1F1AA

Crystal structure of yeast h48q cuznsod fals mutant analog
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
153
structure length
153
Chain Sequence
VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIQEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER-ZINC SUPEROXIDE DISMUTASE
publication title A structure-based mechanism for copper-zinc superoxide dismutase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 38
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1f1aA00
1TO4A 1JK9B 2C9UA 2AF2A 1JK9A 1OZUA 2AQPA 2GBTA 2AQRA 3F7LA 2VR7A 3KM2A 1IBHA 2AEOA 2WZ6A 5CU9A 1SXSA 1JCVA 4A7UA 1IBBA 1MFMA 1P1VA 4A7GA 1OZTG 3L9EA 3GZOA 2AQSA 1SDAB 1Z9PA 1E9QB 1E9QA 1IB5A 2Z7UA 1DO5A 1UXLA 2WWNA 1XTLA 1XSOA 1YAZA 2GBVA 4A7SA 2WZ0A 1RK7A 2JLPA 1SXCA 1PZSA 3GQFA 1N19A 4A7QA 3KH4A 2SODB 1HL4A 4MCNA 1CB4A 4L05A 1IBDA 4BD4A 2WYZA 3MKGA 3SODB 4B3EA 3GTVA 1CBJA 2V0AA 1SDYA 3MNDA 3ECWA 4A7VA 3L9YA 5KBMA 4U4IA 1EQWA 2Q2LA 3K91A 1YAIA 1XTMA 3KM1A 5KBKA 1COBA 1AZVA 1L3NA 2GBUA 2VR8A 2XJKA 1N18A 2Z7YA 4BCZA 1F1GA 1E9OB 1HL5A 2WYTA 1OALA 1E9OA 1SXAA 5KBLA 2JCWA 4MCMA 3HFFA 2AQQA 1F1DA 3F7KA 3GZPA 1ESOA 1SXNA 2ZKXA 2Z7WA 4N3UA 2R27A 2WKOF 2APSA 3CQQA 1OEZW 4OJAA 2C9VA 1TO5A 1S4IA 3T5WA 1SOSA 1QUPA 1Z9NA 1B4TA 3S0PA 4A7TA 3KBFA 3LTVA 3GZQA 1PTZA 3HW7A 3KH3A 1F18A 1U3NA 3RE0A 4BCYA 2ZOWA 1SXBA 4N3TA 3GTTA 2K4WA 3KBEA 1PU0A 3HOGA 2ZKWA 1YSOA 2LU5A 1EJ8A 2AQNA 2ZKYA 1IBFA 4OH2A 1SPDA 1UXMA 1DSWA 2WZ5A 1BZOA 1B4LA 3H2QA 2NNXA 2WKOA 2C9SA 1E9PB 2E47A 1Q0EA 1E9PA 1OAJA 3CQPA 3ECVA 4FF9A 4A7GF 2E46A 1FUNA 3PU7A 3QQDB 3QQDA 1KMGA 1F1AA 2XJLA 3H2PA 1SXZA 2VR6A 1SRDA 2AQTA 3CE1A 2Z7ZA 1BA9A 2WWOA 3ECUA
chains in the Genus database with same CATH superfamily
2WAHA 3QEHB 3VH8B 5B1KA 1WFJA 2BZDA 1HI6A 4PREA 1IC7H 2EH7H 1ZPLA 1BMZA 3BW9B 4IIQA 4WV1B 1IKOP 2DLHA 2P49B 2YPKA 3NJHA 1ET5A 1XHHA 1LTXA 4D0DA 1HWWA 1OSZA 2ZWYA 2H6OA 4FP8L 4HK0A 3TYGL 5KS9F 5M7QA 3QDMB 2V5RA 4C55A 3QCVL 3BP5B 4A66A 4P23A 1JGDA 3X13A 2B4CH 4DGVH 4N24A 4NQVA 4M7ZB 3KJ6H 2ZP8A 1EPFA 2AJUL 2G75B 1Q9LA 1AQKL 3LKNB 4NHCH 4TLSA 4EO5A 1HDMB 5AVUB 1GZQA 2PR4H 5DJCB 5EEXA 4L8CB 5DUPH 4GAYB 5IMOA 3D51A 1D5MB 1M1SA 4Q74A 5A2BA 4XNXL 1HAWA 4PJFE 5T1LB 3CQFA 3K0YA 2BNQD 1QATA 4MDJA 5C09A 4ZSOA 3PREA 2G4GA 4LEEA 1TTBA 4LPTA 4ORGB 4AQZA 2WBJD 4BGDA 5B1JC 3N91A 1NKOA 5C3TA 1KXHA 2VLKB 4PB0H 3F05A 2IPTL 3TF4A 4PRAB 3VFUA 4BM7A 2RQEA 1WT5A 5CSZA 3CHXA 3IU3B 4F7CB 3KWTA 2DM7A 4H88L 4OJFH 3S4SA 2XTJE 5ALCH 1DQVA 2NXZC 3Q5TA 3P4NB 2OI9C 3ZT7A 4OTXL 1KCSH 1I7ZA 3QWOB 4YHPA 4OQTH 5AW1B 1E27B 1EO8L 1KTKE 2W9EH 3WMSA 4BYHA 1NUNB 2FWLB 3GBML 3HAEA 3JWNG 1MCRA 3K2UH 4MAYA 4YEEA 5ESVA 3ZR5A 5ES4B 5I0YA 1KBGH 3QRGH 2PPEA 5HD8D 4OKDA 4UBDC 4I1RA 2XN2A 4PCSA 4OFQA 4K7PL 4PJ9C 5E1QA 2CLZB 4KC3B 2Q7YB 2EVJA 2Y9RT 3BP7B 4H8UA 1T4KB 1ACCA 3ABZA 2QV4A 1RZ7L 3G6DL 2R23A 4QHLA 4ICXA 5T3XE 1RZFL 1BOGB 1D6VL 1OSPL 2QEJA 1GGYA 3UC0H 1YYCA 3QUZD 2WC7A 3U9PH 2G60L 5E4EB 1R6VA 3HLKA 3RDTC 4WLCA 1JZ5A 4MQ7A 5GSVB 5FO7B 5F0MB 3Q8BA 4X8XA 2MEJB 3ATBA 4QPEA 1NA8A 1HOCA 4C47A 4N9GB 1MIML 1H3XA 2APXA 5DVNA 4UANA 1BA9A 4TQIA 1SY6H 1JNLH 2A9NL 4UDTB 1Z32X 5BQ7B 3KPOB 1BSIA 3ALPA 1WITA 4QYAA 1S3RA 1GGCL 1EERB 3BZDA 4R5VA 2HJFB 3GUFA 4UINL 1F8TH 4A63A 1AI1H 3BJ91 3HE7C 3T65B 3WHXB 2BVOB 4JL2A 3EGDA 1PPIA 3D12B 2RALA 3MBWA 1HQRA 3RZCA 1BQHG 4H8PA 3MRGB 1W15A 4Q9RL 3QA3B 5ABAA 3G6JF 3O41A 1NUDA 5GRVK 3V4PL 5JPNB 5KVMC 1IO4C 4G6AC 4YSUA 1W72B 2PYFA 5GGTL 4FYRA 1QACA 4IBQA 1N7ML 1YQ2A 5C0JB 3EAKA 5LHDA 3OJDA 3GMQA 1C1EL 3UACA 1YLBB 4ODHL 1Y0LA 4E42B 3L16A 1LHZA 1JZ3A 2UY7A 1W80A 4NCC2 1YNLH 2X70A 1Y18B 4UB0H 5FEBA 3IFNL 3V0IA 3P9LA 4YDVA 3TBYA 5I5IA 4B0MB 3DJTA 3CK0H 1BZ8A 3DSNA 3QZNA 4C8XA 5IM7A 4N2MA 3MR9B 1I85C 4WI5A 3JV0A 2NW3B 4TVPL 4ALAL 1Q0XH 2X89A 3ZJAA 3L7EB 1EBPA 1VKXB 3S48A 4X0NA 1JWSA 5F7EH 4YSCA 2G4EA 3ILPA 3QDGA 5E1AB 3Q2VA 4V1DA 2QVKA 1KN2H 3QDJD 1CFVH 1NIAA 2DQEL 4PGBB 3U30C 4QMEA 1BJ8A 4U6YA 4UBDD 4HS8L 4ZW6A 4E9LA 1FNAA 4FXGB 4XRCA 4PJBF 1DVXA 4PJ9D 3UJIH 2IWKA 2WVVA 2HUEA 5MERA 1JRHL 2A6JA 2QLVB 4MNQD 5C07A 4BSVA 1YCSA 2MQGA 3N2JA 5IGXL 5EZLA 2UXFA 3EYUL 4N8VA 5I2IA 5JPMA 5IROC 4F5CA 3MCG1 3DHMA 2FQDA 5FWQA 1A7OL 5IMLA 3IJYB 4X8JA 4FQLH 4WCYH 2IC2A 1G9NH 3J7HA 3O6ML 3BP4B 4GKLA 5T1DL 1LO3L 4KXDA 3A4AA 4TSCL 1F4AA 3RDTD 1QRNA 1VEPA 3FSZA 3R4RA 4GW1A 4FX5A 4NIYE 1X7QA 4IEFB 4RFOL 1YHPA 4M56A 4MA3B 4G9DA 4WNQB 4BK4A 1GJIA 2Q6WA 1M05A 3OXRA 4NKIH 5HYSA 3DBXA 1Q0YL 2OMZA 4RA3A 4S1RL 2HFFB 3UGEA 4OLWH 3A0OA 2K45A 3VXPA 1X5MA 3MNVA 6FABL 2QADB 2LGNA 3C6SA 3QO1B 5HJDA 2PW2A 4M7JL 2QSQA 8FABA 4MHHI 3G6AB 3RVUC 1T03L 2J71A 3IMUA 1ZHLB 4KTYA 1YN7A 4MKMA 4UV7H 4U0RB 4PPTA 3NJMA 1PF3A 3HE7D 4FQIH 4MA8H 5HHQB 1G6VK 2YD6A 3IDIA 1EEYA 4TF4A 1RK1B 3HFML 2ZWKA 4K0OA 4UZUA 2WUCL 1JFQH 3ZMNA 4KO5A 1EEZA 1FCGA 3SGJA 3ARQA 1K8DA 3T71A 1S5HA 4L3FA 3SSGA 4PG2C 1UD3A 3KCPA 5EO1A 4JFDB 25C8L 2DLFH 2O6CA 2JELL 4K94H 4YHIA 4FTVD 2DI7A 2WWNA 5ADOH 3JTSA 4O02A 1H3WM 1CQYA 4I5BB 3RWJB 2PPDA 2MPAH 2QVMA 1WK0A 4MAUL 4RFNB 3K80A 4WW2F 4Y9CA 4XNMA 1W9XA 2WINA 3BN3B 5IVOA 3U7WL 5AAWA 4Z8FH 2R0ZH 3KPMA 4ODSL 3P4MA 5BJTB 2YS4A 4PGEB 5TPWL 2E7LC 2W0PA 2XWZA 4HIEA 4IKNA 5FYKD 4JHUA 1YECL 1YJDH 1Q1JH 4YLQT 1IAIM 2VXVL 1WF5A 1CLZH 4EKJA 5K59E 4JX0A 1LO2L 3FOMA 3GTVA 3CU7A 4D3CH 3NIGE 4IMLA 4G6FD 3O2DA 2ZE0A 1DEEB 2XWBB 4QGTA 5LN8A 5J1SC 1L9TA 2BOCB 3KWWA 4I2XA 5IB4A 4R4FH 2EECA 5IEKB 4XO8A 1UJ3B 1BEYH 3PABB 1O0VA 3P4LA 2CUAA 1BJ1J 1HC1A 2V7NB 3TTYA 5KVGE 1XF4A 3JXAA 2D7QA 4YSRA 4PJ8A 5IIEB 3BKYL 4JRYA 4CMMA 3FYEB 1GOGA 2YEVB 2JTDA 4FFVC 4HMDA 5IROD 5C0CB 3D4GA 1V55B 1TSRA 1NC4B 1L5GA 4MMZC 1OGTA 4N0RA 3QI9B 4OFPA 2MIZA 3TCLB 5ITFA 4ZYKA 4KK9D 3TEZA 1MCNA 3KPQB 1Z9NA 8PAZA 4GLRH 1OCWL 3WS6C 3EO0A 3QNYA 2WXQA 2IGFL 4M9OA 1A3RL 4OGXL 5FA4B 4CU6A 1DQKA 4P5TD 4U31A 4PWGA 3IDJB 4UTCA 2LU3A 5DJAB 5J0BA 2ESVB 2VQ4A 1TQBB 1FVDA 1NL0H 4MJIB 3ARBB 3T9WA 1ITBB 4C4UA 3O6FC 5D4HA 2NNXA 5GRVL 1UWYA 4YXKL 2XG4B 5IJKC 2CHDA 3DI2B 4HV8A 4MWFA 4NUJA 4CBPA 1XO8A 3MX0A 3BUDA 4OZFG 2DDQH 1T4WA 4ZMWA 1FLRH 3RWFA 3TPUB 2VCOA 3AUVA 1E3FA 1MVYA 2RAMA 3K74B 5TE4H 3F7LA 2GSMB 4LFHD 3A6CH 4XPBL 1R5WB 2VMFA 3JYCA 2CK2A 5DD5H 2B1HH 4H8HA 3NA4A 4XN2A 2PLTA 2XTJC 2FO4B 1T0MA 2P5WD 3EDDA 3W38A 5F7HA 3LEYL 2YGVA 1X7SA 4W6WB 3AM8C 5DMKB 2BSBA 3K4ZA 1JGUL 5CHNB 4G7QB 4X9HA 1UADC 3LKPA 1VCBC 4QXUL 3UFIA 3O3DA 5GRUH 1LEKA 3VD9A 3EOTH 3MNZA 4HEMA 4LLWA 4PBDA 4E9WA 5IB1B 3U4EB 2HSIA 3QBTB 5AOLA 3FKUS 4I18B 1QX1A 4CW1B 1AZUA 3MV7B 4L05A 4K2UL 2W65B 5JQIB 1BQLL 5D7LD 4P2RD 4K3EL 2BIQA 1MRCL 3FQUA 2X4OA 4P5SA 2MOGA 5ID0A 1KYDA 2CPUA 3J2PA 1TJGH 5DHEA 5KSUA 1WBYB 2B3RA 2OMYA 4OKVA 5E4IA 5GHWH 1OY3B 4FFVD 4CVUA 3FHAA 4H1LG 2BNRB 2MPVA 2ZXBA 1MEXH 3PJSB 4R96A 3DX6A 3IM1A 1E9OB 1JWUB 1H6FA 2A9BA 1ZCRA 3SYCA 3MA7A 1I7RB 3AS3A 4B5ZA 3STZB 3TVMA 4L8SA 3QUYA 3S36H 3U0PB 1KCKA 2Z7WA 4RLDA 1AJ7H 4KI1A 3CFDB 4KV5E 3VXUB 3QK0A 4P49A 1O9VA 4A2GA 3N1MC 5EU6A 5DXWA 3MYZA 4G8IA 1XGYL 3CPLA 4TLTA 2FSDA 1W8OA 1A66A 2JTYA 7PAZA 2OJZL 2B1AL 1L7TH 3O6FD 4OCWH 4AYEC 2FD6L 1S5IL 3OLDA 3BGFC 5CMAB 4FE9A 5C7ZA 4ZFOB 5IREA 4MA7H 3D50A 4ZX4A 3MROA 1IGJA 3CHOA 3IEAA 3V5DA 4W81A 1BVKB 1DTUA 1J8KA 1AOZA 3DV6B 1WZAA 4UT7H 5J12C 4U1KA 1UB6A 1E4JA 3FO9B 3K8MA 3S97C 4JPVH 4W9HC 4YHKL 4I1PA 2HKHL 3MRFA 2MCPL 5J6HB 4ZPVA 5I0ZA 1CXEA 2ADGA 2E8YA 1SRDA 2RCSL 2XTJD 3AW5A 2HVJB 3GBNH 3L45A 4NGHH 3FZUC 5FYJH 3IJSA 4KVNL 3LRKA 3T0DA 2WKGA 1AR1B 2WXGA 3FFOA 4JDTL 4YPJA 4O2FA 4MYPA 5I5RA 2CRMA 3ZTEA 3RTQB 2CGZA 4OCSL 4Z7VB 4YHYB 5BCAA 4U05A 1X5IA 2YR3A 4AYSA 3NUKA 5HPOA 2TSAA 3MUUA 1SY6A 2ITEA 2V8LA 4X7DC 4OZIB 2NLJA 4NUGH 3GB7B 3TS8A 2BVUA 4PJXB 2Z4QA 3DSFH 4JB9L 1INDL 3GLZA 5I16B 1NGXB 1XL4A 2H47C 4WSKA 2GKIA 3WYRA 3A67L 4M1GL 2WKLA 2PW1B 3PFUA 5B39G 2XETA 4UQ9A 1TLMA 2VDKL 2YBRA 3TJEL 3FAWA 1Z9SB 2ZCHL 3MBED 1CB4A 2DMHA 3CHRA 3DPDA 3DX2A 5BVJA 1CF1A 4YHNB 5D7SL 1UM6L 4JGJA 3P73A 2W5PA 4L5FE 4WWKA 2OULB 3OKOA 3JV4B 1MF2H 4LOVA 1MFBL 2GSGB 1A3QA 3KYKL 5IFJB 3U6RB 2EIEA 1CXFA 2IAMC 5FGRA 1UATA 4XNDA 2XVBA 5DQDH 3B1UA 4X6DE 3Q1SL 3QUMH 1CDBA 1FAKT 1QA9A 3L5XL 1A64A 1LE9B 3MO1B 1S7VB 3KGSA 2FCBA 3C09C 2YUVA 4G11A 3R4DA 5ISZE 2YGOA 3K6IA 1U42A 3WLBA 2C3HA 5KVFL 4YZWA 1KFGA 4WI0B 3IMTA 1N2RB 2XBDA 1F1DA 2IFFH 3C6LC 4HS3A 4C56A 1NCHA 3UYRH 1NANH 1C8QA 2IH3A 2JQMA 4CL7A 3B8SA 3FQTB 1QBLL 1M57B 5JDJA 2W81C 4FHJA 5FFOA 4PLKC 1SOSA 2GPZA 1CD1A 1B4TA 4I3RL 3TNMA 2CLVA 5KYWB 4JREB 4B60A 4ZFOL 4QRPB 2Y3AA 1JTOA 4WUKL 5DD0H 2R1XB 3L3OA 3WJLA 1UOLA 3N9GL 3CMOL 3HUJB 4H0HB 4J2XA 1E4KC 2ZX7A 3DDGA 4ELKA 3FQXA 4I3SL 4KK5C 2VJ8A 4LSPH 1OO2A 3NZHL 3MRIA 5DEGA 1FG2A 1SN2A 2VMCA 4O58L 4Y2DA 4HKXB 5C6TL 3II3A 1OE2A 1T1XB 3X12A 2GIMA 4X9GA 1ILUA 5FGSA 4HCIA 1ZTXH 2M26A 4X6CB 1M7DB 1OE3A 4PI0A 3UYPB 1RZGA 3D9AL 1A9EA 4L37B 5A16A 3RAJL 5E9DA 3IFPB 4X9YA 3O4LB 5A2LH 1FNFA 1MELA 1IE5A 1QSFA 1PEWA 2W95A 1CK0H 4XXDA 1KGJA 2XWTB 5I76A 3D0LB 4GUOA 3NG5A 1DN2A 1DLHB 1EHNA 1P7QB 3N1PC 2WWKO 2JFCA 4ZQTA 1UXWA 1W6LA 2XVKA 4KKPA 1YEJL 1BZ9B 2NNRA 2W94A 3NEEA 4GP5B 4S1QL 5B8CA 5L4MA 3U25A 4M03A 2RQ8A 2G2PA 4EQ3A 3TZVA 3FJTA 1SXCA 1H5BC 2H45A 1AFVH 4ANVA 1RIHL 1JMXA 3GS4A 4LE8A 2NMSA 4NNYA 4NX0A 4IRJA 4BFGA 2E3VA 1TU2A 3EH5B 4JHBA 3N42F 2DQHH 3TONA 3HNTL 5MENE 1ACZA 2GYSA 4FQQA 1ZLUH 4F58L 5L0QB 1KB5L 4A6YL 1M7UA 1OCCB 4Z7NB 4KY1L 1Y1DA 5E6UB 3C6LD 1ADQH 4FXLA 5CLZA 2WNKA 1XF3B 1MCFA 4HCGA 3H7LA 2VM9A 3VX1A 4M1DH 2FHBA 2YHGA 4AGQA 3JWNE 3SPJA 3BWUF 3HIZA 2RH0A 1AHWC 2H2PC 3AWEA 3BI9X 4NQDA 3VFNB 1A6ZB 1E5CA 4PLKD 3T0BA 3LHPL 3AT0A 4G6JH 5HI5C 3ZKSD 1IGTA 1NGPH 5D7JB 5E4EC 1TNMA 1IM9B 4HHAA 4L48A 2JCCB 1BBDH 1NLBH 1E5BA 2ITCA 1ML0A 4QRTB 4A04A 1TO5A 4YHMH 5C0EB 4OAWA 1ES0B 2DH3A 4S2SA 1AGEB 4K8RH 5ICXB 1BF5A 1TITA 5BUAA 4FEIA 3SYPA 4KK5D 3V4VB 3HCVB 3S5LA 1RZQA 3AAZB 4JG1H 2YWYA 3B43A 4HIJB 2ZYHA 5EOTB 2WOBA 5GSRA 4YFEA 2QFRA 3CLEH 4G8AC 4NN5B 5EORL 2X4RA 4AYID 4JEGB 3VD7A 4LSSL 2GT9A 4FXTA 1ZLSH 5FO8A 1DR9A 4NDMA 3HHMA 4JFOB 3PP3H 4Q4EA 4HPHA 1BVOA 3M8OL 4K9JA 3V8CA 1GC1C 5JPNC 4U1JB 1ETB1 2DBLL 5EO0B 3OHMB 5C08A 2EIDA 4KKZA 4AITA 4QRBA 5DK3A 3VUAA 2VQ1A 4Y4FA 2E7MA 1U8NB 4GKNA 1T7YA 2CCWA 1SEQL 4NQEE 1JGVH 3FONA 1CFNB 1UM4L 2Q8BL 3ABMB 3OR7B 1OM3L 3MCKB 2FO8A 4NKMA 2DKUA 4N90E 1PLCA 1RQ5A 5DTFB 3GO1L 1G84A 2VJXA 4F1ZA 3EBIA 2F53D 2CG9X 2NUPA 4H1LB 1E90A 3FCUB 3BZ4A 3EYFA 3LNFA 3Q9QA 3O9WA 4MD0A 4R9HA 4HPYL 5HHOE 4Z77B 2HRGA 4JHAL 3CVHL 1IIKA 1KXQE 1L0QA 2RJMA 3IE4A 3VWKA 2EUVA 2GSIB 3SE8H 1YAZA 2XI9A 2CBQA 3ZKQD 4ANKA 1MRFH 1UT2A 4Z7VE 3FQRA 1KT2B 4YDIH 4ABWA 1QLEH 5HGBA 5I1EL 2VIRA 3CD4A 4DOHB 4FXGC 4J3SA 4JQXA 3GRWL 4ADIA 4AL8L 5JQ6L 1F45A 1WEJL 1QFWL 3MLWH 2YJQA 5D7IB 1AQMA 3OKEB 4Q9QL 3TBVB 1A7NH 5E2VL 1E43A 1FFNA 2YO3A 4I0CC 2EIMB 5AAMC 5LN4A 5CGMA 3NZ8B 5HI5D 3S5YA 3UZVA 1S9WB 1I7TB 5LBVA 2WQWA 3GMLA 3QQ4A 1DQLH 4LPVA 1KGWA 2EDTA 1TJIL 4X9BA 4JFXB 1OB1A 1AE6L 1N5YH 2HMIC 3VGEA 5CINH 1MAML 2FWUA 3ULVH 1UH2A 1QSEE 3WXVL 3E6HA 3UADA 3VWJB 4F2FA 1UZ8A 4Z3IA 4JHZA 4F20A 2QADC 2YGPA 5BMFH 4HT1H 3RWHA 3TEXA 1G87A 1G7IA 1B0IA 4LRNH 1ZHNA 1MZYA 3KYOA 3D1MC 3QUXB 5D4IA 1J7VR 1VERA 2EIJB 1I9IL 3T0XA 3PGDB 2F1EA 3JT0A 4M5YL 3BP6A 4PWIA 4N2DA 2Y7QA 5D1ZB 3L5JA 2B08A 4YBHA 1SJMA 3PXJA 5DUBB 1H8OA 2AP2A 2ENPA 4GRLC 2EYSA 1XGRB 1ZXKA 4A2MA 3PIQA 3HNSH 1QW9A 4Y4KB 2ATPB 4NSKB 3QNFA 3PWNA 1FZMA 1RMFH 2ORBL 3RIAF 1MNUH 2F0CA 2V6HA 3UGXA 3RL2B 2AK4A 2C9SA 3IETB 2ZWNA 4FQ1H 5FFLA 5B39B 2Y2YA 1A2YB 1U8KB 2OXGA 5AOIA 4YE4H 4GI6A 3CHSA 3QEQA 1PX3A 4OFYA 1QKZL 4R84A 3FH8A 3KPSA 5JIIA 3HN8A 1MSPA 3OKLA 1IBZA 1U3HA 2DN7A 2E7CA 1J1OH 2DIEA 3TBTB 5T33H 5AVWB 1ZVHA 4O9HH 1HHJA 3KGRA 2RA1A 4EE2A 4WIQA 1URLA 1J10A 4JZNB 1QQDA 2COVD 1TDQA 4NHUB 4TKWA 4XXWA 3CXHJ 4G7VL 3NTCL 1BVNT 1XH3B 4FG4A 3GIVB 3THML 3ZN6A 3NCEB 4J3OC 1OZTG 4AC2A 5GS0H 4PTTA 1S78D 3GSVA 3NEXA 1UVQB 2ARJB 2OSYA 2ZTBA 4QY8A 1CIDA 4LSUH 2D0FA 3CFCH 3PWPE 4HH8A 1XBDA 2IBZY 3K5RA 3O4LE 3TC9A 3LXBA 4ZXBA 1KG0B 2XYCA 2WMPB 1KIQA 3CFBB 1X5XA 3CBKB 4NC2B 4PJ5E 2QPUA 3TA3C 4OBRA 1N8ZA 1OPOA 2PO6D 5CGBA 2BY3A 3OLEA 4UQBA 3KR3L 4NUMA 1W0VA 3P30L 4E9YA 3QI9C 1HU8A 1KLFA 1JZEA 1OGAB 3K1DA 3BLKA 4I0PB 4NI3A 4YK4B 4KJYA 2OA9A 4UUJB 5AZ2L 2GJJA 2NT1A 1JERA 3F58H 1QLFA 5DJ0A 4OZHB 3RWCB 1VDGA 4POYA 3U36B 5C0AA 2KBGA 1FNGB 2AGJL 3GIZL 1LE5A 5EIIA 3SJVA 2NY4C 3TT3H 3BN9C 2ICEB 1K5WA 4BQBA 5F71A 3QUMA 1MFNA 4WW1A 1KBWA 3PWVB 1VAHA 4JLRB 2ZUUA 4Z7NE 5DHXB 2VGLM 1MFCH 4C83B 5AWNL 5HYQB 4YSPA 4NNPL 3VXQA 4IOIB 4L9LB 4XWGL 3F7VA 4DETA 2IALA 2Y25A 3G04B 1TJHH 2WXJA 2ZWLT 1F4WL 1ZDQA 1DZBA 3MFFB 4XH2A 4GRLD 1NDGA 1XL6A 3CZFA 3MJWA 2WTRB 4JG9A 4XE0A 3DMMC 4FLQA 5B21A 5EDSA 2O5NA 2YLHA 2LE9A 5T5NG 2XVGA 3UABA 5F1SA 5CD3A 3SDYL 2H3XC 5I8CA 1GR7A 3T8XA 3RWIA 2CUMA 2X4PB 3AGVA 2Z31A 2JCCE 4P99A 2X2IA 4JFVA 4FP8H 1R3JA 4O2CB 5IF0A 3A4FA 3JV6B 4G9FB 1VFBA 4FL4B 4DN4H 5F3BB 5I9QB 1UASA 5E5MA 3C5ZC 3VFWB 2AJUH 4KROD 1AQKH 3OX8B 4KRLB 3SHSA 3ZSSA 1S7XA 5ISZD 4UDUA 3S88L 3CZJA 3TN0A 4BZ2L 4YFLF 4NO5B 1HILB 4J3OD 4AV4A 1JPFB 3LH8A 1ZT4B 3HS0A 4PJHA 4LEOB 4XNXH 5CIPH 3INUL 3O6LH 3RGVC 3SBQA 4EI5B 1K4CA 4PJAF 4OV6F 3JWNC 3ZY7A 3GSWB 1F3DH 4WJKB 3ZMEA 3PV6A 4UZSA 2N0MA 5LNGA 5K9KB 4AM0B 1JCVA 2VLRA 3FCTB 3DK2A 4HJ0C 1SF3A 3TA3D 1VFAA 4AKPA 3VAEA 2Z92B 3HS9A 3EOYG 3WO3B 4ELMA 4G8EB 3I9GL 4JUTA 1MAKA 4MDRA 4H88H 1AZNA 4Z1PA 5IVZB 3BD3A 4ENEC 4LNVA 5L8JB 5FYKL 5DMYA 1YUKB 4OTXH 2C3GA 3GQFA 4Z7QE 1I1RA 5DDHA 1EO5A 2DH2A 5KBKA 5FO2A 3RY6A 1KJ2L 4ZAKA 3I3DA 1EO8H 4AYGA 2YZ8A 3TO4B 1CD9B 3AQYA 4HLZH 3GBMH 3O45B 4BINA 5I0XA 4AZUA 1GY1A 2GQHA 2XKSA 5ICZA 5MEQA 2PXYB 4WHYG 1Y7VA 4EBQL 1FH2A 5IHHA 1PZ3A 1QUNA 4PVLA 2BSED 1JF1B 4PJCE 2NY4D 1J9TA 4K7PH 3X11B 3BN9D 2DWTA 1Z66A 3ULUF 4MLIA 4Z7UB 2FJFA 3RJDA 1PQZA 4PJGB 4CRPA 2AK1L 2W91A 3G6DH 5EZIL 1RZFH 1D6VH 1OSPH 5FHBH 1ZV2A 3P02A 4M6AA 1MHCB 2G60H 3VI4E 1FL5B 1LO5A 2R1YA 4AX3A 3DMMD 4ERSL 3DX9B 3CHQA 3KD4A 2J8UA 4HU8A 1ADQA 5I75B 2D2OA 2JKWA 1EWHA 3BT2L 1IFGA 3FC8A 3RUGE 1KELL 4AYFB 3M07A 5AL8A 2P44B 4OZ4B 3RVVC 3S34L 2BIIA 1KYUA 1MIMH 2MOVA 3B2MA 4ZMPA 1G7LA 2BOBB 3FNKA 3O8XA 1S4IA 1DVFC 1G7HB 2A9NH 1H3VA 1KPVB 4G5ZH 5F6HI 1A14L 3JWDC 5EUOA 3EJCA 1AR1C 4PVBA 3VE0A 2E9IA 1GGCH 4GG6B 3VXNB 4BCYA 1F02I 5HYFA 4UINH 5MEND 1JZJA 1HK6A 3C5ZD 2DJMA 4FQXC 4HS6B 4XNQA 1CC3A 1CFBA 2H0EA 4CBZA 2YAOA 2X7LB 5HDWA 2AXJA 3BKML 4Q9RH 1F11A 5I1IL 3VXOA 1YMMA 5CJOH 4QHMB 3RGHA 3SKNB 4JO8A 3V4PH 3GDBA 3RGVD 4R3SB 4ODXA 5GGTH 3VA6A 1NEPA 3FH7A 4XO3A 5HY9A 2WAQA 1N7MH 5JDSB 2BLFA 5FX3A 2VXQL 1C1EH 4HJ0D 1A4KA 4KRMB 2NUTB 1W91A 3GSNB 4BUQA 1CICB 4K23L 4GSDH 3QWRA 3DIDA 4XVTL 2DYPA 3GF8A 2A6KA 2NYZA 3BZFA 2X6CA 3AJ7A 4HGKC 3VB8A 4ENED 3B2VL 1AS8A 5KN5A 1R1CA 1QG3A 3PGCA 4I85A 1Y6KR 2FLRT 4TVPH 4ALAH 2OMVB 4ODWA 4NENB 1HEZA 3LSOA 1GYAA 1BFVL 4EZMA 3Q1EA 3DXAB 4AGMA 4JY6A 5C0BE 4F27A 4GSQA 2WJ5A 3OGCA 2DQEH 3DVNB 4LNRA 2ENYA 3EFDL 1XB3A 4HS8H 1DVSA 4GUPA 1YDPA 1GMIA 1P1ZA 4PLOB 2L4OA 2OW7A 1N0XL 1D7FA 1HCYA 1LMIA 1JRHH 2FECL 1F86A 3G5XA 2X6VA 5HXMA 5F72S 2AEPL 3CH1A 4YNYA 3VD4A 3IBOA 1E2WA 4YL9A 3UDWC 3IAPA 4I87A 3QFJB 3O6MH 4OV5B 1KYFA 2F5BL 1LO3H 3KPPB 2OSLB 4NQED 5T1DH 2XPYA 4TSCH 4B5EA 1PZ5B 4JREC 3NIFB 3BAJA 4RFOH 4WKZA 4N90D 4R7NB 4K5LA 3RVVD 1A8JH 2QV2A 2BJML 2JKRM 4JL1A 1NPNA 2EO1A 1DVFD 4X0KB 4KBPA 3IN0A 1KB9J 5HHOD 6FABH 2KQNA 3KE0A 2OZ4A 4GSXA 4M7JH 4IKIA 4OZHE 3ECBA 1T03H 1KIUA 1KTLB 2F1AA 3CQQA 1Z9MA 4S0HA 1FE8L 2CQVA 3R18A 2C4XA 1IM3A 4FQXD 2CDEB 1NCJA 4P0DA 1EXUB 4PJDF 1E65A 5CR8A 2QKSA 2WCPA 2VLLB 3ESOA 3VXMA 1HHHB 1YEWA 1TIUA 5D5MB 1FO0B 1A7PL 5E08L 1FCCA 1EZVX 5BS0E 3UTZA 1FFTB 1G94A 1S9YA 2R83A 1TT6A 2JELH 1CFSA 2ITDB 2CCVA 2WZ5A 1IL1B 3OKMA 4P05A 4B41A 3Q3GA 4OD2A 4PJEB 4OV5A 1GGIL 2HVBA 7CGTA 3L3HA 4FXKA 1RZKH 4MAUH 3U7WH 1NBZB 3TO2A 1X5LA 3OG6B 3Q06A 3AADB 4Q6IC 4ODSH 3FO1A 5L2KA 5TPWH 2RACA 5D1QA 4G43A 3P9MA 1EDHA 1YECH 2AEWA 3ARGA 1QSED 1FLTX 1UFUA 3FO0L 4IQHA 2VXVH 1HWGB 3GMMA 1TMCB 4DTGL 3FPXA 4PAZA 3NA9L 1WIPA 5ERWA 5IUCA 2Y4SA 4DO5A 5L0QC 1RCYA 3QQXA 3BAXA 4KKCD 4UIMA 5TDPB 5F88B 3KL5A 1O5DT 1MN4A 1PLBA 4H5SA 2FR4A 2H1PL 5FB8B 2CDGA 4NZUH 5AVRB 3WAKA 5HYJE 4OJDH 4Y2NA 5F9DC 2FB4L 4BQCA 4EZJA 5L4JA 2AXGB 3LS4L 2ADIA 3KCWA 2BY1A 3EDKA 2EVHA 2WTPA 4PRIA 4KQ0A 3LXAA 2C7UA 2F8OA 2XNAB 3CXHK 1E8XA 1U95A 4MFHA 5IWLC 2FIKA 4K71B 1U8LB 5D6DA 5D7JC 1AVAA 3ZE2E 2X2JA 4OF7A 4XXCC 1UG9A 1BQ5A 3FN0L 2VO8A 5I8OL 1NFAA 3ZZQA 1OCWH 1CLCA 5I17A 1P69B 4P07A 1CIUA 2IGFH 4HLJA 4YDMA 4F33A 1A3RH 1KTDB 4OGXH 3VRIA 4LOFA 5BZZA 4JN2B 3FU3A 3KYAA 1PD0A 1RHHB 4WJ5A 2QL1A 4U1HA 4DZBA 5E6IB 1HHKA 3B56A 2XOTA 1F1GA 1TEFA 4XMPL 4XCCH 1A4JA 1HH9A 2J1YA 4YXKH 3GSRA 2BW5A 2JIXD 1YNTB 2H3NA 5IMMB 3ZDXF 2LLNA 4BSWA 5F21B 1AO7A 3CNKA 4GFXA 4LVEA 4LOEA 1NBCA 3PWPD 3PL6C 4LB8A 4PJGE 1QNZH 1K6QL 1T20A 4PJ5D 2DY2A 4ZTOH 3ZKMD 3U2SB 3Q9PA 4L4TB 5E4OA 2Z65C 1BPVA 1ETZB 1IMHC 3N85L 2FBOJ 4N2EA 1I8LA 4XPBH 4IJ3C 4DCQA 2VZSA 4RGMB 1UKSA 3ETTA 1JIBA 1T83A 2GHZA 2UX6A 3UMNA 2J88L 2EJ1A 3LEYH 4IYKA 3L9RA 3V9CA 4DPCX 3QFGA 4ZFGH 2VYRE 3OAYK 4RGOL 4TULH 1YSOA 1PNDA 1JGUH 5SWZA 5BOPA 2YLKA 5CP7B 4Y8DC 3HMXH 5ENWA 4QXUH 5JW4N 4R2GC 4ZDHA 3FF7A 3CFJB 1SQ2N 1JDAA 1N70A 2OMWB 3CSFA 4PJIA 4F8OA 4P2QA 5EWIL 2LOEA 2OR8A 5HP5A 4GG6E 4YS4A 3QR0A 2IV9A 1U8OA 4J27A 1AC6A 4G6KL 4N1EA 2P8MB 4OCXL 1EXGA 1MQKL 2MHAB 1QW8A 1UXSB 3D25A 1GIGL 3LEVL 5EN2A 3T08A 1BQLH 4JQVC 3U1SL 4K3EH 1GW6A 4P3WA 3TL5A 1MRCH 1X7TA 1Z7JA 2ENQA 4G7SB 5MEPA 2BXYA 1CL7L 3HMWL 2VUYA 5CIPA 1U6AL 1QPXA 4HKZA 1A7BA 4E9VA 3TJHC 3HC0B 2EUXA 1KLUB 2FX9L 4B3VA 5KS9B 4NP9A 1ECYA 3HG1A 5E00B 2V5MA 5AW9B 1AQDB 2UYLB 3ASOB 4N0YL 3VI3A 4Y5YA 5FKPB 1R0AL 4HJEA 3NCXA 3Q6FB 4Z7OE 3K1KC 2OMTA 1DQDL 3B7TA 4GO8A 4Y9FA 1N19A 5F7YC 3KH4A 4FJYA 1MLBA 5I23A 5TE6L 5KYYA 1F2QA 5GZOA 5I82A 3VFVA 1XGYH 4Y19E 3HI1B 2FSEB 3EBAA 4A2EA 1G7JB 4PS3A 4ESKA 1NQBA 2B1AH 2OJZH 4KKBD 4JKWA 2GITB 1HSBB 2FD6H 2BVPB 1NIFA 3NFSL 1G7MA 1P2CB 1QLRB 1PZAA 4LLYA 4J4PA 2WSDA 2CJUL 3LZNA 2A6IA 4CSPA 4BKSC 4Y2LA 2BDNL 1T2QL 5CJXA 1F3JA 2XN1A 3G5VA 5AQ0A 1SVZA 3PL6D 5FO9B 4Y4KC 3IVKA 4M48L 1TTUA 4CC4A 4HZAA 2JXMA 3SKMA 5JOPE 3RURA 3FB5A 4N6RB 4YHKH 2HKHH 2MCPH 2B2XH 4CNIA 4UOZA 1DJYA 5IK3B 3GZPA 3F7PC 2IAND 2RCSH 4FQ2L 2C1PB 3NIFE 2MNUA 4XPFL 3NDZE 5IW1A 3ZHNA 2R4RL 4KVNH 4N20A 5DJZA 2HXAA 2AJ3A 2XWJA 3RBGA 4PRHE 3D4YA 4JDTH 3FQWA 4M62H 5C0DB 4R2GD 3UMTA 4H26B 5FK9A 1SYSB 1M9WA 2EINB 2R9HC 3GXNA 4GBXB 1INDH 1KXVA 2HN7B 2R2EB 3MJ8A 1QRND 5E51A 5F1IA 2Z93B 3A67H 4M1GH 5KVGL 3OZ9L 1CU4H 4P5MB 4BFEA 2VDKH 4AMXA 2YSSA 4M7LT 3TJEH 4AJVA 4EQ2A 2OP4L 1OLZA 1TKWA 2H9GB 5F7LB 3ZE0F 2VR4A 4NYLB 2XJLA 2ZCHH 2KPWA 1NIEA 3RWDA 3W81A 4UAOB 3GDCA 3AWGA 4EOWH 1NCOA 3V4PA 2R0LL 3ZU8A 3N6YA 4GH7B 5EC1B 5CCGE 3TJHD 2GUOB 2VW4A 1MFBH 3DUSA 4PJHF 5GGTA 1BXAA 3KYKH 4IBWA 1L7IL 4TM9A 3REWA 2A4CA 4F8PA 2W92A 5CFAA 2BSRA 4OJYA 4IGBB 4QOKA 4I0PC 3Q1SH 2ZOOA 1T7VA 1NIBA 1DCLA 5DC4B 3DHUA 5AYUL 4UTAH 2C3WA 4XVOA 1N10A 2XN9E 2PYEB 4LKXB 3UROR 3GHBL 2VQTA 1DO5A 3JTTA 4Q7DA 5E5RB 4DP6X 4KKNA 1EANA 3D2UB 4ZW5A 2ICEC 4KKQA 2P5EE 1W0WB 2V2XA 4OI8A 1RJLB 5EV7A 4RSYA 1IEHA 4UF7C 2Z91A 4JKMA 4W9DC 4BD4A 4UNVA 3EJRA 4RETB 3T3ME 4I3RH 3C87A 3FYIB 3C2AL 4AV0A 4XNZC 4NRZA 3PDOB 2W88A 2BX5A 2MSPA 3NJFA 4NPJA 5JOEA 4WUKH 1RIUL 5H37G 4PSRA 3WEMA 5KYXB 3N9GH 3CMOH 4HPOH 2WZPD 1XF2B 1MH5A 4ZUSA 2VJ0A 4RIRB 4W4OC 1RUML 4F1SA 4I3SH 3X3GL 1ASOA 2GEQA 4U1NA 3MRLB 3NZHH 4EPSA 2PCPB 5JW5A 2E9WA 3SBRA 4O58H 3KPRE 4Q8BA 5FA3B 5C6TH 4L29B 4L3EA 3QH3B 4KKRA 4R7DA 2MOQA 3FO2B 5C0BD 3SOBH 5HHXL 4FADA 4UILL 4UU9B 3U2JA 1T5XA 2OMXB 1HKLH 1HSAB 1RZ8B 1QWUA 2EDHA 2R9HD 4LGSB 5T3ZE 2H4EA 3RAJH 2Z4TA 1TTGA 5EBGA 3CCHB 1AP2B 3EH1A 2ILLA 4J1UB 1UA6L 4W68A 2IDCA 2H26B 2VLJE 4ELDA 1KB9K 3BFQG 2VMDA 4OLZL 2WO3B 3SGKC 2NW2B 4IBYA 2KDYA 3WLWC 5IOPB 1J5HA 1YEJH 2GABA 4ZO8A 1AC0A 1E8YA 5E1GA 5I0WA 3DROA 4P46D 5KVEH 3R1GL 2ZYSA 3HN3A 3S4SG 2LU4A 1J1XL 2HRHA 2EEBA 4R4BB 3OWEA 1RIHH 2K0RA 1BQRA 2VDNL 4NRXA 5AALA 5IHUL 5IW6A 3QNZA 2VR6A 5H8DA 1X9RA 1EDQA 2V5TA 4APQA 2WWOA 2HJLA 4Y5VC 5F1KC 3ECUA 3HNTH 3HAEG 4X5WB 4UQAA 4QUOA 4F58H 1OPGL 4FQHA 1KB5H 3BMWA 4A6YH 3NQKA 4TLKA 2WXHA 1YVLA 1TCRA 3I6LE 4KY1H 4UT6L 1T22B 4IBSA 5AVYB 4KI5D 2HLAB 2YUWA 5F1NB 5DVOA 3BQUA 4NZ8A 2C9RA 2R7EB 3KLAA 5F89A 4HUWA 4GW5B 5I0DA 3C2SA 5FW6A 3V2AR 1S7RA 5BS0D 1MI5E 3I02B 1UGKA 4HOZA 1XCXA 1DDHA 4KZ0A 4JO5A 1RPUA 2N0KA 5DRNA 2D3VA 5I75C 1DBML 1G1YA 5KS9E 2WGXA 1PIGA 5DHVB 1S7WA 3MODL 1KIPA 3OC8A 5DURB 5E5UB 5B3JE 2P24A 3BYYA 4HLEA 4LLMB 4OM0L 1T04A 1FNEB 4ODVL 3NN8A 4X7TA 3N43F 2VITB 1T0NB 4HKBA 2J1ZA 4ZQKA 1KDJA 3MBXL 1P4BH 1YAIA 3MUJA 4UM8B 1WJ3A 4DVRL 1XBRA 5EORH 4UZGA 4Y5XB 2X0UA 3MRCB 4LSSH 5B1AB 4F92B 3VGAC 2D3NA 3L13A 4NKOB 5LDSA 3AU1A 4H8WC 3P0VH 3M8OH 2Y36L 2WLLA 3OGOE 4Y1AB 3MLYL 3IJ7A 4D7PA 5B4MC 2DBLH 5HYJD 3B4NA 1F00I 1UCTA 2NCMA 3J27A 3MV9A 1KY6A 2VXTL 1MCWM 2BHZA 4UTBL 43CAA 5D2LA 1YY8B 2BK8A 5E2UL 3VSVA 3FQ1A 4L5FL 1SEQH 1RVFL 1X6NA 3MRJB 4JO2L 1UM4H 4U3SA 5TTRA 1P6FA 3GSOA 2IQAA 2Q8BH 1OM3H 4V11A 3WLWD 2PCYA 4YOKA 1UT9A 4HULB 3IN2A 2NY1C 1HXYA 3VSQA 2ROXA 1YC7A 3WV0A 5DK0B 2Z8WC 4R26L 3IXAA 3DPBA 4HPYH 3ZDZB 3ARZA 3CVHH 5DHYB 2A6DB 1Q0EA 1CI3M 2WW8A 3DV4B 4JZJB 3KLQA 3GT6A 2VM3A 4J12A 5JORA 3BHBB 2B5IC 2W07A 1P5UB 2IXQB 1H9VA 1HH6B 3OB0K 3HMXA 2EDWA 1SLXA 1EGJL 2AQTA 2EO7A 3GRWH 5JQ6H 4AL8H 2AJSL 3BGAA 3BSZL 4XX5A 5D7HA 1WEJH 3U9UA 3VDCA 4JM2A 2KLSA 3H9SB 4Q9QH 4MA1B 3UIZA 5E2VH 4DP4X 4U3XA 1ZHBA 2H6PB 3II2A 5F3HB 1RP8A 3SPCA 3TX4A 1B0WA 1TPXC 2YD1A 2PF6A 3F83A 1SXSA 1UENA 2WQ8A 4NNXA 1B0GB 4KZEL 3SDXA 3H53A 1PFOA 5K1VA 4KTGA 1XCQB 5CEZE 1TJIH 2UUDH 5D2NB 1AE6H 4BWUA 2JB5H 4HGWB 4LLVB 5HYSG 1VA9A 4BXSV 3IJHA 5FGCB 3WXVH 4NZJA 1QI4A 3B2PA 1JPSL 4DEUA 5MI0C 1SHXA 3LQZB 1PKQB 2NX5A 4U1GB 1LEIB 1PD1A 2TSBA 1HL4A 5E70A 2XIDA 2GCYA 5FGBC 1BD2E 2PYEE 3G6JE 1CBJA 3QEUB 3NRFA 1S7UB 3MNDA 1I9IH 5JHDE 2X4NA 3DJ9A 4M5YH 4B9CA 4OF6A 4PCTA 5CZKA 3E38A 1PVHA 1XQ4A 1NUFA 1RJYB 1JG9A 3QAZB 2XZCH 3ARUA 1KCUL 4HFUH 3UBXA 5B4MD 3ZYIA 1SJEA 4AWJC 3U48A 2ORBH 1QBBA 5A7EA 3W0WA 4NBZB 3LS5L 3QXWA 4X6BA 5HVGB 3S98A 4YSAA 1QHQA 5DO8A 1U4FA 1LWHA 1C12B 2P26A 4XT1C 3ILEA 3APDA 3OKKB 3SIKA 2BVTA 4H40A 4R5TA 4ZZKA 2NOYA 3VFOA 5G4MA 1QKZH 1MNNA 5I19L 2NY1D 3MI6A 2EYTB 1XGUA 3QJXA 2H8PA 2JMRA 1INEL 2NTFA 3W11C 1QFPA 1JF5A 3HLAA 5CEYA 3T5WA 3D39E 1OF2B 4KVPA 1YEDA 3QT2A 4G7VH 4ZG1A 3NTCH 3KWUA 3H9HA 5LGJB 4Y19D 2P47B 2UXTA 3THMH 3WIFA 1RUAL 4DQOH 4PJBE 4XOEA 4GQRA 2XV2A 3BH9B 5ETUB 4Z0XA 1SPDA 2V7HB 4LHUA 5AL0A 2NQCA 5TDNB 3RFZA 4MLSA 3DARA 4P4RB 5IHZA 1JS4A 3FTXA 2WNWA 4JY5H 3L3JB 4ZRGA 3WBDA 2O6EA 4F9PC 2VR9A 1IGIH 3EJTA 5JOPD 1FVCA 3CDYA 1V5JA 3DGCR 4CSTA 4Y16A 3P69A 5IOKA 1BZ7A 2VKWA 2QDVA 3FUNA 3Q2LA 1BJ1H 4MAZA 1E67A 4OLYH 1OM9A 2NY3D 4Y7OC 1WTLA 3NACL 5HYIA 1NJ9A 1HI6B 1QP1A 2CMRL 2IPKA 2YFNA 2ZT9C 1CPUA 4PRHD 4PREB 4IIQB 5D1XE 1XVSA 3MXWH 2AGJH 2I85A 1MW1A 2FX8H 2YPKB 3GIZH 2VDPL 2WN3A 4D0DB 1O7SA 1OSZB 1XZWA 4GUCA 1OAYH 3A5VA 4HK0B 1IQDA 1FYTE 1NGQL 2CWRA 4QRRA 1VLXA 5F6HJ 5F97E 1JSYA 5I1AA 4QHUA 4P23B 1JGDB 4X8CA 3RX5A 3X13B 2GBVA 5IQ7L 4NQVB 3REVB 5HHMB 1GGUA 5AWNH 4NNPH 1IAOA 3TWCL 3RIFF 1Q9LB 3TT1L 3E8VA 2EC9T 1S6NA 4XWGH 2MNJB 2OCFD 4WQOA 4LCCA 3HE6C 2WY3B 1F4WH 1GZQB 2CM6A 3L3DA 4JK0D 4YR6A 4IHBA 2O5XL 5LB1A 4XO9A 5IMOB 1I82A 2E8ZA 3D34A 2ADFL 3WMQA 4EAEA 4S1DC 4YSTA 1H8SA 1TEGA 4X99A 4MDJB 4LVNC 5D70H 3SDYH 3B83A 5C09B 4ZSOB 3SDCA 4KH9A 1ZK9A 4FCAA 4NKQB 4UQCA 3T4YA 1A4CA 5K1JA 1WS7A 4Y1TA 2ICWI 4JDZA 2EDXA 1FRGL 3JWDL 3QJZA 3D3VE 1JNHA 3HEIB 5CSZB 4NUQA 3W11D 2RR3A 3IDGA 3QJRB 3S4SB 5KYNA 4X7EC 4X98A 4PFEA 15C8L 4NN7B 5A2JH 2XN9D 4JE4B 1H0DA 3A6BL 4KXBA 4WHDA 3VXRD 3S88H 3TF7C 1I7ZB 4YHPB 4BZ2H 4UI2A 4CJ0A 1YEFL 3PJNA 1KCWA 3QWQB 4ONHA 3AZUA 4TVSa 2P5ED 1TZGH 3WNPA 3INUH 4JFZL 3HAEB 3QEGH 5ESVB 1QYGL 4MAYB 5J4MA 4BZ1L 4ZX6A 1PG7W 1ZAGA 1ASPA 3I85A 2Y72A 3K2IA 1S9XA 1X4ZA 3QULA 3MV8D 4DP9X 2VM4A 4OLEA 4XO4A 5J06A 1HL8A 2BS71 1F6AA 1BECA 2QPEB 2R23B 4QHLB 5KSBA 3ZR6A 3GSQA 1AH1A 4P8QA 3I9GH 5SWSA 3Q01A 3CIQA 2XWXA 4E9RA 4XMTA 2E4FA 3ZUNC 2BSDA 5EULV 1KY7A 5FYKH 4NQXA 1AKPA 4ZW7A 1J0IA 1OHQA 1D9KC 4FQJL 4MQ7B 1ROCA 5CJ8A 4BHUA 1KJ2H 35C8L 1HOCB 3BO8A 2YAQA 4MKTA 5F9OH 3SBPA 5KSAC 3KPRD 4QHKI 4RISL 5C08D 4N8UA 2APWA 4EBQH 4RQQA 4PWHA 2NXYB 3PUCA 4Z7WA 5T3ZD 2JF1A 5FECA 1MZZA 1PJ9A 2F5AL 2AK1H 3TBCA 1OAQL 1HZHL 1F97A 2V17H 4GO6B 1K3IA 3EGDB 1KB5A 2AQSA 4A6YA 2O61A 3ARED 3MBWB 1QBML 1HQRB 3HE6D 2VLJD 5GS2D 2R0KL 3RZCB 3IDNA 4ZMQA 3EW3B 5LAXA 4ERSH 3H9SE 3DIVA 2LLGA 3O41B 4ATTA 1ZMYA 1ZWIA 2EDLA 2VXUL 2PYFB 3BT2H 5J13B 2CDFA 4ZTEA 2BRRL 4HWZA 4LXFA 5KJ4A 3S34H 1WA2X 3OJDB 5DZAA 1IC0A 1DJXA 3GMQB 3CC5A 4NQUA 4A2HA 4OD3L 1E5YA 5AUMA 3ARYA 4KJQC 1Y0LB 5C1MB 4UM9D 1A14H 2UY7B 3LVTA 2X70B 4Z76A 4WO0A 4XN4A 3P9LB 4YDVB 3TBYB 3TURA 4AGNA 5I26A 1NMCB 4G71B 3T4AC 4ZO9A 3DSNB 5IM7B 4TMPA 2YK1L 3PF2A 3RL1A 1E42A 3I6LD 4Q6KA 3Q5OA 2YPLA 3BKMH 4OM1H 4J8RA 2OM5A 2NR6C 1JWSB 4OI7A 1J8SA 3ILPB 3QDGB 4V1DB 2D7NA 4AENA 3T2PA 5JHLH 5JR1L 1XIWA 4U6YB 3U1QA 1MI5D 4RRPA 1JGIA 4XRCB 5A6MA 1CXIA 3T77A 2WVVB 5GZNA 9CGTA 3MRPA 5MERB 2A6JB 2CRYA 5C07B 4BSVB 3F12A 1NSNH 3EGSA 3ISYA 4K23H 4XVTH 2HKFL 4N8VB 5I2IB 1OW0C 5JPMB 1BMWA 5IMLB 2OV0A 4X8JB 2ERJC 2D0HA 2PR9A 1IZKA 3G9AB 2EP6A 4JG0H 4ZMLA 2CIIA 5KANI 2DTSA 4DZ8A 4MRBA 3J8F7 4GW1B 4KRPC 3GEFA 3HZYA 1K2DA 4BFNA 1D9KD 1X7QB 4G9DB 2PTTA 1BFVH 1D7DA 4NQQA 2Q6WB 3ZIYA 1E4WL 2BSSA 1M05B 2DLGA 3NK4A 3OXRB 2AMUA 5FLUA 2VDRB 2E47A 1E5ZA 2OMZB 3DBXB 2R2CA 4L1SA 4XGZA 3JV5A 3VXPB 3E80A 3EFDH 3MNVB 3V6FA 3C6SB 3S3BB 1KMGA 2PW2B 4QR7A 5LQBL 4K5PA 8FABB 5J1TC 1N0XH 3CVHA 1T0OA 3MQIA 3UG5A 2HFEA 4A37A 4AYBA 3FSAA 6CGTA 3IDIB 2QPFA 4K3GA 1H15A 5E8OA 1EEYB 1F90H 4PHXA 1YUHA 3STLA 3MJ7B 3BVUA 3GLAA 3ZW3A 3MLUL 2BNQA 2YIHA 4XN8A 4DUXA 2AEOA 1A02N 1EEZB 2AXHA 1NAKL 4DN3L 2VXSL 1K8DB 3GRWA 1V8HA 1B2WL 3VU1A 1V54B 1S5HB 3OB8A 3UTSE 2IEPA 3KCPB 5FYJD 3EUUA 5I1HL 3NCFB 2ZSVA 5KVDE 5EO1B 3RFRA 2X4QA 2WBJA 3GZOA 4YHIB 5FHAH 4PJ7A 3BC9A 4FNTA 4OZGA 3HG4A 1ZXQA 3QIWC 3JTSB 3WIIL 4O02B 3QNXA 3VFRA 4I89A 3V79C 4XNMB 2WINB 4KUZL 4KXZH 3KPMB 3QR1A 3P4MB 4F2ME 3TV3L 4IBTA 2EDNA 1FE8H 4HIEB 5CLTA 4EVNA 3TBBA 3KMDA 4AJYV 1H19A 3WO4B 4BWWA 5D9SA 2WYZA 3FOMB 4YZFF 4IMLB 5HJ3A 3ARFC 3F84A 5CNHA 5EOQL 1A7PH 1SHWA 4AQ1A 5E08H 3KWWB 4I2XB 5IB4B 1SMAA 1PG7L 3V6OE 2FEEL 3ZZLA 2ATKA 3V0WL 4FTDA 4HWNA 4F2EA 4XCEA 5E99L 4G42A 1GGIH 4H8VA 1O6SA 1XF4B 3BFWA 5J7CC 5DO2D 4NJAL 4PJ8B 5AW3B 4JRYB 4CMMB 2W38A 1BLNA 4GOSA 2QDWA 3O2VL 5CEZD 3QUZA 3ZPDA 4XP4L 2Y07L 5ADPL 4FFYL 4OCRL 2EXTA 2FWOA 2J1XA 1OGTB 5D1XC 1FC1A 2FJSA 2PP8A 3KNBA 1NPJA 3FO0H 4OJAA 3SE3C 2WZAA 3OR6A 3I9IA 4KRPD 1NEZA 4ZYKB 5D2LF 5ITFB 5HVWA 3C60C 4IKLA 4L2LA 3EO0B 3QNYB 4A7TA 2DMKA 3H1ZA 1BD2D 2ZOWA 4N9OB 4MQSB 2X6UA 5CJBA 4YBQC 5JHDD 1U58A 1JHTB 4HDIA 2H1PH 1FVDB 1RULL 3TU6A 2DW5A 5T3XH 2NY5C 2X9YA 4K5OA 3NPSC 2FB4H 3SE4A 5I6MA 3LS4H 3BIKA 4HV8B 4MWFB 4NUJB 1WGOA 2LVCA 3CBRA 3TEYA 5F6IC 1TYRA 3MX0B 2G5RA 4WW2C 5EIQA 1FUNA 2HFTA 5DJYA 5IT2L 4EJ1C 3LY6A 3RWFB 4IKJA 3L1EA 5AYTA 3FN0H 4G80A 2HG0A 5I8OH 3GI8L 3ISRA 4J3TA 3BPNB 1PZDA 1JK9A 3F6JA 4JM2F 2XQYA 3JVGC 5GQBA 3QIWD 4MXQC 3E0GA 1MUJA 5ECGA 3QXVA 4LAJH 1T0MB 3DUUA 3D39D 3I84A 2P7TA 3MOAL 1KGXA 1KGIA 2VDQB 4OJEH 4A7UA 3MCLL 4TUJA 4XMPH 2F19L 3D30A 3OZKA 1R3HA 3LKPB 4YX2L 3O3DB 1LEKB 1V27A 3MNZB 2FBJL 5J3HD 4MNGE 1N3NA 1VCAA 3EDJA 4FYSA 4OIAA 3WNKA 3T2NH 1U8CA 3ARFD 2CHZA 3M6DA 3QDJA 5AYQA 4LDEB 1OT4A 3WELA 4YJZL 2F8XC 1K6QH 3QIBC 4RA0C 1HHIA 4K7PX 4PJ9A 3BCDA 3N85H 4MNQA 3SQBA 4YQXL 4GNKB 2ICES 3B2UD 3Q8AA 4A38A 2E9JA 5LGYA 3WS3A 4Q97A 3TNNA 3WTYA 4QIRA 3FQUB 2X4OB 5ID0B 4J6RL 4CC0A 5KSUB 3K8LA 3ARTA 4F24A 2OMYB 4OKVB 4RGOH 1FAIL 2Y1ZA 2QSTA 3RDTA 2EQDA 1EDYA 1R5VA 4R96B 4D0BA 3DX6B 3VU2A 4XBPA 5D1XD 1BZQK 1ZGLA 1KCBA 3MA7B 2VO5A 1HJBC 5EWIH 3TVMB 1GHFH 4L8SB 1FYTD 3C60D 3QUYB 2QKIA 3RY5A 8CGTA 4G6KH 4JKLA 5EU6B 5HYEA 1Z9LA 4G8IB 4ONGH 1WA1X 4YBQD 3CPLB 2BVEA 3LEVH 1GIGH 3U1SH 3HE7A 1QUPA 4FLOA 2CXKA 1LEGA 4OF5A 2I25N 1AG6A 4BZ2A 4GIAA 1FC2D 1IAKA 5J6GA 4WTZA 2UXGA 5MHSE 1CL7H 4W9GC 3HMWH 4EUPH 4PY7A 4RRPM 1U6AH 3ES6A 3MROB 4G2AA 1IGJB 1PJWA 2FX9H 2NSXA 3V5DB 3D4CA 5C07E 1WFMA 2XQ0A 3EJUA 4JKKA 4N0YH 4U1KB 1UB6B 4K8RD 4KY2A 4LO9A 1R0AH 2X44D 4UQ3A 4FTVA 3CQPA 2DEWX 1KYOJ 1CDUA 2MH4A 3MRFB 3ZO0A 3D3VD 4KTEH 3NABL 4BKTC 5B7MA 4N0UA 4QJ4B 2DYRB 4ZPVB 1NZRA 3WY2A 5TE6H 4EKXA 2ADGB 4N8CL 4IS6A 3IJSB 1HS6A 3FCGA 2CBPA 2QGBA 1I85A 3L3KA 4O2FB 3GXMA 5HGHA 2FDBP 1YN6B 4MMYA 2FT6A 5IB3A 2DF3A 3ZL2A 2HA1A 1KJ2A 1KJ3L 3VXSE 4D7BA 3BZEA 5A2IH 2CJUH 4LSTL 2NLJB 4YFLI 4L1BA 2BDNH 1T2QH 3PWJA 1N68A 2I5YL 4RWHA 2XXFA 2Z4QB 4M48H 3FT9A 3QIBD 4N2KA 4JKNA 5HI3C 5TGBA 4EN3D 2FZ3A 4P9HC 3L4XA 2XACC 3WN5A 5K39A 1U41A 2BHUA 2YBRB 3IRPX 4XC1L 5DZJA 4K7FA 4QNPF 5IROA 4FQ2H 4DGVL 2R4RH 1F41A 4HAFA 4K9EL 3W39A 5BVJB 3KJ6L 3P73B 1A1OA 4WWKB 3OKOB 5D7KD 1QTYT 4GPVA 4U6TA 3S35H 3LNHA 4P5TA 1QA9B 4YSSA 3H42L 5E0FA 5D6CA 1PBYA 3HZKA 4LT7A 3M86A 2DI9A 5SV4A 2NY2C 3AACA 5KVGH 5I6NA 4EI6A 1VGEL 4JRFA 1R17A 3OZ9H 1EK3A 3WLBB 5CFHA 1SLWA 4HS3B 2OP4H 3OKNA 3FW6A 4C56B 4QHNA 2ADYA 2H5UA 2NNAA 4PW3A 1XR9A 2IH3B 2VAAA 4PV8A 2R0LH 2E74C 5EZPA 1KENL 3WNLA 5IEHA 1LK2A 1IIIA 1CD1B 1L7IH 4PG2A 5F7KC 5IVXA 3QJQB 3TNMB 3D6GA 2CLVB 4D9QE 4OQTL 4BQ6A 5CN3A 1XSKA 1F18A 3WFEL 3L3OB 5C71A 5C92A 1B3JA 2DMCA 1QFOA 4HUVA 2P5WA 1G1OA 1N12A 2B14A 3QRGL 4MVBC 3MRBA 4KX9A 5AYUH 5JYLA 2BWDA 5KSBF 2ZONA 1B4LA 3GHBH 1GYVA 2D9CA 1THCA 3FQXB 2E7LA 1E3ZA 1DUYA 1U3ZA 2WXLA 4PBVC 5I18L 4OZIF 5EDXA 1MIEL 3MLZL 3MRIB 4HALA 1GS7A 2FAUA 1FG2B 3FQNA 4TQ8A 5DEGB 4Y2DB 3UAEA 3X12B 3UC0L 4CSZA 4Q2ZA 5B38A 1N9PA 1M2VA 4GKOA 1OP9A 3U9PL 4OW6A 3V6OC 1RZGB 1FH5L 3GBLA 1A9EB 3KG5A 2XWEA 4WTWA 3HPLA 5A16B 3C2AH 5E9DB 2BP3A 3R8QA 1NGWA 1EAOA 4JFFA 5HI3D 1IBHA 1QSFB 1F4HA 4P2RA 4L9DA 4LIQE 4MD4A 1RIUH 5D7LA 1QHOA 4OGZA 1U9KA 3RTLA 1JNLL 4XXDB 5I76B 1D6EA 5KOMC 4CDHA 4ODUA 5I73B 2NY0B 2FLMA 3QQNA 4XP9H 3FFCE 2XC8A 3EJQA 4PRPD 1RUMH 3X3GH 3DWTA 1UXWB 2OJEA 5B8CB 4XR8C 4A7SA 5CF3A 1FJ1A 4PUBL 5FDWA 3TZVB 2HUHA 3RIKA 3HG2A 4NN7C 3WS6A 3H85A 5LGHL 4YBLB 4GG8A 1CT8A 4NNYB 4IRJB 5HVHC 2E6PA 5E8NA 3NJVA 1JTPA 1TU2B 1U2YA 2J7LA 3LB6C 5DJ6A 5CZXC 2F7QA 5BRQA 4FQQB 1LK3L 3IS0X 2NY2D 1E2ZA 1UA6H 4MRCA 4PR5A 1W72H 3O6FA 1WWBX 2A9AA 2WXOA 2W60A 2WXNA 4PHZA 4PJFA 3KPLA 2ZWSA 2AKRA 5E94A 1R9FA 1RSYA 2W9DH 3T6ZA 5DT1L 1IGCL 2GIYA 2PNDA 3LQAC 4FI7A 3UTSD 2CBOA 4NQDB 3LKSA 3R1GH 4GAAA 1NMAL 4AIOA 2QELA 1J1XH 4AQOA 2YFOA 5GIRA 4PWEA 3HUJF 1IGTB 4FRWA 2VDNH 5IHUH 2P3YA 4J39A 2DIJA 4HHAB 2VC2L 1HXKA 1BJMA 1EH9A 3LIZH 2ITCB 2ADJA 3ABLB 2F8VA 1CFVL 4MVBD 1JI2A 4OAWB 1OPGH 5DD6A 3M1BA 4S2SB 1BMGA 3AM8A 4YHLL 1ZGLM 3VYOA 2FNBA 1J5CA 1G4RA 2DEYX 2EVGA 4BH8A 4X6CF 3V5KA 4GFTB 1DVTA 4JFEE 3S5LB 1AMYA 3GTTA 3U9WA 4E0RA 5GSRB 1WZ1L 5EU6E 2X4RB 4WDIA 2GT9B 5FO8B 1X3DA 4NDMB 3ABKB 3RZCC 1XD1A 1CLVA 2IBBA 4U6XA 1A7QL 2E46A 2KUTA 3WKYA 3FRUA 4HIPA 3U79A 2ED8A 5DK2A 3ARVA 2B7DT 4XMLH 1UUNA 5C08B 3AITA 3WJJC 2VQ1B 4Y4FB 1AQHA 3MODH 3NFNA 4DHLA 5A3IC 4GKNB 3MBEA 2XX0A 2O5ZL 4KDWA 4PYGA 4ODVH 3FONB 2OYMA 1J8HE 1RXLA 1NBQA 2D03H 2WO2B 3MBXH 3VXTA 4NKMB 3HG5A 4FQIL 4DP5X 2JJSA 2GI7A 2APBA 1W6WA 4DVRH 3DRTA 4X5LA 1YEIL 3T0VA 4POUB 2NUPB 4OUUA 3BZ4B 3EYFB 1JFQL 3O9WB 4MD0B 1WE5A 2XA3A 4PJAE 3VWKB 2YOCA 1F6FB 3OSKA 3DYPA 3BWUC 4WJG3 3LRMA 3LB6D 2Y36H 5CZXD 3MLYH 4FA7B 2WQUA 3FQRB 4ZD3L 1WP6A 1XGZA 3EFOA 2VDML 5HGBB 4HHGA 1L6ZA 4JFUA 2VIRB 3KPNA 1AQ8A 4U7MA 2VXTH 4M6NL 3DHPA 3DVGA 5E2UH 4L5FH 2QTEA 1GOFA 4K3JL 4PW9A 4Z8FL 3CX2A 4KKLC 3FUHA 3BIAX 3COOA 1QTPA 4M5ZL 5JPMC 3C08L 3IB4A 1MW3A 3CZUB 4NEHB 4IHOA 2NSQA 1A6UL 2XZAL 2QVTA 4F15B 1ZDSA 4XMKL 4D3CL 2R15A 3UZVB 3S8FB 4WKXA 5CGYC 1WZLA 1AZVA 2KKQA 4R26H 1EBAA 2MTAA 5CS7A 3GMLB 1C5DA 1A6PA 1XEUA 3QQ4B 4J4PD 1OB1B 4R4FL 3LOWA 2J5LC 3L3GA 2IPUK 3ULUE 3Q2WA 4J3OH 1BEYL 1UM5L 3E6HB 5I1DA 1TYJA 2HX9A 3FUDA 2WVTA 5AW8B 1UZ8B 4JFPA 1EGJH 1GZHC 3RWHB 4N22A 2AJSH 4Q0XL 3BSZH 4XI5D 1BEXA 1G7IB 1A6WH 3LEXA 1PL3A 2NCEA 1UA3A 3KYOB 4DIXA 3MRMA 3EYSL 4Q9CA 3A47A 1N6QL 3BP6B 3NCMA 3T3PB 2Y7QB 32C2A 2HB0A 4MS6A 5EPMA 5C6PB 2O6PA 1SXBA 1BCIA 3EJPA 4CKQA 4KZEH 1D2PA 1QHPA 2EYSB 3MREA 3SGJC 1Q90A 2OXHA 3PIQB 4IOSD 3IRCA 1LJMA 3PWNB 1FZMB 3MJ9L 1VEMA 3BPOB 4PQXA 4F3FA 2AK4B 3RX7A 4YXLL 1E4HA 2N4IA 4OIIL 5FIEA 1EUTA 4HEPG 1LLAA 2OXGB 3HBZA 2ZOKA 4OLXL 3QEQB 5DEZA 1ET7A 5I71C 2WQSA 1UD8A 4KKAC 3KPSB 3TIDA 2BSTA 3OKLB 4WEEA 1U3HB 2ICWJ 5ITBL 4U3HA 5T3ZL 2DDQL 1HHJB 5D71L 5AEAA 4TQPA 1QQDB 2IOMA 1FLRL 5A2FA 4EF3A 1SOKA 4JDEA 2CHNA 5BW7C 1KCUH 2A99A 5DD1L 2WN2A 5TE4L 1RU9L 2OYLA 4IRZL 2A83A 4PTTB 3GSVB 2Y6TE 3C6EA 3LS5H 3C6LA 4QY8B 4CU7A 2VL5A 3OQ3B 4WI8A 1AYOA 5LCVH 3SCMD 1IJNA 5GPRA 4ZXBB 1MHHA 1KIQB 5DI8A 1N8ZB 4V33A 1G6RH 3MJGX 4NBYB 2K8MA 5FW7A 4K3DH 4Z3FA 1INEH 3RHWF 1W0VB 4QO1A 3B6SA 5CGYD 3PHOA 3QORD 1KLFB 1KC5L 2BHFA 2WBXA 4U2YA 4G8GE 5C0GA 4KJYB 4UQDA 4A2LA 3FT1A 1E4KA 2YA1A 5JO5A 5DJ0B 1JL8A 1QLFB 1RUAH 3QRLA 5HJBA 1JGEA 4NPYA 5C0AB 1OP3K 3MLPA 2KLRA 2I27N 4KNTA 1LE5B 3K5SA 3VXSD 4C58B 3JWNH 5EIIB 3SJVB 1RZJC 1TJGL 3PXLA 2EDJA 4HIIA 2A7BA 5AD0A 3QUMB 4WW1B 3ZHLA 3QPKA 5DQJA 1MVUA 3IJ8A 3VXQB 2OYKA 4XZ4A 5MP6L 3E2HB 1T3FA 3D0VA 4XP5L 3F7VB 2IALB 4D8PA 5CEXA 1DO6A 2C34A 4XH2B 1NDGB 3FOLA 3CZFB 2KPNA 3ETBJ 1CDJA 4NZDA 5AFAA 3NACH 4B7LA 5KSAD 5CD3B 5I8CB 1H3TA 4X6FA 3T8XB 4F7EA 3RWIB 4PVNA 2A74A 2R56L 2Z31B 2VDPH 4GIOA 1BVNP 1SM3L 3VGDA 5IF0B 1R3JB 3ISWA 2F53A 1NICA 1NGQH 1RH8A 4KKAD 1H5BA 2HAZA 4MJ5A 4PJDE 2XPZA 4RNRA 5IQ7H 2JNZA 1YG9A 4LGRB 4N26A 4P2OC 2QPSA 1N26A 1VFBB 3KXFE 5E5MB 1UZ6F 5GGSY 3TT1H 1S7XB 4UDUB 1F1AA 1WFOA 3TN0B 2NQ3A 2O5XH 4ZS7H 1U8QA 2WNGA 3IFOA 3CFKA 2ADFH 4PJHB 3FU7A 3HS0B 1S7QA 5BZXA 1K4CB 2VISA 1KWGA 4XBGA 2J6WA 4L1HA 3GBNL 1ZVNA 5FYJL 3GBDA 2BHYA 5LO7A 3PV6B 2IDQA 5LXGL 1ODAA 3D4ZA 4FZ8H 2HPTA 4NO0D 2VLRB 5GJSL 1AHWA 3KLDA 3U7YL 2J8HA 1VFAB 4D9QD 3UPRA 3BD5A 1SBBA 1FRGH 2WLYA 3JWDH 2VDOL 3D8MA 4UOW0 1EHAA 2DRUA 3ZRCC 4C59B 4ELMB 3WEOA 3WFDH 4JJ5A 3UEQA 3BH8A 3OB0H 4NUGL 4KUCF 15C8H 4V2BA 3A6BH 3DSFL 3CFQA 3TVMC 3HHSA 4QXWA 5DDHB 3APCA 1NCWL 1YEFH 4WFHE 4JR9L 4Z3TA 4ZAKB 4JM0A 3UP1A 2X53A 3KPOA 1DBKH 4BH7A 1A22B 3QYMA 1IE4A 4J6IA 5F9WC 5MEQB 5ICZB 1B2YA 3PP3K 3S37X 3AY2A 4WI6A 3VFPA 1QUNB 4JAMA 5EBLA 2DLIA 1EZVY 2FJFB 4JRXD 1PQZB 3T2OA 3M17A 3QHFL 4YHOL 4RGNB 3H6AA 3QXTA 1FL3A 5CEZL 1DQMH 4QGYA 3QUML 2LR4A 1W72A 5INDA 2IWEA 3L1FA 1LO5B 2R1YB 3FFCD 2J8UB 2K9UA 4TQEL 2Q2EB 3NQIA 2FQEA 3P3YA 4HJIA 3WU1A 2H41A 4RISH 3B7YA 1G7LB 4BSJA 3ZHDA 3O8XB 5F3FA 2B8OT 3RPBA 4RMVA 3ARPA 3UYRL 3L5WA 5EUOB 1MKFA 1LP9A 3T1FA 3VE0B 3NJKA 3ZDXE 5IVXF 3P9WB 3LIZA 4P2OD 3MV01 3D08A 3SPGA 2F5AH 4FI8A 3LRLA 4XNQB 1OAQH 1DQJA 1HZHH 2WSPA 3KL0A 3CVCA 4GRWE 3G5WA 4CUCA 2R0KH 4UT6A 1F11B 5DRZA 3VXOB 1YMMB 4PGBA 3IMBA 3OMNB 2V2TA 1IZJA 1GCFA 2IFGA 5AOJA 1K9TA 2VXUH 3KW7A 4ODXB 2X6AA 4RWYL 2VMJA 2CHXA 5HY9B 4XPAH 5EC2A 1X5JA 4NQTA 4QAWA 2PO6A 5EN3A 4OD3H 4DAGL 5C3LD 3A3YB 2L3BA 1A4KB 4XWOC 4AEEA 3RQ3A 4F8TA 2C3VA 5AAMA 2DYPB 2DKMA 3ZT5A 4LSVL 1ZTXL 3AY4A 3JWOC 2A6KB 1ZS2A 1L6XA 3CXFA 4MX7A 2Y7NA 3BZFB 3ULUC 3U4BL 2YK1H 5KN5B 1TVHA 3PGCB 5I15L 2GC4C 5AW0B 4WI3A 4BE5A 4ODWB 4JFED 4YAQA 1KPRA 3VMNA 1HEZB 3LSOB 4LF3A 2DJUA 4ZMTA 3LD8C 3FT3A 5T1KD 2Q76A 4JY6B 4NAJA 4U1LB 4I8DA 2NZ9C 1WHOA 3KYNA 3OGCB 4LNRB 2O5YH 1NCAH 2IDSA 2X87A 4GUPB 1YDPB 1P1ZB 4YC2C 3AMLA 2K6ZA 3ARDC 4FA8A 4QKTA 4KJPC 5LKNA 3G5XB 4H2CA 1KLGA 1PNCA 2HKFH 3I50L 2IDTA 4GRLA 4ABUA 3ZUCA 1QLEB 3CH1B 4YNYB 4KTDL 2QHRL 2H0JA 2Q7AA 3MLSL 5CN2A 3PG2A 1DSFL 3POHA 2NYYC 3FBQA 3N1QC 3ATAA 1QEWA 1IKNC 4UTBA 5ACLA 1J8HD 2WXFA 2JJTC 4PJFF 4WKZB 1Z2KA 3WJLC 1TZHA 1JPGA 1ZV9A 4UAHA 1E4WH 3S96A 3K6DA 4PI2A 4X6DA 3FFDA 1YPZE 2H1XA 5DF0A 2VSMB 5FOBA 1G9NC 1RHFA 4M1DL 4OLVL 3T6WA 4H20L 5LQBH 1G0YR 4GT7A 3ECBB 3RKPA 1KIUB 3VG9B 4KNSA 5ISZA 5I8KH 1C8PA 1FGVL 2NY5L 1WD8A 1IM3B 1AY1L 3SJVE 3FT2A 3UERA 4ATWA 4ICWA 4Z95L 3MLUH 2VNCA 3C5JA 3VXMB 1NAKH 2CUIA 4M5SA 2VXSH 1EGJA 2I24N 4OZFH 5BO1L 1B2WH 3BSZA 1TTRA 2N1TE 3SO3B 1U8IA 5I1HH 4P5KA 4K8RL 3UTZB 1S9YB 5ICYA 2NYKA 3TA3A 1CFSB 1I8MA 3LN4A 1QABA 3OKMB 3U46A 4U1IA 3Q3GB 4OD2B 5H2BA 3WIIH 4XWOD 2ARJQ 4JG1L 5DVPA 2Y0SA 3L3HB 3ARSA 4FXKB 4A7GF 3CLEL 3TO2B 5B8CC 4WSJA 4KUZH 1E4XL 2PPFA 2BS8A 2R0WL 2P42B 3FO1B 1QAWA 2PUQT 5L2KB 3TV3H 2EIZA 3F8UB 1XB6A 5D1QB 4G43B 3WD5L 3P9MB 4H7VA 5H94A 3ARGB 4K94C 4DGUA 4OSUH 3GMMB 3OLGA 1KF9B 3LN5A 5EOQH 3FRPA 3OF6D 5ERWB 2R29L 2CO3A 1RJZA 2BSEA 3ZE0E 3ME0A 4UIMB 3WNOA 1PG7H 1IC1A 3BQVA 1P7KA 1TFPA 1OGPA 4H5SB 2FR4B 2K9FB 4G6ML 5E99H 3EFFA 5L88L 2G2NA 2CDGB 3ARDD 3P0YL 1IB5A 4PJHE 4L0YA 4ZPTA 1QSVA 1XX9C 4LLDA 3WENA 5F7MC 2ADIB 3V0HA 5F44A 3O2VH 2CGYA 3ZMRA 3OBAA 4OU3A 4PRIB 4EZLA 2K6WA 2C7UB 3DMMA 4MZ2A 2D2CC 4R7LA 2Y07H 4XP4H 1U95B 4FFYH 4OCRH 5ADPH 1JZIA 2FIKB 3OG4B 4WO4C 3QDHA 4OI9A 2MCG1 5CBAA 1MRFL 1HYRC 1I8IA 3DGGA 1ACYH 2JKNA 3H4HA 3I3EA 4PVMA 4ZMZA 4EIUA 5H4ZA 3SGEI 1HOEA 2ZKMX 4HUMB 4LSQL 4QJ3B 5I17B 1G6RA 3PP4L 4F33B 1CGTA 4AGPA 1FFPA 3ZGHA 4XAWH 3VRIB 2KLTA 4AKOA 1UKTA 3TTSA 2I60H 2CO7A 5MENA 4WJ5B 3VFSA 4U1HB 3UJTL 1A7NL 1RULH 2P8LA 3DX3A 4ZK8A 3C5ZA 4DZBB 1HHKB 3WFHA 4YDKH 3WUZA 4LLUA 5FLVA 3QIUC 3NJXA 5SWQA 1A4JB 1HH9B 5D5MF 4E41E 4P4KC 3GSRB 2GEEA 4B6ZA 4YSEA 1AR2A 2L7QA 1VACA 2H3NB 1Y07A 2BY0A 1KOAA 3FU0A 3HFFA 1AO7B 4BSWB 1PW3A 3RGVA 1XDTT 4WFFE 3VFMA 1XAUA 4PJEF 4FOMA 3QRFM 4RGNE 4L4VE 2JH2A 3QS3A 5CINL 1T20B 1U8MA 3BPCA 3PNRB 5JYMA 2O4EA 3GI8H 4OFIA 3I2CH 3T0EE 1UYWH 3QISA 1AMXA 3D85D 3PAZA 1CR9L 3B2XA 4DCQB 5BMFL 4LESA 3GZQA 5KEZA 2LABA 3FUJA 3L9RB 1ET8A 4LPWA 4G8GD 4AM0Q 1K8IA 3BKCL 5SWZB 4RZCA 3CSGA 3NOIA 5GS1C 5EU7E 2F19H 1JXFA 4L1DA 1DSWA 5ENWB 1KGCE 4YX2H 4M4RA 4ZDHB 2FBJH 1IV8A 3DETC 1QNIA 3HPJA 4TOYH 3U0PA 4PJIB 4P2QB 1KCRL 2UVEA 1JWMA 3HNSL 4K73A 1VZHA 1RMFL 2WB1A 3STBA 4AV5A 4N2LA 1U8OB 3DO4A 3OVUB 3PQYD 1HQ4A 1Q9KA 5DSCA 2DJSA 1D5RA 2QVFB 2DLEA 2HG5A 4J5VA 1H6UA 2CR6A 3PLYA 4NPKA 4KX8A 4YQXH 2B15A 3D25B 4ZUWA 5EN2B 1K4DA 5CMAA 3FSOA 3MJ6A 4AQ8C 3VACA 3BGMA 5MEPB 1G9HA 3LXCA 4O9HL 2PWGA 3N1GC 3DV6A 4ODBD 5CIPB 4HKZB 1BQHA 4NQEA 1R33A 1S8DA 3SKOA 5HHNA 4CILA 3HG1B 5A2CA 4WO4D 2GFBA 2XDHA 12E8L 4JFQA 3W3BA 5J6HA 5ELIA 3VI3B 4Y5YB 1IUZA 1BYNA 1LDPH 2OMTB 5CJQL 1FBIL 1DVFA 3AS2A 5HHOA 4TL5A 1EIBA 1SOQA 3UAAA 4LSUL 5CD5C 1ONQA 1KXQA 1E7UA 1MLBB 3KXFD 5AVSB 5KYYB 4FAAB 3QYCA 3VFVB 3CXDL 3K6SB 2X1OA 2VN6A 1YNTF 3TH2T 2XIIA 3HI5L 3FTUA 3I6KA 3JQOB 4FQXA 3QAQA 3N06B 1IVLA 3QIUD 1ZV5A 1BGXL 1WIOA 4P4KD 4F7KA 4HOWA 4D8OA 1Z5LA 1G7MB 3BESR 1T7ZA 4MZ3A 1CFQA 1XFPA 4LLYB 2A6IB 5K59F 4NAMA 1F3JB 3G5VB 3NIGF 3CV5A 5HHPA 3W9DA 1NCBL 1IFRA 3IVKB 3QPXL 2JXMB 1G7PA 5T5FL 3SKMB 1Z5YD 3FB5B 3NAAH 5DS8A 2VW7A 3RKDC 1P0SE 1MFDL 2AERT 4ZFFB 3ZZ1A 4BGLA 2A4ZA 1A47A 4XNAA 5IW1B 2CK0L 4WENB 5DJZB 2AJ3B 2XWJB 4UT9L 4AJWA 3L5IA 1QSEA 5HI4C 3W5MA 4WFHD 3WKNA 3FQWB 1FYHB 3AG2B 1ZEAH 2WLKA 2KS0A 4KNUA 5BV7L 1CTNA 1KJ3H 3DETD 4R4ND 5FK9B 2ZIDA 4JRWA 3I75A 2GJ6E 4LSTH 1TTAA 1RIVL 1ROWA 2I5YH 3UBXG 5JA9A 3Q8FA 2DIAA 1W16A 4E36A 3DX4A 4PGDA 3MJ8B 1BZOA 4WI0A 5F1IB 3WG7B 4KQ4L 1AKJD 2ZXCA 3VXME 1NAML 1SFDA 1NFDE 2VZ1A 3IPEA 1WBXA 2YSSB 3IGAA 4XC1H 3S5ZA 1TKWB 4FKKA 3X14A 3RWDB 2NZ1A 4K9EH 2CUHA 4DN4L 4R0LC 3OAUL 3V4PB 1P84J 1D5BA 4H0LC 1DVYA 4M61A 1UQSA 3X3FL 3ZDYB 3DUSB 3ET9F 1BPLB 3L48A 1OSYA 1WISA 2G5BA 3O3AA 4JPWL 4JZOA 1MY7A 3DTXA 3REWB 2BSRB 3LCYA 1AZBA 1NBYA 2X1XR 4QOKB 2ZXGA 2Z1KA 1GSKA 2EKSA 5C9KA 3MTXA 3O6LL 3H42H 5L2KE 4HIHB 4LVOB 5D1QE 4J3WA 1CJYA 1TQSA 5JA8B 2UZIH 1O7DE 2W0FA 4RESB 5CD5D 3GD1C 2JKTM 1VGEH 3JTTB 4KFZC 2EICA 4NQCE 3CMGA 2YKLL 2JIXA 1I3RA 2V2XB 1BP3B 2VZTA 4I1NB 4PTUA 3SDDC 3U0WL 3US9A 5IMKA 1YEEL 3PWPA 2Z91B 3E2HC 1KENH 5DHDA 5TQ0H 5J11C 2DWSA 3LQAL 3EXJA 1UB5A 1BAGA 3DVIA 4YVUA 3IGUA 5IUSA 4G82A 2AS5M 4PJ5A 2PWDA 1R3LA 1VIWA 1MPAL 4LVHC 1KNOA 3VRLE 4NRZB 4XBEL 1DFXA 1M6UA 3ESMA 4G1MA 4WY7H 5FS5A 4OY9A 4OFKA 3WFEH 3NCCB 2VB5A 2VN7A 3R8BB 4HUUA 3RKDD 5LGKA 2BINA 2HCZX 4Y9BA 3KPTA 4Q6IA 1MH5B 4ZUSB 4LASL 3PWUA 3GJEA 3RB7A 3VYNA 5I18H 4HKJA 1RPKA 2F7PA 3MACL 4U1NB 5HI4D 1MIEH 3MLZH 5JW5B 3PAVA 5TFSL 1GYCA 2HX7A 1JRHI 4L3EB 5FHBL 5BRZD 5I8EA 4R7DB 5IJCC 2W9LA 2J4WL 4XOBA 2J72A 1T5XB 4LGPB 4NXSA 2FK9A 3S6CA 1FH5H 4IRSC 5LVEA 2CGRL 1LO0L 3I6SA 3MYJA 4HU2A 4OGYL 2DQTL 1NPUA 4PH8A 3ZK0A 4DVBA 4DEPC 2M1KA 4BRJA 3UTTE 1LP9F 2R2BA 5GRWA 2BP0A 4QLWA 4D9RE 4PJ6A 2R59A 4G5ZL 2XCMC 2MMXA 2ZKWA 2Z34A 1HEJC 4KGLA 1EJ8A 4JANA 1WZMA 2VKXA 2F54D 5IWLA 1ZIBA 4OZFA 4FYTA 3DROB 5GRZA 4FMKA 4PUBH 4XXCA 1D7BA 5DUML 5JXAL 4N5EC 2Y6SC 3D09A 3CFNA 4O00A 1WCQA 1XXFC 4NRXB 5CJOL 5LGHH 5IW6B 3QNZB 5GGRA 1AS6A 2XV3A 5T1JA 4NIKB 2FJUB 3N41B 4APQB 4Y89A 2HJLB 7FABL 3LDBB 4NJ9L 1LK3H 2X4UA 4FQHB 4ZBJA