GH7B 1MDTA 2UV3A 3W5MA 4DP9X 2ALAA 4KOBA 1ZOXA 4FGMA 3VJ6B 2CLRA 5HYJB 3SDAC 3QUGA 4MLIA 4Z7IA 4PCYA 2X1QA 1MCDA 4R7XA 4P2OD 1RZFH 1E27B 4J1UA 4IKNA 3QJVB 5D93C 5DWUL 3O6FB 2RCSH 2XIIA 3ZTEA 5F7HA 5D72H 5IBTL 1FORH 1EVUA 1EJFA 1XBDA 2ESVB 4JO8A 1NCOA 3U30C 3ZYIA 4JQIA 4AJWA 1EUUA 4TVPD 4ZNCD 1FFOB 4YDNA 4ZW6A 4OY9A 3PAYA 2ICCA 2WP3T 1RFDL 4XXWC 1PNDA 2ADJA 5IBTH 3CZUB 3HG1D 2RBLA 5E9DA 5D6DA 2ZPKL 3RVWC 4ZQKB 1NDTA 1IC0A 5DF0A 4JG9A 4HV8A 2ED7A 2VLRB 5D7LE 1OOAA 1XD1A 2YBRB 2GFBB 1UA6L 4PJBF 4G42A 5T1DL 4ANXA 5CBEB 1KIUA 3WEXA 2Z31A 1RFDH 4FP8L 3TS8A 3HS0A 2ZT9C 5SWZE 3WSQL 2LVEA 2ZPKH 5IB4B 1KB9J 4LEOB 4NQSB 3LRLA 1PNCA 1JF1B 2FO8A 1MI5A 1XH3B 1NJ9B 4U1GB 5I2IB 3HAEB 4OLXL 4P46B 1A6AB 4HH9A 1N6VA 1R9FA 2G3MA 1AR2A 1UA6H 2C4FT 2VERA 3A47A 5T1DH 3VB9A 2ED6A 2RH0A 4QCIA 4YSOA 1SJXA 1U8PA 4N3TA 2XTSA 3PJSB 4FP8H 4YHYB 3EO0B 3IJHB 5DVOA 5I15L 2M2DA 3FKUS 3WSQH 1XB3A 2R29H 3G6JA 3GLDA 4JQIL 1Z0NA 3TN0C 1RIVL 3L3GB 4YSUA 4E0RA 5I82A 2UX6A 3L13A 1AIZA 3BP5A 4JFZL 4NQDE 3PAUA 5INCA 3QXAB 4Z78B 1EBAA 1GW0A 5I6XC 4NP4L 1G4MA 5HYQB 2G30A 4TUUA 4NO2B 4RMRA 4C4UA 3HRZB 5D1QB 4LSVL 3QFDA 2VLME 2JB6A 2ROXA 4FNLL 4JN2B 2HFEA 2YGVA 2E59A 5I15H 4JQIH 5I16B 3Q6FB 1OALA 4LLDB 1KJ3L 5DK0A 4BFKA 1WV7T 1FVEA 4G8GB 1WIUA 4IIQB 2ZXCA 4QTFA 1MLBA 1W0YT 4JFZH 4M4RB 4MHHI 3EXLA 2WSDA 1PZ5B 1M7UA 4TUOA 3W57A 3ZE0F 5HYIA 4NP4H 2GITB 3SDDD 1JPST 1KGUA 2YEZA 5FV2A 4LSVH 5FUZL 4FNLH 5SWSD 2X70A 4UCFA 5ANHA 4Y4FC 2A6KB 3QJHB 5I0XA 4JO4L 3T4YA 1KJ3H 3O41A 4N5ED 4G59C 4GKZA 1HDMA 1TXKA 4AIZA 5TE7L 2WM0A 3DO3A 2HTLC 4RVBA 2GK2A 5FM8A 5IROA 3C12A 2NRDA 4Y4HC 5IM7A 3MGAA 1R34A 1VFMA 1IKOP 2YD5A 4B7IA 5FUZH 3X1GA 4JW3A 2B1OA 4XMUA 3ROOB 2JCCB 2KC0A 1RZ8B 4JO4H 2EVIA 5CO1A 4ZMYA 4ZUTA 5IJKC 3EYFB 1J05A 1ZHNA 4QOKD 4JFHE 1IU1A 5TE7H 5EBWB 5FM5O 2OR8A 2CM5A 5BPPA 3AG3B 3C60A 4NQXB 3D50A 4QYOA 4L5FL 3QIUC 1WAAA 3EDJA 3GIVB 1MHHA 2BVOA 4RGOL 3APFA 1JXKA 4K8RC 1BZOA 4DCQA 1GCFA 2H8PB 1CYGA 1ZS8A 2ENQA 2YBGA 3MREA 2LHAA 2ZUXA 4OCMC 1A1MB 1YQVL 2NW2B 5BVJB 3A6OA 2V9TA 1J9RA 4PAZA 3ES6B 4N5UA 1X5YA 2O72A 4OD1L 4PY7A 4QHUA 3ARBB 5BOJA 4X4YA 5FLVA 1J0KA 3IWVA 4L5FH 4N0RA 3LZLA 2QL1A 1SLWA 2VMJA 4LDOB 4RGOH 4FZEL 4M7LT 3O3AA 5F9JA 3OLIA 2IDCA 4Q2ZA 3VFSB 2UZIL 5ILTL 2HRGA 2P52A 4PJCA 2KDGA 2BY3A 2V2XA 2VN6A 5E6IC 4LCWE 1X6NA 4FHBD 4OD1H 5JHDD 2Y5EA 1OSZA 2JJTA 4ZMOA 4FI7A 3S8GB 1KJ2B 4QJ5B 2H32B 5IG7B 5K93A 2PUQT 4FZEH 1R3JB 4DP4X 3CVIL 2UZIH 1TCRB 5AUMA 3JTBA 1HCYA 1EXHA 1Q0EA 3LB6D 4GRWH 3H55A 4IBUA 4M4PA 3VA2C 1DQJA 4XN8A 4NO5A 1I4FA 3UG5A 4WWKB 4XT1C 1JZEA 4BJLA 1A4CA 3VMPA 2CCWA 3ISRA 2FH8A 2HTKD 2AJ3A 1U6AL 2VQTA 1TNNA 3CGTA 2HAZA 4FHKA 3RYMA 3A23A 3CVIH 3UOAB 1UQSB 2FYVA 4U1KA 4B0MB 1RMFL 3MLPA 1RU9L 3KPMB 3DA0A 1NGWB 3CDYA 3CZSA 3N1QC 2X6UA 4HHAA 4ZSOA 3VH8A 4YHYC 4NERA 2BCMA 3RIAK 5IBLD 4G71B 2JFCA 5IR1B 3ZMEA 4MJJA 3WLBA 5H37A 3BUTA 3PFQA 3REWA 5T8IA 2IQAB 4I0PA 3ZE0E 5AFAA 4LFHD 1QBML 5GRXG 2IXQA 1PZDA 2MOGA 3QO1B 2Y7MA 2H1PL 1RU9H 1KC5L 5F9OH 5I24A 5CIPB 3QWQB 2OMVA 1JTOA 1XV8A 5C09D 4KK6C 4LQFL 3WS3B 4MDIB 5BZZA 1I3RB 5IFJB 4G43A 1WS7A 2X4NB 1T66D 3HN8A 3KYOA 1E4XH 3H2QA 3UJJL 4PV8A 2OFQA 3NSDA 2CO1A 2LU7A 2ZUSA 4FTDA 2H1PH 5DO2D 3FSAA 1IM9B 4GUPB 3E6HA 1ECYA 3D6GA 1QUNB 4ODXA 4YO0A 4Y1AD 1NCAL 3VFMA 1XFPA 4XAWL 1K72A 1F90L 4JRYA 4GBXB 4U7SA 3UJJH 4HIJA 4MWFB 4FNSA 5GS2H 2PO6A 2QFPA 1ZY9A 5D7IA 1TU2B 3AU1B 3D69B 1MCJA 1GC1L 1M7IB 1ADWA 4XCYB 3QGVA 1NCAH 5I74B 1IM3A 4GS7C 4XAWH 5B7FA 3L5WB 3SDCC 1F90H 1H6EA 1K4CB 2H45A 1WWWX 4PS3A 5E24E 2GC4C 4UAOC 3HHSA 4ZAKA 4QKXB 2OM5A 1XX9C 1A47A 4M7LL 4QRSA 4FYSA 3QIWD 1E2VA 4AI7A 3AGVA 1G1CA 4GJTB 4WI8A 4D9QD 4NQEB 3D18A 4C56D 4XNZC 2NY4B 1KJVA 3EDFA 4Z3HA 4WW2F 3E6FA 1I31A 2J6WA 3IGAA 3LNEA 1E8ZA 1PIFA 1OCWH 4EXKA 1PX8A 2BP8A 2DEXX 5GIRB 3MOAH 4JO1L 4R97B 5CSBA 3ATDA 2X4PA 2OSLB 3QQ9D 4F7TA 5FFLA 3WTYA 3TZVA 4WENB 3MLRL 1RV6X 5GGVL 2A77L 2NY5C 3GJEA 1JVOA 4LSUH 5J1AB 2NNAB 4WHYG 2MQGA 3MYJB 5HJGA 1S6NA 4JO1H 4KKAD 3HC4L 4NUJB 4WUUE 4LKCA 2Q8AL 4CU7A 3AG1B 2QKIC 4G9FA 5B4MD 4DGYH 4ONFL 1D3CA 1GYCA 1IL1B 2H3NB 4AL8C 4I88A 2EDLA 3MLRH 1F41A 4EN3C 3V0AC 3CD4A 4BKLA 5GGVH 2A77H 2VDPB 4J3OC 1LE5B 3KXFE 4LLYA 4GMSL 3BUQA 2AF2A 4U1SA 1E9OB 3FQTA 5IJBC 3HC4H 3STBA 4XTRD 4QF1A 3CFKA 3S35X 3ECBB 4U3XA 4WFFE 2Q8AH 1U8KB 2FZ3A 4QRTA 1DDHA 4ONFH 1AGFB 5KEZA 3RTQD 3V8CA 1DVSA 2C34A 3X12A 4GY4A 2XG5B 3BPCB 2XNAA 1DE4B 2EIDA 2BNRA 2R8SL 4GMSH 3ZPDA 1J48A 1V5JA 2ODHA 3EJYD 3RZWA 3OLDA 4P57B 1M4KA 3QDMB 4N2CA 4X7EC 1BQSA 4WHDA 4XVTL 4F80A 1G7JA 4LVEA 5B1CA 1TQTA 3U48A 3WCYA 2OXGA 4NPYA 4BFNA 2R8SH 1X7TA 3HZKB 3HUJF 4OSUL 3V4UL 3GS4A 4G8EB 4MXVE 3HB3B 3TBYB 4P23D 2YKKA 5LGKA 3HC0A 1MAJA 4PVLA 4GQ9L 2JVUA 4H8HA 3T3ME 3FQ2A 3CU1A 4XNUL 1NLBL 2VN7A 1F11A 3F2LA 2EXYD 4XVTH 5DQJB 1WBZA 1A6UL 2VMEA 4IGBB 3MXWL 2IGLA 4LKXA 2JQMA 4UILL 3GMRA 3JVGC 1CLOL 1MVUA 2CJTA 3LEVL 4I89A 3RHWF 2NX5D 3VWJA 4ENEC 4OSUH 1P5UB 5I1CL 1CT8B 4Y89A 1SBBA 1P4LA 5FYKL 2OMNA 4PJFE 1ACYL 1F4HA 4GQ9H 1GZPB 5C3IA 4XNUH 4AIXA 1NLBH 4X99B 3SO3B 1ZVSA 1U3HB 1A6UH 2YPLE 3IMSA 1QSED 4I85A 4L2YA 2X4QA 3VWKA 1JZFA 1CLOH 2NYYD 3WKYA 4MJ2A 4QRRA 3FCUB 3V0JA 1U8QA 4NWTL 3UBXI 4IKJA 2OTUA 5I1CH 5AKVA 3QXDA 2W92A 1F5WA 5CKGA 5FYKH 1MOEA 2VT0A 3TEYA 5GGRA 1MUJA 1N0XL 1ACYH 3KPNB 1T1WA 3L3DB 4L9DA 1IFRA 2X2JA 4U1MB 5DDHB 5F6IB 4TPRL 4NHUB 1M9SA 4JJ5A 2ICEB 2IOOA 5TPWL 4F2MA 4KO7A 1AOZA 1MHCA 4ZUUA 3VFPB 2CHWA 2F53A 3CDFA 3GBEA 4NWTH 3BZDA 1QW9A 4GW5B 2NY4C 1DVFD 2RQEA 3PYCA 2H7WA 2BIPA 5IGXL 3U0TA 4PWFA 1N0XH 2LAGB 4PGBA 3A22A 4JFQA 4OIIH 4XP6H 3WFZA 1LEIA 2OMYB 3LKSB 4TPRH 5LJYH 5EOTB 5TPWH 5B38A 3FO9B 4IMKC 3JUZA 2VZTA 4X4MA 3S2CA 2FECI 3BUDA 4S1DD 2Y07L 1MNUL 1UZGA 3PNWB 5IGXH 3X1NA 2ZAIA 2PLTA 1ASQA 1RHFA 3CMOL 4KC3B 1G9MC 2GJ6E 2BSSA 3KD4A 2KHAA 4NQCB 2ATKA 3TA3A 5DA4A 3DC0A 4OZGB 4NQVA 4Q56A 4CW1B 7TAAA 5JW5A 1F8TL 5LCVA 3WFDL 4LP5A 1WDAA 2P8LA 1EFXD 3D2UA 5FKPB 2Y07H 1MNUH 2O1AA 4LVOC 4WVRA 3CMOH 1FBIL 3T8VA 3V5KB 3CFIC 4HLEA 3L4WA 4F7EA 2MEJB 4WU5B 5FM4A 5T3ZD 4K7FA 5E00B 4A7UA 2HT3D 1VDGA 3UTSA 3PGDB 1F8TH 5HYSA 3X14A 1IBFA 3IWUA 3JUYA 5EIIG 1EAPA 1Z9OA 3IPFA 4M8QB 1N12A 3U1QA 1FBIH 1I1FB 4DUWA 3BGMB 1OGAA 4BZ2A 1OD9A 3ZE2E 1ZGLB 1QZNA 2WY3B 3RA7L 4KK8C 4UQ2B 4HIXL 4WY7L 3CXHJ 3K0WA 5GZOA 3QZOA 1NGPL 3WTVA 2Z65C 2EP6A 4MJIB 4Q6KA 3RGBA 4WV1A 4B5ZA 1N26A 1Z5YD 2IAND 4R7DA 2AV7B 1U8CB 5EFIB 1PG7H 4RMSA 4N8CL 5L2JA 3LOWA 5BRZA 3EAKA 3RIKA 3EF4A 2ATAA 1ULVA 4FFZA 2ZF8A 1LP9A 2X40A 3HB3C 5HYJE 4WY7H 4D3CL 1RPUA 5LCVL 5GGUA 4RAHA 3P4LA 3Q2LA 2C3VB 1FN4A 3L3OA 3T3PF 4GO8A 1FL5A 3FQWA 4DVBA 1KEGL 3ESVF 5B39G 2DQHH 3HMXL 2ESVE 3R0NA 4TVSa 3X3FL 1F3JB 1QPXA 1P5UC 4WI0B 4JZNA 1L9MA 3ERXA 3VFGL 5I6OA 4Y9GA 2BK8A 4HT1L 4XPTH 1JZ4A 1BAFL 2C7UA 3BWUC 5ID1A 4D3CH 1C5CL 5LCVH 4UNTA 5EZIL 1PZCA 3G5XB 2NY6D 2WZ5A 1KCSL 3DVIA 1SOSA 3QH3B 4RWHA 1UEYA 5AW2B 4BZ2L 1CFQA 1KT2A 2RACA 3K46A 1CS6A 3HMXH 3PWUA 4NENB 4QWWD 4POUB 3X3FH 4P2RB 5KSBA 3VFGH 2XRAH 2QMKA 4HT1H 2Z0BA 1ID5I 1DYZA 2ENPA 1BAFH 1CL7L 2ZD0A 3MLTB 4ZD3L 4ZDHB 4HPHA 5I1EL 5KYXB 2MPAL 2N1KA 3K4AA 5F7WC 4JR9L 1KCSH 1SEQL 3LVEA 3TPUB 4PJ9A 5BZWB 5K9JH 3HN3A 1JWSB 2B7DT 5EDXA 4BZ2H 3TCLB 1H6TA 3GBLA 3S8FB 4FFZL 4HJ0D 4HGWA 4RGMC 1EGJA 2R0ZL 4OVUA 2AJUL 2VM4A 1P6WA 3QDJD 5DMYA 5AAMC 3X3GL 1CL7H 5LXVA 1QRKA 5IBLC 4Y2DD 3VD4A 2QQKL 3BIBX 3GSUB 4MAZA 4YX2L 3QXVA 4YXLL 4PGZA 1I7RA 1VADA 1EZVX 2WOBA 3D33A 3HPLA 3MJWA 1SEQH 5E8DL 3X1BA 4BUGA 5IVZB 3SPGA 3L4VA 3MV8B 1L5GA 3JV5A 4HJTA 1ED3A 4CJ0A 1O9VA 2JIXA 4QI3A 1A8ZA 1ZTXL 3IS1X 3CSBA 1Z5LB 2C1PB 2R0ZH 1E4XI 2AJUH 2JK5B 3K4ZA 3HG4A 4UT9L 5MEPA 4PJXA 3GF8A 3X3GH 3POHA 2DL9A 4H25A 2Q7YB 4LSTL 4YX2H 5DFAA 1KYFA 5IHWA 4GW4B 2C5DC 1T66C 4HUKB 5E8DH 1CGUA 5C0IA 1NDGA 2UUDK 5D1QE 3FAWA 5A6IA 3DYOA 1E4JA 3D3VA 4D0DB 3SQOL 3B3BA 1FWXA 3EW3B 1ZTXH 1UZ8A 3ALPA 1CLYH 4UT9H 4U6VL 3C6LC 4G8GE 2PWGA 2ZX9A 3J27A 4KJYA 3G08B 1DQQA 1Q9WB 2WLIB 4LLWB 2IPKA 4LSTH 1E43A 1XCXA 3A4AA 4RRPG 4Y16B 4XMWA 2H47C 1T4KB 2HX9A 3VFVB 5ICZB 3WGUB 3GSNA 5CEYB 4CVXA 1ZV2A 3LIUA 4P2OA 3SQOH 1EGJL 4P2CG 3U7YL 3NPSC 2EICA 2CK0L 4AENA 3GYRA 4GO6B 1YMMD 2IADA 4JDTL 2CDFB 3KPSB 2FDBP 3LKNB 4N8CH 5FW6A 2JJVA 3EJSA 4MZRA 4CDGC 3FS9A 1RZGA 3B6SB 3CC5B 2X7LB 1HH6A 4R5VA 1JNHB 4GRLB 4WFED 1EGJH 1PD1A 3QZWB 5ECGA 3U7YH 1T04B 3V6FB 4YJZL 2VR6A 2JCCE 2CK0H 3QIWC 2ZZUT 4JDEA 4MXQC 3CUPB 4WZ9A 2XWZA 1OL0A 3RWJA 1RJZA 2FHBA 1MFBL 2WZPA 3NSJA 2UXVA 5DMKB 2IH8A 1NDMA 1NEZG 4QNPF 1XAUA 1SXCA 1FNLA 2QLYA 3IEAA 5F3FA 4A2DA 5B3JE 4WGWB 3HPJA 2IDFA 4RESB 3NIGF 3W39A 3QQ9C 3N50A 5AVRB 1SJMA 3MUHL 5DRZA 3TWCL 3BDBA 3FRPA 2AJZB 3GSQB 1JHTA 1MFBH 3DVFA 3GSNL 4IJ3C 4OZFA 4JZOA 1H5BC 5HPOA 5CS7A 1SZNA 5I17B 1GHFL 4DH2A 3D7PA 2TRYA 5C0CA 4M9OA 1N70A 3MUGA 3VTAA 1I8IB 4B95C 3ULUE 3UO1L 3AG2B 3CDCA 5M94B 3LAFA 3DJRA 1HAUA 4OJFL 2LVCA 5FIEA 3GSNH 1R3HA 4APQA 2K3HA 2D9QB 2ZUVA 4C8XA 3BEVA 5K1JA 2YARA 2VDLB 1JNJA 4MA1B 2R4SL 3IDNA 4MMXC 2Y2YA 4ZG1A 2I9TA 5E99L 1JK9A 4NC1C 4L29A 1QMUA 1XGQB 1YUHB 2AP2A 1ADQH 3UO1H 6FABL 3RKDD 1KCVL 2R2HB 4OW6A 2P3YA 5D7JC 3WEAA 3C9NA 4OJFH 1CR9L 1FH2A 3GPSA 5IW1A 3BT2L 2NXZD 3KLAA 1IFHL 3LEXA 3B2UD 3LVTA 4KTEL 4DK3A 2R4SH 5AAWA 2GTZA 3ZTCC 2P8MA 2VGLM 5E99H 4Z7UA 2WO2B 1A7OL 2X6CA 3CZKA 3P77B 3L9EA 1KCVH 2FL5A 1AD9A 3RILA 2QVTA 1E50A 1CR9H 1BD2A 2AQNA 3QUXB 4HISA 1IFHH 3GLZA 3ESOA 3G5YB 4KTEH 4OLUL 1ZA3A 3DETD 4LCCC 1XCQB 5BZDA 3RGVB 3BJLA 3VFWA 3PXHA 4EIZC 2NT0A 3PGCA 1E3XA 2NTFA 1GKEA 3KL3A 1MW2A 5FOJA 1XGTA 3VD9A 5GGSY 2ZXBA 1YY9D 2R1WB 4OZFH 3I74A 1OE2A 2NDFA 3FFCB 4X6DB 1U8NB 1TNMA 2YA0A 3A6BH 3WIHH 4OLUH 1MAKA 2DQTL 2MFNA 3RL1B 3M7FB 4RIRB 3HS9A 1UWFA 1XGRA 5I30L 4WJG3 1T6BX 3UAJA 5FYJD 5JOEA 5IOKA 1BFOA 3KDPB 4RH4A 3LKQB 2Z7UA 2WLJA 4FDWA 3DX7A 4X4ZA 4O4YH 1BWMA 3QWRD 2I25N 5T1KB 4Y4KD 5CMAA 2L3BA 1UT2A 2NYYC 4DN4H 5I66B 2V9UA 2DQTH 3MRNA 4HSQA 2X6VA 4D94A 1W16A 2BFVH 2FWUA 1R3LA 5DYOA 5C6TH 3LNIA 5TDNA 5KSAD 3EBGA 1JPGB 4EIBA 1RZKL 4NUGL 4NHCL 1A6TA 3QK0A 4FQ1L 5FUCE 2J12B 2QPSA 3HKZA 3QUYB 3GMPB 4WUUD 3O9WB 3RY6A 3HC3L 4CDHA 1X5MA 3RVUD 2VITA 1IAKA 4PCTA 3MV7D 5K9KA 5DURB 2Z3FA 3M7OA 3DRQB 4UM9A 3RX9A 1YJDC 3O3DB 4UU9A 3F62A 1UG9A 1RZKH 4HJGA 4NUGH 2DQCL 4NHCH 1GGIL 1GS6X 4FQ1H 4XO4A 4Z3JA 4NQEE 3RDTD 4ZT1A 1LQBC 3HC3H 4R7NA 3P0GB 3EUDA 4PEEA 2CJSA 2EIKB 3X1FA 5DZJA 2AVGA 3GD1C 1WHOA 3DO7B 4G6KH 1F56A 2VLKB 1XSJA 4X5WA 4NQTA 1FFNB 5DC2A 1DSFL 3MLVL 3R4DA 4N2MA 2DQCH 3UROR 3IXTA 4DZBB 4YSAA 3ZDXB 4QDGA 2MKWA 4UDUB 1VFAB 5JW4M 4DSYA 1IUZA 3HR6A 3TO4B 4WNQA 4XVOA 5HPMB 2V0AA 5GGSB 2OTPA 3T65B 3U7AA 4EI5B 2W88A 1OT2A 3QEQB 3FQNA 3RIFK 4M5ZL 2CO7A 1ORSA 1SLXA 1DSFH 1L9RA 3KVPA 3MLVH 3P3TA 4IU3B 1MH5B 4MAYC 4RSVA 3TVMD 2RR3A 1B2WH 3AQYA 5DJAA 3SSGA 3HMWH 5DA0B 1FFPA 3B2MA 4GQRA 3QFJB 4PB9L 2HT3C 3CX5K 3MLWH 4DEWA 3OXSB 3D4GA 4YBQD 5D6CB 4R2GB 4XNMB 5HHQB 4L2LA 3EO9L 1FRGL 4WNJA 3WUWA 4M5ZH 3LKOA 4Y5VB 4QHNB 4AC2A 3F8UB 2X0UA 2NTSP 4NZTL 3CSTA 4PV9A 3QEHB 3EGSB 1U58A 4PB9H 43C9A 5BOZG 1HQ4A 2EE9A 5CLZA 4FQIH 5CSZA 4L4VB 3FHQA 4JKMA 5GSRA 2ERJC 3DPBB 4L48A 1FRGH 4WHYH 3VMOA 4HDIA 3PHQB 5E0QA 2EYRB 4PJDA 5D5MF 4GAYB 1E3ZA 2OMTA 3QDME 4NZTH 4DGUA 5KTEL 2MPVA 4Q7DA 1KY6A 3DGCR 3ILPB 3WEBA 5EU6B 5KVFE 2E7BA 2I5YL 2DQJL 1HL8A 5L4IA 3ZGIA 5BXFA 2DM7A 2HVKB 5I28A 4M3JA 4WSGA 1O75A 3NPZB 4E9WA 4PJ8A 3HZVA 5GS1A 4GXUN 1FL6A 2IIJA 4HIEA 5CGTA 3IAGC 5B8CB 5IT2L 1X3DA 5KTEH 1FAIL 4HKBA 4ESKA 2EUVA 1HXYB 1UM6L 1H3UA 4N6RB 3AT8A 4Q6IA 1AS6A 4C56A 4QXTB 2I5YH 2DQJH 2NY6C 3HBZA 3LZQA 1JP5A 1UD5A 2WQRA 1IQWH 5L8LB 1OPGH 2XWJA 1Z3GL 5D2NA 1G9NC 3R8BB 1RUKL 5IT2H 1FAIH 2CU9A 4WEBL 1K85A 3ARSA 1MZYA 5C70A 4N8VB 3CZJA 2YZ1A 1UM6H 4O02H 4XMKL 1JDCA 2Z92A 4DTGL 3CDGA 3G6AB 1QO3B 32C2B 2ZNWA 2PCPA 4HWNA 1UCBH 3QQDA 3MNWA 2GJ6D 4E68A 3QDHA 1MEXL 3QUZB 5TH2A 5LG6A 4PRNA 3TBSA 5HYEA 1Z3GH 1C5DB 1RUKH 4GT0A 4XMKH 3MRCB 3AUVA 4UIMA 4DTGH 3BD4A 2AEOA 3BZ4A 4XBPB 5EZOL 3MRJB 5J1SC 5I6KA 5DQ9B 1MEXH 3KR3L 2Q2EB 1CE1L 3U0WL 1KLFB 4IRJD 3CZFB 3P2BA 1CD0A 1S7XA 1XF5B 4PIBA 3UZVA 4OM1L 1SN0A 2PCFA 3GI9L 4JGUA 4DIXA 3RTQA 4IBZA 1MFVA 2D03L 5EZOH 5F1SA 1E67A 4RNRA 4RBPH 4XMVA 3CDZB 4KXZH 4HXBL 5ITBL 2K6YA 1H6UA 1CGXA 2XYBA 3U0WH 2EKJA 3TO4C 3NVQA 5J7CC 1ML0A 3UZEA 5AW0B 1FNFA 3MRGB 3KWVA 2JI3A 1S7UB 4OM1H 3GI9H 2HMIC 2EKSA 3HI5L 1EZVY 3HG5A 2R39A 1L3NA 4NQCE 4J23A 2D03H 1ZJBA 3ZE1F 3BVXA 1CXIA 4OZGE 2XTJC 3UTZA 3FU8A 2DLEA 2X4OA 5ITBH 2DS4A 1J5HA 4BRVA 2FJUB 5F9DC 1Y18B 2MNWA 3TCTA 1GZHA 2GUOA 1H3GA 3JBG7 5FGBC 3ZYJA 2BHYA 1DUZB 3K8KA 4JM0A 4KY1L 2P80A 3OSKA 1MLCB 1T1XB 4X80H 5FFGA 5E6SB 3HI5H 2FHCA 2EXTA 5DUBA 5KVEE 2YLHA 3O6FD 1HEJC 4O2EA 4LHUD 3VXSD 2LW3A 2ESVD 4GRMA 3CG8A 4MNQD 4TS6A 4APXB 3DXAA 2ZX8A 2NX5A 4J3OF 1HNFA 3ENEA 4KY1H 3B2XA 4BSWA 1TTBA 1CYXA 1TETL 4GG8B 4AGPA 4L0ZA 4ALAC 3BUIA 1JPFB 2YS4A 1OEZW 5AOKA 1JZ2A 2A2QT 1DL7H 4KK5C 2NYZA 1L7TL 4MJIE 2X4UA 12E8H 3OAZH 3MJ7A 4UINL 1AHMA 2IOIA 2OMUB 2VLRD 3SN6N 3G5ZA 1SLVA 3MRDB 3QT2A 3MRBA 2WTPA 3EOBB 5LDSA 3ETSA 3V0VA 4I0KA 4WIQA 4U1IB 3TTYA 1B4JL 4X8GA 3W5NA 4O9HL 4DERA 3KG5A 1MWAB 3L4XA 4IMLA 2FR4A 4MBRA 1DVFA 4CSTA 1IZKA 3C8KA 4J3BA 5E8NB 4JHZA 2DLTA 2TSBA 2WCPA 1SUHA 3P9MB 3GJFB 2QKSA 3QQ3A 1B0GA 5DHYB 2V37A 4MMYB 2BP0B 3TP4A 1B4JH 4KJPD 3BZEA 1Q94A 4O9HH 3FW6A 4ANVA 5T1LD 3N1MC 3GXTA 4YUEL 4M29A 5DFTA 3K6DA 4KVNH 5B3NA 2K78A 3QUZC 3QS2A 3SKOB 1ZSDB 2PYFA 4P2RE 3BP4B 1ZHBB 5D1QD 3B7YA 5IOPA 3KPOB 2NXZC 5IVXA 3W0WB 3U4KA 1G7QB 3RNKA 4N8PA 3WY2A 4L3CB 7PCYA 2VUYA 4FL4B 3Q9PA 4DAGL 4G8GD 4YDVA 1JD7A 4YUEH 4GG6F 1LLAA 4UUJB 2NUPA 2D7TL 4TSCL 4H0IA 5E23A 3IE9A 2EO1A 1H0DB 2Z4QB 3CLEL 1TQCB 3D87B 4XMLL 3H4HA 3L6FB 2O5XL 1M7DA 1H8OA 2X2YA 3GNML 5T1JA 2YFNA 3WHE0 3JYBA 4DAGH 2QADB 2IWFA 4HIHB 1XIWB 2F74B 5CXPA 2A6DB 1EXUB 2R59A 5AW9B 5EH1A 4FA7B 2D7TH 4TSCH 4OUUB 5AVVB 4IHOB 5JZ7D 1I7ZB 3CLEH 2VCOA 3HJ0A 3F7VA 3UZQB 4KITB 3MACL 4XMLH 5MEQA 2O5XH 4X4XB 4BDVB 3GNMH 5KVDL 4WTZG 3N44B 3MOQA 5ESQB 4M6OL 1ZA6A 3B4NA 2E74C 3GEWB 3S7GA 4P3DB 4ELKB 5LAXA 5IMLB 4BHUA 2P9RA 1EHNA 5D7LA 3MACH 3TYFB 3ZQ9A 1BBJB 1BGXL 3GSVA 4JQVA 4L8DB 2VM9A 4Z5RB 2OYLA 1QFOA 1PZAA 5JUEL 4A2HA 1JRHI 2JKTM 4AQZA 5BW7C 3V9EA 5CWSA 5SWZA 4WTXA 4PYGA 4FQXA 2WC7A 3L48A 5CN3A 4NQUA 1W0VB 4J3SA 3ARGB 4MA8L 5KSAC 3OKEB 1GGCL 3ZRCC 5LDUA 1FVCB 3LCYA 1F58L 3IAPA 1BGXH 1OZTG 3CPLB 1PJ9A 4AZ8A 1KIRB 1H15B 5JUEH 2XKNB 3RVUC 3SGDH 4R5XA 2EE6A 2J1WA 2VABB 3MBWA 1DO6A 3RWDB 4QIRA 2H9GA 2OA9A 3DUUB 3WXVH 4CAGA 1CB4A 4Z7OB 1M42A 2X9ZA 2YD2A 4MA8H 4NQDA 5MENB 1GGCH 2XZZA 4GEIA 1HILA 1F58H 5EO0B 1LYQA 1FIEA 4LO9A 3WEMA 5JXAL 3RDTC 1MCWM 1N3NB 1ND0B 4Z7VF 3RURA 4M48L 5D9SB 1JXDA 1JWMA 3WFHA 5KAQF 2XBZA 5D1XB 1SJVA 2YRBA 1OANA 2FD6L 3LXBA 3Q5OA 2JKNA 7FABL 4WU7B 2F7RA 3QNZB 3SHSA 1IARB 5AW4B 2PXYC 2VSDA 4DVRL 5IMKB 4R3SB 2HYMA 5JXAH 2A74B 3NEXA 4JG5A 4DKDC 1MCQA 1PKOA 4M48H 2XPYA 1CBVH 3ZT7A 2B77A 2X6BA 1B0WA 1NCJA 3GMOB 5BJTA 2FQEA 3ZDWA 5KG9B 1ZLUK 2FD6H 3F7YA 1FNGA 7FABH 2FJSA 2YUXA 1M2VB 4JRWA 5E9NA 3F7KA 4M3HA 4DVRH 5LLIC 4J4PC 5FYLD 3PUUA 1MF2L 3QCVL 3MUJA 4HEPA 1W72H 4L3EB 1BSIA 1QLFA 4M7ZC 2CHZA 2IAAC 3ALXA 3SDXB 1IIIA 4F57L 1N2RB 5FR3A 1U33A 1FL3A 4HCFA 1MF2H 1XGUB 3QCVH 3L9YA 3QRBA 1QZ1A 3V0GA 2YD6A 1SYSA 1TTRA 3MV9B 4S1RL 1RLWA 4X8JB 1A21A 4YHNA 1YSOA 4BK5A 1ACCA 3VXTB 2I7OA 2HP4A 2QADC 2HJFA 4GYBA 5E03A 2LTQC 2CIIB 3ULAB 8FABB 4OV5B 1Y0LB 5HDOA 4F57H 2YK1L 1Y07A 3T1FB 2Y6SC 4W9JC 2QSCL 3NFPB 4NCC2 4IBQA 4S1RH 1PAZA 1U8OB 1QSFB 2HPTA 3IVKA 1AZBA 2EEDA 3II3A 2BHFA 1YC7A 2NSQA 4XOEA 1BIHA 3DX8B 2WWOA 3O6LL 4LCWA 2H0PA 3ZMRA 5KUKA 3K80A 1KPUB 2YK1H 3CIAA 4GEJA 1G7IB 4ONOA 3U6RA 2PETA 5HDQL 2QSCH 2X87A 3FFCE 4X6DE 1BP3B 4N1HB 1QLEB 1RLBA 1N68A 2AW2A 3OGCA 4YH6A 4DK6A 2HXAA 1WJ3A 4KJWD 1G6RA 4HSAC 2PW1B 5JPNB 3VUAA 3PPEA 4IOFC 4OCRL 3T6ZA 1Q90A 1GRWA 4N68A 1MCWW 3ZIMA 5BO1L 3JV6B 2BIOA 1QI3A 3UIYA 2I69A 3T0EA 5HDQH 4GP8B 3BEWB 2CD0A 1BXVA 5L0QB 3MBXL 3DX9B 1NFIA 1YAZA 3EYSL 3HE7B 1RK7A 1E4WH 5JIIA 3B56A 3MQIA 2YUVA 3QWOA 1BPLB 2NW3A 1DN0A 3RKPA 4PJHA 4J3OG 3MBXH 2AABL 4YSQA 4P2QD 2GQHA 2W07B 3QI9D 3MV01 4GI6A 1PDKA 3IDYC 4OLWL 43CAB 3VX0A 2Q0ZX 5JIHA 1RH8A 1L7IL 1S9XA 4KU1A 3VQ1C 4G6FD 5D1XC 5BMFL 2XZCL 4YGVB 4F9PA 3MZGB 1AS8A 1QBBA 3ARRA 3RPKA 3D30A 1DVUA 4HKJB 5LGJB 1SQ2N 1XR9A 4JO3L 3KVQA 3HZYB 1G1OA 2AABH 1THCA 1PL3A 2BH0A 2B20A 2B59A 2VLKE 4JDZA 4OLWH 4RAVA 3VI3F 3ARFC 2GBUA 1YLBB 1HL4A 2KERA 3JT2A 1L7IH 5BMFH 2XZCH 5DD5L 3ZDXE 2OAAA 2H0EA 4NO0B 5FB8B 4X6BA 1VEMA 4FJZA 4S2SB 2TRHA 4N0UA 3QDMD 4Z7AA 5HGAA 1A14L 1FZJB 3FUDA 3FU7B 3QEQE 1V3MA 3RWIA 3QP3A 3P1VA 1VACA 5HVGB 4LLAA 4Y19B 1AQDA 2NZ9C 3TT3H 1K8IA 4FTVB 2E56A 4U6YA 4ZFZA 5DD5H 1T5WB 3RX8A 4AJVA 3QFJE 1BX2B 4LLUA 1NANH 1Y1UA 3J8F7 3UTQA 1HINL 1JYWA 5H94B 2WO3B 2OMZB 2VSMB 2CDGA 2OJEA 1BQKA 4IGBD 4JFOB 4JFYB 1JGEB 1I8KA 4YHIB 1HNYA 4XX5A 3BH4A 5AOLA 3WKML 1VHPA 3ROLA 3MN8A 5DK3A 3R7RA 3PREA 1HE7A 3T6XA 1CG9A 4JKWA 3WJJC 5KBNC 2XA3A 3BQUA 3WMQA 4L4VE 1HINH 3AABA 2XWRA 4NOBA 3D34A 2WLHA 4AUJA 4BV1A 2WQUA 5FA3B 1U3HD 4NO3B 4F37K 3RFRA 4Y1TA 4ECNA 5HHNA 5DS2A 1SXNA 2X42A 4E2OA 4AJ0A 2JB5H 2NY0C 4OD3L 1DLFH 2GTQA 4ES8A 2YC1B 3C8DA 3T0BA 3CFEB 2CDEA 2VAAB 1CYWA 5C0BB 3SKUD 2IMNA 1A65A 1AKJA 2V6HA 3JTSA 4P4KD 3VD1A 1QG3A 4NNYA 4WUUA 1IAOA 1QTPA 2BSTB 2VYRE 4ODUB 3EBAA 1YO4A 4R0LC 1HOEA 1ETJA 1DSWA 3CVCA 2AZUA 3QJFB 1J5IA 4MAUL 3KXFA 5J13B 3HHMA 5C8JB 3WDHA 3QG7H 4KJPC 3RY4A 1Q1PA 1UYWL 1RZIB 5C0DA 3VU2A 5JQ6L 3AM8A 1TT6A 1J18A 3O8XD 2C4FU 2RIKA 3D4YA 1Q0YH 2PTTA 4DWHA 5H8DA 3V0DA 1Y6MR 4W70A 3BPNB 4F37F 4XN2A 3IGKA 4PVMA 1R5WA 4KNUA 1RPKA 3NK4A 1WP6A 1SY6A 4DO5A 5JQ6H 1EDYA 5F7NC 1QWNA 4HKXA 5ELIA 3PP3H 4ABQA 2J21A 4NQCD 2FBJL 2DN7A 1S8DB 1AGDB 1KULA 1W0WA 1UB6A 2GJZA 1KPRA 4W9ZA 1O6VA 5ABAA 3I2CL 2F1AA 3TVMA 1A02N 5CFHA 3S4SA 1F00I 2B8OT 1IBGL 2B08A 3L4UA 4NBXB 2DH2A 4XVUC 4DKFL 3ECWA 5IQMA 1PKQB 2P7TB 2X2UA 2NNRA 4OJDH 4K4KA 2YD1A 1BYNA 3SDAA 4X7DC 1ZV5A 1NBVL 2QPDB 3D2TA 4FQQA 4LBEA 3GRBA 1EX0A 4MB4A 4OF8A 4BZ1A 3FFDA 4HCIA 2D3LA 3NJJA 2P26A 5E4EB 2AVFA 3I2CH 3CFJB 4W9HC 1DVTA 1SVCP 3NAAH 4G1EA 1ZVHA 3NIFB 5C0AA 4CVZA 3VXPA 3Q3GA 3GBDA 4DKFH 4A67A 5FO8B 5KAQG 3UBGA 4OF5A 5D2LB 1L6XA 2ZUQB 4PJFA 1NBVH 2GTWB 5LGHL 4JRXA 25C8H 3L3IA 5FPIA 5JW4N 3V9FA 1I7TA 5JOPD 3RWGA 5CD3A 3DI2B 2YPLA 1AXIB 2BY0A 3UDWC 3OKMB 1FE8L 1DEEB 1D5RA 1IRAY 2OCJA 4XXWA 1INQB 1SY6L 4V1DE 1G5AA 4X50A 1HHIB 4HCGA 4UYPA 4OKVB 5FGCB 1BVKB 4I5BA 4Z76B 4KZ0A 1U8MA 4ETYA 5E9DB 2BSEA 2PYEB 1D2OA 5LGHH 1HJCA 1D5XB 3UACA 3KCPA 5I23A 1HL9A 3SGDI 5E4AA 3DMMB 1FE8H 2ICWA 5EUOF 3BUPA 1AXTL 5EPMB 1SY6H 2WOYA 3IETA 4HUWB 3WEXB 2W9EH 2Z31B 4BFBD 2VLLA 2YRLA 1S7VB 1YN7B 4LPUA 1QHQA 5CJXC 5F7UA 3LQAC 5IV2A 1K4DB 4NKMA 2RGSA 4X0NA 2DQFB 1IEBB 5JQIB 1NPUA 1Y1DA 3VI4B 1OT1A 2OL3A 1MFMA 2I60H 2VR4A 1C5BH 4HH9B 1F4WL 1AXTH 4OVVA 3O4OC 2YXFA 3VXME 3KWXA 2IH3B 3TN0A 3ZMNA 4K73A 3IJYA 1ZT4B 4TMPA 5FEBA 4P2RD 2H2SC 3F6IA 5AW7B 3OZ9L 2GJ6A 2UWEF 3PDOA 3QXTA 5B7EA 5KBLA 4IOIA 5KS9E 4OZHF 3ZK0A 5GGQL 2QGCA 3D39D 4JKNA 4X5XA 2JI1A 4TNWK 2Q6WA 3SGJC 3AS0A 3VFRA 5LNEA 2FEDD 3QDAA 3TH4T 5LXGL 4CVUA 1ZHKB 4L8BB 1KDIA 1RJCA 2P24A 5EA0L 4HHWA 3ASNB 1IAIM 5DK0B 3IJEB 5F0LB 4NQQA 1ZRUA 1SJEA 3FMGL 3QUML 4FNQA 5GGQH 5ICXA 4ELMB 4WGVB 4ZZKA 2G75A 4TUOB 5G2NA 4YQXL 4IU2A 3DOSB 4RMWA 4U1HB 3MV8D 5HY9A 1XF1A 2YEZB 2J5WA 3BPNC 5LXGH 2FH6A 1WBXB 4L4JA 1T83A 5EA0H 2OL3L 3KJ4B 3NFNA 3FMGH 4GRWB 1HDMB 3QUMH 4AXWB 1GJUA 1RL1A 2R2BA 3QPQC 3D1MC 3ILDA 4XXCC 3OKDB 4YQXH 2G3ZA 2CGZA 4PP1C 4AQAA 3FN0L 5KBMA 5GJSL 1OF2A 3FTYA 4TNWF 1IGYA 4P8QA 4HEME 2WBKA 4CN1A 3SQBB 3IYLW 3W0WE 5L6YL 2DTSA 1UFUA 2C3HA 4XPAL 2KBGA 3U4EA 3WS6C 3U9UB 1ZE3C 4WTZA 1UWXH 1TTUA 1D5BB 3MR9B 5J11C 2ZXQA 4PJEF 3INUL 3VJ6A 4Y16D 3QIUA 3ARDD 3TYGL 1NQBA 2EDXA 2RHEA 4CMHB 5HYJA 1WZAA 3FN0H 4HFWB 3UTTB 5C0ND 4GKOA 5GRVL 2TAAA 4MBOA 1GXEA 3B9KD 2VDKL 2BVOB 2R56L 5L6YH 4XPAH 5GRYA 3FH8A 1N8OE 2WYIA 3KPSD 4TQEL 4W4OC 1F2XK 2KQNA 4FF9A 4MDJB 5F89B 3INUH 4KUCD 3TYGH 4JDVB 4P5MB 5J89A 1VA9A 2JJWA 3CE1A 1OAZL 1FFOA 4X4YB 1A7PL 2P4AB 2Y2WA 2FO4B 3D05A 1U9KA 2VDKH 4GRLD 4TNVK 2XWXA 2R56H 3L45A 5F9JB 2P49B 4Q2ZB 3TTSA 2EUZA 4WKXA 4ZUSB 5FC9A 1I1YB 5EF2A 3I85A 3L7FB 1V3KA 4TQEH 5GGVY 3AITA 3WKNA 4BUQA 3ZDYE 1QFWI 1YA5A 4ACPA 4J6IA 4NLAA 4XAKD 5JHLH 4DN3L 1OAZH 3AREB 1GA2A 1L9OA 4FD0A 5CBEA 1FPTL 4HOXA 4NYLA 5FKAA 3RU8L 3AADB 3NSFA 4IRSC 5IB4A 2DJUA 4LEOA 4NQSA 2ORBL 1JF1A 2NY1C 3M1OA 2MCMA 1XH3A 1NJ9A 2XV0A 3Q7JA 2YPKB 4P46A 4DN3H 1A6AA 4XH2B 1UB5B 3U0PA 4V33A 3FCGA 4PS8A 4BINA 1MY5A 3LHAA 5FHAL 4Y9FA 3PJSA 3ARUA 3FULA 3RU8H 3EO0A 4PJIA 3IJHA 5IUSA 2XQBL 4KI5D 1BQHA 1RHHB 2W91A 4PM1A 3VD3A 3FC8A 3L3GA 4ZSOB 1AGBB 1QTYT 2ORBH 4Z7WF 4BE6A 4NKOB 3DTXB 4Z7OE 5C3LD 5L2KE 4K8RH 1HWHB 5MENE 3K3QA 3B34A 2WLMA 3QXAA 1TFHA 4XO3A 3WLBB 2F7OA 4PSPA 4Z78A 4C58B 4MJ5A 5HYQA 2IAMC 3AQZA 4U3CA 3MCYA 2EDFA 5FHAH 4NO2A 1YN6A 3HRZA 4UIKL 3WAKA 1H8SA 3OJVC 4JN2A 4G6ML 5I16A 3Q6FA 4PCKA 4JREB 4LLDA 3KGUA 4XCCH 3Q8AA 3QIBC 5D1XE 3RVVD 4G8GA 4IIQA 3PHSA 4BA0A 2L7UA 4M4RA 2P46B 5D55A 4K3JL 1PZ5A 1XGYL 1KTLA 3H56A 1BFVL 4G43B 4WI3A 4KOCA 5F7KC 4HWEL 2GITA 4E9SA 1D7FA 1A2YB 1HYRC 4FHJA 3W11C 2BMKB 1OSEA 4PV8B 4NAMA 4UIKH 2CMRH 4K0OA 3DROB 4G6MH 4PV1C 2A6KA 3CQQA 3QJHA 1OK8A 2N7SA 2P5PA 1G7PA 2WIMA 4NBZB 1CTMA 1NANI 5CJ8A 3QUXD 3WNKA 5FV1L 4K3JH 3ABZA 1XGYH 2PP7A 3TOPA 4AGLA 3FQYA 3FUFA 3WNIA 4PLNC 4HIJB 1JN6B 2PO6B 4V11A 1JMZA 3OTTA 3F7RA 4NPKA 1SXAA 2CKBB 5D7IB 3ROOA 4L3EE 1RZ8A 1WFJA 2V9RA 3MBED 4ZUVB 3SDCA 2WKGA 4PCSA 1YNKH 2VR7A 5KYNA 3KS0H 4PD4K 3EYFA 3PV6A 4EMZA 5EBWA 1T0NB 4G8IB 5J0BA 3HE6D 3SDXE 4X0KA 5I73C 4KO6A 3US9A 5E1AA 1KXVC 3GIVA 4FRWA 3MRLB 1MREL 3ZR5A 1KN4L 1XSKA 3MV9E 4Y5YC 4PRPB 3BHBB 3C87A 4E41D 1ZANH 1A1MA 3D18B 2NW2A 5T1KD 3LN4A 5BVJA 4K23L 4JBSA 3UC0L 3E6FB 4R4ND 3ARBA 2QFRA 4JEGB 4E9XA 4JFEE 3K1DA 3KYNB 3PABB 3T6WA 4OQTA 1WWCA 3VGHA 1HXKA 1MREH 4XE0A 1RURH 2HX8A 4ODVL 2NNFA 2X4PB 1KN4H 1D5ZA 5DQDH 1QSFE 4JM2B 3QUYD 5CJOL 1OW0C 1WCQA 1SQMA 2F8VA 5AW5B 2JLPA 3O9WD 4RGND 5A3IC 5HDLA 4AYGA 2LAAA 4K3GA 4K23H 3UC0H 4L3AA 1BLIA 1DJGA 2WVSA 4KNTA 5DURD 3GJEB 3F64A 3BPLB 2DAVA 5D1ZD 1KJ2A 4NCC1 3PAVA 1SPDA 2H32A 4XN1A 2MH4A 4TQHA 4YVUA 3BUYA 1R3JA 4ODVH 4MMZC 4XN9A 5F1IB 3V6ZB 4OLVL 1TCRA 1X4ZA 5AYTA 2YJLA 5I1GH 4XCEA 4JFDE 4QJ3B 5E6UB 2YQGA 1T5KA 2WN3A 3EF7A 3IPEA 4WWKA 3HZMB 5GGRY 3PQYD 4ZPTB 3QW9A 1TVDA 4LLYB 3GZKA 1MCKA 2JWYA 4Y5XB 4PLKD 1HNGA 5JMOC 3WEOA 5BS0D 4HAKA 2FZ3B 4B9CA 4BQ6A 4BQBA 3KPMA 1H3TA 1T0MB 4WTQA 1NLDL 3BOVA 4TSAH 3RUGF 4BGLA 3KW8A 4DESA 1SXZA 3WMSA 1QASA 3O4LB 1OTSC 5ALCH 5IR1A 1B4TA 4YHZL 2YQ3A 1UC6A 3BCFA 4OQTL 4FFYH 1INDL 4EI5D 5IJDC 1S7RA 4L8SB 2Z8SA 4X4KA 3ULUL 1ZPLA 3LQMA 3FFOA 4E9RA 4F8TA 1OSPL 4QXVA 3QO1A 2NY5L 3LPFA 3O3BB 5LBSA 5DMJB 4R4FL 3ZL4L 1NLDH 2X3AA 3TURA 3BVVA 3OG4B 4XVJL 1DLHB 4YBLB 2WYTA 3WS3A 3FQUB 4MDIA 2PWEA 1I82A 1I3RA 3QJTB 4K9JA 1KJ2L 3KYKH 4OQTH 4R2GD 5C0FB 2BHZA 1INDH 5IFJA 5E95B 1QKZL 3S5LG 6CGTA 1OSPH 2H41A 2C1OB 2NY5H 4WDIB 3V4PA 4E5XB 1GJIA 4XNQB 3ZKXC 5C7XL 1IM9A 4TLSA 4OT1L 2NY2B 3SYQA 4GUPA 1QUNA 2KT6A 3RVTD 4XVJH 1WBZB 4D0BB 4X98B 4HWUA 4KQ4L 3OKLB 4MA7L 4LKXB 4ATTA 4J3VA 3GMRB 3BD5A 4A38A 2VXVL