1F1AA

Crystal structure of yeast h48q cuznsod fals mutant analog
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
153
structure length
153
Chain Sequence
VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIQEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER-ZINC SUPEROXIDE DISMUTASE
publication title A structure-based mechanism for copper-zinc superoxide dismutase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 38
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1f1aA00
2NNXA 4OJAA 4A7UA 1F18A 3GZQA 2Z7ZA 1B4TA 1EQWA 4A7GF 3K91A 2GBVA 3H2QA 3F7KA 2E47A 2WYTA 1OZTG 3PU7A 1JCVA 1FUNA 3KM2A 4N3UA 1SXBA 1YSOA 1OZUA 1Z9NA 1HL4A 1Z9PA 1U3NA 1RK7A 3RE0A 2VR6A 3KM1A 1S4IA 3KH4A 2ZKYA 2E46A 3F7LA 3CQQA 3LTVA 1BZOA 2AQPA 1BA9A 2V0AA 1N19A 1SXCA 1E9QA 1P1VA 2VR8A 3GTTA 4U4IA 2WKOA 4BCYA 1XSOA 1OALA 1IBDA 5KBMA 1PZSA 3GZOA 3HOGA 4N3TA 1XTLA 1E9PA 2AQRA 1SDYA 2ZKWA 3HW7A 1CBJA 1B4LA 3CQPA 1AZVA 2GBUA 1MFMA 1N18A 4A7SA 3S0PA 2SODB 2XJKA 1F1DA 2Q2LA 3SODB 4BCZA 1F1AA 2AQNA 1PTZA 2Z7WA 4BD4A 4A7QA 3QQDA 2ZOWA 1CB4A 3ECWA 1E9OB 2WYZA 1OAJA 1TO5A 1SOSA 2Z7YA 3CE1A 4L05A 2WZ6A 4A7TA 1JK9A 1IBHA 2AEOA 2JCWA 1YAIA 3GZPA 2AQQA 1HL5A 1OEZW 4FF9A 1SXAA 2WKOF 2R27A 1IBBA 1UXLA 2Z7UA 1SPDA 4A7VA 2C9VA 4MCNA 2ZKXA 2WWOA 2AQTA 1IBFA 3GTVA 1TO4A 3MKGA 3GQFA 2AF2A 4B3EA 1KMGA 2K4WA 4MCMA 3QQDB 5KBLA 3KBFA 1SXZA 2C9UA 4A7GA 1SXSA 2LU5A 3HFFA 3KH3A 1IB5A 1EJ8A 2WZ0A 3KBEA 1SRDA 1E9QB 1PU0A 3H2PA 1JK9B 1UXMA 1SDAB 2WWNA 3ECUA 4OH2A 1ESOA 1COBA 1E9PB 1QUPA 5CU9A 5KBKA 2APSA 1XTMA 3T5WA 1YAZA 2VR7A 1SXNA 2XJLA 3MNDA 2AQSA 2GBTA 1E9OA 2WZ5A 1DSWA 3L9EA 1DO5A 1F1GA 1Q0EA 3L9YA 3ECVA 2C9SA 1L3NA 2JLPA
chains in the Genus database with same CATH superfamily
7FABL 2NNXA 2KZBA 4YEEA 3A6CL 1Y7VA 3OR7A 2X70B 4ZW7A 5LXGL 4MYPA 1Q0YH 5LNGA 4NRXA 1EXGA 2V7HB 2XT1B 5D5MA 1NM4A 1QKZH 3OXRA 5M7QA 2VDRL 2UYLB 4F7MB 2R69H 3Q7JA 4OFPA 3WMSA 5F88B 5D96C 1QAWA 1JVKA 3GMPA 4LOUC 1U21A 1YPZA 3S88H 3UO8B 1KPVA 3D7PA 2PYED 3HTLX 3VXME 1D5XA 4AMKL 1MWAH 4GNKB 3RVWC 2KHAA 1SZNA 3ZO9A 4OTXL 1P5VA 3QNXB 3FQXA 1A9BB 4GMSH 2PCXA 1NOAA 4WW2B 2I9TA 3UG5A 3N0AA 1FH5H 4NP9A 3WNPA 1A6PA 5IBUB 3HI6L 4IBYA 3DHJA 1INEL 5FWQA 2OJ1A 3VFSB 3T0EA 2IDQA 3O2DH 4M7JH 4B97A 3FMGH 2LU3A 4HIEB 4MRCA 3LKSA 2ZZUT 5HGDA 1K85A 4F8PA 2V17L 2JH2A 4OLVL 1N64L 1FFPB 3HG1B 1Z7JA 4WU5B 3SYCA 4XXCA 4S2SB 5IW3A 3TNMB 5JHLL 2CXKA 1GTNA 3DUHA 5AWNL 3MV7D 2Y5TA 3S2CA 3EFDH 2OI9B 4NWUL 3VFVA 2IH1B 4M6MH 3TBYB 1JWMA 4MA8H 3WS3A 4KHXH 4BXSV 1BFVL 3QO0A 5BZXA 1H8LA 3OAUH 3WIFA 4AW7A 3P3RA 3FB8A 2HKFH 5KG9A 1X9RA 3MNVB 4FXGC 5B39G 3DGGA 3I84A 4ZXBD 5BRZE 1NGYA 3C2SA 1HQRA 3QXAB 1XBRA 2VLME 1A6AA 1KTDB 2X6CA 4ZPTA 2WUBL 4LCWB 4HAFA 4LEEA 4N2MA 5F7AA 3RNKB 4FOMA 5EORH 3D48R 5IB4B 3BP7B 5D2NE 3GS0A 1I85A 4X42A 3P2BA 3LN4B 2XPZA 3F12B 4WZ9A 4GJTB 1JHLL 4XRCA 1G9NL 3AY4A 4YHPB 4K8RC 1TVBA 3NABH 4ZUSB 4HCRH 2Z8RA 5IOKA 2NOYA 5DA4A 3FT1A 1MCKA 2FSEA 2FTAA 4PCKA 1KG0B 3GLDA 3BGAA 1LDPL 3KW7A 4NYLA 2YPVH 3BAIA 3L4VA 3Q01A 4ZPVA 4ZW6A 3FKUS 5IW6B 2XLLA 3SE4A 3BFQG 3EJSA 3E9UA 2JELH 1OM9A 3Q6GH 1XMEB 2CD0A 4JFYA 4X7FC 2H0EA 4AMWA 4NQVB 4P4KB 3GIZH 1BEXA 3L3IA 3NGBC 3OAYK 3ZHNA 4Z7NE 5FS5A 2HH0H 1YEJL 3NJMA 5FV1L 2EDMA 1FPTL 2YD0A 4N22A 4PJBF 1BZOA 1FJ1B 2Q86A 1BIIB 1EAJA 3HPLB 4Z7OE 3B9KC 2NTFB 3LKNA 4Q58C 4KX8A 1QTSA 1Q38A 3HA0A 4YH6A 1PG7X 3VXRD 2XWRA 3N40P 3GGWB 4GKOA 5CHNA 1IC0A 2R4RH 4OLWH 2WCSA 4LVNC 3OAWA 5D93B 4X7CC 4HMDA 1KT2A 4HFUH 4A2DA 5BOZG 2DQFA 1BZ8A 3V5HB 4LCYB 3C60B 1YN7B 5A2BA 3U1SL 4HF5H 1VFOA 2BFGA 4HHAA 4KK5D 2XJKA 3S48A 4WRLA 4RH4A 5EWIH 3MNZB 3RL1B 2PTTA 2R0WH 2OMVA 4NT6B 4HS8H 5I5IA 1S7XA 2MKWA 5KVFE 1RFDH 1ERNA 5IVOA 1UCTA 5E4EB 2DWEA 3BPLC 4PW3A 1FE8H 2BOLA 5AYQA 2Z8VC 5GRWA 4OCRL 1L4IA 5DRWA 1T0MA 4XAWL 2VXQL 4L29B 2QGCA 3PWVB 4JJOA 4M43H 6FABH 1EK3A 3LEXA 4ZQKB 3KMDA 2CLZA 3MRBA 2GIXA 2E6PA 1CI3M 5AD0B 3T04D 1QBLL 4FQXD 1C16B 5TPWL 2D9QB 7TAAA 1BQKA 4IK6A 2NX5A 3VW3H 1FFOB 3AGWA 4E9XA 5T3XL 1A4BA 1GJIA 3U6XS 1ID2A 4I0PD 1WC7A 4K15A 1IAIL 1NUNB 4GUQA 2CCVA 4XNDA 3IMWA 5J12C 2ADFL 2CIKA 4QTIH 1G7PB 2AXJA 3WJJA 3FULA 1U8HA 3H2PA 5DRNA 5FGCB 3HRZA 3OG4B 1BXUA 3N1PC 3RNQA 5D2LA 12E8L 4M48H 4JFHE 2BLFA 4XBMA 1CL7L 5D7HA 3AROA 4HJIA 4KK8D 1U92A 2V2XB 4L37B 5TDPA 4AKOA 1JGIA 5DVNA 2ZXGA 5IFAL 5FO7A 3E7JA 1JGVL 4PGBA 5CEXB 4XO3A 2VDLH 3WSQL 5I30H 2WXOA 1A6UL 3GF8A 1TZHA 2ZOOA 3RHWF 4ZW3A 4QHLB 1PZUB 1HYSC 1IKNC 3QARA 4OLXH 4JKPH 1Q0XL 1RPKA 3GXUB 3WFBH 2LLLA 4XVSL 5IUCA 5CZVH 5HP5A 5KTEL 4PV9A 4FZEL 3L5HA 3WUWA 3RWIB 2BSCA 4LVEA 2ICWJ 2YUXA 3RE0A 1EHLL 4OCYH 5FDWB 3QI9A 4PS8A 1E8WA 1I3GL 1UOKA 2HRHA 4LCCA 3K71B 3DRQA 4N87A 3Q05A 4KQ0A 2X09A 3EO1A 2DQCL 3P4MA 3KBHE 1T20A 2GCYA 3GNMH 3TZVC 5DZAA 5D71L 1DDHB 1NPNA 2A6IA 4GW4B 4MA7L 4MBOA 3ZZSA 1UFUA 1N4XL 3CU7A 3KYMB 4PWGA 4X4XA 4MAYC 3LZNA 1Y1DA 4WJKB 4BRVA 4P2QB 1BPLB 4YPJA 2YPLA 3BEVB 1QUNB 3IJ7A 4M8UA 5FCSH 4B9PA 4YSRA 4F9LA 1KLGB 3BT0A 4R0LC 3T2PA 1DJZA 1NFAA 2DICA 4HUCA 1RZJC 4RMBA 1MW2A 1YQ2A 3SQRA 3POHA 2V9TA 5JHDB 4AQAB 1T1YB 3RLSA 3AU0A 2Z7YA 3W0WA 1CLVA 1CD1B 1PNCA 1VDGA 3D2UB 4P9HH 2X2IA 2YMXH 1AHWC 2NXZB 3JV5A 3UTTE 1CICD 2Y69B 1JI1A 1NCIA 1DL7H 2QELA 3V0VB 4AX3A 3IKCA 1OTTC 4GKZB 5JNYB 3POCA 3WHE0 5GJSH 1HZHL 4U0RB 1ES0A 1I1YA 2UWEF 3EYFB 2WBJA 2N0KA 3RHWK 4KDTA 2CJUL 4DT2A 1HQ4A 5FYJL 1AP2A 4UAOB 1PMYA 3E38A 1I7ZA 3GMQA 3E6HA 5AVTB 3FQTA 4I3SH 4HWEL 3CFJA 4CC1A 2WWMD 1B0GA 2HFGL 1IFRA 4F7TA 5ACLA 3BFOA 4V1DB 5I1HL 1XB8A 2H0FA 2G3MA 3FUHA 2XQYA 4JZOA 4RMWA 3HBQA 1IC4L 1RPUA 4N0UA 1XF2B 1DLFH 5G5DB 4PRID 4DQOL 2EILB 3ESVF 5CU9A 1RIUH 4M6OH 3APCA 3ZPDA 5EO1B 1XTMA 2ARJA 4ABVA 4M6NL 3E8UL 3U83A 1TTBA 4Z3IA 3R0NA 5F7UA 3HKFA 4YDNA 5IB2A 5C09A 5C0AA 1YUHA 5CEYB 4ZO9A 4CAGA 1NCHA 3LRHA 3WLWD 4Z76A 4JO2H 2R2BA 3BHBA 2LGNA 4Z5RB 2DEXX 1RSFA 1MHPL 2K78A 1QLEB 3N85L 1CLOH 4X9FA 3Q9QA 4XCNA 3OKKA 5BS0A 2C1OA 1QP1A 4Z3TA 2KPNA 3IMSA 3OF6D 4L4TE 2FJSA 3D4YA 2O26U 3LZFH 3QIWC 5I8CB 4AT6A 1E8XA 4PGCA 1Q0YL 1Q9KB 2UX7A 3DBXB 1GGBH 1I8KB 1EO8H 1K9TA 1PLCA 1R3JB 4P5MB 3V7MA 4YHNB 3JZ7A 3KYNA 4RMVA 4ZFQA 1QKZL 3ZMEA 3DSFH 4WV1B 4CL7A 1AIFB 1OAZH 4NRZB 2LV4A 5IHHA 4XMPH 2R69L 3DTXB 5CWSA 3RFRA 4Y2OB 3FO2A 4HLEA 4XMTA 2H6OA 4JFFA 4HUWA 2IPUG 1FVDB 5C92A 4Z0BH 4R96A 3S88L 1C8PA 4R4FH 2PP9A 4R2GC 3EOBB 5B1JA 4ALAH 1MWAL 2VZ1A 1E67A 2QKIA 1I9IH 5D7JA 2EDFA 1TUPA 2X4RB 3LKQA 1TIUA 4OZIF 3BN3B 1BFOB 4GMSL 3VI3E 3QUYC 3IMVA 1N0XH 1FH5L 4FXLA 5KBDA 4GEIA 3O9WA 1XIWD 1NC4B 2I5YH 2G2RA 3DSNA 2EZ0D 3DX6B 4BFRA 2NY4B 2W0KA 2ATPA 3O2DL 4M7JL 5MEOA 2FR4A 3FMGL 3BN9C 1BAFH 4TUOB 3O11A 3LKPB 4YBLC 2VL5A 2X4TB 5CIPB 1GXEA 3KPRB 1DJIA 3MAWA 3AY2A 3JWOH 3ZT7A 3QDJE 1DBJH 1WCQA 4MNGA 4ZSOB 3VGAB 3EFDL 5KVEH 5EU6B 1TCRB 2J88H 4KUCD 4H0GA 3MTRA 2MSPA 3HNSH 4M6ML 5SWSB 3TFBA 4MA8L 2B16A 4KHXL 5FGSA 4BSJA 3OAUL 1LEIA 1OK0A 2V2TB 1IC7H 2ENPA 2HKFL 4HKXA 2E8YA 3SDCC 3ZKMD 4M7ZB 1YEGH 1NFDB 3PQYB 1N6VA 4QRTA 5LNDA 1ACZA 1KJMB 3FQNB 1XD1A 4V11A 1USQA 1WAAA 4YAQB 5F0PB 3HC2A 4AUUA 5BCAA 4JPIA 1QHOA 1DDTA 5IVZB 5EORL 4WWKC 3VG9C 5CJXC 4GS7C 2XVKA 1I3UA 1BXXA 1NLBH 2FWOB 2J1WA 4LDOB 1G7IA 4D9RD 1DEDA 4UOZA 1I7TA 5F6HI 3AT9A 5EBWB 4AYGA 4KH2A 4N25A 4MTMA 2BVOB 2WTRB 3C9NB 4TNEA 1KGIA 1WFIA 3NABL 4HCRL 2FEEI 1K3ZA 1CXFA 3SCMA 5FXCH 3VNYA 1AXTL 4ECNA 4MJ4A 1P7BA 2YPVL 1NANH 2YPKA 1F4XH 4GFXA 1F4HA 3OQRA 3M88A 4JFXB 1R3HB 2FZ3A 3ATEA 3G5XB 1NIEA 3TLRA 4LASH 5EULV 2JELL 3Q6GL 2EC9T 2MIZA 5J7CC 1I3RB 4JFOB 2ZCLH 5L8LB 3VRJA 1RVFH 3R8QA 4Q6IA 2MRYA 4JVWA 4Y16A 1PZAA 5ICUA 3GIZL 4TQEH 1ZLVH 4XMXA 2HH0L 4RAUB 3RDTB 3PDOB 2ZXBA 4N3TA 5ICYA 5EA0H 5JXEA 2MNUA 4S0SD 1WBYB 4K5LA 1RJZB 2ENJA 5K39B 2IFGA 3TO4A 5I24A 4OLWL 5ISZA 3T8VA 2FX9H 1PTZA 4F3FB 4HFUL 1KYDA 2MFNA 4M4RA 5LCVL 3RY6C 4XNZC 1H9VA 4I77H 1UA6H 4HF5L 1OAJA 3ARGA 5DURD 4N6QA 4X5XA 4GP8B 4APQA 5EWIL 3G6AB 1IQDB 3BVVA 4J1UB 2R0WL 2W07A 4HS8L 1YNTF 4Q6KA 1YAIA 2DEYX 3TCXA 1RFDL 1Z0MA 4GXFA 1CE6B 4GW5A 1FL6A 5FA4A 1FE8L 3QWQB 4WI7A 3KWXA 1S7RA 1GZQB 4MX7B 4M43L 6FABL 4MWFA 4N2KA 4PJGB 4KK6C 3RRQA 2IVFC 2G2NA 5D9SB 2R9HD 5I17B 3WFDH 2VLRB 1LL1A 1KIPB 2VABA 4N4YB 2JJVA 4N8VG 3QJXA 3RB7A 3RTQD 4TNWK 1ND0B 1W0WA 3VW3L 5IUSA 5BJTB 4KU1A 5IV2B 4WHYH 3T0DA 4PBWD 4NNXB 1C12B 3LXUX 2H0JA 5C07B 4QTIL 1B0RB 1L9NA 4QIRA 3NIGF 2OMWA 1ODUA 3MA7A 4I2XE 1MUJA 1V27A 4NNYB 3UZVA 1E2WA 2X4UA 5EEUA 4M1CD 4M5TA 1LILA 1DO6A 2WXNA 1GC1H 4PBXA 3O6FA 3FOMB 4M48L 1P6AB 4NJ9H 4Z7VF 3BEWB 2XWJB 4JKKA 4DAGH 3QJZA 1JTPA 4AOFA 4LDCA 5KS9F 3HPJB 1KSRA 2KZ1B 2E7MA 4K23H 5EZPA 4H8UA 2XQYK 4MMXB 3C75A 2MMXA 2EVGA 2J3SA 3QQNA 4QJ5B 2VGLM 5I30L 2ROYA 1IZKA 5KSAD 5INDA 3CBRA 1IAKB 4GT7A 2GHZA 3RZCA 2R8SH 3BLKA 1GGIH 4OLXL 4JKPL 4YE4H 5CBEA 1TLMA 3WFBL 3QW9A 5CZVL 4IKKA 1XQ4A 1AQKH 1AGDB 4NLHA 2QR0A 4N28A 1ZGLP 3D6GA 4OCYL 2E7LC 3T0AA 2QSCH 3FFCA 4WO4D 3S8WA 2N0MA 3FDWA 4JPQA 1B2WH 4FZ8H 4GH7B 1SDYA 2PTVA 3NJIA 4ELKA 3S5LG 4S0HA 1UWGH 4MASA 1G9NC 3GXTA 1Q9LB 2CZNA 2F74B 4GPVA 1BVNP 1UCBH 2GT9B 2J8HA 4C57C 3UPRA 4MXVE 3EFOB 4DOHE 3T0EE 4KI1A 2BCKA 3SDXF 1TYEB 4A04A 2OYMA 3TBSA 4HIIA 1BLNA 1A6TA 4L4VD 3H6AA 4N2DA 1WE5A 3HJEA 3SZ6A 5I23A 2XG4B 4WEUD 1MZZA 1FRGL 3UH8A 1SDDB 2PWFA 3ZT6A 2ZD0A 43C9B 2X41A 5KYWB 5GSVB 4TVPE 2YEZB 2F61A 2CO6B 1Y6MR 3LNGA 4GUPB 4CUCA 3I6KA 2APTA 2AMGA 2KC0A 3GJFH 3H42H 5EN3A 2ZXWB 3DK0A 1KTKE 4MQXC 3VGHA 4MSWB 3FW6A 1SEQH 2AANA 3CDCA 1RUQH 4FXKC 4P9HL 2FWLB 1G6RA 2JXMB 3J8F7 3GBLA 3PL6D 2IADA 1BX2A 4WJ5A 3SDAD 2FRGP 1FHNA 2WXJA 1DL7L 3SPJA 5I0WA 2JJUA 2XYBA 4I18B 5L2KE 2APXA 3NCYP 3QDGA 4J3OC 3DVIA 3PRZA 2PXYA 5GJSL 3CN0A 4K5NA 4NQSB 4FNUA 5E6ZA 3BH9B 3DXAB 3PQYD 4CRPA 3KBEA 4P2AA 3CSBA 5DJYB 5BPPA 1UWYA 3CFDA 3MXWH 2NYYC 4I3SL 3EBIA 3K6FA 1IV8A 3SY6A 1V3MA 1S5HA 2QGEA 3QWRA 4D0BA 4DUWA 3DV6A 2E9BA 2VQ1B 4PJDB 2YZ1A 4MDJA 3LB6D 2UX6A 5HXMA 4G5ZH 2B4CH 4GFTB 5SX5H 2QV2A 3FHEA 3MO1B 1DLFL 2XWBB 4E9LA 4P5RA 3ZIYA 4HX1B 4P57A 1RIUL 5CD5D 5TK2A 5IHZB 2GITA 3MRNB 1JMZA 4XGZB 4YLBA 1QG3A 1HHHA 3IKKA 1CURA 5IB3B 1CCZA 2VDPH 1NKGA 4TSAH 2H3NA 3W39B 1BZ9A 1PNDA 1ZHBB 3QORA 4F24A 1I8IA 3MREA 3MUGB 3ZTDC 4JO2L 4DN4H 3U48A 3T2LA 1ONQA 4QRSA 1E4KC 3VFGH 3P73B 1VEMA 5ESVB 5IROC 5FYLD 1CLOL 1EJOH 2F1BA 2L04A 4WIQA 1FC1A 1OLZA 2PETA 4WW2C 2CBQA 2GJJA 2APFA 5IBLD 4I3RH 3BYTA 1UXWB 3LZFL 3OL2A 1M7IB 4LEXH 4XWOD 2EDHA 4JY4B 5DD6B 1GGBL 4EDXA 1EO8L 1QR1A 2A1WH 1KB9K 5CAYB 1UUNA 3DSFL 3HG5A 4RGND 5DJ8A 5E8PB 3EH3B 1OAZL 1J5HA 2H0PA 4TMPA 4XMPL 1R47A 1CGVA 1M71B 3CG8A 5CXPA 2VQTA 1AOHA 5F6HJ 1GW0A 1PG7W 2NCMA 3ES6B 2W65B 2OI9C 2UXGA 3FUEA 4AV4A 4YMPA 4NQQA 1CWVA 3GPEA 4S1SH 5ACZA 4Z0BL 1ZT4A 5E1QA 4R4FL 4AQEB 5GSRA 4ALAL 1S7WA 4HMCA 3TM6A 3FQWB 2AJYH 2EECA 4NENB 2HX8A 2BS9A 2GY7B 3ZDZF 5IK3B 5FLVA 1U91A 3UL4A 1IILE 5C9KA 5DJZB 1JGEB 1SXAA 3D50A 4LIQH 2HP4A 1WDAA 1N0XL 2NX5E 3ESUF 3DUSB 3QJQB 1QSEE 1MNUH 3ULVH 1K5NB 2FWUA 2I5YL 3K6NA 1R17A 1J05A 1TITA 1AKJA 2YKLH 2ZG3A 3T1FA 5GXBB 5F72S 5ESQB 4HWZB 1BAFL 3QEGH 4B3EA 5E2TH 5EDSA 5C08D 3ZDXF 3WHXB 2DMHA 2VQUA 3QXDA 3UAAA 4N86A 3JWOL 3D33A 1EBAA 3CN4A 1DBJL 5ADOH 3DO4A 5IWLC 2FEDD 5KVEL 4PGJA 5C07D 2J88L 3F7YA 5F7DB 2G9HB 5HHOE 1UJ3B 3HNSL 4PLKD 4XMUA 4OZIE 1JRHI 5ICZA 1A2YB 2Y7MA 3B2VH 4X0KB 2QPSA 3O0RH 1IC7L 3WJLC 2OMYB 2I85A 2ZXEB 3OKEB 1YEGL 2AQSA 5FECB 3U4AA 1JN6B 2VC2H 4P4KC 1SHXA 2VN3A 3BSHA 3GJEB 1RU9H 2BINA 2A5UA 4MD5A 4Z18A 4NFBA 1NDMA 3GSRA 4YIQB 4BSVB 1PY4A 3C5ZB 5DD5H 1E4WH 4JFDB 1IGJB 1A4AA 1NLBL 2CU9A 5DD1H 3UCQA 2KMWA 3KM2A 1WITA 3IJ8A 4HS6B 2X28A 1YSOA 5GGSA 3W9EB 2X42A 5D93C 1T7XA 2ADYA 3ZN6A 5B8CA 4JPVH 5K59F 3C60C 4EPSA 3LAFA 2NR6A 2YC1A 2YSSA 2PPEA 1MREH 1ED3B 3CLFH 3R06A 4K7PX 4PR5A 1T89C 3EJYD 2TRHA 3FT2B 1F4XL 3WTTA 3OB8A 1KXTB 4Q14A 3T4AB 2Q6WB 3VE0B 2EEFA 2WKOA 3BQUD 1JZGA 3DC0A 3FB7A 3HHSA 3GJFB 3DRTA 5KSBB 2YPLE 4P23B 1YEEH 4G8EB 2ZCLL 1RVFL 2CHXA 2OL3H 2WQXA 3FN3A 3LHPH 4PTUB 1HAUA 3QJHB 1CDJA 1WD9A 4TQEL 2EC9U 4QRPD 3WY3A 2YFNA 1FFRA 5HHNA 2VDOB 2SODB 3U7AA 4UT7H 2WXGA 5EA0L 3W0WE 2WB7A 2WJ5A 3APMA 3BIAX 2NY1C 2P43B 3GLZA 3UDWC 3D4CA 2OZNA 3GSNA 1Y07A 1JIBA 4ABWA 4JRXB 4C4BA 3VFOA 4DVRH 2Z64C 1S3RA 3MROA 3BH4A 2F8XC 3SDDD 2GSIA 2HG5B 2DD8H 2VMCA 2CO7A 4U1JA 3UBXA 2CSPA 1BAWA 5AUMA 1UA6L 4FQ2H 1J8HB 1MCIA 4NM4H 2KLSA 2V8LA 2IQ9H 5E6YA 3U0PA 1TZGH 4XI5C 1LO3H 1JZFA 3KLAB 2EO9A 4HGWA 4NSKB 1JD9A 5HVHB 4J5VA 5JIMA 2WP3T 4ZUTB 2QVMA 1L6ZA 3APDA 4E9WA 5F9JB 5I1DA 2DLTA 3BRDA 1XDTT 3MFFA 2DM7A 4JQIA 3QFGA 4IMLA 3LV3A 4NQXB 4H8QA 5GGTA 2VDPB 1CFSB 2Y4SA 1SHSA 4N0UE 4XBGA 5I71B 1RULH 3O81A 4P5TB 1A3ZA 3CMGA 4KJPC 3WFDL 1ZGLB 2W0FB 3KWVA 4Y5YB 2OYPA 2DYPB 2EXWD 3B9DA 1EWHA 3HAEG 1HJCA 5C09E 5C0AE 4P59H 3MRMA 3ELAT 1OARH 3QZWG 1U3HA 5CU5A 4H2CA 3LIZA 4YOKA 4HHWA 4Q74A 4Q89A 4PW4A 3O4OB 1H3WM 3GMNA 3JBG7 4DPCX 1WT5A 5KSBE 5T5FA 5HY9B 4X7SH 4AW4A 2X7LA 4W4OA 1F6AB 1ZT7A 5IM7B 2X3AA 1GW6A 1M7UA 5BS0E 1GC1L 5F7FA 5IIEB 1UC6A 2J56A 3U4KA 1YEDB 4NJ9L 1C7TA 1UVQA 2FJHB 3HE7A 4JFWA 4NI6A 5T1KB 2VCOA 2NY5C 4FERA 2OZ4A 4DAGL 1S8DA 4QNPE 2VQ4A 5KYXB 4Y4HD 2WZPA 1LXMA 3FH5A 5F7YC 4URKA 3RGBA 5IOPA 5D6DA 1K2DA 1OZUA 3I6LD 2QKSA 4K23L 1HL4A 1TJHH 3OXSA 1HHKA 3BWAB 2QLYA 5H8DA 3ESNA 3VI4A 1QFHA 5AENA 4A6YB 1BVNT 3EGXB 2W92A 4YSTA 2PPAA 4QF1A 2YD5A 2R8SL 5D7IB 1PZ5B 1GGIL 3HC4H 3MLXH 1MCJA 4YE4L 3NIGE 3X3FH 1RHFA 3A21A 4BZ2A 4JFFE 3P9LA 3LQAC 3EG9B 4J27A 1AQKL 3IMBA 2CALA 1MLCB 2X87A 4U6XB 5BO1H 4XNYH 4LP8A 3HIZA 2NXZC 1LP9B 4N90E 4Y5XB 5EPMB 4GSRA 4D7PA 5DFTA 1U8LA 2YAPA 1JE6A 1HKLH 1FGVH 1UENA 2QSCL 2HVKB 1M05A 1M3IA 3HLAB 1F1DA 3QBTB 5FUZH 1B2WL 1KTCA 5J9PB 4FZ8L 3K6DA 4U0RC 1UWGL 4PB0H 1VRSA 3AU1B 4MJ2A 1UCBL 3RWDA 3EJPA 3QR2A 4UAOC 4DGWC 1LO2H 1KB9J 4CDHA 4AVIA 2EKSB 2XN9A 1U95A 3LNHA 3QIUB 4FDWA 3P0VH 3O4LE 2KZKA 4MNHA 3K1DA 2X4OB 1B0IA 2E56A 2YWYA 3GB7A 2ZUQB 4MNGE 1URIA 1YEKL 5F3HA 1RIHH 1EDHA 1F13A 3H42L 2L8AA 2P28B 4RA0C 3G08A 1ADQH 1SEQL 4A55A 2XBTA 2XVLA 4G80B 1RUQL 1KUMA 1VACA 3ZYOA 1HH9B 3GUFA 4GSDH 3VMNA 1UYWH 1OP5H 4NUGL 2WIIA 4QEGA 3W5NA 1VLXA 1AR1B 4J2QA 3TN0A 8FABA 1H8NA 5I75B 4LMQI 3L1EA 2GSGA 3V10A 4NKIH 3MXWL 4QXVA 1HXMA 2ZTBA 1UKSA 3NCJH 1RSYA 3OLDA 1H0DB 2PPDA 2ZX6A 5BXFA 1C08A 3QFJB 4FQJH 4JFDD 4JRYA 2ED9A 1EANA 3ZR6A 5I1GH 1EBPA 4WV1C 4AQ8A 1FHGA 4G5ZL 2B4CL 3T3PF 3BVTA 2GI0A 4DP0X 1E6JH 2OL3B 4L8SB 4Z7QF 4UIMA 4DP7X 1ITCA 3QCTH 3IGAB 4ZMZA 5C6PB 1T1XA 2VDPL 5ES4B 3S37X 1A1MB 3T65B 1G4MA 4TSAL 4HA1A 3RKPA 1HOCB 2J71A 2AAVA 3CHPA 2EH7H 1T2JA 1S4IA 3SB3A 4ZOBA 4DN4L 4WKXA 1EEZB 3STLA 3VFGL 1T66C 1IM9A 3CIAA 4YPGB 4X6FA 1EJOL 3P9MB 1IIKA 1DN0A 4ZMQA 3RL2A 4Y4KD 3HUJF 1PLGH 2ALAA 1D9KD 4I3RL 5DVOA 5A2JH 1LE9B 4LEXL 4J23A 3JZYA 5CCHE 3RY5A 5KVFH 3ZDYB 3BKYH 1JNLH 4UQAA 2NY4C 2A1WL 3ILPA 4FLQA 2PPFA 3S0PA 3DIFB 1U3JA 2E59A 3KYOA 3RVTC 3VGEA 3KGTA 4BWTA 5CCGE 2R1WB 4YSOA 3MOAH 4BH7B 2A6JA 4NQEB 3QULA 5GGUB 5EIQA 3VGAC 4R7NA 1MFEH 2X4PB 3TONA 1C5BH 3D18B 3EJCA 1AY1H 4S1SL 1OSYA 3CC1A 5CFHA 4OZ4B 3GXIA 3RX5A 5L9DH 1HEZA 2A83A 3T4YB 3N44B 1SHWA 4IJ3C 2AJYL 3UBXI 4M7ZC 1QQDB 4E42B 3BGMA 4NZUH 3ULUF 4MDIB 7PAZA 3BO8A 2F7PA 3BP4B 3ARDD 4LIQL 3FBKA 3GBEA 2IPTH 3FAWA 1TT6A 1NIAA 4G6AD 1RKRA 2EJ1A 2K4WA 2NSXA 3T6XA 2R2EA 1MNUL 3ULVL 1I53A 1A65A 3GSNH 5EC1B 2YKLL 4MMYA 5DFAA 4ETQA 4BGLA 5E2TL 5FF6A 3BP6A 1QSFB 3I6GA 4FKEA 4X9BA 5HHXH 4AM0A 1V5JA 5E9DA 2FQEA 3IMUA 4ZFOA 4YXKH 1IAOB 5ADOL 4A63A 2BY3A 2NZ9D 2XZQH 4YDJB 1SOKA 1O6VA 1LQBC 3ZDZE 4DZ8A 3VXMB 3QWOA 5CILH 4JFVA 3B2VL 3O0RL 5AQ0A 3CFEB 2WSKA 4N2GA 1OE1A 1V10A 1ZE3H 5T1KD 4JQIH 1AKPA 4CU6A 1IFGA 4OM0H 2VC2L 3NK3A 1FAIH 3QAQA 3L54A 1RU9L 1UACH 4P9HC 2HTKD 4UTBA 5IW1B 4F33A 4HJGA 1SBBA 1DJHA 4EKXA 3RDTC 4EI5D 3U46B 3G6JA 3GMMA 1NIBA 4OFIA 1AZRA 5DD5L 1E4WL 3MYZA 5B3JF 3L9BA 2D0HA 5DD1L 1BVOA 3B56A 2CGYA 3K6SB 4BFFA 1KBBA 1XL4A 1AS7A 3VD3A 1U8MA 2BHUA 2BZ7A 2BVTA 4JPVL 3V5KA 2HSIA 3KPPB 2PABA 2W80C 4R4NC 1KN4H 1M6UA 1YN6B 1P1VA 4I1NB 2Z4TA 5EBMA 3BP5A 5E03A 2P5WE 3VTMA 1MREL 3CLFL 5I16B 1QWNA 4HUUA 5BRZB 4LEBA 3HFMH 1M2OA 3ETBJ 3QUZA 4PJHB 4QWWC 5E8NA 1DQVA 3L5WB 1F97A 4J7RA 5DZVA 3GRWA 1FN4B 2XA3A 1YEEL 2FO1A 5F6IB 2O93L 2OL3L 3LHPL 3GMRA 2AQNA 3UTSD 4DGVH 4KRPB 5JW5B 3CDZA 3MCKB 4MFHA 4GAAA 4UT7L 5EOQH 4UB0H 5D2NB 1M3JA 4DUXA 1ZLUK 4BZ2H 2XWCA 2NZIA 5I1EH 1XF5A 2VYRE 4ZAKD 1T0PB 3B2PA 3P0YH 4DVRL 2Z7UA 4IHBA 2E4FA 2VB5A 2ICCA 1R46A 3DX2A 2DD8L 3QDGE 1BDYA 2QZ5A 3KLKA 3VJ6A 1EHNA 4FULA 4IRJA 5IHUH 3VGFA 4NPYA 3GQFA 4QT5A 3N1FC 4LE8A 4NM4L 2IQ9L 3IEAA 1L5GB 2VLLA 1TZGL 3KXFA 1LO3L 3CPUA 3MSPA 3TH4T 2X6UA 1AR1D 4Y5VA 3MRRB 3IJYB 3VXSD 4DP6X 3S5ZA 3UGEA 1G1KA 3TYFA 3WEAA 4Z7NB 5C0ND 4JW3A 5TQ0H 1JP5A 2WWNA 4MMXC 3PJSA 3FFDB 2XWTB 4KX7A 4Z7OB 1QATA 4UT6H 1BHGA 4M4PA 1RULL 1IVTA 3U79A 1X5YA 2C7FA 2A9BA 4LLVB 1YMMA 4NO0B 3V0DA 2XHNA 4CVUA 4WAFA 1KFGA 3PP3H 5SV4A 1YECH 1X5LA 5F9WB 3U9UB 1T4KB 3RVXC 4EAEA 1OARL 5LJYH 2CO3A 2YSTA 3MACH 2Z7ZA 4L9DA 2B20A 4X99A 1G9EA 3SKOA 3HBGA 4KI5D 3GM0A 4AK2A 1TZ8A 2NUTB 3RURA 4X7SL 3T2NH 4FAAB 4MAUH 2DWTA 2OMUA 1MNNA 5CSZB 5HI4D 1UT1A 1UHVA 1KYOK 1EXUA 4N5UA 4Q2ZA 3BGFC 2AEQH 3F7VB 5E0FA 4OJCA 4BXVA 1J1OH 3ROOA 1BVZA 4X6EA 4YGAB 3JWOC 5CEZH 4DHLA 2AQ1A 1W0VB 4O00A 3AUWB 5FOBA 2Q3ZA 5KYUB 1AOZA 1TJHL 4OIIH 2UVEA 4FA7B 1OQXA 3E1ZA 2I60H 3PDGA 4BHUA 2EUZA 4R84A 4G6FB 1I9EA 4AV0A 2QSTA 2EE6A 5K9QI 5DC4B 1WLHA 2NY2C 2OTWA 2NNCA 3DDGA 3WG7B 3X3FL 3MLXL 3HC4L 3F7QA 4UM9B 1AHKA 3NSYA 1WCBB 2GBUA 2Q7YA 2X4QA 3C8KA 3F83A 5BO1L 1KPUA 4XNYL 3VAEA 4JZJA 2B1AH 4HEME 2JVUA 4O2FA 1IFHH 1HKLL 1FGVL 3NSDA 3OMNB 4XODA 3VMPA 4I18C 2WZAA 5DWPA 1DFXA 5FUZL 4AYFB 1T1ZB 1AAJA 3HLKA 4LHUB 4PB0L 2EDNA 2WWKT 1OE3A 4HLJA 4WSJA 1HWGB 4BFGA 4U6HB 3N41B 1AVAA 1LO2L 2QJDA 3A67H 3L5IA 1MVUB 1ZS8A 2EEDA 3DYOA 4M03A 2OMXB 3LMJH 5MERB 2YD1A 1A5FH 5JORB 2J8UB 1T22A 4NUJA 1ZT1B 1RIHL 4FN0A 1S7TB 4G8IB 1TSRA 1ADQL 5I6PA 3T6VA 3KEHA 1OGTA 5CBAA 1DQQB 2DIAA 1NBYB 3BVUA 4GSDL 2FO4B 3TTYA 1UYWL 4K3JH 1ZHLA 3SD2A 1PIGA 4UILH 1LO5A 5IMKA 4I4WA 1QLRA 4MMZB 1B90A 1CFVH 1INQB 1PY0A 5CN1A 4B7IA 2Y1AA 3SOTA 1FORH 3AG4B 2DW5A 5I76A 5AALA 4NKIL 5FFGA 1GKOA 5H2BB 4PRHB 3ZTJG 3MBED 1DQIA 3NCJL 3UZEC 4LVHB 3TXAA 1PDKB 2YRPA 5CJQH 4N9GB 5EUKA 5KZCD 1T5WB 3O3BB 2I9LB 4FQJL 3MV8D 5D7EA 3CNKA 4YK4C 2Y6TE 3B6SB 3KNBA 1WJ3A 5I1GL 4NHUA 3MC0A 4YSEA 4JDEB 3DJTA 2ZKHH 5E9AA 2IH3B 1AGCB 2F8IA 1E6JL 5BV7H 5FEBA 3H0TA 3QCTL 3I74A 3UTTB 1TPXB 2N01B 1HHGB 1WK0A 4UDTB 4M7LH 4C56A 2DBJA 3VQLA 2V2WB 1MZYA 3KPOB 2IF7A 3PWPD 3SJVA 4E9RA 2ICWB 5JOFA 1R5VB 4OZFB 4U7KA 5FHBH 5JW4M 1IBGH 2EH7L 3FCBA 5F9OL 5BRZD 3BRFA 3WKNA 2DLFH 4FFVC 4JEGB 2YBRA 3JV4B 1VADA 4NQCA 1I8UA 4WEBH 1XTLA 5CGTA 2EUWA 2HMID 1M56B 2W1NA 3CVHB 4UTBH 4XWGH 2CR6A 1XF4A 3ZKSD 2ZWKA 2BMKA 1QPKA 3FTVA 2GUOB 1PLGL 5INCB 5TGBA 4BKTC 5E6SB 4PLJD 3I2CH 2XXMB 4PWFA 1G6VK 4ZG1A 5KVFL 3OJDA 5L7XH 3BKYL 4Z7QE 3WV0A 4J3WA 1JNLL 1GC1C 4JM2D 3CFKA 3LXAA 3FUFA 3NK4A 3LKOB 2HA1A 2FDBP 3NJLA 1FG2A 1XX9C 35C8H 3F5WB 4W70A 4AIXA 1JBJA 2QBWA 4ZOAA 3MOAL 3QAZB 3H55A 3GZPA 4EUPB 2OCJA 2P5EA 3FONB 1MFEL 1C5BL 2EIKB 4JHAH 1TKWA 1AY1L 1UJ3C 1D5IH 3JTSA 4LZKA 4W9EC 2BVPB 3HUJE 5L9DL 3MV9B 3RFZB 1UD4A 2EXSA 1EVTC 2DQTH 3ETTA 1NMBH 2AVFA 2UZYA 4N24A 3VXOB 4NZUL 4QO1B 3L3HB 4PJIA 2VAAB 5EU4A 1EH9A 2CLRB 4JDTH 5I6XB 2X1PA 2IPTL 3AITA 4P04A 1VFAA 3C5ZC 5C6WH 5J3HC 5T3XD 3Q44A 5DC2A 1SDAB 2RIKA 3FU7A 5EF3A 3NJNA 4NPJA 1QZNA 3GSNL 4N8UA 4EQ3A 2BDNH 5AB1A 4POZD 4ZX3A 3BW9A 1OCOB 3CFUA 2H1PH 3I75A 3RAJH 5HHXL 4JHBA 5CJOH 2K4AA 5FW7A 2PCPB 2FNWA 3ATDA 4YXKL 1T1WA 1ASPA 3O41A 4DKFH 5J1AB 2PNDA 2HT2D 2VLKD 2XZQL 1UXSA 3BZ5A 3EYOA 2MCMA 3VWJA 1U8QA 4D0DB 2JKJA 2HTLC 2X10A 5HYSG 4NO2A 3DVGA 4Q56A 5CILL 3D39B 1BBJA 2C3XA 3T4AC 2ZJSH 4OV6F 5CP7A 3EDJA 3NEXA 4N0RA 5GGSY 2OX5B 1N0LB 4P23C 4PSPA 2DAVA 4JQXC 1KGYE 1XWVA 4OM0L 1FAIL 1UACL 1UA7A 4M56A 4J12A 2FJGB 2COVD 2G3NA 3PGCA 2UY7A 5DSCA 3ESOA 3ZQXA 4EDWH 4HJ0D 2RJMA 5IEKA 4G6FD 5HJ3A 2V3DA 2Q5BA 5ID0B 2VNCA 1KBPA 2CE6A 3QQ4B 4N68A 1UB6A 4TV3A 2BO0A 1RMFH 4D8PB 3H3PH 2NY0B 1JHTA 3RVVC 7PCYA 2BP8A 3QDJB 3FUIA 4J3BA 5D1ZC 4DPAX 3ZSTA 4BHUI 3FTSA 4KKPA 1CTOA 5I8OH 1M1XA 3BXNB 3KPQB 1KYOJ 3PNWB 2EADA 1KN4L 3JUZA 3WEBA 2H9GA 3L2LA 2F7QA 4L1TA 4PJXA 3BPNB 2YA2A 3BPCA 3FT0A 3CCHA 4NQDA 1LWJA 4C8XA 2WJ7A 5E00A 5TJWK 4E41A 3P2TA 1EAQA 3HFML 1EAPB 3CZJA 2XN9E 5SWZD 4LHUD 4P4RB 2JNZA 5B3JE 4R5XA 3NCEB 1R5WA 4ACTA 2WZ6A 1HEJC 4GP5B 4DGVL 4ANXA 1E28A 3KHOA 5I71C 3EBAA 4O9HH 4P5TC 3M1OA 3UAJC 4JMNA 1GOGA 4UB0L 4Y5YC 5EOQL 4HUVA 5E5MB 2H3XC 4FFZH 1Z5LB 1NFIB 5HYQA 2Y07H 3GSWB 4BZ2L 1QBAA 5I1EL 4KKBD 3BFWA 3SE3C 3ZSSA 5IF0B 1AGFB 3S34H 2VDQH 4O2CA 3P0YL 1JPEA 4G8AC 1UJTA 3I9AA 15C8H 2YN3A 3O4OC 5E6UB 3SPGA 2VIRB 1UZ8B 4C4KO 4EIUA 4IQHA 5IHUL 3B7SA 5CKAA 2B0SH 3QQ9C 4KXBA 4ZUUA 1NBZA 4LLUB 3T6WA 5KW9H 1S9VB 5FYJD 2UV3A 2X1OA 4TF4A 3EGSA 3FT3A 4G7RB 3EHBD 2YD9A 4IBVA 3BESR 4TUJA 1E9PB 3LXBA 4W6YB 4ANWA 5E4IA 4NKOB 2NSQA 2BNUA 3IFOB 4JPWH 5GISH 4BA0A 5BV7B 5TQ0L 4CJ0A 3WMPA 3ILEA 1CFNB 4UT6L 3MRLB 2WO3B 5D7SH 5AW4B 3H3KA 1ZTXH 3KS0J 2FX7H 1LK2A 1JUFB 1S9YA 1CFTB 1GRWA 3NPSB 1V54B 4L0PB 5HHPB 1DQJA 5C3TA 1A8JH 4XO9A 2Z31B 3UTZB 1YECL 4IOIB 2X4NA 4N1EA 4NAMA 5FUCE 5BW7A 5LGJB 1KYFA 3MACL 3CXFA 4S1DC 1PZ3A 1OSZA 1CXKA 4Y5XC 3SYAA 4H8WC 1T5XB 3MRQA 5E7BA 4Z7WF 4JJ5A 3ULVC 1DVFA 3T2NL 4MAUL 1CTMA 4M7LT 3ZE0F 3X12A 1MRCH 3FPYA 3O3AA 2L0DA 3ZL4H 1TZIA 3AREA 5LB1A 2KERA 2AEQL 1X9UA 4XNUH 4L5FH 1J1OL 1ZD6A 1QFWI 4DGIH 3C6SB 9PCYA 5CEZL 4N8VA 2HVJB 3V0EA 3UXFA 4IBUA 1PZSA 5E6IA 2Q87A 3Q06A 4H5SB 5E5UB 2I60L 1A4JB 2Y1YA 2B7DT 3STBA 2ZKWA 3QIUC 3S3SA 2OJEB 5L4IA 3KW8A 3GXFA 5IGXH 3IBOA 4WK0B 4WHCA 4NO3A 3DTDA 3KDMA 4NRYB 2ZUQC 2VLJB 3SODB 5TF0A 4HUNB 5B7FA 3FT4B 2BNRA 4CVXA 3TH2T 2E86A 4NEHB 1BQUA 5I18H 4PJEF 1MHEB 1S7UB 1ZY9A 2BSBA 3AXLA 4GUOA 1S2EA 1XH3B 2B59B 4ODUB 3MLZH 4Y2DD 3MNWA 1NAMH 2B1AL 5I1IL 1Z3GH 3H54A 3SGDI 1IFHL 2P7TA 1UFGA 1IM3A 1HL5A 1YY9D 3DTUB 1B4JH 5HI3D 1A7QH 4FRWA 4EZKA 1A1OA 3VDAA 3O3EA 4LCIH 3UZQA 5C7XH 2ZIDA 3KLLA 3RWFA 1CUOA 4H26A 1SM3H 1EERB 4L4TD 2GIMA 4KKNA 4LQ1A 4P5KB 5KAQG 3NSCA 3OXRB 3EZJB 3PIQA 4K5OA 5DI8A 3TFKD 1JGUH 2OBGA 3A67L 4XXWA 3FQRA 1SFHA 1NGXA 1PLAA 5HYFA 4FG0A 5F7KC 2NNAA 4FFWD 4CN6A 1LLAA 4Y4FD 1FIGH 3GMPB 3LMJL 5E9DE 2C26A 3I9IA 1W8OA 1RZPA 1JWUA 4QYOA 2OSXA 4WNSA 4XVTL 1A5FL 1J0JA 1FV1B 2OFQA 3BCDA 3HBPA 4JN2B 1N59A 1KPVB 3N9GH 2R7EB 1IX2A 4L8SC 4AQ1A 5JA9A 5DS8B 5A7EA 1K6QH 3A24A 4GSXA 2L7EA 2VDKH 3S5LA 4LB8A 2W95A 4M3HA 3B83A 4WUUD 4PGEB 3PXJA 2EDRA 1GVIA 2GBTA 3HC3H 4YHYB 4PJ9D 2IAMB 4K3JL 2A99A 3TCTA 4WTXA 4IW4C 2R23B 1JTOA 3GXPA 3IETA 3T0EB 1CFVL 4BBWA 4F37K 6CGTA 1JZ3A 5A1AA 1FORL 4QGYA 1ZHNA 2ICEA 1NPUA 1LE5A 4XR8C 5AOKA 4FG6D 3MLPA 3GKWH 2G0KA 2EEAA 4WI6A 3OAZH 2WMPA 4MCZA 5AL0A 1J9RA 2ZCHH 5CJQL 3QH3A 1RZKC 2X40A 3TNNB 2W60A 1DBKH 1IGCH 5AB2A 1C5DA 3QPKA 2AV7B 4JHWH 5FO9A 3S8GB 5A3IC 2EO1A 4ZFOL 5JYLA 2X89D 2P3YA 2ZKHL 5KAQF 5KG9B 1FNEB 4P2OB 4IKIA 5BV7L 5HDOA 3CPLA 1ID5I 4CJ1A 4K7FA 4X7EC 4M7LL 1HQRB 1M57B 1RZFH 1XSOA 1W6WA 5L2KB 1TTGA 1I4FB 4ZPTB 5JQHC 1P4BH 1AC6A 1OL0A 1U3ZA 1G1YA 5FHBL 2JTYA 1IBGL 1P6FA 1ZV2A 2X0WA 2NY6B 5FUOH 5JW4N 2EXYC 2DLFL 3SEPA 3HI5H 2Z92A 4N2BA 1JYNA 4WEBL 2VDQB 4LPVA 2E9IA 2KUTA 4MKTA 4HETA 4FA6A 4UTBL 4XWGL 3O8XC 4JFQA 3CJJA 5IFJB 1TNNA 2P5PA 1E7VA 3GXDA 5DMGD 4N6RB 4HIHA 4KTYA 5CD3B 4XB8A 3I2CL 2BHZA 3V6ZA 1ZHKA 3EF7A 1BJ1J 4BUHA 5L7XL 2FSEB 4IRZA 2HX7A 4KUCF 1DQDH 3IDGB 5AL8A 5C0DA 1AJ7H 1E2ZA 3DO7A 3WD5H 35C8L 2WLKA 1XGRA 2HRLA 2DQUH 1PKQB 1KXQA 2CK0H 3PFQA 1PJWA 5FYKH 3TIEB 5DZOA 4PVLA 3AUVA 2LFGA 2N7SA 2YD4A 4YHLH 3ALPA 3RTLA 4IGBB 1H6EA 4JHAL 2HLAA 4JBSA 3D05A 2ZICA 4OQ1A 3HMXL 5ITFA 3RQ3A 3HZKA 2ZF8A 2WQ8A 3IWUA 5EN2B 5IB1A 2EYTB 2F1AA 2DQTL 4YN3A 1NMBL 4Z1PA 4QRFA 1GZPB 1YMME 4YNYA 4JDTL 4K9EH 4NM8H 2AXGB 3DGCR 1OANA 1S9XB 1KT2B 1AZUA 3ZQ9A 1CI5A 1J1PH 4E36A 2UXVA 1UOLA 4NAQA 3EXLA 3Q3GA 1X9LA 4KK9C 4U31A 4LAQH 2BDNL 2Z31D 4OIFA 2XFXB 4UM8A 1TEGA 3N6YA 2E27H 3L3OA 2H1PL 2AXWA 3RAJL 3GZQA 3MLTA 5CJOL 2WXFA 1UATA 4PCSA 3GDBA 4DKFL 5DRWB 1DJGA 4OLUH 2BWIA 3TA3B 3DVFA 1ETA1 3VCLA 4HU2A 4HOXA 3SE6A 2CLZB 3RWJA 3NJHA 4GG6A 1OTUC 2RQEA 3OWEA 3FB6B 2ZJSL 3FH8A 4XN1A 1FVEA 3KG5A 2CR0A 4R5VA 1OV8A 3GMLA 1J0KA 1H15B 1SOQA 2G75A 5DO8A 5F6IC 1AH1A 1AO7A 2IWEA 3N3EA 1KGWA 2UZXB 3A3YB 3S4SA 4EN3D 3PHQB 4JDVA 4LU5H 1QSEB 4KRPC 5D8JH 3ZL2A 4EDWL 2QADD 2H2SC 4Y19A 5D2NC 2CKBA 4QUOA 5G2NA 2XRAH 1IBDA 5LO7A 1NIDA 2CIKB 4FQPA 4X98A 3RGVB 1XMWA 4PPTA 1U8HB 4YXLL 1RMFL 5DRNB 3H3PL 1I9JH 1JK8A 4PW9A 4WW1A 1A6WH 4XCYB 4PRBB 1IEAA 1XB3A 2YAMA 4F8LA 3NMEA 1EEQA 5I8OL 5HHOB 5E7FA 4OZIB 3C5JB 5HBBA 3NACH 3UYPA 2WLYA 3ULAB 1EA9C 5DUBB 1IKFH 43CAB 3N43F 4WGKA 4IOFD 3S5YA 3WN6A 2EXTA 4CSZA 1ET8A 1LO4H 4WU7A 1QA9B 3FO0H 1TZHB 1IGMH 1U8OA 3M1BA 3W82A 2H47C 3S96B 4LPCA 5AKVA 1L0PA 1OF2A 4ELDA 2G60H 4LDEB 5KJ7E 1W2KT 3H9ZA 4CVWA 2OW6A 1DVSA 4UQIM 4LRIA 3TYGH 1GGYA 1CDCA 3LHAA 4TXVB 3W81A 4O9HL 3PV7A 5GRUH 3UIYA 2IGLA 2XETA 3WUWB 5FO2A 1MCPH 4D2NA 5IJKA 3HBZA 4HIXH 4FFZL 4AVJA 5J56B 4KZEH 5I5JA 3M7FB 5IB5B 4FADA 1HH6B 2Y07L 5FOJA 3H7BA 2AK4A 3DRQB 2H32A 4HBCH 5F9WC 2C9UA 4JZNB 5F1IB 3S34L 4Z9KB 2VDQL 5FGBC 4E9YA 4WTZA 4FQQA 3JSSA 15C8L 2HT2C 1HNYA 3GSUA 4HFWA 4XBPA 2IO5A 1L3WA 5HPMB 5H37A 2B0SL 1YNLH 2ZYHA 1NMCB 5ENWA 5KBKA 5KW9L 2F7IA 1PCXA 2IWFA 4AY0A 4F7EA 2GTWA 1RK0A 3VFUA 4FJZA 4YDLB 1N10A 2OPCA 3CHSA 1QASA 3SGKA 3T0ED 2ZT9C 4H0HB 5AW5B 2BP0A 5B7MA 1WEJH 5GISL 3GSVA 2P9RA 3K1KC 2BVQB 3O6KH 4HDIA 2DN7A 2O5XH 4KNTA 2JKXA 5FDYA 1RV6X 3QCUH 3W0WB 5D7SL 4TVPD 4FKHA 1ZTXL 2WYTA 3BZFB 4AH2A 1RJYA 2FX7L 3FJTA 5B38B 4QHNA 3WYRA 4BE6A 1SLVA 2EDEA 4C56E 4F80A 5DZNA 3IKCB 4Y89A 5L8JB 1F0LA 1WYJA 2VERA 3SJVE 1TU2B 1KNOB 3L95A 3ZE1E 3BZ4A 2XIDA 3QZLA 4RZCA 4Y2NA 3L1FA 4NQCE 1AP2B 2VE6B 4AYEC 1ZA6A 4QXTA 2F5AH 3GMQB 3HB3D 1A0QH 1MRCL 1XCQB 4X7TB 1T03H 2NY6D 3ZL4L 5D4QA 4DO6A 3R7QA 1AE6H 5CCKH 4FQCL 1JSYA 4U7SA 2PW1B 4W9JC 3CH8A 5IFHH 4M8RA 4XNUL 4JZOB 4L5FL 3NFPA 4JLRA 3QRGH 1N18A 2ICES 1AQDA 3V4LA 3NZSA 4L1BA 4FTDA 1U41A 4PGZA 3VFWA 1N8ZB 4HKBB 5F7EH 5IGXL 5C09B 5IQMA 5C0AB 2J1XA 2EDJA 4DCQA 1ZE3C 3LY6A 2MQ0A 1YNTB 4Z7WE 5HYJA 2ZXAA 5C0FA 4X6CF 1LM8V 4P49A 5I18L 1D6VH 5ESAA 1BFTA 5BVPH 1K8IA 3MLZL 4XCNB 1NAML 1EEYA 1LEGA 2C9VA 5E8EB 5BS0B 1Z3GL 3ROLB 5JZ7D 3IF1A 4DH2A 2ZAHA 4FXGA 1B4JL 2AQTA 4PJIE 1A7QL 3GKZA 4AT6B 3GXNA 3LNDA 3GK8H 4MMZC 4RMQA 4WWID 4LCIL 1DBAH 3NN8B 4OKVA 5C7XL 3IJSA 3K81A 4WNJA 1SM3L 4B95C 1NGQH 5EOCH 3IRZA 5EU3A 3FCSA 3U7WH 4BEIA 3IRCA 1NOFA 1JGUL 1HL9A 4LVHC 3R1GH 2BIIA 4IRZH 5E95B 1CG9A 4PJEE 4LF3A 5CWSB 1FIGL 5FKPB 4PG2C 3IE9A 4JFEB 2AKRA 1MJJA 3NIGB 2HRGA 3DX8A 3A4EA 1S9WB 2A6DA 5DTFA 1OAUH 3ARVA 3D3VA 4UU9A 3N9GL 4Z7VB 1GKEA 2W0PA 1K6QL 1TPXC 4KJWD 4N8PA 1DLHB 2VDKL 3TU6A 1KIQA 3ZTNH 2GYSA 3HC3L 1L9OA 1EQWA 3MGOA 5CR1A 3CVDA 3TPUB 3T77B 3PWJB 4IU3B 1OW0C 2AZAA 2VKWA 3EJUA 3PPEA 4GQZA 5HDBF 4G6MH 2BNQA 5LKNA 1FG9C 4ZX6A 3IN0A 2NX5D 4HOZA 3O11B 3FB5A 3GHEH 2VJXA 1NBCA 3GKWL 3O4LB 3B9KA 4G9FA 4JM0A 1O75A 1BLIA 3ZKQD 2ZCHL 5A16A 2FUTA 3LH2H 1WO2A 3BZDA 2OQJA 4LKXA 5IMLA 1SMOA 4PRDA 1DBKL 1IGCL 2OMZB 3X11B 2AXFA 2ADGB 4JHWL 3IDMB 3F8UB 1WIPA 4QOKA 3M07A 4XO4A 2J5LB 4G70B 2OA9A 3U0TA 4O51B 5DT1H 2ILLA 4HKXB 3V0IA 3QAZC 2JK5A 2ZYSA 3EO0A 3QZOA 1RZFL 2YAEA 3SDXB 2G4GA 1RZ8A 1CGUA 1P4BL 4AJYV 3BH8A 1IARB 4PJGF 1ZLWH 1HHIB 1S9KC 4LARH 5FUOL 4P9MH 3RFZC 4KDWA 1O0VA 3DJ9A 3HI5L 4KVNH 5SWQA 1AD9A 5I6XC 2HLFD 2JCWA 4PB9H 2AK1H 2XBZA 2ZX9A 3C8HA 5I1LB 2PCYA 3G5VB 4OZHF 5C1MB 4G9DA 5CFAA 1UASA 2GUYA 4ISVB 4PJ8C 4KJQD 2J6EL 1RHHA 5I15H 3PF2A 1DQDL 5EF1A 3QI9D 2WLLA 3MJ9A 4DPBX 1AJ7L 1WS8A 3L6FA 3WD5L 2CA3A 3HMWH 4OUUA 2HFEB 1CT8A 1FAKT 2V33A 4QR7A 2DQUL 2CK0L 5FYKL 3W11D 4G71B 3OKNA 1XGTA 3NFNA 4A7GA 4JRWA 2HT4D 4YHLL 4XMKH 4Q6IB 1NCUA 2ZCKH 4GKNA 1A1NA 2FE0A 3DJRA 4X4MA 3ILQD 4TQHA 2CDEA 1WWAX 2WLIA 3KAAA 1UWFA 5ICYB 1XL6A 3F62A 2YPLD 1VGKA 1AXSA 2JIXA 3F00A 3OC8A 5DRXB 1DHKA 1NJ9B 3QE5A 5HGAB 5GZOC 4S1RH 3NIFE 5L2JB 2GBAA 4K9EL 1MQ8A 1HSBA 4NM8L 5IVXF 1NSNH 1NCOA 5JUEH 4M4RB 3SDYH 3W0WD 5CINH 3EZ8A 1FNSL 1J1PL 1IKNA 4G8FA 3VQ2C 4KITB 3ARGB 4X5XB 1G7HA 2JKSA 4LAQL 4APQB 4DZBA 3KL3A 2NY0C 4N2FA 1LEKB 2E27L 2W07B 1GZHC 3P77B 4GG8B 4XE0A 1WBXA 3RUGF 3KBPA 3BKMH 4GW5B 1ZIBA 3LRGA 4IKLA 2WBJD 1ZSDB 2WN2A 3BPNC 3TZVA 2DQEH 4FEIA 2E46A 3IJHB 3QJFB 5E4OA 3ESPA 5K33A 4F5CA 3MODH 1SBSL 2MQGA 1BWMA 4MAYA 2P46B 3DA0A 3NVQA 3LH8A 4OM1H 5A40E 2UUDK 4ZS6C 5FB8A 1ZPUA 3B5HA 2DY2A 2RCSH 3L81A 4XZUB 4FNSA 4JDZA 3GZOA 5KBMA 3MYJA 4QD2E 4DP4X 4AXWB 4LU5L 4X4YA 2C3VA 2NZ1A 2QVIA 3VACA 1ORSA 4X8XA 1NBQA 1MFDH 3FU9A 3EGDA 4R0LA 3MX0B 5D8JL 3TCLA 2XRAL 2JKWA 1JF1B 5C09D 3SE8H 5C0AD 3GHPA 4QTFA 4N9OB 1B6UA 2OMWB 2Y2YA 3UZVB 3RKDC 2FUQA 5JW4Q 1I9JL 2QMJA 2QZQA 4RMTA 4Z3GA 1T80A 3B2XA 1A6WL 2HYMA 4GO8A 1EHKB 2EVHA 2R1XB 3ZDZB 3GSXA 2C7UB 3WTWA 5F1SA 4M1GH 4TTGA 5BS0D 3NACL 5T1MB 3X1FA 3KWWA 1MY5A 3CSTA 4NS0A 5DHEA 4BIKA 3LPPA 1LO4L 3JTTB 4J3XA 3FO0L 3GRGA 1WZKA 1CDGA 1IGML 2GY5A 5DK0B 4RLDA 4WK2B 4U2ZA 5INDB 3HAEH 5KEZA 2PYFA 5C7ZA 1G5AA 1Q9WA 2E0PA 3RZCB 2AF2A 2G60L 2QQLH 1MIMH 5BV7C 4GAYA 3QHFH 1NL0H 1U8KA 3KGSA 3WJMA 3EW3B 5HTSA 3QQDB 8CGTA 4R7VA 1I7RB 2Z9TA 3TYGL 5GRUL 1YG9A 1D5MB 2R59A 3F6LA 1MCPL 2Y1VA 4IIZA 1ZVHA 2NT0A 4HIXL 4YBQC 4KZEL 3JV6B 5B1KA 5CLWA 2P49B 1JK9B 4JFFD 3CV5A 4HBCL 1KIUA 1D7DA 3IDJA 1OAYH 4MA3B 5JIKA 4LOFA 4B50A 4N90D 3VXTB 2P5WB 2IDTA 5D7JD 3UPRB 4P2RA 1WUZA 5EOCJ 4MS6A 5DJ2B 4Y0GA 5L4MA 2BCKB 1YNLL 3ASWA 3VNZA 2CGRH 2XKUA 3KPLB 4X4KA 3IJEB 3O9WD 5GGVH 3ZRSA 1O6SA 4F2MA 1I1FA 2QTVA 4QAMB 4AGPA 3QIWA 1ZRUA 1PD0A 2A9AA 3DJZA 1FUNA 5I66A 3VRIA 3APNA 3L2MA 3O6KL 4P07A 4PLNC 2O5XL 4R4BB 3PWLA 3QCUL 4RGMB 4JVUA 5AW0B 1G6RB 3L9RB 4FTVA 1QPPA 4XOBA 5IMOA 2IADB 1SYVA 1K8DA 5I5MA 4NOBA 2Y7NA 1ETZB 1WP6A 3ARTA 4LK4A 3OHXB 4IDLA 4X5PA 3QDGB 1UZGA 1AMXA 3MI6A 3DX1A 1MWOA 2RB8A 2W38A 3F04A 3LS4H 4WF7A 4F91B 4BCYA 1A4KA 4RWHA 2B1HH 3B37A 2G3ZA 4P0DA 5IQ7H 5EFIB 5IESH 4HWBA 2F5AL 3IFLH 3IGUA 5GS0H 1OSPH 1AQHA 1A0QL 2UVFA 2LVEA 3ECQA 1C5CH 3WENA 4LCUA 1S5HB 1T03L 1DP0A 3VFPB 4C59B 1AE6L 2BSTB 2IPKA 5CCKL 3PAZA 4DUVA 5IFHL 4MCYA 3BUYA 3QUYA 3LPWA 4A7QA 1OTSC 3H6JA 3QRGL 3GUTA 4OV5A 1KENH 5AYUH 5I19H 3MUHL 3EDEA 2P8MA 1EFQA 2GITB 4ENEC 3Q6FB 5LDSA 5F7EL 1L9QA 3SCMD 4UQ3B 1UM5H 1BZ9B 3FN9A 3U30B 3MREB 1OCWH 4W93A 5I26A 1JGDB 3MQIA 4QRSB 5SX4I 3REWB 1NDGA 1D6VL 3B8SA 3CFMA 3MKGA 1W72H 3B9VA 3ZKNC 3O45A 5BVPL 5H94A 3QT2A 3MN8A 3ARFA 2V5RA 3EADA 4GRLA 3HE6B 2HZHA 1XB6A 1H8OA 3Q8EA 4NUPA 4Y16D 2LOEA 4ZFFA 2IAMC 2F53A 4XMWA 3SDCA 3K6IA 5FYKU 3CLWA 2PO6B 4ZFZB 4OW6A 2QGDA 3NZUA 2VT0A 3GK8L 1DBAL 5JXED 2FQFA 1QR1B 1PX3A 2RD0A 1JZEA 3V5DB 1NGQL 3H3BC 1NCAH 5CZRA 1R24B 1URZA 2H3KA 2J43A 4H8HA 3U7WL 4WFGD 3MRJA 4ONFH 1L6XA 5DJ8B 3TO4D 1AYOA 1XEDA 4XNBA 3ULUH 4WWKA 5ISZD 3B3IA 2YMOA 3JXAA 3R1GL 3T5WA 5CJXA 5IJCC 4IRZL 1BG1A 1WZMA 2EVFA 5IQ9A 1RJCA 5T1LB 4BV1A 4DP2X 2L4OA 4ATTA 1CFMA 3ARGD 3LNIA 1XF3A 2WNKA 2BSSB 3AJ7A 1E27B 1MCLA 5ABAA 4APQD 4BCXA 4UT9A 1ZT4B 1OAUL 2A74B 2JB6B 4K7PY 5E8DH 5GSRB 2YUWA 1S7WB 4P2OC 1MLBB 5EF0A 2H6PA 4J4PC 1MF2H 1T04A 4GG6E 4HZ1A 2VSCA 1U8IA 1PD6A 3UJJH 1SJHA 3ZTNL 1UD8A 3N1GC 2ODHA 3M6DA 4OZGA 4CADB 4GXUM 5AG9A 5FO8B 1U3NA 2RHEA 3OX8A 4MD0A 3EFFA 2NY6C 1FLRH 1IE5A 3L4WA 1JNJA 2D03H 1G84A 5E23A 3BAKA 4B9JA 3VXNA 2K3TA 2QPUA 4Z3JA 3AM8C 1TVHB 2XPGB 3T1FB 2AFNA 4G6ML 4TQIA 3OSVA 4RVBA 3LEVH 3GHEL 3JWNG 5EUOF 3QDMA 3Q8CA 3VDBA 3SKMA 1ZMYA 2EUVA 3LH2L 1OWRM 1BBDH 3B2DC 2I07A 5F89B 1B4LA 4OY9A 5DRZB 4LESA 4OAWB 2Y06H 4CGUB 4YSQA 5ICZB 1WFOA 3TBCA 5D4JA 2ESVA 3HAEB 4JFSA 4WI2A 3RY6A 4RETB 2R29H 2CPUA 3O6FD 3OBAA 5DT1L 1P1ZA 3VWKB 4CC4C 4DEPB 4O02H 4F9PC 3QZWB 4R3SA 1HILB 4MJ6A 1PD1A 4J8RB 4BA8A 5KYNA 4IGBC 4JAMB 4RFEA 1MQKH 5HDBE 1XR8B 4NZDA 1N5AB 1NH6A 4IS6B 1NDMB 3D34A 4X5RA 4FYQA 1VERA 2GC7C 2ATKB 1HDMB 3CUPA 3V4UH 4DO5A 4JL1A 3C5SA 4LARL 4P9ML 4LNRA 3UJTH 2E3VA 4QRRA 1NUFA 4KI5C 1J8SA 3CHRA 1MPAH 4KVNL 4G1EA 3RZCD 3PAVA 3CQFA 4Y9GA 4Y7MA 5GGSB 4HWUA 2OMNA 4PB9L 2IMNA 2AK1L 5DHVH 3FTWA 5B8CB 5CLTA 2Y2WA 4PIBA 1OE2A 4ZUVB 5I15L 4Y9EA 5JYMA 3L48A 5DMIH 4PRNA 1JYVA 3NG5A 3FFCD 2XNAA 1L6PA 5D1QB 3HMWL 3OPUA 1EZSA 2XZAH 3P2DA 5DQJA 5I1JH 3FB7B 3HHSB 4LGRB 3IU3B 4P99A 3VRLF 4L3CB 4NB7A 1J0HA 3RIFF 2AJ3A 4XMKL 3TA3C 1P7QB 2WLJA 3KPMB 4ZODA 2ZCKL 1L9TA 1B2YA 2ZSWB 4HC1H 1WS7A 2J6WA 3NEEA 4OJFH 3H9HA 1UB5B 1PG7H 2FYYB 2XXFA 3MKKA 3Q5TA 3Q2NA 5HHNB 3MNDA 5JHLA 5DJAB 1FZMB 4OZHE 5AZUA 3FCGA 3P4OA 3T3PB 1F18A 3ZKXC 1N67A 3DETD 4S1RL 1OK8A 1TFPA 5B3SB 4MXWH 4PN6A 2QEJA 1VIWA 4Z7QB 1G94A 1NSNL 5JUEL 5F1OB 3SDYL 3D0LA 4F2EA 5CINL 1U8PB 3CZLA 3EJZC 1CU4H 2XI9A 2OSYA 1LP9F 3RGVC 3CVIH 4U1KA 3F7PC 4PP1D 4PVBA 1QACA 1BEYL 3IDXH 3K3QA 2BPBA 4PAZA 3QUXB 2D73A 4APXB 1P7KA 2DL9A 2VR6A 3QDGD 4JN1H 3ZE2F 2PXYD 4KWUA 3ET9F 3BKML 3D87B 4M7KH 2E7LA 3DUUB 5I1DB 1GY2A 5CMAA 3MFFB 3HUJB 4NC1E 4D9LH 4MHHI 4IMLB 1PAMA 2DQEL 3BVDB 3M86A 1E5BA 4K5PA 5FHAH 5JMOC 4XBGB 2GSMB 1F11A 2XKNA 3MODL 3UEZA 3QWRD 3BPOB 2NT1A 4QJ4B 4GKSB 2FL5B 4OM1L 5CSBA 3X13A 1XH0A 2V8MA 2CGZA 4PTTB 2RCSL 3B7UX 4DO4A 4M61B 1YEHH 3IXTA 3OZLA 1W72B 1USZA 3MRMB 4N0FB 4JQVC 1JPST 4X8GA 3CZSA 4PJ5A 5A2AA 3IXAA 2HRPL 4XX1G 1MFDL 4LSSH 3BVNB 1J9SA 4NZRH 2Y24A 3RUGE 3TJEH 1VZGA 4TNVF 4JKLA 4XXDA 2YBGA 1MI5A 3SE8L 4XNQA 2WHVA 1PBYA 3WN5B 2BOCB 5IJVA 5GRVL 5K1VA 3QORD 3O2VH 3SQOH 2N1TE 1R33A 3K0YA 4QRPE 4FXKA 3W11C 1UD3A 4FFTA 5IKCA 2HT4C 1S8DB 4W9DC 1QSZA 3VD7A 4Q7DA 5E2WH 1TYRA 4KZCA 3T8XA 4M1GL 2AV1B 4ZNEA 5IOPB 4IOSA 3M46A 1NMCC 2GJZB 1T6BX 3DPBA 3JT2A 5ADPL 4PJFF 3SD5A 4YDLC 4MCMA 4N0CC 2OSWA 4F9LC 4JB9H 4UYPA 4LAJH 4LGSB 4TQ8A 3BWUF 4J3SA 2X70A 2QQLL 1MIML 3ZYIA 2DMGA 3QHFL 1NL0L 5CN3A 3QK0A 2V5TA 1D5RA 2V7HA 3I6SA 3BD5A 2WPGA 4OSUH 4KI5F 3VM7A 4P06A 1E6OH 3B43A 2UYLA 2VXQA 4F7MA 3ZT5A 1BF5A 1OAYL 5F88A 2CDGB 3FAXA 4PJAF 5C0EB 1DSWA 1XCWA 1NA8A 5DVLA 4FMKA 3PNRB 1ILUA 4AI7A 4OT1H 4KDTC 4HT1H 2GVYA 1E4KA 1CPUA 5IROA 1LD9B 4I7ZC 1U95B 2CGRL 3QDHA 3QNXA 4PV8B 4MNHB 2NDGA 5GGVL 3RU8H 1A9BA 3ZDYF 4WW2A 5JA8B 1AKJD 4AVHA 2DZEA 4O02B 3ZMNA 2YA1A 2WK2A 3CSYB 1PAZA 3NIDF 3VFSA 4AGNA 1VFBB 1V3LA 1DVUA 4CKVX 1HT6A 3G08B 3AABA 3T2OA 3AFLA 4L9LB 4PU2A 4G72B 2DJUA 3B9EA 1E9QA 3M17A 4UT9H 4XNMB 3AGVA 2ARJQ 3DIVA 3HG1A 1FFPA 4WU5A 4S2SA 4CU8A 4JHVA 3BAWA 2ERJC 3WKMH 1J10A 4FCAA 4CC0A 4K71B 2NXYD 2X1QA 3N44F 3SE9H 2IH1A 3LS4L 4K9EC 3RBSA 8FABB 8PAZA 4MQ7B 3C8DA 3TBYA 2B1HL 3V55A 3SY0B 1U36A 3VH8B 4E0RA 3FUDA 5DHVB 5IQ7L 2CBMA 4OLYH 2MHAB 5IESL 4IRSB 1CK0H 3IFLL 3MNVA 1HXMB 5GS0L 1OSPL 3EOAA 3G5ZA 3GZKA 1CE1H 4GW1B 4YVUA 1C5CL 3KPSB 1D5ZA 3QXAA 4HUXA 2AVGA 2IOIA 1HKFA 2Y7SA 1BQRA 3KD4A 1KTDA 2NCEA 4LCWA 4P2YA 3RX8A 1OIOA 2NYZA 3MRCA 1KENL 3RNKA 5AYUL 5I19L 5IB4A 3BP7A 1FWXA 3HZVB 4NKDA 4BELD 4YFDB 1A14H 4H0LC 2DH3A 3MGTB 2JI2A 5IG7B 3V8OA 2AZUA 4CBZA 1KJ2B 2WP3O 3R18A 3ZMRA 1X5JA 3F12A 2NR6D 5J0BA 3AT8A 3K46A 1R4XA 3HKZA 3V0JA 4MJIB 5C9JB 5JIDA 3TT1H 3SPVA 5ERWB 1OCWL 2FLMA 3OSKA 3TO2A 3GD1C 4X4ME 4AYDC 1G9HA 4L1DA 5IWLA 1HEHC 1KG0A 4JVPA 3RYMA 4X6FB 1W72L 4R97B 5CCJA 1NCNA 4QDGA 2BWDA 1AQ8A 3ZTJH 1IC1A 1SY6H 4KKAC 5IW6A 4KHTH 3W3BA 2KH2B 1U2YA 3WJLA 3WNJA 3QZBA 5HI5D 4UCFA 1QR4A 4NQVA 4P4KA 3P02A 1H3XA 1XZ0B 1NCAL 2EE3A 3DV4B 4MS8D 2MWCA 6PAZA 3KYOB 2WQUA 4ONFL 3VXUA 1FJ1A 1BIIA 3WFHB 3HPLA 3ULUL 4ZTOH 5ECGA 4UZUA 1AZZC 4CSSA 3SBWC 2E4TA 2UXFA 1I1AC 2HFTA 3WE1A 1CDHA 4A1RA 1H3PH 1DUYB 3CVCA 4O4YH 2JCCF 4FHKA 4RX4A 4DKAA 4B41A 3OD3A 1G7MA 2J5LC 3V5HA 1BQHG 4LCYA 4UBDD 3C60A 5CLZA 1YN7A 3QFDA 4YDIH 5DC9B 5E8DL 3X1BA 1QFOA 3OKLB 1MF2L 4RIRB 4G82A 3MNZA 3RL1A 1T89A 3GI9H 1PX4A 1N3NA 4NT6A 3UJJL 5JPNB 1KY7A 1EO5A 4JKNA 1DEEB 2CHNA 3FOLB 2DI9A 2BSRB 2OYLA 3RPIA 1X44A 1FLRL 4GBXC 4GXUN 5DS2A 2D03L 4L29A 1I1RA 2R2EB 3OB0K 3HS9A 3PWVA 4YHIA 4JM2F 4ANVA 5AVVB 1F3DH 4PJ6A 1NQBA 1NEPA 3ZTCC 4ZQKA 5KWYC 1BCIA 2NTSP 3G6DH 5MP6H 3P54A 1BFVH 1I1CA 2NW2B 3FTGB 5EEYA 3LEVL 2QPDB 4AM0B 2DIJA 1U3HD 2PWGA 4NDMB 4JCWA 5D1XA 5KSVA 2B39A 4UWQB 3S7GA 1FFOA 1BBDL 3A22A 3FUJA 3UDWA 1GMIA 4DZ8B 3WEMA 4HWNA 1QLFA 3RI5K 3RB5A 4HKZA 2Y06L 3KLHC 3QWOB 1IUZA 4QLWA 3ERXA 2R0ZH 2R29L 4O02L 2ITDB 4XC1H 3HE7D 3QPQC 4C83B 1Z5YD 3F05A 4Z7NF 1ZDQA 3L45A 4KXCA 2WZPD 4G5AA 5F7NC 1MQKL 4FLSA 3BWZA 1N12A 3QXVA 4BQ8A 1P6WA 5EUOE 4HJUA 3V4UL 1IU1A 2V2XA 2FBJH 3WNNA 2X4SB 3UJTL 5JXEC 1MPAL 1NUDA 4IKNA 4OIAA 2DYSB 5TQ2H 1JZDC 5KYYA 5CEXA 3JT0A 1NC2B 4LHUG 4L3AA 3TT3H 3V6OE 1GYUA 3SYPA 5AB9A 1U8MB 3K72A 1VZIA 3V5KB 5G4NA 2ZWLT 1FL5A 2YEVB 1MWAA 1SRDA 3ARGC 4N2IA 3QQ3B 3DARA 3K2IA 1YEJH 5DMIL 3MJGX 4P2RE 3RWIA 2WM0A 3QUZB 2XZAL 5I1JL 4WJG3 5DFVC 5DZ9A 1E5AA 3FRPB 4X5WB 4XH2B 3J7HA 5HGHA 3WGVB 5EV7A 5DCCA 4DTGH 4GW4A 2A77H 4HC1L 2YXMA 4OJFL 1PG7L 3CDZB 2XN9D 4XNXH 5EMYA 1EJ6A 5FK9B 2GBVA 1BMZA 4S1QH 4B9IA 3OZKA 1NPJA 1ASQA 4P2QA 2E8ZA 1KC5H 1Q4NX 1XF5B 2Y22A 4DKEH 2GQHA 2PYEB 3JWDH 1QUNA 4MXWL 3ZHDA 5CZXD 4EVNB 3ALWA 4LSUH 4GB9A 3V0FA 5HSFA 5J1TC 1J7VR 1CU4L 3EJTA 4XN2A 3CVIL 4ZD3H 3VRLE 5JHDA 2EKJA 4W9FC 4AQAA 3IDXL 2FSDA 5C8JB 2G3XA 2V0AA 1CD1A 4OF5A 1YDPB 3D2UA 3BAJA 4JN1L 3FU0A 1OO2A 1X4YA 4ODWB 3TN0D 4M7KL 1ZCRA 3TYFB 4B7LA 1IJ9A 1CL7I 4P46C 4G6JH 3V0VA 1F2QA 2GK0B 4GKZA 2BZDA 3S97C 3QEHB 4D9LL 1PFCA 4IIQB 5JNYA 4U3XA 1QFWM 5FHAL 5IQOA 1K5WA 3EYFA 2I25N 5AEAA 4ELMA 3HJ0A 4S10A 4HCRA 2OCFD 4OZFG 2ZXCA 1YMMB 2XX0A 5E5RB 5MEQB 3ORJA 4JRYD 4OFVA 3RJDA 1UQSB 3RZCC 3Q1SH 3ECWA 5J11B 1D5BB 5EOTA 2HPOA 1YEHL 2YPVA 1BQLH 4DK5A 4V1DA 4YDZA 1TYJA 1IL1B 3QHZH 4ZXBB 4F7PA 1TQBB 4OF8A 4LSSL 3ZE2E 4NZRL 1XF2A 4E9TA 2WXIA 5G5DA 5IFAH 1ORQA 5AKRA 1NEZA 3UTSE 3FQUB 3O2VL 3SQOL 3CHQA 2ZSVB 1VEPA 2QPFA 5C97A 2F53E 5CEYA 1IM9D 4AZ8B 2C3GA 4LL1A 4TTDC 1CYWA 5E2WL 1XFPA 1EIBA 4ZUWA 4YX2H 5FOBB 4L8BB 4AKQA 1A3QA 1TJIH 4EUPG 4BQCA 2QHLA 1X3DA 3RWHA 2WLMA 5J6HB 3TASA 3K0WA 5BUGA 1PQZA 2GJ6A 1A3RH 3NRPA 5LCVA 4KMQA 4JB9L 1I3GH 1RZGB 3OKOB 4ZX4A 1MFCH 3B2UD 4FLOA 5I8CA 4IK7A 4TLSA 2OAAA 2B9BA 1MRFH 5JQIB 3DBXA 4P5MA 1R3JA 1E4HA 4Z23A 1GYCA 2Q7YB 4JPSA 4ONOA 1JFQH 1KPUB 2J44A 4WV1A 4OSUL 1AIFA 4NRZA 2X05A 3DX7A 4JFTA 1EXHA 1E6OL 4LLYA 2VMJA 4JG1H 4ZMTA 3ARBA 3NJVA 3DTXA 3FRUA 4YHZH 3OHXC 4O58H 5LVEA 2MTAA 1XGUA 4OZGE 4Y2OA 4PJFE 1FVDA 2GAZB 2CBTA 4IBLT 4OT1L 1S78D 3GSQA 2ADIB 4HT1L 2KQMA 3ABZA 2J25A 3WBDA 3Q2LA 1OOWA 1NCBH 4ADJA 2X4RA 5D72H 5ETUB 2ZKYA 2CDFB 2PN5A 3RU8L 3P4NB 3MJ7B 1EEUA 3AACA 3ELQA 5KVDH 5K1NA 1K4CB 1NC4A 1KLFA 4AUJA 4G42B 3DX6A 1F90H 3HVNA 4HP5A 3AAZA 4PJAE 5E9DD 4EIBA 1HFUA 4TUOA 4UT9L 1G1OA 3LKPA 3EYUH 5DHXB 5CIPA 3U30C 3KPRA 1X5AA 3H53A 4M8QB 4ZSOA 3WKML 1AHMA 4FQXB 1LO5B 1TCRA 4I4WB 5EU6A 3OWRA 3SE9L 5IMKB 5AVYB 5SWSA 5MI0C 1CLZH 1A7OH 5CJBA 3U6RB 1I7UB 1GOHA 3HE6C 2V2TA 4OLYL 1CK0L 4I0PB 4JFUA 4X6DA 1XF1A 1NFKA 2P80A 2PO6C 5HVFB 1CE1L 2IXQB 5HYSB 1NFDA 4R7DB 5FKAB 3MRDB 1KJMA 4F8NA 2PWDA 3FQNA 3U4EB 2QQQA 4KUZH 3PUCA 4Q52A 3HS0C 3II3A 3D5OF 2HFFB 5IVZA 1OP4A 1TO4A 4TUUA 3HI1A 2BY1A 2FWOA 1RP9A 1A14L 3MR9B 5LDUA 2ZOLA 2EABA 3NA4A 5EBWA 5C0CA 4IBWA 3P40A 4Q9BA 4TVSa 2BVOA 3C9NA 3EDDA 3SJVB 5JOFB 1KGCE 4HLZH 1RL1A 3TT1L 5JO5B 2A74C 2DJ4A 4MA1B 1WSST 3QUZD 1VADB 3E2HB 4NQCB 1V3KA 3VI3F 5JOPD 1SLXA 1HE7A 1SY6L 1XF4B 4JFXA 1R3HA 2W88A 3Q1EA 3G5XA 4KHTL 1NCJA 4TLTA 3UTPE 3IDYB 4JFOA 4E5XA 5JLZB 4GI8A 4GRWE 4P8QA 5L88H 4CU7A 2A9MH 4RAUA 1B4TA 3RDTA 3PDOA 5B4MD 4FQ1H 3VSVA 4ZTOL 4ZDHB 1IEHA 4N0YH 1J11A 1WBYA 2IV8A 3QNZB 4ADIA 1RJZA 3ALXA 3MRIB 3LOWA 1G7JA 1KZQA 5HVGB 5K39A 4ZQTA 3H9SA 3UC0H 2NNRA 1EGJH 4IRJD 4CMMB 1H3PL 2GK2A 4O4YL 5LAXB 4Z7WB 5ICXB 1TKWB 3ZE0B 4F3FA 2JKLA 2YGOA 1E3XA 3CBKB 1K3IA 2ISDA 3VWKC 3KXFD 4UUJA 4YDIL 4DEPC 2YGQA 3V4VB 2FJUB 5I6KA 2ITFA 5KUMA 3G6AA 1IQDA 2UZYB 2B2XH 1JVOA 3GI9L 3MV8E 3L4UA 1CTNA 1WPCA 2NY5H 3BIBX 4MVBC 5EU4B 1FBIH 2GJRA 3LRSB 5F2FA 1CE6A 3CVBA 4Q6YA 4XTRD 4L8CA 3DYPA 4CVZB 4UOW0 5FM8A 3MOQA 4KRNA 1GZQA 4PJ5E 2ZWYA 1CICB 4MX7A 1MFMA 1YMMD 4LSRH 4UQDA 1LWRA 2W8CA 3G6DL 3JYBA 5MP6L 5D9SA 2JCCE 2VSDA 3BW9B 3PWPE 3ZK0A 2DV6A 5I17A 4BRJA 4BGDA 2VLRA 4PJEB 1DN2A 4XPTH 2CUAA 2NQ3A 2A0LD 1B0WA 1BVKB 3KVQA 3GHBH 3LQAH 3CXHK 3O41B 4YEFA 1ND0A 2QL1A 1UXSB 4NIKB 1BJMA 1GYWA 1U8QB 5BJTA 2WWKO 5IV2A 3IS1X 4HKJB 4JO1H 1Z9SA 5D1QC 4NO2B 1MELA 3CHOA 4NNXA 2R0ZL 1C12A 3S35H 2ZPKH 4JM4H 1G1CA 2RFXA 2YAOA 3MLUH 4XC1L 5LAPA 4NNYA 5HHMD 1KB5H 4W9GC 4HH9B 4XHJC 4Y9CA 2Q7AA 4PRIB 4W6XB 3KWTA 2J73A 2NUPB 3BEWA 2XWJA 5L8KB 4U7MA 4YSSA 4LLDB 1SLWA 3OPZH 5FW6A 2FBJL 5IEKB 2BVUA 3HPJA 4A2LA 2E7CA 4GSQA 1AXTH 5D70H 5A2CA 5TQ2L 4MMXA 3QSKB 3TJHD 3APFA 3QS2A 2WZ0A 1KLUB 4K7PH 3TT3L 4OGAC 1IAKA 1ZVSB 1CD8A 5GS0C 5KVGE 2H9GB 1FIEA 2Z93B 4AEHH 5E1AB 3FT9A 3CCHB 2MH4A 3VD9A 3QUXC 4LLQB 2H2PD 5BZDB 1ZK5A 2YAFA 1H3GA 3FUNA 3SBPA 5T3XE 5DEJA 5A2IH 1JJUA 3NCXA 1TTRA 3NESA 1QLEH 1SMAA 1R5WB 4DTGL 5ITBH 1MIEH 2A77L 32C2B 1F3JB 3BUPA 5LCVH 2J2ZA 5E51A 2EEXA 4HV8A 1Q9LA 4BK5C 1C1EH