3VG9B

Crystal structure of human adenosine a2a receptor with an allosteric inverse-agonist antibody at 2.7 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
212
structure length
212
Chain Sequence
DIVMTQSPASLSASVGDTVTITCRASEFIYSSLTWYQQKQGGSPQLLVYAATNLADAVPSRFSGSGSGTQFSLKINRLQPEDFGTYYCQHFYGSTWAFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title G-protein-coupled receptor inactivation by an allosteric inverse-agonist antibody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Adenosine receptor A2a
total genus 53
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2011-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vg9B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vg9B01
1RUKH 3V4UL 4P5MB 1RIVL 3NFPB 1S7XB 1A6TB 2E7LC 4NO0D 5T1LB 1K8DA 1FSKB 2VLMD 2GTZB 4XC3H 2BNQA 2FEDC 3D69A 4G6AD 1J8HE 4OB5H 5GGRY 5I30L 3WHE0 4QRPE 5EBMB 4XGZB 5B8CB 2F8XC 1VDGA 3WE6B 5MEOA 1M71A 1BM3L 3BGFB 5EBGA 1IGMH 3GSRA 4X6BA 4D8PB 3BD3A 4JY4B 1IEAA 4PRAB 1F4AA 2B0SH 4R96B 4NHCH 4XPBL 5I73C 3LQAL 2VH5H 4IJ3B 3THML 1JZ3A 3QP3A 2ESVA 2WZPD 5ESVB 1MELA 2VLKD 4PJ9A 1OTTD 1MNUL 4NQEA 4WFED 3WJJA 1Z9OA 4NJ9L 5DSCB 5EOTA 1QBMH 3D39A 2A0LD 2I9TB 1T6VN 4NC1E 3T04D 3ULUC 5F1OB 4OGYL 3TCLB 4DZBA 4PJHA 2ZPKH 4M62H 5J56B 3X14B 5ERWB 4AQOA 3RAJL 3OKDA 5D7SH 3LB6C 1RZIA 4JO4H 5HHMB 2VDLH 5CBEB 2R2BA 2JCCB 4DVBA 3HPLB 1ADQA 4JRYD 2WANA 4QEGA 5EU6E 4ZXBC 4POUB 3WJJC 4GG6F 1G7HA 1F02I 3QJHB 1JBJA 5A3IC 1N5AB 1ZHLB 5T1MB 5SWQA 1OAUH 1JTPA 3SJVE 2P5WA 5KAQG 3JVGC 1RJZB 3FFDA 1E4KA 1N0LA 3DGGA 4YQXH 1NFDF 3NABL 2OR9L 4Y19D 1KJ2B 1BD2E 3O6LL 3AU1A 3TCXA 5GXBB 4AMKH 3S98A 3EFDH 1IILE 5HYFA 3LQAH 1NCWL 4ETQA 3T0ED 2NNAA 1Z0NA 3T0VA 3O11B 4ZUTB 5C7XL 2R29H 3CUPA 4XNZB 1MQKL 2W65A 3ARFD 2XZCL 4NKOB 4U6VH 1T0PB 5GPRA 1OGAA 4QHLA 2P8LA 2APVA 8CGTA 4XAKD 3RY5A 4M5YH 1QEWA 1YNLH 3HC4L 3HE7C 5KSAA 3MLVL 1RK0A 4MJ6B 5K9QG 1HHIA 4PGEA 1EO8L 3QCTH 2WNGA 4HIHA 3C87A 3TVMB 1UM4H 4LSQH 3PWJA 4FTVD 4I77H 4UTBH 3GSUB 3V5KA 3FONB 3UO1H 2J5LC 4R7NA 5DJ0A 1EHLL 4ODWA 3S35H 3LN4B 3RGVC 3RVXC 3O3AB 4PJBE 3MREB 4PRHE 4X6DE 5C3TA 4EUPB 4F7PA 2NZ9C 4KRMB 1IGTA 1JTOA 1LP9E 4HBQA 1OCWH 3DMMC 2CKNA 5EC1B 4I0PB 1GZPB 5I1IL 1Y0LB 4PJCF 3NFSL 3WJLA 2BC4B 1KJVA 4YPGA 5I8EB 2A6DB 3QR2A 4PJHF 5HD8C 4HUVA 2M8XA 1BFVL 4P2RD 2AERT 4G42A 3LKNB 1FORH 5LGHL 3V5KB 2NLJB 1TNMA 3LD8C 3KYKL 1BZ7B 4X80L 5GS0H 4HGKC 3CAFA 5CCKL 3BN3B 3WUZA 3CU1A 3NIGE 2AKRA 1PD6A 3OKOB 3AAZB 1CZ8L 4JKWA 4ZD3L 5T1KB 2VDQL 1P7KB 4L8DA 3QCVL 2DMKA 5I8KL 3GB7B 4QT5A 4UZGA 4DOHE 2EDRA 5CBAB 4TUKH 2YBRA 3V0VA 5HI5D 1VGEH 3IDNB 3X3GL 4X0KB 1G7LB 2Z92B 3WUWG 5KVDH 3LH2H 3FO0L 3RPKA 3VFWA 4PGZA 1L9NA 4OF8A 3QIBD 4IJ3C 5I16A 4KRLB 5E4EB 4XCNB 3P4MB 1FYTE 2F54A 3MODL 3SKOB 2J88L 5CKGA 3BEWB 1K8IB 1MIEL 1WIPA 1MWAB 2GSIB 2QQNL 1BGXH 3D3VE 2P5EB 3ZYJA 3KNBA 4JY6A 2BDNH 3CLEH 4MQXD 3WCYA 1GIGH 1AQKH 1DL7H 4X8XA 1DDHB 3HZMB 4JFHD 3VCLA 2W0LA 3L3OB 4PP2A 1JCKA 3FFCE 3LRSB 3FQXA 1I7ZA 2J8UB 4OBRA 4PV8A 1JNNL 2ZP0T 4MNQE 1CT8A 1JPSH 2KBGA 4XP6L 1NBVH 3W0WD 2ITCB 3LAFA 4KHXH 1AY1L 5GSRB 3FB5B 1RURH 4FFYH 2MPAH 4NM8L 4ISVA 5CGMA 4NKQB 3QG6B 4XP1H 5I2IA 4ODXA 4UU9A 5KSAD 5LKNA 2IQ9H 2FX9H 3JTTB 4PJ9B 5FYKU 3UAJD 2ZZUT 3HI1B 3VG9C 5F7HA 5ADPL 4NC1C 4GFTB 4JRXD 1MREL 5A40E 4HLJA 2AJZB 3TZVC 4YXLH 3U0WH 4Z7WF 4JFFD 1U8QA 2VLRA 2UUDH 5ACMA 3FQRB 1QFOA 1WBXA 4NQCA 1MIML 3P9MA 3TYFA 5I8OL 3AS0A 4GBXB 3DX8A 3M45A 5GGVH 5HHMD 2B5IC 1IKFH 2C1OB 4WTZG 2R0WH 3FMGL 4JFDB 1KG0A 2LVEA 5H35A 3LHPH 1LE9B 3IFNL 4NO0B 5CP3A 2ICWJ 3S36H 4N0CD 3HG1A 4OCNC 1MRFH 2WWKT 3IJSA 2PW2A 1WZ1H 1WAAF 3RVTD 1DVFB 3DSFL 2ADJA 2AJXH 3FO1A 3MV8B 4POZC 5HDLA 4GG6A 3HZVA 4FFYL 2Y1VA 35C8L 4M5ZH 1S7UA 4Z7VB 1QQDB 4YBQC 4DZ8A 1L7TH 3MJ7B 5CD3A 3EOBB 1MI5E 4P2YA 3ZTNL 5INDB 1CXHA 4RAUB 1A14L 2NY6D 4HK3J 5DFVC 1N3NA 2QTEA 5BQ7B 1UWXH 1MVUB 4JDZA 1DBBL 1FRGL 2W0PA 1A7OL 4OZFH 2NY6B 5FYLL 3K8MA 5GS0D 5ILTL 1CFTB 3JV6A 5BQ7A 5DD0L 2YD9A 4KHTL 1FO0A 1BBJB 5J12C 3EYQD 4HS6A 4MXWH 2DM3A 1CL7H 2IG2L 2V6HA 3RGVB 3DX6B 3VFUA 4KKCC 1AI1L 1QSEB 3EW3B 4U1LA 2XA8L 4CW1A 3FT3B 4FQ1H 4MNQB 2Z8WC 3FZUD 3QDGD 3BDXA 2H2SC 3MBEC 1UM5H 1OAYH 3TBVA 3ZKND 4OIBA 4PJXA 2C1PB 3ZE2F 4AENB 3KPRB 4I2XB 2X4QA 2DQTH 2OQJB 1BFSA 5AUMB 1BHGA 1UYWH 5I6XB 3WDHA 4JG0L 3SE8L 1T22A 3VFMA 4GLRH 1HQ4A 2VO5A 2ZKHL 2FWOA 1JMZA 1RQ5A 3QIUA 5J11C 4JM4H 3JZ7A 5FF6B 5B4MC 1ZHNB 5TF1L 1WCBA 3EOAB 5JW4R 3ULUE 5C07B 2R0ZH 4GRLB 5CZXD 4QY8B 3BPLB 4K3EH 4WVRA 3ORJA 2MHAA 2VUYA 4TN9A 1AGBA 4XNXH 3VI4E 5F88A 5DDHB 4PRDA 3E8UH 5CJOL 2AK4E 5E00B 3HC3H 2ITDA 3BZEA 1G0YR 3HG1E 2O61B 3DETD 4UIMB 4NRZA 4IOIA 4HC1H 2YMXL 4YHKH 3ULVF 5EFIA 1CK0H 2V2WB 4KK8D 5F1IB 4IMKC 3V6OE 3OG6B 1HKLL 3PIQA 1MF2H 1FCGA 3GIZH 3BWAB 5KVGL 2YPKB 5JNYB 1MJJA 2PW1A 1KN4H 3QQ3B 2R56H 1S9XB 2V5SA 4L8BA 1MQKH 1JZ7A 4QXWA 4R3SA 5EU5A 4LP5A 1A2YA 1G6RA 2J6EL 3SKOA 5HHPB 3V95A 3F62A 4GSDH 2D9CA 4DN4H 2NY4D 2HT4C 1MCQA 1OSZA 4CU6A 3FOMA 5IF0B 5J0BA 2XWBA 4ZSOA 4AIZA 4BH7A 5CEZD 5AEAA 4X4ME 1YEFL 1KB5L 3ZDZE 2D7OA 1KCSL 3MNWA 4G6MH 1L7TL 4U7MA 2PNDA 3V7MA 2V17H 5F89A 2ENSA 1RU9L 4LL9A 1D9KC 4CU7A 3GEWB 5DR5L 5IOPB 2ICEB 4QTHB 1KIRB 3D3VA 5C0CE 4YZFF 2X4PB 4XP4L 1JRHL 3EHBD 5CWSA 4AEHL 4PGBA 4JKMA 4LHUB 4LOUD 5I76A 4MMXC 3U4EA 3C6LD 1FNEB 2VZUA 4NQXB 5I73B 5KSBA 1TTFA 3OKKA 3IDIA 1UWGH 2E7LA 2F5BH 5T5NG 4KI1A 4ZUWB 2VE6B 3GMOB 1EERB 3ALPA 2IAMA 2ENYA 4J12A 5JLZB 1G7IA 2P24A 3MUJA 5M7QA 2P5ED 2ZSVB 4ODVL 2Z31A 1FFRA 1XCQA 5C9KA 2ED7A 5JDSA 25C8H 4U05A 1NC2B 3OZ9H 1ND0A 3TN0B 3Q1SH 2AVGA 4YIQB 5FK9B 2CRYA 3PHQA 5C0RH 5LQBL 3P4OB 4P5KA 4EEEA 1NDMB 4KUZL 2NZIA 3PXHA 3QEQE 4JEGB 4KJYA 4LQFH 2AXGB 3F65A 2G60L 4G9FE 1H5BB 4OT1L 2EDWA 3QDJD 2R69H 1XIWC 4JM2A 1IAIL 4HUUB 5I1GH 4LCCB 3KWWB 1WT5A 3D3VB 1SYVA 2I5YH 4PRHA 2VJXA 4M1GH 3IT8D 1G9MC 2BSTB 3NZHL 1QFWM 3QHZH 3F58H 3BD5A 3TO2B 2Y06L 3HNVL 4LKCA 4AEFA 1TQBB 4P4KB 3Q0HA 4N9GA 4YDJA 1X9QA 1QPXA 2F74B 4I48B 4NT6A 2ICES 1XF3A 3H3KA 3QQ4A 2J5LB 4LEXL 3H8NA 4Y4HA 3NN8A 3EYFB 5IMLA 1PY9A 4L4VA 3AMKA 2MSPA 4P59L 1BOYA 1F97A 3BP6B 3FO0H 5E4IA 4ZS6C 4YX2H 2AEIT 4G6FB 5C0DB 3AGVA 3B9KB 3MRIB 2P4AB 3HE7B 5DJAA 1NMAH 1D3CA 1R5IB 3MXWL 4HUNB 1RJLA 4WV1B 2FX7L 3EO9L 5DO2C 3VH8A 1AGDB 2JIXD 4G6JH 5HGBB 1FSKC 3QHFH 4E42A 5MHSE 1KCVH 2B2XH 2VDKH 2E27L 4Z76B 3EYVA 1Z9LA 1L0XA 1W0YT 3QNXB 4DK3A 3DX7A 1PSKL 2FO4A 2VTFA 4XVUC 4FFVC 4UT6H 5DTFB 3WFZA 5IESL 5L0QB 4DN3H 5HGDB 4Q7DA 1DJSA 5C0BA 3S97C 2EC8A 3KPOB 2XKSA 1ZT4B 3RL2B 4MX7B 3EJYD 2F8OA 5DJ6B 2FLBT 4U1HA 3ARPA 1WBZA 4MA8L 4K3HA 3GIVA 2HVKA 3QUMB 4D9QD 3U1SL 1OTUD 3C6SB 3QUKB 3RVWC 5C0NC 5AD0B 4OSUL 5E4EC 4HFUL 5ESAA 2YD2A 4A6YB 1DSFH 5CSZB 5D8JL 1MHPL 2J12B 1LE5A 4Q9CA 4HF5H 1XCTA 3RZCB 4CADA 1LWRA 3WMSA 1KCKA 3W5MA 5SWZE 4HIIA 3BIKA 4KRPD 4UB0L 3RY6A 3FTGB 3PWPE 5JXEC 2XTJD 1CI5A 5DD6A 4YIQA 4HCRH 5J6HA 1SJXA 4E0RA 8FABB 3PJSB 1YYLH 5FDYA 4IOFD 4PJXB 2ARWA 4O51B 1JYNA 2YPLE 1RY7B 3IDYB 3TBVB 2YZ8A 4LLWA 3F7YB 4XCEB 4BSVB 1LO2H 4IHOB 4LDLB 1RZ7H 5DJXA 2XTJE 4NKMA 1XGUA 4N0UB 4XBEH 4Y16A 3WS3B 4Z95L 3V52L 2IBGA 5JXED 1F4WL 4KRPC 1LGVA 2OJEB 2YPLA 1A7NL 1HSBB 4LGRB 5I1KH 4HS6B 4RX4D 2QL1A 5GGSA 3ES6A 4PREA 4TSBL 3MGOA 1F3DH 3UTSA 4AH2A 2D7NA 2ZOLA 4JAMA 4QRPA 3NPSB 2DIBA 4PJDB 5EBLB 1TZIB 3CDCA 3X11A 3RWGA 3CX2A 4I3GA 2AJSH 5FGRA 1U8MA 5LXGL 3DOSA 3HMXL 1OTUC 4LHQB 3MRMA 5IKCA 3EJYC 4OCMC 2YN5A 3NZHH 1JIBA 2VITB 3HCVA 2R39A 4XPTL 3WIIL 4CVZA 3VFTA 3NA4A 4OCSL 3FCTB 2CKBL 4FFVD 3RL2A 4LPCA 2NW2B 4XVUD 4L29B 1NGZA 3MX0A 5FB8A 3E6FA 4LCUA 5ENWA 3NABH 1IZJA 1VEPA 4R0LB 1KT2A 4UV7L 3G5YB 4OLYH 5D5MA 4PJ8B 5AYUH 4GRWH 3CXHK 4WU7A 3VDAA 4TSBH 3L3GA 3FRUA 2ZOKA 4MHHG 4NHCL 3U82B 1L0QA 1G84A 1YEDA 2VLKA 4PJ9D 5TQ2H 3E3QE 1CU4L 3UTTE 3QDMB 3N0PB 4R4FH 1FVEA 3VJ6A 3TH4T 3IFPB 1NGZB 4LHUG 3U4AA 1W8NA 1CU4H 4QTIH 1U8QB 4MWFB 2NY1D 4Y4HD 3VRIA 1CDBA 4CDHA 1FFPA 4NFBA 3JWDH 5JMRA 4FQHB 5KW9H 3C5ZB 1FFNA 1JJUA 3LDBB 4PJ7A 3HS0B 5E8OB 5DVOA 5I2IB 1NEZA 1S9KC 4YR6A 4ZFFA 1NFDB 2NY0B 4O2CB 3RZWA 5CZKA 3B9AA 3S4SA 43CAB 1PKQA 2WBJA 4WI2A 3RIAF 5C86A 1QO3A 2BY3A 1XIWD 1ZXQA 3RU8L 4R97C 2A9NH 4PTUB 1RU9H 3D9AH 3CX5K 3NGBB 3QUXA 3KJ4B 3Q6GL 2O5XL 4F7MB 1MHHA 3P11H 3D39D 4NQDD 1NC4B 3WEXA 3VGGA 2WBKA 1NBZB 3TT1L 4NQED 4HG4K 4K7FA 2XQYK 3NTCH 5L9DH 3CZFA 2XQBH 2OYPA 2IFGA 4QHNA 4N68A 3RNQB 1L4IA 3GGWA 2NYYD 4WDIB 4DGVH 2DB8A 4K7FB 4YXKL 3BIKB 5I71B 3JSSA 4YDLC 3ZHLA 4ZAKB 4NQTA 2Z31B 4X5LA 4KVCH 2Y23A 1ZLSH 4ONGL 3O6KH 4F7MA 5CBAA 3IB4A 3C6LC 4G8FA 3TVMD 4LOUC 4Q9RH 2VSCA 1V3KA 4LIQH 1BBJA 1E4XH 3EHBC 1Q0XH 1JPTH 4TPRL 4JB9H 5KSBB 3CFEB 4TQEL 4ZNEA 1KTLB 4JR9L 5D5ME 4YH6A 4K3DL 5FM8A 1D9KD 1A9BB 2WW8A 4S10A 3E2HB 4LF3B 1U95A 1X4ZA 2YA1A 3CC5B 1FFNB 4RNRB 2VZ1A 4WW2C 3T65B 2I07A 5E7FA 2ZNWA 4XP9H 3IDYC 5I0ZA 4H1LH 3AXLB 2FO4B 1UT9A 3TPUA 3WXWH 3QAZB 2X40A 5D1ZD 3WNNA 1YEIH 2J8OA 1FH5H 2HT4D 2NY4C 5EO1B 3TO4A 1Q72H 3AC0A 4HMEA 5CGTA 3QIUC 3MRFB 3S37L 3V4VH 2M1KA 1FZMB 4ZSOB 4AIZB 3MLSH 5HYJD 4YGVB 3BEVB 1S5IL 3M17B 1N6QH 4WNQB 2H6PB 3B8YA 4JFHE 5H35B 5E5UB 4XHJC 5ADOH 1HHIB 1H15B 4QXUL 5CJ8A 1SY6A 5DQJB 3Q1SL 2FEEI 1RHHB 4BZYA 4EI6A 3VXRA 4HC1A 4M03A 2DMBA 4NKOA 1ED3A 2J8HA 4U1NA 1NGQH 2FX7H 3EO9H 3FAWA 5INCA 2CH8A 5E8EB 5EO0A 3TIEB 3LKOB 4HJGA 5DUPH 1NAML 4JZNA 1KN2L 3VD3A 5FECA 4PY8I 5ICZA 1UC6A 3V6FB 3DETC 4X7SL 4JANB 3VFOA 4X6FA 5F9JB 4HKXB 1SYVB 3LS5L 1F90L 2G5BA 4G6KH 1KCSH 4K7PH 4LF3A 3FB8A 4J3OC 4YDKL 4LCYA 2VAAA 3HR5B 3GJEB 4KJYB 2D03L 1BVZA 1F3RB 3B9VA 5E03A 3UTSB 1I7ZB 4LARH 4K3DH 4PJXE 5B4MD 4PP2B 3E3QC 2OK0L 1T1XB 1GRWA 1ORSB 4UDUA 4BA8A 3MLZH 4JJ5B 4CMMA 5C09E 3KJ6H 3SDDD 4KK9C 5IEHB 4PBVC 5LWYH 4ZAKA 3UJIH 1KCUL 1SJEA 1CE1L 3ZKNC 4G8GE 4PJCE 3MBED 2X4NB 3FZUC 1W0WA 5F7WC 5H2BA 4PR5A 1A6VH 1TQBC 5E94B 1YZZA 3P4MA 3SE3A 4LKXB 3MV9E 4DN4L 4P3WA 5DC0A 3O8XB 4YXKH 2VNCA 3GSVA 3L5HA 3CSYA 1AXSB 25C8L 3MV9A 4LNRB 3IDNA 2DLIA 3CVIL 2EXWD 1U8KA 3F6LA 3KPMA 5FIEA 4WW2F 1KJ3L 2VXSH 2DQDL 4U0QB 5F7DB 1ZAGA 1P2CB 2D7TL 3DROA 1FZKB 1U8PA 1P4LB 1LVEA 1AHWA 3F7QA 1RZJL 4ODTL 4JRXA 2YK1H 3VXSB 1FO0B 2NY7H 3ETBF 3I6GB 3NCEB 4Q9QH 2PN5A 2BHUA 4NHUA 2VDNH 4EI5C 1BVKA 2G5BB 1KB9J 1UFUA 1DQMH 4KAQH 4X6FB 1NPUA 4GAYB 1TQCB 1OPGH 5A2FA 2W9LA 1ADQH 4I5BB 1IGTB 5EC1A 4NQDA 3PP3K 2RGSA 5JZ7C 3ZDYF 2UZIL 2EDOA 3QWQB 1G7MB 4N0CC 1S7UB 2FJFA 1FL5B 2KZ1B 4X8JA 4P23A 3DWTA 3ULUL 1B0WA 1UB6A 2VLRE 1EZVY 3T1WA 5DJAB 5HYSB 4JJ5A 4KVCL 1MCJA 4UDUB 3CVHL 2NY3B 1CICB 3MYJA 2PTUA 4JHAH 1U58B 1TETL 4LLAA 1AKJD 4JG1H 3OBAA 4E5XA 3MRFA 5EFIB 3HNSL 4YDJB 4JN1H 4J4PD 3KYMA 5GJSL 4NQCE 5C0AD 3SDAA 1FBIH 5A16A 3DYPA 3LCYA 3RPIA 3JWOL 4MHHI 1QTYT 4HFUH 4C54A 5I8KH 4Q97A 4P9ML 3UTPE 1SY6H 4GMSH 5F7NC 3HR6A 3QFJA 3G6DH 3O6FB 1YEJH 3MLWL 2F54D 4WIQA 4R2GB 1H5BA 4DGYH 2VLRD 3ME0A 5INCB 4NCDA 4TUJB 4V1DA 5HYJB 2VR5A 4OFVA 3IDGA 3N1GC 7FABL 1W72A 3MRMB 4PJIA 5J9PA 4KI5E 4JG0H 3SE8H 4EXPX 2DWDA 1BQHG 1X5YA 1IAOB 4O9HL 1FFOB 3QEHB 1HHKB 2IALA 2OTPA 2WP3O 4PJ5E 5D72L 3BSZH 4V1DE 4G8FB 3KVQA 2J4WH 3CU7A 1H3TA 4ORGA 5B8CC 4YE4L 1GHFH 2ZSVA 1IGYA 1G7IB 2NXYC 3DHMA 2QR0A 2GK0B 5FYJD 1ITCA 5JW3L 1OHQA 3ZYOA 3ECBB 1CGVA 3VXOB 5EOTB 4NCC1 2HKHH 4GAFB 4NQSA 4POYA 3RNQA 3AXLA 4WI8A 3ZLQC 4ELKA 1XGPB 4GS7C 1GOFA 3UROR 5I9QC 2VLJA 1NL0L 4RGNB 5C71A 5EH1A 2X4PA 4LCWA 1J11A 1U93B 3IDXL 4LEOB 3UPRB 2UVEA 3HFMH 4I9WD 5GS2D 1PYWA 1YNKH 5D2LE 3V0VB 1S3KL 4MCYB 5CEZH 3MCKA 4GO6B 4OZHA 5DZLA 4G6FD 4MS8D 2AQ2A 5ACZB 3OXSB 3DX9A 4BK5A 3RX7A 1WC7A 1JMXA 4U1HB 5SWZD 4K8RH 3MV01 3ARXA 1JPGB 3VWKB 4ZFFB 4Y0GA 4OCRH 3HZVB 1A6WL 2CIIB 4Y16C 2LV4A 1SEBA 3TJEH 4P2CG 3HS0A 3DMMD 4PRBB 4KMLB 5E5MB 3HRZA 1JZ6A 2NZ9D 4QRUB 2BERA 1WIUA 5HYSG 4L3EE 4YPGB 3RVXD 1KCUH 3RGVD 2DBLH 4HHAB 4LSUL 2I60L 3VRIB 4YHLL 5J12B 5K9KB 3WIHL 4YHIA 4I0PA 1WSST 1HIML 2YWZA 1YEIL 4R4BB 4K94L 4D94A 3T09A 4L9LC 1JFQL 1TZHA 3BHBA 2G75B 3HE7D 3DVGB 1YEDB 4LARL 4IOSD 1TNNA 3FQRA 3U0WL 1WISA 3OR7A 4MNHA 1YMME 1T5WB 3SOBH 1ZLSL 2R4RL 1EJ6A 3ARFC 3UP1A 2C4FT 2OSLB 5C0EB 5CFHA 1H3VA 1G9ML 1A8JH 5F6IB 1TMCB 4ZOAA 2VH5L 4L4VB 5T3XD 4WY7H 3C2AL 5T5NF 3ZE0E 1W72B 5EA0H 4XNYL 2H45A 2NW2A 3ARQA 2XKNA 3IGAB 1FNLA 2GUOB 4ZFGH 1T1WA 3TBWB 5CILH 3QRFM 4HIJB 4PJGF 1FV1B 1DQQB 4GRWB 1C12A 4UIKL 5IJKC 1RUQH 1LNUB 2Z31C 5A3ID 4UNVA 3AU1B 1XFPA 3PUCA 3HZMA 1DDHA 2EIDA 3GMMB 3NACH 4HH9A 3NGBC 4HUUA 4AYFA 4GW5A 4Y5VB 5K9OB 2AK4D 4CUCA 5E1AA 4M00A 1YNTA 2P5EA 2XN9D 2WM0A 3L5WA 3O2DA 3P4OA 4P5KB 4XPAL 1FNSH 4IIQB 5FK9A 2DM7A 2EDKA 4F7TB 4IDLA 4TQEH 2E8ZA 1LD9B 2A0LC 4AEEA 5I1EH 4LRIC 4TNWF 5ERWA 4MAUL 3WV0A 5IVNA 5IJVA 3MBEA 1XGUB 4N0UA 1AGFB 4X8JB 3DX6A 1TCRA 1WWCA 3RGVA 1U8HB 1XF2A 3MZTA 4HKZA 4QTIL 1J10A 4HJ0C 1MHCB 1A6ZA 4FXGA 1MIEH 5D93C 1J1OL 1GH7A 4LSTL 4ZUWA 4DFIA 1NCCL 3FN3A 2N7AA 1EEZB 4P3CL 3EAKA 1A0QL 1IBGH 1EVUA 4XCYB 4TVPH 3ULVC 1VFMA 3ARDB 3KG5A 4HZAA 2H9GA 1QBLH 2E7BA 4Z77B 3CZJA 1MCPH 2ZG2A 4LLDA 2IPUG 3C8KA 3PWLA 1BREA 2MMXA 1KB5A 3SQOL 1XR8A 3ULSA 1KPVA 4XVJH 4I13B 3O6KL 5I1IH 3ILQC 4JZOA 5CEYB 1CDJA 4X6CF 1WEJL 1CFNB 4ZPTB 3TT3L 4NQVA 1A21A 4G6AC 3KPOA 4TOYH 5BCAA 3TFKD 1NMCB 4M9OA 3PWNA 4TSAL 5CZVL 5I1GL 1EGJL 1HH6A 2X4OB 3KLAA 4BSVA 4ESKA 4N90E 3K4ZA 4WFGE 1LE9A 4TSAH 4MAYA 5IHZA 3OKMA 2FJGB 3KYNA 3VXUB 2D4DA 1DQLL 1JGDA 5E94A 3IAGC 3BAEL 4JPKL 4Z7WA 5F8RC 1RUPH 1RZGB 3CDFA 5TQ0L 1MFAH 3A67H 2IF7A 4TRPH 1X5LA 2XTJB 4BFEA 2W65B 4LSPH 1LK3L 2R9HC 3QWOB 3AMLA 2J6EA 4JO1L 4X6EB 2X4UA 4XWOD 5KJRL 2E9JA 3GMPA 3BD4A 1I1YB 2R0KH 1W8OA 3F5WB 4PJGE 1KTDB 1UKQA 3IU4L 2ICWA 1Q8MA 1QACA 4FZ8L 2P7TB 1XF3B 4EIGB 4J2XA 5J6GA 2FGZA 3HNSH 5JQ6H 5EO9B 4P46B 1J1OH 2ADIA 4WTXA 1AO7A 4D3CL 5C0JA 2OL3A 4G7VH 4CU8A 2BHYA 5J6GB 2GT9A 1DEDA 1A0QH 1IBGL 3IFLL 3BP4A 1ZT1A 5E00A 5C08B 4YHPA 4PJ5B 1DANU 1T7VA 3D0LA 4DVBB 1LO5B 5BZWA 5D7SL 4Z5RB 4KPHL 4Z95H 5FECB 5DQDH 1A3RH 3GO1H 1PW3A 5SWSE 1YEGL 3BQUD 4U1GB 4RGOH 4XNXL 2H2PD 5DA4A 4JY5H 1DLHB 4MD4B 4RFEB 3STLB 5HYJE 2AXGA 2BVQB 1OLZA 4PJDF 4ONHB 4MA8H 5C70A 1PY4A 1NDGA 3FFCD 1MJ8L 1Q1JH 4MVBC 1I1RA 5IVZB 1BBDL 4HH9B 2CRIA 3VD4A 2GJZA 5H37G 4NP4L 3WO3B 1LNUA 5DEZA 4OLXH 1DR9A 1EGJA 4OFYD 4PB0H 5B3NA 1HH6B 2X4OA 3KLAB 4Z7UE 5C9JB 3Q5TA 1KENL 4NWTH 2EEAA 4I48A 4NT6B 2YRZA 1FYHB 4CGTA 3K74B 1M7DA 5AG9A 2GFBA 3EGSA 4L8SC 1ZKAA 2AQ1A 1Z2KA 3D0VA 3UJTL 3TC9A 2W91A 4L8DB 4OZGB 3NA9H 4K2UL 3NFNB 4NNYB 4L4VD 4ZS7L 4ENEC 5ACLA 3K81A 1FNEA 3QNYB 1Z9SA 3HAEH 1A5FL 4HSQA 4X6CE 1ZGLB 2HFGH 5IESH 1OGAE 5IV2A 1A9BA 3QI9D 4RIRB 2GAZA 3GSWB 2Z35B 1SBBA 3L6FA 1G9MH 5KZCB 5M94B 1KCRH 1MEXH 4P2QD 5E2TL 3O0RH 1GZPA 4DUXA 1OW0C 2QKIB 3A6CL 1BJ1H 1CLCA 2OXHA 2DQUH 1S7XA 3NFPA 4P23C 1U3HD 4JKKA 2FEEL 4ODWB 3GI8L 1EEYA 4N1EA 3FO2B 1GL4B 4KQ4H 3IXTB 4Z7VE 2P5WE 4J1UB 5D7IE 4Q74A 1L6ZA 5I30H 3MRBA 4M7LH 4JFOB 4OKVB 1XGRB 4EN3A 1IEBB 3DSFH 3NACL 1ORQA 4UOW0 3OXSA 5JUEL 3MRRB 2IBBA 3RA7H 1MJ7H 3QPQC 4ZO7A 3U4EB 2HLAB 1K3ZA 2DJ4A 3LOWA 4HD9A 1AQDA 2B8OT 1OB1A 1VGEL 2Y7QA 3AREA 2AK1H 3L5IA 3QUXC 5A2JH 1FN4A 4F2MA 4OF6A 4QTHA 2HH0L 4MNGA 4R26H 5C8JA 4P2QA 2WP3T 4NN6B 5D7KE 4XAKE 3D39E 1E4WH 1OGTB 5JTWA 2X1PA 2HFEA 4GH7B 4MDJA 4WHYH 3RWHB 4AK1A 5CEZL 5IQ9B 4ELKB 1RAMA 1YNKL 2EE2A 4WGWB 5I19L 3NVQA 5I8CA 1UWEL 5DMGD 2BVPA 4WUUE 3OJDA 3RVVD 4JZJC 1JWSA 1NGYB 1TVBA 2XKNB 1T89A 4MXVE 1JNHB 5HHOB 1I8KB 2VC2L 4DW2L 4JFEB 4E41B 4X9FA 4EIZC 2GK0A 2UV3A 4I8DA 2E6PA 4HKJB 5IBTH 5F88B 3A6BH 4GUPA 1J0JA 4JJHA 3WUWB 4PV8B 3U4BH 1FNGB 5C0EA 1VB9A 4G3YH 4OFPA 1EFQA 3D25B 1T5WA 1YMHA 3L3IB 1FNGA 2J8UE 5CJ5A 2BSED 1KXTB 4FXKB 1ACYL 1Q72L 1S9XA 2V17L 1FGNL 2FATH 2JB6B 3KNBB 1RZ8A 2EDNA 1I9EA 2DDQH 1JGUH 1T3FA 1KYOJ 5I8CB 4NNXA 4RWYH 1B3JA 3HZKB 5BS0B 3NZ8B 1AKJB 1X3DA 5D96B 1XZ0A 2ZUXA 5BVJA 3W0WA 5E99H 4TNWK 5HYQA 4J8RB 1F2XK 4IOIB 5KVEL 4J3UA 3MRHA 1TJGL 4HPYL 4UT7L 3RUGB 2DYPB 5C7XH 1S78D 4GRWE 2Q20A 1CR9L 1WFTA 3ARZA 1UQSB 4JQIH 3L3JB 2NY2D 3DRQA 4UBDD 2AI0H 1ZGLP 2EXYC 4WEMB 4GRLA 4DTGH 5D2NB 3JUYA 5EPMA 3OKNA 4NJAL 2YUWA 5ID0A 3WSQH 4XGZA 5B8CA 4OKVA 3GBNH 4Y1AB 4FQIL 4JGMA 4KH2A 3GBLA 4QKXB 4IRSB 5EOQL 3VWJA 3IXTA 5I15L 3BKCL 3D18A 4JN2B 2HTKD 3QDJB 2VLLA 5IMOA 3EOBA 1ZANL 5INDA 4DQOH 1JHKH 3EJZC 1QBAA 5KSVB 3ARRA 2CK2A 1A22B 5FUZH 4EDXA 1BIIA 1S9WA 4GAYA 1I85C 5CMAB 3WS3A 4WO4B 2O5XH 4P2RE 3VFUB 2PUQT 2R0ZL 1JZ2A 1RUAL 1ADQL 3TVMA 1GOHA 4ZMAT 4X80H 5FYLD 5GS0L 4PY8J 5IIEB 4GW1A 2AJVL 2C1OA 4ERSH 1ZLVK 4S1DC 1CDCA 3FTGA 5IHUL 5J9PB 1CBVH 4DUVA 4YHOH 2BY1A 5BRZE 5IB5A 2HJKA 5D2LF 4ZFOL 2DQDH 3ARTA 5CSZA 3N1FC 3GHBH 4PLKC 1U9KA 1H3WM 5M95B 1G0DA 4XBGB 3CSYB 2VISB 4M02A 3NBNA 3GJFB 1TITA 5IEKB 2R1YA 3CCHB 1KJ2A 2VXQH 1DN0B 4MQSB 4AQ1B 3H7BA 4P3DA 5FA3B 1MFNA 5ISZA 2OJZL 4N1HB 4MDIB 5DYOA 3S3PA 3SE3C 4H1LG 1IARB 3V6OC 1JWUB 1J0HA 2A6IB 4KQ3H 3T0EE 4DTGL 1FE8H 2QQKL 2A77H 1K6QL 1YC8A 3LKRB 2H8PA 4WW2B 5GGUB 5D9SB 4WFHE 4OUOA 3TA3A 1I9IH 3C5SA 4EQ2A 1KSRA 5D1XB 1CN4A 1U8LB 1ZA6B 2IPKA 1PG7H 2RQ8A 2H8PB 4PJFE 3QI9A 3CFKB 3VXTB 5HSFA 3TCLA 1HSAA 4HKBA 2QV2A 5C0JB 1Q9LA 3SKMA 2FL5B 5I17B 3ARBC 2OK0H 3LKSA 3DARA 1XF1A 4QXGH 4C56D 3GUTB 5I18H 4JKLA 4EI5A 2AABL 5D1QA 1PJ9A 1CGUA 4XMLL 1AR1C 3GUTA 2H41A 4PRIB 5DJCA 1MFCL 2JELL 5I19H 4WI5A 5FV2A 4PG2C 2V5TA 2DKMA 3UBXB 2YD1A 4O2FA 4Z7OE 4H8WC 4PRID 1U2CA 3GSRB 3SDXA 4Q6YA 1GXEA 5EA0L 3S7GA 1U8LA 1ZA6A 2IPKB 3T77B 3H0TA 1J88A 1KN2H 3GJFH 4PY7A 3V52H 1UJ3C 1A7PL 3SKJH 4X5XA 5CS7A 3GBNL 4LRIA 4YGVA 4FABH 2R2CA 4WW2A 3PDOB 3PWUA 4KWUA 1MCBA 5ITFB 2EYTB 3ESUF 1HEZA 5I75B 2ZUWA 2IMMA 5EUKA 1S8DA 5HXMA 4MDIA 1L7IL 2WAHA 3NPZB 2QBWA 2PYEA 3TO4C 5CSBA 5EDXA 4PR5B 4NYLA 4K3JL 1LEKA 3K4DA 4XC3L 3W5NA 2WK2A 2APWA 4M7KL 2HFFA 1D6VL 1HXYB 1A1MA 4RA3A 4XP9L 1N0XH 4KDWA 3KJ6L 2X41A 2NR6C 1LP9A 3TBYB 3TNMA 2Y5EA 1UCTA 3KHQA 5F44A 4I1NB 2EKSA 4JKPL 4LPVA 1QLFA 3VGBA 3RKDC 1HHJB 5ETUB 1QNZH 2FIKA 3PL6C 1BF2A 4OF0A 3DUSB 3FN9A 4HWEL 4OGAD 3O8XC 3G08A 1FGNH 2FATL 3G6JA 1HHJA 2ATKB 3MLYH 5ETUA 1I1AB 2QEJA 4HXBL 1GJIA 2MCPH 1MHCA 2ZCHH 3P4LA 1BZ7A 3MOQA 4PGBB 4JFEE 4E41E 4YAQB 3LKNA 3WKML 3IDMB 4QOKD 5I8EA 3DV4B 5HHXH 1OGAD 4GXUM 3BZ4B 4JDTL 5CMAA 1KELH 3QZWA 5BVJB 1NGWB 1IAII 2OTUA 1LO0H 3SGJC 1LD9A 1HILA 4NN5C 3RFZC 3S5LA 1MUJA 1AKJA 4U1JA 1I1FA 3VMOA 3GSNH 2ZUQB 5L88H 3FFDB 4QHNB 3TBTB 5FUCC 5I1CL 3Q48A 5MEND 2YPVL 3WFHB 4F33B 1TXKA 4XMPL 4Z0BL 4URTB 3LKPB 4GRLD 2ZCLL 4Y19A 4F58H 2XFXA 4JFFE 3QCUL 1YMMB 3I2CL 3T2NH 3GMMA 2G9HA 1MHHB 2DQCL 1PEZA 3VFPA 3ARGB 1BFVH 3QIWB 3L95B 3IDUA 4QHLB 5DK0B 3IVKB 1INQA 4QRRD 4GJTB 3RA7L 1RUKL 2HTLD 1WLHA 4D9RE 3D2UB 2FX9L 1CZ8H 4ZD3H 1JF5A 1G9NH 3Q6GH 1NGYA 1TVBB 3EYSH 3MGAA 4QXGL 2VABA 3OV6A 1RK1A 5E08L 5DGQA 5FKPB 3HUJE 2R8SH 4KI5C 3MRQB 1VGKB 4Q0XH 5F1IA 1X5KA 1CDIA 1IM3A 4U0RC 1Q9LB 1ZLUK 1XT5A 5H8DA 2YEZA 3DVGA 3I02B 2R0LL 1BX2B 4ZOCA 3WHXB 1OB1B 2Y7QB 3QFJD 5DFTA 1ZVSB 3IKCB 5GJSH 3O6FD 3VW3H 2GYSA 2APFA 4L9LA 3HAEG 4JO1H 4M6NL 3RZCD 3FRUB 3CH1A 2XTLA 3GM8A 5HJ3A 4JRYB 5D9SA 3P9WB 3MLXL 4ONGH 4LIQE 5C0FB 5K9JH 5D5MF 1IEBA 4HEPG 4LVNC 2LFGA 4FQIH 4PJGB 4ZFOB 1P5VA 2GJ6B 4HJJH 2CJUL 3JV0A 1HQ4B 1CXFA 1KGCE 2DJSA 2R1XA 5I1AA 2B20A 4HWBH 2UUDK 1CLYL 1YC7A 4OLYL 3CZFB 2X4TA 3B9DA 5D70H 3VGFA 2Q6WB 4P2QB 4UUJB 1PYWB 4R4NC 3DV4A 1CGSL 3PXJA 4NP4H 1EV2E 2XG5A 1CD1A 5DZOA 4LCWB 4PRNB 5J57B 5DWUH 2PXYA 2AEWA 2WBJC 1GGIH 1CFTA 1AD0B 1FVDA 1IGFH 5DWUL 1ZWIA 3SE4A 1J1PL 2XQYG 3W81A 4F8TA 4TVPL 1QLFB 3LMJL 5I75C 4JDZB 4C55A 1ZS8B 2ARJB 3BZFB 4KMQA 3TNMB 1OARL 1S9WB 3VG0L 3EYUL 4D2NA 1T03H 5GZOC 1H5BC 5LGJB 4JLRA 2DIAA 4HH8A 2CRZA 1LEKB 5L8JB 2YD6A 3OKYA 2YXFA 1AD9A 1R3LA 2HT2D 1V5JA 4P2RB 1KPUA 3IFPA 1QBML 5MERB 3DNKA 4JFPA 4Q2ZA 3CDGB 3G5ZB 1X6LA 1T4KA 3VXMA 3LQAC 4CADB 2WLZA 5C6TL 1ZHBB 3U9UB 3UYPA 3MNZA 1K2DA 4UAOB 4XH2B 1ZGLA 5GGRB 4YGAB 3RJQB 3VXUE 4M1CD 4UB0H 3RBSA 3SGKC 3H0TB 3KPQB 5B38G 2QSCH 3IKCA 1FFQA 3OL2A 3SCMC 3OGCA 3ZT7A 5LVEA 2C3GA 2NXZC 1MCNA 3SGDH 2OL3B 3TN0D 4BQCA 5HHME 5CJOH 2GFBB 3EGSB 1RVFH 4Y4FD 4YUEL 2LTQB 2X4RB 1U6AH 3KPQA 2AJZA 5DJ8A 3WO4C 4Y4FC 1MCPL 5C1MB 1JGUL 2VL4A 4ALAL 5TFSL 5DTFA 3TN0C 3UC0H 1EGJH 4HXAH 3V8OA 2NXZD 5HVHB 4ZUVB 4WW1B 1G7JA 4BQBA 4YDIH 1ZHBA 1NAMB 4HULB 3QNXA 2GJZB 3VWJC 1MNUH 4M9PA 2VXUH 4M1CC 5JIHA 2BK8A 1NCDL 1QSFA 3UZEA 4X4YB 1FPTL 3K0WA 1U8IB 3QEGH 4QGYA 5DK0A 1R3LB 3MXWH 5AWNL 2BMKB 3ARGA 4Z7WB 1A1NA 3W9EB 3DV6B 5DT1H 3SDXE 3VXUA 1E4JA 3B5GA 3KXFB 2A1WL 2P48B 2VLJE 2HT2C 4OM1H 1SM3H 4Y16B 5TE6L 2CJUH 4HJJL 1FAKT 4YEFA 4AIXA 2A6IA 3FL7A 2HAZA 2Q8AL 1P1ZA 4KMTL 1LDPH 5GZOD 5TDPB 3W11C 5DUBB 1XR9B 4QNPE 2Q76B 1MUJB 4U1JB 3CMOL 2MWCA 3QZWB 4N8CH 1X4XA 1OWWA 3GI8H 5EU6A 1MLCA 3BZ4A 5HDBF 1FIEA 3QNZB 4OF5A 5KSUB 1U6AL 4J3SA 1FN4B 2I5YL 4F2MB 4NN6C 3ULSB 4OAWB 2YOCA 2P1YA 4J23A 2WBJD 4MJ5A 1U92B 1XGYL 4OAWA 2K7PA 3ILPB 2X4TB 4Y88A 3DPBA 4I3RH 2VZOA 3AAZA 3JXAA 4C83A 1QFWL 1V3MA 3GK8H 4NO3A 2EDHA 1XR9A 1N26A 1AFVL 1MCOH 3WXVL 1W0WB 2HYMA 1G9NL 3EYOA 4NM4H 2D0FA 3OZ9L 4XMKH 1U8HA 2ESVE 3L7EA 4FQCL 5ISZE 1RUQL 3DRTA 4JFXB 4LRNL 1RFDL 5CIPH 5EU3B 4B53A 1NMAL 3GNML 2X7LB 3KS0H 3IDJA 2R2HB 1KCRL 1MEXL 15C8H 3PABB 1C5DB 5JHDE 2APBA 4QHUA 1E28B 4ZFGL 1XF5B 3ARBB 3EYVB 5D4QA 3BUYA 3S9DB 4UDTA 1WBYB 3D6GA 1GGBL 2ADGB 2Z35A 3JV4A 4WWKC 2Z0BA 2W0FB 4OLXL 3OJVC 2GAZB 3GJEA 1MRDL 2NY5H 4LLDB 3RZCC 1IM3B 3FT4B 4P9HL 5MP6H 4KVNL 2VWEE 3NCJL 3GDBA 3O6FC 2V7HA 5ID0B 1FLTX 5IOPA 1VACA 4WW1A 1YN7A 3NN8B 2VABB 1TFHA 4EN3D 1M7IA 5C92A 1DBKH 3QQ4B 4YBLB 2QADD 4FQ2H 3LKOA 3MLWH 3MNWB 1OW0A 3O9WC 2GUOA 3TO2A 1M7IB 5CLWA 1IAMA 2L0DA 4KRPB 4HZLB 4OD3L 1CFVH 5HVWA 3I3BA 4IRSC 2HTLC 4U31A 3H3PL 2BNRD 2NXYB 2C4XA 5IWLA 3OJ2C 2JCCE 1HKFA 3K7UA 4L4TD 4XH2A 3WIFB 4PJ5D 5E6YA 4P46C 1N5AA 4Y19E 5IBLD 2KQNA 3ROLB 5ICYB 3QI9B 4FQXB 4Y5XA 2D3VA 4XC1L 3DMMA 1W72H 4H26A 4K55A 1FLRH 4O5LH 3IFLH 5BZWB 2E7HA 3U0PA 4TRPL 3EDKA 5EU3A 3S36X 5D1QC 3LKRA 4LCIL 3SDYL 1YPZF 1DQJA 1T66D 3BX7C 2A9ML 3BP7A 1AO7B 1HN1A 4NRXA 2WUBL 5T3ZL 3D85B 4JFEA 4E41A 5MI0B 3X17A 4F15C 4P46A 4MQ7A 3RY6C 1WGOA 4UIMA 4AT6A 2P7TA 2VDQH 3CXDH 4HC1L 3FQTB 3G6JB 4YWGL 3GJFA 4CVXB 3OKKB 3T0BA 5DDHA 2FYYB 1BFOA 3QA3B 1T5XB 2HFEB 4P2OD 4L9DA 2EYSB 1U91B 3G5VB 4ODUB 3KLHD 1BP3B 4PRAA 4OGAC 1F4YH 5JDJA 3U0TA 4JPKH 5J7CC 3PL6D 2CLRB 4NWTL 3RKDD 1MLCB 2VZVA 3ZKXB 4F8QA 4HPOH 1IKNC 1CBVL 3A0OA 1FGVL 2IQAA 2CKBA 4L3EA 2NR6D 2VXVH 4ZQKA 3BH9B 1YEHL 4P5TB 3WJLC 1S7SA 3OWEA 4PUBL 4PD4J 5KG9A 3BH8B 3HRZB 1WZKA 3V5DA 2JJTC 3WEXB 3NCMA 3TO4D 1QSEA 5EULV 2O93L 5D7LD 1ZLUH 3RKPA 1HCVA 2MOVA 3B2VH 4PJAB 5FUOL 2BMKA 1CDYA 3FQNB 2VUOA 3SDXB 1J05B 3IAPA 4JQIL 5GZND 2F15A 4MCYA 4DEPC 1FE8L 1KCLA 5FYKD 3UPRA 3LPWA 1UEYA 3SDAD 4NUJA 4OLWL 1U93A 1G9EA 4NGHH 1DQML 2Q86B 1DBBH 1PGRB 3QRGL 1FJ1A 4K9EH 3PIQB 2ED8A 5DHVH 1CDGA 7CGTA 3DRQB 5EG6C 1VPOH 3NH7L 3CX5J 3X3FL 3UTTB 3RWIA 3BYYA 1ZLWK 1UACL 3NFNA 5D7IA 3VD9A 2UZIH 1JFQH 4ELMB 3O6MH 3QULB 5GS2H 3UDWC 1P7QD 4PJFA 3CSPA 3MLTA 1UA6L 4NRYA 5IB3A 3N9GL 3IVKA 2VXSL 4Y2OA 1WQVT 4S1RH 1ZSDA 4FFWC 5HHNB 5D7KD 1T21A 2VQ1A 1WCBB 3EOAA 4NC2B 5F7FA 4XNUH 1A7RH 4RMQA 1C5BH 3T0EA 3ZKSD 2Q8BL 3I75A 3O4LD 2YK1L 1WTGT 1MRCL 3TV3L 1S9VB 1UZ6F 5FXCH 1KCVL 5F9DC 1X7QB 5FB8B 3ISWA 2F53A 1A02N 3STLA 3CCHA 5HHOE 2AI0L 2X4SB 4L4TE 4DKEL 5DUPL 2VISA 4R90H 1AE6L 1PZ5B 1IKFL 3QISA 5KAQF 1FIGL 4CN1A 1NGWA 4HUKB 2APXA 3CVIH 3TBWA 1PX4A 3BWUC 4PJFB 2Z91B 5EOQH 4ISVB 4GQPH 2ID5A 3GNMH 1JWSB 3FT2B 5DJZB 2MPAL 4NM8H 1M05B 1JHTA 4OJFL 4WUKH 4PLKD 5GS1A 1MJ7L 3TIDA 5JW4M 1F11B 3JV5A 1CT8B 4Z7VF 3N1QC 2AV1A 3BRGC 1QLEH 4Q0XL 5F3BA 3AS3A 2Q86A 3H3PH 5DVMA 5F9WB 5F3HA 2OJEA 4QRSA 4JKPH 1BWWA 3MLZL 3UTOA 4S1DD 4LAJH 4NWUL 4MB5A 3MJ9A 1MPAL 2UWEA 5J13C 3TH3T 3LY6A 4YHIB 2AV7B 5IG7B 3MXVH 2HG5A 2BJMH 1TLKA 4ODHL 4JZJA 4O51A 2Y36H 2DJUA 1GGTA 3QDJA 4LLQA 1CFQA 2H3NA 3GHEH 4ZXBB 2PYEB 4X7EC 2FJGA 1B6DA 4QRUA 4WHCA 5H2BB 5I16B 1UXSB 1HYRC 5SX4H 3MOBH 4NKIH 5F71A 2Z92A 1G7LA 5FGBC 5IHLB 3F7VA 3VWKA 4HAGA 1YEJL 3MO1A 1XCTB 1M6OB 4Y2DD 1Q0XL 5JXAL 3RI5F 1CG9A 3QB7C 5J11B 2HTKC 1A7PH 3SKJL 3WN5B 1WC7B 2W9DL 4X5XB 4OLUL 1KYOK 5ACZA 2CKBB 4L3EB 4PY7B 3VFSB 5A2IH 3L3JA 2VKWA 2YUXA 4MJ4A 3UYRL 4KJQD 1ZVSA 2CDGB 4G7YH 1HDMB 4PGDB 4YJZL 3FN0H 3LRGA 3C8KB 3SO5A 2EXYD 3HMWL 4UBDC 1IC4H 5IFHL 5IT2H 2A9NL 2NY2C 2WUCH 4KV5F 3ZE2E 1Q38A 1GC1H 4HDIB 4WHDA 5JOFB 3OAUL 3MRQA 1TQCC 3QNYA 3VXSD 5L9DL 2X89D 3VRLE 1S78C 4P5TC 4RX4A 1QRNB 4M1DH 4EI5B 2XA3A 4M7LL 1BD2D 4H25B 2CIKA 3KYKH 1KPRB 4PRPA 3PWVA 3FB5A 5LBSH 3T2OA 2H26A 1ONQB 1OCWL 3BPNB 3UZQA 3D85A 1EAPA 4HKZB 1EFXD 3OJMB 4P48A 3D9AL 4FQXD 1R5IA 3MJGX 2J8UA 1N59A 5DMJB 1N0XL 3QXDB 3VFPB 3B5HA 4FP8H 2VXUL 1RK0B 4MJ6A 4PV9B 1WIOA 5IB1B 5J1AA 3L5WB 4Y19B 4G7VL 4MZ3A 4N8PA 3SBWC 4Y5XB 4K71C 1N2RA 5FO9B 4JHBA 4JFFB 4MD0B 4U6VL 4YNYB 5C6TH 4ODTH 4ONFH 4FZ8H 4K8RL 2R56L 3K2UL 5CEZE 3HC4H 3BJ91 3W2DH 5I1DB 2R1YB 2ERJB 4Z18A 1HOCA 4MSWB 2FBJL 3RVVC 5F9OH 3S34H 4IDJH 5DMGC 5GGTL 5E2JA 3O45B 5E8EA 4RDQG 43C9B 4X83A 4OM0H 4DKAA 5EIIB 3PGCB 3RWEB 3RRQA 1EHNA 2VXTL 2P8MB 5I74B 3MRRA 4F57H 1MJUL 3OG4B 2K9UA 2D0GA 4LSRL 3QUXD 3QYCA 3C2SA 4N8VA 4XPGH 1RZIB 3NIFE 4H1LB 2V7HB 1Y18B 2AJSL 4JFOA 2NW3A 2AABH 1FORL 1JL8A 1I4FB 3RWFA 1OTSC 1OAKH 2ZCKH 4XCCH 1CF8H 4MGXA 2W0FA 4JVWA 4RGOL 3MRKB 1OOAA 3X12A 3S8WA 1MWAL 1T80A 1OPGL 2FSEA 4KKBD 1YJDH 4YDVA 5DD5H 1D9KA 5C0BE 3O2WH 3MLVH 1YNLL 1U3HC 3HE6A 2I07B 2B4CC 2FH8A 4NC0B 1DBJH 2CLZB 4GXVL 2KUTA 4P23D 1XIWA 4JM2C 3MYZA 4I77L 5IFJA 4LSQL 1UM5L 1CXEA 5DC4B 3PDOA 5T1LD 3WLWC 3EYOB 2DWEB 3ULVE 5IBUG 12E8L 3KAAA 4Y4KB 2NXZB 3EFDL 4I0KA 3QI9C 2ZJSL 2X1QA 3H9HB 3VWKD 2MFNA 3JWOH 1Q9OA 4CVUA 1K5NB 3L5JA 4L8SB 1EBPA 1SJHA 32C2A 4ENED 4JN1L 1CLYH 5IFAL 3GKZA 1XH3A 3LD8B 4X5WA 3MV9B 4Z7UA 3KYOB 3QNZA 2RR3A 5GQBA 1P7QB 2VZSA 4O2EA 2EEDA 2R0LH 4J8RA 4G43B 1B90A 1QLRB 4O02H 2PCPA 2XXCB 3LKSB 1CFQB 4S0SD 4PD4K 3TF7C 2D7QA 1N4XH 5DUBA 1JNLH 5EZLB 5K33A 4LSTH 2GKIA 1LEIB 2DDQL 1DE4B 2AJVH 1AHWC 4GS7B 1I3VA 4U33A 4HX1A 3CFDB 1I8IB 4LVOC 3ARUA 1FVEB 1NBZA 1G7HB 5C2UB 1AC6A 1PBYA 2P49B 4FP8L 4MVBD 5SWSA 5IM7B 5F3HB 4OZHE 4F7TA 4JO2L 1QPPA 4X4XA 5DFWH 1HHKA 4OZ4A 3AUVA 2H2PC 3S88L 4AG4L 2CDEB 1F11A 2R2EB 1NJ9B 3MRPB 1T7YA 4PJ7E 4LCYB 4JR9H 5ID1B 3SDDA 3P30H 5GGVL 3C2AH 3UTQB 2V5YA 3PP3H 5HYJA 1A9EA 5C07E 1JN6A 5C08E 1G7JB 2ZCLH 1M4KA 1A5FH 4HQQH 2E27H 4OUUA 1JPST 3QHFL 4DUWA 2FBJH 4ELME 3FO9B 1EXUA 1RFDH 2PYFB 4L3ED 4ODSH 1EUUA 4HAFA 3HN3A 4Q6IC 5IR1A 3OHXB 3PNWA 5JOEA 2JK5B 3KYMB 3VXRB 2V9RA 3SDDB 3K1KC 1KF9B 1UCBL 2D7PA 1J12A 4NZUH 1F4XL 2N56A 4Y5VC 2QLVB 1J8KA 2OL3L 1BVLB 3SKNB 1GGYA 2ZOLB 4JAMB 1U58A 3ARFB 3OKMB 1LO4H 4XPAH 3ES6B 4PREB 4CNIA 1ZSDB 2R8SL 4D0DA 4MNHB 1LDSA 4PJ8A 3QO1B 2DQJL 3SOBL 3EZJB 2E6JA 5IVXE 1MH5A 1MCSA 2BNQB 2B2XL 3WKNA 2C26A 3TBSA 4GKZB 1V7ML 1SHMA 2BJML 2E7MA 2VIRA 3T2PA 4Z7WE 1CQYA 5IW6B 4LVEA 1EHAA 4YHLH 1AGCB 1MHEB 2CRMA 4KTYA 4DAGH 3GMRA 4XI5D 4Y8AA 3TFKC 5D6DC 3HKFA 3SY0B 4APQA 4YX2L 4PJ8C 3ILQD 5CIPB 5F6HI 4LPWA 5D1ZA 3ROOA 2BXZA 1IL1A 4KKAC 1P4BL 1YECL 4XMPH 2NQCA 4Z0BH 3GSNA 2H32B 2DLTA 4IMLA 2R1WA 4JRXB 3VXSA 3U46B 4U6YB 1RZJC 4K23H 1SJVA 3MJ7A 1UQSA 5CD3B 2JJVA 3ULVD 3T3MF 1IJ9A 1DFBH 4GAGH 4LEOA 1UM6L 2A83A 3OQ3B 1SBSL 4OFDA 3ZYIA 4XP5L 2XKUA 5SX4I 3RTQA 3MV8A 3FO1B 2P5WD 4X9HA 1KTRL 4NQDE 4LGSB 3QQ9D 4FOMA 3MV7E 1BIHA 1AE6H 2VLME 4HJ0D 1E6OL 4HGMA 4QRQB 3HZKA 5BS0A 4A6YH 1JNLL 4HS3A 1A7RL 5JW4N 4CNIB 1NUGA 3HB3C 5T3ZD 1T2QL 1KG0B 4AEHH 3H42L 3QT2A 1Q9WB 2LQRA 3S96A 2LVCA 3GRWA 4NKDA 3IETA 4HIIB 2HKFH 1DUZA 4DFHA 3SKUD 1SYSB 2AJ3A 2ZNXA 4A2LA 1IAKB 1DLFL 2DF3A 2Y07L 2EYSA 3MRIA 5C0CD 5FYJH 4UTBL 4D0CB 4G5ZH 4I18A 1FV1A 3H9YA 4W6WB 3PQYA 2HVKB 5DLMH 5KVGH 1F45A 1JF6A 4XVJL 1S7VB 2NY1B 4Y4HB 1UZ8B 1S7RA 3TA3D 1JI2A 4WGVB 2BVOA 2Z31D 4KY1L 1J0KA 2F74A 4R8WL 4ZUUB 2E9BA 5JQHC 3BMVA 2EIZB 4C58B 2J6EH 1P4IH 2CDEA 3CVHB 1TVHA 4UAOC 3T3PF 4MDJB 3RWHA 4OZ4B 2ATPB 5L2JB 1NCCH 4OCLC 1SEQH 2CUHA 1KEGH 4J3XA 4RISH 1WUNT 3LKQB 1V7NH 4R90L 1C1EL 2XV6B 4K7PX 1N6UA 3GMPB 2Z4QA 3E8UL 4P0DA 3ZKQD 3BHBB 4OQTA 5CJQL 3JTSB 1KV3A 3FAXA 3DMMB 1R0AH 4QHKI 4JQVA 2AJYL 5IBUB 4G6ML 3KLSA 3UPCA 5SX5K 3QG7H 2DQHH 3V5HA 1ODAA 3PHQB 3HE7A 1HINL 3R0MA 2WQRA 5FGBA 3MPCA 1FNSL 2HT3D 5LGKA 2APTA 3HAEA 1YMMA 2OCFD 2VXQL 1BOGA 2LE9A 5CZVH 4P23B 4CJ1A 4FQLL 4HIXL 2FHFA 3U9PH 1RUAH 1MI5A 3PWNB 3KPPA 3RX5A 5MEPA 4MA7H 2YBRB 2WIIB 3TBTA 5JHLH 4Y16D 3V8CA 2XA8H 4IMLB 5ALCL 3EO1A 3MCLL 4W6XB 4XX1G 2CPCA 2OZ4H 4EOWH 1KPVB 1ZHKB 4FS0A 3CC5A 4RNRA 1Y6KR 2PYEE 2MQ3A 4R9HA 2VQUA 4MS8C 5K9JL 4I9WE 2FHBA 3L7FB 1CFSA 3EO0A 1K9TA 3BKCH 5I1KL 4AH2B 4E9LA 1MHEA 1FL6B 4UDTB 4NNYA 1DBMH 4OFIA 2FIKB 3P9LA 3U7AA 5FUZL 3MA9H 1S5HB 5D2NE 1R3KA 2D4FA 1WCQA 5DMKB 5TE4L 1NMBL 5DJXB 1SEQL 1B88A 1NANI 2GI7A 3S3JA 5BMFH 1NH6A 1IT9L 5KSBE 2QHRL 4AEIH 3HPJB 2DQFB 1TCMA 1TJGH 4HPYH 4PGEB 5ILTH 1HH9A 2NXYD 1INDL 1PLGH 5IVZA 1FC1A 3TPKA 3S5LG 4OZIB 3V5HB 3UBXI 3DJ9A 3L5XH 3NCBB 3DVFA 5DJ2B 3CUPB 3HMXA 5IEHA 3QQ3A 5CWSB 2IGFH 4QRPD 2ICEA 3EUUA 5F3BB 4FQLH 3U9PL 2JB5L 2FECI 4QYOA 5FOJA 2BFVH 4PJ5A 1QFUL 5KVEH 3GMNA 1YY9C 2I9LB 3BMWA 3UBXA 5C3LD 1ZANH 1QO3B 1RUMH 2I25N 1RJZA 4D9RD 4GW4A 1VFOA 3S4SB 2VLJD 2F54E 4PRIE 1ZHLA 5C0BB 5LQBH 1P4IL 5SWSD 5IROC 2Y72A 2NY5L 5I1JL 1N8ZB 2ICWB 5F70A 5DHXB 2FDBP 4J4PC 4HWZA 2LU3A 1P9MC 1F4HA 1JF1A 4BK4A 4NCC2 2IH1A 2CD0A 3UJIL 4JFED 4E41D 4MWFA 1QHPA 4C56B 3QWOA 4TTDD 3VXTA 3CFKA 3UPAA 4JO3H 4BKLB 4DZBB 1MCRA 4P99A 5HY9B 4XT1C 1TZHB 1QSEE 4JFZH 3I75B 3QPXL 5JNYA 2H26B 3CJJA 2CIKB 1HCFX 1ZA3B 4LEXH 4LLVB 3M8OL 3BSZL 3UZVB 5K9KA 1UKTA 5I1EL 1RURL 2DKUA 2XY2A 3QDMD 1U8JA 1T1YA 4I2XE 4M43H 1S7TA 2BY2A 5JZ7D 4UQ2A 5JOFA 3ESVF 4FMKA 5E6IB 5F72S 5IB3B 5E5MA 2ZSWA 4GRMA 1MPAH 3L3KA 5DYOB 1K4DA 3V0WL 3INUL 2Q7YA 1CXLA 1F58L 2ITDB 1IRAY 1V7MH 3FB6B 4O58H 4F9PA 4W4NA 3PF2A 4EI5D 4XHQA 1U42A 1MIMH 1H3XA 4OLZH 2UYLA 1ZLVH 2G60H 4F7EB 1P2CA 2NY0D 4J6RL 4LCCA 3GSNB 3PWLB 3QDHA 3WN5A 1T0NA 4Z77A 4LASH 3MNZB 3O3EA 1AIFB 5TDNB 5IKCB 3SDCB 5CIPA 3ROOB 4BUHA 2AJUL 2UZYB 1XIWB 4NUJB 4PGCA 5D7JB 4R0LC 3KS0J 5T33L 4YHML 1HHGA 4OD2B 4OZIA 2P45B 3K46A 6CGTA 2DLFL 2PXYC 1T22B 3VFMB 1B4JH 4RGMB 1UCBH 4WY7L 2O5YL 3DXAD 4Z9KB 3MGOB 4KMTH 5J06A 1J0YA 2EXWC 2X2YA 4JO3L 5IVXB 5DRNB 2EH8L 1NCBH 5BV7H 4PJCA 2Q3ZA 4NQSB 4WI6A 4G8GA 3ARYA 3HE6C 2XNAA 4YXLL 2DQUL 2KPNA 2WBWB 4H0HB 4CW1B 4M6ML 4OCWH 3U48A 1ZS8A 1GHFL 2ARJA 3BZFA 1DVFA 4EDXB 1IGYB 3TP4A 2VE6A 3GMOA 4H1LA 3PV6B 1KENH 5CD5D 1FZJA 2SEBB 2WLYA 2X9XA 3X13A 5GS1C 4KK9D 3SDDC 1NCDH 1BVLA 3L3HA 4LPYA 3TIDB 4PRNA 4EOWL 2BSSA 5DK2A 5CAYB 2IAND 3RDTB 3MV7A 3UTSE 3G6DL 4MSWA 4KZEL 4JANA 3VFOB 3EO1B 4FA8A 1BAFL 4F7EA 1K4CB 4MB3A 5FUOH 1EJOH 4R7DB 3B2VL 3PP4H 5EO0B 4CVXA 3BZDA 3HUJB 1VFAA 4OFYA 4LVHB 3HG1D 1OD7A 2ARJQ 2EE3A 4R4FL 2V2TB 5D1XC 1NSNH 2OJZH 5FUCE 1NFDA 1JUFA 1A3LL 5I6XC 4NPYB 4Q6IB 4GSDL 4C4KT 4U3HA 5BS0E 4LFHD 4M5YL 2X70B 4LQ1A 2A38A 3JWNC 2IADA 4QLRA 1UJTA 5ANMA 3G5XB 2JJSA 1A2YB 3ZSTA 1J1XL 4ODSL 5SWSB 1ZT7A 3RIFK 2E6QA 4XHJD 4QF1B 2FR4A 2DQEH 1BX2A 5EUOE 3WHXA 4ZPVA 4JCLA 2B4CH 2PR4H 3LIZL 3TPUB 3GMQB 3CFBB 5GHWL 3QIUD 4PB0L 4FQJL 3TWCH 1OAKL 2ZCKL 4YHKL 5D5MB 4KJWD 3CVHA 1JGVL 4PS4L 1FRGH 4QRRA 5D72H 5T3XL 5D1ZC 1CFVL 2IBZY 3OR6A 3SE9L 4X5WB 4Z7UB 4L29A 4PGDA 1IGIL 3D2UA 5DD3L 3CD4A 1EDQA 3NAAH 4MA3A 4X99B 5ALBH 2XG4A 2XZCH 3VFTB 3FOLB 3MC0A 2VKXA 2EDYA 4YBHA 4X7SH 2PF6A 3MCKB 1FZOA 1MAKA 5BXFB 3DUHA 3S34L 2HKFL 3DROB 4AZ8A 1ZHNA 4KROB 5EZOL 1KJ3H 3G9VA 5F7DA 4XBEL 2NLJA 2G2RB 1MAML 5IK3A 4NJ9H 5IB2B 4NJAH 3OKLA 3P0VH 1MCFA 1IC1A 3TVMC 5EN2B 1R3IH 2WUBH 2CLZA 1WVZA 2H3NB 5E95B 4HWBL 3KPRA 2HRPH 4JHWH 4LVOB 3BEWA 3B9EA 4LKXA 4OM0L 4RMSA 3HRPA 3UDWA 1N6QL 5T3ZE 2B4CL 4OGZA 1QD0A 3ULVL 3VFWB 3RHWK 1DFBL 4G9FB 4PYHA 1NGXA 2DD8H 2NYYC 1INEH 4LLWB 5D8JH 5GRUL 1YN6B 2DLGA 1T6WA 1L6XA 3NOIA 5SX5H 4GLRI 5GS1B 4Y2DB 3KGRA 1AY1H 1PKQE 3H42H 1HYSD 1OGAB 3QIWC 1P53A 4P3CH 4O2CA 2VYRE 3PGCA 3RWEA 2V5MA 2CMRL 5IUSA 3RZCA 1HWGB 2J8UF 1KULA 3SO3C 4PS4H 3WNOA 4G42B 5E8PB 3O6FA 4ETQB 4UT6L 2HFFB 2HJFB 1JPFB 1U36A 5CUSL 5E7BA 1F4WH 4C56E 3DSNA 4RZCA 2XWJA 3QEUA 3I50L 2GTWA 1MH5B 1NC4D 1NGQL 3RVUC 1QVOB 2IH3A 4YXHH 2P5WB 2DTMH 6FABH 1BZQK 4MNQD 4R7NB 4U1MB 5D7JD 2NY1C 4Y4HC 1E6OH 4DCQA 3GSUA 4HK0A 4XVTH 4DGVL 3QUZA 1MVFA 5HHNA 5MENB 3ARFA 2W92A 3MLXH 4JFDA 4LLVA 4EVNB 1IAIM 1PSKH 1N5YL 5GRJH 4PJ9C 3LN9A 4WI9A 3GKWL 4GBXA 4WU5B 1JNNH 1OAQL 2P8LB 4TNVK 4R3SB 4OZGF 4HLZG 2BVQA 5L2KB 2L4OA 2YXMA 2VLRB 1BM3H 3QCVH 4PBWD 2PW1B 4OSUH 4HG4J 4FZEH 5C09B 1G7PA 2VLKE 1CCZA 1YA5A 3B9KA 4JGUA 3K1DA 3T2QA 4V2CB 1K4CA 4H88H 3KPSB 5DEGB 1I3RA 1A6AB 1MCKA 2HMIC 2VR9A 5DUMH 5FYLH 2N1KA 1AGEB 1RMFL 1K85A 3FT4A 2RBLA 4LQFL 4N0RA 1UXWA 3OAYH 4HEME 2AGJL 4JB9L 4X6BB 4D8PA 3QJHA 1UZ8A 1QNZL 4RBPH 4G9DA 4OGXH 1NLBH 1FZKA 1U8PB 4PRDB 3DI2B 4UI2A 5DT1L 3EDEA 5HPMA 4YFLI 5CGYC 1REIA 3L1OL 1G0XA 4HV8B 3QAZC 3OTTA 3RWDA 4OTXL 3T2NL 1WWWX 5DJDA 5AG8A 3DO7A 2J88H 3CDGA 3G5ZA 4PG2A 2X1OA 12E8H 2KKQA 1N5YH 4WO4D 3MUGA 3AFLA 4FQQA 2I9TA 4N5UA 5ISZB 8FABA 1NCAL 1U3YA 4LLQB 1HNFA 3GGWB 2CXGA 3WNPA 1GAFL 1JYXA 5BW7A 2AV7A 5SWZA 4FNLL 3S4SG 1J0IA 1XH3B 4FFZH 4IOFC 2GY7B 3IS0X 4PTTB 1U92A 2CO6B 4FQPA 1NEZG 5JW5B 4PLNC 5TGBB 5IHBA 2XTJC 3L3DA 3STBA 2BFVL 4OD1H 3C6SA 3QUKA 2GY5A 3OB8A 4QRSB 1BFOB 2NX5D 4HXBH 1S7QB 2CDFB 1FL6A 4X98A 4G8EB 1F58H 3CNKA 3VGEA 1KNOA 3QZWG 2X9WA 3HR5A 4RQQB 4AM0B 3RVWD 5C0ND 1RI8A 4YUEH 1PAMA 1HK6A 3Q6FB 3NCYP 1BEYH 2YN3A 5DQDL 1MCCA 3LEYH 4JRWA 1I3RB 4BELD 2Y5TB 3DX7B 5F7MC 5FYJU 5ICZB 3IKKA 3M07A 1FC2D 1WZLA 3Q5OA 4HJGB 1R24A 3QFDB 1A6TA 3V7AE 1NUNB 3QJFB 3WIHA 5D7LA 4DZ8B 4APQD 4Q9RL 1RJLB 3QO0B 3I84A 4U1GC 4XNZC 5TDOA 4EI6B 3VWJB 1T0MA 5IJVB 4JFQA 1LO2L 4CAGA 1I9IL 2PW2B 2UY6A 3P0GB 3SPVA 1TJHH 1CE6A 5EZOH 5DO2D 5FM5M 4WNQA 1P6FA 2VWEC 3TYGH 4TSCH 4D0BB 1N8ZA 1JWMB 3L9RB 4DGYL 1YNTB 3ABZA 3BYTA 4KGLA 4LGPB 5ENWB 4ZS6D 3AM8C 4N9GB 3SJVD 43C9A 1BLNA 3HC3L 3T4AB 5E6IC 3RUGA 2UWEE 2BSTA 1C8PA 2NMSA 3LKQA 3LMJH 4KUCF 4LCCC 5DC9B 4XCCL 3RWIB 2EC9U 3G04A 3PGFH 4BH8B 3GHBL 3UCRA 3RIFF 3VMNA 3G6JE 4ZOEA 1HKLH 1TVHB 1JGVH 1YQVH 4JM2B 1I7TB 4L1DA 5E9DE 4NIKB 3U9UA 5T1MA 4JFYA 3SE9H 4BUGA 2O61A 3BKJL 3JV4B 1SVCP 1NDMA 2J7LA 1O7VA 4OLWH 3GM0A 5AZEL 3MR9B 4ZFZA 3A6OA 1HH9B 4K3GA 4D0CA 2VDRH 4ZO8A 3LSOB 4XVSH 2B1AH 2VERN 4S1QL 4K7PY 4M61B 3ET9F 1IAKA 4R2GC 1QBLL 3TZVA 4G9FA 4LMQE 1DUZB 2HA1A 3BPOC 4L4TA 2PTTA 4ZOBA 3DUUA 4NKDB 4XCFH 4M1DL 5HHOA 1Y6MR 4HUXA 3QEQA 4RISL 1DBML 1DP0A 3HI6H 1MLBB 1AD0A 3IDIB 3MACL 3WD5H 5F6IC 2L7JA 2PXYB 4M48H 1PQZA 1A7OH 3BGMA 3EYSL 4YHNA 5C8JB 1TJHL 4U1LB 2DS4A 1RIHL 5IW1A 3UJJL 2ERJC 2R4SH 4LSSH 1BJ1J 3REWB 1AQDB 4QO1A 2NY3C 4GBXD 1WF5A 5IW1B 3E0GA 1PQZB 4PB9H 1JNJA 1T2JA 3DX9B 4MXWL 2F53E 4K3EL 4OI7A 4OCSH 1I1AA 4QXTA 2ZCHL 3KXFE 2MCPL 1ETZA 1CR9H 2H32A 1T89C 2NPLX 4M7ZB 4JDVB 3QXUA 43CAA 3FKUS 3QXVA 1WJ3A 1F13A 1MI5B 4MX7A 5MEPB 1D5ZB 3F8UB 4X4MA 3VH8G 1TIUA 2C7UA 4TNVF 5DZNA 1BEYL 4JM2F 1JV5A 4OD3H 1N7ML 3BDYL 4IIQC 3S36L 3C5ZA 4JPVL 1UWXK 1NAKL 4U6XB 5DI8A 5L88L 3EDJA 5IW6A 3GSNL 2JF1A 1K3IA 3BQUA 4HS8H 4JZJB 1TTUA 1CGWA 3WNKA 4YDVB 3E1F1 4GKZA 4K3JH 3MR9A 4G6JL 1UENA 4GG6B 3X12B 5B3JE 2DI8A 5J13B 1JZ4A 1HEZB 4GAGL 1PDKA 4ZSOE 4DKEH 3UBXG 2ZKHH 4MJIA 5ECJE 4ZUVA 1TZGL 4NO0A 1XF4A 5C09D 3BXNB 3QUYA 4HIHB 3A6BL 1G7QA 3NCFB 4ETYA 4WEBH 1QKZH 1FFOA 3QEHA 4DVRH 2FLRT 3SKNA 3G5YA 2XXMB 3R1GL 4D9QE 5HDBE 3RX8A 3UEZA 4IS6A 3P40A 3DX8B 2FNBA 4ZUUA 3LS5H 1DQDL 4OZGA 3SBWA 1I7RB 1Z6JT 3O4OB 3CFCL 2V2TA 1Q94B 4PLJD 4XRCB 1S7RB 4PJBF 1VEOA 2OR7A 2DM2A 4KK8C 4P57A 2Y07H 4D0BA 2V7NB 4FMFA 3KPRD 3CFJB 1K2DB 4XMLH 1A9EB 3I3EA 2EE6A 5GSRA 2B5IB 1Z3GH 5GISL 5J89A 5ITBH 3WNMA 1U8MB 3GK8L 1WFNA 1T0MB 3SKMB 3LKPA 3K8LA 2QQNH 1NJ9A 2R2EA 5CZXC 3RWGB 1JGLL 2BHZA 2C3VA 3MJ8B 5C0RL 2OQJA 3Q5YA 5IB4A 2C1PA 1FZJB 4AENA 3U7YH 3R8QA 3V4VL 3L3OA 2NTFA 4WEUD 3HFML 1CIUA 2QHRH 4B7IA 4BSWB 3LQMA 3OKDB 1C5DA 1R5VB 1EX0A 3TH2T 4OCYH 1ZE3C 2YC1A 4OF7A 3MRLB 1UACH 5D2NC 4HBCL 4NNPL 4LAQL 4XPHL 4LRNH 4UT9H 1EAPB 3BISA 1Y6NR 2H2SD 4RQQA 4AM0A 4H8WL 2OBGA 3MACH 1RZKH 4UV4H 4NO3B 1I9JH 3VA6A 1DN0A 2R1WB 1ZEAL 4KKCD 2F8VA 5FYKL 2XICA 4OD2A 5ESVA 1LEGA 4ZUSA 4NQXA 4O4YL 4DKDC 2QADB 3DURA 3WYRA 1G1YA 3SDCA 3EYQC 5LGHH 5JIIA 3VMPA 5D7LE 5TFSH 3T0XA 1JI1A 3TBYA 5HDQL 2X05A 5IB5B 4OI8A 1A1OB 4PB9L 3SO3B 5GS0C 3PWPD 1URLA 3O6ML 4NM4L 2FGWH 1CTNA 2K1MA 3L5XL 2NY6C 5DFVD 2DKSA 3MO1B 3QUZC 4YBQD 1UM4L 5D6CB 3OSKA 1S7SB 2Q8AH 1T1YB 3ZL4L 3GSVB 1OSZB 5FHAL 3CH1B 2VAJA 4ZXBA 1ZA3A 4POZD 2LABA 1Q1JL 3QDGA 4TPRH 3RVTC 1JPTL 5HI4C 3WFEH 1G6RB 3ZE1F 4QHMB 5JPMB 1DZBA 1A1OA 4NQCB 3FONA 3SGEI 3HTLX 4G8IB 1V8HA 1Q0YL 4LHUD 3O81A 3PWJB 3JBG7 3MLUL 5C0DA 5C0AB 4N8VB 1EFXB 1MI5D 4ERSL 3JTTA 2B1HH 5FEBA 1BPVA 3MLUH 3WFBH 2HN7A 1N64L 2O5ZL 3BUTA 3ULUH 1A6ZB 1OAZH 4FXGB 3TZVD 2XQBL 2YMXH 1YDPA 4QRTB 5DQ9A 1CICD 5LG1A 4GXVH 3UAJC 1TCRB 2XY1A 4TUKL 3V79C 5KSAC 2M26A 5JHDA 5L2KE 3GMLA 4Q58C 3TM6A 4HKXA 4PJEE 3LRSA 3EYUH 5HYQB 2RIKA 5C2BH 3RY4A 4PJDE 4EVNA 1I8LC 1IC7H 4DCQB 1I3UA 3WL9B 5C0GB 5DJ2A 2X1WL 1IZKA 1I8IA 4XZUB 4U1SB 4PLOB 1CLOL 3WL9A 3QIUB 1S9VA 1DE4A 1NUDA 4GW5B 4Y5VA 2XWJB 1OM3L 3F7PC 2QHLA 3NFSH 4MQXC 4W68A 1FYTA 5LXGH 5A43C 3BKML 2X4QB 4OIAA 4OIIH 3LHPL 4FRWA 3T4YB 5FM5O 3MRGA 2EIEA 2XZQL 4RMTA 3KDMB 1IQDA 1XMWA 3EBAA 5MEQB 4FQ1L 4LLMB 4P57B 4YFLF 2FBOJ 2ICCA 4H20L 5DMKA 4M7JL 4PG9A 3UO1L 1C1EH 1OF2A 4TUOB 3QIBC 4HUMB 1PX3A 1S7WB 4RAVA 3U30B 2CSPA 3VFNA 4ELMA 3CK0L 1FVDB 1QSFE 3O6LH 3DUSA 5ICXB 4X6CA 1T04A 1KJMA 5HI5C 2VSDA 1QR1B 2P44B 2FHCA 3K8KA 4TVPD 1X5ZA 5EIVA 5EORH 4MLIA 3VGAC 4F37K 1IEAB 2RCSL 3AREB 1A1MB 1FVCA 1JGEB 1F3DJ 2CK0H 5DJYA 3FFCB 4PJBB 1D9KB 4NSKB 1BIIB 4TVPE 2VDOH 3U83A 3F12A 1U3JA 4NO5A 1RZ7L 1FO0H 5HD8D 4ZTOL 2DN7A 3O3AA 1OSPH 4X6DA 1J1PH 4HMDA 1GIGL 1G9NC 1BOGB 1F8TL 4M4RA 2D31B 3UTSD 2DQJH 1II4E 5FKAB 1QHOA 1R5WB 3IXAB 5FOBB 1KEML 1LDPL 1I3GL 2OXGA 3SGEH 5IMMA 4JDVA 1OP3H 3JUZA 2VXTH 1ETZB 3DXAE 2A74A 1GGBH 2QKIA 2WV3A 4RMVA 2BNUA 2PO6A 2ZPKL 4XP5H 3VD7A 1GSMA 5I8OH 4PJBA 3H9SB 3I02A 4P9HC 1U41A 1WBXB 5AWNH 3BWAA 4OCWL 3OR6B 1FHGA 4C4KO 5LJYH 3KPRE 3I2CH 2OTWA 2BY0A 3VXME 3WFBL 1P69B 3KR3L 3T0EC 4DAGL 2Q7NA 3BP5B 5TF0A 3FQTA 4ZDHA 1ZK9A 3HLAB 3C5JB 5E2VH 3BZEB 5FCUH 5E08H 1FH5L 1J0ZA 4NZJA 3U6RB 1I7UB 4H88L 1M7DB 1KIPA 5CBEA 4MAUH 5BOZG 4ZTOH 4K94H 1AGBB 4LASL 2KDGA 5IJKA 3W9EA 1YMHB 3L3IA 1NFIA 3QXDA 1I75A 4JVPA 3BDYH 1WZMA 3X14A 2IADB 5ANMB 3WUWA 3BFOA 4ZXBD 2F53B 5I66A 4PJHE 1KIPB 2DLEA 2AJ3B 2ADFH 4RDQF 4MYWB 1EIBA 5EZJA 4Z7NE 1RJYB 3LB6D 3MLYL 3O3BB 2FWOB 2LAGB 4PJIB 5E9DB 2XYCA 2FZ3A 3K3QA 4I0CC 5C0AE 1Q9WA 4ZDHB 2EH7L 5C6WH 1EBAA 2VQ1B 5IEKA 1QRKA 2FGWL 3CFJA 1NC2D 4J3TA 1BJ8A 2V7NA 4R7DA 4ZS7H 3ULUD 1CICC 4MXVF 4UOJA 2DTML 5IQ9A 6FABL 4QOKE 4FABL 5ISZD 4WJ5A 4HDIA 2A1WH 2R4SL 5DA0B 2W9EL 3QHZL 3MFFA 4HGWB 5GGQH 1S3KH 1OTTC 1KFAH 3LEXA 3BE1H 3T1FB 3QIBB 4LU5H 4S1SL 4EDWH 4YO0A 5MENE 5ANME 2P8PA 4OLUH 3O2DL 1V05A 3GB7A 1ZV5A 3HI5L 1ULVA 3GZKA 4DGIL 3HI6L 1G7QB 1ZEAH 2NCMA 4NQEE 1YN7B 3PHSA 5DEFB 1XF4B 2LU4A 3PV6A 2F19H 4H5SA 1CICA 3V4PL 4JQXC 3VG9B 5EBMA 2WSKA 4JO2H 3WS6A 5HI4D 1C5CH 3UC0L 4U1IB 3IFOA 2Q8BH 2OM5A 4JFQB 3KYAA 2XRAH 3HC0A 3C6LA 3S88H 1BZ9A 3FJTA 4OCXH 4L3AA 3DBXA 5BO1H 3MUZ1 1RZGA 1FO0L 3RIAK 1NCUA 1WBYA 1WK0A 1FPTH 5D7LB 3QUZD 4NQDB 1YJDL 3BGFC 4JLRB 1E28A 2UWEB 2K7QA 4ZO9A 2CMRH 1BZ9B 2ICWI 2FEDD 4MAYB 1MFBH 4ZNCD 5HHVL 3HZYB 3QDAA 2P5EE 4Y1AA 1YQVL 3L7EB 2JJSC 1U3HB 3C8DA 5KW9L 2CR6A 1EO8H 3QCTL 4GKSB 1R3IL 2BNQE 4BYHA 4E0RB 4P49A 1CLZH 2BXYA 1B6UA 4X6CB 1AJ7H 4CN6A 3UTZA 2ZJSH 3MV9D 3ILPA 4Y4KC 5DR5H 4O2FB 3RUGF 2C4FU 1OF2B 3OHXA 1VADB 1W0VB 4D9LL 5KN5A 1AXTH 3H9SE 4IRJC 1LE5B 3QDME 4RBPK 1U8KB 3ARDA 2AXHA 2NNAB 4LNRA 4P9MH 2WMPA 2VDMH 3D87B 1KOAA 3HI1A 4OZIE 1OY3B 1VPOL 3NH7H 1L9MA 2DRUA 2BRRL 1YUHA 5GGVY 1CFBA 1MLBA 4OLVH 3RWJA 2R1XB 4HUXB 4QHKJ 1OAUL 4MQ7B 3MV8D 5EZJB 4UNUA 4FXKA 5IROA 1F6AB 3O2WL 5HI3C 5C0FA 4MD4A 2ORBL 1A4KA 1MFAL 5GSVB 5KZCD 4GAJL 4BZ2L 3CVHH 1R5VA 5C2BL 4Z7NF 3B43A 1KN4L 3NAAL 4X7DC 1NBYA 2EDDA 2P47B 1A1NB 4Z76A 4KROC 5DHVA 1J5OL 1ZT1B 3U6RA 2AEQL 1QFWI 2YRLA 5GRZA 4V2BA 3DVIA 3ARWA 2GSGA 1KIUA 2GT9B 2V9TA 3DVNB 2Z8RA 1C08A 2R23B 4OZIF 2DICA 2YA0A 5EZLA 1YEHH 3ARED 4KQ3L 3VFVA 3DIFA 4XCNA 3GMNB 1FCCA 3MUHL 4YHZL 5BV7C 4PLJC 4WFHD 5EUOF 2YKLL 1C7SA 3EYFA 3KPSA 5DEGA 1F6FB 4OLVL 1QUNA 5JIKA 3LQZB 1BQHA 4U2ZA 5F7EH 1I8MB 1CDHA 1EPFA 2A9MH 1J1XH 2X4UB 2VDML 4K9EC 2HVJA 5T3XE 3LZFH 1V3LA 4IDJL 2AJYH 4HWBA 4B5EA 3MROB 1NCAH 3FQNA 3QIWA 2AEPL 3R8BB 4KUCD 3P77B 5CEXB 1OAXL 2NX5E 2ZUQC 1QA9B 3QCUH 3GIZL 4EN3B 2IPTH 3N85L 3T08A 1M71B 5FKAA 2MQCA 4GKNA 5IIEA 5GGRA 2DQIH 4HF5L 3STZA 3CDYA 5I1CH 2W59A 2KL6A 5K93A 5GGTA 1D5XA 3S3SA 2FB4L 4G9FD 4PJXF 5FO7A 1OT2A 2A6JA 2V2XB 5EO1A 5F1NB 4OZHF 2H32H 3F12B 4WHYG 1AD9B 2IQAB 5T1LA 2OTUB 1MFBL 5L7XL 3I6LE 4O5LL 3INUH 1NC2A 5B22A 1JPFA 2XI9A 3L6FB 4CVWA 3DBXB 3ZL4H 4AY0A 5FFLA 1MFDH 3GSWA 2F53D 4GAJH 4BZ2H 1MFEH 3CIQA 4UMGA 1B4JL 2EEBA 2DLFH 1Z3GL 5GISH 1RIUH 3MJ9L 2NY3D 4GBXC 4MA1C 1RULL 4KK6D 4K7PL 2YWYA 5KSAB 3O4OC 1WZ1L 4WWKB 1EEZA 5DEFA 1J7VR 3O9WA 3RL1B 3D0VB 5IW3A 3WFCL 5DHYA 5IFHH 5EIIA 1VCAA 3GSOA 1D6VH 2XZZA 4M7KH