3VG9B

Crystal structure of human adenosine a2a receptor with an allosteric inverse-agonist antibody at 2.7 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
212
structure length
212
Chain Sequence
DIVMTQSPASLSASVGDTVTITCRASEFIYSSLTWYQQKQGGSPQLLVYAATNLADAVPSRFSGSGSGTQFSLKINRLQPEDFGTYYCQHFYGSTWAFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine receptor A2a
publication title G-protein-coupled receptor inactivation by an allosteric inverse-agonist antibody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 53
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2011-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vg9B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vg9B01
1T7WA 2PUQT 1IGFH 4XP6L 3G6DH 4I2XA 2BNRB 4Y1AE 1GZQA 1D6VL 2BOCA 2MKWA 3DI3B 3QFJE 4OFYA 5BRZA 4WCYH 5J6HB 2PXYA 5GQBA 5TGBB 3ULVH 3C60D 5T5NG 3WIHL 4KK9C 3SDCD 1G7PA 4DGYH 5LBSH 1Q38A 3TN0A 3H3KA 5FYLH 1CXIA 5HVFB 5KBNC 4NZRL 4OJFH 5IB5B 3VWJD 1KB9K 2EYTB 2VLRA 3DGGA 4OKVA 3PNWA 5C70A 3QUZA 1EXUB 1OARH 2HFFB 3DX7B 2QKIB 3KYMB 2IPKB 1RUMH 1BD2D 4MDIB 3EYUH 4FNLH 1QLFB 4PJCB 2ERJB 3CUPA 1OQXA 1S9WB 1F8TL 2MJWA 3TO4B 2IALB 2PNDA 3BDYH 2D03L 5IB3B 1YEDA 3I75A 1BVKA 3CZFB 3MRQA 3MUJA 3I3BA 3MYZA 2DYPA 4AEIL 4ZUVB 4Y5XA 4KHTH 4LPTA 3C60C 1SQ2N 4X4MA 1AGFB 1RJZB 4L29A 4UIKL 5DRZA 4LCWA 3QXUA 3JTSB 3MLZH 4A6YA 3G5ZA 5FKAA 1D9KB 5L2JB 2COQA 1FJ1A 1T1YA 2ZSWB 3VWJC 3TWCH 1NANI 2DQEL 5L8LB 4ZFOL 4H8WL 2LVEA 1MWAB 2Y36L 1P4IH 1CLOL 1JGLL 3C08H 3H0TB 1FNFA 4P48A 1XGRB 5L7XL 1KEMH 4Z7UF 2VSCA 1E4WH 4LCCC 4N90D 4E0RB 4OZIF 1JUFB 4JO4L 1X5JA 4W6XB 2B8OT 4YHKL 3B83A 4NQED 5H37H 3B9AA 2VYRE 4BH7A 4QRPE 3NIGE 3C9NB 1VFMA 4YUEH 4EUPG 1MPAH 3GSVA 4WJ5A 5EIIA 3EYFB 3WFHA 2IAMB 5JO5B 1E6JH 1WAAA 1KIQB 3W2DL 2C26A 3MOBL 4Y19D 1CWVA 5DHVB 5I66A 3O6FA 1C16A 2CKBB 3SCMA 5CAYB 1Z3GH 4PY7A 3P73A 4TNVK 4UNTA 3PL6D 2P24B 3QQ9D 1QPPA 1OD9A 4Y5YB 1R3HB 4Y2DA 3MRNA 3MFFB 3TH4T 2FSEB 3B9DA 3VFUA 1OHQA 4OCLC 4KJWC 4GRWB 2P47B 4ZFOA 3EO0B 4JO1H 4Z5RB 2CLVB 4NZDA 4RMWA 1QRKA 2IG2L 1C1EL 1BVLA 3PWPD 1CD9B 3CFBA 3L95A 4OD2A 1INEL 1VKXB 4PY8I 3G04A 1JP5A 4U6XB 4M8VA 4GW4A 5EU6A 3SO5A 1MNUL 1T21B 3NACH 3PL6C 3JVGA 3PG2A 3WLBA 3QQ9C 1TDQA 2ICWA 1FORH 4Q9RL 4DUVA 3UTSA 3SQOH 4RGNE 4YXHL 3DO3A 6FABH 4JO3H 1BZ7A 4JB9L 2IPUK 4EJ1C 3GJFB 1FYTE 5ICXA 4DQOL 2BP3A 4PRNA 4A6YH 1SM3L 2YD6A 1BM3L 1U3ZA 4KU1A 4LLUB 4DTGH 3DHMA 3QPXH 5I1IL 2R23A 3HNSH 3FQTB 3OF6D 1KIPA 3HLAB 3NAAL 4ZAKD 4OLVH 4RIRB 3PGFH 4XP6H 3UJIL 3UCRA 2IWGA 3GMMB 5CEZE 2X4QB 4KTEL 4DZBA 1NAKL 4C83B 3MC0A 5H94A 4BQCA 4FZEH 1WT5A 1ZMYA 5ERWB 4J4PD 5EUKA 4NQVB 3Q0HA 1FFNB 4XGZB 2D7PA 4C56B 4DN3L 1PLGH 4YHYC 3U9UA 3GMPA 4S2SB 2G9HB 5JOPD 4F7EB 4MJID 4TNVF 2ZSVB 3OPZH 5DMYA 4YBQD 2CUIA 3HZVA 3MV8B 4K8RD 3T0BA 2O5YL 3CFDB 1ZGLP 1MCSA 3S9DB 1J87A 3QG6A 3FTGA 3OX8B 3X3GH 1UZ8A 1ZLSL 3U7WL 3RGVC 1MCOH 4CVXB 4GG8B 5KS9B 1CG9A 4MXQD 1PYWA 3O2VH 3V0AC 15C8L 3CSBA 4X7CC 4JY4B 3Q5YA 4PBVC 2X2YA 3T1WA 1QVOA 4YBQC 5IK3A 3QIBB 3HFMH 3GMQB 4K8RC 3U4AA 4TSAH 4OZIE 3K0WA 4J6RH 3U36A 1HHHA 4H0IA 4GKZB 3X17A 2QHRH 2WLZA 5KOVC 1EEUA 1FZKA 3ARYA 4IHOB 1QQDA 1ZLWH 1PGRB 2B39A 5I1CH 4PJAA 3MJ7B 3V4VL 3B9KA 3GSNL 3RQ3A 4NQCA 5EU4B 1DN0B 5JHDB 1B90A 3MTRA 3PDOA 4MD0B 5EO9A 4NN5C 3WCYA 4S0TD 2DQDH 5FYJE 1CGVA 1CQKA 4OCMC 5IR1A 1WC7B 5JW3L 5DJZB 1GXEA 1Q9WB 3BKML 3CSYB 3V6OC 4HGWA 3VXUE 4HKZA 4HLZG 5AZ2H 2ATKA 2J8UB 3MV7E 5EBMB 4FFWC 2R0KL 3STBA 2D9QB 1G6RL 2W92A 2G60L 5F88B 1M4KA 3LRSA 3BZEB 3IRPX 1AHWC 4FQCL 2AJVL 2D31A 1DBAL 3S3SA 3EDKA 3O8XA 5DJ6B 3FO2B 5J06A 1CR9L 4O58H 5IQ7L 4HWBL 4GAGL 4CMHC 1GGYA 4JFEE 1LO0L 5JOFB 1INEH 1MH5B 5GGTA 1HYRC 4UQ3B 4WW1A 5TF0A 3HKFA 5T33H 3IU3A 5DGQA 2A83B 1HHKA 3MLRL 4JZOA 1RSFA 4QHNA 2WP3T 1CK0H 4RWHA 4NQDD 4I0KA 3PGCB 1UB5B 3D0VB 3KNBB 2OMNA 3CLFH 3CXHK 1VGEH 4R96B 3IKCA 4PJIE 2GJZA 1ETZA 3OQ3B 3OGOE 4Y16A 1F3JA 1A6PA 5DK2B 4RAVA 4HK3N 1Z0MA 3WUWG 3TBWA 3RBSA 1MFCL 1LO2L 4KI5F 2Z93A 1KOAA 3S96A 5GGSB 3EKCA 1NAKH 1I3GL 4X6DB 1IQDB 1A6ZB 4ELMB 1T1ZA 2XPGB 3ARBD 4FP8L 3H9SB 4HWBA 1NKOA 4J8RA 3U0PA 2VXSL 4DN3H 4PJFA 4HUUB 4WEUD 4ACPA 3Q1SL 32C2A 3IYLW 2EH8L 5EU7C 1GIGL 3U1SL 4OCWL 1FE8H 3KR3L 5J1SC 1YY9D 1U3JA 2BJMH 4GMSL 4JKKA 4LU5L 5FK9A 3WKNA 2WINB 3U4EB 3VG9B 1WFUA 3SDXF 5DK0A 5IVXE 1F42A 3ARBC 5HD8C 1VEMA 2MCG1 3QDJE 1UM6H 5HYSG 4L8SA 3IJHB 3WLWD 1U41A 4X4XB 1P4BL 3KWWA 4Y4HB 2NNAA 15C8H 2YD1A 4PJHF 3ZL4H 3IAPA 1F11B 1N5YH 1YY9C 2FRGP 1JZ3A 4DVRH 4LLYB 4GOSA 1MHCA 5L88L 5MP6H 5GGTH 4JDZA 2IPTH 4U1SA 5DMIH 4JZJC 4AQ1B 2XN9B 4Z77B 4QOKA 5IW6B 4D0DB 1JWSB 3UTZB 4G8GE 2YD5A 2VXTL 5DRWA 4LGSB 1B6DA 1T5WB 1DUYA 3OGCB 1ADQL 4IJ3B 2V2WA 4MXVE 4XPHH 3WLWC 5HHQB 4HJGA 2HFTA 2DQIL 2W0FB 4NRXA 1K3IA 5BV7C 4OGYH 4ZS6D 5FUCE 3QO1A 4MSWB 3ARXA 5EBGA 1FCCA 4QHKI 3L7FA 5CILL 4YK4C 1KBGH 2Z8VC 4GG6F 2X89D 5TE6H 3H9ZA 4BSVB 3FO0H 5E6IB 4AT6B 1F02I 2GFBB 3ARDA 3QNYA 5M95B 4R0LC 1KPRA 3TT3H 4YHNA 3ARFD 5C0CB 2G60H 1U92A 2JB6A 4KQ4L 2OYPA 1VPOL 1CU4H 1I8KB 5CZVH 4AY0A 4YO0B 3VH8G 3FB6B 3TZVC 4FQCH 2AJVH 3VD7A 3MJ8A 5D5MB 1M7DA 2YC1A 1ZGLM 4JZNA 1I85A 4NHUA 4HG4J 1CR9H 1RZKL 1EFXB 3T65A 5IQ7H 4HWBH 1BJ1J 4GAGH 2HMID 4KRNA 5TQ0L 4C4KT 3IS1X 4HLZH 2DQFA 3CXDL 4C58B 2AJXL 3KJ6L 5EZIH 3QXDB 4X8JA 1HH6A 3HZKB 5IB1A 3NFPA 1V3KA 2D7QA 1IKFH 1DEEB 2B1HL 2C1PA 1QFWI 3B9EA 5KVFL 1U8KA 1X5YA 2I9LB 3ARFC 3REVB 2AEQL 5HHVL 4UU9A 1WCQA 4YXKH 4JRWA 3RUGE 5EH1A 4PIRF 4YWGH 4HDIA 4WTXA 1YNLH 4Z78B 1JNJA 4NOBA 2XZQL 2DOCA 2IQAB 3GSXA 1RD6A 1Z9OA 1C5BL 1D5MA 5E8OA 4FQXB 5E7FA 5EZOL 2ADIB 3FONB 4WI3A 1KFAH 4DEPB 5JORA 4NN7C 1JZ2A 1UCBL 2X4RA 1LO2H 1Q0YH 1XEDA 3ARPA 5C0EA 4F57L 1I1FA 4MYWB 4F37K 3WNNA 1QBAA 4UINL 4Z9KB 1MIMH 1QSVA 4TPRL 1KJMA 5EZJA 3QG7L 1IKNC 2GSIB 2H26A 4PG2A 3D87B 2GW5A 4GQ9L 1RZFL 2XXMB 3N0PB 4XPFH 3MRIA 5FA3A 4JJ5B 4PR5B 3U1SH 4WHTB 4OCWH 5CP7A 4EN3A 3DURA 1IQWL 2WQ8A 3NOIA 1JHTB 4PJXE 4ZS7H 3VH8A 2FL5B 2ORBL 2RGSA 2Z4QB 1BIIB 3IDMB 4OI7A 1C7TA 4ZDHA 5DSCA 5GS0L 4HAFA 1AD0A 3FQUB 5IMOA 4JDTL 4P5TD 5C09E 1EMTH 5CEZL 5T1LB 4I0PC 1V7NL 2BVOA 1E0OB 4ZQKB 3K46A 2OSLB 3OKOB 3OXRB 4UNUA 5F1NB 4HBCL 3GMRB 4LKXA 3MUY1 3G5XA 2KPNA 1E4XL 1P4BH 2R2EB 4JN1H 4P4KB 1A6VH 3HI5L 5FM5M 5CJQH 5ADPH 4K71B 3NN8A 4N8VB 4HXBH 4PRIB 3RZCB 4HWUA 1UZ6F 1IM3A 2H8PB 4MD4A 1OAZH 3CNKA 4TUKH 5D1QB 3GI8L 5L88H 5MEQA 4X5XA 1AI1L 4G43B 5B8CC 4JFXA 1ZA6A 2F5AL 4P57A 4YBLC 1YC7A 4ZO6A 1SBBA 1BVZA 5IB2B 4OM0L 1N7MH 5C08B 4YDKL 4NKMB 2BVUA 2Y5EA 4TUJB 4BQ8A 2UWEA 3RL2A 2QADD 1ADQH 1AXSA 3NZ8B 4UT9L 4TOYH 3FT2A 4N0CD 4O2EB 3WIFA 4QRSA 5I8KL 1VGKB 5EOTA 4JN2A 1Z9SA 5MHSE 2MQ0A 3BP5A 3X14A 2JCCE 4L8CA 1W0YT 4GG6E 1RULL 5I8CB 1LO3L 4F37F 2UUDH 5CKGA 1WF5A 4POYA 2YSSB 2NX5E 2FX8L 1JPST 1JZ7A 3RTQD 4YDIL 3WHE1 2RQ8A 2CSPA 3K8LA 1XGTB 4Z0BL 1JYVA 3CH1B 4HWZB 3LH2L 3VXRB 1CE1H 1VPOH 1H3WM 2F19H 3MLYL 1CFVH 1UB6B 4U2ZA 4CVZB 1DQMH 2WUCL 3EYOA 4N0CC 4P2OB 5EIVA 4HUVB 2F54E 2ZUTA 5ISZB 2XTLA 5HGDA 2X4UB 4PJAF 2OQJA 3KJ6H 4JFYA 4EVNB 4PJ8B 3OR7A 3IXTB 3KPRA 3SO3C 3D39D 1W72L 1KJ3L 2B1HH 3UC0H 3RTQC 1JGVL 4XCEB 3MR9B 3FZUD 4YFLI 3TBSA 3LIZL 1E28A 1MUJB 5HHVH 2R9HD 2R2HB 2Y25A 2Z31B 4OCYL 1ZHBA 1LD9B 4F7TB 2XY1A 2Z8WC 2DWDB 3H8NA 3IJSA 5T1DL 5DJ0A 1LK2A 2W1NA 4HH9A 1S5HB 4NUJB 2Q3ZA 3X11A 3HE7D 2VDNL 2X9YA 3MOAL 3O3EB 1GPOH 1EZVY 5GGUB 5EZOH 4MS8D 4M1GH 1UCBH 1YUHA 1V05A 3QIUB 4CVUA 1HSAA 4PP2A 1RMFH 2AP2A 2LABA 4X9FA 4F57H 3FZUC 2EDWA 2DDQL 2APBA 1AE6L 4WFEE 1J8HE 1FSKC 4PRHB 4EDXB 1CGTA 3PV7A 4I77H 4U3CA 3G9VA 3TNNB 3HE6A 5KG9B 3SKNB 2WLYA 4LMQE 1C8PA 1HXMA 3QG7H 5HI3D 4XC1H 2GJ6B 4OT1H 4LCYA 1UA6L 1ACYL 2YN5A 4GQ9H 4JAMA 4A2LA 4CU8A 4MS8C 3F7VB 4X6BA 2IH3A 2NPLX 3MFGB 4PJ7A 5AG8A 5DD5L 4MJ6B 1U2HA 5AG9A 4HKJB 1OWRM 1IQWH 1ZVSB 1DBBH 5I8OH 4G5ZH 2HH0H 3G6JB 2EEDA 1FGNL 1NGYB 1RK1A 4DAGH 1D6EB 4JRYB 4Q6IA 4OCSL 3FB8A 3I50H 4NZTL 2Q8AL 2WUBL 3QJHA 1M71B 1N8ZA 2VL5B 3BQUD 3LQMA 4ETQA 3OWEA 3MLSL 2C4FU 2J5LC 4FMFA 3TH3T 1BREA 2OCFD 2JIXA 5HI3C 4KDWA 1TVBB 4NIKB 4JFDD 3HI5H 2F5BH 3DETC 5K93A 3NGBC 2CRIA 2VZTA 1UZ6E 5C07D 1CGUA 5GS2D 1LGVA 3IDJB 2XA8H 3MROA 2AK4A 3OJMB 1G6RB 3WBDA 2YPLD 2YS4A 4XNUH 4F7MB 4PJFF 2H41A 4PRAB 3TNMA 5TDPB 2FD6L 1FRGL 2F5AH 4HEPG 5HTSA 3V5KA 1T2QL 5D7LD 4OM0H 2GY7B 3IVKA 1RPQA 4YDKH 5D6CB 3QUXB 2HT4C 5AD0A 3HRZA 2X70B 1QP1A 4NM8H 1LDPH 2J6EL 1AH1A 5L9DH 1EUUA 3WMSA 1V3JA 3MGOB 1E4JA 4F8TA 2PTVA 3WSQH 3ZKMD 4F9LC 4PJIA 5I8KH 1GGIH 1JV5A 1SJEA 3WKML 4JQIH 4YE4L 2YK1H 5T1MA 3AXLB 2XT1B 1Y18A 3WL9B 1PY4A 2H3NB 3U7YH 4M5YH 2PYFB 4PJBB 5JW4M 5IFHH 4PJDA 3VD4A 5AUMB 4MAYA 2IH1B 4YDIH 4XWOD 3WD5L 2XQYK 2ZJSH 5TH2B 3LH2H 3D0LA 4ZSOB 4FG6D 4EI5A 3MLYH 5CCKL 1BAFH 5I30L 2DICA 3KLAB 2WUCH 2QTEA 5DO2C 5HHPA 3LQAL 2KKQA 3ZKMC 1CLYL 1ZVHA 2QSTA 4GJTB 1Q94A 1T7YA 1LE5B 4NHCL 2QQLL 4LHJB 5INCB 5CMAB 3D85A 1CFNB 3D18A 5HI4D 3KYKL 4XRCB 1LEKA 2E7HA 2VJXA 1XIWA 1S7XA 1TZGL 4PGDA 4NO5A 5DJCB 4JFZL 5FYJH 3WN5A 5DD0H 5C0DA 3SE4A 1JGVH 4XWOC 1D9KD 4FXGA 2BNQE 4RRPG 4LASL 3FFDA 4OCXL 3D9AH 1A47A 4RGOL 1BQLH 2J6EA 4FG6C 1U58B 5HHMB 4OCYH 2V2TB 2LFGA 2ERJC 1KF9B 5T1DH 3QDJA 3TO4C 1EHNA 3O4LE 4XVTH 1HIMH 1NC4B 1T03L 4D2NA 2AXGB 3RWCA 1QBBA 1S9KC 1UACL 4KXZH 2E7LA 2R1YB 5H35B 2VUOA 1L0QA 2AI0H 3VFOB 5IKCA 1JK8B 3HAEB 4MD5B 5AYQA 3S4SG 3MUGA 2HT3D 1D9KC 4GLRI 1J0IA 2DWEB 2DDQH 5IFJB 3KJ4B 3RWFB 1F6LL 1EEZA 3MLVL 2J88L 4BSJA 3H6JA 5EU3A 1TJGH 5DA0B 2NY3B 1XH3B 5FF6A 1R3LB 4ZYKB 4G8GA 2YWYA 3DVIA 2R0WH 2HJFA 2BZDA 1J7VR 4U1HA 1FL6A 4KKLD 1WWCA 4NQSB 2ZKHH 1A6UH 4JFFE 3U0TA 3DARA 4X7FC 3ARUA 3ZYIA 2XWTB 4KAQL 3OKLA 3VA2C 5E8PB 1QSEA 2HT3C 4RMRA 1SYVA 1U8PB 4HC1L 4IM8A 4FABL 1FGNH 4OF3A 5LGJB 1S9YB 4HZLA 4DCQA 1Z9LA 5DJAA 3E3QE 4OAWA 4RISL 4ODSH 1UEYA 3P11H 1MHHA 4UV4H 3MLSH 4C55A 3E8UH 1RZJC 1GGCL 2XXCB 5DQDL 2OXHA 4KKLC 1HI6A 4CUCA 5HHNB 4M1DL 1KCKA 2CR3A 5T1KB 4XHJD 4RRPA 5FAAA 3BE1H 4Y5YC 5AZEH 4IOFD 1BOGA 1WBZB 4WFFD 2CGRL 5DQ9A 1RJCA 4ISVB 4KK8D 2MPAL 3MXVL 3VRJA 3G08A 3NFSH 2FD6H 1HHJA 3STZB 3MNZA 4LHUG 5HJ3A 3DMMD 3BUYB 2VQ1A 5F70A 1SMOA 1T2QH 3RWDA 1I3VA 2ZUUA 5C9JB 4HUWA 1AGCB 2W91A 3TA3B 1CGXA 1MCHA 5EOCJ 1A3RL 5C0AA 4NC2B 2XKNA 1NCBL 2J6EH 5C0BE 1A9BA 4LVHB 1OW0A 2XICA 2KZWA 3ECBA 4XHJC 3WKMH 1U0QA 3VXTA 4IOFC 1YYMH 1MY7A 1UWGL 2AK1H 4JRXB 1RIVH 5D7JA 4KK8C 1KPVA 3GMNA 1AGBB 1HEZA 3HG1D 4QTHA 1TLKA 4ODTH 5EZLB 2IADA 2YRLA 1WUNT 1ROWA 3EYSL 2IANE 2DTML 5EG6C 4C56D 4UTBL 3CX5J 1VCAA 3WFEH 2CDEB 2PCPB 4RZCB 3L3KA 2B4CH 2LVCA 3DVNA 3V4PH 2EDTA 2Z35B 1F4XH 3O11A 4X99B 3WFCH 2P5EA 4ODUB 4Z7WE 2G2RA 4GRLB 3NA4A 1CLYH 1NUFA 3MV8D 1NAML 3RU8L 5GSRA 1BBJB 1ZLUH 3VD9A 2LTQB 3BH9A 3KXFD 2GT9A 4POUB 5L0QB 3FL7A 3V6BR 5C0FA 4TVSa 2UWEF 4UDTA 6CGTA 4XPTH 1TZGH 3RBGA 1YMHA 4CN4A 4MJ4A 4PJXA 1H9VA 4PJ5B 1MRCL 4LASH 3L3JA 4OCXH 5MEND 4RGNB 2WK2A 1S5IH 5KSUB 1AQKL 1S78D 4LOUD 2JLLA 4LLWA 1S7UB 4ORGA 1F58L 1X7QB 3GJEA 1FYTB 3HZYA 3ILPA 3TEUA 3TIEA 4YFEA 2O93L 1PZUB 1T66D 3WS6A 2CDFA 3GMOA 3QIBD 4MA8H 3O41A 2W0KA 1HILB 5IF0A 4P0DA 4XC3L 1KB5B 4LHUA 1UACH 4MQTB 1B0GB 1DQLH 3DO7B 4F7PB 5ALCH 1JPSL 1FFOA 3T0AA 5FM8A 5HYQA 3D2UB 1QSFD 1XR9B 5JUEL 4XP9L 4P2QB 4IMKC 2YWZA 2OTUA 1QO3B 4WDIA 3S3PA 4PV9B 5ANMB 2LQRA 4GAYB 5BZDB 3S88H 5JHDD 4WHDA 3MLVH 2J88H 5DRNA 1XF5B 5HGHA 4YJZL 2P42B 2HG5A 3A0OA 5EWIL 4LF3B 1JMXA 1BF8A 1I1AD 2VKXA 1NAMA 5J13B 4NC0B 2VXQL 5F9WB 1T66C 3QIBC 1ZAGA 2JK5A 4GW1B 4EQ2A 5AYUL 2BSRB 2RR3A 5DC0A 3CPLA 3ZMRA 3V7MA 3C6LD 5F7DB 1FO0B 2YA0A 2W07A 4DGVH 1D5XB 2IMMA 1KB9J 4X6CE 1KGCD 2DM2A 3C8KB 3SE3A 5B39A 3QUYA 1XAUA 3MRKA 5T3ZH 2OI9C 3S37X 4NKIL 5HY9A 2GTZA 1QZ1A 5EBLB 5FO7A 2NX5A 3P9LB 1EJ6A 3EYQD 3CFEA 3UJJL 3VXQA 3SOBH 4RISH 5M94B 4ZFGH 1LP9A 1CFTA 2X1OA 3RIAF 2FIKB 3S97C 4U1KB 4ELKB 2QQKL 4U05A 4OQTL 5DT1L 3HS0A 4U7MA 4JHAL 4Y8AA 1I1AC 4M00A 4HH8A 3QQ4B 1GGCH 3CCHB 1Y0LA 1CFSA 3GKZA 3KLDA 4NO3B 3T4AB 1RZGB 1IBGL 4WUKH 3C6LC 3IS0X 4JVUA 1UGNA 3GRWL 3DRQA 4G3YH 4K3HA 4Z7UB 2BFVH 4OZIB 2W0PA 2BSSB 3WO3B 3F12A 4OLXH 4X4ZA 1CD1B 3JWNC 43CAB 5FB8B 3VXSD 4GAJL 3RHWK 4PJ7F 2ZCKH 4HPYH 1D7FA 3IF1B 5IJVB 3O6LL 1RQ5A 3OKNB 3TCLA 3QHTC 2A6JB 4FQHA 5KJRL 2BY3A 2FBOJ 1NMBH 2XTJD 3GM8A 1JNLH 4WHCA 4ALAH 5KSBF 1W72B 1F3DJ 1D5IL 3T08A 3MV7B 3ZE0F 4AL8H 1PZ5B 4HFWA 4KPHH 5DVLA 2CXKA 3H9SD 3WXWH 1J8HA 4OQTA 2XKSA 1VERA 4ZPTA 5DUPL 5E08L 4KUZL 3PQYA 2HLAA 3PE9A 5HYJA 1CLZH 1MJUH 5FKPA 3TVMD 3O3UN 3OAUH 2EIZB 4WI4A 2R2BA 1NAMH 3RU8H 2HFEA 2P5WE 2YBRB 1A1NA 1U8NB 3W9DA 3T4YA 3QAZB 4M6NH 4O00A 4X98A 1DE4B 3C5JB 2PW1B 1MFBL 3SKUD 3BIKB 3QO0B 1T2JA 1W0WB 3AFLA 2BC4A 4OZFG 2C3GA 2DL2A 5FCUH 3EOAA 2PTTB 4NM4H 2OXGA 4XNYH 5HYJD 2AKRB 2X9WA 1S3KL 4PJDF 1PKOA 3IDUA 1FGVL 1OAQL 1VFOA 2CLRB 3I85A 5C0GA 3BH8B 4CU6A 2PXYD 3DYPA 3GSQB 1UWEL 3VG9C 4MNQB 4XP1H 4LDLB 1AJ7L 1GOHA 1TQCC 2XN9D 1CS6A 1U2CA 2C4XA 3FOMA 3O9WB 4AENA 1OCWL 4KJYA 5BS0D 3VRIB 4FTVA 5JUEH 5KW9L 2HN7B 2DI7A 3L5WA 3RHWF 1O7VA 3VCLB 2VLRD 1P2CB 4ERSH 4MX7A 2Q1EA 4PTUA 5I73C 3BKCL 2A1WH 1YN7B 2HT2D 4OD3L 1JF1A 4QRRB 2VLMD 5E6ID 4LVOB 3SGDH 4CADA 5JA9A 2ADFL 1JJUA 2AAVA 1DUZA 4L3EE 1NCDL 4MCZB 4OM1H 4O2CA 3VXOA 5KTEH 1CCZA 4XNQA 3TC9A 5C0CD 1AKJB 2NY6D 1A7RH 1KTDB 4J1UB 3QNZA 1LEIB 4HLJA 5HYIA 1R3JA 4L5FH 1TMCB 2DJUA 1VACB 5K9KA 2DLGA 4IJ3C 1YPZA 2D0FA 5EU5B 3KPLB 3VFNB 3BP7B 4GKSA 4YPGB 4CN1A 1C5CL 2YRPA 4OKDA 1MVFA 3E6HA 4MHHI 2WBJA 3LKOA 1EPFA 3MCLH 4OQTH 4JHAH 1NDGB 4AH2A 3NCFB 2HT2C 1IBGH 5E6IC 3S6CA 4YHIA 1EGJA 3VA6A 1ZEAH 2GJJA 4NQXA 1BZ9A 2NY6C 4OZFA 1FNAA 3GIZH 1I8IA 1OAUH 2FJFB 3TBVB 5GGRB 1RZ7L 3GIVB 4H26A 4DUWA 4EXKA 5D96B 3GGWB 1MJ8L 1GOFA 1KT2B 1AO7D 5FHBL 3MXWL 2HKFL 5JHLL 3SBWC 3L3OA 4X7SH 2VQUA 1NJ9B 2KDGA 4UOW0 2R1XB 4PRDB 4PJ9D 3MJGX 3QNXB 4QY8B 3IDIB 3P0YL 4PRBA 2VLJD 3DX8A 1G7IB 4NNYA 5DUBB 4XNXH 2GITA 4Z7VE 4OLWL 4D0BA 1DJSA 4AQOA 3TO2A 1ERNA 1PKQB 4UUJA 5D71H 4JCLA 3W39B 3O6MH 5D7IE 2Q86B 3VXPB 4YGVB 3TF7C 1A7PH 3W0WE 4N1EA 2VDKH 5DUPH 5IFAL 2XWJB 2Q8BL 3LN4B 4I3RH 1SEBB 2Q76A 2DM3A 5EUOF 1FQ9C 4XBGB 3SGKA 5B21A 1AIFB 43C9A 3QB7C 3EBAA 5D2LE 4CNIA 3QDGE 4HPOH 2W9EL 1D5BA 4PJ9C 2L4OA 1FAIL 1TCRA 2H6PB 4NT6B 4Q9CA 1MAJA 4WIQA 1Q9LA 2ENYA 3G5YB 4M6MH 4GXUN 3M1BA 4LQ1A 5T1LD 1RFDH 2NXYD 4MNGA 2XY2A 4NO0A 2GY5A 1KTRL 3VDBA 3UPCA 4P4KD 2Y06L 1I7TB 2WANA 1P1ZA 1T20A 2O5XL 2OP4L 2ZUVA 3EW3B 3TYFB 4NFCA 3RZCD 1GGBL 1J1PL 1O7SA 3THML 2FJHB 5D1QD 3I6LD 3VFWA 1EEQA 4WENB 3UBXB 5KAQF 2LU4A 2ESVB 2A73B 2VITB 4TUOA 3TBYA 1K4CA 3MLTB 2DS4A 3CXHJ 1EA9C 2VWEE 3DI2B 1AJ7H 1EGJH 5EBWA 5E00B 3SY0B 4UDUB 4FZ8L 1KYOK 2AW2A 5F96L 4OZFH 1ZWIB 3S37L 1YMMA 3WFDL 5DD3L 2OL3B 4P4KC 3UTQB 2DLEA 1ITCA 4K71C 3T3MF 1ZT4A 4ONHA 3QUMB 3AMLA 3BKCH 3NFNB 3RZCC 2CIKB 3ZDZF 2A6DA 4F3FA 5I16A 5ID1A 5D1QC 2C3HA 1JNHA 4U6HB 4LLVB 3IAGC 3WHXB 1NMAL 4OSUL 3C60A 1XCTA 4XPBH 3BRGC 5DRXB 4R7NB 1OGAB 3T8XB 8CGTA 1DEDA 2E27L 1MAMH 4RWYL 3VXRD 5E1HB 1KPUB 3VWJA 1ORSA 2Y4SA 5E2WH 3KPPB 1I1YB 4XXCC 4TNWK 3RWJB 4P2OD 4DGIL 1BD2A 4RFNB 5J8OA 2XNAB 1IAOA 3I6GB 3VMNA 4R8WH 1EO7A 3MRFB 3SDXB 3SJVB 5B3JF 2AABL 4NJAL 4LCCA 2OM5A 2DQUH 3DXAE 4NOFA 4PJ8D 3VFSB 4Z7WA 2W60B 3PV6B 1RIUH 5BRZB 3VXME 2NY0B 5EFIB 5A43C 5C7XH 4PJHB 1YYLL 3MRLA 3TT1H 3SKJL 1IMHC 1KLUA 3QULB 1KXQE 1IFHL 5IT2H 3CFJB 4N1HB 1Z5LA 4P2OC 1DCLA 1S9XA 3W82A 3VW3L 1NCCH 1MJ8H 1MY5A 5I17A 3ULUF 3EO1A 1LDSA 4JG0H 5FHBH 1KC5L 3I75B 3RDTB 1UXWA 3AMKA 4PJ8C 4NWUL 4MQ7A 4BQBA 4P5KA 5SWSB 5DUML 3VI4F 3P4NB 1IEAA 4NQEA 3P0YH 5F1KC 4L29B 2VE6A 3P77A 4LCWB 1ONQB 1BJ8A 4GG6B 1FC1A 2BRRL 3LKQA 4KC3B 3U2SB 3G5ZB 3FRUB 2HTLD 1T1YB 1UVQA 3P0GB 4M43L 3BISA 1HE7A 1OGTA 1NBVH 1N3NA 2VLKE 2GJ6D 4LKCB 3FCTB 4ODWA 1T0NB 4LSUH 5L2KE 2CJUL 3PL6A 3DSNA 2P46B 3CFKA 3RX5A 4ZXBD 5ITFB 3QIUC 3O3BA 5EORL 5F89A 5EO1A 2CUHA 1LNUA 5I1EL 4K3JH 4JRYD 4ZFFA 1F45A 1YDPA 5JW4R 4CKVX 3O3AB 4F2MB 8FABA 4R26H 4HBQA 2HTLC 4S1QH 4UQ2B 4X6CA 3CDYA 4MWFB 4TNWF 1A3LL 4GRMA 3GSVB 4G9FE 1XR8B 3V2AR 4DKDC 3KYOA 5DJ2A 5SV3A 1HHIB 3TGXA 1JTOA 3O3DB 4W4OC 2PN5A 5E7BA 4PY7B 3AM8A 1IC7L 1PQZA 5IWLC 1SHMA 3RVUD 3O81A 4Y2DB 5GRWA 3MRNB 1VFUA 5FO9B 3P30L 3V6ZA 3S8WA 3V4UL 1H3XA 1FG2A 1F4WH 4OB5L 5J0BA 1CDUA 1XGYH 5JXED 3HUJE 3RGHA 5F96H 4PJGF 3LS4L 1UM5L 2EEAA 3WFDH 2DBJA 5DD3H 2R4SL 35C8L 5DJDA 1YY8B 3L95B 1NBYA 4DK3A 3OF6A 4ZAKA 5FGCE 2BCKB 3G04B 4GW4B 3R0MA 5E9DE 3GB7A 3PP3H 2W65A 1ORQA 2AJSL 3RVUC 3GBLA 2ICWB 3BSZH 3V52L 1NMAH 4OSUH 1S9VA 4J4PA 2D7NA 4CAGA 4LSSL 4NRZA 1BZ7B 1X5GA 3RGVA 1MJJA 3OZ9L 5JXEC 3QUXC 1ZTXL 4URTB 4YIQA 4PRNB 3ES6B 4N8PA 4L8BA 1RIHL 1HQ4A 1I9RL 4QT5A 3LHPH 1CBVL 2CKNA 3MCG1 4DGIH 1HHGB 2AEPL 5FOBA 1KIPB 5DI8A 2KUTA 2LE9A 3KPNA 2C5DC 3D39E 3F7YA 3UX9B 5HPMB 4G80A 1UCTA 5DWUL 5C8JB 5K9OB 5FYKE 1FL3A 1A1OB 5D70L 4LPVA 1RUKL 2DL9A 2GSGA 4DZBB 2Z92A 5H94B 4OUUB 5DD6A 1U6AH 3K2MC 4WFHE 1JWMA 5IW1B 5EUKB 1DQQB 3SKJH 3BIBX 2AV1A 2Z91A 1E6OL 2R2CA 2ZZUT 1IFHH 4FQIH 1G7JA 4DZ8A 3QWRD 4LVNB 1ZT1B 2ZUYA 1PSKL 2EC8A 3GMPB 3ZT7A 3RPIA 1URLA 1KLFA 3SE8L 1ZOXA 4WGWB 1OSZB 1U8JA 3WNOA 1NC4D 4YHLL 2WZPD 1T7VA 3V6OA 1F97A 4IMLA 1YEEL 1F4AA 2BHYA 4ODBD 5IGXL 1DLHA 4JFPA 5DUMH 1YPZF 2NQCA 4Y1AD 3FTGB 3QFJD 3BKJL 4RAUB 2YUWA 2A74B 1A5FH 4QRTA 5CUSH 1UZ8B 4JO2H 1ED3A 1GAFH 2BRRH 3PHQB 1AHWA 3BAEL 2N7AA 1NCAL 4Q0XL 4M43H 2NY3D 1TENA 1T7ZA 4HF5H 4LP5A 5KZCB 5D9SA 3ZTNL 3VFTB 4WI9A 3P4OB 3VWKD 3T3PF 3MRMB 3A67H 3NIDF 1OVZA 1TITA 1V3LA 4K07A 2J1KA 3PP4L 2VDOL 3PDDA 1BX2A 5EULV 2YN3A 3U36B 2JELL 3EOBB 5EORH 4KK5D 3FN0L 4L3AA 3N85L 3MRCB 4XNZC 5E4EC 3RWIA 3Q3GA 4K3EL 4M7JH 4PJAB 2BXZA 4Y5VA 3DRTA 3KJ4C 3B9KB 2I60H 2M1KA 4WI7A 4NQCB 3ZKNC 2NY3C 3D3VE 1UXSA 4M62H 1CL7H 2BNQB 1K3ZA 3X13A 3VWKC 1J0JA 1YQVH 1QR1A 1AFVH 2R0ZL 5EO9B 1WFOA 4TVPL 2QL1A 5IR1B 1MREL 4PGCA 5F3BB 2A0LD 1BQHA 3F58H 3HMXL 5KVDH 4JPVH 4YZFF 1HOCB 4Z95L 2EDRA 2D7TL 3RKDC 1FIGL 4K8RH 3UYRL 2FECI 1EH9A 4NQDA 1HWGB 4DKFL 3PUCA 4FQLL 3KPSE 2R1WB 2QR0A 3NCEB 5I0ZA 2D31B 4HIJA 2Y07H 5E5UB 2DB8A 2E8ZA 2DLIA 2P8PB 4QRPD 5I1KH 2BERA 2BNRE 4UB0L 4NWTH 4JGUA 2R4SH 4X9HA 2N56A 3TBTB 3HHRB 4PREA 2EKJA 4WW1B 2A0LC 2XG4A 3F7PC 5JLZA 2M8XA 5MEOA 4GH7B 2AJSH 4JRXD 3M8OL 2YPVL 4P3CL 3V0WL 2ICWI 4JZOB 3BP6A 4JFFB 1QKZH 4QHNB 2ITCB 2WWKT 3GSRA 5F7WC 2E6PA 4HIEA 1I75A 3VJ6A 3QCUH 4ZOBA 4PJCE 5H8DA 1TPXB 3ARBA 1RVFL 3TA3C 3A6BL 4HGMA 2E9IA 3IKCB 1N0XL 5DZOA 1EEYB 5JR1H 3EGSB 2X4SA 3BFOA 1F3JB 4RMSA 1L7TL 4GRLD 4LVHC 4M5ZH 4S1DD 3TBWB 1MCWM 4JM2F 1Q9KB 3MOQA 4K94L 3KS0J 5DWUH 3S96B 1DR9A 3P9MA 4S1SL 4I18B 5D70H 5J1TC 1ZSDB 3BPNB 4KFZC 3NCBB 3O6KL 2FX7L 4RGND 3U0PB 3L1OH 1AGEA 4PJFB 3QHZL 5KOMC 4KMQA 4NN6B 1PSKH 1FYTD 1SBSL 5GJSL 4GRLC 32C2B 4S1DC 3H7BA 1B2WH 4QO1A 3IDYC 4GXVL 3M17A 4YNYB 2LTQC 5E2TH 1I7RA 5FO8A 4I48A 1TCMA 5C0BB 5L0QC 1XGQA 1X3DA 1YEEH 3MRRB 5GS0D 3OKMA 4R0LA 1G7QB 2BSTA 1NGXA 3D25B 5CEZD 4UT6H 4JANA 1QFUL 2VXUL 2OZ4A 1FNGA 5I76A 4H20H 4RGNC 3TZVA 4DVBA 1J1OH 3QPQD 5F21B 4L8SB 1U8MA 1JTPA 2CPCA 3V6FA 2DLFH 1RJLB 1VA9A 1OF2A 2IANB 1WEJL 1JCKA 2J4WL 3RI5K 3UYOD 5DMKB 2FGWL 3NIDE 4FHBD 2X89A 2VKWA 3PP4H 2P48B 2V9RA 1XGUA 1GL4B 4GRWE 4JDZB 5GS0C 3HR5A 4Y88A 5ICZA 3ARFA 2VDQL 3RVXD 5ESQA 3UTTB 4K3EH 1OAKH 1AC0A 4KHXL 1RZ8A 4JLRA 1BLNB 3R06A 3GUTA 3QPQC 3PWNA 1XF2B 4TQEL 1DUYB 4ZPVA 4QRQA 1NLDL 3QHFH 4HJGB 5TDOA 3INUL 4MJ2A 3JTTB 1MJ7H 3MRJA 3HNVH 5J13C 5SWZB 5F9WC 2R0ZH 2X1PA 3GFUA 4WFFE 1NGWA 4YR6A 4D8PB 1DLFL 3NTCH 1DQDH 4I0CC 2NYYD 5GHWH 3DGCR 3QNYB 4YZFE 1KPRB 3IJYA 3L6FB 3RVXC 4FXKB 4FRWA 2HVKB 2JB6B 3MLXL 3B8SA 4XNMA 3RL1A 4FQLH 4BUHA 4O51A 4OV6F 1WFTA 3DVGB 3KDMA 5CEXA 1JFQL 4XCCL 1FN4B 4XCFL 1A6TA 1V8HA 3AREB 1IKNA 3T65B 1F90H 3TIDA 1CICD 4U6VL 1HQRB 1OQOA 3FQNB 5DLML 4IOIB 5BV7H 4X8JB 1HH6B 1HINH 5IB1B 4UI2A 1X5XA 3NFPB 4JFOB 2EE2A 1IGJA 4D9QE 4QRUA 5HHXH 1KCLA 4YXLH 3ARSA 2C1PB 1MLCA 1U8KB 3VXUD 4X0KA 4QNPE 2ZNWA 3CDGA 3QA3A 3MV7D 3ZYOA 1K85A 2C7UA 4PLJD 2OZ4H 4XHQA 4IDLA 4LARH 3MV8E 3SKOA 3RI5F 2DKSA 1CICC 5LAXB 2OR9L 2H45A 1MIEL 2BVPA 2VLKA 5KSAB 1A7QH 2FH6A 3DUUA 1FVCA 2X4RB 4JFED 3NABL 3R4DA 3CMGA 3DROB 5L2KA 5CGTA 4M8QB 5IG7B 5C0JB 2AGJL 5JPNA 1RUPL 1VESA 3SGEH 5KS9E 4J2XA 1ZA3A 2CMRL 4XVSL 3VI3F 4LAJH 5D72H 5FV2A 3O6KH 1KIRA 4PLJC 5DHYB 2FX7H 4FQQA 2R8SL 2HFGL 4NKOA 4ZODA 4Z7QE 5AAMA 4UOJA 3LN5A 1YEHL 1RJYB 4U3XA 4JM4L 1P7KA 2EKSB 4APQB 5FA3B 4LP4A 3LQZA 1Q1JL 5HVHB 2A9NL 5GISH 3RPKA 4GXVH 5CP7B 5E2UL 4W4NA 3DURB 3UPAA 2XWBB 3BGMB 3CSPA 4YGAB 4X5WB 3QAZC 4LSPL 4MNQD 5K33A 2EDFA 3LKSB 1F6AA 5DSCB 4LLMA 4W81A 3HC3L 1KJ2A 2N1KA 3FQXA 5DK3A 5JHDE 1MFDL 5FYKL 1JRHL 1QFUH 2VXUH 3AS2A 3CC5B 3SGJC 3ABZA 4F9PC 2UZYB 2QQNL 5L8KB 4NDMA 1U8QA 4LKXB 1B6UA 3G5XB 2FATH 3RAJL 4KKCD 1CQYA 3KVQA 4RNRA 1X4YA 3B3IB 3DUSA 3NCMA 3I3DA 3D85D 1U42A 1ZS8A 5E94A 4PLNC 5FGSA 5J11B 3I02A 3F62A 4P49A 4PJEF 4Y4KD 5MEQB 3L9RA 1N2RA 4X5XB 4L9LB 3ULUL 3O9WC 3FT3B 3RTQA 4Z76A 2VDQH 3HC0B 4NZUL 4CMMA 4PGJA 1X4ZA 4RAHA 4NCDA 3H2WA 5CD5D 3RZWA 4H25A 4LPWA 2UWEB 1BHGA 1AXSB 4UTAL 1DN2A 4KKCC 4V1DE 1C08A 3QDJD 4PP1C 1WIPA 2R4RH 1MHPH 2IEPA 1CXLA 3VE0B 5BO1H 4YFLF 4ZFZA 1T89C 3S5LG 2Q6WA 3SDDB 1JN6A 1MRDL 3D39A 1DLFH 2H2SD 4U1IA 3MGTA 3TYGL 5F8QC 1MFEH 3RY5A 4WW2A 5IBUB 5MI0C 2VABB 3AROA 1B4RA 1WCBA 1IC1A 4ZUSB 5CD5C 1FDLH 1B3JA 1R5WB 4H1LB 5IEHB 2GKIA 4XPAH 4HUNB 5I1HH 2ZOKA 2I27N 1FVEA 4QCIA 5FV1L 3V5DB 1JFQH 2MCPL 2VDLL 1IILE 3QUKB 1T3FA 1SYSA 4U6TA 4X6DE 3U79A 4XH2A 4YFDB 1KELL 5D4QA 4ELME 7FABL 3KPRB 5F9OH 5GSVA 5CD3A 4OTXL 5LGHL 1IL1B 2EXYD 3MRDA 1N6UA 2IFFL 4OZ4B 1NBZA 3S3JA 1GGTA 4XCYA 2G75A 3QDAA 2ADGA 4HQQL 4PFEA 2ADJB 4QYOA 1E28B 5IESH 1KJ2H 3IFNL 4G6KL 1ZHBB 3OB0K 4OZHA 5IJKC 3BI9X 5CBEA 3IJSB 5DJ0B 1F4YH 4MJ5A 3BZ4B 1SEQL 1W0VA 4QHUB 4MNHA 4AIZA 3DIFB 1FFPB 1PDKA 3NABH 1EK3A 5DYOB 1HSAB 2AGJH 4PP2B 5HHOE 5CLTA 2JTDA 5B4MD 3WDIA 4X9GA 3IT8D 3U82B 4ONGL 1YECL 5CIPB 3NA9H 1D3CA 1UJ3A 4HKBA 3S5LA 1HXMB 3V79C 4JFDA 4LCYB 4F9LA 3NH7L 3B43A 4JAMB 4X80L 4OLZH 3LVEA 4B53A 1HH9A 4PJ7B 1FPTH 4BH8A 5EOQL 1WZ1H 3PJSA 1GZPB 2I9TB 2NW2B 4NFBA 2AV7A 3OKEA 2YPLA 3GNML 3QXAB 1CGWA 4JR9L 1H5BB 4NZJA 1T04A 1KJVA 3FB8B 3RA7L 1MFDH 1WGOA 2VL4A 5KSBB 1JRHH 3QJHB 1N8ZB 2K3TA 4ETQB 1OP9A 4G6MH 3QWOA 2JIXB 1J1XL 4Z7OF 2E8YA 3ZE2F 3I6KB 3ZSTA 4RFEA 5HDOA 5J6HA 5C0CE 2PO6B 2HWZL 1TNMA 3CJJA 5C0NC 4D0CA 2FBJL 2D3VA 5C0IB 4KH2A 4PJEE 2XZAL 4NO2B 2NMSA 3MLUL 5D5ME 1FLRL 4AEEA 4NZUH 5IB5A 5JW5A 4S10A 3BMWA 4IDJL 1EXUA 2HFFA 2MMXA 2NY2D 3DX7A 2IPKA 5AD0B 3HRZB 5C09D 4LRNH 4MDIA 1QLFA 1J5OL 3TO4A 3MMEA 4WUUB 5IB3A 4HHAA 3CZFA 3RVWD 1KCUH 1JV5B 1RZJL 1SJEB 5HGAA 3LKPA 2CKBL 3FO1B 4ZUVA 1Y18B 3CVIL 2CO7B 3GK8H 4PRPE 1WSST 1AGFA 1RJZA 1MRDH 5IVOA 1BGXH 4NBZB 4G8EB 3TYGH 4KVNH 2EXWD 1D9KA 4PJDB 5L2JA 4KKAC 4OGXL 1BPVA 2ZSWA 1MHEA 4GBXB 1MWAA 3MRPA 4EI5B 2JB5H 4RFNC 3H0TA 3PWLB 1XGRA 5DF0A 1JHLH 5LCVH 4PB0L 4MXWH 2VDLH 4RMTA 1T1XA 5HDQH 3RDTD 1JUFA 4ZUWB 3LS5H 3STLB 1EJOH 5SWSD 3FQRB 3D18B 4JVWA 4BZ2H 1TNNA 2LV4A 3DNKA 1LEKB 1XIWB 4OTXH 5LGHH 4HXAL 5GS2H 2IFFH 2EXWC 5E2VH 5JDSB 5C0DB 2XZZA 1RZIB 3IU4L 4H88H 4UV7L 4UZGA 2BY2A 1DANU 5F1OB 5JO5A 1FHGA 4L1DA 2YPKA 2V5TA 3RDTC 2CKBA 3MNWB 3TV3H 4OF8A 2NTSP 4HIIB 1AQDB 4OLEA 1QHOA 3RWCB 5BXFA 4TSCL 2F54D 4Y5YA 1G0YR 1EO5A 3MFFA 1KTLA 3EAKA 4OZGF 5IKCB 1IGCH 2RFXB 2CLZB 3QXVA 1HXYB 3ZE1F 1Q0XH 5IMLB 1HZHL 4K3DH 1IGYB 4ONFL 1DP0A 2P8MB 3GO1H 2CLVA 5DC9B 1IC5H 4PRIE 2DQTL 1BECA 1YECH 2NZIA 3LRGA 3I6LE 1VKXA 2HJFB 4U6XA 5AWNL 1S7TB 4OIIH 1T21A 1T22B 4HWEL 3NH7H 1VB9A 3O4OB 3EO9L 1TIUA 1NCUA 3Q6GH 1DL7L 4Z7NE 5C08E 4MA1B 4ZOAA 1QSEB 1X6NA 3B2VH 1MF2L 4HJJL 4BFIB 3GNMH 1DVFB 1SYVB 2MFNA 3FO9B 1DBJH 4HZLB 3DMMA 1H3PH 1HKFA 5HSFA 1ULVA 4OFIA 5TE7L 3BW9B 4LSQL 4E9LA 5JIIA 1MHHB 3FQTA 3ZZ1A 3HLAA 1MWAH 1T1WA 3ZDYE 4RIRA 5I0DA 2VAJA 2KH2B 4KXZI 3GMMA 3ZE2E 5ETUA 2X4QA 1WITA 4Y2DC 4MDJA 4C83A 3LB6C 2DMBA 4KZDL 2X05A 5DQ9B 5ERWA 1JYXA 3FOLB 5EUOB 3HG1A 2RHEA 4TULL 3K81A 4AIXA 3RWHB 3G08B 1FFNA 4P46B 3HTLX 3DWTA 4ZNEA 1EV2E 2GTWB 4C56A 4D3CH 1HYSC 2B20A 2R0LH 5ISZE 2O5ZL 4HUWB 3NCCB 5BZWB 4NJ9H 1U91A 1K2DB 2XKNB 4JGJA 4NGHH 2ZSVA 1I8LC 1QLEL 4G9FB 1A9BB 4I1NB 3MV8A 1RZJH 3ECBB 4QGTA 3CFDA 4GS7B 2CKBH 3KXFA 3VXTB 5KN5A 1MCPL 1CIDA 4TRPH 4GXUM 4X8XA 2DD8H 3JUZA 5D7JB 1KXVC 3MA9L 1KPVB 1U9KA 3OX8A 3UAJD 1HEZB 4CBPA 1QOKA 2XKUA 4JEGB 4GG8A 4IMKA 4O9HL 1B0RB 1J88A 3EZ8A 4OGXH 5KS9A 5GGSY 5I2IA 1MCCA 1WTLA 5J1AB 4GRWH 3LRHA 5TE4H 1ITBB 5MENA 2VN7A 2DI9A 3L3KB 3LSOA 4JY4A 4ESKA 4BQ9A 2P5EB 1A21A 3B5GA 4FQ2L 3QIBA 3GMQA 5GSRB 4IRZH 4GKZA 3BH9B 2DMCA 3DUHA 4IHOA 4PRHE 5JXAL 5K9QG 1LQSR 3MRBA 4MB4A 3JV6A 1QFWL 4R4FL 3B2UC 1I9JL 1QSFA 1TJIL 1YMHB 3MJ7A 4X7TA 1OM3H 2WW8A 3ZTJG 3W11D 4LVNC 2I5YH 3FB5A 3IFLL 5EU4A 1DN0A 4L8DA 5JHDA 4K7PY 3WIIL 4PLKD 3R1GH 4UV7H 3HRPA 2ICES 1HSBA 4G6FD 1I1AA 4X6FA 2Q20A 4AIOA 1WC7A 4GW5B 2G5RA 1OSPL 2V9QA 3CSYA 4WW2F 3GMOB 4PYHA 2J8UA 1G7HA 4N0RA 3LZFL 4JRYE 9CGTA 2H1PH 2CDGB 3C6LA 3HNTH 4O02H 1F4HA 4YEEA 3PWUB 3UDWC 1CGSL 2Z8RA 4YHML 1PJ9A 5ESVB 4PY8J 4P2YA 3BZEA 4OZGE 1FBIL 3A6CL 1YEFL 1HZHH 3N1QC 5I18H 2EDOA 4WDIB 2VIRB 3DX6A 5DJ6A 1CD8A 5IBTH 3FO2A 2UZIL 5D8JH 1C7SA 4WO4B 4PLKC 1QSZA 2AJZB 4XMPL 2BNQD 1JI2A 5ALBH 3WV0A 4ONOA 5LWYH 4RX4D 4PS4L 4UQ3A 3U0WH 3OKKB 3BPCB 1IC4L 4N1CA 2HLFD 5DQJA 3O4LD 1NLBL 3CPLB 1NH6A 1TZHA 4DN4L 4NSKB 4OZHF 3KPQB 4PD4J 1HNGA 4AK1A 5TF1L 5B39B 3B9KC 1UB5A 3D0VA 1TETH 4WI2A 5HY9B 5BJTB 4XAKE 4M9OA 4LCIH 4G6JL 3VXSA 1CFTB 3QI9B 3N1FC 5DK2A 4LSQH 5I1LB 5D2NB 1LK3L 1EHLL 2HJLA 5F8RC 1CFSB 3SDAB 4HW6A 5ACZB 4PJBE 2DLTA 3WNKA 5BW7C 2HLFC 4YQXL 1QYGH 1TVDA 5GGSA 3N9GL 4X6DA 3BT2H 3DRQB 4R90L 4JFFD 1ACZA 1DBMH 1A6ZA 4ZSOE 4OLYL 2G5BB 3BDXA 2XPGA 5I15H 2FJGB 1MCLA 3BHBB 5ACLA 3H9SA 1VFAB 4ZUTA 3ZT6A 4HUUA 3EYVA 1AP2B 2O5ZH 3CFCH 3DYOA 4W6WB 3TCLB 4BKLB 4FQ1H 2AXJA 1T83C 3TVMA 1QLEH 5INDB 1FZJA 2BMKA 1DFBL 4P59H 3REWB 2C1OB 3SE9H 2F8OA 3BIAX 5E99L 3U4EA 5F3HB 1X5KA 4KK9D 4M61B 2A9MH 5CZKA 5HHME 4FOMA 2EO1A 1TPXC 3FFCB 5HGGS 4HFWB 4M7ZC 4RDQF 2DI8A 4KY1L 4X4XA 3D48R 3KPSB 1P6FA 3E3QC 3PQYB 2HLAB 2D4FA 1G7MB 3JXAA 4C57C 4LSVL 1QBMH 4KRPB 4K9EL 5I8EB 4WWKB 2X42A 1F11A 4PJGB 4LLYA 5C0BD 2ICEB 4I18C 3BPLB 4C59B 4IRJB 2DIAA 5DHXB 3NBNA 5JXAH 3W9DB 2IQ9L 3VFMB 3GBMH 3T4YB 3BPNC 2XN9A 4Z77A 4X98B 5BS0A 1K9TA 5IW6A 2DMKA 3BN3B 3UTZA 2PYEE 5FOJA 3OGCA 5HHQA 1QLRB 1I9IL 2BC4B 1EDQA 1LILA 2W0FA 3ISWA 4G7VH 1FV1B 5CP3A 2MQ3A 3C2AL 2IAND 5GRJL 1L0YA 2JF1A 3DYMA 4MSWA 3BWAA 3O2WL 1OSPH 3E6FB 4YH6A 3AVEA 5E6IA 4AT6A 2GI7A 2GFBA 3LZFH 1LO5B 2DRUA 3P4MB 1CGSH 2P45B 4YHMH 5C0CA 3ARGB 3ZTJH 2IBZY 3T0DA 3UTTD 3FOMB 2W9DL 4KJYB 1I8KA 4FTVB 1BZQK 2I24N 3MJ9L 4OFVA 4YO0A 4B0MM 4RBPH 5D5MA 2FO4B 4ODXB 2UZIH 3ZT5A 3UYPA 4NP4L 5E5RB 1EFXA 1QRNB 4XMPH 5I9QB 5SWZD 1HCFX 1RURL 2UZXB 3QP3A 1A9EB 5JW4Q 3SBWA 3QXDA 4PS4H 3GSOA 1JF1B 2E3VA 4HIHB 2EIDA 1UEMA 2PW2B 4N8VG 3WIHA 4CADB 3OJVC 3LD8C 3LY6A 2I9LA 3IDNA 4O2CB 3VXOB 2AJ3B 5D1XD 4UILL 1XF3A 4KJWD 4BELD 3LEVH 5EO0B 4K7PH 4Z78A 4HT1L 4PUBL 1WICA 2FB4L 1YPZB 3HPJA 2PR4H 2VDMH 1FNSL 3ZYJA 3WNMA 3MBXH 4G42A 3QJFB 3ARED 2GHWB 4LSTH 2FR4B 3CVHB 4GAFB 1PG7X 1AO7A 5KVEL 3U6RB 1EHLH 4OF5A 4JRXE 4NNPL 1A6WL 1G7LA 2MHAB 4P3WA 4KVCH 4P3DB 1KCRL 4X6EB 5IROC 4HFUH 2RJMA 2DQCH 1N64L 5TQ2L 3U4BL 4PJ9A 4DKEL 4BZ1H 3EFFA 2VLJA 1UYWH 1N6VA 3C09B 5D1XC 2VR4A 1BBDL 5IM7A 1KN4H 4OLYH 3HI1B 4WU5A 4G8FA 1QA9B 1AY1L 4LEXL 1I85C 3AREC 1RU9H 2D2OA 1OPGH 2AERT 4YHZL 2NLJB 5SX5H 2V5RA 2AJYH 5DJYA 1A7BA 1ZHLA 1IRAY 5KSAD 4M93C 5CP3H 4PR5A 5FUZH 4WHTA 4NQTA 3SGDI 1IZKA 4D9LL 2ARJA 3MBEB 3UROR 4HS6A 1CZ8L 5C0RH 1JHTA 4GUPB 2FL5A 4PJ5E 2Z4QA 1BIIA 3IDMA 5IOPB 2VSDA 2H2PC 5E99H 4P4RB 4M7LT 1WTGT 1J05B 3FQUA 2ARJQ 3QCVH 3T09A 3VG0L 4I3SL 1NFDF 5T1LA 5DXWA 3L7EB 4ZQKA 1TQBB 2OSLA 3OXRA 3OKOA 5F1NA 3TO2B 5A1AA 2VAAB 2D9CA 3ARZA 3DV6A 2R2EA 4P4KA 4MA3A 2EYSB 3JV4B 4FFZH 3IXAA 5KSVB 3MGAA 5KSAC 5DTFB 4APQD 2F58L 3RZCA 4N8CH 2H8PA 5D1QA 43C9B 5DJ8A 4CNIB 1D6VH 1KCVL 2GEEA 4MMZC 4P2QE 4G43A 2DIBA 4JQVA 4ZD3L 2DLHA 1LEGB 5ANME 4EUPA 1INQA 2CR6A 1A6AB 3CDCA 4QHKJ 1Q9LB 3WIHH 3C6SB 5IB2A 4WI8A 4R4BA 5C08A 1K6QL 3VD3A 4MNGB 3RGVD 4JFQB 4EIGB 4NZRH 2NY5C 2X4TB 4TUJA 1A1MA 2ZUWA 3IRZA 4XXCA 3QYCA 4O2EA 1P1ZB 1T20B 1VGKA 3C2AH 4APQC 3VFRA 3SPVA 1I4FB 5HVHC 1F8TH 2D03H 1UH2A 3VFWB 4U33A 5I8CA 2VC2L 1CF8L 4AEIH 4K23L 2YSSA 5E0QA 4JKMA 1CDJA 3IFPB 4W70A 4UIKH 5FO8B 4JM2B 2P5WD 5EBWB 3CH1A 4HWZA 3VXRA 1UB6A 4HGKC 1C5DB 1YMMB 4FFYL 4CVZA 5C2BL 3AAZB 3VGBA 2DQEH 1NUDA 4FQPA 4P2OA 4H8WH 1CFBA 3ARTA 2Y36H 4HUVA 2ATPB 1CLOH 1JGLH 1RURH 1ZT4B 4Z8FL 4ONHB 5ID0B 4M48L 4RFOL 5L7XH 2A6DB 4R7DB 4XBPB 5ID1B 2I26N 1H8OA 1MQ8A 1X5AA 4Z7UE 3L3IB 4E41B 3SDDD 4PJ8A 4EVNA 1K8IA 5J11C 2V5MA 4WRLA 4JO4H 3ESUF 3S7GA 3WS3B 3BYTA 4JPKL 4WGVB 2FHBA 4L9LC 4MQXD 1OAXL 4FFWD 4YHKH 3SDCB 3MR9A 4JHZA 3VFVB 2VOTA 4AEHL 1BJ1H 2R2HA 3T2NL 3UJTL 1LD9A 5CHNA 4F7TA 5B38G 3QDME 1OD7A 1CT8B 1NKRA 1XFPA 3MYJB 3MZGB 4LLAA 1I8MA 4NUJA 1KNOA 1S5HA 5F6IB 5JQ6L 3AU1A 2VXVL 1E27A 4XTRD 1PD6A 2EE3A 3W2DH 3MOBH 3SDDC 1A6WH 5IHZA 3U4BH 4MQXC 3T0VA 2R56L 1CVSC 1HDMB 3T0EE 4XX1E 5ITBL 1MI5E 1X44A 4EDXA 3Q2CA 1BBDH 4L3ED 4PTTB 1J0ZA 4EUPH 1F5WA 2HVJB 2BVYA 1A64A 5GGVL 5KG9A 5B22A 4NRYA 3ULVF 1Z5LB 1AY1H 4LEXH 1Q8MA 1C1EH 2IG2H 1S9XB 4YHZH 2B1AL 1IAKB 2GJ6A 3BJLA 5I17B 2EO9A 4XTRC 1FL5B 2XFXB 3EO1B 4XZUB 3F7VA 2YA2A 3K80A 1JPGB 2QJDA 4Y4FB 4MJ6A 1WFNA 1MNUH 5IWLA 4P5KB 4V1DB 4HKJA 4UT7L 4ZXBA 2X1QA 2FWOB 2VMFA 4JHWL 3G6JA 5EA0L 1D6EA 4NQEB 5SX5K 4JRYA 4Q9RH 3QSKB 3GSNA 5E8DL 3RY6C 2VLLB 5T3XD 2CH8A 4YX2L 4YXHH 2VL5A 4JB9H 3VRLF 2ZCHL 4DQOH 1OGTB 1FVDB 1SM3H 1N3NB 1TVBA 4G6AC 1BM3H 5HYFA 5I1IH 4Y19B 2C3VA 4ODWB 3NAAH 5E2JA 4MNQE 3PL6B 3CFKB 3IDJA 3UJIH 1G6RA 5F89B 4JKPL 5EO1B 1KCVH 4KTEH 1LNUB 4F7MA 5B38A 4LSDA 5TDPA 1YDPB 4K7FA 4NPYB 8FABB 1KENL 1WIUA 4P2RB 5JXEA 3HAEG 4MA7L 2F8VA 5HD8D 2X70A 1H3GA 3PWPB 1T4KB 4TVPD 3MGOA 4QRRE 5H2BB 3T1FB 3W0WD 3BP4B 1R24B 3WL9A 3S36X 1NGPL 2EE9A 2PO6D 2O5YH 5IP4A 1LMKA 2NY4B 1H5BC 3QDGD 1FG2B 1IM9D 2CK0L 4HMEA 1ZLSH 3U7WH 4XBEL 4ZSOA 4JG1L 5HHOB 1H15B 3FB7A 3KLAA 4XP4L 5DJDB 4G9DA 4LLQB 4RMUA 4ZAKB 5EC2A 4Z8FH 5INCA 3U7AA 1FH5L 5CMAA 1PG7L 3UPRA 1CFNA 2P1YA 4PB9L 3GB7B 4P9ML 2PO6C 4XT1C 3BRFA 1ORQB 1S7VA 4ZO8A 4OGZA 2C3XA 4JPKH 1R3IL 5F97E 1A7NL 4PGZA 3FQWB 1OAXH 1S9VB 3GSUB 5SX4H 5CZXC 3HI6L 3KHQA 5GIRB 2GIYA 1MJJB 5T5FL 3V4VH 4GBXD 3WUWA 1U58A 3GSWB 3GSNH 3QWRA 3UJTH 1GVIA 3TZVD 1G84A 3V95A 4MLSA 2A77L 3LMJL 2E7MA 2HKHL 1NC4A 5FOBB 4MJIB 3MCKB 4N0UE 1K4DB 5DI8B 1ZLWK 2AXGA 2YHGA 3F7YB 4AM0A 4G80B 1AR2A 4U6YB 5JW3H 4EIZC 3BKMH 4LFHG 5EPMA 3OAYH 5IUSA 4ZO7A 1JK8A 3TPKA 3HAEA 2YD3A 4Y1AA 1JF5A 2R0KH 1PKQE 3QFJA 3QFDB 5I1GL 5DEZA 1G6RH 2DWEA 4NNXA 3H42L 1FNEB 5IFJA 4R4ND 5DFWH 4GBXC 2OJEB 2VWEC 4PJEB 2FX9L 4WEMB 1DBAH 4CRPA 5GGVH 1XH3A 1R3LA 1JZ8A 4ZYKA 5FYJU 4LGRB 1CTNA 4PV8B 3ULVE 3DX9B 3BKYL 3VWKA 3RPIB 1XT5A 4NN5B 1YN6A 4NQSA 1UKQA 5L8JB 4I4WB 1LO0H 1G9NL 4K94C 5IVZB 5FYLE 2B5IB 4UOW1 2XWTA 4JY6B 4XVJL 1DLHB 3WJJC 1T5XB 3DXAD 1CIUA 1U8PA 2DBLL 5EB9A 5HYSA 5LGJA 3MLRH 1S9YA 4CDGC 1A22B 4PRPB 3VXMD 4R4NC 1WAAF 1ADQA 2GCYB 3GI9L 2MKLC 5T5NF 1AHWB 2A38A 5MEPB 2BVQB 4NKDA 4FQJL 3OG6B 1U93B 3LEXA 3TP4A 2JJVA 4P9HC 5ICYA 2ESVE 2KBGA 2H32A 3D5OF 2HJKB 1MFCH 4LRIC 1WBZA 4KI5E 1JPFA 5FM4A 1X6LA 4J3VA 1QR4A 4O5LL 3RWIB 1I3GH 4Y5VB 3STZA 3WYRA 4OFKA 4L4VB 3WFBL 2EYRB 5C9JA 1AGCA 4I0PD 3TA3A 1NGQL 4QRPA 1UXSB 4FP8H 2VXSH 2EC9T 2ZPKL 4JREB 1L0XA 4QXUL 3Q1SH 4I9WE 5EN2A 3O4OC 1OLLA 2EH8H 2VLKD 5CGYD 1GIGH 7CGTA 1H0DB 1OGAE 2H9GB 1BQHB 3KR3H 2VZVA 4XAWL 1NGPH 4JRXA 3UZVB 3BRDA 4GMSH 4M7LL 5L2KD 1KB5L 1EUTA 3PIQA 4QHLB 1AGBA 1DVFC 4LU5H 4K2UL 5EOCL 1XCQB 2XA3A 3HAEH 5EZLA 3UO1L 2QR0B 3QZWB 3FMGL 2OJZL 3JWOC 3GEWB 2CDEA 2X10A 3SDXE 4HIJB 2VISB 3SJVE 2MOVA 1M05B 5CINL 1REIA 4X5LA 1DBKL 2Z35A 3C5ZD 4X99A 4JY5L 3K8KA 4GRLA 1VADA 3NZHL 5BRZE 4G9FD 1QBLL 5IB4B 1MFAL 4PREB 5CGYC 5KVMC 4IIQB 1BBJA 2YEZB 4PJHE 3BVNA 3LDBB 5CSGA 1S7RB 4OCRL 1B4JL 4P9MH 4R2GB 5JLZB 5MEOB 4I5BB 1FO0L 2EDKA 1GH7A 4B41A 1NUGA 3F7QA 4HMCA 4P46C 1CL7I 1I1RA 4U31A 2ARWA 5KSUA 2EH7L 2BNUA 2VXTH 1KCSL 4JFHE 4BSWB 3NIFF 3C5ZC 1X7QA 4IRSB 1FYTA 2DQIH 5SWSE 1V7ML 2NTFB 1EAPA 1HILA 4X4ME 1ES0A 4GS7C 2E9WA 4LCWE 5CILH 2YKLL 5A2KH 5HDLA 1MQKL 1KB5A 2XZCL 1Y6NR 3KAAA 4P5MA 4QF1B 4TTGA 3PDGA 2H32H 3DO7A 4F7PA 4YHOL 5FDWA 2BOBA 3P9MB 2D4DA 1U95B 5E9DD 1NL0L 4YC2B 4P2QA 1QO3A 1A0QL 2OR8A 2YOCA 5ANMA 1PAMA 4KQ4H 1BFVL 3B5TA 4GAYA 5BZDA 1PBYA 2EDDA 4QHMB 3WXVL 1XF5A 2FX9H 2M26A 4KKBC 4LF3A 3VFPA 1QFWM 1RZKH 4XX1G 4GW1A 2BSRA 5TQ0H 1NGZB 4YDVA 2X4NA 3OHXA 1NC2B 3CXDH 2R69L 2AJXH 4MMXC 2IBGA 1XGQB 1D5XA 3UXFA 3ETBF 1JWUB 2BSTB 4ZTPL 5KVFH 4W6YB 2DBLH 5FYKD 1SJVA 2XRAL 1TTGA 4JANB 4PBXA 3S34L 2A6KB 2E6QA 2AEQH 2FLRT 5CEYB 2KQNA 3CMOL 4WFHD 4WO4D 3GI9H 5D6DA 1ZLVH 4DVBB 4U1KA 5F7UA 4ELKA 3V6FB 3OL2A 2XZQH 4NUGL 4ODVL 5DURD 3WE6B 2AEIT 3QQ4A 4PLOB 1C5BH 4EI6B 3LKRA 4HEME 3HPLB 4NO3A 2GAZB 3T4AA 4BFBD 1M7IA 1O0VA 4U1MB 5DFVD 1MELA 5C6TL 3ZYZA 2YD2A 1N6QL 1U8OB 1U36A 1Y6KR 2V7NA 3P0VL 5J89A 3ULUD 1J8KA 4Y8DC 3HR5B 3S36L 2DF3A 3ZSSA 4EEEA 1DTUA 3MX0A 5I74B 4OZIA 4XXDB 3BEWA 4LEOA 1CD1A 5ESQB 1EX0A 1Z9MA 3ULSB 1RZ8B 4JLRB 4N0YL 3V0VA 5FB8A 4MZ3A 4WO4C 4UINH 2ZOLA 3PWNB 1NEZB 3QI9D 1IEHA 3L5IA 1I9EA 4TPRH 1NGQH 1FP5A 5IJVA 5EU6E 1WISA 5TDOB 5IIEB 3OKNA 2VQTA 5C6WH 1NFKA 1CICA 2A6JA 3QCTL 4KQ3L 5DFVC 2ZPKH 4CN6A 3DETD 1RZFH 4PYGA 1OB1B 3HCVA 4O4YL 3K8MA 1UQSB 1BEYL 1W72A 2DQHL 3ULUC 3X3FL 4XAWH 3IKKA 4ZTOL 2X41A 3GKWL 1JZ4A 2CRZA 4M7LH 3VXUA 1KB5H 2ORBH 3HMWL 3MV7A 1W8NA 5EOCH 4JVPA 1CXHA 4YDJB 5SWQA 5GS0H 3BEVB 2QV2A 4JDTH 5DS8A 5CEZH 3PHSA 3FMGH 2OJZH 4O51B 3QI9C 1V7NH 4OZGB 3KDMB 5CEXB 2HT4D 5D2NC 4HBCH 1A6TB 1IAIL 3ARVA 5GGRY 3W81A 4JPIA 1UWXH 3R8BB 1ZHKA 4KTYA 4JE4B 3SDAC 1E4XH 2FEDC 3DLQR 3D3VD 1I3RB 1Q9OA 1VENA 1JHKL 2EIZA 4HCRL 2AJUL 5F72S 1MFAH 4HUXA 2CD0A 4N9GB 4XMKL 4AG4L 4JFEA 3BYYA 1B4JH 3GI8H 1NCTA 3ROOB 2RCSL 3HN3A 3RY4A 1CN4A 1AI1H 3CDGB 3C5JA 3QA3B 5I6XB 1T6VN 2PW1A 3QIWB 2VNCA 3BIKA 3QO0A 2HRPL 1W0WA 5DA4A 3RP1A 3SGJA 4U1GC 4F9PA 3KPSD 2PTTA 2EH7H 2W59A 1PEWA 4AMKL 3B6SB 1KCSH 4UT9H 2F74B 5D7SL 5DO2D 4KRPD 2AKRA 4WWKD 1KLGB 3OR6B 2BNRD 1JVKA 3FT4B 3K4AA 4R3SB 2IPUG 4RA3A 1FVCB 1YJDC 2J3SA 3BD4A 4IRJD 2BDNL 4G8IB 3GSQA 3IB4A 1WZMA 1RULH 4Q6YA 4MNQA 1J11A 4B7IA 1LO3H 1EIBA 5I71B 4WEBL 1N4XL 2DQGL 4D9RD 3NCJL 2FX8H 5CBAB 1W2KT 3MPCA 4P5TB 3VCLA 4XVUD 4Z0BH 3HC4L 1P2CA 1HNFA 1DDHB 1KXTB 1CXFA 3LN5B 5GXBB 2UUDK 4KRPC 5E1AB 2O61A 1MCWW 4M4RA 4WWKC 3TO4D 1RHFA 1P7QB 5DD1L 2BHUA 3LQZB 3TJEL 4X7DC 2EDBA 3BPLC 4IRJC 4PJAE 1NSNL 1GHFL 4Y4KA 3ARGD 5FHAL 1DQJB 1JPTL 1KTDA 1W72H 4J1UA 1LEIA 4NQCE 1IEBA 1KJ3H 1XGPA 2DM7A 5GRUL 2JE8A 4Q97A 1MCEA 3FQXB 1VACA 4XVUC 4LNRA 3MV11 5HGBB 5JIKA 3LIZH 1I1CA 5JDJA 5EU5A 1UH3A 2E5EA 3VFNA 3CMOH 1ZE3C 4YPGA 4NDMB 4RA0C 2QADB 1IJ9A 5IVXA 2B0SL 3MA7B 4CJ1A 2Z8SA 5E5MB 4ODVH 3G6DL 3CDFA 1MVUA 2VDNH 1VDGA 3MOAH 1FLTX 4L4JA 1WWWX 2F9BT 4WCYL 1A8JH 2ICCA 4GT7A 3ULVL 2QLVB 3SGEI 1ZLVK 5E8EB 5LBSL 3P0VH 3G5VA 3L9RB 3ARGC 3S36H 5FYLL 3RTQB 1X5FA 5GGRA 3UBXG 4Z76B 5E8NB 4OJFL 4YAQB 4TSBL 3GIVA 1AE6H 4YHPA 1OARL 3BGAA 2BY1A 1RUML 3EYUL 4FNLL 4JCMA 4QXGL 5I9QC 5IJKA 2IAMD 5DVKA 1CDIA 2PYEB 3BDYL 2X1WL 1C08B 3CSGA 5CKAA 4RSVA 1NJ9A 4KQ3H 1UA6H 1ACYH 4ZFZB 5J6GA 5F9JA 4KHTL 2R1XA 1JN6B 2I07A 4V2CB 5DD5H 1BEYH 4U1IB 3GKWH 3MLZL 1G7IA 3UTOA 4BZYA 4WW2B 5DUBA 1S7WB 5H37G 3TWCL 1V3MA 1PKQA 4OCSH 5GS1A 4NZTH 2Q8AH 3W39A 2WUBH 4YGVA 1P4IL 1RK0B 3C08L 4OCNC 4F33B 2IAMC 1KEML 2OL3L 1E4WL 1IAIH 3HE7B 3ORJA 1SEBA 3L3HB 2QHLA 1F3DH 4XBGA 3ZHLA 1AIFA 3QUML 2E9BA 1H3UA 1JHKH 1SYSB 2AJUH 4XP5L 4EXPX 3C09C 2H6PA 4NT6A 3MRDB 3G5YA 1NBZB 3WNPA 3NIGF 2G75B 2RCSH 4RQQB 3NCYP 4PJFE 4YUEL 4QYOB 1FRGH 1RV6X 4L4TB 3CFIC 4OZHB 4NC1C 1E6JL 5CBEB 1I7TA 3RUGA 4KUCD 4NBYB 4MJ5B 1Z3GL 2B2XL 2Y6SD 1W0VB 3N1GC 1HK6A 2IMNA 2FJHA 3MBEC 1CDCA 3S4SA 1T2XA 1I7UA 3KYNA 5CSBA 3UBXA 4YE4H 2A73A 3EDJA 1SJXA 3MLTA 4HC1A 2XACC 1PVHA 4HKXB 3I9GL 5E00A 2OBGA 3SY0A 3ZKSD 4D9QD 4KJQD 1TQBC 4JO1L 2ZG2A 1ZWIA 3WEXA 3WD5H 2Y1VA 3BQUB 3IGAA 2OL3A 3UTQA 4WV1B 1UJ3B 4HKBB 5CCKH 1CE6A 5I30H 1N59B 1N26A 3NFNA 3PWJA 2Y6SC 2CIKA 1AXTL 3LQAH 3NACL 1YC8A 1TXKA 2EDEA 4U6HA 3CLEL 1HH9B 4NHCH 2QQLH 2BSED 3WHXA 3PJSB 5C07B 1FORL 3UTTE 1RUQL 3SQOL 1Z6JT 1A4KB 3KYKH 3OKEB 6FABL 5A2LH 4XB7A 5KANG 4JM2D 2YUXA 4KJQC 3DTXB 4JFZH 5IEKA 1T0MB 1KJVB 5DC4B 4A6YL 5JNYB 5SWZE 3MNVA 5D7LB 5CLWA 2X4OA 3RWJA 3QPXL 4RGOH 2F53B 5C09A 3ROLB 3HNSL 5EC1A 3I6GA 4OLVL 5MERA 3V5HB 3SDXA 3MRFA 2B0SH 5IMKB 3PGFL 4A2MA 1NBQA 5FCSH 1K8DA 4E41D 1E4KC 3VFSA 4RFEB 2W60A 1T03H 3PV6A 3EDFA 3LKNB 4FZEL 3P2TA 5EFIA 1IARB 4D0CB 4PJHA 1JNNL 4F7CB 4JM2C 3QULA 4L3CB 4EZMA 5FIEA 4X4YB 3TM6A 3N06B 4TSBH 4P23B 5JW5B 1MAKA 1PLGL 3K3QA 5D1ZB 3CFJA 3ALPA 3GMLB 1P4LB 4J3OC 1WWBX 3MRGB 3QEGL 4QXGH 2XOTA 1A2YB 3OPZL 3MMEB 3RDTA 4HHAB 5TDNB 1FZMA 2FH8A 1II4E 5HGAB 3LKPB 5SWSA 1X4XA 2EEBA 3P4NA 4CDHA 4U1NB 3MV9B 3U83A 4CW1B 3SDCC 4KDTA 2ITDB 1ONQA 3X3GL 2JCCA 4KAQH 1CGYA 2FECL 4GG6A 1PY9A 4ZO9A 1MCOL 3U2SA 1JRHI 3FRUA 4HC1H 4FABH 1XZ0B 3O2VL 4OIBA 1MHEB 3L3GB 5F7EL 3MRPB 5F6IC 4M7KL 3OV6A 1GRWA 1P5UA 3T0XA 4LKCA 3FCTA 2OL3H 1T0NA 3HFML 1T1XB 5DQDH 4TSAL 4Y4FD 4J6RL 3QUMH 4M1DH 4V1DD 2QHRL 5ITFA 2B7DT 2F54A 4OLUL 4XP5H 1BF2A 5I1CL 1B0WA 2EDJA 2CGRH 4KTDL 3GM0A 3O3AA 4F2MA 2FDBP 2MPAH 3MXVH 1FCGA 4UQ2A 3KGRA 4MWFA 2CXGA 3QQNA 2YD9A 1KG0B 2RIKA 1XR8A 5F6HI 1HHIA 5DJXA 3O3DA 2DQDL 4GMTL 1A3RH 2YPKB 3DJ9A 1CXEA 1NCBH 1SJHB 3QDMB 4Y4FC 4QTIL 2B2XH 4WNQB 5AZ2L 5BXFB 4B5EA 4E42B 5FO9A 1KTLB 1UWGH 2V6HA 4IS6B 1NUNB 4HAGA 3I9GH 4P2RD 5BQ7A 1AGDA 3GBNL 3EYSH 4O58L 4E5XB 3T0EB 1G1CA 2DTMH 1MI5B 4UTBH 3QR2A 1YY8A 4UIMA 2KZ1B 1TVHB 5IV2A 2BCKA 4LDOB 3W9EB 1VFBB 1I8LA 3TLRA 4QEGA 1AXTH 5T33L 3DBXB 1ZGLB 4EBQL 3CLEH 4ZMAT 4HS3A 3GRWA 2EDYA 2GK0B 1RUQH 3QWQB 2NY4D 1CK0L 3LEYL 1U3HB 2MSPA 2OTWB 2UWEE 5FECA 3CLFL 1L7IL 2ZG3A 1C12A 4QGYA 1JGEB 1VGEL 3DMMB 4PJIF 1MRCH 3ES6A 5HHOD 1JYWA 1SVCP 1MOEA 1ZLUK 3PGDA 4QKXB 1HHGA 2E9JA 1AQKH 4Y4HD 1NFDB 1T1WB 5HVWA 2EICA 1TZIA 1FFRA 1F58H 5HPMA 3AM8C 5C8JA 5K9OA 3DOSA 5ETUB 1H8NA 1A1OA 4H5SB 4C54A 4MDJB 4Y0GA 4OUUA 2NY4C 4XC3H 1JNNH 1MCRA 5IW1A 1JPSH 1DQQA 3HG1B 1EAJA 1ZANL 4XP9H 4KDVA 1ZT1A 3IFOB 3AUVA 4ZOCA 2X7LB 3TFKD 1S8DA 1U91B 4U1LA 4Y4HC 3QEGH 1OSZA 4X7EC 4ZAKC 5EWIH 3KPRE 1FE8L 3QQ3B 2VXQH 2BJML 2WNGA 1W8OA 3MLPA 2UYLA 5AYUH 3KXFB 5KN5B 3UDWA 4M3JA 4RAUA 4J4PC 4Z0XB 1INDL 2V7HA 4J3UA 2A74A 3HB3D 4U4BA 2W38A 5IVXF 5C1MB 3PHQA 4ZUUA 2D0GA 4NKIH 1UM6L 1L6ZA 5I2IB 1U8HB 5D7KE 5MENB 3UJJH 5F7EH 3VFTA 2OTPA 3TFKC 4BJLA 3UZQA 3P4OA 4IEFB 4CL7A 4M7KH 1HWHB 1EFXD 3AY4C 3G6AB 3MRMA 3LSOB 2QQKH 4J3SA 3ZL4L 5DT1H 3IDGB 1N5YL 4DVRL 5MP6L 5GGTL 2IPTL 3RWGB 3MRHB 5DMIL 5FEBA 3EOBA 3RWEA 4OLUH 3IETB 3MRBB 3MRCA 5T3XE 3JV6B 1M1SA 4LBEA 4XMLL 3GRWH 3HB3C 1QSFB 1U3YA 4PRPD 4KTDH 2OI9B 4X7TB 1K5NB 4MXVF 2V5SA 4MXQC 4HK0B 4XPHL 3MLWL 3FB5B 3QRGL 4HULB 4N9OB 4L8DB 2J12B 2BNQA 1BQUA 4OGYL 4GAJH 4PJ7E 2VH5L 4K9EC 1HSBB 4ETYA 1I1AB 3O6LH 4FQXD 4X6FB 1KBGL 4GMTH 4RX4A 5TE6L 2B5IC 1CYGA 5F3BA 4QTIH 2ENSA 3FO0L 5BW7A 5KJRH 1G7HB 3O4LA 1HOCA 3C6LB 3TT3L 3L3DA 2OK0L 3D69A 4N0UB 5FA4B 4WHYG 5KSBE 3MO1A 1D5IH 4BQ6A 1CU4L 4DW2L 4LLDB 2R1WA 5CZVL 4QXTB 4L4VD 3NPZB 4TVPE 4FMKA 3DX6B 4PBWD 2P8PA 2ZUXA 3ZE0E 3GBNH 2OS7A 4NYLA 5E08H 2AXFB 3LV3A 4KUZH 5A16A 4FQXC 3TBTA 2YR3A 4OGAD 5EZIL 4KV5F 1AC6A 1T83A 2AK4E 1ZVYA 4DEPC 5CGMA 1ND0A 1IKFL 5DQJB 4AEFA 4EBQH 2WWKO 2V9TA 1TZHB 2VR9A 4JFFA 2ITCA 4Y5VC 3BJ91 3LEYH 3RUGF 4YXKL 1D5ZA 1FG9C 4YWGL 5I19L 4HV8B 1YNLL 1L7IH 1JZ5A 1MFBH 3OXSB 4WUUE 3VXSB 1EEYA 1LE9A 3EGSA 2QSVA 5LKNA 4JREC 1NMCB 4OGAC 1KFAL 4PRID 2HJLB 4XCNA 1Q0YL 1WBYA 1Q9KA 4JQXC 2XTJB 1S3KH 4R2GD 1XF4B 4PJDE 4I18A 1CFQB 1FGVH 4PGBB 1OAQH 1XMWA 3U46B 1ZSDA 1UWEH 3PABB 1MIML 1ZANH 5C08D 1OCWH 3JWDC 5KW9H 1ZT7A 1CVRA 2Z0BA 4ZUTB 1I7ZB 3EYVB 4IRSD 3HZMB 4XPFL 3QEQB 4IIQC 4YNYA 3TVMB 3LDBC 2FEEL 3VMOA 4R2GC 5IHBA 3AS3A 2QQQA 4KGJA 4PJXF 1FZJB 2BMKB 2WIIA 4ZS7L 5C0BA 1S7SB 3MRRA 4OD3H 2WQRA 4HX1A 1U8IB 2YRZA 1OWWA 1G7QA 3CAFA 4OV5B 2ADFH 3D25A 1NCDH 2SEBB 1EMTL 1TQCB 1INDH 5FGBC 5CSZB 3CX2A 3MREB 1RJLA 4IRSC 4JN1L 1A6VL 5CJQL 5ADPL 2IANA 4HXBL 1C5CH 3ARQA 5I73B 1JE6A 5DMKA 3BZFA 5ISZD 5HYJB 1OAZL 2VR5A 3DHJA 4TUKL 1NC2D 4I2XB 1GZQB 3U30B 2XQYG 2BOCB 5C2UB 4AZ8A 2PXYB 4LHQB 5JPMA 5LJYH 4YC2C 1G7PB 1T80A 4XMLH 3UTTA 2AQ3A 3TN0B 1N7ML 3BO8A 5BS0B 1EHAA 1EZVX 4X9IA 4RGMB 1BLNA 2UV3A 1RZ7H 3OTTA 1XF2A 2J8OA 2R15A 2Y7QA 2Z31D 4TOYL 2VLRB 3MLWH 3DGGB 3QRGH 4OKVB 3PNWB 3QUZB 4UBDD 3JTTA 3ME0A 4NCC1 5SWZA 1TJHL 2VH5H 3BWAB 5J7CC 5F9DC 2JJUA 3CUPB 2JCCF 1CXKA 5C86A 3MXWH 1YEDB 2HKFH 1BVKB 1QSEE 3MRQB 5JHLH 4D8PA 2VERN 2DYPB 5IROA 4Y5XB 1F00I 1MCDA 3RRQA 2YZ8A 2XIDA 3QIUD 4ZG1A 3O45A 1YNTA 3L6FA 2OK0H 3G9AB 4FXKA 1LP9F 5D1XA 2NY6B 5DRZB 2HVKA 5DMGD 1CE1L 4PRHD 4A6YB 4DW2H 2F19L 1CFVL 5FKAB 4ZNCD 1FJ1B 1R3KA 1DQML 2Z31C 3RIFK 3DVGA 4OLWH 1VHPA 1FN4A 1EVTC 4UBDC 3AREA 2ICWJ 5CWSA 2NY5L 4ZS6C 5LXGL 2VZSA 5IFAH 1HQRA 3FQNA 1YNKL 2Q8BH 2AQ2A 4XWGL 4IOIA 1EBAA 4KV5E 4JFOA 1P53A 3RNKA 3GSOB 5EUOE 4WHYH 4DOHB 3UC0L 2W9EH 5I74C