3MODH

Crystal structure of the neutralizing hiv antibody 2f5 fab fragment (recombinantly produced igg) with 11 aa gp41 mper-derived peptide
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
237
structure length
237
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords gp41 MPER-derived peptide
publication title Crystal Structure of a Non-Neutralizing HIV-1 gp41 Envelope Antibody Demonstrates Neutralization Mechanism of gp41 Antibodies
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 237
sequence length 237
ec nomenclature
pdb deposition date 2010-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3modH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3modH01
1U8PB 4P2YA 1FYTD 3EJZC 1MHEB 1N7MH 4HBCH 4JFZL 1FPTH 5KS9B 2OBGA 5D5MF 2VDQL 1IL1B 1QR4A 4NZTH 4NN5B 5A2IH 2LVEA 4GG6F 3DX8B 4GQ9H 1C7TA 1P4IL 1TVDA 4JRYE 5KW9L 1OOAA 2CO6B 1U41A 2APFA 3IDXL 5DQJB 3QIBA 4C56B 2FGWL 3LEYH 4XVSH 1IGYB 5ADPL 2CDGA 4QRRD 3VXPA 4FMFA 5JORB 5F97E 1QUNA 3PDDA 4U1MB 1EEYA 3SGKC 1ADQH 2IQAA 4LCYA 4ZSOA 3ARFD 1T0NA 2W9DL 5C0BB 4HFWB 2PYEA 4NQDD 3WFCL 1P9MA 2BSTA 5D6CB 2V7HB 1ZKAA 3O9WD 4BH7A 3QIUC 1OAYH 2Q8BL 4GRWE 5GHWL 1IMHC 1LO5A 1JWMA 1NGWB 1UWXK 2EXWD 4IOSD 3MZTA 3ROOB 1EO5A 1OL0A 2Y7QA 3FO9A 1MHHA 2OL3H 1KPVB 1HI6B 2FD6H 4ZUWB 3RBGA 4LAQH 5AYQA 3B9DA 3BKJL 4I3SL 3QA3B 1WZMA 2PYFB 1YMME 2F8OA 1G7LA 4GW5B 5E8NA 4RGOL 5I1GL 3I75A 5L8KB 5IMMA 4JKMA 4CMMA 5IHZB 1LDSA 1E4WL 3G5XA 4OLEA 1X5FA 4HFUH 2DM4A 1NGQL 3INUH 3QHZH 3UTTB 1R5IB 4U6HB 1TTGA 3S7GA 1S9KC 1AR1C 4YEEA 3OR6A 3VWJA 5T33L 1QRNE 1IKNA 1WLHA 1GRWA 2X4UA 4NC0B 1FVCB 3GM8A 4V1DB 3RAJL 4R4BA 3R0MA 4N9GA 3FO0L 4PJ8D 1S7SA 4O9HH 4HLJA 5J13B 2DOCA 5EO9A 3L3IA 3TPKA 3FFDB 4LLDA 4P48A 1XCQB 5I74C 3S36H 4UOW0 2X6MA 1VADB 4YDKH 3CPLB 2P8LB 5HGBB 3KXFE 1XGYH 4UIKL 3V4UH 1CGSL 4MJ6A 2NLJB 4EDXB 1DFBL 3HUJB 3TBSB 2A74A 3LN4B 4UV4H 1XH3B 3O41B 4LSRL 3U7AA 4YHIA 3HE7A 1WFTA 1TENA 2EYSB 3F8UB 5J0BA 4ZODA 2HJFB 5AG9A 4CBPA 4CKVX 2X4RB 2XWJB 1BWMA 3MLVH 4L3ED 2XY2A 1VPOL 4PJIB 1B88A 1JNLL 1IGMH 3TO2A 5JDJA 2UZXB 1D5IL 4ODWA 3SQOH 3KYOB 2D0HA 4BFGA 1JI2A 3LIZH 4E41B 3S4SG 1N5YH 1UEYA 1U3HC 4FQ1L 3EOTH 4MA8L 2ED7A 1R3IH 5CILL 3I84A 3VG9C 5K9QI 2YD8A 5FK9B 1I3GH 3IF1A 3ARQA 5FYJE 4IOIB 4PRPB 3G6DH 4LF3B 2KQNA 4LPTA 2FX8L 1TXKA 1LP9A 2XPGB 4KPHH 3FRUA 4UNVA 1SBSL 3N85L 4N90D 2EYTA 5TE4H 1KJ2B 4M1DL 5B38G 3RWJA 1FCCA 4I3GA 1IGTB 3LS4H 5KG9A 3T77B 3EYOA 1Q9KB 3MOAH 3DARA 2YA0A 3JWNC 1ZAGA 3KPSE 1F6LL 3QEUB 3IETA 1AGCA 4HPOL 7CGTA 2APTA 1JP5A 2R69H 2MNUA 3WEXA 5GZOD 2FL5B 1TJHL 3DVFA 1AXIB 5AD0B 1C12A 5EU5B 3HZMA 1YDPA 3QYCA 1JHLL 3U4EB 3T4YB 2F54B 3TN0D 2YZ8A 5I19H 2X4SB 5HI5D 4XNZC 2QQLH 8FABA 1TZGH 3H8NA 2IC2A 1FZKA 2A9MH 1PD6A 2BVPB 3TFKC 4OLXL 3VFWB 2VLKB 4CRPA 2ZOKB 2OXHA 2OMBA 4LDEB 2EDYA 4OZFH 3MJ9H 5TE6L 2AJYL 2EDRA 1XF2A 3HMXL 3WIIH 2OK0H 3QO1B 4NHCH 2QHLA 4P9HL 2H26B 3GDBA 2R2BB 1L9NA 3G6JA 4M1GH 4KDTC 3BT2L 1H3GA 1MRDL 4GLRI 4PRIA 3FO2A 1A1OA 3RVTC 4FZEH 1T20B 2E6QA 1G0DA 5I76A 5EU6A 2DKSA 1TZHA 4HGKC 4U7KA 4K94L 2MQCA 3Q5YA 3ZYIA 5F8RC 3L7EB 4YDJB 3NCYP 4ZPTB 3KYAA 1KXTB 3MO1A 3QUXC 5TH2B 1MHPL 4XP9L 5KBNC 5IOPA 2NY3D 1M05B 3GSNL 3P2TA 2RBLA 4ZUSA 2X41A 5IT2H 3PWUB 1IAII 5HDLA 3WXVH 1L9MA 4NGHH 4Y5YC 4RMVA 4LCCC 1P7HL 3ZHLA 1QLEL 2I07B 1IQDA 4AH2B 3CZFA 2VL4A 3V79C 3DYPA 3OKEB 1W0VB 3TNNB 2NY7L 1GJIA 5E8EB 1B0GB 4PJ9C 2UWEE 1EAPB 1JGDB 1A1NB 2XZZA 3WJJC 4F9LA 3DSFH 1URLA 2DYPA 4DAGH 2IPTH 5JIIA 2XWBB 1NBZA 2CKBB 1FAIH 1T4KA 5EWIH 1C16B 3H9SA 2IAND 4M48H 4PJEA 5I1HH 4NKIH 5DZNA 1JNNL 3EYUH 2OJZH 4Y5VB 4FQXA 2COQA 2FB4H 3QDME 3TNMB 4RBPH 1T83C 4M1CD 3V4PH 1MFCH 5EBLA 2VZUA 3HS0B 2Z35B 4XPBL 3ZZ1A 1KN4L 1I4FB 1WFUA 3OMZA 2XRAL 4KTEH 4JM4H 3V6FA 3TV3H 3QNXA 4KK8C 1ZSDA 2VLLA 2DBJA 4Z9KB 3B4NA 3VXRB 1JTPA 3IJSB 3H9YA 1NDGA 3QQ3A 1QPPA 5LCVL 5BO1H 2E3VA 3CVHB 3FT4B 5HYJD 1ZT1A 3RX8A 3FN3A 1JYNA 5IJKC 2F53B 3SEPA 4AL8H 4PYGA 2RR3A 3X3GH 1CXHA 2UZIL 1DN0B 2DI8A 3VFGL 2BOCB 3MRIA 1IZKA 1G7HB 4HUXB 1UFUA 3RTQB 3AVEA 4WDIB 3L3HB 1WBXB 4HKJB 5F6IC 3S98A 4B0MM 4ZFZA 2GCYA 4L1DA 3CFJB 1KIPA 1INDH 5GISH 3CDCA 3ZDXF 4Y4FD 2ZOLA 5K9OA 4WW1A 1KJVA 1EEUA 1W0YT 4G3YL 5DJ6A 3ZE1F 1BFOA 3PQYE 3TCLA 4P4KA 4JPVL 1XGQA 1A6ZA 4QWWD 1S9VA 2YS4A 5C6TH 4HEPG 3E6FA 2EZ0D 4G7YL 1PSKH 4Z7VA 1YECL 1OTTC 5JXAL 3ALPA 5DYOB 3D0VA 5F9JA 3NH7H 4LLYA 2WQ8A 2VERN 3QIBB 3S34H 2OI9B 3UTZA 4O58H 5DQDH 3S4SA 5SWZA 2C3WA 1VFAB 1NCUA 2IQAB 1M6OA 4PGDA 5BQ7A 2PYEB 2EDQA 1IKFH 2LVCA 3T2NH 4HUKB 1JPST 3ZYOA 2FATL 5DLMH 4KI5F 1EHNA 3RPKA 4YX2H 1GSMA 4M61A 4BH7B 4QCIA 2V7NB 2CDEA 3N1FC 4J4PC 3CJJA 5F3HA 4WHYG 1KENH 1IBGL 2Y7QB 2DS4A 4CUCA 4ELME 3FO9B 4JPIB 3QJFA 4L4JA 2H3NB 4JM2D 3DPBA 5LQBH 2VWEE 5D71H 3TVMD 3VWKC 2W9EH 4G6KH 5DZLA 4YHPA 4GRLA 3BKCH 4DN4L 4MNHB 1G7LB 3WSQH 5E8NB 3FQRA 4XVTL 5GS1C 3U9UB 3I75B 1N5AB 4ZPVA 5DVMA 5IMMB 5T1LB 1BBDL 5FYKU 1F58H 3C2AL 4MAYC 5MP6L 1IGFH 2X4PA 2IWGA 5C09A 12E8H 2HG5A 3OKOA 3ARSA 2XICA 3UO1H 2QSCH 1G7JA 2NXZB 5J1AB 3BIAX 2X09A 2VKWA 1JPFA 3CK0L 4CU6A 3LH2L 4PJGE 3HMXA 4QOKA 1QBMH 1KLGA 1R5WA 4P3WA 1S7SB 4MJIE 3LQAH 3O3AA 3RGVD 4YDLB 4PBVC 1NAKH 4I4WA 3KS0H 1OD7A 4I77H 4PYHA 3VXMB 1HHKB 2HRPH 4WHTA 2IFFL 1NUNB 2E8ZA 4NZRH 5GRVK 3KLHD 1QSED 4PGZA 4BJLA 1FGNH 1HK6A 1CBVH 3VA2C 2VXSL 2C4XA 3QUKA 2A74B 1KTDA 5F9WB 3HB3D 4YHIB 3HE7B 3VG0H 4RX4D 4NRXA 3BZEA 2XFXA 1P53A 3JSSA 2XN9D 2Z91A 3EYSL 1U8LB 3ZKMC 4XI5C 1ZVSB 3TO2B 3EO9L 5TF0A 2MQ0A 2AEPH 3QQ4B 3MV9A 4ODWB 3GSNA 3F7RA 3O4OC 4QLRA 43CAA 3C5ZD 1NBQA 1GOGA 3O11B 4OBRA 4ZDHA 3GGWB 3MUZ1 3C08H 4JFFA 4DGYL 4X7DC 3GBLA 1XAUA 3QIWD 1U8QB 3LDBC 3B5HA 3G9VA 4HJGA 3T0EE 5I1KH 1EHXA 1FE8H 4IM8A 3B8YA 2FH6A 3RDTB 3IB4A 5CSZB 1Y0LA 1HXYA 3QXAB 4J3SA 3SDDD 1MLCB 2WUBL 4I2XB 3SOBH 4XPFL 5EBMB 1LO2H 1C5CH 3FRUB 1X5ZA 4HUUA 1E4KA 3JZ7A 4L4TE 4JQXA 1QO3B 1KCSL 2LAGB 5KG9B 4R0LB 1Z9LA 3RWEB 1ITCA 3EYOB 5IB1A 4YO0B 3IETB 1AGCB 5E7BA 2FEEL 3C6LC 3PP3K 3VFPA 4TNWF 1UB5A 3TIDA 1JRHH 3KPRA 2WUCH 1YDPB 3ARBC 3FB7A 3QSKB 3IFOA 3PHOA 4W6WB 1S3KH 2FBOJ 4J6RL 2XQYK 3V5HB 4AEHL 5I30L 3CMOH 3MRHB 4FZ8H 3BZFA 5DJ8A 3MLSH 4HBQA 4Y4KD 4BSWA 1RY7B 1FIGH 3QWOA 2AS5M 1CZ8H 1VSCA 2E8YA 5CMAB 3I3EA 5FM5O 1A14L 4Q6IA 3BD5A 1EZVX 1A9BA 1FRGH 3ELAT 3EYQC 3I2CL 3HAEH 1A3LH 4YQXH 4L3AA 3VRJA 3IDYB 1I1FA 2YPKA 2EYRA 1AGBA 1NLBL 1IJ9A 2J6EL 5CJQH 1N7ML 3LKPA 1MJ7H 1NBVH 1YQVH 3UPRA 4OCXL 3ARWA 4JRXA 5EU6B 2I9TA 4LVNC 1NC2A 4YHZL 4YHML 1YN7A 3C60C 4XBPA 2XWTA 1XGRA 4GQ9L 2HFFB 1WZKA 2GTWB 3PF2A 1OWRM 4JAMA 4DOHB 4PTUA 1M7DA 1TNNA 3MO1B 2VXVL 4KK6C 1CL7I 3FAXA 4MXWH 4L4VE 4WI2A 1ZTXH 1U92B 4OLVH 5CLWA 1Z0MA 2OR8A 3IXAB 4QKXB 4O02L 3QPQD 1RFDL 4ZUSB 4GW1A 1LDPL 4IHOB 3LQAC 4WUUB 4X5WA 1QACA 1UA6H 4X7FC 5B39A 5LGHL 4R26H 3VCLB 2WW8A 1MHCB 3RWHA 5E08L 1QRKA 2MSPA 4HKXB 1DCLA 1ZLVK 4Y4HD 3IS0X 3TIEA 1P2CA 2YN5A 2DYPB 4S1DC 2NMSA 3GMLA 3WIFB 1A6WH 1FORH 4GS7C 4YHLL 1YY9C 1K4CA 4KZDH 2JELL 2VOTA 1NBZB 1F4XL 1T4KB 5HHOD 1YJDH 4PJEB 5IGXH 5HHQA 2AXHA 2NY6C 4FQXB 3IU3B 3NFNB 2BRRH 2FBJL 3ULUE 2DAVA 5KSVA 3A6OA 4P0DA 5EBLB 2VWEC 1IQWL 3EJYD 4E42B 1A7QH 3WLBA 4G9FA 4U1KA 5ID0B 1ZA3A 3GUTA 2GW5A 1T04A 1Q1JH 4HIXH 1LE5A 4G8IB 1BFVL 4RMSA 1FNGA 1EEZA 4NDMA 3RKDC 5FM8A 3F7VA 3QXVA 1R3LA 1U3YA 2VDLL 2YKLL 4OD1H 4XPHH 2YPVL 1EXUA 1ZT1B 2PXYD 2JCCE 1FDLH 1LD9A 1NGPH 2HAZA 2XZAL 3DMMC 4GOSA 4JFDB 5CHNA 3T09A 3L95B 1CICD 4NT6B 1PLGH 3CD4A 4M62L 1EFXA 5BRZD 2P8PB 3MRIB 5EU4B 4UQ3A 3T2OA 4OT1L 4H8WH 4OSUH 3SGKA 4ESKA 1D5MA 4ZFZB 1IM3B 4D94A 2IH3A 1OGAD 4LHQB 2DQGH 2ZOLB 4JO3H 4OLWL 4PJFE 5L2KA 3QBTB 3QIUA 3H6JA 1BFOB 1LWRA 4R7NA 4X98A 1LEGA 4MNQD 4U6XA 3TCLB 3VW3H 2YEZB 4HC1H 5EUKA 1RURH 4RFOH 2X1PA 3E6FB 1RJYB 3BUTA 3MGTB 3D25B 3S5LB 1GCFA 4G6FB 2ADFL 4LCWE 5CZXD 4Z7VB 3QJHB 3MMEA 3FONA 1U3ZA 5DFVD 4U3HA 5C2BH 4GG6E 2X89D 4IIQB 3LHPL 4LLYB 3MLXH 5HHPB 5IVXA 4I0PA 5KJRL 5SWZB 4DKFL 3T0EC 4JREC 4ZXBC 1OAUL 4PGDB 2LU3A 4CVZA 5C6WH 3P4NA 4QRSB 1KFAH 5F7NC 1OCWL 4CW1A 2VE6A 2DIBA 4M7LL 4WW2F 1ZT7A 5DJXA 1T1YB 1UM4H 5GS0D 2DWEA 1DQQA 5MEOB 1D5ZA 3FCTB 1QFUL 4QCIB 1JF1A 2UV3A 3HPLB 2WWMC 2XKSA 5CJOL 4DKDC 1NMAH 2DI7A 5ANMA 1CLOH 1K6QH 3SHSA 3MXWL 4NZDA 2ZUTA 4D0BA 3OAZK 4I3RH 1J8HA 2H32H 5AWNH 5ISZA 2IH1A 3R4DA 2F5AL 2D7OA 4YBLB 5EO0A 5DWUL 5I0ZA 4GRLB 2DBLH 4OZFG 4ZAKC 1GGBL 2OMNA 5B3JF 3RI5K 4M43H 1OQXA 4L8DA 4QRPA 3TPUA 1ZHBA 4GBXB 5IBLD 1HEZB 5DHYB 5DURB 3D18B 4MQXC 5DUPL 4RAHA 5JHDE 1XT5A 1GHFH 4Z0XB 4AMKH 1WTGT 2KL6A 2YD1A 1R3JB 2HG5B 1DBAL 3QNZA 3ES6B 3LKNA 2VR4A 4F8QA 1HHGA 1G7JB 4P46D 4GAYB 4AG4H 5T3XD 1PG7W 1U3HA 2LQRA 1I7UB 4PRHE 2XXMB 4QO1A 4KU1A 3FT2B 5FYJL 5C7XH 4JZOA 1K5NA 3RY5A 3RWIB 1RUQH 5JXEC 2J6EA 1JV5A 4WHTB 4QXGH 1CDHA 1DEDA 4XNQA 4RGNE 1UCTA 5ACLA 4H0GA 2EDWA 2ZUQC 3QUKB 5I8OL 1RU9H 1KCUL 1KTDB 4FTVB 2AJXH 3PABB 2HT4D 5KSUB 4NRXB 3BZEB 4J3WA 2R0LL 2B0SH 2ICEB 2B8OT 3OL2A 3LRSA 2Q1EA 4K07A 1RUAL 1NCAL 1IFHL 4G9DA 3B6SB 1HSBA 4H8WC 5AZ2H 3REWA 3CLEH 1XR8A 2Y07L 4IS6A 2JB6A 4ZDHB 5T3ZE 1AIFA 1F5WA 2LE9A 4L8SC 5I6XC 2ZUVA 3REVB 1A0QH 1H9VA 4HJGB 1RUPH 4M48L 2LTQB 3MRGA 5E5RB 3JUYA 1A9EB 4N0RA 4R96A 3IU4H 4NQEA 3OJVC 5L88L 3RX5A 3MRLB 5D5MB 4S1QH 3TV3L 1CD9B 2EIZA 4X7TB 4XAKE 1R24A 5ICXB 4BQBA 4X9BA 3E2HC 2DQEH 4PJHA 3V7MA 2SEBB 2HFEA 3DV6B 3ULUC 1SYVB 3KPMA 1TCMA 1X5YA 4JG1H 3DVNA 4JFYA 1UB5B 3TIDB 3KPRB 1CU4L 4O51A 1G0YR 4N0FA 2IPUG 3HFMH 1Z9SA 3FB7B 4DEPB 3UZVB 2EEDA 3PHOB 5LXGH 1C5DB 5IKCB 2NY2C 4PUBL 1XR9A 3LVEA 3LEVL 5DJ8B 1RZGB 1W72H 3MV7B 2Z31B 3QWOB 3H42L 5D7JA 5ETUB 4HG4K 3CLFL 3W9EB 1T89A 1TCRA 2AGJL 5C0IB 4Y5YA 1KCVH 1C1EH 4LCCA 1A9BB 3WJLA 1WBZB 5EFIA 4RFNC 1I1FB 2YPKB 1QQDA 2EYRB 2Q8AH 2AXFA 4LSSL 4RMRA 1UADC 4PJ9A 2VN7A 4I0KA 3UPRB 3GBNL 2UYLB 5T3ZH 3WJJA 2J8UF 3PWPE 4JRXB 4PRID 4ENEC 4OF8A 1YN7B 3NCJH 1HKLL 1SJEB 2DQIL 2EIDA 4TSAH 1FSKC 2Y06H 4PTUB 1M7DB 2IADA 4XMLL 2FO4A 1GAFL 2ID5A 4APQD 3D69B 4XNXL 5E2VH 5DR5H 3A6BH 1T83A 3AREC 5JA9A 1EO8H 1TETH 4NO5A 1A7OL 3FOMB 4ODUB 2VXTL 1IKFL 4MB5A 1FNFA 1YMMA 2NTSP 1KTLA 2EO1A 2CDFA 4OD2B 4DFIA 2R0WH 3EYVA 4QTIL 3WYRA 5DTFA 5JA8B 1KB5H 2OR9H 4EEEA 1CGTA 1PG7H 4N5ED 5FUOL 1S9YB 4FQLL 1H15B 3SJVA 3WFEH 3TJHD 5HY9B 1TVBB 3ARGC 4P5TB 3TIEB 1P2CB 2OS7A 3GMLB 3PGFL 1ACYH 5DD3L 2BVEA 4EN3D 1T5WB 1K4CB 1IC4L 3DBXA 1QRNA 5JIKA 2ZSWB 4NFBA 3MR9A 1J88A 3VU2A 5BZWA 1T03L 5HHQB 3H9SD 1ZEAH 3K74B 5ENWA 1TJIL 5D9SA 5MHSD 1DDHA 5FUZH 3TC9A 1LE9B 3X3FL 2UUDK 2E6PA 1BZ9B 3BN3B 5GGQL 1FNEA 3DTXA 1L7IL 4M6NL 4KXZH 4G9FB 1ZA3B 3KXFA 4OZFA 4QRQA 4DGVL 3WNKA 1T04B 5IK3A 4LLAA 1JPSH 1LE5B 1MIMH 1EEZB 4NDMB 5T1MA 3F7VB 4KMLB 1QTYT 4UB0L 3F58H 4JQVC 3UJIL 1K4DA 3GJEB 5GGSB 5I1CH 2NY0C 4YAQB 3PGCB 3B2VL 3MRQB 2W07A 5C0EA 3WUZA 1U8IA 3JV6B 1RZJH 4PJCF 3QUMH 3TA3B 1KB5B 2R29H 4NCDA 1QKZH 3O8XD 4KMQA 4DCQA 3ZDXE 5HVWA 5L2KB 2JJWA 2VDNL 4M4PA 2HJLA 3BIBX 4FFVC 3ZE1E 1A21A 3TGXA 1EVTC 3JBG7 3ZYJA 3MZGB 4J4PA 4RCAA 4RGNC 1LEGB 4U6XB 1YEDA 5LJYH 2YD6A 3VXUD 2FDBP 4NJAH 4H88H 5EUKB 1Z6JT 4P4KD 1AD9A 4J1UA 5HI4C 3U4AA 4PG9A 3PWVB 4PLJD 5DT1H 4MX7A 3FONB 3VWKA 1FE8L 3QCVL 4TQEL 3U48A 4I0PB 2WBKA 1X5KA 1OB1B 3HI6H 1ZLUH 3B3IB 1J5OH 4MAYA 5IMKA 3BSZH 1INEH 5E4IA 2A83B 3P4NB 3AY4C 3E1F1 2F5BL 1KPUA 4PR5B 4KI5E 2VE6B 3VFUB 5JOPD 5DRZB 3FQNA 1YEGH 2HJKA 3WXWH 1H8SA 1DQQB 5DD5H 5BOZG 1JF1B 1V3KA 2O5ZH 4OIIL 4WI5A 4TRPH 1H3TA 4XCEA 4G8GE 1DQDH 4ZFOB 1ZLWH 3BESR 1A7PL 1J8HB 1ORQA 4M5YH 5ISZB 4M00A 1RJZB 4GRMB 3L3GB 5JW4N 4LNRB 1HILB 3MLUH 1NUFA 4JFEE 5I16B 5GJSL 2DD8L 3AM8C 4H20L 4Q0XL 4QRPB 4UDTA 5DRNB 1WCQA 1ZHBB 4ZTOH 4RQQA 2CH8A 5DJ2B 3HAEG 5DGRA 5D7LE 2PTUA 3VXNB 1AGEB 4H25A 2VRAA 1JNHA 5DS8A 3VXTA 3U0PA 5C09D 1YQVL 3E8UH 1HHGB 5FOJA 4M6ML 4ODXA 2IEPA 1BZ7B 1XGTA 5E94A 1W0WA 3KPOA 4C57C 3ORJA 3BJLA 4QOKD 3TBVB 1S7TB 3U9PH 4JZOB 1K5NB 1MWAL 3T1WA 2UWEA 3RGHA 3QXDA 3S8WA 2VDMH 4LSQL 5GS3A 4KKLC 3LPFA 2V5TA 4RZCA 2K3TA 1PGRB 1BVZA 2A38A 2X5PA 2NYYC 2CUHA 5TFSL 2HWZH 2J5LC 4NQVB 3QRGL 5I66A 1GPOH 2R8SH 2Z4QB 4D0CA 2VDOH 3MODH 1ZHKB 2P5WD 1JZ2A 3OPZH 3FB5B 5C0CE 3E6HA 3QDMA 1NL0L 3C6LA 3HC3H 1NCBH 4G5ZH 3LRSB 5CGYC 2AJ3A 4FQQA 3MLRH 2FX9L 4P23C 1MCOH 1CR9L 5CD3B 1DUZA 5DK0B 3ARBA 5BXFB 4IS6B 1AIFB 4MCYA 1KEGH 5KAQF 2GJZB 5EU3B 3VJ6A 4JFFD 5IB4B 1CTNA 3HG1B 3PP4H 5D1XC 1T7XA 2NY4D 3MRGB 4LPXA 3T1FB 1NUDA 4CVUA 4C59B 4KK9C 5B8CC 5A1AA 1JPTL 2P7TA 1YNTA 1BGXH 3DO7B 5J6HA 2PR4L 3ZKND 3O4LD 3D48R 1BBJA 3DSNA 1FNHA 1FN4A 4OCYL 4LP5A 4IOFD 3GSVB 1P1ZB 3H0TB 4LLQB 1DANU 2YBRB 4TVPD 2NXYD 3KPMB 4WV1C 4M6OL 1JN6B 2HRLA 3VXSE 1U2CA 5T5FL 2I5YL 3RY6C 1IGJB 1MY5A 1NGPL 3O45A 2A77H 3PQYA 2XTJD 1FC1A 4Q74A 4F57L 3RRQA 4M7JL 5KN5A 1PLGL 5E1AB 5I1AA 3T2QA 3TT1L 1N2RA 1TTFA 1XR9B 2HA1A 2HKHL 3NCBB 3GSRA 3NFPA 3UTSE 1BOYA 1JGLL 5D7JB 3VGAB 5L9DL 1OWWA 1X5AA 1YPZF 4JO3L 5JDSA 4XNUL 3P9WB 4F3FA 2Y5TA 3SDCB 1QQDB 1I8IB 2BMKA 5L7XH 2YD2A 2VLJB 1GZPB 1UG9A 3RUGF 1EJOH 1BF8A 5DD6A 2FHFA 3QR2A 1T1ZA 4UI2A 1NC2D 4L3EE 2ZUWA 3NABH 1TJGH 2HVJA 3ZO0A 4N8VB 3X17A 3V8OA 2FO4B 1BREA 3BEVB 3ULUL 5D2LB 4M7ZC 1J86A 3BN9C 3PDOB 3GIZL 4TUKL 1GGUA 3HZVB 4P5KA 4KDWA 2H1PL 3KS0J 1FG2A 2IQ9L 4TYUA 2GUOB 4K7PL 2RJMA 5DHVH 2DN7A 4G6AC 3VDCA 2CDFB 3EYVB 5FYLE 1AJ7H 2DRUA 2KDGA 5MI0C 2ATKA 5DUBA 1T66C 4MXVE 4OI9A 4PJ5A 5FKAA 43C9B 1B6DA 5JHLL 4GKZA 3SJVB 2WLZA 3O6LH 5AUMA 1J0IA 3IFLL 4KKBD 1U58B 4KI5C 3VGHA 4M3JA 4QYOB 4ODHL 5DK2B 3DYMA 4WGWB 3U0WH 5BZWB 4U4BA 4NO0A 1DE4A 5D9SB 4KJQD 4HMCA 4MJIA 5HPMA 1JF6A 1DDHB 1NCDL 5CS7A 3VI3F 2DIAA 4OGYH 7FABH 5E9DE 4FABL 4HEME 5D1ZC 5GSVA 4M93C 2WBJC 4OZHF 3DTXB 4HH9A 4Y2DC 1PKQB 4N8CH 3ARDB 3IFNL 3KR3L 5ICZA 4X6DF 3RHWF 3EJZD 4YHOH 4R7DA 4HPYL 3BUYB 3C8DA 4G42A 1WEJH 4IRSC 2EDNA 4OKVA 2YA2A 3HNVL 3QEGL 4G7VH 3X13A 2YXMA 4OCRL 5EZOL 1MFAH 3SE8L 4QXGL 3O3UN 1TNMA 5DHVB 2NX5E 4MS8D 4JFHD 4FP8L 2L0DA 1MJ8L 1OM3L 1CWVA 5KSAB 3CVIH 4IJ3C 4ZXBA 4GMSL 2P24A 4KRPC 1WV7T 2EDKA 5TE7H 5IR1A 3DRQA 3UEZA 1DP0A 2BVOA 4HULB 2QADB 2CXKA 1SJHB 5J12C 3L5XH 4FQCL 1VGEH 5CEZH 4L4TA 5BMFL 5DC9B 2EH8L 5CIPH 2V2XA 3SDAB 3QIUD 1YEDB 3B2UC 5J6GB 4LRIC 4ZNEE 5IW6A 4NKOA 1U2HA 1U91B 4PG9B 4XAWL 4WY7L 4JCLA 5CEXA 3TZVB 1I9JH 1BQHG 2ESVE 3MRNB 1NMBL 3QEQA 4M7KL 4ZAKA 4LVOC 1YN6A 5I15L 4UV7L 1NGZA 5BVJA 5F7HA 2P5EE 4R3SA 1ZXQA 4NRYA 1MVUB 5EZIH 4EIGB 5EB9A 2XZQH 1J0KA 3G5VA 3LAFA 5IMKB 1X9QA 2PTTA 5SWSD 5DMKA 4X4ME 1P84J 2W38A 4ELKB 1AR1D 1QSVA 1KPUB 3GO1H 4HJJL 4RMUA 5C0JA 1KCRL 5AAWA 3MA7B 4Z78A 3MRMB 3FQNB 4XP5L 4HWEH 1RJLA 2DQUL 3Q6GH 3Q0HA 1XIWB 1VFBB 3GMNA 3OKNA 5CWSB 3S35H 3WL9B 1K9TA 1DJSA 5EU7E 3U79A 3F6IA 1NH6A 1F11A 3U30C 3I3BA 4JLRA 5IEKB 5JXEA 3LSOA 5EO1B 4HDIA 1ORQB 3T0WA 1FHGA 3IAQA 4GH7B 1F3RB 2F74A 2OTWA 3ZTNH 1EUTA 4R9HA 1XF1A 4RISH 5DJAA 2ZUYA 1XZ0B 4OLYL 3LRGA 1UKQA 4DGIH 3IRZA 3VI4F 4F58L 3UBXA 3QCTL 1QR1B 4UDTB 4DFHA 4DQOL 4WFEE 5EOTA 4RQQB 5FECA 3SGJC 3UXFA 4NN7C 4H25B 4DN3H 5C0DA 1JNHB 1WITA 3U0PB 3O3DB 1PAMA 3CU1A 4Z7QF 4XCYA 4ODXB 1XGTB 5JR1H 5E94B 1W0WB 3KPOB 3PE9A 2BY1A 2ZP0T 2Y72A 6FABL 2XNAA 5H35A 1U3HD 4LGSB 4UAOB 2A9NH 2DWDA 4G43B 5JO5B 5I1IH 5INCA 4XGZA 1J0JA 5ICYA 1GZQB 4YR6A 3CFCL 3UTTD 2HFGH 4P59H 2R56H 1B3JA 5EG6C 5I66B 3BW9A 2IBZX 1MI5E 5TF1H 4P2RE 5F3BB 1BF2A 1DBMH 4OZIF 4XP6L 2LU7A 3C09B 3EUUA 5DRXA 3P9LA 1VB9A 2FJGB 3GMQB 3E6HB 4U7SA 1J87A 1FLRH 4NKDB 5C8JB 3QFJA 1JZ5A 5C07B 1QBLH 4K3JL 3PGDA 4GG8B 5IVNA 2OTPA 2PW1B 1B0WA 3MX0A 5HYSA 4LPWA 1EO7A 5E0QA 2R39A 3FZUC 4XCNA 3VFMA 4BK4A 5HHXL 3HNSH 1C5BH 1KGCD 1J0YA 2ICES 3O6FA 3TFKD 1ZEAL 5MENB 4J3OC 4HIHA 2DQJH 4NQCE 2R2HB 3VFVB 2JCCA 4TUJA 3D85D 2H8PB 1YNTB 2P7TB 4MCZA 2J8HA 5CZKA 1YEIL 5LWYL 1MRCL 3T04D 2H32A 3PWLA 4ZD3H 1LQSR 3X12B 4NQED 4PRAB 4TN9A 1MAML 3RWGA 3SKUD 5E8PB 5AZEH 4GKSB 3I50H 3PHQA 4PV9A 1QVOA 2V2TB 3EYFA 3RVTD 4G6ML 3KPTA 5T1KD 3SN6N 4PJFA 1EMTH 1T1XB 4FS0A 3EAKA 3QULA 1V8HA 1CFNB 4UINL 4X5LA 5ITBL 3O45B 2I9LA 1MF2H 5I1AB 4BKLA 3QUXD 3U2SB 4FXKB 4K3EL 1KIQA 3AREA 3NFPB 4WW2B 1MNUL 4JE4B 4OB5H 4YFLI 1AO7E 1AP2A 1QBAA 4YXKL 1Q9OA 3JTTA 1H3PL 4NM8H 2OQJA 3UJJL 4N0CD 5DUML 5F96L 1BQSA 4JRYD 5CEYB 2HH0L 3GSWA 2BMKB 3QZWA 2BSSA 2ADJA 4PJ9D 3OB8A 5DD1L 5IFAL 3F5WB 2BNQE 2OP4H 5DD6B 1RHHA 5IEHA 1T1ZB 3FHAA 1YMHB 2FECI 3P4MA 2DL2A 1N64L 4U6VH 2YSSA 3BAEL 3WNPA 2HVJB 1U8OA 2KZ1B 5ADOL 3LMJL 4M5ZH 4M9OA 5F89B 5AYUH 2ADGA 2ERJC 2IG2L 4P5KB 1FG2B 3WNLA 5I17A 4CMHB 2VC2L 5I73C 2ARJQ 2VQ1A 3OBAA 4HUWB 3FOLB 5E99L 1BQHA 4EIZC 1YMMD 2JLLA 4KK8D 4V2CB 3V5KA 1CI5A 4F7EA 5C9JB 4PJ5B 1AY1L 5FKAB 2X40A 5JHDA 4OI7A 2HT2C 3ZYZA 5GRJL 4NQSB 3UPAA 4KUZH 4JGUA 4AEIH 4JKKA 1LK3L 3O3EA 5E8OB 4M5YL 5AG8A 1MOEA 4JO2L 3QO0B 2PO6B 2BNUA 5I9QC 4PRHA 1QRND 3QWRA 1P7QA 2CK0L 4EI5C 5CCKH 4XPGL 4TSCL 1T2XA 4NO0B 4LPYA 1RIHH 4Q9BA 4GXVH 5EU7C 3GKZA 3GSQB 5GGVL 4D9LH 3QDHA 3AGVA 3T3MF 1WJ3A 3P4LA 1AKJA 2CLZB 2WINA 5E4EC 2NCMA 5GSVB 1T2QH 5JW4Q 2Y6SD 3E8UL 3IDNA 5IB5A 3MLYH 4U33A 1RZKL 3KXFD 5FCUH 1ZHNB 2JIXA 1Y6MR 1YEJL 2WANA 2LV4A 1OAQH 4OKVB 1S8DA 1PY9A 3N1QC 3CH1B 1OTTD 2FZ3A 1VFUA 1RV6X 3X13B 3WN5C 2VB5A 4YEFA 2DM2A 1IT9L 5JW4R 3VXQA 4A6YH 3GSOB 2X05A 4PJXA 1BIHA 4HS3A 1UCBL 1FZJA 4PJCE 3ZHKA 4MLIA 1GPOL 4U6TA 2LABA 3O2VH 2JE8A 2P24B 4NZUL 4U1GC 4HT1L 2EE2A 3Q1SL 1RVFH 3AY4A 5D2NE 3OPZL 4ZO9A 1MWAB 5DVOA 1F97A 4PJBF 2ATPA 4YK4B 4JB9L 1Z0NA 2RFXA 1JMZA 4K2UL 4MWFB 2ZCHH 4NWUH 1D9KC 2IGFH 2ITCA 4J4PD 4ZS7L 1J1OL 1K8IB 2NY1C 3GNMH 4H1LA 3AB0B 1QSFE 1G1YA 1FC2D 3PP4L 5CEXB 2AK4E 3RL1A 3KPSD 3IKCB 1A5FL 2EECA 1YY8A 2X4OA 1DEEA 3QEQB 2VZ3A 3U1SH 2VR9A 3AM8A 4R3SB 1CGYA 4NRYB 2MQ3A 1KPRB 5IBTL 5HGHA 2ZSVA 4N8VG 3P4OB 4HKZA 4U0RB 1P7KB 2J8UB 2UZYB 3MJGX 5SV3A 2PTTB 4OZGB 1RUKL 5DMKB 4MAYD 4X6CE 4EQ2A 1HXMB 4ISVB 4XXDA 3SE4C 2YUVA 2CD0A 5DJCA 1A6UH 1CXIA 3QUZC 4R90L 5HGDB 2VQTA 1A3RL 4LEXL 4A6YB 4LARL 3OAYK 5F1NB 3MYJB 2A77L 2VZ1A 1OQOA 5DK3A 5CZVL 1F11B 5J89A 2XA8H 1BMGA 1II4E 1NJ9A 3LSOB 1MEXH 1S7VB 1JGUH 3JV4A 4HDIB 2AABH 5BOPA 3V6OE 1WAAA 2XQYG 3C6SB 2F74B 2Q76B 3SDXB 5DJAB 1MPAL 2C3GA 3MLWL 2XA3A 2X70A 1JE6A 4ACPA 4U1LA 3EOAB 1FO0L 2J4WL 5EOTB 1WF5A 1G7QB 4OIBA 3ROLA 2GJ6B 3B43A 3NCCB 3QG6A 4PB0H 5EC2B 4OTXL 3ZKMD 3JWOL 4XI5D 5D93C 3QUMA 5DF0A 5H2BA 2WM0A 3WUWB 3VE0B 4EVNA 4JZJC 3JTSB 1EJOL 4XCYB 4QHMB 1WWWX 4ONHA 1UENA 3ARUA 1BX2B 1G1CA 1NSNL 3ZE0F 3BH9A 4LL9A 4PLKC 4ZUUA 3DIFA 4JFQA 3NZHH 2P8MB 3SKMA 5GGRA 2CRMA 2QHRL 5INCB 3S88L 3P11H 1INQA 5B8CA 1B4RA 5E24E 4LOUC 3G5ZB 3NAAH 1NFIB 3R1GL 1BFSA 5I1JL 4XC1H 5CP3H 4XMPH 3MXVH 1Y6NR 1DQML 1L4IA 2VITA 1G7IB 3EBAA 3P9LB 3BGFB 4N0YH 4YGVA 4NM4H 4WV1A 3QFJB 3QDMD 3C6LD 4NQTA 4XBGB 4OGXL 4XNMA 1WQVT 3MACH 4KHTH 4WCYL 1DBBL 4YBHA 4LLVB 4RNRB 3ARBD 1MQKL 4XCNB 4K8RH 3VFMB 2CMRH 2NZIA 1BHGA 5KS9F 4I13B 5HDQH 4PREA 2AKRA 3O81A 3O6FB 1I3UA 1YNKL 1KSRA 4F37F 1OAKH 4J3VA 3MV8E 3U46A 2ICCA 5HXMA 2ZUUA 1EDQA 4KMTH 4MCZB 1R5VA 3EYQD 2J88L 3OKLA 2VSDA 2D03H 3MUGB 35C8H 2I60L 3MLZL 3GMPA 3RWGB 3LZFL 2PNDA 3VFRB 3RJQB 1J1XL 1CXFA 2L7JA 1UXSA 1F4YL 5F1SA 3T4AA 3DVGB 2CRIA 4GUPB 3C60D 4OV6F 4KJYA 1J8KA 5F7KC 5FDWA 2D7TH 1I1AB 1GIGH 2VO5A 5CINH 4PV8A 4KK6D 5T3XE 1KIQB 5IESH 4HUMB 1NAML 1I8LC 3QRFM 1MAKA 2JJTC 1AP2B 4MLSA 4FXGA 3QDJB 3WBDA 5FYLL 1N6UA 1QEWB 5EUOB 5K9JH 1OARH 3ARXA 2GK0A 3LKOA 4NNXA 3D9AL 3SPVB 3N1MC 1EHAA 5I75B 2VN4A 5J3HD 4ERSH 1MQ8A 2BSSB 1H5BC 1MAJA 3W2DH 1RIVH 2ADIB 5D2NC 3AU1A 3DX7A 1SY6H 5D7IF 4FQJL 3SDYL 1RHHB 1XF5A 4ZYKA 5IEHB 5EIIB 4HJ0C 3O2WL 4P9MH 4S1DD 3OX8B 4B53A 4F37K 4HF5H 5F7EL 2GAZB 4YUEH 1KCLA 3VFTA 1QFWM 3BQUC 1KELH 4HUNB 4Y5XB 5E5UB 1D5BA 3GZKA 1OAZL 4M4RA 4ALAH 3MREA 4J7RA 5BVPL 1A6AA 1E4XH 3MPCA 3I6KB 1WT5C 3W39A 1MCPL 5C08B 4U1HA 4Z7OE 1YNLH 2F19H 5D1ZA 5I17B 4Q9QH 1ND0A 3SCMB 3GK8H 2VQ1B 4IRJB 4PG2C 1ZHLA 3HUJF 4JFEA 2DDQH 4JR9L 4J23A 5L2JA 5D72H 2HKFL 4RWYH 2YR3A 4WFHE 4IRSA 3CCHA 1V5JA 5D7LA 1ZLSL 3IDJA 1UM6L 4X0KA 1VFOA 4PJIF 2JB5H 4HWBL 5KVGL 4TPRL 3GHEH 1PX4A 1GC1L 2K1MA 3MJ7A 1JI1A 1JWSB 1NANI 4JG0H 1CGUA 1L7TH 3NZ8A 1CE1L 3M8OH 4Y19A 2PW2B 4NFCA 3DMMD 3JVGC 2AEIT 1OP5K 2BNUB 3U0TA 1HIMH 1R0AL 2OZ4L 2MCPL 4NNPL 1P7QB 5DJDA 4DGIL 1E28A 2Z8SA 5DJYA 3VI3E 4FFZL 3FN0H 2QJDA 1FYTA 4MJID 4Y7MA 2ICWA 2G5RA 2A6JA 4XHJC 4K8RC 2WINB 3V6OC 4OZHE 1QFPA 3THML 1AHWA 4ZFFB 1MJJA 5DD0L 3L3OA 3IDNB 1CXLA 1QHOA 1VEPA 5IB5B 4YHNA 3V0VB 4LRIA 3FB6B 2AV7B 1CICC 1Q0YL 4LRNL 1U8MA 2FJFB 1FO0A 5INDA 3V0WH 5C0CA 3S3SA 3OJDA 4MA3B 2FZ3B 3GMRA 5DRWA 1IAOA 3WFHA 4YWGH 4O2FA 4K9EC 1T7WA 1QFOA 4PJXB 3OKKA 2ICWJ 2W60B 3UMTA 3D3VB 3UTQA 3DURA 2HN7B 1Q0XL 3BP5B 3TWCH 4YC2C 3T0ED 1JRHI 2A1WH 5GRUL 2BNRE 2XTLA 4ZXBD 1NCNA 1A6VL 4YXHL 3B9KB 4OLUH 3QB7C 4UIMA 5EIVA 3CFBA 4LBEA 3OHXB 3ZLQC 4L4TD 1V05A 1X5JA 4UTAL 2WWMD 2BVQA 1FH5L 4JFDD 5JPMA 1G9MH 2GK2A 4Z7WF 4L29A 3QDGE 3T0XA 4OCSH 1YPZB 2BSRA 4Z95L 3GMMA 1S5IH 1DEEB 5F1OB 3VXSA 5BS0E 1BAFH 4WO4C 3TYGL 3LS5L 4XHQA 3QUYC 4Y16B 2ARWA 4IMKC 1T21A 1NCWH 4PY7B 5KVDH 3EKCA 4NFDA 3RUGB 3BPOB 4HKZB 2AXGA 4ZD3L 2VUOA 3SGJA 5HHNA 4MQXD 5SX4H 4XX1E 3V95A 3W0WB 4PJ8A 3RU8H 5MHSE 5FB8B 4QGYA 1NFDA 1AGFB 2YD5A 3V5DA 1RZ8B 5TDPA 3BDXA 2E5EA 3RNQB 4PRBA 4HUVA 1ZVYA 2ZUXA 4LU5H 5D96B 1JFQH 3UC0H 3WLWD 4TTGA 1T7YA 2B1HL 2EDLA 1NJ9B 3RZCB 1N4XL 3JV4B 4OLZH 5JXED 1UQSB 4K23L 2J5LB 4UILH 1QA9A 3IDUA 4HX1B 3RNKA 4Y8DC 3NMEA 4L3EA 3VI4E 3ILPB 2X70B 1KYOJ 2AVGA 1RIUH 3FQWA 2AK1H 3UJTL 2B4CH 1A7NH 3ROLB 1AE6L 3KNBA 3ALWA 4L4VD 3EGSA 5M7QA 4K7PY 4KVNH 4Z7QE 1NAMA 4EVNB 2X42A 3O0RH 3ZT5A 5LBSL 1MH5A 4ONHB 3DXAE 5JNYB 4KROB 4ZUUB 1DVFC 3FN9A 5GGRB 4HIEB 3VXUE 4IEFB 2G2RA 2YD9A 4JHAH 1ZGLA 3D1MC 4X6DB 5CJ5A 4JY5L 4BYHA 4PIRF 3RPIA 5E03A 2CXGA 4KWUA 1G0XA 1U0QA 2XZCL 3QI9C 4LSTL 4QRTA 1Z3GL 1OVZA 1GGCH 2IMMA 4OZIE 2VITB 4GMTH 4QF1A 5IM7B 3C5JA 3RWFB 3BO8A 3UBXI 1A6PA 4R8WL 3VRLE 1PW3A 4K7PX 4NKQB 5F21B 1JHKH 4HKBB 2VDKL 4XB8A 4JDTH 1Q9LA 5H94A 4UNUA 4WEUD 4IRZL 4MGXA 3MRBA 2ZCKH 3RJDA 4W81A 3QPXH 2W0FA 4WHCA 1KXVC 1I85C 1IAIM 4YPGB 2D7QA 4FMKA 5IFJA 1FNSH 1HE7A 1X4YA 4PREB 2AKRB 2NY2D 5K9KA 1RZIA 5A16B 1CFSA 25C8H 1G7PA 5BW7C 1N6QH 4Z7NE 4K55A 4JFPB 5KVEL 1UXWA 4WNQA 1HYRC 3MRJA 4LIQL 4HWBA 3UYRH 1QFWH 1G9MC 2A6DA 2W0KA 4JJHA 1SEBA 3RL2A 3WIHH 2B1AL 1I1RA 1MIEH 3EZJB 3GMPB 5FO7B 3G04A 2C7UA 3V2AR 1BVLA 1KIRA 4U6YB 4QXUH 4Q9RL 3HRZB 4S11A 3FT3A 1UXSB 1AQKH 4DTGL 4L3CB 4ENED 2DB8A 1OSPL 4HZLA 4KJYB 3FFCB 5F7MC 3BVNB 5FDWB 5HBBA 4ZNEA 2DL9A 3B5GA 3D39E 3HE6C 4HQQH 4NPYA 5F7DB 3G6AA 4LCWD 4X7SH 2CGRH 4YHKL 1SVCP 2OTUA 5IQ9B 2ESVA 1MFEL 4K3GA 3GKWL 1HOCA 2P5EA 4XP4L 1AXTL 1Q9WA 4NNXB 3IYLW 5GIRB 2VL5A 1BEYL 5FOBA 2IGFL 1VGKB 1UH3A 3I9GL 1DLFH 2AEWA 1HCVA 3KYKL 2ENYA 3AU1B 3ARGD 1LMKA 4APQC 2B4CC 1I8KA 2BXZA 4RBPK 3WUWG 3ZL4H 3BDBA 3KJ4B 1X44A 3BXNB 3TBYA 4KRLB 4EI5A 4NJ9L 2YZ1A 3CFKB 5SV4A 2AI0H 5IJVA 3LKRA 1CL7L 4PB9L 3OGCA 5F1IB 5LGJA 3PL6C 5KVFL 3BPNC 4U1HB 5DFTA 4AQ1B 3F7PC 4RGMB 1EGJL 5IROC 5KSBB 2CIKA 4XVJH 4EBQH 1ZHLB 2MHAA 4TUOA 3L3DB 5HYJA 5M95B 1BVKA 5L2JB 1BLNA 1FVEA 4EN3C 4U1JB 3O4LE 4X0KB 5EA0H 3S96B 2GEEA 4MQ7B 4JY4B 4Y19B 2NPLX 5BV7L 1G9EA 3EJJX 2NY0D 4RDQF 1P5UA 3BHBA 1N3NA 5B21A 2R4RL 1QLRA 4O2EB 4S2SA 5IHUH 3OXRA 1SM3H 4PRHD 3MRCA 5IMLA 2KH2B 1FFPA 4KZEH 1FYTB 3T3ME 2A6JB 1D6VL 4LCUA 4XBEL 3HI5H 4JFOA 2D4DA 4U1NB 1KLUA 1HHHA 1AHWB 1AKJD 1MJJB 4FFVD 4IMLB 4JGMA 4NUGH 3NN8A 5B4MC 5DJZB 5FA3A 1D9KA 3HZKB 4RGND 4MDJA 5F7YC 1U8KA 4NYLA 4P2RA 3KJ6L 2DQHH 4HGWA 4DUWA 4QRRB 5HI4D 2R0KL 1KT2A 4OM0H 3EFFA 4ODTH 3T0BA 1TTUA 2R0ZL 1DQJB 3WD5L 5SWQA 3SE9L 3ARFB 1AGDA 2A6IB 4MB3A 1G9NH 4NQDB 5FYKE 3UTQB 5T3ZD 3OB0K 2CO7B 2GTZA 3O2DL 3O9WB 2R1XA 4MJ2A 4W4OC 3ULSA 1S7QA 4QT5A 4WWKC 4YDVB 1K2DB 5E8DL 4L8CB 4NQCA 2ZCLH 2XXCB 3SE4A 4OFVA 4UU9A 5I8CB 5ELIA 2Q86A 5DI8B 3ARZA 4UIMB 1DQLH 4HG4J 3QUZA 3G6JF 5GSRA 4UT7L 4N9OB 1RZFH 32C2A 4OCWH 4Q9CA 2YPLE 4TULH 3QNYA 3SO3C 1UACL 2IAMC 3FQUA 5GGTH 1L0QA 1CDGA 2EDHA 4UQ2B 3VFOA 3WFBL 4XAKD 5JPMB 5CBEB 4L29B 4HGMA 4PJ7E 4KGLA 1ED3A 1MJUL 4UT9L 1U8NA 2ZPKL 4DVRH 2GIYA 3CFDA 4R4FH 4KUCF 3DUUA 4MD4B 2NY5C 5EOCH 1BD2E 4D3CL 3QG7H 5DSCB 1R3HB 3QHFH 1RULH 2CJUH 4XPTH 4DKEH 1OY3B 4HCRL 1OW0C 2EICA 4LHUG 3RWCB 4X9IA 2DM7A 4FOMA 4EUPA 4NN7B 3OAUH 4C83B 4K9EL 1PYWA 1IM9B 4JEGB 4PJ8B 4JZJA 3RGVA 4XNYH 1JBJA 4KAQL 3TYFA 1NFDB 2QQNL 5T1DL 1ROWA 4B50A 3WO4C 4GKNB 4P4RA 3V5DB 5ACZB 5TDPB 4BSVB 4JQIH 4XWGL 1HQRB 1WISA 4PRBB 4EQ3A 3BRDA 3K8MA 5C86A 4HUVB 1EHLH 2X1XR 1QSEA 4ZUTB 3QEHB 3D0LA 3O6MH 4XH2A 4AT6A 4WI9A 1EBAA 4XZUA 2BNQA 4KKLD 4HSQA 1YYLL 4FQIH 4K71B 2V9TA 3PWPD 2NYYD 4GW4B 1MLBA 4P2QE 1IAIH 3L5IA 4Y1AE 1JPGA 4PJEF 1DL7L 4M8QA 3CXDH 2PCPA 3KNBB 1KB9K 2DQCL 2JTDA 1YEFH 1FZMB 3L1OH 4W4NA 5E70A 5J9PA 5L6YH 3MROA 3CU7A 2H45A 3S97C 5CGYD 3BH8B 3BPLC 4RA0C 4NQXA 3RIFF 4P23D 4PJAB 4G8FA 4XPAL 5KAQG 1MH5B 2BC4A 5F9OL 3ZE0E 5GS0L 3SDDA 5CJXC 1BQLL 4JRWA 3MOQA 3W9DB 3BWAA 4NWTH 4YFEA 1KELL 1FL3A 5D1XD 2G2RB 4LQFL 1DBKL 4KXZI 3D2UB 2DTSA 4GAJH 1IC7L 4KK9D 3DX9A 5GS2H 5JLZA 1PEZA 5FF6A 1I7ZA 1KTRL 4WRLA 5DMIH 1Y6KR 1YEEH 5LAXB 3MA9H 2YK1H 4I18A 4GQPH 4MA1B 4QF1B 3C5JB 2BFVL 1LK2B 3BO8B 2RGSA 4I5BB 4FNLL 2CUIA 2AJSL 3C5SB 3TN0B 2E7LA 4HH8A 3LD8C 4ODSH 3ULVF 1Q9LB 3M17A 5C0AE 5C0RL 1WBYB 4MYWB 1IC5L 4OFYD 5SWSE 3STLA 1K3ZA 3GHEL 2I27N 5IUSA 1Q72L 4FA8A 3H9HB 2BVUA 4U49A 1UWGH 5T3XL 5IQ7H 5KS9E 1CVRA 5HVHC 3SKJL 4Z7VF 4PJBB 5AEAA 1DBJH 4LSUL 5K9KB 2JJTA 2A6KB 4YGAB 4N0UA 1G7PB 4F15C 3VXOA 1B90A 1AD0B 4RAUA 4C56E 3MRJB 2K7QA 3V6ZA 5H37H 4XP1H 3IAPA 4NP4L 2R4SH 1SEBB 2G5BA 3RIFK 2W0LA 3VD3A 4OQTL 5K59F 3DX6A 3GHBH 2GSIB 3S37L 3PV6A 2MPAH 4P49A 2AERT 3G04B 4K7FA 1BVLB 3EFDH 5C0BE 1H5BA 3ILQC 3N9GL 3FT3B 4LMQE 3JWDC 1S78C 3P0VH 4KGJA 5D2NA 5J1TC 1IGIH 2BY0A 3H7LA 4D9RD 3HG1D 5E6IC 2C3XA 2EDBA 4CDGC 1OPGL 1UJ3B 3KPPA 2NY3B 5ABDE 3BKYH 3PDGA 2XYCA 3L3JB 3WNOA 4DKAA 1Q8MA 2YC1A 4O00A 1VCAA 2VXUH 4R97C 5CBAB 5DHXB 4DW2L 5JQ6L 4PGBA 4MJ5A 1CT8A 1AFVL 3BN9D 3NACH 4ZTPL 1CK0L 2D2OA 2OTUB 2AK4A 4CVXA 4UTBL 4JKPH 1WGOA 3IDMA 3QT2A 3HLAA 1Q38A 3P9MA 4G6AD 2DLGA 4MNGA 2AJZB 1Q9WB 3UTTE 2VZVA 4LLUA 3MLTA 4FQHA 5JIHA 1T66D 4OCNC 1AQDB 4OV5B 3UDWC 4KRMB 5A3ID 4OD3L 3O2DA 4X6CA 1MFBH 2IANB 1ODAA 3GSXA 2YD7A 2BDNH 4XWOC 1V3MA 4HS6B 4KI5D 4V1DE 4LEOA 3T8XB 3TBYB 2AEQL 1OTSD 3C9NA 1OSZB 1N59B 5L0QC 2IPKB 2BERA 4CL7A 4EKXA 2P45B 5IJVB 4O2CA 1SMAA 4G8GD 5LGJB 1DANT 1KGCE 3SDCD 4DVBA 1OT1A 3V6OA 2AQ3A 3LN5A 5F6HI 1JHTA 4YFDB 2BVTA 4TTDC 2WBJD 4K3HA 3HUJE 1QLFA 4Y2DD 2MHAB 4TUOB 2J12B 5HYJB 2PXYA 3IXTB 4MVBC 1BVKB 4JFED 4GJTB 1BLNB 1FVEB 2V17L 4Z5RA 3WHE1 5CD5D 1E6JH 3P77A 1CICA 3QAZC 5E2TL 1WVZA 4LU5L 4LHUA 3MRFB 4PJIE 4HCRA 5A2KH 5J11B 3UC0L 5D7LD 4EDWL 4KRNA 1CFVL 3BIKB 2NNAA 4E41E 3F65A 1OAXH 3HCVA 4OLZL 1A4JA 4PPTA 2Z0BA 4X80H 3U82B 3FL7A 1N3NB 1OGAA 3U6RA 4Y4FB 3VFNB 5F88A 1TPXC 1W8OA 3OXRB 4JANB 3RKPA 4PRPE 1NLDL 1FFPB 4MNQA 4KRPD 1A4KA 5DQ9B 3L3KB 2YXFA 3EO0A 3GBMH 3VMPA 4JJ5A 4R2GB 1SJXA 3MNWA 1HHHB 4U3CA 5DEGA 4KVNL 5KTEL 5ERWA 1N6VA 2E6JA 1U6AH 1PFCA 1FNAA 3GI9L 5FA3B 3HC4L 1MUJA 3FKUS 2BRQA 2PUQT 2X89A 3B2UD 4MDJB 1YEKL 1I1CA 3TT3L 4HGWB 3QCUL 4OF6A 1RMFH 3HI1A 4OI8A 3O3BA 5ALBL 3GEWB 3EFFB 4MS8C 4EI6B 5C0CD 2F54E 3QUYA 3E0GA 2VUYA 1BFTA 5D1QC 1F90H 2C3VB 2ZG3A 1A1MB 4DZBA 4G80A 3VGBA 2VZSA 1K8DB 4P2OB 2R1XB 4XX1G 1UWEH 3NA9L 2ZWLT 3F7QA 1MREH 1S7QB 2XACC 5IB2B 3FRPG 4KQ4H 1E6OH 1BIIB 1JHKL 4FQ2L 3BGMA 4BFIB 3MV8A 1S9XA 2ICWI 4UU9B 4Z8FL 2Q86B 1J1PL 4BZ2L 4JM2B 4NBYB 4QXTB 2V5YA 4X4YA 1BZQK 3TVMB 1LEIB 3MGOB 3QNYB 3CUPB 2F8XC 3G5YA 3FQUB 4OUUA 4NHUA 4F7CA 2DQDL 3NTCH 3O6KH 1TITA 2R23B 4X7EC 5IW1B 1U8NB 2WAHA 1HHIB 1FBIH 2N7AA 3DUUB 5D70L 5JOEA 3VXSD 1CDJA 1WCBA 2JJUA 3AXLA 2GT9B 3UTPE 4JHWH 1JL8A 3PJSA 4Q97A 4P46A 3PWJA 2H41A 3PNWA 4X5XA 5D7IB 4NN5C 4EUPB 1KJ2H 1WFOA 4HXAL 3UTSD 1M71B 1MFDH 3RGVB 4O5LL 4JN2B 4MD5A 3EHBC 2V2WA 2YA1A 4W68A 1GVIA 1X7QA 2G9HA 1DVFA 3TZVD 4LSPH 4MQSB 4F7TA 3MFGB 1QSEB 2VH5L 4OQTA 2D9QB 1CLYH 3D0LB 5JIPA 4AT6B 1P4BH 3BGAA 3OR7B 5HGAA 1QYGH 1VENA 2XN9B 3HKFA 2GHWB 4JGJA 4FFYL 3R06A 1JGVL 4GAGH 4UT6L 4KHXL 5GRXG 2WK2A 1S7XB 1SHMA 5HDOA 3WMSA 2PCPB 3GJFH 4ODVH 3C5ZB 4MA7L 1KBGH 2PN5A 1VEMA 3H7BA 2NY5L 3LEXA 5J9PB 3QIWB 3MROB 2MKWA 5C9KA 1GGIH 4KTDH 5J8OA 3BDYH 4NQXB 5I8KL 1FGVL 5HYFA 2IALA 4G8FB 2YRZA 1FL5A 3VXRE 4JN1H 2ZJSH 3SDDB 3FZUD 1F6FB 5FYLD 5EOQH 4IDLA 1ES0B 4XRCB 1FVDB 5HD8C 1NCCL 3K1KC 5TPWL 5CEZD 5C71A 3ZDYF 2F53E 4GT7A 2O5YH 5JLZB 3DX9B 3I02A 5ACMA 2B2XH 1DLHB 4J12A 1NEZG 1IAKB 3R0NA 3Q3GB 2OJEB 4J3TA 5EPMA 1U95B 1UJTA 4KTYA 4I18B 2FLBT 5IP4A 2E27L 1I3RA 5J13C 3J7HA 2BJML 2R9HD 4H5SA 5JPNA 1V7ML 1C08B 1I9IH 2YMXL 3M17B 5HHMB 2J3SA 3EW3B 4ORGA 4Y4KB 3V4VH 4YHYB 5E9DD 1BOGA 1QNZH 4I48B 1ZWIB 2FX7L 3RQ3A 3IDGA 3RA7H 2QQKL 1UM5L 1LVEA 3BKML 4Z7UB 4RIRA 2CKBH 4JPKH 3GJFB 1T5XB 4N0UB 3MOBH 4MDIB 2VIRA 3T65A 4MXQD 3VXOB 4AM0A 2GFBA 3OZ9H 4RAUB 3W82A 3CDGB 3V6ZB 1ETZA 1MCFA 1S7UB 5IVXF 2IMNA 4CADA 3QISA 5JW3L 1U8HA 2G60H 4S1SH 2G5BB 1CE6A 5BV7B 3VH8B 3DX6B 4Z7WB 3PV6B 4L8BA 2NX5D 4ONFH 5ESQA 3GRWL 2PYEE 4AJ0A 1H0DA 3FQTA 2FGZA 4POZC 1CD0A 2E9IA 3FMGH 3DJ9A 3RWDA 3IGAA 3U4BH 1ZANL 2W65A 4APQA 3U7WH 4OM0L 1FIEA 2FWOB 4NO3B 3MC0A 5TQ0L 5ILTL 2HLFC 3KPPB 1NDMA 2VISA 3CVHH 2C1PA 4PGEA 3Q2CA 3KYNA 2YC1B 3TO4B 4N0CC 2VDPH 2LU4A 4X4XA 3PL6A 3V52L 4PGBB 4TOYL 4MJ5B 1RZ7H 3U36B 3P30L 4JO1L 4TSBH 5IROA 5HHVH 3DROA 2X7LA 3IDMB 4XC3H 5BS0A 2Z9TA 5MEPA 4Y4HB 3HLAB 2ESVD 4JFXA 1YYMH 3NFSH 4MNGB 1I7RB 3K81A 5FIEA 2P5ED 1RZFL 1G6RL 4LLUB 4FQHB 1ZE3C 2NW2A 4EN3A 3NPSB 1G7MA 5HHOB 2HT2D 3SO5A 4X8JB 3MNZB 4C55A 4J8RB 3GSXB 4TVPL 4FFWC 5CP7A 1CG9A 4P5MA 3BP6A 4LEOB 4UUJB 3L5WA 2EE6A 3C9NB 3H3PH 4F7PA 3WFDH 4QRUB 1SVZA 3JWDL 4C4KO 1KC5H 4EI5D 3DUSA 3KLAA 3GSUA 3VXME 4DVBB 1N8ZA 3MRPB 4C54A 1V7NH 5DEZA 1GXEA 1Z5LA 1CF8L 1MRFH 5ESVB 4WJ5A 5E1HB 1S7RA 5CJ8A 2PXYB 4V2BA 4WVRA 3P77B 4PP1C 4WFED 1CQKA 4OF5A 3DGCR 1PVHA 3BISA 5I1EL 5ALCL 2X4QB 5BRZB 5C0GA 4PS4H 4ZQKB 2NNAB 5F9DC 1ORSA 3BZ4A 3LQZA 2Y36H 4AK1A 1A4JB 5DMGC 3O8XA 5FYKL 4FQIL 4Z76A 3U6RB 1OGAB 4MZ2A 4PTTA 5F88B 3CC5B 4NRZB 3KPQB 4PRDA 4W4OA 4S1RH 2Y6SC 2EKSB 1S9WA 5J1SC 2YUWA 4C58B 4MNQB 4IDJL 4Y8AA 3VXUA 9CGTA 4I2XE 2EH7L 3L7FA 2HLAA 3EO0B 2AJUH 4ETYA 3OWEA 2CK2A 3HNTL 5DEGB 3L9RA 4Z0BH 3EZ8A 2DTML 1MUJB 2IAMA 3A6CL 1D9KD 4OZIA 4Y5VC 1S5HA 1MI5D 5CUSH 2BHZA 4P2RD 2NY1D 5FDYA 4P3CH 2ZZUT 2CDGB 3VXPB 1ZLUK 4L9LA 3NBNA 4ONGH 5FGCB 4HWZA 4OM1L 1DSFL 3DGGA 1EEYB 4ZSOB 4LCYB 4OZ4A 3ARRA 3BE1H 1T0NB 1F6AA 1WTLA 4DUXA 3C8KA 1HSAA 1OW0A 4DZBB 4AZ8A 5TDNA 4H0HB 4WEBH 2BSTB 4NBXB 4WU7A 4YDIL 3OB0H 1LO5B 1YEHH 1JWMB 1SEQH 3TCXA 3EOYG 1S9XB 1N0XH 1ZLWK 4HIIA 4NQCD 5FUCE 4F2MA 5B38A 1MHHB 2HTKC 3QUZD 4G6JH 3P3YA 3IJHA 4H26A 2EIEA 3G5YB 3RTQC 4OUUB 1LEKA 1CLZL 5FM4A 3WKMH 3R8BB 1RUMH 4NCC1 5EU6E 4YXLL 1F42A 2C1OA 3MBXH 4WUKL 4CMMB 2XY1A 2VQUA 1F8TL 3G5XB 3JV5A 1VEOA 4DOHE 4KY1L 5H37G 1F4WL 1KN2L 2O5XL 3CSYA 3PJSB 2DLFH 5D2LF 5GQBA 5EBGA 4P46B 3OR6B 3PNWB 4CJ0A 3VWJB 1HINH 3I6GA 4X5XB 3D39A 1Z9MA 1HQ4A 2BXYA 5IMOA 1BM3H 1UYWL 4NNYA 2X4UB 3LRHA 3U7YH 4NOBA 2Z8RA 1KEML 4R4BB 1AO7D 3QIBC 3OXSA 4N9GB 3P0YH 4WUUE 4OJFL 5D7SH 2OI9C 3RP1A 2ZKHH 5EO9B 1X7QB 2G9HB 3L3IB 4LLDB 5CJXA 5JUEH 4LCIL 4NN6B 4PJDA 4PLKD 1J05A 2XKNA 4K3DL 3K80A 3BP7A 1IE5A 3IDIA 1BP3B 4EOWL 2VXUL 5TQ2L 4MJ6B 3GRWA 3SGDI 1HZHL 2P5WA 5HGAB 2WSKA 5I71B 3SBWC 2BNQD 4PFEA 2F58H 1WZ1H 4LOUD 4MSWA 1NC4D 1B4JH 4PJEE 5HPOA 2Q6WA 5DDHA 4U1SA 4AIOA 4EXPX 15C8H 1LO0L 3HMWH 4W6YB 1F3DH 3A67H 2ENSA 4ZO7A 4ZFGH 3T0DA 3H7BB 1KNOA 3LEXB 2XQBH 4YE4H 1UB6A 1XF4A 2IALB 3IF1B 5IV2A 4MAUL 4WFFE 5GGUA 5JTWA 1TQCB 2VDRH 4JO4L 3CX2A 4XCCL 1KJ3H 1LP9B 3TJEH 1G6RA 4LSVH 3O4LA 4OF0A 4CNIA 4KQ3H 2EYTB 4JFDE 1X4XA 2NXZC 3G08A 4QY8A 2C4FU 3RWJB 3I02B 3NIDF 4TNVF 1IKNC 3KG5A 2VLME 5T5NF 3CXHK 4JFZH 3SE3A 2AJVL 3HR5A 5IHBA 4WENB 3WEXB 3UROR 4LHJB 1C12B 3HZMB 4YDLC 3HHRB 1P4IH 1QPXA 3TH4T 5KW9H 1JWUA 3IDXH 5DJ0A 1OHQA 5JPNB 3ULVE 2FGWH 3ZHDA 5ADPH 2QBWA 3P40A 3AMKA 5JOFA 4ORGB 2QQQA 1T7ZA 8FABB 1FZKB 1RI8A 4HXBH 2FIKA 1I75A 5F9WC 3IDGB 2H6PA 3GI8L 2W9DH 3HE7C 3ZKXB 4HIJA 2C9AA 4Z7VE 3WFCH 1XF2B 5EZJA 2AV1A 2E9WA 2X1OA 5HJ3A 4HS8L 5FA4A 2VIRB 5GJTL 3G6JB 5GHWH 2Q8BH 1ETZB 2M2DA 1HH9A 4OF7A 5SWZE 5ITFA 4U2YA 4PRIB 3FO2B 1A1OB 4HBCL 1CE6B 1FPTL 2D4FA 2PKDA 5IW3A 5LG1A 5K59E 1EA9C 5I76B 1U6AL 3BP4A 3U83A 4L8BB 4NZTL 5ESQB 3BKJH 3UDWA 4I3SH 1TZHB 3RDTC 3FQTB 3KPNA 1FNLA 1L6ZA 3RWDB 4RGOH 5I1GH 3DRTA 3LEYL 5HI3C 4XVSL 2MKLC 1E4WH 2X10A 4HJ0D 1NGQH 1TZIA 3P73A 5IOPB 3KYNB 2YPLA 1ADQL 4R0LC 3BQUD 1F02I 1AXSA 3LV3A 3CFIC 3N50A 3TBTA 5T33H 1D7FA 5IB3A 4PJ7A 4TNWK 1IQDB 3CZFB 1QSFD 1OAYL 2AK4D 5J3HC 5MEPB 3FO0H 4DK3A 3ULVH 2VTFA 2OL3L 1P69B 5EIQA 5TGBA 3L5HA 2FD6L 3LPWA 1FV1A 4LAQL 1KYOK 5SX5K 4ZS6C 5KOMC 1I1AD 1SBBA 4UIKH 1CGSH 3H9SB 3K8LA 1DFBH 5HGGS 3DUHA 4LSRH 5FUCC 3MCLH 1QP1A 3BP6B 3BMWA 3KYMA 2FECL 1VACA 3IDYC 4HFUL 4X6EA 4HMDA 4D8PA 3INUL 3QHZL 3P0GB 3QDJD 1VPOH 2B20A 1JNLH 4M8VA 2UWEF 1D5IH 3DUSB 3KLAB 3MBED 3V6FB 3QNXB 1ZSDB 2VLLB 3RVWC 4XHJD 4K8RD 3OJ2C 4FQ1H 4MA8H 1Z5LB 1EH9A 3QQ9C 3S3JA 5CILH 4P2QA 1NDGB 3QQ3B 1F2QA 4WJ5B 1JF5A 4Y1AA 4XCFH 1HDMA 1S7RB 4FTVE 4O9HL 2CLVA 2FX8H 4J3XA 1TFHA 1LHZA 3S36L 1SBSH 3N85H 4LHUD 4YDKL 2GITA 5C0GB 4MQTB 1ORSB 3BZ4B 3HZYA 2HVKA 1XGYL 2WIMA 4M1DH 3V4UL 2AXJA 4LP4A 2JKXA 3O8XB 4UV4L 4P3DA 4ORZC 4Z76B 2GCYB 4PTTB 1KIPB 4HPOH 4ETQA 4WI7A 3MLVL 1TJHH 4PRDB 5K9OB 4WW1B 1KJVB 4L9DA 1IGML 5DJ6B 5EC1A 1JHLH 4OAWA 2O61A 3SQOL 4L5FH 4P4KB 1XGQB 1A6ZB 3LIZL 1N5YL 1S9VB 3M45A 1HHJA 3M1BA 3GB7A 3WDIA 3L9RB 2N56A 3EOTL 5D5ME 4OLXH 1R3IL 3TH3T 3RVVC 1D3CA 3N1PC 4KH2A 4Y0GA 1I3GL 2WMPA 3VH8G 1S5HB 5TE6H 3D0VB 3WE6A 3G6DL 5F9JB 5BJTA 1JYWA 3HMXH 5EULV 4KPHL 4P9HH 2G75A 3UTZB 3KPRE 4L9LB 5C0AA 3S4SB 4HWZB 5SWSA 3DGGB 5TE4L 1JTTA 4WO4D 2EDDA 3BT2H 3QUYD 1M6OB 1MHEA 3LS4L 1F6AB 5BQ7B 3L6FA 1MRDH 3MOAL 1UH4A 3C8KB 4HWNA 5TDNB 3MV7E 3HTLX 4X99A 2R69L 4M61B 4NC1E 2HTLC 4K94H 1GL4B 2FH8A 2CDEB 5F3HB 4U3XA 4HK3J 5DQJA 3FO1A 2MCG1 5I0DA 1IGYA 5FEBA 3MV8D 5I19L 2QQLL 1MHPH 3CDFA 1TZGL 3QJFB 2A9ML 5JORA 4XP9H 3GSNH 1CGWA 2KBGA 4KKNA 2YOCA 4YHPB 3MJ9L 5C0BA 4HFWA 5FKPA 4JRXE 4EZMA 3FQRB 1EFQA 3WIIL 1C7SA 2CKBL 1QLEH 2C1OB 4X8XA 4NHCL 4ZPVB 3ULVC 2OK0L 5D6CA 2D7MA 1F3JA 2V7HA 5A40E 4M1GL 1NGWA 3BYTA 2X4PB 3ROOA 2NY7H 5C09B 1YJDC 3CSYB 3OKOB 5GRWA 1KPVA 4FZEL 1HI6A 2B5IB 1HQ4B 4ZUWA 3PWNA 1IAMA 1JPFB 4NNYB 4QOKB 2P4AB 4XMKH 1KLGB 4IIQC 1R5WB 2V9RA 1UVQA 3S37X 3WLWC 2E9BA 1JNNH 3O3AB 2Y23A 4LPVA 1E4XI 1HNGA 4I4WB 5HVGB 2DIJA 4Q6YA 4PJDB 3UTTA 1J05B 2FHBA 4U6HA 1DVFD 4XPBH 1KN4H 3T08A 3IDIB 5IT2L 4CVWA 3WXVL 2XRAH 4NGHL 1MCSA 3VA6A 2EE9A 1CD8A 2VR5A 2P5WB 2QKIA 4I8DA 1FVCA 4YJZL 2XFXB 4RMTA 5HHVL 3QI9D 4PLOB 2Z91B 5LCVH 1CN4A 1BPVA 3FFDA 3MV9B 1ADQA 3GSNB 5EORH 43CAB 3DSFL 4PBXA 2ZG2A 2MWCA 4DAGL 2IPTL 2UZIH 4YBLC 4JFFB 1VADA 4G9FE 3VFGH 1UB6B 4GRLC 2P8LA 1FAIL 5EWIL 2NY4B 5I1HL 1CLCA 2NLJA 4EDXA 3HUJA 4NKIL 4NOFA 5IV2B 3LN4A 1XH3A 3EYUL 5GGUB 4I9WE 2OJZL 4GBXC 5H8DA 2EYSA 2FB4L 2HJFA 1Y0LB 1HXYB 3D85A 4NUJA 4AY0A 2OM5A 2X4RA 2XWJA 3V4PL 1MFCL 2NW3A 2OL3A 4HUUB 3F12A 1G6RB 4GXUN 4CNIB 4G3YH 4WFHD 1RPQA 3ZDYE 4QY8B 3KYOA 4JM4L 4KTEL 4JPVH 4KDTA 4XB7A 4G7YH 5IB1B 5J06A 2NXYB 3WKNA 4LVHB 4P9HC 3C2SA 5T1KA 3KHQA 1YECH 4LDOB 5FK9A 1WSST 3LN9A 3VFPB 5BO1L 3K1DA 4CU8A 4IOIA 4PRPA 5DXWA 2XTJB 5DJ0B 5L2KE 4JKWA 4AL8L 3IFOB 3X3GL 3QUXA 2WNGA 4PRNA 3BZFB 4BSWB 3MYZA 1IGTA 3T77A 1EERB 1Q9KA 4Q6IB 2FATH 2WWKO 3MV01 1INDL 3QEUA 4JRYA 5GISL 1IEBA 1TQBB 3HE6D 5AD0A 1W2KT 2AQ1A 3VRJB 4LK4A 4YIQA 2F54A 2EC9U 1AGBB 3HRPA 2EEAA 5C6TL 1IBGH 3LKPB 2X4SA 2E7BA 5ITFB 5GXBB 1PDKA 4Z0BL 2BVPA 3VFWA 1PSKL 1U8JA 2I9TB 4OZGF 1NC2B 2LTQC 4XBPB 2XWTB 4DN4H 3SGEI 1XGRB 1L0XA 2DLTA 2YD4A 2FO1A 3NH7L 2BNRD 1AC0A 1FFNA 4JAMB 3S34L 2RCSH 2H26A 4O58L 2Z8WC 1BBDH 1MCQA 5DQDL 4Q58C 1SJVA 3MRKA 3C2AH 5MP6H 3TF7C 1TZIB 3P73B 4CGTA 4I1NB 2ZUSA 5SX4I 4GW1B 3DYOA 1J8HE 3T2NL 5ISZE 5KVMC 5DLML 4N1EA 4X5WB 4YX2L 3PL6D 3CK0H 3PIQA 3LH2H 3SDXF 3QDGD 1RK1A 5B39B 1CD1A 2M8XA 4YDJA 3RWHB 4QRPE 3S9DB 4DEPC 1KENL 4ZPTA 5BS0D 5ID1A 3GFUA 5TH2A 4FG6C 2R1YA 2NZ9C 5IJKA 1FV1B 5LQBL 2Z31C 3WS3A 2IFFH 5D71L 1M05A 3FFCD 2W9EL 4G6KL 2DMKA 4NC1C 1KIUA 2PF6A 3BKCL 1IARB 4LASH 3WSQL 3NGBB 2E7MA 2VXSH 4RDQG 3FB8A 4BQ6A 3LOWA 2I07A 1H3VA 4AH2A 4KV5F 1VACB 4X6EB 5KSVB 1F58L 2OLDA 3OKEA 4D8PB 1IGFL 1W0VA 3EYSH 1B0GA 12E8L 3EO9H 4OFKA 1JGDA 1A1NA 3UO1L 2QSCL 3WLBB 4U1KB 1HINL 3GUTB 4ZOCA 3MJ9A 1FNGB 1QBML 2CKBA 5JZ7C 1BECA 1R3LB 1JGEA 2YRPA 3LQAL 1CFTA 1XCTA 3MV11 5B4MD 1EXUB 1X5LA 3TNMA 1NAKL 1LD9B 2WUBH 4I77L 5CHNB 1KUMA 4XPFH 3ULUF 2HRPL 1UT9A 2YWZA 2Z35A 3HS0A 3BJ91 2GITB 4NZRL 2WWKT 1EFXB 1FGNL 4UQ3B 1KCSH 1CBVL 1D5MB 3LKSA 3VXRA 4LFHG 4JY6A 3VG0L 3DXAD 4D9RE 2IH3B 3HG1E 1VKXA 3LB6C 3IVKA 4DK6A 3QIUB 1WWBX 3FT4A 4P5TC 5EC1B 2DKMA 4OAWB 2AEPL 4R7NB 2JCCF 4WWKD 4X98B 4POYA 1I9RH 2XIDA 2Q7YA 1HHJB 4X6BA 4J6RH 3GB7B 3C08L 4X83A 5I30H 1PJ9A 2BOCA 3WCYA 3UPCA 2X44D 3KPSA 3MMEB 3RTQA 5I1KL 4WDIA 5C2UB 4JVUA 1A14H 2IAMD 3T2PA 5C70A 1P6AB 3SOBL 5GS1A 3JV0A 2G75B 3JUZA 1LO2L 5IVXB 1C5CL 3I2CH 5SWSB 1NQBA 1NLBH 4X9HA 1FL6A 2J6EH 4XT1C 3L6FB 4CVZB 3S6CA 5F7UA 4OCXH 4CW1B 2HMIC 4X99B 1P6FA 4YHMH 4YHZH 5DJXB 1ZT7B 1UEMA 2DWEB 1D5ZB 1JRHL 5DYOA 2WUCL 2W0PA 5EUOF 5ANMB 3FO1B 3DLQR 4ZG1A 2VXVH 1S3KL 1VFAA 2OX5A 4D0BB 3CMOL 4FZ8L 1I9EA 2E7HA 3FAWA 4HXBL 3MLSL 4O02H 4LNVA 1FIGL 2IH1B 1MCWM 1RFDH 5I74B 1CZ8L 2VLJE 4N1CA 4NIKB 1LDPH 5EO0B 3TA3C 3V9FA 5FKPB 2KZWA 1AR2A 1NFKA 2ZNXA 4L8DB 3TPUB 3NOIA 5CGMA 1F3JB 1FRGL 1WWAX 3SBWA 1BJ8A 2Q3AA 5LGHH 5D8JH 2V7NA 3I6LE 1A3LL 5CLTA 4YQXL 2DF3A 5E08H 1M7IA 3QNZB 5CJQL 5D2LE 3LKNB 1MJ7L 1NBVL 2X4TA 4JPIA 1E27A 2H3NA 3PWNB 4YHLH 3D39D 1U3HB 2W92A 5J56B 2JELH 4RRPG 1F4XH 4MNHA 5A2FA 1FP5A 1UVQB 3VG9B 1ZOXA 3U9UA 1N5AA 5E95B 5GRZA 4I0PC 5T1LA 4MXWL 2FBJH 4JVPA 2D3VA 5KZCD 1ZTXL 3TP4A 4HLZH 4OLVL 5I1LA 1JV5B 2EDOA 3SJVE 1IQWH 4WTWA 4XNQB 4QHLA 1IVLA 5J1AA 3LCYA 5I8EA 1KLFA 2QKIB 1BFVH 1UA6L 4R26L 1IM9D 2VDLH 2YKLH 4OUOA 1RZJC 2YPVH 4B7LA 4G9DB 3ULVL 1HSBB 2DJSA 3REWB 1KACB 2XZAH 3VXMA 1XR8B 1HHKA 2PETA 2JB6B 1A6WL 1J7VR 1CDUA 1FORL 4XNZB 5E2WH 3X11A 4KZDL 1PKQE 4M62H 4JPWH 1YJDL 4OT1H 5IGXL 4M02A 3S5LG 3MCLL 2BRRL 3D85B 4NUJB 5DMYA 1JJUA 4R96B 5D6DC 4OLWH 4ZOBA 1U8LA 2NW3B 2OL3B 3F12B 4GRWH 1ZVSA 4F7MA 1U36A 5DEFA 4NQEB 1A7QL 1F00I 3QQ4A 1J12A 1MCWW 3FHQA 3BD3A 3NIDE 2EIZB 2RQ8A 1R24B 3O11A 4WU5A 3GGWA 1Q1JL 4HIXL 4PJXF 2P47B 4PJHB 2ADFH 4CDHA 1U8QA 1CXEA 2HFEB 5T1KB 4XPHL 4OD1L 1SYSA 3DVNB 3AMLA 4JFYB 4XCFL 3C60A 3MNVA 3PXJA 4O51B 4N0FB 3RDTA 3LHPH 5CSZA 1FDLL 3QXAA 3BEWA 1MLCA 4I2XA 3VGGA 3ILQD 1YUHA 5EBMA 4CN4A 1S78D 1QOKA 5KJRH 3QUXB 3WNMA 1WUNT 1NGXA 4PRNB 5E6ID 5ECJE 2XOTA 3T3PF 4DKFH 1QO3A 1OAUH 4H8WL 4KKAC 4OSUL 3D2UD 1EPFA 4R0LA 3RWEA 3WHXA 1TCRB 4YO0A 1OCWH 2HT3C 4Y5YB 5E56A 4JRYB 1IEBB 4M7LH 4LCCB 2DQGL 4WIQA 1QFUH 3RVXC 5EFIB 4N8PA 5CJOH 4YIQB 4ZO6A 4L5FL 2AXFB 3UCRA 3VW3L 4P99A 4HC1L 5DA4A 1RURL 4PJ9B 3CMGA 4RFOL 3RFZC 3V5HA 2VLRD 3MXWH 4BK5A 3MRHA 1U8JB 2X1QA 5FYKD 2F5AH 5DGQA 5C2BL 5CMAA 5DWUH 2CUMA 4GRWB 1GGBH 3MLXL 2J1KA 4XVUC 2LAAA 1FFNB 2IADB 2CIIA 4XWOD 1K85A 4ELMA 3MRKB 5DUPH 5F7LB 4NO5B 1QBBA 2H2PD 1DBAH 3K46A 2YPLD 1KFAL 1YMMB 1KTLB 2OXGA 1WAAF 4BQ8A 5J7CC 1UM4L 3PIQB 5FGRA 2C26A 1RK1B 1M4KA 1CD1B 5DTFB 5F93C 1GYAA 1F45A 2BY3A 2HFFA 2NQCA 4UBDD 2GTWA 5CEZE 5FYJH 1NMAL 5A3IC 4TTDD 5ID1B 4JVWA 1CLOL 1K6QL 1BD2D 4MVBD 4DZ8A 1U92A 2R1YB 3DMMA 4I3RL 3IXAA 4Q7DA 5AWNL 5GS2D 3WS3B 2V5SA 1F3DJ 2BSED 4QHKJ 3CAFA 5D7JC 3DBXB 5FCSH 1QRNB 1T89C 3AC0A 4PJGA 2DBLL 4IHOA 1FCGA 3MR9B 1OTSC 5SX5H 3JXAA 3VGAC 5I8OH 3FB8B 1KB9J 1KCUH 4M43L 4WUUA 5ENWB 5F6IB 3WJLC 4NZJA 3VCLA 3SDCC 2R0LH 1MHCA 4NKMA 4HKXA 1GHFL 4AMKL 1RUAH 1NCAH 1FNEB 1IFHH 4LPCA 3KXFB 4Y89A 2Y07H 4OZFB 4QRQB 3WIFA 4AG4L 5IK3B 5CD5C 1KJMA 1YZZA 2A0LC 4XMKL 2ZNWA 5T1MB 1JGEB 3HAEA 4P2QD 5C7XL 1CFTB 1XCTB 4Y1AD 4WFGE 1K4DB 4M6AA 1RUQL 3IU3A 3NFNA 1WC7A 4HMEA 3ECBA 4YPJA 4KKCC 5C07E 2W9LA 5C0EB 4E42A 1U8IB 2V9QA 2DLIA 5KOVC 5L88H 3AROA 3RY4A 5ID0A 3T0EA 4RRPA 1RU9L 2Y5EA 1J11A 3LKSB 2BHUA 4G8IA 2AJXL 4JY6B 5D1QD 4DCQB 1VKXB 2B0SL 3IVKB 5MENE 2HJLB 1CDIA 2X1WL 2GI7A 3I85A 1CU4H 5AZ2L 3CGTA 5EORL 4JFDA 4AENA 3CLEL 3L95A 5BCAA 1MCRA 2Q7YB 1EEQA 1AD9B 4NT6A 4X6BB 4J1UB 4PUBH 1A0QL 3IFPA 3LEVH 2P8PA 4MX7B 5EU4A 1RUPL 3KPSB 3H42H 3VWKB 3CLFH 5DO2C 2AGJH 4HV8A 2KUTA 1IM3A 3ZE2F 5GS1B 3LPGA 1OD9A 1MCEA 3IU4L 4QGTA 4LKXA 4Y2OA 5C0AD 5CSGA 3ARDC 4MAYB 1B0RA 4S1QL 4LSSH 2YEZA 2DLEA 3RHWK 1FL6B 3AS2A 2N1KA 4PY8J 1NPUA 3V7AE 1RJYA 4R2GD 3MGTA 3D25A 3GBNH 3S5LA 2DQEL 2AP2A 3DECA 4JG1L 3QJHA 1G6VK 2HJKB 4KFZC 3Q48A 1HKLH 1FLTX 2DQIH 4IIQA 3HFML 4OFPA 5HHPA 4XCEB 5B39G 3KWWA 4XMLH 1F4HA 1GAFH 4C56D 5LXGL 3DVIA 3EHBD 4XNXH 1W72L 5KSAC 3D6GA 3DWTA 1GGTA 1A7OH 4WI3A 1UGNA 2DICA 2EDXA 4QRSA 2VXTH 2B39A 2F9BT 2QADC 3MUJA 5C0BD 1KCVL 5B3JE 1C1EL 1NKRA 1T1YA 4P2OD 5MEOA 4QTIH 3FCTA 3HPLA 4L4VA 3SDAC 2Q8AL 1KXQE 5FUOH 3ARVA 3NCFB 4FQLH 1M7IB 4D2NA 5DS8B 3VXTB 2X4TB 1E27B 2FNBA 5T3ZL 3VGEA 3O4OB 1H3WM 1FFOA 1W8NA 5HVFB 3PGFH 5DD3H 4PBWD 5IHLB 3NCJL 1IC4H 3TZVC 4L8SA 3VGFA 5KSBF 3LDBB 4HK3N 1T03H 4TSAL 3UZQA 2Y06L