1F1AA

Crystal structure of yeast h48q cuznsod fals mutant analog
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
153
structure length
153
Chain Sequence
VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIQEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structure-based mechanism for copper-zinc superoxide dismutase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords COPPER-ZINC SUPEROXIDE DISMUTASE
total genus 38
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1f1aA00
2E46A 1SPDA 3RE0A 3GZOA 2C9SA 1JK9B 1F1GA 4MCMA 3L9YA 4A7VA 2Z7UA 1ESOA 3SODB 2WYZA 1N19A 1CBJA 2XJLA 1UXLA 3QQDA 1SXAA 2GBVA 1DO5A 2WZ0A 1E9QB 1PU0A 4A7UA 1BA9A 4FF9A 3KH4A 3L9EA 1OZUA 1OAJA 2Q2LA 2AQQA 1OEZW 2LU5A 1PTZA 1U3NA 3F7LA 3LTVA 1SXBA 4BCYA 4A7SA 2NNXA 4N3UA 1N18A 2ZOWA 1TO5A 2Z7WA 1SDYA 1BZOA 3MKGA 2ZKWA 1E9PA 2WYTA 4MCNA 1Q0EA 2JCWA 1E9PB 3K91A 3ECVA 4BD4A 2GBTA 1IBHA 1OZTG 2AQPA 1EQWA 1Z9NA 1SXCA 1DSWA 1RK7A 2WWOA 3KBEA 3H2PA 3KH3A 1SDAB 1L3NA 3HW7A 3HFFA 1S4IA 3QQDB 1IBBA 1OALA 1SOSA 1F18A 2XJKA 4B3EA 1SXZA 1FUNA 1IBDA 1EJ8A 4OJAA 2VR7A 1JCVA 2JLPA 4A7GA 2C9VA 5KBMA 2WZ6A 2VR8A 3GTTA 1SRDA 2WWNA 2WKOF 2K4WA 1AZVA 1HL5A 1Z9PA 3CQPA 1F1AA 1XTMA 1F1DA 2GBUA 1B4LA 2AQSA 4U4IA 3S0PA 3CQQA 1YAZA 4OH2A 5KBLA 1QUPA 1B4TA 1IBFA 3HOGA 4L05A 1KMGA 3ECUA 4A7QA 1MFMA 2APSA 3PU7A 3ECWA 2ZKYA 2V0AA 1E9OA 4BCZA 1UXMA 3KM1A 1E9OB 1YAIA 3MNDA 1IB5A 1CB4A 1PZSA 1SXSA 1P1VA 2AF2A 1COBA 3GTVA 1XSOA 2ZKXA 2VR6A 2SODB 3H2QA 1XTLA 5KBKA 2R27A 1E9QA 1YSOA 2E47A 2C9UA 4A7TA 2Z7YA 4N3TA 2AQRA 1SXNA 2AQNA 1JK9A 3GZPA 3CE1A 3F7KA 2AEOA 2AQTA 3T5WA 1HL4A 3GZQA 2WKOA 1TO4A 3GQFA 4A7GF 3KBFA 5CU9A 2WZ5A 3KM2A 2Z7ZA
chains in the Genus database with same CATH superfamily
1RZ7H 3TBSA 3X1NA 4BCXA 3LY6A 4FZ8H 4D94A 4UQ3B 2AV1B 5FYLH 1TVHA 5F7WC 4O2CA 5JW5A 1CUOA 1WWAX 3K72A 4MD5A 4PUBH 4G7VL 4XWOD 1VA9A 3Q1SH 4OCWH 5FHAL 3RTLA 4NFBA 1T1XA 1BZ7A 3GO1H 1S8DA 3HUJF 4Y88A 1XMWA 2A77H 4XMWA 3S34H 1JNJA 3QDMD 4H26B 1WICA 1A21A 4G6KL 4MAYA 5CGBA 4NZRL 4N0FB 1Q9OA 3P77B 3BJLA 1T7YA 4I9WD 3MRPB 4DP9X 3F85A 4JKWA 4PRPB 4X6FA 2AQ3A 4WEBL 4P2YA 4FLHA 4BH8B 4FFVD 2LW3A 3QK0A 2YQ3A 1DHKA 1BZOA 3SQBB 3UPCA 3GKWL 4ERSL 5HPMB 5I1AA 3S97C 4AEFA 4X5RA 1QHOA 1MCRA 3HJEA 1WGVA 3WNOA 1PLBA 5JZ7D 2ARWA 4PTTA 2NUPA 5EU7C 3SKOA 1XAKA 4YQXH 4JS7A 4MHHG 4HIHB 5BPPA 3KLHC 4W6WB 3APMA 1U8OA 1CDJA 3A21A 4JGJA 4IDJH 3QDJD 3REWA 3KEDA 3VFGL 4J3SA 4HJJL 1DJSA 1UOWA 2JVUA 2ICEA 2LE9A 1IBGL 5DMJB 3QARA 5FLUA 3KVDD 2IWFA 3VG0H 2BXYA 4NUPA 2CG9X 5DZOA 1A6WH 3IK2A 4WWKA 1RUPH 2PW1A 1A6ZB 3UPRB 4WF7A 1HHJB 1T0MA 1F6AA 3SY0B 1JRHL 4QRPE 3N40P 3AG1B 1A8JH 2KBGA 2YD4A 3U9PH 1KENH 4ZAKA 2AJXL 3SE3A 2DKSA 1QLRB 5E56A 5C0GA 4FYTA 2WXKA 2TRHA 2P8MA 3JWDH 3MPCA 3STZA 1JD9A 2H6OA 4KRPD 5EC2B 4AVIA 5SWQB 1FAKT 1FH2A 5HHME 1C1EL 4QXGH 1XH0A 3GTVA 1HINH 3JWNG 4GRWE 2X28A 3U6XS 1NUFA 4PJEF 3KLDA 4R4NC 2YN5A 5G2NA 3AUVA 2FIRT 4KUCF 4Z3TA 5IM7B 1E5ZA 1G7JB 5C0IB 2W0LA 4NN5C 3PRZA 4DP7X 1CGSH 4WI3A 1U93A 4A66A 4TF4A 3KDMA 4X0KA 1UCBH 4BWUA 4X7FC 1YEGL 1X5MA 1U58A 3K2KA 1HL8A 4FAAB 1FORL 3D08A 4S1RH 5ILTH 3ULUF 4BFEA 4K3EH 4ZO8A 3QEUB 4X5WB 2WP3T 3SGJA 3B7RL 4OZGB 4A6YA 2CGYA 2VUOA 1TQWA 3US0A 4KKQA 4K5NA 5F7DA 3TPUA 3APDA 3ARQA 1CTOA 4R8WH 4DPAX 2DWTA 3UGUA 3L3JA 3LXUX 3QJZA 1KB9K 4P5MB 4PREA 1DVYA 2OW7A 3QUXC 4HH8A 4KJQD 1ZIAA 4MJIB 4M7LT 2VLRB 1OE3A 1RZKL 1T0PB 1KCSL 2CUIA 2BJMH 4U1HA 3KPSE 5AOKA 3O3BB 1XZ0B 1QD0A 3QHFH 4QXUH 4RX4A 2Z31D 5A3IC 5KVEL 5F8RC 2KZBA 4UM9D 2YWYA 4N2BA 5C0AA 4NUGL 5DJDA 4KXZH 2NT1A 4XPAL 1OB1A 1HCZA 5F3BB 2D3VA 1UD3A 2HWZL 4Y5VC 3REWB 1DDHB 4PGDB 1UUSA 1NCGA 4GSDH 2Y2WA 3N2JA 5JW4M 2B4CC 2HT2D 4JVUA 2QADD 4YX2H 3BXNB 3GBML 2CRMA 4IGBA 3VFTB 2FATL 1S5IL 2G5UA 5AW8B 2B1AH 1R3KA 4OJEH 5MEND 3K71B 5E2UH 2MMXA 3ET9F 5ESVA 5EBGA 4NUMA 3RBSA 1FAIL 3L3KA 5IQMA 2E74C 3IRCA 4N22A 3CDYA 4LHJB 4PGCA 2VYRE 4ADJA 4JO3H 2KERA 5LGJB 1DVSA 3V4PA 4NLHA 2P5WA 2HKFH 3CVDA 3VCLA 4WW2C 4NO3A 4ZX3A 1WRFA 2X2HA 3Q2NA 4NRYA 4U3XA 3UZVB 5C6PB 1FFQA 2WGNB 4NO0B 2DQJL 2NY1D 1H9VA 2IWGA 4I2XB 1B4JL 2BERA 2WNXA 5JQ6L 5LBVA 4FNLH 3R7QA 4S2SA 4AYMC 2QV2A 3ZGHA 5CZKA 2JFCA 4MD5B 3ARTA 1FZMB 1PZSA 1RZKH 1HWHB 2ICES 2YGVA 2OSLA 2YUZA 4NQSB 3I6KA 1BLNA 4TVPD 4YHZL 2QBWA 5IVZA 3BIKB 5K5YA 1NEZG 3BGAA 3T0EC 1XF3A 1DSFL 3OAYK 4C56D 3QR2A 1OGAE 1I9IH 2AQTA 1N9PA 4A7GF 3CFEB 3D2UA 4PRIE 3MOQA 3CCHA 2KC0A 2L04A 2NY5C 3ZR5A 4F5CA 4NUQA 4WW1B 2ZOTA 2PTVA 4X5WA 3TCXA 7FABH 3K6FA 4G6FD 3DOIA 3WEOA 1TTCA 5HHMD 4UTAA 5C0AE 3U7WH 1MZYA 1SLWA 4WWOA 1F1GA 4HKBB 3MREB 2VLJD 2W9DL 4HCIA 2CO6B 2Z7UA 4PJGB 4O02B 4YDIL 1HDMA 2GK0B 4K23L 5BV7B 5GS0L 5E5MA 4BZ2H 2WXPA 3V0HA 4YFEA 4LGRB 4LSVH 1DLFL 3LH2L 3UG3A 2EIJB 3BT2L 4MJ6B 4UIKH 2VT0A 3MLXH 3FH7A 4P23A 1G84A 1QUNA 5BZWB 2P46B 5KVFH 4E0RB 5GS2D 4XC1H 3HZYA 4QHMA 4DUVA 2CH8A 3FB6B 3F7RA 2YPLE 3ISRA 3MBED 3K0YA 2CXKA 3HG0A 3TU6A 2ICEC 1TQVA 3P3RA 3C5SB 4G43A 5CZXD 4PJGF 1OAZH 3D4ZA 3V4VA 2B15A 4WHYH 4OKVA 4WRLA 5BJTB 5DZNA 4MB1A 1QSEB 3DX9A 4ZFGL 5DD3L 1GY2A 3RZCB 1L3NA 5JOFB 4QOKB 2C7UB 4MS8D 2Q6WB 1WCQA 5D2NA 1JF5A 1N4XH 1NUDA 5JMRA 1KXVC 1INEL 2E6JA 2B0SH 1WISA 4B3EA 4B9YA 1NL0L 2VABA 2ZOKA 4I0PC 3RVWD 3BRFA 2V9RA 4UDUB 4BK8A 3KHOA 4ZODA 1TQTA 1ML0A 2J8UA 2MQGA 2CR0A 4RMTA 4EDWL 2OMXA 4LRNH 4KMTL 3K74B 1QRND 1YY8A 3BGMA 4GQ9H 3CX5J 3KCPB 4LBEB 5FM5O 1SVZA 4KDWA 2APWA 3BO8B 2J8UE 3DRTB 1N5YH 3AQDA 4AK2A 4FQCH 3MX0B 5PAZA 1QFWM 2DDQL 3GWJA 3QCVH 4PTTB 1N6QH 4YXHL 1HOCB 4P5RA 1TJXA 2XN1A 2B9BA 3I75B 5D70H 1DVQA 5C0GB 2AAVA 1GR7A 3UTTB 1TYJA 4G8GB 1H0DA 5EUOE 2AP2A 1Z9MA 1G6RB 5E5RB 1G7QB 1VESA 3P4MA 3MNMA 4LQFH 4PVLA 1Y6NR 4RRPA 1JBJA 1UOLA 2JELL 4YWGH 2WO4A 4X6BB 4YHPA 1ASOA 2JB6A 4JFOA 3LXCA 3D52A 4FQIH 4WV1C 2H5UA 4OQTH 4NOBA 3TFKD 4KO6A 4U1JA 3JWNC 1GL4B 1CIUA 2M8XA 2Z1KA 1UA6H 2D7QA 5TFSH 4P59H 1J5CA 4Y9EA 5DEGB 2A6DB 2ZUXA 3GLZA 5CD3A 1AP2B 3FO2B 2Y7MA 3VXSB 4QOKA 4E9VA 5FDWB 1CBJA 1I75A 2B5IB 2J8UF 2AANA 2XTJD 3DSFL 3QDGB 3QXAA 3B4NA 4WEEA 3MV9D 4AZ8B 3W9EB 3GXIA 1H0DB 1ZK9A 3QNYB 3H7BB 1KG0B 4N25A 2FD6L 4I3RH 3C5SA 3Q8AA 3FULA 2BS9A 3WFBL 3QFJB 3WDJA 4M7JH 3C6LA 5KYNA 1GPOH 2WUBL 1RUAH 3S35L 5GGQH 4GS7C 3U2JA 3V9CA 2P8LB 4IRSD 1YMME 3WBDA 4IM8A 1GC1C 2G5BB 1R5IA 4LP4A 4QOKD 3VI4F 3WN6A 4PJHB 3O8XB 1SXCA 3QXDA 2F54B 4PU2A 5DK2A 3T0ED 1BZEA 4EI5C 4F1ZA 3K72B 3JWOH 3MRCA 4N0UE 1XB3A 3T6WA 2BP8B 2F9BT 5ALCH 1KN4H 2EIZA 1PG7W 5ERWB 2HJFB 5HGGS 2JWYA 4U1NA 4EI6A 3Q06A 2J20A 4HWNA 1IC4H 2Y3NA 1WFNA 4PG9B 3HNVL 3FUEA 4HIJB 1FYTB 4XX1G 4BYHA 4E5XG 5GZOD 2TAAA 2DIBA 4NQSA 1YQ2A 2FYYA 2W88A 5A43C 2ATKB 5FO9B 1R0AH 1LWHA 2ZJSL 5JNYB 1A7PH 1H8SA 3UDWA 3T2NH 2EE6A 2F7OA 5GQBA 3HI5L 3ZHKA 3AQYA 3PQYD 3SDAB 2VMCA 4QRTB 5FYLE 3PF2A 1MJ8H 3QZNA 3A67H 1E4KA 5ETUA 3ZO0A 2NZ1A 4K0OA 2APFA 4IRJC 3MUJA 1JPGB 1UASA 5ICYA 1FYTE 2FDBP 4HWZB 3NVQA 4EIBA 1CB4A 1XH3A 1NDMB 5GS1C 3QWOA 2KPNA 1CFSB 2ZKXA 4MQXC 1X5KA 3VGBA 3X3FH 1FNGA 5HYQA 1IE5A 4KK5D 5HDRA 5IBLD 1ZSDA 5EO0B 1S7VA 1LEGA 4JKLA 4DP5X 1E0OB 5J8OA 5D71L 2F8OA 3CCHB 4W6XB 4GMSH 3W0WA 4L1HA 2EH8H 2JJSA 4JDVB 2MNWA 3RWCA 4P23C 4BWWA 4U1JB 3U7YL 3RI5K 3VXSA 1QTSA 3QQ9C 5HHOB 1U3HC 3WJLC 1C8QA 3RVUD 2OKMA 1G6RL 1VFAB 2A0LC 4EDWH 1UD6A 2X38A 7TAAA 1RUML 4B96A 3M6DA 2QMJA 4O00A 3GNML 4IMKC 4ZRGA 1F41A 2CKBL 5C0FB 2NLJB 4LKCB 1A7PL 2CD0A 4JFOB 4U1IB 2X3CA 2R83A 4L5FL 2WBJB 3RWEA 3BH8B 1KB3A 5FOJA 3ZK0A 5SX4I 4MMZA 4EJ1C 1XB8A 1LP9F 5E9DE 2P5WB 5LN4A 3LHAA 1Q0EA 1UOVA 1ZT7B 3WNNA 4NKQB 3RA7H 1OY3B 4I3GA 2F15A 1BREA 2CKNA 5IMOA 4LEOA 3T0EE 4DEPB 1BX2B 3EBHA 1T4WA 2OMVB 3EZ8A 3G5WA 5GIRA 3H2PA 3UCRA 5C08A 1J1OH 2QLVB 4WWKC 5B1BB 2WWMD 2Y7LA 1EFQA 1VFOA 3NFPA 4M1CC 3OMAB 5E99H 1BZ9A 2ZOKB 3WIAA 4HIPA 1S7TB 4Z5RB 3C5JB 1JWSB 2PCPA 4E5XB 4BZYA 2OMXB 4YHLL 2EDOA 3CFIC 2CLZB 1WFIA 4ZD3L 5FAAA 1RUAL 1BVOA 2NNAB 3GUFA 2J12B 4RBPK 3ESOA 5H94A 3HAEA 2EDEA 5I24A 3BYYA 3VVVA 1EO8L 2HTLC 4OKVB 5B3JF 4AW4A 1RFDH 2ZCKH 4ODUA 4XP9L 5IJBC 2DQEL 5KYXB 1WAPA 5EBLA 1UWGH 2GJ6D 4HFWB 4YSQA 3QJRB 3WFCL 2ZICA 3HS9A 1OAQL 1E2VA 1TJIL 3STZB 4YBHA 5F7NC 4WKZA 3IFNH 3V5KA 5K9JH 2FLRT 1X5AA 2X87A 1H5BB 2ZYRA 1B90A 1HS6A 1MFEH 1V7NL 1AO7A 1KN2L 1XGPB 1YEFL 4IOSD 4U3SA 5JW3H 1F6AB 2QHRH 3N9GL 4WUKL 3SE3C 3VXSD 3VDCA 4BXSV 1HYSD 1G0YR 3BEVB 1LO4L 1YEEL 2ED6A 3MREA 4MQXD 2H8PB 5IJVA 4ZUUB 1JTPA 2F2HA 5EZIH 1YEJH 2Q7NA 3DC0A 2NXYB 4LHUG 4X98B 5GS2H 4M5YL 1KCRH 3C6EA 4KU1A 3U25A 3SDXB 2G30A 3A0OA 1ZCRA 5CJXA 4AQOA 4PJIA 2CGZA 3IDXH 3U9UB 4KKNA 2WYZA 1LVEA 4YDJB 1I9RH 2B39A 3BFQG 3CC5B 2HFFA 2QV4A 4LCCB 1B0GB 2GJJA 4PTUA 1JNLH 3GSXA 5DA0B 5E94A 3FUHA 4GAAA 3RGBA 5C0CA 4C8XA 4NZTL 4BBWA 1KTKE 1ZY9A 3R4DA 4WY7L 1QW9A 3IS1X 3SQBA 3IJYB 3SDCA 4Z1PA 5I1AB 2EVJA 2IVFC 1KYUA 5ESQB 2UXTA 2PXYC 1TQSA 4ZK8A 1HFUA 2HN7A 1JZ3A 1PG7H 5C9JA 2F53D 2FL5A 3MLYL 5CR1A 2YRZA 3TZVA 1Q9OB 4JZNA 4S0HA 5EU7E 5GZOA 1RZQA 4L8SB 5AB9A 2ESVA 3NJXA 3VFVA 2EDDA 3AG4B 3CJJA 3RWGB 1YNTB 4Y19D 5JHDA 4PB9L 3NJFA 2WJ5A 5F97E 1XCXA 1HX0A 4QI3A 5E08H 2XWRA 3EYQD 4L29B 2QKIA 1CMOA 1MXDA 5D5MA 3CVHL 5ADOL 1QMUA 5TDOA 3VXUA 5C0RH 2IMMA 4O02H 4APXA 3SE8H 4JPVH 2QKSA 3ZT6A 4PJBB 2GUYA 4U6VL 5SX4H 3PYCA 1GCFA 1RJYB 2XUWA 1HIMH 3CFKB 4H7VA 1ANUA 1TCRB 5FGSA 4ZBJA 5C6TH 5FXCH 3P0VL 5LAXB 3X14B 4Y9BA 3BIAX 5IJKC 1NFDF 2ZKYA 5I1IL 1L0XA 1U8NA 3CVHH 3BT0A 43C9A 2NQ3A 5E00A 2E7LC 1I31A 3WE6A 3P4NA 2HX9A 2WGXA 4GAYA 1H5BA 3RWDB 3X2QB 3SD2A 4KV5F 5T3XL 2XWDA 4H20H 2IO5A 5CO1A 1F6LL 4UNIA 3F7PC 3FU5A 3K5SA 5DTFB 2F08A 5C0BB 2Q3ZA 1K4CA 5DU7A 3UO8B 2GJ6A 4QXVA 1NFKA 4W93A 2IPUG 3MGTA 4KXDA 3CH8A 5KBNC 1HH6A 2AMGA 4DHLA 2Y7NA 5ISZE 1JP5A 3P4LA 5CP3H 2A6IB 2XRAL 2YGOA 2VNCA 2VDQH 3C87A 1FZJA 3NJNA 1B0WA 4WV1A 1WIOA 5ADPL 3U6RB 1XGYL 2EDLA 3MODH 3ESPA 1UENA 4G9DA 2WINB 3QXWA 3DBSA 1I7RB 2E27H 4OFIA 4PJGA 3MROA 2FNBA 4GEJA 5E2VH 1AJ7H 1TLMA 3TWCL 2HVBA 3NQKA 1QBMH 3BD3A 2DEWX 4U6VH 1CG9B 5KUKA 1VFBB 1SOKA 4JFFA 4NNYB 3TO2A 1JNHA 1DBJH 4PS4H 4DCQA 1IAIM 1QLEB 3GK8L 5AZUA 2E7LA 4R7NB 1UM5H 1OCRB 2NY3B 1TO5A 2ZAHA 5J11C 2N56A 2EJ1A 4JY4A 1QATA 3G6JB 4GKSA 5HGAB 5EZIL 4HU8A 5JLZB 1NAMA 3TJHC 3G6AA 1IILE 2ESVB 1UTDA 2NY3D 3QJFB 1DVFD 4MS8C 4X6DA 3FAXA 1C5DA 4OCNC 1NBYB 3K2IA 5I8KH 2VXUH 5JHDB 1QHQA 2C3GA 4JO1L 1IM9D 1NGYB 1PL3A 4MNQD 3SE9L 5EEVA 3R0NA 1E7UA 3K5RA 3EJYD 3MYJA 5DJ8A 1FVEB 2BX5A 2G0LA 1R34A 5FV1L 1G9EA 1F18A 3DX0A 2H41A 2JXMA 2R0WL 3NA9H 3SY0A 4F3FA 1ETA1 4LIQH 2NSMA 2VLMD 4N0YH 1XEUA 2VDPL 4KQ4H 4XMLL 3TZVD 3B2PA 4APXB 1OTTD 3GO1L 4FQXB 3CZGA 5GGVY 4JFQB 4GUOA 3PP3K 4R84A 3WHXB 2WANA 2B7DT 2A9DA 4NXKA 1OSPH 4MFHA 2EUVA 3V5HB 1RIUH 5L7XL 1E2WA 4FFZL 1TFPA 1R9FA 3MR9B 4NPYB 3F6LA 3IXTB 1CD1A 4UM9B 5JXAH 4XP6L 2QQLH 2Z31B 3SDAD 2EE3A 4WNSA 3T2QA 5EUOA 1QFWI 3ECUA 3MC0A 2DWEB 1E4JA 2VLRD 3EBIA 3QNXA 4OB5H 4X80L 1KZQA 3UC0H 1JWMB 4AXWA 2DKUA 2ZG2A 1EZSA 2OV0A 2F68X 4RMQA 3IWVA 5E6IA 2N1KA 3GSUB 3MRHB 4GQQA 4N2IA 4A6YH 3LVEA 1B9ZA 2VN4A 3N42B 2RTTA 2V7NA 3GC3A 3KWUA 1A3LL 1E50A 1NSNL 3QIWA 3R06A 4WFHE 3LKNB 1F4YL 5C0RL 4RAVA 5I1HL 4U1HB 3E2HC 5HHOE 4E9RA 4LEXL 2BHFA 4BELD 1CFBA 1NPUA 5BMFL 3FUMA 4J6IA 5FEBA 3WNLA 5KTEL 5EB9A 2RAMA 1MW0A 2P42B 4IBQA 4P3CH 4NNPL 3L3GA 1NAKH 3OKLB 3LQZB 4L3CA 4E9TA 3S9DB 2EH7H 4Z8FL 4DGUA 2BIPA 4UQ3A 4KDTA 2B2XL 3O2DL 5JQHC 3N42F 1U3HA 1JZHA 1KJ2A 1XXDC 4XP9H 4HBCH 3VB9A 4ONGL 2QSTA 3JT2A 4HUWA 4LHUA 3V0VB 1ZVSB 4JLRA 1KB5H 2NY6C 2EXTA 5IJVB 1I8KB 4AENB 3KL5A 3HPJB 3JYCA 3O4OC 1E8XA 2H7WA 1GZPB 1I1YB 1YNKL 3O8XA 3P0VH 2EEAA 4NM4H 5IM7A 2C3WA 4N2CA 4RETB 2OXHB 1FZJB 3MJ9A 4IMLA 1P7QD 4LAQH 5BRZB 5IHUL 1OCWL 5IF0B 1OGSA 3I3BA 2YPLD 1TSRA 3VXOB 1EJOL 2A9NH 4Y4KC 4BQBA 2GBTA 5GGTH 5HYJA 1MJUL 3X12B 5C92A 2ZOLB 3MJ8A 4NS0A 1OXYA 3CVHB 1R0AL 2P8MB 1AE6H 2XZQH 3COOA 4L9LA 5K9JL 1L7IH 1JWUA 2FEEI 3D0VB 4OF5A 1N5AA 3E6FA 4FCAA 4I7ZC 4PJ8D 4S1QH 1JPTH 3DX7B 1N8OE 2YC1B 3GMOA 4J6RL 1ZHNB 2CA3A 3N9GH 4WUKH 3ME0A 3T77A 3U7AA 3VRLE 4TVPL 1JMXA 4R90H 3RWEB 4IOSA 4WKXA 5JYMA 1WTGT 1T1WB 5AFAA 1QHPA 5HYIA 5IHHA 3KYAA 1A65A 3K0WA 1ZV2A 4L4TD 4RGMB 5HGDA 5GS1A 4PHXA 2VO5A 5B38A 1SJXA 3BAWA 1RUMH 4ZPVB 5D1QD 3MA9L 2OX5B 4RAUA 4PJDB 2W59A 1QSFA 4ACTA 2Y0SA 4R26L 5LDSA 5J13B 4DERA 1MRCH 3O2WH 1XGQA 2V8LA 5F9OH 5IT2H 1LK2A 2O72A 3VE0A 3S36L 1XQ4A 2HRHA 3B2UD 1XMEB 3EH1A 4RDBA 3MLVH 3VGEA 4NBXB 1N68A 1JNLL 5BVJA 2FB4L 4ZX6A 5CLYA 5B39B 2UZIL 4MBOA 5TPWH 3QDMB 3BZ5A 3O9WB 1AIZA 3QDGE 3CAFA 4QR7A 1BF2A 1UYWL 3VXNA 2JNZA 4XP5H 4K7FB 3MUHL 1MQKL 3D4YA 4N86A 3VA2C 1L0YA 2NQCA 2OI9C 3KWWA 4HJGB 1EEQA 4LVEA 2GTQA 3DURA 4AMKH 2YSSB 3DECA 2H3NB 3HZVA 3MTRA 1IQWH 2CJTA 1S9XA 4RH4A 4EMZA 2XN9B 4AK1A 4KH2A 1PLCA 3B56A 1FL5A 2WTRB 3G08A 1JPGA 1VHPA 2KDGA 2V2WB 4H8WH 4PJFB 3V10A 4PJDA 1JK9B 2ED8A 5D5MF 1RJCA 1T4KA 1Z3GL 1VGKA 3MBXL 4XZUA 5DGRA 4WO4D 4XB3A 5JW3L 4BSWB 1EH9A 1TMQA 1MVFA 1T6BX 4Y4KB 1TEGA 1X9RA 4P3WA 4P9HL 5E6ID 4JKPL 1OAXH 2YPLA 3HNTL 3ZYZA 4P2QE 4KZEH 3EGDB 2CRIA 2MJWA 3KBPA 4G9FE 5DZVA 2VR5A 4GI6A 4JO8A 4DP4X 1B6DA 1D5XA 1I7ZA 3FT2A 2GQHA 4YIQA 1GS8A 3PV6B 1FNEB 3VGGA 2VMEA 1A02N 2NZ9C 3Q0HA 3VSTA 2OZ4L 2WVUA 4HAFA 3DYMA 4X6CF 3V52L 2AJZB 4JFZL 3L4VA 3GJFH 1J11A 1DVZA 1PZUB 3CVHA 1T1ZA 4HZAA 5I66B 4LHUD 1EFXB 1MIEL 3NJIA 3UTPD 1SM3L 3BPNC 4E68A 3RDTC 3SO3C 1U6AL 4OLXL 1CDUA 2SEBB 4E41A 4HUXB 2O5ZH 4M5SA 4XNUH 3K3QA 2KZWA 3O11B 1KYOK 3FO1B 4QEGA 4EI5B 2Z8SA 2DPKA 5EZLA 4HFUH 1MQKH 1X5XA 5D93C 3JUZA 5DLLA 3TONA 3W0WE 4DPBX 3MJ9L 3TF7C 2FRGP 1A6TA 5GGQL 3P3TA 1KG0A 3ZDYB 4AH2B 2I7OA 3AREA 1X5IA 1G7HB 4HIEB 3V7AE 1W2KT 4HCGA 2V2TA 4PBVC 3F83A 5TE7H 3OLIA 3QFJA 2WZ6A 4Y2NA 4RDQG 1E67A 4X6CB 5IP4A 3SPJA 2FH6A 5F3HB 1J1PL 1B4LA 2JF1A 3LEYH 1V54B 1FNEA 4AYFB 2IFFH 4OZHF 4NO0D 3QIWC 4PRDA 4ZOBA 3TCTA 5F96L 2ORBH 4EZJA 3ES6B 3QJXA 5JXEC 1FNHA 4JKPH 4L5FH 5E2WH 3TVMD 1JOIA 4F2ME 3DKHA 4ENED 1VEOA 3JUYA 4PW3A 3BKCH 1HZLA 1U2CA 2OL3B 1V05A 3CFDB 3N1QC 3NFNA 4XC1L 4FERA 2VZSA 1M2OA 2D7OA 2BY1A 1VGKB 3AROA 4X2UA 2WOYA 1OCWH 2GJZA 4MVBD 5E6ZA 5A40E 2QTEA 5D7EA 3EDDA 1ZA3B 4MXWH 2GFBB 1G7IA 3DVIA 3Q2WA 5MI0B 3V0GA 3D5OF 3BT2H 5FYKE 1SXNA 3GB7B 5D1QE 1FLRL 1KN4L 6FABH 1J1PH 1WBZB 3J2PA 4BUHA 3NIDF 1LE5B 2MTPA 4QRUB 4X7SH 2CLVB 5D7LA 5TD4A 3S2CA 4AZ8A 1IGYB 4F33B 5DQJA 1KGXA 1LO0H 2OR9H 1RP9A 1WCBB 2HAZA 3NGBB 3BP7B 1NC4A 2NTSP 2R51A 5MENA 5DFWH 3DO3A 3FU3A 1FFNB 2VXSH 4W9JC 5DHYA 1NJ9B 5KSBE 2ZZUT 4PJ7A 5CCKH 5C0FA 3ZTJH 5DUMH 1G0XA 5MHSE 3KS0J 4NYLA 3D51A 4GQ9L 1F3DH 1PTZA 4MLSA 2IOOA 4MXWL 4HKJA 4PJEB 1YEKH 4PGBB 4H5SB 2FX7L 2ESVE 1H3WM 4N2HA 2YSTA 1WK0A 4F57H 1KELL 3TGXA 3TCLB 1R1CA 1ACYH 2MTAA 1FL6A 5C0AB 4RRPG 2ZJSH 4G59C 1HSAA 2H32B 4XXCC 5CZVH 1PJWA 3TA3A 5E9DD 1AD0A 1U3ZA 2EEBA 2PW2A 2RFXB 5T33L 3ZKXB 1MCOL 1YPZE 3N06B 3RZCA 5GSRB 1PKQE 2IAMA 3RI5F 3ARFC 1R5WB 2AKRA 3POHA 1WBXA 4OFKA 1IQDA 3B9KD 5DHDA 5KTEH 4XP5L 1P6WA 4FD0A 3R0MA 4OD2B 4OZFH 1KWGA 3PL6D 2UZPA 3VXOA 5JO5A 2YARA 1A6TB 3NIGB 4BJLA 2XNAA 3L3JB 4YO0B 5L8KB 2OXHA 3CSFA 2EO9A 5DFVD 3N04A 3BPLC 5I76B 2XHNA 4Q6KA 5BVPH 3NABH 1J5HA 3V6OE 4OZ4A 3PWVB 1MREH 4L4JA 3RZWA 3WEAA 3GXFA 1E3FA 1YJDC 4IMLB 2CIKB 1I8MA 2G3XA 1ZPLA 4KOBA 5KBLA 2EVIA 2FWSA 1V3LA 2WIIA 1A8ZA 3VM5A 3MRGA 1S7QA 4NKIL 2YPVL 4OLWH 1I9EA 3AU0A 4NN7C 2A74B 2GCYB 1R3HB 3I6SA 4PV9B 5F7LB 3WOVA 3TNMA 1HJCA 1DEDA 4Q0XH 3VDBA 4JO4H 3MQIA 3ZE0E 5EG6C 4G8GD 3QNZB 1IC7H 4ELMB 5C1MB 1E5BA 2YBRB 4JAMA 1E6JL 4GJTB 3TXAA 3SBWA 5DJXA 5BRQA 5GSVA 4BH7A 2WLHA 2OBGA 4N8CH 1X9QA 1L7IL 3WJMA 1NFDE 4I2XE 2X2JA 1FN4A 2WBXA 2CU9A 1ASQA 3E6HB 4Y5XB 2IH1A 1NGXB 4MYWB 2ITDA 1D2OA 2WNWA 3GHBH 3VXSE 3T6QC 4PS4L 3ORJA 1EHAA 1YYLL 2D4DA 3AC0A 3PHAA 4GRLD 4GT7A 4Y4FB 3HR6A 5B8CB 1HXYA 2E46A 2F8XC 3TASA 5I2IA 1NDGA 1DBBH 1L9PA 4I3SH 4NO0A 2GJPA 4JRXA 4XCCH 5ADOH 2Y06L 4WW1A 5I23A 3GSUA 5D6DA 3WGUB 4MX7B 1OZUA 4L4VE 2XLLA 2BZCA 2LABA 3U82B 4OGXL 3IDNA 1BEXA 1Q0XL 3ARBB 3D25B 2D8KA 3FT0A 3FO9B 1NCNA 1NEZA 2CUAA 3LOWA 3QUYC 1O6SA 5K9OB 1N18A 1C1EH 4P05A 5JXAL 4X6DE 3LKOB 4UANA 2DJUA 3OKDB 3TN0A 5JR1L 2GIYA 1UACH 2OP4H 5GRZA 1MRFH 1ZK5A 5DHXB 4ZUWB 4PV1C 2GKIA 4GKNB 3ILDA 1DN2A 2QSQA 4W9GC 2VW7A 3BPLB 1H15A 5AAPA 1MAMH 2GT9B 5C8JB 5LCVL 2OMYA 4ODHH 4CSTA 4WNQA 3N91A 1M7XA 3EIFA 2APVA 1ZHKB 4YUEH 1FC2D 4N0FA 4Q9QL 2O5NA 2O26U 4YPGA 1EVUA 2JKIS 5C0CE 3QZBA 3MYJB 5DJ8B 3QJHB 4N4YB 1KB9J 1BXXA 1NCCL 3IFPA 4GBXC 2OSYA 4UNUA 5DD1H 2FNWA 3NG5A 1P6AB 4UYQA 2EYRA 3U4EB 4P3CL 1NGPH 1N67A 1OCOB 1TYEB 3PNRB 5E23A 3ZXAC 5JHAA 1VEPA 3BFWA 1QNZH 2BSEA 5KN5B 5AYQA 2ROXA 2QFPA 2X44D 5IUSA 4NC2B 3MRRB 4L0PB 5A2KH 2QSCL 3OMIB 4NHUB 4MXVF 3KW8A 4HP5A 2TSBA 4WUUB 1QBML 4HXBH 4LHQB 5GGRY 2HT4D 4GP8B 4LXFA 4LSTH 4HJEA 2WPGA 1BAWA 4P46B 4O2FB 4U6YB 1J1XL 2P5EB 1IVTA 3M07A 2H2SC 1J5DA 4FLQA 1FORH 3C8KA 1YY9C 2XXFA 4JRXE 4FFWC 1QEXA 4HJJH 1L9TA 1PIGA 4S1DD 3FTUA 4O02L 3BDXA 2NR6D 4XPAH 4NQCE 2NY1B 2ADJA 3T71A 4HV8B 4HIIA 5CMAA 1MLBA 2AQRA 2C3XA 4NC1C 3LNDA 1LM8V 1QNZL 3B9DA 3WNJA 5E08L 4FP8H 4X5XB 4XNXL 5JOPE 2BINA 4ZAKB 1TZOA 5FGRA 5JIKA 2R69L 4K8RD 4N2MA 4ECNA 5IVXB 5I9QC 4GSDL 1CYXA 4RZKA 1ZLWH 5E00B 3ZW3A 2YD6A 2HX8A 4PRIB 1W6WA 2HVKB 4EKXA 3L5IA 4BRJA 4PJ8C 4CN1A 4LIQL 3VGAB 4OZGA 1OP5K 1N19A 2XOTA 1E43A 4AQ8C 3KDPB 1I1AB 3I2CL 5J6GB 2BSSB 2GT9A 3LKNA 5C8JA 3QJHA 1E9QB 1QBBA 1DVUA 1WD8A 3FT1A 4JANB 4PBWD 1DJZA 3KPSA 3QFDA 4ODXA 3PGFL 4LT7A 5C0IA 4JM2A 4H5SA 5C0EA 1B4JH 1FZKA 3PQYA 3OKDA 3TN0B 3HAEH 3L3HA 4KTDH 3FU8A 2VXTH 3N41B 5IMLB 5LKNA 2Q7YB 3TURA 5ANHA 3FBQA 3NIDE 1XGYH 2XZZA 5DFTA 1VKXB 4XVSH 1AXIB 4WCYL 3DUUB 3DOHA 1ZRUA 1OTUD 3O4LE 4X4ME 5JPMC 5I0ZA 5IBLC 1CTMA 1RZIB 1V7NH 2QPFA 2EDWA 3BWZA 5JHBA 1ORQA 3J27A 4R7XA 3AZUA 1OQOA 5BO1H 5FYLD 2XA3A 3LRKA 4Y9CA 3KPQB 3LZRA 3ESVF 5B39G 3I9GL 1UQSA 3T4AB 2ZWNA 3LN5B 2FT6A 3LN9A 1CLVA 4MRCA 4XC3L 4YC2B 4PJXB 4LVHC 1MIMH 4FJYA 3AAZB 3SQOH 4S1SL 2XPYA 3VX1A 5HPMA 5JPMB 3MRNA 3O6KH 4ZFQA 3B5HA 1CLZL 4OZIF 3V4LA 1ZA6B 3GJFB 4K73A 5CLTA 5T1MB 4NZRH 5HGBB 2K45A 1R3IH 1C5DB 2KHAA 5D7IB 4G6KH 4TVPE 4F92B 1F8TL 2FUTA 3ROOA 3MJ6A 1KEGL 1MFDL 1NAMB 4EN3C 4PJ5B 1WVZA 3OD3A 5F6HI 1UEMA 3MGAA 4IU3A 4AUYA 2CBPA 4NZTH 1BAGA 4YDJA 2WCSA 2V17H 5LVEA 4PJCB 4ZFFB 4PTUB 5DS2A 1GZQA 4QF1B 2Q0ZX 4KRPB 1SEBB 2XSKA 2EXWD 4NZ8A 1FO0A 1S7VB 3NH7H 1R3HA 1Y0LB 3QIUB 5D96C 1HAUA 1G7HA 1BG1A 1AR1C 1UFGA 1VZIA 1E4XL 1HIML 3IXAB 3HZ3A 5B1JA 2P48B 1BQ5A 3GI8H 4FXKC 1MCCA 1BFTA 3SDXE 4YJZL 3NEOA 2ZAIA 5DDHB 2YA1A 3A6CL 4ZUUA 4F7CB 4QLRA 4BUGA 4Z7QB 3IJEB 3VI3B 1SPDA 2PPEA 1ET5A 3W2DL 4HCRH 2J2ZA 1F58L 2OMTA 4ODHL 5GGUB 3P11H 1ZMYA 3UGXA 1Q9WB 1LEKA 4H0GA 3G6DH 5DJXB 1RZJC 5IB3A 3NZSA 4FULA 2BNUB 2JSFA 2VN5A 3IWUA 3O6FC 4O9HL 4OLYL 4A7UA 2H6UA 1BA9A 2PO6D 4I48B 2F74A 3QUMA 4LDLB 2NTFA 1HSAB 2H32A 2QL1A 2FQFA 3JWDL 3ENEA 2WSDA 4QRRE 1QRKA 2X1WL 3KJ6H 3LEXA 2XWJB 4OFYA 5FO7B 5BUGA 4QHKI 5I71C 4GRMA 4DKAA 1D6EB 4JZOA 1Y18B 3WKQA 3V95A 4EZLA 1CWVA 2KQNA 4IKLA 2DLFH 4W1TA 1YEHL 3BLPX 3C6LC 3EOBA 4IIZA 4UNTA 4YZFF 2IGTA 3MRCB 3C5ZA 4ZFZB 5HJ3B 3SDDA 3KDMB 2HFEB 4M5YH 4R2GB 4NCDA 3L7EB 4A38A 2NR6C 4IRSC 4LAJH 5DYOA 1JZIA 3GDCA 1ZIBA 5H35A 3I6LD 3NIGE 3PHOB 4WJKB 2EH8L 4JG5A 4JM4L 4NO2A 3R8BB 3MLSH 2HZHA 2IJ0C 3QHTC 4Q14A 2WXFA 3RZCC 2UX7A 5IGXL 4PRNA 2UY7B 5AW5B 1NKRA 5TGBA 3ZYJA 2ARJQ 1N7ML 2E7CA 1H9DA 1VIWA 2AEWA 1A7NH 3OXRA 4OZFG 4P2RB 3CLEL 2K0RA 3BDBA 1U8IA 1FBIH 1PJ9A 2DICA 2ODHA 3RTQB 4ZI8A 3T0DA 1S7WA 2R2EA 4J4PA 3FTVA 3S8GB 5JIMA 1I9JL 1PYWA 2CMRH 3W9DA 4OBRA 3PCYA 4LIQE 1HK6A 3H1ZA 5JORB 2YZ1A 5ACMA 2XPGA 3JT0A 3P3UA 1I8UA 2D9QB 5E8DL 2JQMA 3MFFA 2MPVA 5E8OA 1IT9L 3AREC 3ULVC 2ZXCA 2VERA 4OQTA 4U6HB 4GW5A 4HS8L 1UM6L 1WBYA 4KNQA 5LGYA 1M6OB 3NSFA 5KBPA 1INQB 1PG7L 4WZ9A 5GRJH 3UTTE 4IHOB 4DGYH 4AVJA 1WAEA 3LIZL 1EMTL 1NJ9A 4GKOA 1IBZA 1KEMH 3IJ8A 2HLAA 1DQQB 4V1DE 5FFGA 4LCWD 3BDYL 1RSFA 2YC1A 1KGWA 1IUZA 2VITB 3DWTA 2WB7A 3FT3A 2EUZA 5TJWK 4IBSA 5HGHB 5AD0B 2PXYA 4QRUA 1TNNA 2ZUQC 1ED3A 3KWTA 3SGDH 4AGOA 4CVZB 4LLUA 1MCLA 2J1WA 4HH9A 3T0AA 2CCVA 2GABA 1NIBA 3MRMB 2X89D 4WWPA 2PCFA 3MJ9H 1LO2L 1NLDH 3I3EA 4Q2ZB 4HFUL 3IGFA 4LVNB 2FR4A 4JFEA 4KZDL 3AY4A 1DJIA 5IESH 4GUQA 1TPXB 2NY6D 1L5GB 5C0AD 2I5YH 4PRNB 1WJ3A 3VRIB 2GI7A 4JY6A 4EIUA 1Y6KR 5E8EA 3UTPE 3RY6A 3BPOC 2LU7A 1MNNA 2WQAA 4H88L 5DS1A 1NMAH 2R7EA 4NZUH 5IVXF 1BXVA 3ARDD 5JIHA 1PX3A 5DC0A 1N4XL 4JJ5A 3BAXA 1AHWB 4LL4A 4PGEA 2ORBL 5CN2A 5F96H 3MJ7A 3NRQA 5FO8A 3TBSB 4G9FB 4LSPH 1Y18A 3KEHA 2NW3A 5CEZE 4LNRB 5D4QA 1W80A 1QBAA 4H0IA 3HNVH 3MBWB 4CW1B 1BFOB 1LLAA 2XFGB 3FU7A 2Y72A 7PAZA 4Q6IA 2DM3A 3UJIH 4N24A 2HJFA 5J9PB 2GITB 4G2AA 5HDBF 1QACA 5EC1B 4JREB 4G71B 1CPUA 2VDLH 1JXFA 4G6ML 4K3JH 3VWJD 3ZE2B 1N6QL 3DIDA 4PJFE 3KXFB 1TEFA 5E8EB 1DVFA 5D7JA 3TA3C 4JRYB 5DRWA 1D7FA 4E41B 1C16B 3BQUA 3PXHA 1E4KC 2KMWA 3PHQA 4E2OA 4DUWA 1WLHA 2JTDA 2WUBH 3FT4A 4QHUA 1LEIA 1BQLL 3H6AA 5C07A 3VX0A 4P2RE 1MLCB 5EEWA 3CIQA 1S78D 2XN2A 4Z76B 4XP1H 5IB2A 1S9XB 4HH9B 5TQ0H 1FL3A 1KXTB 1PNDA 2YMXL 5KYUB 4BA0A 5CLXA 4LVOB 2WBJC 2Q86A 3F7VA 1T5WB 3WY2A 3ULUD 3OVUB 3DTUB 3CPUA 3VXRD 2J4WL 1F97A 2P7TB 2VDNB 4E41E 4FYQA 4YHYC 3WENA 1U21A 4P57B 1CD9B 4QF1A 4YGAB 4EUPG 3WXVL 1IGJA 3OF6D 5DQ9B 2DYSB 4KK6C 3U0PA 5LAPA 2GSMB 3TV8A 4L3EB 2R0ZL 1KJ3H 4KAQL 1JK8B 1UT1A 5LNGA 1BDYA 4ENEC 4M48H 2NY4C 4L9LC 4GOSA 5ELIA 4L8CA 1V5JA 2JB6B 4LSUL 4XGZB 4JFWA 3QJOA 2V2WA 1XVSA 2CKBH 1UJ3B 1F56A 3G9VA 4ZXBD 4BFNA 1BQRA 3QGVA 1WE5A 3QQ9D 4Y7OC 5J12B 1T2JA 2DL2A 2ATPB 4J6RH 1DDTA 2YQGA 2P24B 1S7UA 2NQDA 3HBQA 4WGVB 1C08A 3PGDB 2XWTA 4ANWA 4OLZL 1EFXD 4NM8H 4XMZA 1WSST 1H3VA 3EXJA 1KXHA 4DGIH 4UT6A 1TG8A 3QUZA 2DQ6A 4TUOA 5DLMH 1KGIA 3LEYL 5ALCL 2NY4B 4L9LB 1EAQA 3P4MB 4IBLT 1R46A 3BVNB 4FXGA 5H2BB 5BS0B 4NAJA 4IOIB 2NY7L 1NWOA 1X5HA 1YECH 3Q7JA 3VVWA 3HA0A 1ZHBB 4W6YB 1RIUL 4ZUSA 5KSBF 3S36H 4AITA 3DETC 1CICB 4ZDHA 2YD3A 1RZIA 4R26H 1RH8A 3DV4B 4IGBB 3MA9H 4HEME 2YGQA 4WTWA 2UYLB 2QZQA 3BO8A 3TBBA 5GS1B 2VR3A 3WFHB 5ITFA 1TZGL 2Y6TE 2HKHL 2FJHB 2V5YA 3EOBB 4IOFC 5EUOF 1IAMA 1JZDC 5KS9B 3VG9C 2VSMB 2Z31C 3MOBH 4GRMB 1E4XH 1KJ2B 4J3TA 5LBSL 2F54D 4IBZA 3U6RA 3S37X 3O8XD 4WHTB 2EO7A 4HDIB 4F7MA 2WKLA 1AKJB 4Q6IB 3SDYL 2NYYD 5I5IA 4JLRB 4B6ZA 2JKNA 2NTFB 1YYCA 3QDJE 2BVOA 1I1AA 1OALA 2HRLA 3X11A 5FO7A 3IPFA 5D7IE 4UMSA 4U3CA 3D85A 5MEOB 4PY8I 5FO8B 3FF8A 1K4CB 1UD2A 3T1FB 4N26A 1AG0A 2GK2A 2ITCB 3FUIA 4WIQA 2R9HD 4BINA 2FZ3B 1ZLUH 1HNYA 1YPZA 3L4ZA 5A2BA 4V2BA 2OSWA 2NXZB 5KVDH 1TOXA 5IW3A 4IBTA 1FDLH 1JUFA 1Q0YL 3IKCB 1TU2A 1NLBL 1A7OL 2CWRA 3NJKA 4S1DC 3RWFA 3WV0A 5DRZB 1CLYL 5DJ0A 1Y0LA 3QIUA 4L4TB 4WU7B 4XNYH 4N2LA 4G83A 3VQLA 1CT8B 3PS6A 4JO5A 3DX8A 3MNDA 4CSZA 4XE5B 4DFHA 4LLVB 5JA9A 2P5PA 2PMZA 5E70A 3RJDA 4Z78A 1JWMA 2BSTA 4KRNA 3VAEA 5D4IA 4NO5B 4KNTA 2YN3A 2HSIA 4HUMB 5GHWL 1XFPA 4HWBH 5FC9A 5FV2A 3MRIA 1J05A 4IKNA 1EHNA 1B9KA 2EDQA 4HT1H 4PLKC 1CFMA 4LCVA 5CJOH 5DURD 4P2OB 1WZAA 4U1SB 1T4KB 4H1LH 2XQYA 5EPMA 3L9BA 1ZLUK 3QG7L 5JQIB 1CGUA 1NH6A 2BCMA 5BRZD 1JAEA 1KT2A 2YMTA 4LU5L 2ZWKA 1K3ZA 1RULH 4U2YA 3T6ZA 1SXAA 4PJIF 4K7PH 4KK8D 1P4LA 4TVPH 2ZWZA 4MMYA 3FQ2A 3EGSA 4M9OA 2V7HA 4U6XB 2IADB 3THML 3ARED 1QO3A 2NT0A 4LSSL 5JLZA 1IL1A 2N0MA 2DH3A 2JJTC 4MJJA 3V6ZA 5DYFA 3QQ4A 1FVCA 1TQBB 2WMPB 1F6FB 4Z7QE 1T5KA 1T2QL 4V11A 5FFOA 4P4KC 4ONFL 4QRBA 4MXQD 1OP3K 2X4PA 3KPQA 4Z18A 1XGUA 4AJVA 5IFHH 4X7DC 1VKXA 1S5HA 2BWDA 5K9OA 2JKSA 3WFEH 5A2JH 4E9QA 3RZCD 1HYSC 3BZFA 2WWOA 2OYPA 1HZHL 3BH9B 4QRSB 3EJRA 1AI1L 1Q9LB 3ZJAA 2VO8A 4YN3A 4J3OC 4TSCH 1XH1A 2JK5A 3BPCB 3CX2A 3DX8B 5FA3B 2BVYA 1KCUL 5E4EC 3RFZC 5DJDB 2D2CC 1V55B 2J71A 3BZEA 5JHDE 1WUNT 2ZXWB 2FLMA 2G0KA 4GXUM 1XSJA 1S9VA 1CYGA 1O7VA 3AY2A 4TN9A 2AW2A 4DVBB 4POYA 3AB0C 4HBCL 3WNMA 7FABL 2ENSA 3OJDB 5EU5A 1GJWA 4FMFA 2FZ3A 1SLVA 5C09D 3V4VB 4ES9A 4R0LA 4C4BA 2E9WA 4OH2A 5B1AB 1DFXA 3CSGA 2KKQA 1IM3A 3O6FD 3SYOA 5J11B 3T2LA 5AVYB 5HHXL 2VLJB 2DWDB 3BPOB 2G5RA 2BXZA 2ZOLA 3BKML 3EDEA 3MJ8B 5EOCL 5F7DB 3TPUB 3X11B 2V5MA 1DCLA 2WQ8A 3CG8A 3IDGA 4R7DB 2R39A 4R4BA 3VQ2C 1U2YA 2VLKE 4FL4C 1JF6A 2VXTL 1I1FB 2OULB 3EH2A 5T1LB 1JE6A 3PNWA 4PJ5E 4X0KB 1U95A 2E27L 5I1EL 1CF8H 1KTDB 3F12B 5H37H 2R56L 5CCHE 4GW4A 2FWUA 2VLKA 2WLZA 4EVNA 2KDYA 5G5DA 2X6CA 35C8L 5GGSB 2G75A 3CFKA 1SMDA 4G80B 4HS6A 4OZ4B 4TSCL 3UC0L 4OF0A 1RU9H 4JHAL 3AS0A 1AR1D 5L6YL 1U3HB 4TPRH 3PL6C 1R3JA 4ELDA 3MUGA 4CDGC 5C08B 3WFCH 3PFQA 1NCAH 5F7YC 3S48A 1SLXA 5IFHL 3RDTB 1KPVA 2DAVA 2BPBA 1WHOA 3EJZD 1J0IA 1A4KB 2FEJA 3MRLA 4G82A 3CFMA 1R5WA 2CJ3A 5FGCE 2EDFA 4NQXB 1A7BA 3CFJA 1VJSA 4JFSA 5KBDA 4Z95H 3QQ4B 3MLUL 2NXZC 2DQFA 2WUCL 3TEXA 5B7MA 4IJ3B 1NCWL 2Y25A 4NP9A 2EZ0C 1FL6B 2CIIB 4M4RA 3SGEH 3VRJA 1JRHH 2ZXBA 4YBQC 2Z0BA 4JFUA 5EN2B 1A6WL 1ETB1 1YG9A 3AITA 1ZLDA 4QRSA 4QTHA 4Y2DB 4LSTL 3IJYA 4HWEH 5KSBB 4GRWH 3V6OC 5FCUL 4U3HA 3HLKA 4KK5C 1V3JA 4L8BA 4GO6B 2JK5B 3BPCA 4LLWA 3UL4A 4JHUA 2JI1A 2PWDA 5CBAB 3BSGA 1MHEA 4LCCA 3POCA 3D09A 5C3LD 2GEQA 4Y4HB 4J2XA 5FOBB 4YSDA 1GC1L 2OTUB 2X4PB 1UKSA 1GMIA 2EIEA 3K6OA 3BEVA 5AUMB 5BUAA 2VW6A 1A6AB 2VM4A 1JNNL 3QWNA 3S98A 1U8CA 1AANA 3FTSA 1KPRB 2K70A 3IU4L 4I0CC 5E4OA 3O6ML 4QYOB 5K69A 3EYSL 4E9SA 4Y16C 4BEIA 2GG1A 5HDQL 4RZCB 4PRHD 4G6AC 4PWJA 4AKOA 4LLYA 1MFMA 1DZ0A 2WXHA 4DPCX 3OHXC 5LWYL 4YVUA 2COQA 1CICD 4J4PC 3U1QA 5SWZB 2DQTH 4FZ8L 4UOW0 4UWQB 5EH1A 3QPKA 2OW6A 1NGXA 5JR1H 3E9TA 1PD6A 4F7TB 2WO3B 1K8DA 3GSWB 2F7RA 3BUTA 3QNZA 4XHJD 4ELMA 4ZMOA 3V0WL 5IR1A 1W8NA 4OIIH 4N0RA 3MLRH 4TQHA 3BVXA 3VTMA 3ML9A 1DVTA 4OLEA 4TNFA 4FABH 5JYLA 3MRIB 4LCCC 4JN1H 3DOSA 4AJYV 4RQQA 2AK1H 1S7QB 2PR4L 3CZFB 4X99B 3ZX1A 2OMWB 3MGOB 1RZFH 4Z78B 3MKKA 3H6JA 4W4OC 4UTAH 1RKRA 2ZNWA 3MOBL 4ZXBB 2DF3A 5LBSH 3SOTA 1FV1B 3BP6A 2FECL 1EZUA 5DQDL 2C9QA 5LGHL 4W9KC 4P46A 2AEIT 3CNKA 4IEFA 4FEIA 3FO1A 5E2JA 1HCVA 4FI7A 1U8HB 3VXMD 4UQAA 3MGTB 3B5GA 1HXMA 4QXTB 2BS8A 5B22A 4RFNB 1JHLL 3KYMA 2WAHA 4N0CD 5IFAH 2JCCB 2OMVA 3Q8BA 4S10A 5D4HA 2PYED 4KVCH 2XI9A 5B3NA 3O3AA 1QR1B 3O4OB 5DVOA 3V5DB 3NCYP 3D2TA 2ZKWA 3DXAD 3QNYA 3LZOA 5I0VA 4XNMA 4XX1E 3WTYA 4I1PA 5A6LA 3QDJB 1E9PB 3RUGE 4NJAL 3ZE1F 2OZ4A 3U4KA 3TLRA 3I74A 2DWYA 1PNCA 3IMVA 1IZKA 4Q74A 3EW3B 5I5RA 5AW2B 3V0JA 4HPHA 1G5AA 2PP7A 4FZEH 3THMH 3QZLA 3FS9A 1ZEAH 3HW7A 3FQTB 1PFCA 4LKCA 5D1XA 3NRFA 3LRMA 4X7CC 4APQA 3ZR6A 3I9IA 4WLCA 1XD1A 3L5WA 2F1AA 2MCPL 3M1OA 1H3XA 4HALA 5CIPB 1NCUA 3OHXB 1JGEA 4O58L 4PRPD 5EA0H 3IM1A 3A4DA 1HQ4B 1QPXA 4R97C 1FGNL 1LMKA 1W6LA 1F11B 2CLVA 4LCWE 4P2QB 4ZOCA 1IGJB 2NY0C 4YDVA 3OAZH 3CQQA 4I5BB 4N6RB 1SJMA 4EZMA 1MNUL 1XF5A 2VAAB 2AVFA 1WCBA 2XQYG 3CDFA 4YGVA 1KNOA 1BD2A 1IGIL 1YEJL 6CGTA 5K59E 4H88H 4GT0A 3D4GA 3PE9A 4DN3L 5F93C 3GIVB 4YR6A 5CIPH 2OK0L 2FBRA 3T0WA 4R7LA 3H3BC 4PWGA 3HC4H 3PWNA 1PQZA 4ZOAA 1J12A 3MCLH 4XGZA 1VGEL 1X5ZA 3L7FB 4O5LH 4OLXH 2F5BL 4YAQA 3TFKC 4ETYA 4H25A 3BMVA 1XL6A 3VACA 2NOYA 1I4FA 2H32H 3ZE0F 4P2QD 5DXWA 1P84K 1O5PA 4L3EE 2ZXQA 4DFIA 4Y1AA 2IPTH 4A2EA 3H4FA 4XRCB 1TQUA 5HHNA 3N0AA 1JDAA 1QNIA 2VW4A 1IGIH 1U8LB 3LIZH 1AFVH 1GOGA 3L1GA 2IV9A 2ZG3A 1PEWA 2VISB 2F19L 2DZEA 1T04B 5E1HB 3BKJH 2DQMA 4ZD3H 3S8WA 3HZMB 3SGKC 1HT6A 3Q5TA 1XGTA 4FF9A 3TTYA 5BQ7A 1N12A 3QS2A 4C4KO 1MCWW 1ZVNA 1PEZA 2VDRL 4HJ1A 4Z3IA 3FUDA 4Q8BA 3QORD 4FTVB 3U48A 4TUKL 3RB5A 3DXAE 5DD6B 3T3PF 5EV7A 4DOHE 2P8PB 3ERXA 4LL9A 4ZTEA 4X5PA 1M05B 5FKAB 1RIVL 2AJZA 1K4DA 4YDNA 4BFBD 4NC1E 1IQWL 3VH8A 2FT7A 5E2WL 2ZIDA 1QI5A 4DW2L 3JVFC 4JFTA 5KYWA 1N26A 3VGHA 1D6VL 3N1FC 1RZPA 1LK3H 2A99A 5IBTL 1WFJA 2IFFL 4FFTA 1RD6A 4HUWB 2YD7A 3VXMB 1NBZA 4YSOA 2HPTA 2VISA 3ELQA 2E75C 4P59L 5H37G 5JIQA 4BSJA 1ZT1B 2EDJA 1HEZB 1JZGA 3MV9A 4LSQL 3RFZA 4W9CC 3RVUC 5T3ZH 4EBQL 3D4CA 4ELKA 2O1AA 2IPTL 1WAAF 2NX5A 4RWHA 5EZPA 2W1NA 5GZNA 5IHLB 1AOZA 3FDWA 2R4RH 2ZUUA 1OSYA 2Y36L 3RGVA 1T83C 3CZEA 1IO4C 3P11L 5IHZB 1AZVA 1HL5A 4KC3B 4X7EC 3ULUL 1FPTL 1IEAB 4X6CE 3RNKA 3VFOB 4ALAH 3DJ9A 5T1MA 1WEJL 2XV2A 7CGTA 3S3BB 3MRFA 2AV7B 5KAQG 1QP1A 4AC2A 5I9QB 2HTKC 2YGPA 4KRLB 4DKFL 5LHDA 1G9HA 4ONHB 2V7NB 3KNBA 4XO3A 1IGTB 5DQDH 2X4TB 2OJZH 2ZCLH 4TUKH 3C5ZC 4Q4IA 2AJSH 4IQHA 1YN7A 3CZKA 3ESUF 1C7SA 4YZWA 2FQDA 1AO7D 4G8GA 5T5NG 3DROB 2F19H 4ABVA 4YFDB 4Y1SA 1AACA 3OXRB 4P2RA 1QQDA 1AZUA 5E1IA 1OANA 4OT1H 2GFBA 1CZ8L 2FJUB 2XBDA 3SDCC 2Q2EB 3TJPA 5I15H 1Z3RA 4KJYA 3EHBB 3PY9A 9CGTA 4UBDC 4R4ND 1MJ8L 3ZHFA 3RNKB 2X7LA 4FNRA 4JZJB 5HGDB 5TQ2L 1VERA 3RIAF 1T2XA 1XGRA 3UZQB 3DX3A 2A1WL 5KSBA 3WFZA 2VDMB 3DHUA 3HFML 3CTTA 4JFPB 1UWEL 3LN4A 1IIKA 3VD2A 1ZS8B 2ZT9C 4G3YL 1CLZH 2JELH 4YWGL 4CSPA 4GW5B 1FHGA 2BSED 3O6KL 4XN9A 4AGMA 3Q8FA 2PTUA 1LD9B 3EYSH 4BZ2A 3BCFA 3JWNH 3HN8A 1CBVL 4JFDD 4ANUA 3GUTA 3QWQB 3ZQ9A 5B4MD 2FSEA 3GMOB 2C3VA 2UWEB 2NY5L 5CJBA 4BCYA 4URKA 2JKJA 1S7XB 1G9MC 4HQQH 4PIBA 1MFDH 5ACZA 3PXJA 3WIHH 4FCHA 5HGAA 3HC0B 3MV8E 2B14A 1U8HA 3UO1H 4UQDA 4BV1A 3HMXA 4P23B 3AJ7A 3G3LA 4HF5L 4BHUA 3VGDA 4AEEA 1LWRA 1Q9WA 2KI6A 4J3OD 3U30C 4BK4A 5KSAB 5T1DL 4Y16B 3KBEA 2VZ3A 3T65B 1HNFA 1MCKA 1YQVH 4GSUA 5I1EH 2CO6A 1IAKB 2H0JA 4W68A 1FF5A 1K8IB 4OCXL 1U41A 3FQRB 4XPBH 3N85H 3PHOA 4IEFB 4HZLB 3S37H 3S3DB 1OE1A 5FUOL 1OKEA 1EAPA 5I26A 2EVGA 3RDTD 5AW1B 3GXPA 4XNDA 3D3VD 1A0QH 1I7UB 5KEZA 1H5BC 1KTDA 4N2EA 4LCYA 2FD6H 2JV6A 5D1ZA 5J1TC 4AQ8A 3WTTA 2DD8L 2Q8BL 3PFUA 4LFHG 4L1BA 3B5TA 5EFIA 2A6JB 2Z6FA 5ABAA 1A1MA 2OJEA 4GG6A 2F6AA 2Y7OA 1CFQA 2YLHA 4NQTA 2IQAB 5HSFA 1XBDA 3MLTB 3UTSD 2X6MA 4ZTOL 1U33A 5EO1B 4OV5A 1OW0C 1NIEA 2G4EA 3L81A 4C57C 1CQYA 1MY7A 4HMDA 1GCYA 1A3QA 1KY6A 4JQXA 3CFNA 3TBVA 2XN0A 1SY6L 2X09A 1X4XA 4RCAA 3LKRA 4L1TA 5IK3A 1UZGA 4P9ML 3QR1A 5D7HA 4D8PB 3VI3E 4MJ6A 1HL9A 3WFDL 1KOAA 4YR6B 1GHFH 3MRHA 3DA0A 4F7PB 1GAFL 5LAXA 1A6ZA 3X14A 3ZTNH 5I30L 2VR6A 1XTLA 4QNPF 4HOXA 4HK0A 1K2DB 3O6MH 2UVFA 1XR8A 3P02A 1AY1H 4LASH 3WFEL 4BQCA 1SDDB 3MLPA 3BP5A 3GZPA 4XVTL 1XF5B 2ENYA 3VFSB 2XX1A 3I84A 3QRGH 1UT9A 5FIEA 3BW9A 2PXYB 2B1AL 3B43A 1NEPA 4R83A 3LKSA 4TUJB 3SCMC 1HAWA 4AXWB 1BF5A 4IU2A 2QDVA 4AQEB 4WWID 5I17A 2HRGA 3APNA 2Y7QB 4XNAA 1CCZA 2I85A 4N2NA 4Z9KB 4UV7H 4HD9A 1UB5A 3V6BR 5DD0L 2EEDA 5CM1A 4KMTH 3Q6FB 1BD2D 4XNBA 2DY2A 2EKJA 5HYEA 1I53A 1RK0B 3DVFA 2DRUA 5T3XE 2F8VA 1OPOA 3S3SA 2J3SA 3DK0A 1MVUA 2FO8A 4U2ZA 1DQML 2W0KA 4OLVH 1XF1A 2E3VA 2OXGB 3F7QA 4Z0XA 3ZLQC 3KJ4C 1MCHA 3KL3A 2BOCB 3TA4D 1T89C 1TQCC 1B0RB 4KGLA 2VLLB 3BKMH 5KYYA 2BFVL 1PY0A 1D3CA 3EO9H 4M61B 3IKKA 2JIXA 4NDMA 5EOQL 2HP4A 4BZ2L 3DARA 2C34A 4Z7VF 1MCJA 2YFNA 4G6FB 4APQD 4AJWA 3GSNA 5AENA 5B7FA 3RL1B 2AV1A 2FLBT 5INCB 1FE8L 2K7PA 3QUHA 4PJXF 1RVFL 2QKIC 3FO0L 1BZDA 3EGXB 1P9MC 3O4LB 2I9TA 2YK1H 1CFQB 4JRFA 3ARFA 2NSQA 2WW8A 3IN2A 1GS6X 3RPBA 1F58H 2KZKA 3GTNA 3HBGA 4TULL 4JFFB 1UCBL 3TO2B 3L9RA 4Z7NE 1NGZA 3LH2H 2NY2C 4YHIB 4H8UA 3D18B 5IVOA 4F7EA 2WNGA 1SRDA 4PJ7E 2VMDA 2K6YA 4ELMF 1M1XB 1QI4A 1HZHH 5LGHH 4R96B 1YZZA 2A77L 1VACB 4MDJA 3ARBC 2K1MA 3IDMA 2XWEA 4BQ6A 4FFVC 1IC1A 3O6LL 4BGLA 3WDHA 2V9TA 1S9KC 5I1LB 2APSA 2PYFA 1TTGA 2GTWB 2XA8L 4P5TC 5CSGA 3KVQA 4R4BB 3TIEA 4HJTA 3A5VA 2NNRA 3SZ6A 1KCVH 2D7TL 2WOBA 4AEIH 4QCIB 5KUMA 4W4OA 1EHLH 4N8PA 5EU4A 4LSSH 3SDYH 1PAZA 1PCSA 2DD8H 3KPOB 1UADC 2H1XA 4RNRB 4AGPA 1YPZF 3GUTB 3US9A 2DLHA 4JPWH 4MSWB 5F70A 4YHKL 2YUVA 1RI8A 2BFGA 1UHVA 3EH4B 3GZQA 2DQJH 4QJ4B 1MHPL 3DYPA 3DGDA 4Q9QH 3PIQB 3NGBC 3EJUA 4X9BA 1RMFL 1SLUA 4XNYL 1U36A 1OARL 4JFXB 1FG2B 2XG5B 3U46B 4N85A 3UZQA 2ID5A 3BQUD 1U30A 3CZSA 4WDIB 2DMKA 3FN0L 4AV4A 5FA3A 1BM7A 1J87A 3CN1A 5J89A 1UB5B 3STLA 1T6WA 1SFHA 3AS1A 1M3IA 3JVGA 1DCEA 4JVPA 1FJ1B 1O6SB 3CHRA 4TLSA 1HI6A 3GI9H 4ZUSB 3DROA 3K8KA 3E1F1 3WHXA 5DFAA 1E65A 1XEDA 4KVNH 3SPHA 3TBTA 2QKIB 3BAKA 4XMUA 4AE1A 1BVLB 1GSKA 3LKSB 5AAWA 4IBUA 4MB3A 4N87A 4AY0A 4BH8A 2DEYX 3VXQB 4WK4B 3I9AA 3ASNB 4MWFB 1CFVL 5CJ8A 3ZDZE 1O75A 4QJ5B 2QVMA 3GJFA 3WFDH 3MXWL 4K94H 4OW6A 3FB5B 4JKKA 4TKWA 1FCGA 1MOEA 2R15A 3GIZH 2CDEB 4QKXB 1LWJA 4XHQA 5TQ2H 3ZUNC 2HMIC 5C7ZA 2VB5A 5D93B 3X1GA 5DK3A 3X1BA 2CCLA 4P23D 5IHZA 5AL0A 1AYRA 1NCWH 1UQSB 3GJEB 3HHSB 3T6XA 1HKLH 3GEWB 1EXUA 1QVOB 1TZHA 4JFYB 1KYDA 3IFNL 3RPIB 2LVCA 4B9KC 1NMCB 3WJMB 4N8CL 2YPKB 5E9AA 3UBGA 2CLRA 5G4OA 2N59A 3F7YB 3MV7B 2W0FB 3AW5A 1MPAL 4LLVA 3HTLX 2X40A 4YHMH 5E1AB 3W0WB 3DGGA 4OZIA 1CU4H 4HUUB 4WFEE 2XVLA 2YD9A 1EIBA 2AGJH 3IGAB 3BFOA 3OLGA 4S1RL 3EYFA 3ZUCA 4FFWD 6FABL 1RHHB 5F3BA 3F12A 3IEAA 4LLDB 5IB2B 4PRHE 1BOGA 1XSIA 5HDBB 3FC8A 1IKFL 2E5EA 3FQRA 3IS0X 5EIVA 5AG8A 2MH4A 2AXJA 5CGMA 3UTZB 2R4RL 2Z1PA 1RULL 3PGCA 1D5RA 3FW6A 4DEUA 2EIKB 4I88A 1QFWH 3FTYA 4OJDH 3PAZA 1OIOA 5DTFA 3M17A 3K1KC 3N43F 3ZO9A 1QSZA 1GSMA 2XBZA 3QAQA 5E7FA 1UB6A 3MNWA 1P5UB 3V6FB 2BOBB 2BNRB 1BV8A 3FU7B 4Y5YC 3UCQA 4JHWH 1NGPL 1KGYE 1C7TA 1WYJA 1MCPH 2VLJE 1MI5E 2XKNB 2AQ1A 3VI3F 1AD0B 2PW2B 2X41A 4ETQB 3JSSA 3WIFB 1AMXA 2K78A 2PR9A 3S37L 2EVFA 1J9QA 3PWUB 1QOKA 4KPHH 5D2NE 3ZZ1A 4XBMA 1I7TB 2CALA 4DP0X 4PGBA 5AALA 3TVMB 1D9KA 1N10A 3CZJA 3LNFA 1IU1A 4QD2E 4PP2A 3DIFA 1Q0YH 1T7VA 4BE5A 3AADB 4XPHL 1ZVHA 2VDRB 3GLDA 1H6EA 4HWBL 5HYSG 3T65A 1TNMA 32C2A 1CE6B 1SUHA 2A6KA 5IG7B 3SDDD 2KH2B 5HBBA 5I76A 3QEHB 4EE2A 4JCLA 5TDPA 5L0QB 2OMUB 4G1EA 2IAND 4Y5VA 3ABLB 2YPVA 1X3DA 2J57A 3GSNB 3QG6A 3ZE2F 4XMXA 1Z9NA 2KQMA 3NACH 4IOIA 2BIQA 4JVWA 3EYVB 4JFFD 3F05A 3UABA 3VD9A 3EDJA 2AKRB 4DKFH 4TL4A 4TM9A 1R33A 3WMQA 2IPKB 1G5GA 2PABA 2QSVA 1BPVA 1IJNA 4UAOB 4Z7AA 2YJQA 4EEEA 4Q9RH 1UM6H 5CIPA 4GRLC 4U1LB 1EZLA 4OJAA 3WCYA 1JHKH 4BE6A 1Z6JT 3HE6B 3R1GH 2PCYA 1X9UA 3MBXH 5D7JC 4AT6B 2ERJB 2XKSA 2FX7H 4P49A 4APQB 1SN5A 5H8DA 3KWXA 3FUJA 4HHAB 1NMAL 4NZUL 2PO6C 5GXBB 1Q1JL 3DDFA 3LNIA 4WO4C 1EXHA 1XGRB 1AHWC 4OT1L 1YQVL 3DVGA 1FI8C 5SX5K 1YDPA 1ODUA 3ASWA 1MRDH 4B95C 2IF7A 4LCWB 2IBZY 3IAGC 3IT8D 4FQJH 5J57B 1M71B 4LSPL 4J12A 5T5FL 1LK3L 5IBTH 4BSVB 2DI8A 3OAWA 5AOMA 1IKOP 3RGVC 1QQDB 3U4AA 3BKJL 1Q72H 5D9SB 3QWOB 3VFSA 1E28B 1EAOA 1YECL 4Y4KD 3FFCB 1F02I 2ITFA 3APCA 1N0XH 4GAFB 2F1BA 4XR8C 1HOCA 3C9NB 2L7JA 2E7MA 3DX6A 4ACPA 4N1HB 4PS8A 4HWUA 3O3EB 1PY4A 1BQHB 3D69B 4JDZB 2AXFA 2B59B 3VD5A 5DVKA 4KZ0A 4RVBA 1FFPB 5F3FA 3Q13A 3OX8B 2ITDB 2ZG1A 3NP3A 2KUTA 3OGCB 2AMUA 3ARGD 2Z3FA 5F1IA 5ETUB 4PR5B 4G6MH 4QO1A 1DQDL 1BMGA 1WF5A 3CMOH 5DUBB 5DHMC 2VLKD 4KJPD 2YOCA 5JMOC 1HWGB 2H1PH 2ZNXA 3MU3A 2UZIH 1CFNA 3WS6A 1KV3A 3WYRA 1EHKB 4M48L 5D7JD 1Y6MR 3MV8B 2VQ1B 2BP0A 2NY2B 2CNZA 1M7IA 2LV4A 3IJ7A 2WWKO 1PU0A 4YIQB 3MCG1 5F1OB 3MCYA 5IT2L 1NFIA 1OP4A 1E3ZA 4IS6B 1J86A 2ZPKH 3BUIA 5IB5B 3MMEA 2N3JA 2WM0A 3EADA 4F15C 3WTUA 1OGAA 4ANKA 3PP4L 2BNUA 2F7QA 2J4WH 2ICWJ 3QNFA 5IOPB 2IXQA 2APBA 2EKSB 3EO1A 3VSQA 4X9YA 4MNQA 4P5TB 2FH8A 2OMTB 2AJSL 4R90L 4N8VA 4NN6B 4Z77A 1HYRC 4ODBD 1E6OH 2VXQA 3V8CA 4ZW3A 3E3QE 2VN6A 2Z91A 3H9ZA 1XGTB 2Q3XA 5BQ7B 2I60L 2PO6B 4P06A 1FGVH 2XQBH 4WEUD 5TDNA 1E4WH 2Q10A 4LLMA 1FIGH 2C7FA 2HT3D 1DJGA 4OJFL 3F65A 4YSPA 3K6NA 2AEPH 3W9EA 1DJWA 5F1KC 1UZ6E 4TSAH 1YUKB 4BXVA 3ULAB 4MMZB 5ITBH 2EDHA 3D39D 3FRPA 3B83A 4WW2F 4ABQA 3VYOA 2IBGA 4KHTH 3BAEL 3FUNA 1VPOL 4NJAH 3SKMB 3IGKA 5JA8B 1AXSB 1MUJB 3P0YL 5KSAD 3TA3D 4K55A 1HN1A 2W0FA 5FA4A 5IB1B 3JTSB 1OHZA 4DQOL 2JJTA 4XI5C 4L1DA 2IAAC 5JXEA 5AZ2H 1P53A 1QUPA 4I77L 1A3RL 1N64H 4MGXA 1BW8A 1FNSL 2A6DA 4IGBC 2BY0A 2CHNA 1KV7A 5BMFH 4BFIA 5BO0D 3GS7A 3GMLA 4XCYA 4XI5D 4MXVE 5AYTA 4YHPB 5CN1A 1M6OA 5J0BA 4B27A 2XN9E 4GG8B 4EBQH 1FVEA 1RJZB 5MERA 4UT6H 3QIUC 3U0PB 1Z5YD 2YXFA 2BSDA 2OMBA 5DMKB 1A6VH 4NGHL 2RD0A 3V4PH 2XN9A 1W8OA 3ZSSA 4PP1C 3KCWA 2NDFA 1FVDA 3FRPB 4HC1H 1Z66A 4EQ2A 1RUKL 2VIRB 2ZCHL 1IGCH 3NPSB 3KLLA 3OR6B 4A55A 4K7FA 4G7YL 2M2DA 2CRYA 1CO1A 3QJVB 1MZZA 1WZKA 1A7NL 5FUZL 4HZ1A 4K94C 2D2OA 2Q76A 1XT5A 3H0TB 1A9EA 2IWKA 4QTFA 3ZKXC 1BVKA 4KKCD 4UT7H 3SGEI 3UXFA 3ILQD 3PWUA 1BQLH 5CWSB 5C07E 2PCXA 3N43B 3P30H 4CKVX 1KEGH 4F37F 1RY7B 5DR5H 1VENA 4HEMA 5FDYA 4Y2OB 5D2NB 4WI2A 3QAZC 5A3ID 3KPSB 3LTVA 4JFDE 5HDQH 1KUMA 5L2KA 1JGLH 3PG2A 3D3VE 3HC4L 3SKNA 1MIML 4NLAA 2V8MA 5DJAB 3FN9A 4WI0A 2NW2B 3IDJB 4DKEL 3NCYS 2W9EH 2VKWA 3D3VA 4GAGL 5BJTA 2BNRA 4JDTH 3V7AG 2DMGA 4QHMB 1RZGA 3CHSA 3HG5A 3LH8A 2YO3A 3DRQA 2I9LA 1J0HA 4AH2A 1IC5H 3HI1B 2D3LA 3MXVL 1OVZA 4LLMB 4PY7B 4BFGA 2CPUA 5BRZA 1LL1A 3HFFA 4O5LL 5EZLB 4Q6IC 2XC8A 1OCZB 1ZKAA 2PYFB 1I1AD 1QEWA 3EFFB 4FDWA 3IYLW 3LXBA 1CGXA 2Z93A 4Q4EA 3X12A 1NUNB 3PGCB 2QQQA 2CDGA 2WXQA 2Z4QA 3DJTA 4OD3H 2VM3A 4OVUA 1PPIA 3GXDA 1NEUA 3FCSB 4OSUH 4MNQB 4P5TA 1EEYB 4YDMA 4CC1A 2ZP9A 4PJXE 1YNKH 1QFPA 2XACC 2EP6A 4XH2A 3U2SB 2DBLH 2YRPA 4N5UA 3QFJE 1DJHA 3GXNA 4JDEA 1W0WA 1KCBA 4ES8A 1BBJB 1M71A 3WI9A 1OCCB 1FO0B 3BEWA 2R29A 4K9EL 4TQIA 2ZUQB 1AXTL 3VFRB 4R5XA 1F2QA 1T7WA 3BUYA 5C0JB 1XF4B 4F2FA 4LESA 5INDB 3FK3A 1ZA6A 3HBZA 4YAQB 3GGWA 4OTXL 3IFPB 2HB0A 4AQ1A 3ARUA 4JM2C 2RCSH 2XWBA 4PW4A 2Z7YA 4B5ZA 5I18L 2V7HB 4RFNC 1LP9B 3HVNA 3G7TA 1MDTA 3NA9L 4CMHB 4YSAA 3DX2A 5I16B 4GUPA 5T1LD 2BK8A 4DTGL 2DQCH 5GJSL 5LGJA 3WNIA 3DX6B 4GRWB 4Z7UF 4U05A 2QTVA 1P69B 2VXUL 4JGNA 1JPTL 4MCMA 1FJ1A 2V2XB 2E4FA 3T08A 4BGDA 3REVA 2A83A 3FO0H 3UTOA 4RGNC 5CBAA 3HR5B 2GBVA 3HHMA 2ADIA 3QUYD 2ADFL 2N7AA 4R2GC 3GSRB 4L37A 1TZAA 3IFLH 3QZOA 4LBAA 3PUCA 1A6UH 5KZCD 4N3UA 2FHFA 4YFLF 2DYPB 2X3AA 2A5UA 5IOKA 1OB1B 3QIBD 4HHAA 1KLFA 4ONOA 1TQBC 3FUFA 4PJAE 3MKGA 5HJ3A 4XBEH 1CF8L 3SDDB 2GIXA 1OQXA 3C6SA 2DQCL 5GJSH 5HDOA 5IROA 2V3FA 2WINA 1W91A 3DUSB 3GRGA 3PABA 4X6FB 1AC6A 4Y2LA 3P0GB 1BEYH 2DWXA 2G3ZA 2RCSL 5EDSA 4YHOH 4JM2D 2JQAA 2Q1EA 4AE0A 4CJ1A 3C8DA 4ODTL 4LCUA 3ARYA 3UP6A 5HHXH 5HHQA 1IGFH 2R69H 4LOFA 5KJ4A 5DS8B 2WVTA 4WO0A 3NJHA 1EO7A 2BZ7A 5INDA 3FTXA 1N70A 3K80A 1NGWA 1NBYA 3VMPA 2JCCA 4RA0C 2WIMA 3KPRA 4JN2B 1IC0A 3PJNA 1S6NA 1NAMH 3MOAL 4WSJA 3RKPA 4Y19B 4M6MH 3AM8A 3CU7A 3SE6A 4NFDA 4E0RA 1K3IA 2LLLA 2P80D 4OJYA 1Z9LA 2Y2TA 3WY1A 1F1AA 4HC1A 5FUCE 3PWJB 4PW9A 5HHPA 4JDEB 1BOGB 1WA2X 4B9CA 1A66A 4J28A 4P0DA 4I87A 3CFCH 1EEZA 1ND0B 2GSGA 1NGZB 4NENA 1JGDB 4M62L 1KYOJ 1NMBL 3QUML 4M1DL 2O93L 1TR7A 1U95B 1NANI 2W5PA 3GM8A 4MJHA 1RLBA 3P4OB 2F7PA 3QBTB 2XTSA 3R7RA 1TKWB 3UYOD 3UIZA 1CE1H 2I9TB 3H0TA 1HHHB 4OGZA 1T5XB 4X6EB 5IEKA 2FYVA 2JB5L 2M83A 2QR0B 1XBRA 1CICA 2RHEA 4JN2A 3GJFK 3B2DC 4F91B 2X4OA 3VFWA 1HCYA 8FABB 5T33H 4KBPA 3HE7C 3ARFD 4CU6A 1HVXA 1TZIA 3FSZA 1LP9E 1AOHA 5D7IA 2Z0UA 4HSQA 4PB9H 2GUOA 4LPWA 4QTIH 5CUSH 4ERSH 4RAVB 1A0QL 4DK5A 2IGFH 4TMPA 3PLYA 3WKYA 4KUZH 3GRBA 4I0PA 1R3IL 1CK0L 1GIGL 4H8WC 1T0NB 1UD8A 1ZS8A 3ZKQD 2NXZD 4RISL 2VDOL 2ZUTA 5LCVH 3ZKNC 1G9MH 4MDIB 5F7HA 2Y4SA 1WITA 1UWXK 2WTOA 3A22A 3ILQC 3CUPB 3NUKA 4OFYD 3L1OL 1BIHA 2VH5L 5GS0D 5D5MB 3GRWL 4JDVA 4K5MA 4XTRC 3L08A 4ATTA 3LKOA 3TESA 3LPOA 3SOBH 1UXSA 5C3TA 2OQJB 3OG4B 2VDOB 2Y6SC 3NSXA 3D25A 4WDIA 1D5IL 3VD7A 4NZJA 1FRGH 2YXWA 4IU2B 3FMGH 2AQPA 4L29A 3CSBA 3U1SL 2H6PB 3NT0A 2BIHA 3JTTB 4F9PC 1YRKA 2QADC 1CLYH 3ABMB 4OIBA 2MOGA 4PP1D 1QZ1A 1OF2B 1D5MA 2R56H 4XVJL 3GDBA 3II3A 4K7PL 2CGRL 5C07B 4CVWA 1DQMH 1ZSHA 4NT6A 4U6XA 3BQUB 4XAWL 3ZE2E 2CO1A 1NGYA 3T3ME 3DTDA 3Q9QA 3P9MA 3TBVB 1YEKL 3D0AA 1X4ZA 5CHNB 2AXWA 1AO7B 4WK2B 2RH0A 3WLBB 4B7LA 2R2CA 5D96B 2VXVL 2OYKA 4UUJB 1GOFA 1WIPA 3RU8H 3D8MA 1V27A 1WG3A 4TL5A 4DETA 2UXFA 2AQSA 5MEQA 1MG3C 3DRQB 5CCKL 1IFRA 5GRUH 3WSQH 1NGQL 2WN3A 3CFBB 4FRWA 5JOEA 1UM4H 3S8FB 2YD2A 4WTZG 2DKMA 4HSAC 1T5XA 4X6EA 5IEKB 1LJMA 2WXOA 3OLDA 2VZTA 5IJCC 3RX7A 3EJQA 3O0RL 4ODTH 5IVNA 2WQVA 3QHZH 3P4OA 3SKJL 3Q01A 3GKWH 1W0WB 1JD7A 2VDLB 1DFBH 2Y1VA 3ZDXB 2V9UA 4OIAA 2BLFA 2CDGB 2YUXA 2Z4QB 3WJJA 2C9UA 3QH3B 4AL8C 4WV1B 4N1EA 3F04A 2BVUA 4FA6A 1WFOA 5HHOD 4B7IA 4JDZA 3EZJB 2OZ4H 4HX1A 3DV4A 5EIIA 3BZDA 4HLJA 2R29L 4LSQH 2HYMA 3WJLA 3H54A 2E76C 2P26A 4HUKB 1X7QA 4ZOEA 4F8QA 3SYQA 5GSRA 2B4CL 4EDXA 1W0VA 3LB6C 2C9XA 5AVSB 4NDMB 4RFOL 3VXRB 4AQAB 1DQIA 1RSYA 1SEQH 5F9JB 1KTRL 3WG7B 1UH3A 4PG2A 4Y5XC 4BKLA 2BY2A 1M7UA 5DVPA 3GSQB 3TT1H 3TF4A 3CXDH 1MJ7L 2C3VB 2UWEA 2Z92A 3ZN6A 5T3ZD 1GY1A 1RFDL 1OAUH 1CURA 1FWXA 4M43H 3EFDL 3SYCA 5I1CH 1SXBA 3PWLA 5EN3A 3T2NL 1GS7A 5CLZA 2N7SA 2HUEA 4R4FH 1NBVH 2VSCA 1U91A 1OL0A 5DVMA 3SJVA 2LR4A 3RTQC 1KLFB 1U8KA 4JFPA 1G1CA 2CK0L 3A4FA 3GSOA 3LCYA 3NSDA 3OJMB 5E51A 3WJJC 2HA1A 1KJ3L 1JMZA 1HNGA 4FQ1L 4EF3A 1S3KH 1SYSA 4WU5B 4HG4K 2YR3A 3VXUD 4NI6A 3WS3B 3O4LA 3GS4A 1LDPH 4X4MA 3BAIA 3CH1A 3P3YA 4U1KA 1CQKA 4HGWA 3ETSA 4C55A 5INCA 3OMZA 3Q2CA 1BD2B 1JRHI 3K8MA 4DVRL 5I0YA 1A14L 4JFFE 4JKNA 3A24A 4Z7NF 4K15A 3B2VL 1S9YA 2AJUL 3D9AL 2BRQA 4K9EC 3ROLA 4PGJA 2X70A 2X9WA 3QIBB 4G6JL 1KBKA 2DYPD 4M4PA 1G7LB 2P5WE 3CLWA 4NM8L 2N01B 3QEHA 1OK8A 1IEBA 2WWNA 4LO9A 3HRPA 1ROWA 4YSRA 1M56B 1QWUA 3ZPDA 1YDPB 2F53A 1ZOXA 3TEZA 2Z91B 1J8HE 5CR8A 4W4NA 1RJZA 2A1WH 1SYVA 1U0QA 3L3DA 5MERB 3LKRB 4QHPA 4B9ZA 1VB9A 2WYIA 1TT6A 2H47C 2VWEC 3RIFF 3NTCL 5CF3A 3OF6A 4KKZA 2OL3A 3CFDA 4XCYB 4R5TA 3B6SA 4G8IB 1J9RA 2G3NA 5E1QA 1E9OB 4ZMLA 1L6XA 3C08H 3IFOA 3NN8A 1MCOH 1ZV9A 2ZPKL 3LKPB 5B7EA 1H3GA 4QRQA 2BSCA 2R27A 3TYGH 1CI3M 4PJ6A 5FA4B 2R1YA 4BKLB 4NSKB 4ZFOA 1FFOB 4DKEH 2FWOB 1L6PA 3ZKMD 1RZ8A 1UURA 1W72B 5GGTL 3TBWA 4N9GB 1W0V