3VG9B

Crystal structure of human adenosine a2a receptor with an allosteric inverse-agonist antibody at 2.7 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
212
structure length
212
Chain Sequence
DIVMTQSPASLSASVGDTVTITCRASEFIYSSLTWYQQKQGGSPQLLVYAATNLADAVPSRFSGSGSGTQFSLKINRLQPEDFGTYYCQHFYGSTWAFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Adenosine receptor A2a
publication title G-protein-coupled receptor inactivation by an allosteric inverse-agonist antibody
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2011-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vg9B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vg9B01
3DSFH 4KI1A 1QLEL 5HD8C 3TNNB 2D7MA 4Z7VB 5E8DH 3FQTB 5EUOA 3NABL 1JPFB 2XZCH 5DQ9B 4MAUH 4XC3H 4OIAA 3BHBA 4HUKB 3ZE1F 4FS0A 3WUWG 2ADGA 3AS3A 1U8IA 1BWMA 3C60D 3H9SB 3KPLA 3MOAH 1HKFA 1JRHH 5E9DD 1YECL 5I9QC 4OLVH 4V1DD 3TIDA 5I1GL 1RZGA 3T2NH 3RWHA 4PTTA 3LEVL 4TNWF 3TN0D 4PGEB 3MRIB 3MA7B 3SGJA 5D70L 3JTTB 2PUQT 1ZE3C 3AREB 3D2UD 1VB9A 2NQCA 1T7VA 4OZHA 1YZZA 1V3LA 1NC4B 1DBBH 5FGBC 2FX8H 3WFCL 1MJ8L 12E8L 2O5XL 1T2QL 1RK1A 4NO0D 2VLRD 1WBXA 4XNYL 2HT2C 3FQRB 3TPKA 2ADJB 3SGKA 2BY2A 1MJUH 4AL8L 3FOLA 4JRXB 1BX2B 5BO1H 3QDGA 1EBPA 1G7IB 1YJDH 4Y4FA 5KVMC 1VGEH 3MO1A 4JFFD 5A40E 5T3ZH 4PRID 5DS8B 3A67L 4HX1B 3A6BL 2F58L 4NCC2 4D0DB 3GB7A 2ICCA 2IFFH 2R4RH 4XMPL 2ZUTA 1RJCA 5CHNB 2FGWH 4QRUB 5E99L 2GJ6A 3U4BH 2CKBH 5SWZB 1AH1A 3B6SB 2WZPD 4P9ML 4HPYH 5H35A 4Z7OE 3KWWB 1DLFH 2B5IB 5CJQH 4KPHH 1CFVH 4D9RE 2OXHA 3RWIA 3RI5K 2X9WA 5JZ7D 5J56B 4LGRB 4M6NH 1KBGL 3LZFL 3OX8B 3IDIA 4LQFL 5H2BB 1VFBB 2BHZA 43CAB 4JY4A 3QQ3B 1U36A 2PF6A 2A6KA 4YDIL 3HRZB 5MERB 4TVPE 1HHKA 1R3IL 3L3GA 3GSOA 5FYKU 5C0GA 4U1HB 4RGMC 5J1AA 1DVFD 2X1XR 1YYLH 1JPSL 2Q7YA 4Y4KB 2J6EA 1KN2L 4LBEB 1EIBA 4PJ7A 4MD4B 1RUPH 3GSXB 4K71C 4BFIB 3QHFL 1JPTH 5SWSA 4LLDB 3I84A 4TRPL 5GSRB 3S4SG 3G5ZA 5GRUL 1CZ8H 3PABB 4MZ2A 5LXGH 5B4MD 5CLTA 5ACZB 4NQXB 1KB9K 4OGYL 1YEFL 4NRZB 5CSGA 2QBWA 4TNWK 4TTDD 1XT5A 2OL3L 4RQQB 2ZP0T 3V52H 1G7PA 2XYCA 4WW2B 4HT1L 4JREC 3E6FB 3G6DL 5IB1A 1DEEB 1K4CA 3NZHL 4JY6B 4P57A 1KELL 1IAMA 5D7IB 5IVXB 5IOPA 4X6BB 1M71B 2Z91A 2IQAB 3JV6A 2VERN 1KOAA 4QRQA 1RUQL 1LO2H 2VH5L 4JN1H 3ROLB 2KDGA 2R8SL 1YMHB 3OR7B 4MWFB 3VXRD 4RGND 3ECBA 4AG4H 1NAKL 1RUML 3QH3B 4IEFB 2EO1A 1MWAB 2XACC 4QHNB 4PR5A 1ZV5A 3TZVC 4L4TA 2AJYL 2HT4C 3DX9B 4MQXD 4OUOA 2VITA 2XWBA 5DI8A 3PV7A 3D3VB 3FFDA 4HEME 3R8BB 3BKCH 2EO9A 5E70A 3LKSA 3DMMC 1GHFL 5I18H 1LP9F 4Q2ZA 1DUZB 1FGVL 2E5EA 1IAIH 1IBGL 3O6LH 4ZUWB 4HK3N 1JFQH 3SDDD 3UBXI 3HUJA 5DZNA 2XA3A 1DANU 1XGRA 4NO2A 1JGUL 2B4CL 2ARJB 1AGCB 4X7EC 3RX8A 1KFAH 3ZHDA 1B9ZA 5EUOB 4WFHD 1Q9KA 5D6CA 4ODSL 2Q8AH 4RX4A 3THML 1MCWW 4X6CF 3BHBB 3BPNB 5E56A 3GHBL 1LHZA 5E5MA 2WQRA 2ADGB 1FC2D 4DFIA 4Y5XB 1U8IB 2DQFA 5F9OH 5KW9H 1BEYL 3MLXH 5LCVL 3ULVC 5DDHA 3KPLB 2NY0D 3WE6A 3C09C 3HMWL 5C0JA 3TIDB 1SM3H 4P3CH 5DVKA 1RZGB 1PJ9A 5EULV 4ZFGH 3I50L 3RWHB 4NWUL 2W91A 1NBZA 4A6YL 1JZ2A 5LAXA 3NIGE 3FFCE 2DJ4A 4M5YH 1TETH 3Q5TA 4B5EA 4OZHB 3GHEH 4RRPA 5FGSA 4X8JA 3L95A 4Z7QF 4J4PD 3QHTC 2DWDA 4FQ1H 1N5AA 5FYJH 3OAUL 3B2VL 3W2DL 4C4KO 5JMRA 4FZ8H 1WBXB 4HIHA 2FB4L 3EYOB 3UTSD 3RWFA 5KVEH 4PJ8A 3FOLB 2B1HL 5IHZA 3QDGB 4OTXL 4KRMB 4UIMA 4Y4FB 2VLKD 2VDKL 2F15A 3MO1B 2WIIB 1HHGA 1S7XA 2BXZA 3PIQA 5EFIB 1D5XA 2PYEE 4MX7A 1RPQA 4X5LA 1E6OL 4ZO8A 5J06A 4JJHA 3SOBL 1NL0H 3RTQA 3FCTB 3REWA 2GJ6B 4KQ3H 5TFSL 4PJFE 3IT8D 1UADC 2LABA 3PHOB 1G9NC 3GI8H 4MS8D 2Y4SA 3TEUA 1P69B 1UA6H 4LPTA 4P46D 1C7SA 1QSED 3WJLA 4I0CC 3GI9H 4U0RB 3IDIB 3TFKD 3CMOH 1ACYL 2GEEA 4OCMC 4JY4B 4NO3A 1TZGL 3U36A 2A6KB 4EUPG 5IJKC 3HC3H 3EYSH 1OCWH 1GGCL 4JFDD 1HHKB 1TCRB 4G43A 4NSKA 3L3GB 3GSOB 4N90D 1J5OL 2AQ2A 4WV1A 5C0GB 4NBXB 5J1AB 4C57C 4O5LH 4ZPVA 4XXDB 2Q7YB 1DCLA 2APBA 4KJYB 2VC2L 3CFCH 4PJ7B 4LSPL 4M61A 1EHXA 3T65A 1SJXA 5D6DA 2Z93A 1OLZA 1U3ZA 4HJ0D 4DGYL 5I30L 1IQDA 1N4XL 1PG7L 3QEHA 1IAIM 5SWSB 2OR8A 4PYHA 3V95A 3UYPA 4ODUA 1RUKL 4PLKD 3QB7C 5IHUH 2G60L 4FXGA 1QP1A 2HTLC 4M03A 5JDJA 1IKNA 1G7PB 4S1RH 3IAGC 3U4AA 3BZEA 5IB1B 4XAWH 5L88H 4P57B 2WP3T 3IJSA 1N7MH 1T7YA 5IOPB 4QGTA 3WKNA 1EK3A 5HYQA 2A1WL 4AEHL 3JV6B 6CGTA 1XF3A 3EO0A 4XI5C 3HI5H 4EOWH 4N8CH 2W59A 4QRQB 1HYSD 4U3CA 1QRNE 4Q6IC 4KJWC 4OZGF 3ECBB 4LPXA 2CIKA 2AK1H 3U7YL 3CC5A 4GW5B 3O8XA 1UENA 4QYOA 4IOFC 1AD0A 4H8WH 4I4WA 4PR5B 2E6QA 1NUDA 1KEMH 1MHHA 4L4TB 4UU9A 5CCKL 5I1CL 2P7TA 4S0TD 4GRLA 2VITB 2XWBB 4RFNB 5FOBA 3HCVB 5DI8B 4ZAKC 4DUXA 2AI0L 3K4AA 2Y5EA 3ZMRA 3FFDB 2UV3A 3L3IA 5JPNB 1GOFA 5FYKD 2CR3A 4G6FB 1KXQE 2XTJC 2WBJD 1FYTB 4TSBL 1V7NL 1V3MA 4HH9A 5I74C 5K9JL 5HDOA 4BSWA 1N6QL 2IMNA 3UAJD 5KVGL 3HUJB 4NZUH 5J11B 2XQYG 2QADD 2QJDA 2DQDL 5I1HH 1YQVH 2NTFA 1Q9KB 4P59H 1QFWH 4PJ9A 4HLJA 5D6CB 5DD3H 5DJ8A 1F4WH 4XPFH 4UOW1 4HK0A 5D2NE 5E5MB 3TO4D 3VXUD 5DURD 1AY1L 3QCUH 4WWKC 3MBXH 5FM8A 2EEDA 1FNHA 1HSBA 1PZUB 2DQFB 4OF8A 3N1FC 4K94H 1QFHA 5DDHB 3WE6B 2EDKA 2AQ3A 2XA8H 5C0JB 3BZFA 2RJMA 4OQTA 3WFHA 5IBLC 3RRQA 1NBZB 2CH8A 4NHUA 4BH7A 5LAXB 2Y6SD 1ZGLA 2WQ8A 5M7QA 2VL5A 4EXKA 3U30C 1CE1L 2GUOA 1H8OA 4LPUA 3WXVL 3CZJA 3SGEI 5ID0B 3B2UC 3FFCA 4LSQH 4X8JB 4XB8A 3T0DA 2B2XH 3FO1A 4IMKC 2DWDB 5A2FA 1X5HA 4PJAE 5I8OL 1N5AB 1UXSA 4YFDB 4ZS7H 3HC4H 1XR9A 4E42A 4HIHB 2CLZA 2PTVA 3NFPA 4XTRC 3RWFB 5DC9B 1EMTH 4PJ8B 3V4UH 5A2KH 1CGSH 3LS5L 2BVTA 4QTIL 4DEPB 4UIMB 3NPSB 4E5XA 1ADQH 1HHGB 4QT5A 1S7XB 3EZ8A 1D5XB 4ELMF 4WW1A 2X41A 3RNQA 1II4E 1BFVH 2A73A 1I9RH 1ZS8A 5D93C 4MD5A 2W92A 3RTQB 5HY9B 4OGXL 2PYEA 2ZG1A 1PW3A 2DL2A 4UDUA 2D0GA 1UWGH 1S7SA 4KKBC 4RDQG 3RIAK 1S9VA 5I8KL 3O4OB 5JXAL 4PJFA 3EIFA 1G9NL 3LDBC 2Q3AA 4MMXC 2X4SA 3G5XB 1UKTA 1CXFA 4NO3B 5E8OA 2BK8A 3IKKA 3UO1L 5M95B 5MEOA 1FNSH 4G43B 2J4WL 3Q6GH 3QUYA 4LNRA 4NSKB 4FQQB 3BH8A 4WV1B 1OQOA 2V17L 3P30L 3TIEA 5TE7H 4U1MB 4ZPVB 1D3CA 3V8OA 3NOIA 5EOQH 4M61B 3T65B 2Z93B 2E9JA 4YQXL 7FABH 1IQDB 3QUXC 1OSPH 5A2IH 3QEHB 1RZFL 3HNTH 1FCGA 3K74B 4KDWA 5CMAA 4I48A 1DL7L 4ODUB 5GGSA 1LNUA 1U8OA 4FTVD 1Q0XH 4ZFOL 1FAKT 5I76A 3OB0H 5TDOA 4FXGB 4YXLH 4BZ2H 4N9OB 1UM5H 5E1AA 3GMLB 1L4IA 5DWUH 1CGWA 1HI6A 1IC7L 3ZYZA 3IS0X 1P84J 4MMZC 3BZEB 5FUCE 1MCOL 3UTPD 4M6MH 1LD9A 3IJSB 2BNQB 4P5TB 1IKFH 3C5JA 2JJSC 4APQC 5DR5H 2EYTA 3OKNA 2AVGA 4X7SH 3C6LA 5L9DH 3SDAD 3BOVA 1XF3B 3EO0B 4MAYA 4Y7MA 1BQHG 4S1SH 1J05A 4MQSB 1GIGL 1TJIL 2P8PB 2LTQB 3BDBA 3QI9C 4C4KT 3CC5B 1MCSA 3LPWA 3O8XB 4QYOB 1QRNA 4KMTH 1AD0B 2BZDA 4PYGA 4GG6B 3TBVA 4I4WB 4XPAL 5HGDA 1MHHB 5HHOE 3LQAH 4UU9B 4FQJL 3RBGA 2P7TB 1ZLVH 3ELAT 4GRLB 1LEKA 2ICES 4KZEL 5FOBB 3AMLA 4M1CD 2H32A 2YXFA 1X9QA 4G9FD 3SGDH 4MXQC 3D48R 4NOBA 4N68A 5KSAD 3ZZ1A 2K3TA 4HH9B 2C7UA 2KKQA 2FATH 1JNHA 1KACB 3ZKXC 5IMLA 5KZCD 2AJ3B 3VFNA 1I7UA 3IFPB 5F3HA 3DO7A 4OZIF 3S3JA 1M7DA 3BGFB 5DUMH 4ODXB 4WGVB 5DD6A 1HSAA 4TUJA 2NTFB 2PW1A 4JG0H 4YK4B 3V8CA 2IALA 5DJ8B 4PJ9B 3V4VL 4MVBC 4OLZL 5ENWA 5GS3A 5IMMA 2E6PA 1J86A 1CS6A 2FD6H 3LIZH 1NFKA 4HCRA 2BOBA 4HK0B 1K2DA 1CK0H 1KIQA 2QQKL 2NR6D 3KR3H 1HSBB 1DBAH 1T5WA 4RIRA 4HUNB 5D2NA 1MCBA 2AK4E 3IDUA 3KJ4B 3BZFB 4FQCH 2H45A 1D5IL 1DLHA 3T0ED 3WFHB 3M07A 3MRGB 4BH7B 1FVDB 1OGTA 5HDQL 4H1LG 2Q7NA 2R0KH 3WNLA 2VL5B 1FVEA 5KJRL 5DVNA 5K59F 2XZAH 2F9BT 4R2GC 3FFCB 2AEPL 4FFYH 4F7MA 2PTTA 3FO1B 2LVCA 5F7FA 4I77L 1UXSB 3KPRE 1XR9B 3RY5A 1GC1C 4E42B 1K4DB 5FYLD 4P2CG 4ELKB 2D9QB 2CLZB 3NFPB 2UWEE 4WTWA 4PJAA 1TJGH 4FFVC 3KVQA 3J8F7 5F71A 1Z3GH 4LLUA 1B4JL 1EA9C 4E5XB 1LE9A 1S9YA 4QT5B 5H8DA 3FMGH 4WW1B 2CMRL 2DQJH 3DYPA 1Q94A 3RNQB 1ZEAH 1KT2B 1EVTC 3U7WH 1KTLA 5F6IB 2JIXA 1A14L 1YMMD 4UDUB 3F7VA 1RULL 1S7SB 1L9MA 1S9VB 1OAXH 5FF6A 3QXDA 4LSUL 1JI2A 3RVXD 3P0GB 4RMTA 1G0DA 3EYFA 4NO5A 4PJFB 5E2VL 3FOMA 3WO4B 5IBTH 3MTRA 2VDRL 1T20A 2C3XA 3B5HA 2X4SB 1CLCA 1OP5K 4XRCA 5DRXA 3TT3L 4GRWE 4BQ9A 1EERB 3EYUH 2XZZA 5D5MF 4X6DF 4JKLA 5E8OB 3V0WL 4JFHE 3U46A 2FO1A 2IPUK 1GSMA 5MEOB 3CNKA 3QUYB 4LNRB 2ZCHL 3BH8B 1WF5A 4U1NB 4BQBA 4HKJA 2CRMA 3TIEB 2QEJA 2PXYC 3FRUA 1JNLH 1YEJH 3K1DA 1JGLL 1OSZA 4OLWL 2J5LB 1MAKA 1H3GA 5EORL 2L7JA 1R0AH 4FN0A 3RUGF 1N0XH 3GNML 1J88A 5CMAB 4I48B 3X3FL 3NIDE 1LNUB 1U8OB 2R2CA 1A6WL 3MLVH 2X05A 4Q0XL 5TDOB 1XCQA 1QSFD 4KHXH 5E1AB 2YK1H 3T0BA 4TQEH 5D7JC 4I3RL 1IGTA 5JOFA 4EN3D 1WQVT 3DHJA 4MD0A 2FCBA 3WEXA 2JKXA 1QFUH 4WUKL 1OF2A 4KUCF 1LD9B 1Z2KA 4HMDA 3MRQB 5DJ2B 3TVMB 5J1SC 3WN5B 1EJOL 3EHBD 2H6PA 2EYTB 2FEEI 3OKNB 3C6LB 4J3OC 1WIUA 1W0VA 5DMIH 4L1DA 4MAYB 5DJ6B 1CR9L 3O4LD 1J05B 2NXYD 5EC2B 2Q8BL 3HG1D 5C2BL 1NGXA 4I1NB 1UB6A 5DXWA 4DVRH 1G6RA 5BV7C 4NQDB 3GSNA 4CJ1A 1NGQH 1IQWH 4NM8L 4Z5RB 4M48L 3TBVB 4MQTB 3P73A 4UT7H 4PJDE 5D2LE 1MQKL 1INDL 1LEKB 1AGEB 3O6FC 1F8TH 5DRZB 3QDME 1YEGH 4R3SA 5E7FA 4LGSB 5HHOA 3QZWA 5EU6E 3LQMA 3WNMA 3NN8A 4M62L 1LWRA 1N6VA 1E4JA 3VFSA 2C7UB 5IGXL 1JNHB 2Y72A 3C5SA 1CVSC 2CRIA 2P5EE 3IDYB 4F8TA 3VFNB 3RVUD 5DC0A 1XH3A 4PFEA 4H0GA 4FQXA 5F3HB 3DO7B 5A3IC 1QBBA 3VRIA 4WFFE 1LO3H 5DD6B 2QSCH 4CNIA 1HSAB 1YDPA 2PW1B 4TUJB 4JM2A 4IRSA 2R0ZH 3ULUD 2IALB 3BKJL 2DN7A 2ORBL 3U0PA 5E5RB 4FOMA 2PR4L 2BOBB 4FNLH 1K2DB 1MJJA 2PO6A 5BMFL 1KIQB 4O2FA 1Z9MA 3SJVD 3NFNA 1T5WB 3BGAA 4GAYA 4LCWE 4RIRB 3K7UA 5D2NB 1FDLH 3HZVA 1R6VA 5HHMD 4JO3L 3BO8A 3FB8B 1CYGA 1DE4A 1GGIL 3VXSE 15C8H 2W9EH 2YPVH 4KJPD 3MLTA 1DLHB 4GBXA 5DO2C 3E1F1 5HHXL 2AK4A 2NY3C 1OGTB 5D72H 4M9OA 5DT1H 4G6ML 1FVEB 4U7MA 1A1OA 1JF1A 4XZUA 3VWJA 2A0LC 3QDJD 2XNAA 2ZUUA 2BFVL 1ZVYA 3BQUC 1WAAE 2IQ9H 1FLRL 3EDDA 2VAJA 3ZKNC 4F7MB 2PTTB 3QXTA 3PP4H 1SYVA 1MIEL 3GSVA 2BDNH 5CIPA 1AGDA 2BXYA 4FQLL 1C8PA 2Y07L 3B9DA 2FJHA 3NFSH 5CBAA 1LDPL 4PJAB 5EWIL 4BFBD 1MRCH 3TJEL 3KPRA 1BGXL 4MDIA 5ITBH 1RZKH 1LE9B 1FNGA 1S9YB 2UWEA 5L7XL 4L8DA 4P23D 4K3EL 5DGQA 1CIDA 1Q94B 5DMKA 1J1OH 3UTZA 1ZGLM 2D7TL 2Z31C 5DMYA 1KTLB 2JIXB 4RNRA 3F7VB 4WO4D 4R96A 3S36L 4CGTA 1HINH 3SE8H 2DWEA 1I7ZB 4J1UA 2QQNL 4NNPL 3QXDB 3IGAA 5FF6B 4HZAA 4UILL 4JKMA 1CGTA 3RVVD 2H32H 5E9DE 1FL5A 3AC0A 4V1DE 3EYFB 4NO5B 2OR9L 3FOMB 1O5DT 1T20B 5E2WL 1JHKL 2VAAA 4XRCB 2OK0L 5DRXB 1IZKA 4JQVA 3TO2A 2E7CA 4YFLF 1ZA3A 3ESVF 1FPTL 4N0FA 1RZ7L 3ZTNL 1HZHH 3U2SA 5I6XC 1CTNA 1TZHA 4J3WA 4HKJB 5F96L 4OCRL 3HE7B 3MV8D 4NDMB 5DK0A 5F97E 3FRUB 2MJWA 4PJCB 3I9GH 1OSZB 2VLRE 1KIPA 4JM4L 3KLDA 3FQWA 1YEEH 1MCKA 4U7KA 5F70A 4ONOA 5INDA 4L4JA 1X5JA 3SY0A 4UT9L 1S9XA 1KCLA 4R6UA 4YHOL 4JFFE 1A7RL 4BH8A 4PRIE 4HLZG 3W9EA 3U0TA 2E7LC 4NNXB 4PBXA 1P9MC 1MLBA 1XCQB 4FZEH 2W0LA 4XNMA 5B38A 5DRNA 3KYOB 1IGTB 2GK0A 5JOFB 2ARWA 2E7HA 4K8RC 4B7IA 4GSDL 3WEXB 5FECA 1OF2B 1YYML 4KVCL 3WSQH 3TT1L 1J7VR 2JELH 3TBYA 2V2XA 2C3VA 5DHVH 4FG6D 1QPPA 1BECA 2H6PB 4R4FL 3VG9B 2R4SL 2VZOA 5KSBB 1W0VB 2RBLA 5AAWA 2M8XA 1FO0A 3ZDYF 5C6TL 4R97B 5D1QA 3TP4A 3VWKA 2AABL 5ALCH 1NGXB 3WXWH 1UB6B 4DKDC 4C55A 4XNZC 1BF8A 1G6RB 3U48A 1N6UA 4PLOB 3GSNB 4KDTA 5CEXA 1W8OA 4P4RA 2ZSWA 5JQ6L 4POUB 2DQHL 3O11A 2DQTL 2NXZD 3QRFM 1CCZA 1JV5A 1SMOA 4D2NA 3CVHL 3BP5A 2H2PD 3CDYA 1P4BL 4PY8I 5DD0L 5J13B 4R3SB 3MFFA 4XP9H 1FAIL 4PJDA 5D2LA 3SQBA 5DVMA 3NN8B 3QFDA 4X0KA 3R4DA 5LBSL 2R0WL 4QEGA 3HZKA 3VFOA 4DTGH 3QDMA 1MRFH 3VFSB 4YDLB 3JV4B 3I6KA 5EU6A 3BESR 3C5ZA 2A74A 4Y2OA 3C5SB 2E9WA 1C5BL 5B21A 2WIMA 4U1SA 3WD5H 1QKZH 1XH3B 1HK6A 4F7CB 4FQXB 1OM3H 5DUPH 3VRIB 4MNHA 2BVYA 2P5EA 4CNIB 2GQHA 4U6VH 1KB5L 5KANG 1J1XH 1CXKA 4HFWA 4J8RA 4JGUA 3U0PB 3VMNA 2D7NA 5DZOA 4ODWA 3LY6A 4GUPA 4NKOA 3PNWA 1MJJB 3UPAA 4Y89A 4EQ2A 2PO6B 4A6YA 1QBAA 4O2FB 3NFNB 2ADIA 4GAYB 4K7FA 4D3CH 1T83A 3VXRE 4RGNE 3DOSA 5EOCH 3BO8B 4FXLA 1KEGH 1DE4B 3DXAD 3MLTB 4G7YH 4LCWA 4GBXB 1WZMA 2AK4B 3VXOB 3BDXA 1UVQA 4N0CC 1TDQA 4EI5D 3VXSA 2CUIA 2UVEA 4RMRA 1A1OB 1JF1B 4XZUB 5TQ2H 3VWJB 3RJDA 5JOEA 4F80A 4NGHL 3OTTA 1Q9OA 4YGAB 3DX6A 3MLWL 3I02A 4MB5A 5K33A 1SYVB 5EA0H 3GSVB 4HULB 5CIPB 2VDPL 1KTKE 1AGDB 4DGIL 5T3XL 1WAAA 2IAMC 2PNDA 3WIIL 2FJHB 5CBAB 5BOPA 3VI4E 5EIVA 3KPRB 3SKJL 8CGTA 4MDIB 1NUNB 4E41D 3QNXA 1IM3B 3B83A 1P7QD 4L8DB 4WFHE 3QRGL 3R1GH 5DMKB 2AEWA 3UTZB 2Z8SA 2HT4D 3P11L 3CU7A 4CN1A 1HKLL 4RNRB 4JHWH 5JW4Q 1C5DA 5DFWH 2RB8A 4DUVA 2DMKA 3ESUF 2DWEB 4RWYH 5AYQA 3VGDA 1RFDH 3IGAB 4YBQC 3N85H 4PB0L 3T3ME 4HIEB 1BM3L 2D7QA 1FL5B 3K2MC 3MLSL 1KN4H 1QLEH 3RGVD 3C60A 3V6OE 4WHYH 1EEYA 2VAAB 4N0UE 4GW4A 5E9DA 4V1DA 4M02A 3TO2B 1BZ9A 2FJFA 3EO9L 3T0XA 1ZA3B 2IBZX 4Y4HC 4N0FB 3TN0A 4XCFL 5E2JA 1MFCH 4YXHL 3RZCD 3C6SA 4GRWB 4WU7A 3UROR 3U2SB 3D2UA 4R4NC 1TZHB 3K2UL 2BOCA 4PB9L 3LB6C 4LHUG 2E8YA 2DDQL 5DK0B 3DGCR 4C56D 2UYLA 1QEWA 1A9EB 1YECH 4GLRH 2C3WA 1KIPB 3FQWB 3VXTA 4CMHB 3UTSE 4WDIA 3LEVH 5INDB 3F7QA 1F97A 4M9PA 4YHYB 4NO0A 3SY0B 2VLRA 2NY2B 2VLKE 1V5JA 4NCDA 4LCUA 1B0GB 4BH8B 3GJFK 3W9EB 3U0TB 4JGJA 4XCCL 3NIFF 2CLVB 3ULVF 1AXSA 4JFFA 1MFBL 4ZFZA 4XNMB 5B38B 4PRIA 3RWEA 5DRNB 1MJ8H 1X5LA 1CLYL 2GK0B 2XOTA 12E8H 3GJEA 1C5CL 2WWKT 2O5XH 2X44D 1T2QH 5IF0A 5B3JE 3LCYA 5KOVC 3OWEA 1JGDA 4PD4K 3RNKA 4XNYH 5IB5B 1JZ7A 2V2XB 2C3VB 2LVEA 4W6WB 4AL8H 2HVJA 4L9DA 1QSEE 1QTYT 5A2JH 4I0PC 1FO0B 5K9QG 1ZANL 4L8SA 1CDBA 3A67H 3A6BH 4HGKC 1T04A 2F58H 1YY8A 2ENSA 4XNQA 5IV2A 2HJKA 4XMPH 3MV11 4JFDE 1UWEL 3ARYA 3BIBX 4N90E 5E99H 5KSVA 5CEXB 4P4RB 2ZSWB 2EYSA 2W07A 1B88A 4NJAL 3O11B 3CJJA 4P9MH 4LFHG 4ZOEA 1GZQA 3BP5B 5CD5D 1DVFA 2QSTA 1KBGH 5F8RC 3LZFH 2VXUL 4ZD3H 4PJDB 4U1GC 5D2LB 3AXLB 4LQFH 3D18A 5MHSD 3QFDB 4X0KB 4LMQE 1MIML 3KLHC 3HZKB 3VFOB 3QDMB 4YDIH 1U93A 3I6KB 5EU7C 4K3HA 2OTWA 3C5ZB 2A74B 1R3IH 2HYMA 2N56A 3LKNA 3G6JF 4X4ME 4KY1L 4M8QA 5BS0B 3OPZL 1JPSH 4LLMA 1Z5LB 5KAQG 4MNHB 5SV3A 2P5EB 3ZE2E 1EAJA 1KN2H 2DKSA 4KRPC 4QF1A 1YEHL 5GS0C 1VCAA 1A7BA 4HFWB 4J8RB 1RI8A 4ODWB 3W82A 4GUPB 4NKOB 3PNWB 4TRPH 2BVQA 1MH5A 2FYYB 5GRUH 3I85A 3CK0L 3BEVA 1J8HD 4F9PC 5C0IA 5FA4A 1Y6KR 4OGYH 1BWWA 2ADIB 5F7HA 1YEFH 4QHUA 5J57B 4K7FB 5EO9A 2OL3H 4K3GA 2X09A 4LPCA 3VJ6A 4HT1H 2HTLD 4XPTL 3G6DH 3VXRA 1U8JA 1UVQB 3VGAB 3VXSB 1KELH 1ZGLP 2X1OA 5GSVA 4HJGA 3ARED 1Q9OB 3LKQA 2NLJB 4B0MM 5FYKE 3DX6B 3I02B 1RUQH 2VH5H 2R8SH 5F7EL 2LU7A 2KBGA 1NC4D 3X12A 2KQMA 1F02I 5EDXA 1NAKH 5FGCE 1RUMH 3ZDZE 3X11B 5GGTL 1HCVA 4KJWD 2ZNXA 4OLYL 3G08A 3QNXB 2AJYH 2BHYA 2IJ0C 3SDDA 2Q6WA 4OF0A 2XI9A 2ZUXA 1KENL 3PWPD 3QIUD 5T33H 1FL3B 3VXUE 1GHFH 1C5DB 3CFBA 4F9LC 1FGVH 1EX0A 1IBGH 4FMKA 2F53D 4XAKD 4RMSA 1JGUH 2B4CH 2CDGB 3C60B 3NA9L 1EEYB 3TH2T 4GW4B 5E9DB 5TF0A 3KPQA 2DLTA 3BJ91 4ODSH 2FJFB 1OTTD 1JBJA 3THMH 2EIZB 3V6OA 4LOUC 3STBA 3TN0B 4N0UA 3GHBH 1XF2A 3TCLB 3QUMA 2QKIA 3C6SB 2VWEE 3WNKA 3D2UB 1DANT 2Z8VC 2I9LA 3PDGA 1BEYH 3MMEA 4YO0A 5LCVH 4RBPH 4MJ4A 2OP4L 4OV6F 3IETA 4FXKA 5IROC 5DMGC 4J4PA 3I50H 4WDIB 3SO3B 3MV01 4A6YH 4NO0B 2VLRB 1N8ZA 4HPOL 4LCUB 3UTSA 3HFML 1UKSA 2O5YL 2YBRA 2VLKA 3CLFL 5BZWA 1AXSB 1F45A 3O2WL 2KQNA 4JFFB 4ZFZB 3SE9L 3PWVA 3EOAA 4PRIB 2Y36L 4X9BA 3GJEB 1N26A 3RNKB 3HR5A 4CMMA 2FB4H 3V4PL 2BRRL 5IP4A 2HVJB 2B1HH 1AXIB 4OTXH 3P9MB 2VDKH 3OJMB 2XY1A 4L8SB 1B3JA 2VKWA 4P46A 3IDMA 3V6ZA 1QSEA 2X4OA 4O51A 1T04B 1E6OH 2QQQA 1YY8B 4XNQB 5IV2B 3SOBH 2HJKB 2L4OA 4EVNA 4NRXA 4PJXF 2Y23A 1CDHA 5KSVB 1J87A 2EYSB 1BF2A 5IW3A 5TFSH 3ZLQC 2B5IC 4JFDA 1D9KC 3SKUD 3KNBA 1F00I 4OCLC 1JZ3A 4W6XB 1IARB 3VMOA 4MJID 3DJ9A 1DVFB 1W72A 1NFDE 5IWLC 3OKMA 4AENA 3D18B 4TTGA 4LVNB 1Y6MR 4QTHA 1TZGH 4FTVE 4L29A 1U93B 1GGCH 5JXED 1JUFA 2OTWB 3BP6A 4NN6B 2OCFD 2VLJD 1BBDL 3LKNB 1J5OH 1UC6A 3S35L 1Q0YL 4HWZB 4M8QB 3HE6D 1S7UA 4GRMA 3IYLW 4Y4KC 3IFLL 4XB7A 3HMXA 4LLMB 2NY4D 4OGAC 4J3SA 2VC2H 4X4MA 5DQDL 1ZLUK 3UTPE 4LSPH 5A2LH 5I30H 1N4XH 1PG7H 1T03L 3MXWL 3AMKA 5GS0L 2BVQB 3G5VA 3J7HA 4KU1A 3BEVB 4YUEL 3QUXD 1RUKH 5C0IB 5FA4B 3ROOA 5F7LB 2CPCA 2OJZL 1I7RA 4QHUB 2C3HA 2G60H 5EO9B 3VJ6B 3LQZA 4LARL 4XMKH 2FECI 3T3PF 1AD9A 4B7LA 3QUKA 3VXRB 4RGNB 1U8JB 4UV7L 1X4YA 3OAZK 2R1WA 5HJ3A 5GSVB 1TTFA 4G3YL 1OOAA 1AQKL 2A1WH 3ZKMC 3VXMD 3DPBA 4G9FE 4HMEA 5BVJA 2A83A 1AGFA 3X12B 1NCBL 1XGYL 1ZVSA 2CGRH 3U7YH 4JHZA 2WBJA 4I3SL 2X4NA 3S9DB 2HFGL 1ZT1A 5HVHB 3IS1X 1I1CA 3G08B 5CCKH 5I1CH 4M6OL 1I8MA 1RZ8A 2XZQL 1S5HA 3SDDB 2Q6WB 1XEDA 2HKHL 5IW6A 1JCKA 5DA0B 2F74A 2WANA 3VRJA 1JZ5A 3BVNB 5EU4A 1V7NH 3BI9X 1MVUA 3CFBB 5K9JH 1CG9A 3UCRA 1N6QH 1S7TA 5KVGH 5F9JA 3TO4A 5BJTA 3VXUA 1NAMA 1ETZB 1SEBA 2HP4A 5CJXC 3VCLA 2DQDH 4XBEL 1IMHC 2EYRA 3T0EE 2NY0B 3B3IA 4LL9A 1E4XI 1NGYA 3KPQB 2FL5A 4PJBE 4JZJB 3BPNC 4TUOA 3DETC 2YUWA 4N0UB 3S37X 1XF2B 1WZKA 2IBBA 3QUMB 2QKIB 4MVBD 3ALXA 2HN7A 2YA0A 1AY1H 2HTKD 2I9LB 2P1YA 3MMEB 4YO0B 4JO4L 3IETB 4FXKB 4J3UA 4Y1AD 5FYLE 3VDAA 4KHTL 1IGIH 3EJJX 4HEPG 3MROA 5FHAL 5JA8B 1RMFL 3MXVL 4LSSL 1N8ZB 3WDHA 1GGTA 2IC2A 3UTSB 4NKMB 4BSVA 2Q86A 1CE1H 2ZPKL 3WXVH 2ED8A 3T1FA 1AP2B 2X89D 4MA1C 2WBKA 3UYOD 1EGJL 2YBRB 2DOCA 2VLKB 4YHPA 5BZWB 1RJLA 3EJYC 3QCVH 5E0QA 1MNUL 3PWVB 4XPHH 4QRTA 2P43B 1YMME 5KVDH 4KKLD 4R2GD 5I8OH 4PGZA 1BJMA 2K1MA 1WC7B 3FQXA 1FJ1A 3HR5B 3D25B 4CMMB 2C4FU 5E8PA 4JANA 2DLHA 3LS5H 3CSPA 4RDQF 4Y4FC 2YKLL 4O9HL 5I8CA 1M1SA 1A6ZA 4P46B 3IDMB 3M8OL 5J12C 3RVWD 1QSEB 2X4OB 4O51B 3DV6A 1AHWC 4DK3A 4EVNB 1A1NA 4NRXB 3V5DA 4DKAA 4OGXH 1FN4A 3MZTA 4KTYA 5IVNA 5T5FL 2APTA 5D1XC 3T4YA 4RRPG 1FZJA 5I8KH 2XQYK 2VYRE 4JFDB 3KNBB 3LD8B 1J0KA 3O2DA 4HD9A 5JXAH 4Q74A 3FO9B 1W72B 1G9NH 4U0RC 3OKMB 2ZZUT 4AENB 1N5YH 4QTHB 1NFDA 4ZTPL 1G9EA 4L29B 1WLHA 1JUFB 3UO1H 1T1XB 2J4WH 2NY6D 4G6FD 1QSFE 4NM4L 1FYTD 4FQ2L 4FTVA 4Q9QL 1S7UB 3P30H 4GRMB 1NDGB 3LHPL 4I13B 2BX5A 4GMSL 3RIFK 2VL4A 3ARTA 1TXKA 3OKOA 5GGUA 3P77A 3RHWK 1CQYA 1TMCB 4YQXH 1PLGL 2PXYD 4R9HA 1L0YA 3S5LG 1JP5A 1RZFH 5J4MA 5CJBA 2DTSA 4LRNL 1DL7H 3HNVL 3C9NA 3TA3B 1DDHA 3OKEA 1A2YB 2MNUA 1I7RB 3FT4A 3L3DA 3O4LE 5DK2B 5DRWA 5F7DA 4TNVF 3HG1E 3VU2A 4YC2B 5LGHL 2Y1VA 3FTGB 3QG6A 3SDAA 3W11C 1DFBH 3NGBB 1IC7H 2W9DL 3LSOA 3LQZB 1BZ7A 4HXAL 4G8EA 1AD9B 2I25N 3QUKB 1MCOH 2FO4A 5D7JD 1G7JA 2D9CA 3EZJB 4OFDA 2J2ZA 2R1WB 1ZSDA 5HJ3B 2OJEB 4FQIL 2OZ4A 2J8OA 5DJYA 2DQEL 1OD9A 3ILQD 1QFWI 3U1SH 2R0LL 3L3JA 2HJLA 4N5EC 4JRWA 5BVJB 1GIGH 2A83B 1AGFB 5IJVB 1ZVSB 1XAUA 4J3TA 1BVLA 3WIHL 4G9FA 3MLUL 2XRAL 2VB5A 3IXAA 1WK0A 2WBJB 2X4NB 4R8WL 4MNQB 5KSAA 2O5ZL 4LSRL 4XPAH 3MJ7A 5FGCB 5B3NA 1MWAL 4FQJH 1RZ8B 4NKQB 4GG8A 4OV5A 2VDOL 1S5HB 3ULUE 3UPRA 4KZEH 1T7WA 2QADB 5GRXG 1EEUA 1JYNA 1CXEA 5IW6B 1QLFA 3BPOB 5EU4B 1C08A 1KCRH 1MVUB 4Y0GA 1DQDL 3HB3D 1CG9B 1U8HA 1C7TA 5EU5A 3JWDC 1S7TB 4NQTA 3TO4B 5F9JB 5BJTB 1NAMB 5DURB 1SEBB 5HHME 3VCLB 4JFZL 4GO6B 1IGFH 1RIUL 1KIRA 3B3IB 1NGYB 2FL5B 3F6LA 3NZ8A 2R2HB 3V4VH 4OLZH 3DUUA 3T0EA 4TUOB 5DA4A 4UINH 3EAKA 3QDJE 4AEEA 4OCNC 5CZKA 2HN7B 4PJBA 1U8KB 3HZYA 4D9LL 4J6RL 5E8NA 1YEIH 3TJHC 1PX3A 4AIOA 1CFTB 3VD3A 2X4QA 1D5IH 4LP5A 1QNZH 1H3PL 4NHCL 1CLOL 1Q8MA 5HDQH 5DO2D 3V7AG 5DQJA 4BSVB 5KJRH 3D5OF 2Q86B 2EE9A 3IB4A 4JPVL 4YHPB 4YLQT 1RJLB 4QRTB 2A0LD 2GY5A 4HC1A 2MSPA 4I77H 1KG0A 1NUFA 2XN9D 3FQXB 5AWNH 2EIBA 1FJ1B 3BAEL 4PRHD 5E8PB 5IK3A 2X1QA 1YMMA 4JANB 4BQCA 4C58B 2AEQL 4V2CB 3KDMA 4DEPC 1KUMA 4L8CA 3HRPA 5LQBL 3D85D 2HH0L 2APFA 2BNQD 2CMRH 4P5TD 1A6ZB 3DV6B 4U2ZA 3RTQC 3WLBA 3KYNA 3V5DB 1FN4B 1A14H 1CU4L 1RULH 3T4YB 3VD5A 3BKML 1RZJC 1C16A 4LSUH 3MV8E 3O4OC 5E6YA 4GQ9L 5HHPA 1K3ZA 5ESVA 7CGTA 5E2VH 2NY7L 4JO2L 2W0PA 3WJLC 3GIVA 1U8NA 5GJSL 3U9UB 1KLUA 2YUVA 3INUH 2YS4A 2EZ0C 8FABA 1VERA 3TT3H 1TPXC 3OJVC 1S7WA 1KB5A 4N9GA 1GVIA 4PGJA 4NFDA 3V0WH 4ESKA 5IEHA 4QXGH 2EDRA 1IAKA 4JB9H 5ICZA 2ZKHH 4PRPD 2NNAA 4WV1C 2ZCHH 4DGVL 4FTVB 1FG9C 3CDGA 3CXDL 5HHQA 4YFEA 3MRHA 1KSRA 1QSFA 4OLWH 5GGUB 1JGLH 3OKOB 3SE4A 3P77B 5D6DC 2XIDA 4AYFA 2J6EL 5EORH 5SX5H 5DJZA 4EN3A 4JDTH 1ACZA 3GNMH 4JRYD 3VFGH 3VG0L 3X3FH 1HNFA 3IU3A 4Y5VA 3C9NB 4HS8L 2DIBA 3EW3B 5JW5A 1DDHB 2HAZA 1WCQA 1A6WH 3FT4B 5DRWB 3L3DB 5F7DB 4K9EC 4Q0XH 4R26L 1VEPA 3SDAB 4P2RD 1X5FA 5JIHA 1IKNC 4RCAA 4NN5B 4I3RH 1YC8A 3O4LA 1FFOB 1BZ7B 3HG1A 1MY7A 1ZVHA 5C7XL 4G8EB 3SBWA 4WUKH 2FO4B 2DI8A 1ZK9A 1G7JB 1CFQA 2QHRL 1X5XA 4K8RD 1ZSDB 1WJ3A 5DJYB 3RPIA 1NBVL 1EJOH 1H15A 5ESQA 5CP3H 2HJLB 5GS1A 3QXUA 1CR9H 1U41A 2YHGA 5C07D 2Q8BH 5C2BH 3CSBA 3AM8C 2ITDB 1AJ7L 4XP4L 2MQ0A 5IG7A 1BVLB 1INQB 1YY9D 3IXAB 3O8XC 4LSTL 5KSAB 3TWCL 4NM8H 5AD0A 4M48H 3MJ7B 4M7LT 1TNNA 2EEBA 5KZCB 1MQKH 3K81A 1INDH 2IPTL 3GSUA 4PRNA 4OV5B 1WZLA 3UPRB 2XG5A 4MDJA 2P49B 1XZ0A 4RMUA 3P0VL 4WHCA 1BBJA 1QLFB 3Q1SL 3S88L 4M62H 1C08B 2DI9A 2NZ9C 3MLZL 5IGXH 2FEEL 1U8HB 5EU5B 4WFED 4X4YA 4F15B 1DSFL 3SJVA 1CIUA 1XR8A 2KH2B 3DXAE 1J0HA 1P5VA 1KIRB 4LPVA 4YK4C 4PJ9C 2A9MH 4WI9A 3IRZA 3BKJH 1OP3H 3NZ8B 3ARFC 4F7TA 1F42A 1QVOB 2ORBH 2D0HA 3DUUB 1XMWA 2PR4H 3T0EB 3VD9A 5FUOL 3QAZC 4PJBB 3U4EA 5BMFH 5EBWA 3KXFD 3EYQC 1FGNL 1IM9D 3HTLX 4TPRL 3QDJA 3L5JA 2J8UF 5D7LD 1MHPL 1B0WA 4JO3H 1MCEA 3HAEH 1GGIH 5FK9A 5C09D 2X4QB 1AIFA 5FEBA 1A9BB 4PUBH 4BK5A 2JCCE 2DQUL 5HHXH 1WFNA 1X6NA 3NCJL 4YR6A 4E41E 4K3JL 2GHWB 1KV3A 3UYRH 5DQJB 2E7MA 4JDZA 4AZ8A 3BXNA 2BFVH 5L8JB 2WSKA 3S96B 3STZA 5CWSA 4JG1L 2G9HA 1FLRH 4HW6A 4P23A 4KZDL 4K3DL 4PRAA 3JWOC 1MIEH 1WVZA 1KG0B 4OLXL 3PWLA 4HWBA 5F44A 4CVWA 4FQLH 5HYEA 2Y07H 1YMMB 1LDPH 4WO4A 5EWIH 4HUUA 3H9HA 3TJEH 4BQ8A 1BGXH 3KDMB 4U2YA 4DQOL 1K8DA 2QSVA 4BA8A 1T3FB 3BN9C 3TVMD 3P4LA 5L7XH 4K3EH 1T80A 2DQGL 5C6PB 2D7TH 5F6IC 2BVPB 4Z7UE 3WLBB 3KYNB 4OZFH 1QD0A 1R5WA 4KTEL 1T89C 3S36H 4C54A 5I1AA 5B39A 5EIIA 2QLVB 4NNPH 1P5UA 2QQNH 2GJZA 1C16B 4UILH 1T22B 4NQDD 4EEEA 4C56E 5HHPB 2P8LA 5ESVB 3LPFA 4CVXB 5C08D 4YBQD 2HMID 1RZJL 2OR9H 3GIVB 1U8NB 3MV8A 1KLUB 5E2WH 1JHKH 5K9OA 3KGRA 4BUGA 8FABB 4OCWL 4R7NA 4N9GB 5FM5O 1FPTH 3T2OA 5IEHB 1RZ7H 3ZTNH 1IAKB 5ICZB 2NNAB 5IUSA 2DJSA 5FM5M 3CDGB 2DJUA 4OCRH 5HHQB 2MTPA 4R4ND 1QSFB 2J5LC 1RSFA 5F6HJ 2MPAL 4JM4H 4TVPL 1SMAA 1PY4A 1J12A 4IRZH 2GT9B 2UUDH 5DJZB 1B6UA 5CJOL 4EIZC 3RVTD 1RHFA 1A6AA 5L8LB 4UT9H 4Y5VB 4YHOH 4PTUA 5JW5B 3MJ6A 2P46B 5JDSA 1A7RH 4NUJB 1EBAA 4OFPA 3QWQB 1LO4L 3N1QC 3C08L 1VFAA 5F7NC 4MA3B 3VI3E 4K9EL 3O4LB 1IC5H 2ID5A 1P84K 4JO1L 4Y88A 3F7PC 4GSDH 3ZKSD 4F37F 1YYMH 4KVCH 3TT1H 4L8BA 4PJEE 3RPIB 4D0BA 1UKQA 1H15B 2F54D 2WUCL 3C6LC 3EYVA 5ESQB 1RIHH 2R4SH 4MAYC 5GS1B 1AO7D 5C6TH 5MHSE 2AABH 2COQA 3RKDC 5IG7B 4N8VG 4MJ6A 1WTLA 4WTZA 2CIIB 3DBXB 4ODBD 5AD0B 2DLIA 4POYA 1QYGL 5JQ6H 2A6DB 2DQHH 2GITA 2DQTH 4QY8B 4OFVA 1KJMA 1QQDA 2LQRA 3GSUB 4PRNB 2EC8A 1WBZA 3CVHH 4NZDA 3ZDXF 4MDJB 1XZ0B 1P4BH 5DD0H 1TITA 5DJAA 1UACL 4P5MA 1GCFA 3VFVA 1BBJB 1I8KA 1UWXK 4Z7VE 1P53A 2AXHA 3AAZA 1FQ9C 3VH8A 2CSPA 5LBSH 2R0WH 1J8HE 5ALBL 2AGJL 3U83A 3GJFA 2DAVA 1SJHA 3T0WA 5J7CC 5LWYL 3KLHD 5GIRA 3OAYK 3F8UB 1C5BH 4LNVA 4X4YB 3CZFB 4EDXB 1UEYA 3SJVB 1XR8B 1NANH 1PG7W 2XTLA 4H1LH 1KB5H 3MREA 4R0LA 4X6EA 5FHBL 4UOJA 4ALAL 3DXAA 3B8YA 4Z0BL 4OD3L 1IGJA 1TZIA 3H0TA 4KRPD 3OKKA 3UJIL 4EI5A 4HMCA 3U4EB 4WEBL 1ZXQA 3S3SA 5EBWB 4DAGL 1MELA 2CO7B 4DN3L 1FE8L 5D2NC 3QDJB 4Y2DC 3OZ9L 3QZWG 4WHYG 3BUYA 4KK6C 5FK9B 3LVEA 3FB7A 1JWSA 5JR1L 3I2CL 1AIFB 2VXSH 3DURA 1CXIA 3QSKB 3HE7D 2VIRA 3MUY1 4YR6B 4OF7A 1A7PL 1E4KA 5CZXC 2I60L 5ICYA 3RDTD 4BUHA 4JRXE 3LH2L 4XBPA 5F9WC 2JCCA 1BFSA 3CFKA 3BXNB 4JDZB 4Q9BA 1HHHA 4GKSA 1EEQA 4NGHH 1F4YL 1I3GL 4JHBA 4E41A 3STZB 5CWSB 2R23A 2G9HB 3PWPE 4P23B 3MLWH 1SVZA 1RV6X 1SJVA 1BVKA 4PRAB 5F1NA 3TM6A 3MRFA 3UMTA 3PWLB 1LO5A 2ZJSL 5IB4A 4KRNA 2VDPH 2VXQL 1UM4L 4DGIH 5T3XH 2VMFA 1UH2A 3WIIH 3ES6B 2F53E 2OTUA 3QYCA 4WO4B 4HUUB 3L7FB 4XAKE 3SDYL 3H9HB 3SKJH 1K8DB 1IGCL 2D2OA 1A8JH 4QXTA 3BW9B 3QRGH 3X3GL 3SQOL 1WEJL 4U1IA 3PP3K 2XKNB 4L3ED 3RGVA 5BVPL 3H7LA 3P11H 2ED9A 1HKLH 1R5WB 1HQRA 1LQSR 4LHUD 1CE6A 1NCUA 5I1AB 5EIIB 5B39B 2WBWB 4Z7UA 4LAQL 1BJ1H 2GJZB 1WITA 1L0QA 2HG5B 3IAPA 5DJXA 3RZCA 2EDEA 2EKJA 4PB0H 1BM3H 1T7XA 2P8LB 1CLZL 3MLSH 2DS4A 1BQSA 3MV8B 5K9OB 4C56A 2E9IA 4R7NB 4NRYA 1I1AC 2FDBP 4KXZH 3EO9H 4NJ9L 1LVEA 2K7QA 3DI2B 5AUMA 4XCFH 1KYOK 4YXHH 5J89A 3HI6L 1ROWA 3S7GA 2VR5A 3T4AB 5KS9E 3Q48A 4HS6A 3LRSA 3HR6A 4AQ1B 3I6LD 2DDQH 4BQ6A 1NCDL 1QFPA 1PAMA 4ODVL 2YMXL 1CBVL 4DK6A 3CXHJ 4ZO7A 4LLVA 4NZRL 4PG2C 2QR0A 4CW1A 1A6AB 1S7QA 3NMEA 4M93C 2Z9TA 4ERSL 1Y6NR 4PTUB 3CSGA 5D7IE 1Z0NA 2A38A 2HT3C 5IVXE 1ED3A 1MFBH 5I71C 1VFAB 4PJIE 4KAQH 5E4EC 3VDBA 2EDQA 3ARZA 1CLYH 4LFHD 3KG5A 2GAZA 2EXWD 2AQ1A 1AGBB 5EZIL 3CX2A 4L8BB 4POZC 4XVUC 5EOTA 4D0BB 5FUCC 2J7LA 3QQ9C 3IFOA 3EYVB 4YHML 2FHCA 2NXZB 2VZ3A 3PE9A 4PJEA 3ZTJH 1ZANH 4R97C 4W70A 2VQTA 3MBEC 1DQMH 4W81A 3S4SA 5FIEA 1AI1L 4MJ6B 2J8HA 1UWEH 1JZ4A 3PF2A 2NTSP 3O45A 1PSKL 2VZTA 4NJAH 2GITB 4LGPB 3MV7D 1KJMB 1QQDB 4YHZL 5I1JL 2FR4A 3QXWA 1WBZB 5IJKA 5JW4N 1X4XA 1W2KT 1D9KD 5DJAB 3CDFA 4DFHA 3VFVB 1I8KB 1ONQA 3AAZB 5KAQF 4MXVE 4RGMB 2M1KA 1MIMH 3VH8B 3VGBA 5D7SL 1A47A 2BSED 4MXWL 5D8JL 3GJFB 1SJHB 3GSQA 4Z7VA 1EZVY 5GIRB 2CUHA 2CXKA 1J8HA 4FQXC 5JA9A 3OPZH 4Z8FH 2B0SL 4JM2C 4IRSC 3MNZA 1JNJA 3MREB 3O6KL 4R0LB 4X6EB 4XHQA 2VZUA 5JOPD 1VEOA 3DXAB 4OGAD 4M43L 1MJ7L 1IGJB 1TZIB 3FN3A 3H0TB 4OKVA 5JW3L 3OKKB 3GK8L 5DD1L 5CJ8A 1Z9OA 3GUTA 3CK0H 4EI5B 3AS0A 3VXME 4HCRL 4JREB 1TLKA 4I5BB 4GKOA 3ZT6A 3AREA 1I3VA 5J3HC 3FB7B 1JWSB 3DURB 5HYJB 5DD5H 4WUUA 5EG6C 4XPTH 2FWOA 1NC4A 1IEBA 4YDKL 5ICYB 4XBPB 3MJ9A 2JCCB 3CFKB 1HHHB 4GKSB 1NBYA 4E41B 2CKNA 2R23B 3TGXA 1BX2A 4JFED 1BVKB 3RWCA 5F1NB 3FRPA 3ZE0F 5F7EH 3WUWB 1FORH 1LO5B 1CGXA 5IB4B 1NMCC 5A16A 3CD4A 4G8FA 3PWPA 4EQ3A 3QIUA 5GGTH 2OTUB 2I5YL 1QR1A 2ILLA 1TVHB 3P40A 4D0DA 4OLYH 3DWTA 1IGYA 1UWXH 5CHNA 2F53A 4QRUA 4QXTB 4KGLA 4E0RA 2R1XB 3B6SA 3RGVB 4OF5A 5ESAA 4XVJL 2VR4A 1HQRB 4KI5E 4UUJA 1CE6B 4Z7UB 5HHVL 1I4FA 3BZDA 5DJXB 3RZCB 5LJYH 1KJ3L 4Y1AE 4X4ZA 1FBIL 3HRZA 4NIKB 3NA9H 4G6KH 1FIGL 4K7PX 4C56B 2AXJA 4WWKA 3X13B 4JQVC 5ETUA 4HLZH 1UEMA 4NRYB 2KZ1B 1CXHA 1HDMA 3MOAL 3GFUA 4YX2H 4WEMB 1QSVA 5AUMB 4NZJA 2NY1C 4LBEA 4GXUM 1G1YA 3EDJA 1SHMA 4HS6B 3DETD 3LRSB 5I16A 4NZTL 1L6XA 2I07A 2OP4H 5EUOF 1NGZA 2J1KA 3FN9A 4KFZC 4CMHC 5KS9A 3JUYA 4FABL 5TE6L 3FZUC 5HDBF 4LLVB 5BS0D 2QR0B 4CW1B 1S7QB 4Y5YC 1MCFA 1WIPA 4RQQA 4IMKA 3ULSA 5C9KA 1JGVL 4ZXBC 3TH3T 3HFMH 2O5YH 4WW2A 1GAFL 1CN4A 1ED3B 2H2SC 4Q97A 4NQEB 5MEND 1MJUL 1DUYA 3CLFH 3U79A 3QT2A 3O2WH 3SE9H 5D7IA 2GI7A 1U91A 2Y36H 3R8QA 4EUPA 5IVXA 2GAZB 4AT6A 4WU5A 3ARGC 3D69A 1GRWA 4KQ4L 4PJIA 2MCPL 3V4PH 5EOTB 3ALWA 3TLRA 2EXYC 4P99A 3IFOB 3C8KA 5GS2H 4OZHF 5C0DA 4ZG1A 4PJEB 1X6LA 5D1QC 3MOBL 3QH3A 4KK9C 2G2RA 5GGVY 3VWKC 4B53A 5BXFA 1QRKA 4MJIA 3LKOA 1WT5C 5CJQL 3S4SB 1CFVL 2ENYA 4AM0A 1HN1A 3CLEL 4KDTC 3O45B 3BDYH 1ZTXH 1UT9A 1FYTE 1Z6JT 4IDLA 5LG1A 1G6RL 4NQCB 5JXEA 1AR1C 3GSNL 2VLJA 5DFVD 2FR4B 3MRNB 1WISA 1QBLL 5D1XD 4KV5F 5E5UB 3HE6A 2MCG1 4HIIA 1W0WA 1DUZA 1OVZA 2B4CC 2CQVA 1ONQB 3FQUA 4LIQL 1K9TA 3B8SA 3MUZ1 1A6VL 5ACLA 4ZQKA 3QDHA 3D9AL 3LN9A 3C5ZC 3GSQB 4X98A 1BBDH 4M7JL 1J8HB 2VUOA 3QUXA 3S35H 1Q0YH 1CDGA 4W4OC 3IFLH 4KTDL 3MNZB 5DQDH 1FH5L 2J88L 4QOKD 4UZGA 4PJ5B 4Y5XA 1P1ZB 3O9WC 3T0VA 3VGGA 1T03H 4OKVB 3MXWH 5GS0H 4NPYA 5JPMA 5DJDA 3GUTB 4F7PA 1T1ZA 2OJZH 1FIEA 1VENA 5FCUL 1T83C 3UTQA 2GCYA 1QHPA 2WK2A 2VTFA 1NSNL 3VXMA 1Y0LA 2JJSA 3PQYB 4HQQL 3MLPA 4PJ7F 2EDTA 4LARH 2Q3ZA 1RJZA 1H0DA 4WUUB 3W11D 2FWOB 4YBHA 3VGAC 4UV7H 1LO2L 1IEBB 5I0ZA 4U1KB 4OI9A 4HBCH 4G3YH 2E3VA 2HA1A 1AQKH 3GDBA 1NBYB 3OHXA 3JV0A 2YR3A 3VD7A 3EYOA 5IFAH 4G80A 5C0RL 1QBML 3ARSA 3EOBA 3L6FA 3RWCB 4F8QA 5JLZA 2X10A 1U0QA 1NCBH 1XGYH 4IBLT 5A16B 3Q5OA 2WIIA 4YXKL 4G8FB 4P4KD 3PWPB 5EFIA 4ZAKB 3NBNA 1NEZG 1EXUA 3QIUB 4I3SH 1QR1B 3HPLA 2HFGH 4HG4J 5DLML 1IGYB 3FCTA 3L3HA 4M6OH 1BVZA 2XZQH 2F53B 3WUZA 5HI4D 4E0RB 2FECL 3ARBD 3H3PH 3PHOA 2V6HA 2HKHH 5ESAB 3RA7L 1EZVX 3F5WA 3LRHA 3MQIA 1NKOA 4UUJB 2HWZL 3V0VB 3JXAA 4OCXL 3X14B 4MHHI 1WZ1L 1DBJL 4MLIA 1I4FB 3MRPA 4B50A 4PP1D 3DIFA 1UZ6F 1R5VA 2Z8WC 5KN5B 1U42A 1XIWD 3C60C 4XBEH 1SBBA 3WO3B 5HVWA 2VDML 4Q58C 1TCRA 4MQ7A 4WWKB 4I9WE 5ETUB 4Y1AA 4K2UL 1T5XB 3DTXB 2Z4QA 1HDMB 4E9LA 4XXDA 3TN0C 1SM3L 4OI8A 4KJYA 2I24N 4XNXL 4WJ5B 2GSGB 3HA0A 4P2OD 4GS7B 3HUJF 3SKMA 5I16B 3SKOA 3LPGA 3FJTA 3RL1A 2I07B 2X89A 5JHDB 2VN4A 4L3AA 4KJQD 2XN9E 1NGZB 5KS9B 1TIUA 4PRHE 5D1ZD 1EFXD 4KHTH 3SO3C 1EEZA 5FHAH 1PEWA 2B1AL 1U3HC 5F1IA 4LSSH 3ULSB 1A7QL 3VRLE 2BNQE 4FZ8L 2ZPKH 4WHDA 2IGFL 1EGJH 1DUYB 5KVEL 4DCQB 2P5WD 1MNUH 1MCCA 1E4XL 1NCWL 1U91B 5MI0C 4EUPB 5J0BA 2A77L 4C83A 4W68A 2R9HD 4AT6B 4WU5B 5BW7C 3ET9F 4GH7B 2OS7A 3D69B 4M7KL 4PJIB 3UPCA 1EV2E 4XP1L 2YRLA 1C1EL 4JFOA 3BPCB 4GG6E 1L7IL 3C8KB 3G9AB 4LCYA 3L5HA 1HE7A 4OLUL 5C0DB 4L8SC 2JB5L 4WI7A 4O9HH 2W9LA 2G2RB 4GW5A 5CGTA 5BXFB 4TN9A 5JZ7C 4MJIB 3LKOB 3M8OH 1FO0L 4O00A 1UA6L 3LS4L 5TQ0H 4AM0B 1M05A 2C4FT 3QPXL 1AR2A 2EKSA 4PRPE 1OAQL 2WLYA 3GI9L 3HCVA 4ZFFA 2LE9A 4YIQB 5T5FH 4R7DB 4XWOD 5F9AC 3SGEH 5JPNA 1X44A 2VLJB 3QFJB 4QNPE 1VADA 1FYTA 3QBTB 4PIRF 1Q9WA 3HE6B 4HIIB 1W0WB 2NY4B 35C8L 1XF1A 3FQUB 4JRYE 2AV7A 3H3BC 4XP5L 3RY4A 4ZQKB 4ZTPH 2PXYA 2EZ0D 4X8XA 4X98B 3V0AC 4NM4H 1U3JA 4FQ2H 3QUXB 4P2RE 5IMKA 4Q9QH 3L1OL 3LHPH 5F88B 4TTDC 4GMSH 4UTBL 3L5IA 4M1GL 3ZYOA 3N0PB 3FHQA 5GISL 6FABL 5GGVL 4QHKJ 1PLGH 3H42L 4NPYB 3K46A 4LRNH 5D7JA 5JPMB 5DJDB 4JQIL 4F7PB 3GEWB 1T1ZB 1ZMYA 5C07E 5LGHH 2GCYB 3UTQB 3MUJA 3VXMB 1CICD 1AXTL 1Y0LB 4LPWA 3GSRA 2W9DH 3GIZH 4HXAH 1RJZB 1H0DB 3JSSA 5ID0A 4RGNC 4FQIH 2V9RA 4PG9A 1LMKA 3OB0K 2I26N 3IVKB 4ZNCD 2R0LH 3OHXB 4MQXC 1KPVB 4G80B 3L3OA 3EOBB 4WEUD 4EDWL 4LEXL 3L6FB 5LGKA 5JLZB 3PGCA 1OP9A 3LN5A 3WIHH 3HLAA 3MLUH 2XRAH 1EXUB 4WFEE 5CEYA 4ORGA 3PJSA 1J1PH 4R8WH 3HPLB 2O5ZH 4EJ1C 4LSRH 5HY9A 3MODL 2EH8L 3JTSA 1MWAH 3L3HB 1WCBA 3TYGL 2VDOH 3IJHA 2J8UE 1UYWL 3IFNL 2JJUA 2MHAA 4YZFE 2NYYD 3P9WB 3F5WB 4OIIL 1YEDA 3QQ4B 5C1MB 3KXFE 1YQVL 1XCTA 1HIML 1A4JB 5DD3L 1QFWL 4Z7NE 3MRPB 1ZLVK 3G5XA 2BY0A 3G5YA 4IHOA 4UQ2A 3NCBB 5EIQA 3DIFB 4KC3B 5D7LE 1R5VB 2YN3A 3RWGB 1EAPA 1U8MA 5C09E 3RX5A 4JFZH 5CJ5A 1XF4B 1D5MA 1FYHB 1RIUH 2SEBA 1X5ZA 3JUZA 3VGHA 4MCZB 4MQ7B 3BKYL 3D87B 2F8XC 4FQQA 4JE4B 4UNTA 4Y1AB 4XX1G 4X4XA 5J9PA 2E6JA 2Z4QB 3V6OC 4U1MA 2BSSA 4RAHA 3QIBD 3ARFD 4WVRA 1RURL 5F1KC 4D9LH 4J6RH 3SKMB 2NX5D 3MPCA 3SKOB 3RL1B 2FX7L 3MX0A 2W0KA 2EICA 4KKAC 1B6DA 4J4PC 1EHNA 4BSJA 2M2DA 1EEZB 4R2GB 1VDGA 5HGGS 4XHJC 4NHCH 4J3XA 1FSKC 3GBLA 1X5IA 4OZ4A 2XN9A 4IIQA 3GMLA 5F1IB 1CLOH 4PRHA 1MVFA 3HC4L 1BOGA 4PRDB 25C8L 3MACL 2CD0A 4JPVH 2P48B 3OGCA 3D85A 3TA3D 4ZOAA 2BNQA 4P5TA 1A5FL 4C83B 3O41A 2VLMD 3BAEH 4HZLA 2EDFA 2XT1B 3QWOA 4HFUL 1S78C 5I2IA 4NQDE 3CU1A 5C08E 2AEQH 4JFOB 4LCYB 3PGFH 2P8PA 5LQBH 4FQHA 3NIGF 1J9CT 2HH0H 1I9JL 1KJ2A 4P46C 1PY9A 4IRJD 1AQDA 4GG6A 3DX7A 2YD2A 3VFTA 3P4OB 1G7HA 3BN9D 3TFKC 1M05B 1CU4H 2EKSB 4CL7A 4ZFFB 3BX7C 2H26A 3LV3A 4KMLB 1SY6A 3BKMH 2DLGA 4LQ1A 3LD8C 2NY6B 1VADB 4PRPA 4GQ9H 4LLWA 3VGFA 4MNQD 4AEIL 3RJQB 1Q9WB 2NY7H 4JO2H 3KHOA 5I15H 5I73C 5GJSH 1UQSA 4JFPB 5I17B 2AJ3A 4F3FA 1HH6A 4L9LA 2AV7B 3IFPA 4EBQL 2PXYB 1BJ1J 4H0IA 2ICWJ 2X70A 4ODXA 1F2XK 4JRYA 3WFDH 4PLKC 3D0LA 4DGVH 2HLFD 3HNTL 5IMKB 4PJFF 3CXDH 5CINL 1X5GA 2AJVL 4Y16D 4X7DC 5AZ2L 1IFHL 4P2RA 5C0ND 2E7LA 2J6EH 1P9MA 1T4KB 4BZ2L 4YWGL 5D7JB 2APWA 2V2WA 3VG0H 2FIRT 4HS8H 2VOTA 5HPMB 1AO7E 3MRGA 4YC2C 5F1SA 3ZT5A 4CVZA 1FVDA 2E27L 4L5FL 4R26H 1ZLSL 2OSLB 5E6ID 5DR5L 3GSRB 4EZMA 2UZIL 1RUAL 5C07A 5C7XH 2VQ1A 1JHLL 4ZPTA 2QHRH 5L6YL 4PV9A 4PG9B 5K93A 1NBVH 1CGUA 4TOYL 1K4DA 5BV7B 3DHMA 4ELKA 4KMTL 4PJGE 3L3OB 5IBUG 4BKLB 3O6MH 3HAEG 1NQBA 3PGCB 2ADFL 3PDOA 1AJ7H 1G6VK 3LN5B 4XP4H 3HLAB 1PKQB 2XWTB 3KHQA 1NH6A 2PCPA 3PJSB 4LSTH 4ORGB 5CEYB 3RKDD 1NLDL 3U0WL 1P4IL 1KT2A 5HGBA 3JTSB 3UAJC 1WCBB 2IPTH 2QADC 3IJHB 2W38A 2MHAB 1OAUL 1UJ3C 2BC4A 3Q1SH 2IH3B 2XKSA 4X83A 3S88H 1YEDB 3GZKA 4X5XA 3BPOC 2J8UA 5F7WC 4Z0XA 1ZWIB 3BSZL 2B39A 2XV6B 5IB3B 3SDCD 1HILA 3I75A 3E2HC 1XCTB 1S3KL 2PW2A 5BOZG 3MLZH 5DFTA 4ZUSA 4IHOB 3G5YB 3TO4C 2BNUA 4UQ2B 1LGVA 3LIZL 4N1HB 1DSFH 3KXFA 1N64L 1EAPB 1U8MB 1IM9A 3JWDH 4LU5L 1D5MB 2SEBB 2IPUG 2YPLB 1F4HA 4UDTA 2RCSL 5CGMA 1IGML 5D7LA 4FFWD 4PJCE 4OZFG 5SWQA 4U1NA 4XH2A 4X4XB 5J9PB 5C09A 1GGYA 4PBVC 1YPZE 2BSSB 4OD2A 1CGYA 2Y6SC 4XVTL 5FUOH 3VDCA 1PVHA 3S97C 1FGNH 3QUML 4TPRH 4UBDD 2VWEC 1DQJA 1NMBL 5C6WH 1J0YA 1MHPH 2GTWB 4Y2DD 2DQUH 2XY2A 4OZ4B 2XN9B 4IIQB 3WCYA 3NCJH 1FNLA 3ILPB 4PRHB 4K3JH 2ESVD 4P5KB 1EHAA 4YPGA 1BOGB 2D7OA 2UY6A 3KPOA 1KTDA 5JTWA 1D6VL 2DLFL 3DLQR 3H9YA 4LVOC 5CZXD 3SDXE 3OGCB 5C71A 3D85B 5KSBE 4D8PA 4JG1H 3MRQA 5DJ2A 3TVMA 4K3DH 3WN5A 3G04A 1S8DB 4OLXH 3O41B 5C0FA 3VGEA 1N59A 3RKPA 4JN2B 5IQ7L 5DJ6A 4HZLB 3QWOB 2P24A 1ZEAL 4K23L 1OAKL 2ZSVA 4HAFA 4RFOL 5EC2A 5I2IB 1FFPA 1BLNB 4H0HB 2DKMA 4DQOH 5HYSA 4MYWB 4UAOB 1NKRA 4FQHB 4XPBL 1I3UA 3L7EA 4NQDA 1PFCA 1KJ2B 5EO0B 2GKIA 2DQGH 5ELIA 5C08A 1GZPA 1AQDB 4Z5RA 3DX7B 3VFTB 5CGYC 1G7HB 4LIQE 1B4RA 4WTXA 3NCYP 4YAQA 4Q9RH 1BZQK 1AGEA 2HRPL 4KTEH 4LF3A 5HYIA 2NW3A 4PJAF 5DRZA 2H26B 2VNCA 3LV3B 1JWUA 4BJLA 3I6LE 4QXUL 5DEGA 1O7VA 4PRPB 5GRVK 4LLWB 2Y25A 3BD4A 5TGBB 1RZJH 1MSPA 2VO5A 4J23A 5ADOL 4P3DA 1UQSB 4F3FB 1W72L 1HH6B 4OCWH 3PHQA 4L9LB 1KCUL 3UJJL 4KMQA 3PXJA 5K9KA 4ONGL 4XP6L 2DB8A 2X70B 1I1AD 4JRYB 4M7ZB 3D0LB 4LRIA 3K1KC 4HS3A 3NCYS 3QCTL 4HXBL 5F1OB 4DUWA 3QUZD 3WV0A 1NGWA 4P2RB 1WICA 3HMXL 4JLRA 4TVPH 3RBSA 4TULL 4KHXL 5CJOH 1A6TA 5E7BA 2V2WB 3FB8A 1X5KA 1ZHLB 4L1HA 2F54A 4CVZB 5M94B 1LO4H 3SDAC 4LSDA 3C08H 1B0RA 3ZT7A 2HT3D 1AO7A 2PTUA 4K9EH 2XQBL 5C07B 4JO1H 2VQ1B 1D7FA 1GXEA 1BOYA 3B9VA 4RGOL 3B9KD 4ZPTB 5ITFA 3MV7E 4PV9B 3NCMA 2BCKA 4XNZB 1FZOA 1NEUA 4RAUA 2WUCH 1JJUA 2FIKA 5I75B 4XVUD 3L9RA 3QQNA 1ERNA 3MRLA 3GRWA 3OR6A 1BFOA 5JUEH 4M1CC 1FL6A 4GKNA 3PDOB 4J7RA 4PJGA 3UP1A 4MA8H 3MBED 1HH9B 5FA3A 1BQUA 5GHWL 2PCPB 5IIEA 3IU4L 5DJ0A 4NC1E 5FYKL 1QYGH 4X5WA 5HGBB 2V5SA 2VUYA 4O4YL 5JOPE 1NCCL 4B41A 4RWHA 1I7ZA 1UACH 4I8DA 4O58L 2BC4B 1ITBB 4KROD 1I8IB 5HI3D 1QSZA 2EDBA 4X5XB 2J8UB 4Z0XB 5ALBH 2AGJH 3TBSA 1HILB 3I75B 5L8KB 1VEMA 2R0ZL 2PW2B 5LWYH 4ZUSB 2BNUB 1PKOA 4LPYA 4OB5L 2NR6C 3DRTB 5BQ7A 3KXFB 1IM9B 4FNLL 1MCPL 1NAML 5MEQB 4F9PA 4UDTB 1KYOJ 5D7LB 4N0YL 4KKNA 5SWQB 5FHBH 1BAFH 4KVNL 4TUKL 4XH2B 5C09B 4ALAH 1H5BA 3T0EC 4Z0BH 4OD3H 3HE7A 4NDMA 4OD2B 3VFPA 4PJCA 3UJIH 4EIGB 2ICEA 4PJHE 1JK8A 4WEBH 4DAGH 3RDTA 1YPZA 3OF6D 4DN3H 1FE8H 4JFEE 2ZUQB 3OZ9H 1MI5B 1DQJB 2AJZA 5I1KL 4JM2F 1T0NA 4G6AD 4KUCD 5JR1H 5HVFB 3I2CH 4NNXA 4HIXL 2XFXA 2LU3A 3R0NA 4NWTH 5F9DC 4OQTH 4DZ8A 1I9IH 4XVSL 1A7PH 3K8KA 2BDNL 3KYOA 4YPGB 2I60H 4HBQA 1A21A 3KPOB 3LH2H 2A6JA 1HXMB 1KTDB 1F4YH 4PS4H 4Z7WE 4D8PB 2VSDA 3ZSTA 1R24A 3CUPB 2CKBA 3G04B 5CZVL 2JB6A 4L3EA 3SDXA 3V79C 5C0FB 5KSBA 2ZJSH 1OB1A 1N59B 4LCCC 1UM4H 5JHLL 1J1OL 2P24B 3C2SA 3JWOH 2ZSVB 4MSWA 4LHUA 2DIAA 3SDYH 1FFPB 1KXVC 1CDCA 2LV4A 2VXVL 3EUUA 5HYSB 2JK5A 4URTB 1MEXL 4W4NA 5EC1A 5SX4I 3L7EB 5C08B 3X3GH 1GZPB 1EHLL 1WEJH 1LK2A 5BVPH 2PETA 1HHJA 1KPUA 2QTEA 4YAQB 5HTSA 1G7MA 3RGHA 1V3JA 4LF3B 2NW3B 2WWMD 4UTAL 4H25A 1JWUB 1B90A 4X6FA 4IDJL 4LAQH 4XC1L 4JKKA 5DEGB 1DBKL 1INEH 3WMSA 2DQIL 2UWEF 1CLZH 3ZTJG 4Y4HB 1QHOA 3JV4A 4S1DD 4P3DB 5BS0E 3IAQA 2FBOJ 3O2DL 4O02L 5HHNA 4CJ0A 3QPQD 4CADA 3NH7L 1NJ9A 3PHQB 2YD6A 1J10A 3G6AA 4NJ9H 4PGCA 4F7CA 5K9KB 3MRDA 1R5IA 3W5NA 5FO7A 3WFEL 5MENE 2C3GA 3HI6H 2D0FA 1A6PA 4HS3B 1M7XA 2NY1D 4UNUA 4ZOCA 1NFIA 1NCDH 3SE4C 1NGWB 2DD8L 4ODVH 1A7OH 2YMXH 1CBVH 4OFKA 2VZ1A 4JLRB 1RJYB 3T2QA 4EN3C 2IBZY 4NZRH 2F8VA 5E8EB 2DBJA 1A6TB 1I85A 3SCMD 2OLDA 3FZUD 1D5BA 1ZAGA 4GRWF 4ERSH 3BE1L 4JVWA 2JJTA 1I8LC 4FQPA 4PREA 2F54B 5F7YC 3VXOA 3MCG1 1FHGA 4ZXBD 5EN2A 3SO5A 1B0RB 2L0DA 4AJ0A 3TESA 2NXYC 2YPKA 1AO7B 4Y8DC 2H2SD 3MGTA 1UGNA 5T5NF 4I0PB 3N1MC 2AXFB 5EZIH 5ITFB 4ZO9A 1I75A 2BCKB 3ARGD 1FZOB 4RAUB 4YHMH 2FIKB 2OZ4L 4JPKL 3L9RB 5GS1C 3RL2A 3MRLB 4NQUA 3MV7A 3NIDF 1T6VN 3OR6B 1BFOB 2R29H 1BFTA 3IJYA 3ME0A 1MAJA 3ZE1E 3FAXA 4WI6A 1FL6B 3FKUS 4UOW0 1D9KA 4GKNB 4BFEA 1AI1H 4PJGB 4QCIA 2KL6A 1NCAL 1IM3A 3KJ6L 5FA3B 5IIEB 5DJ0B 5IWLA 3WLWD 4U1GB 1PSKH 1CL7I 4X5WB 1F6FB 1S9WA 4QWWC 4KK8D 4YHZH 3VMPA 1PD6A 2AXGA 4QOKE 4GXUN 1R3KA 5JIPA 4MA7L 4HIEA 3TBSB 5D7SH 1MCDA 4MXWH 1T0PB 3OV6A 2ZUYA 5D8JH 3ARDD 4KRPB 1LE5A 3ABZA 2BNRD 2WMPA 4KRLB 5HD8D 5BQ7B 3H3KA 3OJDA 2EEAA 3DECA 2B0SH 4PJDF 5D2LF 3O6KH 4KJPC 4QGYA 4M43H 1H5BB 1MJ7H 5JW3H 1KEGL 3VFPB 5KSUA 5DD1H 1A9EA 1A4KB 2ICEB 1JK8B 3O9WD 4HCRH 3RDTB 1YPZB 5I19H 1RK0A 5DK3A 4NYLA 1P4LA 2DTML 4H88L 2AJZB 5TQ2L 3VH8G 5C0CD 4PJHA 5J6GA 1T0NB 5C0BD 1B0GA 4QHLA 3M1BA 2GK2A 4JFEA 3ALPA 2XFXB 2CLVA 1U8LA 4DZ8B 2P8MA 1BHGA 4OF3A 4JQXA 4YDKH 4ENEC 5I1DA 5FYLL 4UB0L 2A6JB 4PV8A 5ICXA 4YNYA 3K80A 5IB5A 1F4XL 3GMQA 5L2JA 4P23C 4ONFL 1R24B 2CXGA 1JIBA 2CKBB 2HT2D 2JB6B 2DM2A 4L3EB 3SDXB 4Z7WA 1OB1B 4A2LA 4HC1L 2ZG2A 4WO4C 4MSWB 4LHUB 2I5YH 1YNLL 4V2BA 2GY7B 3UBXG 3RI5F 4YGVB 2JK5B 5TF1L 4UV4L 4AK1A 3RVVC 5EC1B 1IEHA 1NC2D 4OJFL 2N7BA 3K8MA 3UC0L 4OCSH 4XWGL 1LK2B 1HHJB 1KPUB 4XVJH 2IH1A 1G7MB 2A9NL 5CJXA 1CVRA 1WAAF 1G9ML 3ORJA 2UZXB 4H25B 4X6FB 5GGQL 1CTOA 5HHVH 2C5DC 3AXLA 3KAAA 3TBTA 1SEQL 3M17A 1KJ3H 1ORQB 1FBIH 4JFQA 1MFCL 5GRJL 1F6LL 1FZMA 3FN0L 1FIGH 4RAVA 5HHNB 4CADB 1NJ9B 2R39A 1T7ZA 3G6AB 5AAMA 4PGCB 5BS0A 3MRDB 3OKDA 1R5IB 1Z5LA 3QHZL 2D3VA 1XFPA 2EDXA 5FO7B 4ORZC 4ZO6A 2H9GB 2P5WE 2WP3O 3CPLA 3B9EA 4NZTH 2D31A 1NFIB 5MENA 2FYYA 5TDPA 1KC5L 3CMGA 3WFZA 3HI1B 4YE4L 4Z18A 4FABH 1FNEA 5TE6H 3QIWC 5AYUL 2BMKA 3FQNA 1WFTA 1D5BB 2DBLL 1JGVH 1DR9A 1TVDA 4FG6C 1U3HD 1GAFH 2ZCKL 4IOIB 4RBPK 2IADA 4PREB 5MP6H 4OLEA 5EN2B 1LP9E 5D96B 4DWHA 2YPKB 3MGTB 1PGRB 2Y9RT 1ZLWH 3FO2A 3KPMA 4KQ4H 3WHE1 2MCPH 2NLJA 1BP3B 4XMLL 2WINA 1AHWA 5HYJD 3DRQA 1MUJA 5IT2L 5JQHC 1C12B 2NXZC 3RL2B 4CU8A 3MV7B 3MOBH 3X11A 4X6CE 2H2PC 3OQ3B 3IJYB 2H3NA 5D1XA 3IDNA 1D9KB 5TE4L 4GMTL 3L5XL 4OFYD 2X42A 4QCIB 3CLEH 1UXWA 4ZD3L 3TZVD 2IPKA 1G7QA 1G6RH 3X17A 3GSNH 1S9WB 4P2YA 1OGAD 1FL3A 1OTUC 1QBLH 4TYUA 2AXGB 3PL6C 2VE6A 2K9UA 1QZ1A 4EXPX 1EO5A 1R3KB 1W8NA 4YDVA 5I1EL 1Q1JH 3DMMD 1F5WA 2RFXA 1F6AA 4LIQH 1A6VH 4QOKA 4NKDA 3DYMA 1UH4A 2CDGA 1IL1A 3BH9A 3D9AH 1HEZB 5HPOA 3ULUL 4M1DL 1LE5B 4Z7QE 2HJFA 5TDNA 3NABH 4M7JH 3B5GA 4M4PA 2EIZA 3LOWA 3OJDB 3P4NA 1MRDL 4KTDH 1D6EA 3TCLA 5B8CA 4R0LC 1FH5H 2J88H 3N50A 5DVLA 3RY6A 5AG8A 5LVEA 4KK5C 4I2XE 5KSUB 5L2KB 4EI5C 1A3LL 2RQ8A 3T09A 5I1GH 3ULVD 2V7HB 1RK0B 1WWAX 4NYLB 1P4LB 5F72S 3MNWA 5FCUH 2NY5L 1H8SA 5D70H 1NSNH 1A0QL 2N1KA 4PJHB 5J6GB 3TV3L 4HQQH 4QHLB 3M1BB 5GXBB 3FHAA 1T0MA 1HYRC 4JFEB 4NCC1 5DGRA 5IMOA 2IWGA 5BZDA 5F7KC 1U8LB 1ADQA 1E4KC 2P8MB 1J0ZA 4P4KA 5KG9A 3WFCH 1VACA 2OYPA 3QEUB 5I1DB 2LAAA 3U6RA 4PV8B 5ICXB 5GRWA 2EDWA 4KGJA 4YNYB 3V5KA 43C9A 3GMQB 5L2JB 5C0RH 1QBMH 2GTZA 5IFJA 3ZHKA 2CJUL 4NQED 3ARBA 3P9MA 4Z7WB 4YXKH 3S3PA 4HWBL 3BFOA 5CIPH 1KNOB 5DUBA 3HHRB 1MPAL 2YUXA 3OKLB 1EH9A 5T33L 5DC4B 5DLMH 1SQ2N 1ND0A 3V7AE 2EDHA 4NC2B 1G7LA 3RGVC 1XIWA 1E6JL 3RA7H 1F4AA 2IH1B 4KKCC 1AFVL 3E8UL 5E1HB 4F58L 5CP7A 5IHLB 1OAZL 2HWZH 4OCXH 1WZ1H 1DBJH 2NX5E 3RZCC 1PZ5A 3TBTB 3M17B 3A6OA 4P2OA 3VI4F 3FRPG 4JFQB 4NQCD 4NQSA 1SJEA 2RGSA 1FZMB 2VDMH 4RAVB 3F58L 4K2UH 1AKJD 4HWZA 5D1ZA 1EFXA 4N0RA 1OT1A 5FKPA 2GFBA 3OKDB 1MFEL 1F13A 3AB0C 4XNXH 5GRYA 1H3VA 1UFUA 1XGUA 4PTTB 4WNQA 4X80L 1RU9L 2V5TA 4OZGE 3CPLB 3QHFH 1VFMA 4CAGA 4GRWH 2D31B 5MENB 1OARL 5TDPB 3T3MF 2P5WA 3QJFA 2VLME 1JF5A 3CXHK 5F8QC 5KANI 4ODHL 1FNEB 4OT1L 4MA1B 2BMKB 3WKML 2B1AH 3FQNB 4KKAD 5KOMC 4ZUUA 1A7QH 1MHEA 4XHJD 1RK1B 4PJ5D 5F93C 2IADB 1NBQA 1S7RA 2IGFH 3NZHH 3EDEA 4ETYA 1VHPA 2ERJB 1TQCB 1E4XH 1NCWH 2A77H 4NN7B 4LKCA 3FO2B 3KPMB 3GSWA 4M7KH 1LP9A 1R3JA 1BD2D 3PQYD 5J12B 4HWUA 2WINB 4XP1H 3GB7B 1AHWB 4OBSA 1NUGA 1C1EH 4MNQE 2FHFA 3DRQB 4WUUD 1MUJB 4XI5D 1L7IH 3QO0A 4MB3A 2FZ3A 4OLUH 1S78D 4OFIA 2JB5H 4WCYL 5CD5C 2DKUA 3S5LA 2H3NB 1JRHI 5D1XB 3IDNB 5H35B 1FO0H 3FB5A 5TPWL 3LS4H 3RWIB 4JCLA 3AUVA 4U6YA 3WS3A 4U0QB 4D94A 4X6CA 4IOFD 3QPXH 1MOEA 1OAQH 1UXWB 1A7NL 3DVFA 2IPKB 1G7QB 4GXVL 2IFGA 5B3JF 3AS1A 5FUZL 3BWAA 4ZAKD 1BIHA 1FFQA 4U33A 3VXQA 1VFOA 3JZ7A 4RISL 3D6GA 3BVNA 4OM1L 2VE6B 4YDVB 35C8H 2XTJD 2X2YA 2RFXB 1F6AB 1MFDL 3NA4A 1ETZA 2EE2A 5ISZD 4XP5H 4QOKB 4NKDB 3WDJA 1IL1B 3BH9B 5GZNC 2FRGP 2HJFB 2EDYA 1FG2A 5TDNB 3DUHA 5D7KD 3R06A 1HXYA 4JZJA 5FGRA 1FC1A 3G5ZB 3MR9A 4P9HC 3L1OH 3P4NB 4U6XA 4UTBH 2EC9U 1D6EB 5B8CB 2AP2A 3SHSA 1PYWA 1CICA 4M1GH 3RAJL 5GISH 6FABH 2VSCA 5GGVH 3FAWA 1OQXA 4ELME 3H42H 1A6UL 2IAND 3HMWH 4WWKD 4WI5A 4JQIH 4XMKL 4EKXA 4M7LL 1K4CB 2X1PA 4NWUH 4PLJC 3DVGA 4I2XA 3MNWB 2JE8A 3AREC 3CSYA 3QA3A 1PG7X 1AXTH 3P4MA 5IBLD 4NKMA 2Z91B 1T0MB 5IMOB 1AP2A 5JHDD 3PV6A 5BZDB 3ZE2F 4P4KB 3TH4T 5KG9B 3QG7L 1JN6A 1VACB 1QR4A 1I3RA 1Q72L 3AM8A 3B2UD 4GJTB 2CGRL 3U6RB 3OAUH 3B2VH 3W2DH 1WC7A 3A6CL 3V5KB 43C9B 3D25A 4LKXA 4CRPA 2Z0BA 3BT2L 4EDWH 2GTZB 2EE3A 4LEXH 5IFJB 3QWRD 2FX9L 5E24E 3GMNA 4XTRD 3AY4A 1JE6A 1HWGB 2XXMB 3ARBB 3RIAF 5DEFA 3QIUC 1N0LA 2VKXA 3SPVA 5DUBB 3LKSB 3MODH 2EH8H 1ND0B 3KYAA 4PGBA 3TYGH 4Q2ZB 1E4WL 5K9QI 1G7LB 3UZQA 1UYWH 3IFNH 4WI3A 1XIWB 3SE3A 1XGRB 4NO2B 4KKBD 4XNUL 4AH2A 4OIIH 5CP7B 2D4DA 2VISA 1OTTC 3FO9A 4OD1L 4G6JL 1HHIA 1HIMH 5DMJB 3TNMA 3QIBA 1PZ5B 3ARFA 3BJLA 3ZDZF 1ACYH 5KTEL 3LRGA 4P2OB 1PEZA 1TTUA 2NX5A 4NQSB 1SJEB 2WUBL 5DJCA 1T1XA 3QFJD 3BKYH 4CN6A 1P7HL 1P6FA 4GT7A 2ESVE 1EFXB 5D1ZB