3MODH

Crystal structure of the neutralizing hiv antibody 2f5 fab fragment (recombinantly produced igg) with 11 aa gp41 mper-derived peptide
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
237
structure length
237
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords gp41 MPER-derived peptide
publication title Crystal Structure of a Non-Neutralizing HIV-1 gp41 Envelope Antibody Demonstrates Neutralization Mechanism of gp41 Antibodies
rcsb
source organism Homo sapiens
total genus 42
structure length 237
sequence length 237
ec nomenclature
pdb deposition date 2010-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3modH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3modH01
4NO3A 2VIRA 5CSBA 1EEZA 4IHOB 4WU7A 5DTFA 3QUZD 4M43L 1ZT4A 3KYOB 3I3DA 5DVOA 4IRSB 5JHLH 3TBSA 1LNUB 4LEOA 3M17B 4YHYB 1MCKA 1CGWA 4HH9A 1S5HA 1EPFA 3QEUB 1CFVH 2DYPD 3NFNA 1QR1B 5EU4A 1SBBA 4U1KA 2Y9RT 4JRXD 3EYFB 2OQJB 3PJSB 4MJIE 4GAJH 1E6JH 3IS1X 1AHWC 1N0XH 4XT1C 3GSVB 3I6GB 4JGMA 4BZ1L 4KK5D 4NKMB 4E41E 1RVFH 4AM0A 4CU8A 2BSTA 1E4KC 2KZ1B 1H3XA 5DFTA 3ULVL 3S7GA 3QA3B 1QLRA 4KKCD 5FHBL 2A1WL 3SDAC 3IF1B 1OCWH 3QZWB 1U8QA 1NLDH 4LDEB 5ISZB 3MOAH 4DGIL 1ZLVK 3CLFL 3S3SA 1QLFA 3MFFB 1G6RA 1AQKH 3EW3B 4U6TA 1PGRB 2WQ8A 3DX7A 4XPTH 4R90L 1IARB 5JLZA 4JM4H 1LE9A 1DSFL 3EO9H 3S5LB 4I0CC 1Q94B 1P4LA 4F15C 2H6PA 2C7UB 3DX8A 1MY5A 3MRDA 2W9EH 4JRYE 1K6QL 4J7RA 1CI5A 2VISA 4LEXL 4Y4HD 4Z77A 3PWUB 4X9FA 2DKMA 5D7JD 3DI3B 2FJHA 4RBPK 1K4DB 1NCWH 2ESVB 4KY1L 5MEPB 1QNZH 1QOKA 4WFFD 2FH8A 2NX5E 1MCDA 3LN4A 5HGHA 3M8OL 2QSTA 4L3EE 1G0XA 3OX8A 5E2WH 2G5BB 2XY2A 1T5XA 3BGMB 1VGKB 3RX8A 4R8WL 4C56B 4XAWL 2G9HA 3RBGA 3LEVL 3UTTD 5JUEL 1I75A 3KLHC 3FN9A 4CW1A 4K2UH 4LLDA 5CEZL 4ZUVB 4O5LH 3TBVA 4TSCH 5DA0B 5ITBH 4NO2B 2ZUXA 1IT9L 1FL5B 2X4TB 5HGAA 2NY3B 43CAB 3MLWH 3UJJL 1BX2B 5TFSL 1J1XH 4RISH 4HUKB 2IALA 4WY7H 4KUZH 5E6IA 5IF0B 4PJCA 4NO3B 4KZDH 2OJZH 5EU5B 1L6XA 3SDCA 1YECL 4XNUL 43C9B 1MHHB 3UTPD 1KCVH 5FO8B 2VR4A 5C0RL 3S8WA 3FT2B 4R9HA 4MDJB 1S3KL 2X1WL 3BE1L 2IEPA 1LP9B 2XKNB 2FNBA 5F97E 2WIIA 3UTPE 2EE6A 1U3JA 3D2UD 3K2UH 4NPYA 2XTJD 3CH8A 1J05A 1NCDH 3V5KB 1QSFB 2A6IB 4YK4C 5E5RB 4X0KA 5EU4B 3VRLE 3LOWA 5HHOD 3SY0A 1CF8H 2GHWB 1D5ZB 4WO4C 1MRCH 2CUIA 1G9MC 4D9RE 2YOCA 1WBYA 5HI3C 3TO2A 1A7PH 1ORQB 3TV3H 4MJ5A 4BK5A 5E00A 4NWTH 3MREA 3HAEH 3QUYD 1KXVC 2EDWA 2E7MA 4NM4H 5DUBA 3CFKA 2ATPB 1DEEA 1YMMD 3CXDL 2GQHA 1MEXL 4K71B 3NGBB 1DLFH 1ZVHA 1WT5A 1YMME 2A6KB 2YD7A 2AJXL 6FABL 2FECI 4MNQB 3IDMB 2P5WD 1H5BC 3NAAH 4I0PD 5F1NB 2BJMH 1EJOL 2RAMA 3ARRA 1P4LB 5D7SH 3VGBA 1IGTA 4HKJA 4U7MA 1BVKB 2Z35B 2JCCE 3OG4B 2PF6A 4PRBA 5HYJE 3B8SA 2VSCA 2ZSWA 5DK0A 3PP4H 5HVFB 2WNGA 3LRGA 4MD5B 4NM8H 3R1GH 4D0BA 2GCYA 2QQNL 1N4XH 3MNZA 5FM5O 3OX8B 1S7QA 5DHYB 3VRIB 3WBDA 1T5XB 4WI7A 4WI8A 1MCLA 3ULVF 5EOQL 1DR9A 4U4BA 3TBYA 5GRUH 4Z0XA 1A1NA 3RVUD 4PV8A 4F33B 4HUVA 4BUHA 5IESL 4LVNB 1T1WA 1BBDH 5IHLB 5IT2L 2C3HA 4X6DA 4GW5A 1NC2A 4NZUL 5EZOL 1IC4H 4YLQT 1HINH 3PIQB 3RVXD 2NY0B 1RZ7L 4JFFD 4XCFL 4NHUA 4OLXL 3MUZ1 3S4SB 4G6KH 1OTUC 3SCMA 2OP4L 2FIKA 1I1FB 2FBOJ 3FONA 5IVXA 2JKXA 5DRZA 4OV5B 2CGRH 4XPBH 4GRLC 3B9KC 3GJEB 5HYQB 3MRIA 5HJ3A 3HCVB 4P2RB 5L9DL 3C2AL 2YWZA 3SO3C 3MV8B 5D96B 4YX2H 1EFQA 1HSBB 1MFCL 2BNRE 3INUH 2OI9B 1WVZA 5DXWA 1XGQB 4NPYB 1F8TL 1VFOA 5T3ZH 2AXGB 1HHKA 3ARGC 3UYRH 4AG4H 3MJ8A 4K3EL 1NGXA 4WEUD 4PB9L 4PJ9A 3TC9A 5F7KC 2XICA 5HY9A 3GBNL 4JZJB 4BK4A 3MRQA 4XWGL 3SY0B 4GSDH 3OXSB 4YDVA 1CD1A 4XB7A 3IFLH 1OP5H 2IFFH 1NGZA 5CGYD 1KTDB 4Y4FC 4CL7A 3ZDYF 3FOMB 1CIUA 1RZGB 1XF1A 3RJDA 3VG0H 4PLOB 1YEJL 4ZO9A 5C71A 5IFAH 1JPGB 4PLKC 2WINA 4IMLA 2W60B 1DEEB 2I07A 1QBLL 3GMRB 3TO4A 5JA9A 1X5AA 4UT6H 5H2BB 4F37K 1BOGA 2R9HC 1AH1A 3UPRA 1WSST 2J8UA 1INEH 4NFCA 3S88H 2VR5A 5ESVA 1SJVA 4F7EA 2WWKT 2D7PA 4NUGL 5EBMB 4IOIB 1OAKL 1S9KC 4J3WA 3STBA 4Y2DB 1GPOL 4U3XA 1OLZA 3BO8A 5DK0B 3JVGA 2NY6C 3L1OH 4FFYL 5JW3L 1ZT1A 2A9NL 3C6LD 1WBZA 5EIQA 2ENYA 4POYA 1JF6A 4XI5C 5IK3A 2CSPA 2ICCA 3PQYE 1NCCH 3K81A 3O8XB 3B2VH 4G7YL 2DQTH 4Z0XB 2XN9A 3JTSA 2YD6A 1KYOJ 4GMSH 4Z8FL 1BZ7B 2XZAL 5GISL 2AK1L 4P3CL 4P59L 1CE6A 2FJFB 4R97B 5I8OH 5C0GB 2YWYA 2V7NB 3MNVA 4LLUB 5MEND 1HXYB 2A9ML 4OCNC 3K8MA 3AS2A 4LRNH 2EKSA 5DK2A 4PJAF 5I1AA 4PRPB 5EUKA 2FGZA 3MUJA 4R7DA 1HE7A 2E5EA 2XPGB 1YEGL 5KW9L 3F6IA 4HXBL 2FIKB 5D9SA 3QWRD 3TIEA 4LFHD 1TJIH 3L3HB 5IVXB 3X13B 4KJQC 1HEZA 4Z7VA 3E2HB 3MRIB 4WWKA 5HJ3B 4IS6A 1UFUA 3NMEA 3T0DA 4DZBA 1YMHA 2VTFA 5D6DC 4XMPL 4JZOA 1K2DA 1I9IL 4M1GH 1FN4B 5K59E 2DI8A 3SDDA 1ZMYA 2I60H 2JTDA 1WIPA 2NTSP 1OAQH 3QFDA 1T6WA 3LS5L 3LKQA 3DURB 5IB4A 3RUGA 3C09B 4X4XA 4WCYL 4F3FA 1A6VL 1QFHA 4UINL 3MCG1 4OFVA 3HC0B 1YQVL 1UXSA 4NN6B 2FR4B 1RJYA 1I1CA 1QEWA 1EDQA 4DJMA 2WINB 5HD8D 4ZFFA 5HDBF 1UB6A 3IU3A 5CHNB 1JNHA 3WO4B 2MJWA 1DE4B 1QFWI 3QNZA 1KTLB 2WWKO 3QIWC 5E1AA 2PR4H 5GS0H 5I19L 4JKKA 1YY8A 3TYFB 4PS4L 2PCPB 3T2QA 4A6YA 1DBAL 1A3RH 3MXWL 3IDYB 4TPRL 5E95B 3U46A 3UAJC 3UJIL 4OF8A 4DGVL 3KPSA 4RMWA 3GMQB 3KXFB 2ZCKL 1WK0A 2XQBL 4U0QB 1YEDB 3O4OC 1FH5L 5KN5A 4ZPTB 2H45A 4AEIH 3QXAA 5D2NB 4GW4B 4IOSD 1IL1A 3UTSD 4HWZB 4QRQA 4XCYB 5F7FA 3TF7C 4MS8C 4YUEL 2YEZB 2AEQL 3UTSE 2X9YA 1RZ8A 1V8HA 3H0TB 4JO2L 3KLAB 4QHMB 3CDGB 3QUZA 4HFUH 4KI5F 3RDTD 2XN9B 3IDNB 5BZWB 1J1OH 4IRZL 1UA6L 3IDGA 4MJ2A 4KI5C 1CE6B 5D7IE 2YN5A 5D7KD 5CJBA 5SWSD 3GRWL 5MEQB 1RULL 3KYMA 3DXAD 3I02B 4N1EA 2VR9A 1P4IL 2VUOA 4Q9RH 1C16B 5D7KE 2BSRB 2O26U 5SWSE 1SYVA 3ZKND 2DYPA 3DVNA 5DJ0B 5CBEA 4KMTH 3AM8C 3LKRA 5I1AB 3GUTA 1N5YL 3E0GA 2HT4C 3GEWB 1DVFB 4JRXA 5L7XL 2EYSA 1HI6A 2DQUL 4U6XA 3TIEB 5C0DB 3HZKA 2C3VA 2FHBA 2UUDH 3JV4A 1KPVA 1XF5B 3MQIA 3TJEH 4PJHA 3OHXA 1MCFA 2DI9A 1EZVX 4IS6B 4PJ7A 3FQTA 3VXNA 35C8L 2IGFL 1J0HA 1UM4L 3ZE0E 3QDME 1K2DB 4I3RH 3VWJB 1EHNA 5TDPB 3VJ6B 1E4JA 1JE6A 3QFJE 5JW4Q 3EYQC 2DQJH 3QIBB 4UIKH 5FO9A 1VGEL 1V3KA 4BQBA 3DSNA 1CGUA 3HR5A 4M02A 2KKQA 3TJHC 4Y7MA 3P9MA 1FNFA 1X4XA 4NJ9H 3STLB 1NJ9A 4LPWA 5CJ5A 3QG6B 4OJFH 3AS1A 2H8PA 2RCSH 3TA3C 2UUDK 4Y4HA 4ZO8A 3N9GL 3ZT7A 1MHCA 1NGQH 1WEJL 3NCFB 4OZGA 5F8QC 1MFNA 3WIHH 1BPVA 2D31A 4ZFFB 3RU8H 5I8CB 1JZ3A 1HHHA 1XR9A 4G9FB 4PGZA 2XZQL 4HZAA 4P0DA 5ENWA 1S7RB 5ANMB 3V0WH 1YY8B 3VFOB 2I9TA 1Y6NR 2ICEB 5A2LH 4M7LH 4XNQA 2X6MA 3IJSB 5DJYB 3QQ3A 2BHZA 4R0LB 4MVBD 3UTTA 2V2TA 4KHXH 3WN5C 5BRZD 2EH8H 2AJYL 4JZNB 2J88L 5I6XC 3HNSL 4MA1C 4RRPG 1WFOA 1KIPA 4ZXBB 1EBPA 2ADGA 3QXAB 1XIWD 4QXTB 3KPRA 1DQDH 1T7WA 5D5MA 1IC7H 4G43A 3QT2A 3GSNA 4R2GD 1KIQB 4KDTA 3EYOA 1OAUH 5C86A 1D9KC 1CICB 3HAEB 1HIMH 4Y5YA 1ZVYA 1ZA3A 3WDJA 3UYOD 2JJTC 4Y2OA 4OZIA 2D2OA 3GMLB 5BVJB 1M05A 5EO1A 4GRWH 1FZKB 4PGDA 4NBXB 2GFBB 5T1MB 3L6FA 3BPLB 4TSBH 1U3ZA 5JHLL 3KYMB 5JOPE 4HKXA 4HBQA 5GZOC 3KAAA 5E0QA 4D8PA 4OLZH 2A73A 2G2RB 4LCYA 4NDMB 3UXFA 3VFWA 1UZ6E 1CFVL 3GUTB 3H7BA 1GGUA 2EE9A 5HHOA 4QT5B 5CMAB 3VFGH 5KZCB 4GAJL 1KPVB 1E6JL 4PJ5A 1N0XL 4PJGE 4NO0A 4NC1C 2PXYD 1F6LL 3D85B 3VFPA 4RFNC 2DMBA 1WZKA 1RVFL 3AGVA 1T20B 4CVWA 3ECBB 5DD1H 1YY9D 2IMMA 4KK6C 3OR6A 1MCQA 1MCHA 1B88A 2ZUSA 2ICWA 4PJ8C 1F11B 3S98A 4E42B 2RIKA 4X80H 3JV6B 5INCA 4PR5A 4WUUA 1Y6MR 1OCWL 3VFSB 4PG2C 1NLDL 4RRPA 3MOAL 2R2HB 3ULSA 4I0PA 2P5WA 1AQKL 2XNAA 5DRNA 4XPTL 1VERA 2HA1A 3GSRB 4JM4L 1IEBB 2LVCA 3EO9L 4U6HB 1NGYA 4JLRA 2APFA 3LHPH 2W9EL 2Y07L 3MV7A 1PLGH 3DMMC 2R1XA 4TRPH 2D31B 3EOTH 3QIUA 4PBXA 4HSQA 3SDAD 1NCWL 1HHHB 1QNZL 1T1XA 3ARDC 3MCLH 3VA2C 1R5VA 4NNYB 1QRKA 1CIDA 4JM2F 5E2WL 5ICZB 1JWMB 1XZ0A 1KG0B 2DM4A 3QQ3B 2QADC 3WNNA 5D93B 3T3MF 3IGAA 4JM2C 4QRUA 3OTTA 3ROLB 3JV0A 4K2UL 3KPRB 4O5LL 4X6CA 3GSWA 4TSCL 1TPXC 5ITBL 3L3DA 1SVCP 4BQ6A 4NHCH 4JFFA 3C6SB 4RISL 2ARJQ 2X5PA 1DBML 3MLSH 4WY7L 4KUZL 3VXSB 4X4MA 3TZVC 4OZIB 3MX0A 4HEME 5EO1B 3G5VB 4KZDL 1U3HD 2OJZL 5FM4A 2PW1A 4LHJB 5IFJB 2N4IA 5C0JA 1G9EA 4K9EC 4ONHB 4YDJB 5LGHH 1KCVL 3CFBB 2Y4SA 3ARPA 4HZLB 2DIJA 4FG6C 1LD9A 5C07B 5SWZB 5DC0A 3K2UL 3DRQB 2EEBA 1NCDL 2IANB 1DUZB 3D25A 4U1IB 1NDMA 1MFBH 4TUOB 1N7MH 3MACH 5FKPB 3SJVB 2OZ4H 2VABB 2EYTA 1NCBH 5IBLD 1MRCL 5FB8A 4NBYB 3I3BA 1KULA 1UB5A 2DN7A 3AMLA 4NO0B 1A7PL 2A6DB 2DOCA 4KK9C 3TV3L 3V8OA 1B3JA 1S9XB 5DRXA 3EJZC 3R0NA 2DI7A 2NXYB 4F2MA 3BP7A 4M9PA 3MJ9H 4NM4L 2DM7A 3Q2CA 4PR5B 1OL0A 3HI6H 4WUUB 2X4NA 5L2JB 1DLFL 2GK0A 1CFNA 3J8F7 1YNTA 2VOTA 3RWFB 3LD8C 2XNAB 3NAAL 2VLRE 5GIRA 2BJML 5I16A 3IDXH 3OAYH 4YBQC 3H42H 4P9HH 5KOVC 3KR3H 1I9JL 3BW9A 3U4EA 1NLBH 3BPNB 1L0XA 3D48R 3PP4L 1IVLA 1WISA 4QGYA 3MJ7A 3OGOE 5C2BH 4NM8L 3R1GL 3K4DA 3O41A 4QTIH 3HB3C 4XP1H 1N4XL 4NRZA 4QHNB 2FCBA 5D1XA 5GRUL 4PJXE 3H3PH 4NQEB 3BPCA 1ZWIA 3SGEH 2XWTB 3BSZH 3T3PE 3ZYIA 1BBDL 1JF1A 5KVGH 2WANA 5MENA 1I7UA 1S7SA 2VJXA 3T09A 2JB6A 5GSRA 1IC4L 3L3DB 3EHBC 3SE3A 1HINL 1AIFA 1QHOA 1P6AB 4GBXC 1MLCA 4NCC2 2FGWH 2YUVA 4X98B 4K7PX 4G6KL 2AW2A 3MLUH 3PHOB 3VFTA 3GM0A 2CGRL 4XPBL 5SWQB 3GIVA 4OLYH 1NKRA 5J9PB 4ZNCD 4P2QB 1S9VB 4JN2B 4KGLA 5TE4H 2IG2H 1P1ZB 1QO3B 4YX2L 5HYEA 3ILQD 3LZFL 3INUL 4C59B 4V1DD 5T3ZL 4JY6B 3UYRL 4AG4L 5B4MC 3IETB 4QF1A 3D25B 3O6FC 3QXDA 4WNQA 5HVHC 1EVUA 4V1DE 1S9WA 4YXHH 1OTUD 4UIMA 4OLUH 2P46B 1MI5D 3L9RB 4JPVH 4GSDL 3DETC 3P9LB 3B9KD 5FB8B 1UB5B 3IFLL 3ULUF 1MI5E 1U8JB 2IFFL 3RTQC 4OM0H 1VFAB 1ZTXH 2ED8A 2EDFA 1N2RB 3QDGB 2R2EA 3QQ9D 1AI1H 3U79A 3KYKH 2PO6D 4F9LC 5KAQF 3VG0L 3ULUC 1QZ1A 5KS9F 4I3SL 4O2EB 5IFAL 1DQQA 2YD4A 3HHRB 2DWEB 5FYLE 3VGAB 4LCUB 5JOFB 2H32A 1HHGB 4UT6L 3QCTH 5J13B 4YHMH 5SX4H 4NYLA 2J3SA 1INEL 3S88L 4U05A 1MJ8H 5LGJB 3ARQA 3MOQA 4BKLB 4NQXA 4FOMA 4ZS7H 1Z9MA 5I16B 1MVUB 1FYTD 1SQ2N 4GRMB 4L8DA 4PLKD 4MNGE 1J1PH 4JDTH 2IH3B 3ZZ1A 4NN7C 4QCIA 4U0RB 3L1OL 1JN6A 2YD2A 2DD8H 1U93A 5FYKE 3FQRB 4G6FB 5DMIH 3UTZB 3O45A 1IAIM 3T0EA 2FL5A 4ZSOB 2NZ9C 2HFFA 4POZC 4LLMB 1NCCL 5HYSB 3B2VL 5B3JE 2DQTL 5H37H 1I3RB 4Q6IC 4JFXB 3EOBB 1OHQA 4GMSL 1N5AA 5IMLA 3BXNA 2VKWA 4XPGH 1TJGH 2I9LA 3X14A 5A40E 1JF1B 2UWEF 4MD0A 3DXAA 3F65A 2NY6D 2Z93A 1A47A 1KJMA 5D2LB 4NOBA 2AP2A 2X7LA 5EWIH 4LRNL 4B50A 2ZUWA 4O2FA 2VZ3A 4W6YB 2R1YA 4K7PH 2IAMB 2PYEB 1CD0A 4CMMA 1BBJA 1TJIL 2EDTA 1ZHKA 2CDEA 1MY7A 3T77B 1HYRC 2VUYA 4LLYB 5HI5C 1WWBX 4WW1B 4Z7WA 1VEMA 5CSGA 4C83B 4ZNEA 5FA4A 5GZNC 3VFUA 32C2A 4M1GL 4MDIB 2EDYA 5E8NB 3O4LE 1VFBA 1KCRH 2I60L 1IM3A 1N59B 2GEEA 2P7TA 1OAQL 5EC2B 1DLHB 5HDLA 3KPLB 4WGVB 3CX5K 5FV1L 1EO7A 3O3EB 2IFGA 4PJAE 4TVPD 3UMTA 2BOCA 2RFXA 4RX4A 5C0AB 1UJ3C 2R2EB 3STZA 4TVPE 3NIDF 4HS8L 4GRWB 5I1KH 1QR4A 3K8LA 3MRMA 3F8UB 3P77B 4JKLA 4WTWA 2DDQH 4PJEF 5FO7B 2PR4L 5GS0L 1N64H 2Z31A 4FA8A 1KV3A 2I24N 1A3RL 4O51A 4R26H 4DCQB 4DKEL 3DV4A 4O4YH 2JJSA 5DVKA 5BRZA 1LILA 1FVDB 3OSKA 3PWPD 4RGND 3S96B 4BSVA 4M7KH 1J0YA 3WS6C 5GGVH 1A6WH 1BFSA 4QRRD 4O2CA 2D7QA 3FFDA 3FHQA 5EA0H 2EDNA 4QRRE 3ZDZE 5E9DD 2Z8RA 4MD4B 4LVOB 3WJLA 4EZMA 3MRHB 3RY6A 4XX1G 4GW1A 4Y4KA 5E9DE 3OKMB 3IDIB 3O45B 1CT8A 1ACZA 3ARSA 4D2NA 5HDBE 1KNOA 2EIEA 1KPUA 4HFUL 3ZHKA 3WFZA 1WTLA 1EAJA 1KFAH 3F5WA 1JTTA 5KSAD 1UH4A 5DA4A 1J1OL 5D1QD 3W0WB 5C92A 1T7VA 1L4IA 2V5TA 4HJGA 4FQCL 4J8RB 2I5YL 4LKXB 4O9HL 2BHUA 4MS8D 1S7XA 1RHHA 3T0AA 3QJHA 3WDIA 4Q9RL 1G7MA 4ONFH 4QHLA 3BUTA 4PRID 4NCDA 3T8XB 4JKMA 1M7DA 2X7LB 3PWLB 1TQBB 3BEVA 4LARH 4KMTL 2GSGB 2ZCHH 2NYYD 4PRIE 3MLYH 4A2MA 2BZDA 2R1YB 2GTZB 4DUVA 2JJWA 4P46B 1BBJB 2PXYA 3OJDB 3TJEL 4BUGA 3VXRE 3K3QA 1BHGA 3QXVA 5F1KC 4X4YA 2ARJB 3B5GA 4H25A 5DYOA 1CFSB 2KUTA 1D5BA 5FA4B 1G7PA 3ARWA 4WU5A 4I3RL 4Y16C 5DC4B 3Q5YA 3H9ZA 3L5WB 1VFBB 1FORH 1IAMA 2FSEA 2DQJL 1F2XK 1MUJB 3P4OA 4UIKL 4TUJA 3MOBH 5HI4C 5IMOB 4M93C 5FOBA 4KROB 1K8DB 1R3LB 4YPGA 3AY4A 5JDJA 1BGXH 1KB5H 4LSDA 4NJ9L 4NQCB 2BOCB 2F54D 2YA0A 5EPMB 4OJFL 2RCSL 4OFYD 3REWA 3STZB 3LKNA 1FYHB 4F58H 1NGQL 4P23B 1AGCB 5DD3H 3B9AA 3WIHL 3D39D 5L8JB 5JPMA 3G04B 2GY7B 1TITA 3RU8L 4L9LA 3EYQD 4FFWD 1MH5B 4DOHE 5JPNA 3V79C 1CS6A 3V0WL 1QRND 1U8IB 4M7LL 3L3OA 1AO7B 3PL6C 3LRSA 3PV7A 3H9HB 4YDIH 1JK8A 4D94A 1SMAA 4HK0B 5B22A 1XAUA 2F5AH 1A64A 3TA3D 4KHXL 5KVEH 5C0CE 2EH8L 1CGYA 1K9TA 2IWGA 3MLXH 2ZUQC 1A6UH 1PG7X 3CFCH 3FFDB 4N5UA 4OFDA 2ZPKH 4KXZH 5J11B 1DQDL 1PKQA 3OKOA 5JIKA 1FL3A 1IC7L 5J56B 5B38G 5FDWB 4M7JH 3ORJA 4GW1B 1OAUL 3D1MC 5E8EA 4LLVA 4POUB 1HIML 4OLWH 2P49B 3GI8H 2YSSB 4YO0A 1PFCA 1MCRA 1U3HA 2RR3A 2YBRA 5DSCA 2DTMH 2NY5L 5IROA 2OTUB 4Q58C 4HBCH 4NQVA 2QQKH 4TSBL 1EXUA 3WFHA 5T3XE 3BDXA 5CIPA 5GRWA 1WICA 2W9DH 4OLZL 2YD3A 3V5HB 2F19H 4L8SB 3CDCA 1FSKB 3GMNB 1D9KD 4PJIA 1EEQA 1UKTA 5IVZA 4IIQC 1OOAA 4ZODA 2NQCA 1KJ3H 5GSVA 3RVVD 4IDJL 3VFGL 1PZ5A 4OCRH 3ZE1F 1BWMA 4LL9A 2RHEA 3BP6B 1TTUA 4V2CB 3W11C 4RCAA 2DQFB 2NY2D 5DD1L 2Y06H 5GZOD 4JPIB 3WNLA 3TN0B 5GGSB 3OQ3B 4UDTB 3ZKMC 4RAUA 1S7WA 4X80L 5C3TA 5EIIA 5B3NA 2VITA 4UTAH 5JMRA 2Z92B 2FSEB 3P4OB 5K9OA 1C5DB 3T0XA 1CZ8H 4ZMAT 3VGDA 3AUVA 2AK4B 2ERJC 3QNYA 1I8LA 4W81A 4Q6YA 2HH0H 3TGXA 4P5MB 1P2CA 5MEOA 5I1DA 5B38A 5DQ9A 1BQSA 3O11A 3CUPA 3LHPL 1ED3A 1OP3K 1ES0B 4NC1E 5EOTA 1NEZG 1PLGL 5IG7A 4U3CA 3HPLB 4PJ8D 5KG9B 4TRPL 5F8RC 5JPMB 3EOTL 2Q87A 1JGVH 4ISVA 2FYYB 2X4QA 4PV9A 4L9LB 1IEAB 4XBGB 3MCLL 2GAZA 4M1DH 3GKWH 4RNRB 4P4KC 1BZQK 4PREA 4FMKA 1FVCB 5I1LB 4IRJA 5GQBA 1CK0L 2Z4QB 4H26B 1DN0B 4HPYH 1NGPH 2F74A 4F57H 4LLWB 4I18A 3MTRA 5HYFA 2DLTA 3DMMD 1KLGA 3VDCA 3GO1H 3L95A 2ATKA 1HQRA 5EBGA 4OAWB 3I2CH 4Q74A 3EUUA 4M3JA 4PGBB 4IMKA 1YPZF 4AH2A 3ARDD 3HFMH 4NHCL 4QRPE 4JAMB 4PGCB 5DK3A 2PTVA 4J3TA 2OL3A 5JR1H 3ZYZA 2CDFA 3PWNA 4QHUA 3MLSL 1S7TB 1I8MB 1X6LA 2PETA 3LB6C 5J0BA 1YUHA 4HDIB 2VLKA 5HTSA 5I2IB 4Z7UA 5J7CC 1OSPH 2VZVA 5LGHL 4NQVB 5IHZA 3QQ4B 2ZZUT 4XPAH 1EXUB 2M8XA 2ZOKA 1J7VR 4J23A 1EIBA 4B0MM 3EO1A 3IDUA 4XGZB 5DQJA 3NN8A 3IFOA 2UZXB 3KDMB 2P5EB 5LAXA 1DQLH 1GRWA 2E7LA 5DD5H 3MRJA 4WI9A 5J12B 1DQMH 1MFBL 3OKKA 1G7QA 1N7ML 3MACL 3CFEB 5IVZB 4AIZA 3MLZH 3QDJD 4ZG1A 1AGDB 2BVQB 2OZ4L 2BFVH 1NCBL 1WCBB 5D71H 1W8NA 5JHDE 3PWJB 4EDXA 3RIAK 1EUTA 1CTNA 4WI4A 1ZVSA 2GKIA 4FG6D 3HNVH 3FZUD 5IP4A 4LKCA 4X5LA 4WHCA 1KJVA 1ZSDA 3M07A 4CKVX 4EDWH 3MJ9L 2AXHA 4Y8DC 3WL9B 4I48A 5EIIB 4Z18A 3EDJA 3HNTH 3HI6L 1FV1A 1FVEB 3HUJE 4ZQKA 3RPIA 2YPLA 4WW2C 3JSSA 1GOFA 3SGKA 4L5FH 5IKCA 1ERNA 4MAYB 1A3QA 4PJFF 1FYTA 3NH7H 2NY1D 2VLJB 3CDYA 1I7ZB 3IDXL 1T0PB 2HTKC 1C12B 3H42L 4KK9D 2YK1H 4P9HL 3EJZD 3KR3L 5E4EC 2J7LA 4APQC 3U4BL 5BW7C 3HZYA 1NLBL 3MZGB 2F53D 2MQ0A 1LO2H 3VGEA 3EYVB 1HH9A 5EOCH 4BH8A 4OI9A 4FQXD 3VFRA 3G5XA 4UV7L 5C2BL 3EGSB 4HMDA 3EO0B 1D7FA 4KUCF 1QQDB 4PREB 4QTIL 4XP1L 4IRJB 4J3XA 1HILB 4RMSA 2PTUA 1T22A 2BXYA 3CMGA 3KPNB 2BNUA 4YBQD 1BF8A 3H3PL 1RK0B 4RQQB 4UDUA 3BWUC 5TGBA 2Z91A 3OWEA 3ARYA 3BSZL 4MQTB 2HVKB 3SKOB 5C0ND 3VCLB 4RWHA 3FO1A 1FJ1B 5IB2A 1VA9A 3QO0A 1UC6A 3QHZH 5IMKB 4FTVD 3CJJA 1MFAH 3HB3D 4YC2B 3QI9A 3RAJH 4EI5B 1W0VB 3M1BA 3F12A 1KTRL 3TPUA 2FGWL 3MO1A 4NIKB 4JO3H 4OKDA 5HDQH 1FFPA 3MLUL 5TH2B 4OSUH 5DJDB 4G80B 2B5IB 4DEPB 4OD1H 3FOLA 4YIQA 4OLYL 2NY4C 2WP3T 4U6YB 2HVJA 1IQDA 4HIJB 3UZVB 3AAZB 1Q9LA 1ZE3C 2IG2L 4KKBC 4OZ4B 4WFED 5DQJB 5J4MA 3IFOB 1MHPH 2NLJA 1TFHA 5LAXB 1A1MB 3IDJA 5IB1A 1LMKA 1MOEA 4MQ7A 4WV1C 4CADB 4EEEA 5EORH 1WJ3A 4X5WA 5KVDH 4HG4J 4Q9BA 4YXHL 4OLUL 3D0VB 1AJ7H 3TLRA 5J89A 4JPVL 4WFHD 4FNLH 1UM5H 1AD9A 2NCMA 2NW2A 4PJBF 1UJTA 4MWFA 3RHWF 2OJEA 5JW4N 1Q9WB 1IGJA 1L6ZA 3O3BA 2C1PB 1ZTXL 3JWOH 3KPPB 5JO5B 1BZ9B 1AI1L 3KYKL 3ZTNH 1YN7A 1KJVB 5DGQA 1P53A 2A6JA 1BMGA 5J6HB 4KDVA 3HS0B 1XCTA 1LO5A 4Q0XH 1UQSA 1CDHA 4EUPH 3UBXI 3KS0J 2W65A 3QCTL 4L4TA 4ZQKB 2AABH 3UDWC 4YHML 2EXYC 4PGEA 3BZDA 1E27A 1IGYA 1MJ8L 3PWPA 3RTQD 3TVMB 3WFCL 3FCTB 4ZS7L 4CN4A 2OTWA 2APVA 3GSQA 5IBUB 3QCVH 5AUMA 1MCWW 3OKDA 1BJMA 1J1PL 2M26A 4JDTL 2YKLH 3RWEA 5C8JA 5ETUB 3ULUE 1T7ZA 3X3GH 1EVTC 3ESUF 1WIUA 1X5KA 4WHTA 2FX7H 5INDA 2DD8L 3OGCB 4HUUB 5BZDB 3LQAH 1P7QB 1JGUH 5KS9E 5DMIL 3Q6FA 1Y6KR 1T22B 1B0GA 2Y72A 2B1AH 5KSAA 3IVKA 2D4DA 3P11H 3V6FA 3WUWG 5TGBB 3SDXE 5JMOC 3IS0X 4X6EB 2XXMB 1XF3B 25C8H 2P47B 4XPGL 1TJGL 2GJ6B 2HKFH 3L3JB 4MCZB 4JO1L 3VH8G 4TNWF 1KB5B 1E6OL 2I25N 1OSZB 4UNTA 5C09B 3QEHA 3KPQB 4K71C 1JGEA 3T4AA 3MNWB 3DNKA 5F3BB 5EWIL 1NC4D 3NGBC 2C3WA 4U1MA 3QI9B 4ZUUB 1O0VA 1F3RB 3MO1B 3MV9E 3NZHH 4K7PL 4N0UB 2V5RA 4L3EA 1R5IB 5F9JA 1HQ4A 5D6CA 1J88A 3QEQA 3FJTA 3ILPB 4K8RC 3LKSA 5M94B 3H3BC 2HVJB 1IQDB 2DLHA 2GT9A 4LSRH 5KSBB 4G6AD 5BS0E 4CJ1A 4QOKD 4FXKA 1YEEH 4ODWA 4XCEB 1J11A 1MLBA 2LTQC 4M5ZH 1KCRL 2BOBB 3OF6A 4RMQA 1VADB 4QOKE 4GLRH 2UWEE 1G9NH 4LDLB 1XGPA 1NL0H 3S97C 5MI0C 1U42A 2E6QA 4PP1C 1SBSH 4NSKA 1A6PA 1WAAE 2AJ3A 3TH3T 5L2KB 2F54A 4U2ZA 5HI5D 1QSEB 4NN5C 1U0QA 3BMWA 1G7JB 3O3BB 5A16B 2YUZA 4NUJB 4N9GB 1I3VA 3FAXA 1J8HD 4RGMB 2QR0B 3D39A 3CPLA 3PUCA 3VXMA 5I1KL 3WS3B 1I7RB 1YN7B 4YPJA 4FQHB 4Y19E 3LS4H 5AWNH 4PJCF 2VWEC 2DDQL 3WUWA 3MRKB 5HGBA 2X4SA 5HHMD 4JFEE 4L4VD 4ODSH 5E6IC 1QRNA 2Y36H 2W65B 4L4TB 1FFOA 1N64L 2HRPL 3L5HA 1IBGH 2DJUA 5HHME 1E27B 1MAJA 4L4VE 3SDCC 1DBBH 1IGYB 3MLTB 4KJPD 4R26L 3UTQA 2VB5A 3IXTA 4O4YL 1SMOA 1CXFA 2P24B 4JB9H 4D9QE 2OTWB 4MMZC 4GKZB 4QRTA 4CVZA 3F62A 1MWAH 4M7KL 5LWYH 5GGVL 1T4KB 1A6WL 1KCLA 4DKDC 4MJIB 5AUMB 4ELME 4AMKH 1U8MB 4Q2ZB 3D3VA 4E41B 1CYGA 5AD0A 1T1YB 3MBEB 5I73C 3FO9B 3ZMRA 5IQ9B 2ED7A 2QKIA 2VXVH 4JGJA 3NIDE 1A0QH 5IB3B 4BFGA 4P3DA 4X8JB 2LV4A 1C08B 3WLBA 4OCXH 4PRNB 4GUPB 5FECA 1GCFA 12E8H 3QXTA 2DF3A 2FWOB 3IVKB 1KFAL 4OQTA 1M7IB 3OXRB 5I74C 1P7KB 1CXEA 4ZFOB 4D0CB 1TZHB 3G6JA 3F6LA 4FQQA 5HHNB 1ETZB 3N1GC 4ZDHB 4LLQA 4K7FB 3Q5TA 4JRYB 4ONFL 4AIXA 2VSDA 4LARL 1WT5C 4KRPB 2ZCHL 4E5XB 4FN0A 5JZ7C 3MLYL 5L8LB 2VL5A 2V5MA 2NX5B 4L3EB 3QEQB 3B6SB 4IJ3C 5ICXB 4P9MH 3BIKB 4U1LB 4EXPX 3BQUA 3T0BA 3ARFA 3C8HA 4WI6A 2LQRA 3LN9A 4QXUH 3BYYA 5FCUH 2F58H 1FORL 3P4MA 1T80A 3DPBA 3MOBL 3U2SA 4MHHI 1QBBA 5ACZB 1ADQA 3DO3A 3PV6B 5ERWA 4X6DF 3X12A 1BGXL 1KB5L 3FO0H 4G42B 2EDKA 1DUYB 3TESA 2R2BB 1MQKH 5HVWA 7FABH 2FATH 4MNHB 1S7VB 2AV1A 5GGUA 4F58L 2FEDD 1I4FB 5DD3L 1U8OA 1ZGLB 5HBBA 1SEBA 1CWVA 4UQ3A 3HMWH 3BP4A 4X7SH 5KJRH 5T1KD 3NPSB 5HI4D 3SCMC 5CP3H 4ZAKB 3UO1H 3FB6B 4JY4A 4LSUH 3D2UB 2VXUH 1EFXB 1RZFH 4YDIL 5MERB 5ITFB 4Z6AT 4XP9H 4NQDD 2F5AL 4CVZB 5KVEL 5JORB 3SQOH 1U91B 2CKBH 3MLXL 1A6UL 1HKFA 1G0YR 1GZQA 3CFCL 3PNWA 5F9WC 2ZPKL 4Y8AA 5EN2B 4LVHB 5F89B 5EH1A 4PJ9C 5J8OA 3ARED 4KAQH 5BJTB 2Q76A 4MX7A 4K3DH 4M7JL 1W0YT 1I1AB 5IEHA 3CFJA 3PL6D 4N0CC 3GI8L 3BHBB 2A83A 3QUYB 2DTML 3BZEB 2EC9T 1YMMB 2Q86A 2XACC 5TPWH 4ODBD 4LCCA 4HBCL 5FYJD 1YDPB 2QQKL 3MBXH 4KV5E 1JNLH 2NY7H 5FYJE 1R3KB 5DRWA 1NFDA 3BGFB 2G75B 2JCCB 2W9DL 3FN0H 3LMJH 4H8WC 2J8UF 3NFSH 3TO4C 3NIFF 4C57C 5CINH 5HYJB 2F19L 4JFPB 4X6BB 1F00I 4H0IA 1NANI 4WHDA 3QDJA 3MUY1 4M6AA 1I3GH 3H9SE 2CDGB 3CDFA 3V5DB 3LDBC 1KJ3L 4Y1AE 3QUMA 1ZT7B 4GAGH 4OCRL 2L7UA 5DEFB 4H1LH 4G8GD 3VFVA 3X11A 3SE9H 4JO4H 1ZAGA 1JPSL 3HTLX 1NAMH 4QWWC 2BC4A 2Y5TB 4G8GE 3JVGC 2Y06L 3CCHA 3M45A 3BKCH 3Q1SH 4Z9KB 4WDIB 1X44A 1QFWH 4UTAL 4IDLA 3QUKB 5F88A 5EU6D 2DICA 1CZ8L 2W38A 3O3DA 1Z9SA 4ZFOL 2HH0L 4M8QB 2O5YL 4GAFB 5TQ2H 1BVLB 2HTLC 1WBXA 2E6PA 3TNMB 1IAOB 3W11D 3UCRA 4QRSA 4RDQG 4HIHA 4YXLH 3OZ9H 3T0VA 2AV1B 3ZKXB 3FT3A 2J6EA 4FQXA 3ZKMD 2H26A 3MYJA 5TQ0H 3WIIH 1IKNA 2F5BH 2BNRB 4M1DL 3GKWL 5ICYA 4UMGA 1CGXA 4Z7VF 4MA7H 4NQTA 4OZHA 4YR6B 3C5JB 4OIIH 4E0RA 5T1LA 1QD0A 4HPYL 5F96H 1NGPL 4M7ZC 4WWKC 1LHZA 4HUNB 3O9WB 3CU1A 3DLQR 1Y0LB 4I2XE 3GO1L 4YGVA 3I2CL 5EBWB 5A2FA 4HGKC 3ARBD 3SDDC 4FTVA 3CH1A 3HFML 1FFNB 3T4YA 5J1TC 1CCZA 3RGVB 1JZ5A 1LO0H 3C2SA 2WWMC 1SVZA 1ZA6A 2VERN 5HGDB 1RJLA 5B8CB 3HE6B 1NMAH 3AB0B 5IW6B 2EICA 5ID0A 3FFCE 4HUXA 4EUPB 4XC1H 4RFOH 1OSPL 2ITDA 3O3AB 4XPAL 3FQXB 1JWUA 5I18H 4X7DC 2DM2A 5D7LD 1VEOA 1DQLL 3ALWA 2DB8A 5CEZD 3VXOB 5C08E 5DD5L 3S3JA 1Q9OB 4P4RB 2X1OA 1DQML 5E4IA 2X1QA 3EFDH 3MLZL 1YPZE 1F90H 2BFVL 3QUMB 5DVNA 3RZCD 3C6LB 4G3YH 3SEPA 3PQYB 5GS1B 2VZSA 5EZIH 5DDHB 3HNVL 3VMOA 1U58A 3VXUA 2UY7A 4WGWB 3SPVB 4EDWL 1WIOA 1MF2H 3I75B 4YFLF 4EIZC 3ESVF 3OB0H 2C26A 3BWAA 5TF0A 3W81A 1A6AA 1A4KA 3HNTL 4GKSA 4NKOB 2X4UB 3B9VA 4RFEA 5EU7C 3U9PH 1EO8L 3QUZC 4L5FL 5GGTA 2HLAB 1P6FA 4X9GA 1UVQB 2DLIA 1JPFA 2X70B 3LQZA 1A2YB 3VWKA 1A1OA 1G9MH 1YEKH 4I3GA 4L3AA 2YK1L 3DX6A 4NNXA 2DQGL 4UUJA 5HHPA 4MA8H 1IM9D 1CDBA 3B8YA 3QDHA 1CDYA 4PP2B 3V7AE 3ZKSD 1HHJB 4DKAA 3HN3A 3ZE2E 2ZG3A 3DHJA 4PJHF 3GSOB 4XMKH 1XF2A 2K3TA 1PYWB 3I85A 3HRPA 4PJ7F 4PRHA 1A9EA 1L7TH 4KK5C 4JDZB 3O81A 5KSUB 3NCCB 4QLRA 5ADPH 1R24A 3TH4T 1FNEB 4APQD 4X7EC 4X99A 1N8ZB 2AI0H 3QR2A 3EBAA 4KTYA 3G5YB 4WRLA 3PGDB 1EBAA 4PJFE 4HCRH 2Q7YA 3OPZH 3HE7A 5DUMH 4Q97A 3QHZL 5CBAA 4KQ4H 3T4YB 2F9BT 3RAJL 3BX7C 1FL6A 2ZJSH 4OKVB 5C7XH 1SJHA 5EC1B 2VO5A 4JO3L 5L0QB 5HDQL 4OUUB 1S78D 2OL3H 1I7TA 4OSUL 3RGHA 1Q72H 4OD1L 3TBTA 4Y4HC 4X7TA 3IJHB 1NUFA 5AG9A 4JN1H 3ARUA 5F7WC 5L6YH 2CIIB 5I8EA 5E8OB 2GTWB 1H3PH 3LIZH 3BOVA 2ZP0T 3KJ6H 5FA3A 1MHPL 3L3IA 4F37F 1MWAB 4DZ8A 5ISZD 3MRPA 2I27N 3QDAA 1AXTL 4UILH 2D0HA 5EORL 3PHQB 1F6AA 5KVDL 3EDDA 3WUZA 3G08B 2UZYB 3UTSB 1AJ7L 1YJDC 3MRNA 4HQQH 1TCRA 4FNLL 1UM5L 3MLVH 5IGXH 3QUXA 4Q9QH 5EUOA 4U1HB 2NY4D 3GB7B 1BAFH 3R06B 1J8HA 2L7JA 4J2XA 3JWOL 1T5WB 3VXUB 1PQZB 4UOW1 5KSVA 3ZTNL 5FYLH 4CJ0A 4OZFH 3B9DA 3IXAB 3RX7A 3RDTB 1UZ8B 3BP5A 4Q0XL 3BWAB 3VGHA 4KDTC 1OM3H 1A7QH 4Y5YC 4QY8A 4GH7B 3U82B 4GXVH 5GGRA 3WE6B 4X5XA 5SWSB 4XCNA 4RFEB 2R4RH 1FLRH 2H41A 4S2SA 1MFEL 3CVHH 3K80A 3UBXG 4WUKH 3LQZB 2XWJB 4LP5A 1ZLWK 4GT7A 1JP5A 3VRLF 3TBWA 3QCVL 3QULB 1S9YA 1MCSA 2GUOB 2XTJC 4NNXB 4P5TA 1EA9C 4LVEA 1OD7A 4O58H 4Z0BH 2AJSH 2DJSA 4XNMA 2WBJB 2YKLL 3LV3B 2PW2B 3X3GL 2A77H 5FYKH 3MMEB 2FX7L 3P0YH 3QDMB 1FE8H 3ARTA 2ICWJ 4MLSA 1NSNH 4ZUTA 3LQAL 2EDDA 3L3KA 1JGUL 1RZJC 3QFJB 1NCAH 4YHIA 4N90D 5FGRA 2B1AL 2FEEI 2V9TA 1FCCA 1XGRA 3P11L 1OW0A 4ZYKB 4HX1A 4N90E 4UQ2A 1HXMB 4TN9A 25C8L 1T04A 3DUSA 1IGCH 2HKFL 5CAYB 5EZLB 3Q6GH 1AQDA 2CLVB 5C0IA 2Q7YB 4ZO7A 1QSFD 1MJJA 5ECJE 1NFIB 3ZSTA 1ZLUK 2BNQE 5CCKH 1U8PB 3I6LD 1ZV5A 4I0PC 5EU3A 1SEQH 1F4WH 3NZHL 1BM3H 1T89A 3I6LE 1KEGH 1RIUH 4HF5H 3PHSA 3U30C 3WHE0 2M1KA 4Y5XA 2APTA 2QTEA 2Y5EA 3TBTB 1XCQA 2O61B 4LSRL 5JQHC 2Z8SA 2X89D 2FO4B 3QIUC 3P40A 4R4BB 1NQBA 5KVMC 8CGTA 1W72H 3WKMH 1NGWA 4M5ZL 1CLOH 2CKBB 5K9KA 3EDEA 1G9NL 4MNQD 5E08H 1YEIH 1NL0L 1ZKAA 1XIWB 2JJVA 5EO0B 4OD2B 2EIZA 4GG6A 1SBSL 2FECL 4OGZA 3RVUC 4XPHL 4RZCA 1MCCA 3C5ZB 4KJWC 4K8RD 2R39A 4PY7B 4X6CF 2KL6A 3PG2A 3B43A 4TVPH 3SBWA 5T5FH 5FF6A 5DJ6A 5CZXD 5FUOH 4LOUD 2HFEA 2FIRT 2XOTA 3LRHA 3RVXC 3LS4L 2X4OB 5AWNL 1U8KB 5T1KA 1EGJA 4NFBA 4ODSL 1XGUB 5GGRB 2Y36L 4PP1D 2P8MB 4XCNB 5D1ZA 3EJYC 5JA8B 1IBGL 2C4XA 5HHQA 1G7LB 1DBBL 1O5DT 4NQDA 1EK3A 4JB9L 1MWAL 5LWYL 1U36A 1D5XA 4PJGB 4NC0B 1EEYB 1QFPA 3CLEH 4PJDA 2E3VA 3AREA 2NY0D 4H1LB 1D5MA 3V0VA 1LEIB 3NOIA 2Z0BA 3EFFB 1X5LA 2VWEE 1NAMB 2VXVL 3P4NA 2W0FA 5BQ7A 1A0QL 1QPXA 1RJZA 5F70A 3TT1H 3U0TB 4DAGH 2IH1B 3TCXA 4XXDA 3SDCD 3FRUA 3DROA 4OCXL 4PPTA 4PJCE 1CD9B 3QWOB 4YWGH 12E8L 3DO7A 3T2NH 3U36B 4P2RD 3AU1A 5GJTH 4YXKH 5K9JL 4KVCH 1G7HB 3WHXB 2EYRB 1F4AA 1AHWB 1NUGA 1MJJB 2ZSVA 4JREC 3VGAC 5GGTL 4ZFZB 3BN3B 3V6BR 3U7YH 2B0SH 5CILH 1GGBL 1TNMA 3PP3K 4S1RL 5CP7A 2AEIT 5JDSB 3SDAB 1M6OB 2VZTA 3AXLB 1UEMA 5B39B 3T2PA 1MCWM 4P9ML 1IQWH 4XH2B 4ZTOH 5IVOA 4JFOA 1A6TB 3BFOA 3E3QC 1MCBA 1DQJB 3W5MA 3IKCB 3S6CA 4XHJC 1T0NA 3I6KB 3RY4A 4F15B 4G9DB 2R2CA 4JHWH 2BMKA 4QXUL 5EU6A 5FCUL 2F58L 3QO1A 2KBGA 4BFEA 2WQRA 4GS7B 2EIZB 5D1XC 2J5LC 5IJVA 5E94B 4Y2DD 5DJCB 4GKOA 1GIGL 1FZOB 3FO0L 5TE6H 5DT1H 2PKDA 1FNHA 5I1EH 1MQKL 3OG6B 7FABL 2V2WB 2FATL 1DZBA 3L5XH 4U1NB 1HHIB 3SE3C 4ETQB 3QH3B 1RU9H 4TOYH 3HA0A 1GJIA 1IGFH 2ARWA 4X7SL 5KJRL 3BRGC 3NIGE 1HZHH 5FGBA 4DUWA 1F2QA 3O8XD 3UO1L 2G5RA 5K59F 4LSUL 2HN7A 2VXUL 1RZFL 2HJFA 3N0PB 2ZCLH 1LVEA 4XP9L 4OF6A 1XH3B 2WSKA 1S8DB 5ALBH 4JE4B 4ZOCA 3SQOL 2CKBL 1KELH 1PVHA 2BVPA 4KJYB 3ARBA 4X6DE 2CR6A 1D5MB 4PRPD 4ODXA 3E8UL 1HWGB 4KAQL 4K3DL 3DVGB 5CD3B 5DURB 1RJZB 2A74A 5TDNA 5SV3A 4XXDB 3RWHB 1T1ZA 4LCIL 4YFLI 3V52H 4J1UB 1EX0A 1AGFA 1H0DB 1DTUA 5T3XH 5TPWL 5EO9B 1R3JA 4YK4B 2YRPA 3MBXL 5IFHH 2VLRB 3FTGB 5D7LA 2NR6D 3SE4A 1ORSB 1NUNB 2NY7L 4PRAB 3DV6B 4WO4B 3MGTA 3LKPA 4PJ9D 3FN0L 3LMJL 3HG1A 4LAQH 3NFSL 4HUWA 2CPCA 4Y4FA 3Q0HA 5CINL 4N0CD 5SV4A 2GW5A 1I3GL 3S34L 2V5SA 4Y89A 3RZCA 4JHAH 1LO3H 4GAGL 5IW1B 3LKOB 3TNNA 1MQ8A 1QA9A 2FJGA 5IV2A 3VXTA 3CFDB 3SE9L 4JO4L 4QEGA 2G60H 3QG7H 1NAML 4PJXB 2YD9A 2BVOA 3MRCA 1H5BB 3BKCL 3Q1SL 3UP1A 1IKFH 1K5NA 4FHBD 3VFMB 1QFWL 2BMKB 1H3VA 4CN1A 4EIGB 5D7IF 4XC3H 1FZMA 1ZS8A 2NTFA 1O7VA 3TIDA 4EVNA 3T0EC 2VKXA 1NBYB 1R5WB 2R1WB 3DIFA 2Q7NA 4OUOA 5IJVB 2J8UE 4OGXH 2MPAH 3KXFD 2MQ3A 1KTKE 4XCCH 1KENH 5TQ2L 4LPTA 2CK0H 3IFPA 4JFHE 4D9LH 5JNYA 4LSPH 4ONOA 5IOPA 4QWWD 4YXLL 3OZ9L 1IM9A 2X4PB 3S5LG 3ZKNC 1U41A 2YN3A 3U9UB 2AQ3A 4YEEA 5TQ0L 3HC3H 5EB9A 4KKLD 3WIIL 3HI1A 2C3GA 2V2XB 2F5BL 1Z3GH 4NZDA 2D7MA 5EFIA 2HP4A 3CD4A 4IHOA 4UNUA 5CWSB 3KYOA 4FZ8L 4OIIL 3OJMB 2XN9D 1IC5H 1LK3H 4OLEA 4IRSA 2HTLD 3KHOA 4V1DB 5F96L 2DL9A 2DIBA 1LNUA 1TNNA 2XN9E 4OBRA 4G6MH 3ZT6A 1WTGT 2KQNA 4PJAA 4F8QA 4KTEH 3QEUA 1JYNA 5I66B 1CXLA 4GRLB 3B9KB 1QR1A 3B9EA 1XT5A 4UAOC 2HJLB 4ODXB 4XVSH 3CU7A 4U2YA 5HGGS 1HDMB 2CK2A 4AYFA 4Z78B 2PN5A 3EYFA 1LO0L 2OQJA 3PJSA 3SO3B 2IBGA 4OZFB 2B39A 3AMKA 3GSVA 4KDWA 2VN7A 3I6GA 1NMAL 1UXWB 4NKMA 3ARGB 1CFTB 3VD9A 4JANB 2EZ0D 1VFMA 4XC1L 3Q3GB 4RFOL 4Z7VE 2W91A 4L29B 1VDGA 2VH5H 3VWJD 1EAPB 4ORZC 3GMOB 3CVHB 2WBWB 3IF1A 3QZWA 4ZPVB 3LKPB 5ISZA 4P2OA 1KXTB 2R23B 3QIBD 4HUWB 2J4WH 5TDOB 4Y4FB 2AKRB 3MFFA 1CR9H 4PYGA 2WWMD 4M61B 4MNGB 5M7QA 1K3ZA 1MELA 1JJUA 2Z31C 1R3HB 5I0DA 1Q94A 3B4NA 3EFDL 2JJSC 2C7UA 1F90L 3RUGE 4TVSa 1QA9B 3PWUA 4G3YL 4K9EH 4EXKA 5IV2B 1X7QB 3VXTB 5EZIL 2LU7A 5E99H 4YBLC 2ESVA 4R2GC 2ICWI 4B7LA 4RGOH 2G5BA 1MF2L 3WJLC 1NH6A 3BGMA 3RY6C 1J10A 1P4BH 1OARH 2AEPH 2BVYA 4Y4KC 3ZYOA 4C56A 3U0WH 5E70A 1F3DH 4PRDB 4EVNB 2EO1A 4LU5H 4WJ5B 2YHGA 3U9PL 4YHOH 2NY6B 4ESKA 3T04D 4LRIA 4HLZG 1C5CH 1PY4A 3SGDH 3BPOC 3KPSE 1G9ML 4ZUVA 1YEKL 4ZXBD 3BESR 1S5IL 2W9LA 5GHWH 5HPMB 1RIVH 1FL5A 2X4TA 43CAA 5I1GH 1WGOA 1GC1C 4MA8L 3DVIA 4V2BA 5DFVC 3VXPB 1MPAH 1CICD 4OFPA 5EU5A 5F7YC 1AGEB 43C9A 1MHHA 2DTSA 2UYLB 3BJLA 3O4LB 4HPOH 4PY8J 4XMKL 5FO8A 1A5FH 1W72B 3FT2A 4MDJA 2PXYC 1L7TL 5EU7E 1N6QH 1LP9A 4LHUB 2XKNA 1ZHLB 2ADJA 5CSZB 1YY9C 3C5SB 3EJJX 3MRRB 5ADPL 4AEHH 1EHAA 2BY1A 4H0HB 2AI0L 4MJ6B 3LN5B 1HK6A 4PJAB 2HYMA 5CGTA 4HXAL 3V5KA 4GXUN 1QSFA 3DUHA 3AS3A 3CK0H 2W07A 2A6IA 2PYFB 3HC4H 5DO2D 5DUML 1GOGA 1OT2A 1C5BH 3FN3A 3S35X 4KQ4L 5IJKA 3ET9F 2AJZB 1KOAA 1AC6A 2EDBA 1D5ZA 2ZJSL 5C7XL 1FO0A 2B1HH 3AY4C 1BLNB 5KZCD 4JRXE 1FDLH 2NNAB 3WIFB 1TZGH 1Q1JH 3D85D 1ORQA 4EQ3A 3KPMB 4M5YH 3S4SG 1Q72L 1G7IB 2F8OA 3C60A 1JZ8A 1RUPH 5T5NG 4PJHE 5L6YL 4JN1L 1AKJB 4FXGB 1RD6A 1KBGH 2OLDA 2X89A 1H3PL 2ATPA 4PJ7E 1NMCC 3KJ6L 5DS8B 1OB1B 1CBVH 1KUMA 4P2OB 4L9LC 2A6KA 3JZ7A 3H8NA 4W4OA 3U0PB 5IVNA 4UILL 3K1DA 4MNQA 3IDMA 2Q8AH 4QRRB 4WHYG 5F1NA 5DJXB 2LE9A 1C1EL 4QO1A 2XKSA 3RVTC 2KH2B 1BVKA 2Z35A 4WI3A 2BSED 1DP0A 4HQQL 5IGXL 1IE5A 5C70A 5E9DB 4Q9QL 3QIWB 5JW5A 2MCPH 5A2JH 3MA9L 4AIOA 5GGQH 4MD5A 5FYLL 4OZGE 1SY6H 3T0WA 1OAZH 5DHYA 1OAYH 3VRIA 4WFFE 1YN6B 2CLRB 2V7HB 3DI2B 3O4OB 2A2QT 1OM3L 1A7QL 2DL2A 2VDMH 5F9AC 3L7EB 4D0DB 4GXVL 1U3HC 3OKNB 5IROC 1FLRL 3E6FB 4F33A 3CVHL 1VENA 4W70A 4PRIB 4WUKL 5I75C 1LQSR 5EBLA 3UTTE 4ZD3H 4BSWB 2CO7B 1PSKL 1QP1A 3MUGB 3KPRD 2APXA 3QHTC 4PBWD 2GK2A 3VXRB 2FZ3B 3PIQA 3ULUH 1J86A 3DUUB 4O58L 5DJAB 4Z0BL 4KWUA 2AJSL 3KPRE 5D5ME 2HFGH 2A77L 3TCLB 4JFDA 5FYKL 3S4SA 1FGVH 3P0YL 1FE8L 1I1FA 1W0WB 1NSNL 2YPKB 4OV5A 5I17B 3GJEA 1DN2A 5IBLC 4TNVF 4EI6A 5HYQA 1NCAL 2VLLB 4PBVC 4OZIE 3HCVA 4KVNH 1YA5A 2ADJB 4NJAH 4P2RA 3MV8A 4HFWB 1HSBA 5C07D 1A8JH 1XGQA 2AXGA 4QYOB 1IGCL 3G5ZB 2XKUA 3Q6GL 3CX5J 2WUBH 2XTJE 3SKJH 4XPFH 5H8DA 2Q20A 1JI2A 2ZNXA 3GMPA 4JZJA 1I8IB 4XP6H 4K3GA 5CCKL 5KTEH 2ITCA 3C9NA 3OXSA 3SJVD 1I8LC 2E6JA 3MPCA 1FO0B 1SEQL 1F4WL 3P9WB 5HHOE 4K94C 4DOHB 1BM3L 1KTDA 4PJ5D 4NO0D 3FOMA 3RIFK 1KEGL 1FNLA 1HKLH 4HF5L 1RZGA 1N3NB 4UZGA 2BDNH 3C60B 4EN3A 4CGTA 4PJ5E 2BY2A 1BEYH 1JPGA 2NXYD 2W60A 3BJ91 3GMRA 1OF2A 2DIAA 4PJXF 3VH8B 5H2BA 5C0CB 4WUUD 3GRWA 4JDVB 4GLRI 4HW6A 3T3PF 1W72L 3WKML 1B9ZA 2P42B 4EKXA 5DD0H 3TA3B 1CLOL 1HOCB 1IFHH 2OMNA 4MB5A 4WUUE 4XNZC 5IHUH 4HIEB 4U7KA 4YBHA 5E08L 1YEIL 1UENA 5CJQH 5EBMA 4IOIA 2FX9H 3MODH 4FP8H 5IB5B 2P5WE 1UWXH 4FQIH 4Y2DA 4YHNB 1ZEAH 4I18C 5A43C 1ONQB 3MV7D 5JW5B 1DEDA 1B6DA 3PXJA 3F58H 4TVPL 5T5FL 3P0VH 3QIUD 4HKZA 3DYMA 3LPFA 5FUOL 2APBA 3MV7E 3OKEB 4IMKC 5ID1A 4JM2A 3WN5B 1ACYH 5I6XB 3TFKC 4MA1B 4AEFA 2N56A 2HRLA 4Z7UF 3O8XA 4FFVD 3RL2B 4KMQA 3MCKB 2XTLA 4KJWD 1BZ7A 2FJFA 5C0GA 3RWJA 5DEZA 5EBLB 2V7NA 3ETBF 4KQ3H 1D9KB 3ILQC 4LLUA 3DARA 4AJ0A 1KN4H 2CO6B 1FHGA 5JHDA 2IPKB 1HXYA 4TUKH 4RA3A 4GMTH 3CLEL 4PRPA 4LNRB 2E7LC 5F7HA 3TWCH 4X6CE 3G9AB 5C0EB 2GIYA 2XPGA 4JFDB 3KPTA 5ACLA 2W0PA 1NMBH 4WEBH 4JFFE 5CLWA 3L3HA 4ZOAA 3X13A 3EJYD 3TT1L 4P99A 4DAGL 4EI6B 1FNGB 5HXMA 1MCOH 5GS0D 4X4ME 3PDOB 4YWGL 2ZWLT 4AT6B 3JWDC 4Z7OF 3QQ9C 3T2NL 2PO6C 1IAII 4J4PA 1A6ZB 3O2DH 4RAVA 1FN4A 5GJTL 4LQFH 4YXKL 1BQHB 4KVCL 2VDRH 3GMPB 3NVQA 4RFNB 1HH6B 1AFVH 3DTXB 3U7YL 3DURA 2B0SL 2ITCB 3C9NB 3GZKA 4RIRB 5CILL 3SGKC 1JWSB 1MIMH 5LVEA 3RWGB 4PJ8B 1B2WH 5LJYH 3HC0A 4OCYH 5ELIA 3D18B 1TIUA 3QDGD 5C9JB 4EN3B 2FR4A 5E2VH 3HMXH 4MXQC 2EO9A 1IQWL 4ZTOL 5CHNA 5DHVH 1DE4A 1KTLA 5B3JF 1M71B 1OF2B 2OMBA 2YD5A 3ZTJH 4ETYA 5I76A 3RP1A 3TYFA 1UGNA 2PCPA 4JHWL 4OCWH 3F7YB 3F7VB 3DMMB 2EEDA 1UG9A 4OLVH 4M48H 3GMQA 3KXFA 1OQOA 1TZIB 1U8LB 3MC0A 4QRPB 2W0LA 5GS2H 4DVBB 1YEDA 3QJFB 3ARDB 1VPOH 4ZPTA 1Q9KB 2HKHH 1OP5K 2JF1A 5D2NA 3REVB 4GW4A 5TE6L 1KJ2H 4HWZA 5DT1L 4XCYA 1C7SA 2BSSB 3CZFB 5I1EL 2EDRA 4HKZB 2YEZA 2RB8A 1KIUA 5ESQB 3VXQA 4XHJD 2QADB 5ID1B 4JM2B 3MLPA 4AENB 4LCWA 1LEGB 1FO0L 3L5XL 2IF7A 3AS0A 5KAQG 1BP3B 4J12A 1RU9L 3E3QE 3H0TA 5JTWA 1IGFL 3KLAA 4QHMA 3CDGA 1HZHL 1SJXA 4M7LT 4HWBH 5D1XD 3IDNA 5BZWA 4OCMC 1TDQA 3BIAX 1TPXB 1UYWH 4MQXD 3VDBA 2ZCLL 3RWJB 1OP9A 5MEQA 1MAMH 4R4FH 3DYOA 3I02A 1C16A 4FZEH 5JHDB 3TZVB 2BSRA 2X4RB 5DJ0A 1F4YH 3D69A 1PX4A 5BV7C 3P73A 4U3HA 2HJKB 1A7RH 5MENE 4LPYA 3NPZB 1DVFA 1F02I 4ODVH 2AV7B 5C0DA 5C0FB 3OAZH 4HLJA 2IAMD 2PYED 1XF5A 2XIDA 3K4ZA 4HV8B 3OAUH 5LBSH 3D5OF 4M03A 5DJ8A 2YD1A 2CRIA 2D7TH 4RWYH 3V52L 3DVFA 1E0OB 5H35A 4DKFH 1CQKA 5C0BA 3HAEG 5T3XL 1T83A 4R96B 2ORBH 1BF2A 3VWJA 4LGSB 1CU4H 4RAVB 5FYJH 5IFHL 1QVOB 5TDPA 2EIBA 3GGWB 3VJ6A 3JXAA 2OK0H 3GSUB 3QIBA 5E7FA 5DMYA 4LAQL 5FIEA 2J8OA 3NFPB 1RIHH 3STLA 4XNXH 3QG6A 3ZDZF 1II4E 2CD0A 2ENSA 4RGNC 1BFTA 1ITCA 1CQYA 4JHAL 1LO3L 2VQ1B 2BVTA 1CVSC 2OR9H 3O6KH 4ALAH 1JGDB 4K55A 4NKIH 3QYCA 2VAAB 5I8CA 1OGTB 2B7DT 2G60L 3QG7L 2IQ9H 2M2DA 2R56L 3LD8B 4G9FA 1S7RA 2RBLA 5ANMA 1IKFL 5I76B 3VFOA 2Y7QB 4N1HB 2ICEA 3IJSA 5DJYA 1VB9A 4XC3L 3VFNB 4R0LA 4I13B 3N1QC 5KSAC 1LE5B 4OGXL 4JZNA 5D1QC 2MPAL 4HUMB 4XCCL 1KENL 1C8PA 4ZXBA 5IBTH 1JI1A 5T33H 2CK0L 4D3CH 5FYKU 4QXTA 4D9LL 4LSPL 4I0KA 1AXSB 1G0DA 1BD2A 2VDOH 3VXQB 1KIQA 3QNXB 4LCWB 5C3LD 1CICA 1U8HB 3HAEA 2NYYC 3HC3L 2EDHA 2B4CC 3U7WH 1Z3GL 4QTHB 1CDGA 3GMLA 1JVKA 3VI3E 5BVJA 4HWNA 3T0ED 1FZKA 3GM8A 2GFBA 3HRZB 5T1MA 3T0EE 1LK3L 3W0WD 4F8TA 2B2XH 2XWBB 3LEXB 4GBXB 4OCLC 1EHLH 1JL8A 4G6ML 2G2RA 1IZJA 2BY0A 4NDMA 4N8VB 1MVFA 4KTEL 3D69B 1JIBA 3DXAE 3P73B 1YC8A 4LPVA 3TP4A 2QQLH 4GKNB 4XVSL 2R29H 3SN6N 3RJQB 4QT5A 5FDYA 1AR2A 4BZYA 2ZUUA 5CMAA 2DKSA 1KPRB 4P46D 1UKQA 3D85A 5DJ8B 4JFEA 1T20A 2NZIA 3ECBA 5H35B 5C0BB 4CMHC 4M00A 3O6FB 1NBQA 4QGTA 2Y23A 4YFDB 1F11A 5DJZB 4E42A 3WKNA 2VH5L 3MV11 4Z7WE 3JV6A 4FFWC 3VFSA 4ZNEE 2EDQA 3WV0A 3PDGA 4WTXA 4NRYB 3RTQB 4HIIB 2J4WL 2R2HA 2FHFA 2VE6A 1CR9L 4KROD 1CXHA 3GSRA 1IEBA 4U6HA 4JJ5B 3BZFB 4UU9A 4ZUWB 4NQCD 2Y6SC 3ZSSA 2VMFA 4RX4D 3W82A 3RRQA 5TE7H 1ZOXA 2CXKA 5KS9B 2HG5B 5DMGD 5B21A 4K9EL 4PJEA 3OR7B 4P23D 3HI5H 3SDXB 3DJ9A 4NNYA 3K1KC 1ZHBB 3DECA 3DGGB 5C0RH 4RGOL 5ICZA 1JWMA 2Z31D 1F6FB 1P4BL 1OARL 2AEPL 1RQ5A 1KG0A 2XFXB 1AO7D 3U0WL 4L1DA 3OKLB 4LU5L 4NN7B 4XB8A 4YHOL 3G6JF 3ROLA 3N1PC 2QQQA 1TMCB 2X09A 1CDJA 3MV9B 1C5CL 1NC4B 2AXFA 5BRZE 3UZQA 3UROR 4HHAB 4PG9B 5CKAA 4ODUB 3FQUB 3JTTB 5GHWL 5A2IH 1RIVL 2Y1VA 5I1GL 3BGFC 1BD2B 1INDH 3GJFH 3C6SA 1JTOA 3GI9L 4Q6IB 3VXSA 1MPAL 4Y4KD 5BS0B 5FM5M 5I9QC 3G5VA 4N1CA 1EO5A 5IFJA 1F4XH 2QSCH 4ONHA 4YDJA 3RVVC 4HPOL 1A5FL 3UPAA 2ZUYA 2UWEB 1PW3A 3CFBA 4HZLA 1PJ9A 2MSPA 5C07A 5SWZA 3CC5B 2NY2C 3UYPA 4U33A 4AEHL 3DRQA 3BQUC 4PTUB 5FGCE 2IANA 1DUZA 2PTTB 1Z5LB 3ARFC 1A02N 3WD5H 3NZ8B 5DFVD 1Y18B 4TUOA 4U1IA 3HC4L 5FKPA 1C5BL 1P84J 3SJVA 5ABDE 1DQTA 2VABA 2E27H 4NQSB 4Y19B 3WEXA 1NANH 1IMHC 4FS0A 2B1HL 2SEBA 4JFEB 2P8LB 1FDLL 2A6DA 1TZGL 1Q1JL 1RHFA 3BKYH 4KRMB 3O0RH 2CJUH 4IOFC 1S9XA 1FPTH 4F7TB 1FZJB 1X6NA 2XI9A 1B90A 4M5YL 3MV01 5HHMB 5GGSY 5LCVH 1RUPL 4HC1H 4X9BA 1FNAA 4L4VB 1PAMA 4OIAA 1KBGL 5F71A 3TN0D 2AEWA 2R8SH 1CBVL 5L2JA 3C8KB 1CLYH 2VE6B 3W9DA 2AK4D 1UJ3B 3RWFA 2XYCA 3SKUD 4ELKA 1KSRA 4WI2A 2EDJA 4MCYA 4ZFGH 4UU9B 3C08H 1J18A 5I8KH 3BVNA 1E28A 1H15B 4U7SA 2ICES 2MCPL 4H5SB 4PJEB 4XX1E 3WLWD 1KN2H 3NCYP 2YUWA 3I9GH 5F44A 5GGQL 3KYNB 1SY6L 4WEMB 4QHNA 1OAZL 1OAYL 3SKNB 1IJ9A 2VDML 3O2WH 4XBEH 3RVTD 4NQEA 2APWA 1CLZH 5E8DH 2XWTA 4LCCC 4P57B 3EYUH 1ND0B 3GBNH 2AXFB 4ZD3L 4XWGH 4MJ4A 4BFIB 4LBEB 3CXHK 1A9BB 1RZKC 3MLWL 3CSYB 3MFGB 3ULUL 1J1XL 5CUSH 4RMTA 1PKQE 4X98A 1M7XA 4ZUSB 2HFGL 1FGVL 5LGKA 1QSZA 4RMVA 1YEJH 5DHVB 2VLMD 3PHOA 3QAZC 3ZLQC 5SWQA 2R4SH 4FQ1H 5J9PA 4P2QA 3VMNA 2OXHA 1S9VA 4JN2A 4MZ2A 3EOAB 4KVNL 4NJAL 3UBXB 1P1ZA 3FZUC 1QO3A 1RJCA 3HUJF 2NW3B 5CJ8A 5HYSG 5GPRA 1M1SA 1MCIA 1I9RH 3KJ4C 4JY6A 4OGAD 1T3FB 3IETA 3W39B 4L3CB 2WUBL 3SKJL 3D0LB 1I85A 4XPFL 1KJ2B 2HAZA 1U92B 3K74B 3O3UN 3L9RA 1DANU 4XP6L 1CF8L 5KTEL 3P9LA 3MROB 3WEXB 4PJIE 1GXEA 1ZGLP 1U8JA 3VE0A 1SJEA 1BQUA 2NY1C 1AGBB 2SEBB 4Y16B 1QUNA 1VFAA 4HJ0D 3QDGA 1N2RA 1HKLL 2QEJA 1BFOB 2BDNL 4G8EB 4NWTL 4O2EA 1BEYL 1CL7I 4M93B 2DWEA 3W9EB 5I71C 1F5WA 2AERT 4FQXC 4W4NA 4LCUA 5JOFA 1HHGA 1D6EA 4OZHF 1IKNC 3FQWB 2DS4A 1FRGH 4LASH 5JW4M 3W9DB 5DD0L 3BKJH 1JHTB 3VRJB 4C54A 5LGJA 1IFHL 1FNSH 1NUDA 4BKLA 4ELKB 3ABZA 4HLZH 2DLEA 4NKDB 5IHUL 4MAYD 1YC7A 4MCYB 1G6RH 1MVUA 5CJQL 1CDCA 3QPQD 5D7SL 2FX9L 2VLJD 3MODL 4FP8L 1AY1H 4F7PB 3BVNB 1ZEAL 1E28B 4GRMA 1YEGH 3ARVA 5C0NC 2IQAB 3K0WA 4K8RH 2IH3A 3F58L 3P0VL 3PL6B 1ZHNB 3HLAB 3HZVB 3FQRA 2WM0A 2H2SD 2Y25A 3UTZA 1ACYL 3HPJB 3SKMB 4IRJD 4ZSOA 2J12B 4LLMA 5HYSA 2DWDB 1E4XI 5F7LB 1I3RA 4JFXA 3EOBA 3PABB 2H2PC 1O7SA 1UKSA 5DMKB 4Z7QE 3OAYK 3H9SB 4KQ3L 4NBZB 5F9DC 5D2LA 2O93L 1KN4L 4Y1AB 4TUKL 4GMTL 4RDQF 2JIXB 4A2LA 3BUYA 3E6HA 3TWCL 3WIHA 3TFKD 5TF1H 4G8GB 2IAMA 2PYEA 1NMBL 4WEBL 1I1RA 4BFBD 1VHPA 1UCBH 2VLKD 3T77A 1MCOL 4LLYA 4WENB 1H8OA 3LSOB 4WW1A 4MXWH 4C83A 3WDHA 2VLKE 4OFIA 3VGGA 4Z7UE 1BIIB 5CEYB 1Q8MA 1UH3A 1ZK9A 4MDIA 5GGVY 3O2DL 5ESAB 5E8NA 5EZJB 2N7AA 2OSLA 3LPWA 4LQFL 4IIQB 4I77H 4U1SB 4EJ1C 4CNIB 2VDRL 4WHYH 1N59A 4NNPH 1F4HA 1KGCD 2D7NA 4HKBB 5EC2A 1A7BA 1DLHA 1AFVL 3KPLA 4HWEH 5FFLA 4PD4K 3O3EA 1MIML 5DI8B 3ROOB 1SJEB 2LU4A 3VE0B 1CGSH 3SDYH 3VWKC 1B2WL 5C0AA 1CDUA 4OCYL 5F21B 4NGHH 5E2VL 3HMXL 2C5DC 1KCSH 2ERJB 3MRBB 3RWDB 3P77A 5FCSH 2B20A 2VXTH 3MRLB 5FO7A 1DL7H 3LH2H 4Z7OE 1D6EB 3CSPA 4I2XB 4Y0GA 3SDXF 5FUCC 4OCWL 2YPLD 4RMUA 5BXFB 4DCQA 4YHKH 1N26A 4NO5B 1FVDA 1LEKB 4OLVL 2YPLE 4M48L 3S96A 5DD6B 2XG5A 2X9WA 1KCUH 4K3HA 3QSKB 1VPOL 4QKXB 4MXQD 2HKHL 1FYTE 5F72S 5E6ZA 4P4KB 3BD3A 1KJ2L 3MA7A 3FFCB 1B4RA 4MD4A 3WO3B 4CBPA 1J0ZA 3HE7C 3MRHA 1NBZB 2AJVH 3OKMA 3IDIA 1P7QD 3FQNB 1JUFB 1OTSC 5D8JH 4HWBL 2MHAB 4MSWB 2ADIB 3T1FB 5I1IH 1UACH 5C08B 4Y88A 3W0WA 1UYWL 1JYVA 4BJLA 1B4JH 4OI8A 5D72H 5I8OL 4J8RA 2GJ6D 3HZMA 4LKXA 1MAML 1YPZB 4G6AC 4JG0H 4R4FL 3RNKB 1ZLSH 4FZEL 1WAAF 3T8XA 5C09D 3PWLA 2EEAA 8FABB 1F4YL 3FB7A 4YE4H 2WK2A 4JVPA 4F7MB 2GSGA 5CGMA 3BUYB 3E6HB 1X3DA 1A7RL 3QI9D 1QKZH 4J3VA 3OV6A 2GTZA 4ODVL 5EUOF 4P46A 4MA3B 5CS7A 3OJDA 3VI4F 4L8BB 4K23H 1WZMA 3OAUL 5LBSL 3QUXC 2ARJA 2D7TL 4RWYL 4Y5VC 5H94A 1CFSA 1UCTA 2YC1B 4DKFL 1KLUB 1U8NA 2ORBL 4NOFA 1WFNA 3KPOB 1CU4L 5FYJL 2OSLB 3L5WA 4RSVA 1NKOA 1FFRA 1U95B 2OK0L 1MUJA 3IJYB 3BT2H 5IMOA 4N0YH 4W68A 1K8DA 1R3LA 4F7CB 4ELMF 4PJBA 1RIHL 1HSAB 1JV5A 4KJPC 5DHXB 4PLNC 3GJFB 4XNXL 4NQCA 5L2KD 4X83A 5DJ2B 4JFQA 5EPMA 1QSED 4J3UA 4M4RA 3SGJA 2BRRH 4YDLC 5DVLA 1CXKA 4X6FB 4G8IB 2OR9L 3O6KL 4P23A 1AGCA 1JPST 4DW2H 3G04A 4NKIL 4WW2B 2ADFH 2Q6WB 4P5TC 1MH5A 2IQ9L 4R4ND 4H8WH 1T0MB 1U8IA 4JG1H 4L4TD 1AO7A 3DOSA 4PJFB 3QXWA 4KPHH 5E4EB 4APQB 3H9HA 2IADB 1XGTA 4HK0A 4AZ8A 4L4TE 1ZLVH 2BNQA 5FKAA 2OZ4A 1OW0C 1PEWA 3PWPE 4RGNE 5IBTL 4AEIL 5T33L 4MJID 4D3CL 1K4CB 1RK1B 1QYGH 3MA7B 2E9WA 3L5JA 1B0RA 1OGAA 4E41D 5A2KH 5F7DB 2DBLH 4HS6B 4DQOH 3MBED 5FDWA 2VDOL 4JGUA 2X1PA 3V6ZB 3IRPX 1FG2B 4RBPH 4XRCB 2YSSA 3MJ9A 3U7WL 2BY3A 4XTRD 2OTUA 1KCKA 1T89C 3DX9A 4LSQH 2JJUA 4Y5XC 3DRTB 4WI5A 1MIEH 3WXVH 2A0LD 3F7RA 2B2XL 3HZMB 4ODTH 4OQ1A 3BZ4B 1EHLL 3PF2A 5IIEB 1IAKB 4JRYD 2X41A 1MAKA 2CMRH 3V5HA 4L8SA 3QPXH 2IPTH 3FB7B 3GMNA 3FO2B 1NCNA 2QQLL 3MGOB 4KRPD 5DF0A 2Y07H 4GG6F 2NY4B 2R29L 2NX5D 4GS7C 3L7FB 2J8HA 4L3ED 3BP6A 1A14H 2F8VA 5H94B 1JNNH 3QEQD 3ZL4H 2DQFA 4WV1B 5CEXB 2EDOA 2I26N 3SBWC 3FT4B 1U8NB 1I1YA 4JPIA 1PX3A 3QEQE 1I8KB 2FEDC 3TN0A 5GGSA 4UDTA 4P3WA 2GITB 2Z92A 3SE8H 2D3VA 4I4WB 1C5DA 1MHEA 3OF6D 2GJZB 1CG9B 2AK4A 3ELAT 5F6IC 1MFDH 3BN9C 4YJZL 4PJBB 2KPNA 4P5MA 4U1GB 1JV5B 3GHBH 5D1ZC 3FB5B 2FX8H 2VQUA 4XWOC 4GAYB 4EBQH 3MUHL 4L8CA 1I3UA 2OM5A 4JFQB 2BP3A 1ES0A 5TE7L 1DBMH 2F54E 4PJDF 4LK4A 5I1CH 3HPLA 5KG9A 1JHLH 3VXMD 1XGYH 3HI5L 2FYYA 2VIRB 1EEZB 2XZZA 4WU7B 1IEAA 4XBGA 1EEUA 5DTFB 3UTOA 1ZT4B 3AREC 3D39E 3VXME 4RNRA 3QHFH 3WJJA 1FVCA 5I1LA 1FFQA 5E2TH 4KV5F 3TBSB 3RZWA 2Z4QA 4ZAKD 4H26A 4LEOB 1DN0A 2YMXH 5H37G 1EFXD 1XGTB 1QRNE 4LLWA 4A6YH 2Y6SD 1G6VK 1V7NH 2BNQB 3EIFA 4HH9B 5FKAB 3SGDI 2P1YA 4FABH 1NEUA 1S5HB 3SOBH 3NFNB 9CGTA 4OAWA 2R0ZH 2DLGA 4KKAC 4D9RD 4U1KB 4PGBA 5JXED 3D3VD 1B0RB 1OGAB 5E8PA 3VD4A 3AFLA 5L88H 1CGTA 1GHFH 1INDL 4JAMA 4PGCA 3D3VE 5I1HH 1I8MA 1S7TA 4AM0B 1I1AD 2EXWD 3GSXA 2BSTB 2EECA 4HDIA 2EDEA 5I2IA 1F4XL 2Q3AA 2QSCL 1QLRB 3DX9B 3QQ4A 1U8QB 1WF5A 4XGZA 1QLFB 3KDMA 1G6RB 2P5EA 2YZ1A 4I1NB 5J1AA 3DX7B 1RUQH 3G6JE 4KKNA 5JLZB 3WD5L 1LE9B 4NQUA 2P44B 5HYJD 2H6PB 3DX8B 3MRDB 4HD9A 1I9JH 2VISB 3CFEA 4Z77B 1AGDA 2BVQA 2E27L 2XG4A 1WCBA 1FBIH 2FJHB 3PWJA 4O02H 3V4PH 5IMMA 4OF5A 2LTQB 3LN4B 2K9UA 3BKYL 5HGHB 3O0RL 2CJUL 4H0GA 1FPTL 3VD7A 5F6HJ 1CFQA 3BQUD 1JGLH 5LCVL 1I1YB 4HC1L 1I9EA 5GRVK 3ARFD 5MI0B 4ACPA 3WL9A 1X5JA 1JRHI 3TYGH 2R8SL 3IT8D 2G9HB 1MHEB 3ULVC 1FVEA 4NN5B 1CLYL 4LPCA 4HGMA 5FGBC 4CW1B 3T1WA 3OB8A 4LLDB 4MAYA 3VG9C 3TBVB 4DVRH 2VLJA 4L8CB 1I7ZA 5HGAB 4ZFGL 3C08L 1C12A 2OS7A 4IOFD 3BRDA 1JZ6A 5I8KL 3ZDXF 2FBJH 2IALB 5E6IB 3ZHDA 4PJCB 3EYVA 2BRQA 3I50H 2CRYA 3NABH 3ARBC 3SDCB 4Z7NF 1KN2L 2COQA 3I9GL 3EGSA 3EO0A 1QQDA 3IKKA 2BNRD 4UNVA 2VDNH 1G1YA 1HILA 1Z2KA 2VXQH 2WIIB 4OV6F 1K3IA 3LZFH 4JQXA 4Z5RA 5K9QG 3KPNA 5FM8A 3O2WL 1J05B 4GQPH 4XBEL 1RK0A 4RQQA 1JTPA 5I73B 1CLZL 5E8DL 1YJDH 1TTFA 2CIKA 3O9WD 5EG6C 5D70H 2HVKA 3SKOA 5J3HC 3EYUL 1PG7H 4X0KB 3VCLA 3IFNH 2P4AB 3SE4C 1FJ1A 1MRDH 5E8PB 5IMKA 5IBUG 5J6GA 2FD6H 3QBTB 1WBYB 5CUSL 1W0VA 3TO2B 2P45B 4EI5A 3RGVD 3GSNH 5I74B 3GSXB 4MJ5B 2VDQH 3Q5OA 5ADOH 2EDLA 5E00B 3HE6D 5TH2A 3MREB 4I3SH 1F97A 5DJDA 3UC0H 4G80A 5FYJU 5DUBB 3CFKB 4C55A 4UTBH 4FQ2H 2R4SL 1U6AH 4FQ1L 4U6YA 1EMTH 3RZCC 4HIJA 4O00A 4K07A 3AAZA 3H9YA 4OZ4A 4LDOB 2AXJA 5J1AB 1A1MA 1I9RL 4S0TD 4YHZH 5DZOA 1TQCB 4CADA 4UV4H 1NFDE 1IGTB 4HKJB 1J0IA 4IJ3B 4PRBB 3D0VA 3P4LA 1K85A 2GI7A 3IAQA 1KXQE 2ZSWB 2NXZC 4GO6B 4HK3N 1RZJH 5FV2A 3QDJE 5IMMB 1JMZA 1Q9WA 4OM1H 2C1PA 2EC9U 1TLKA 3PQYD 3KPPA 4BYHA 4AQOA 4D0BB 5JO5A 2GCYB 3MNZB 1BZ9A 5MP6H 3ZE2F 1CFQB 1S7QB 2VDPH 4EOWH 1NCUA 4UB0H 1KF9B 3JUYA 4URTB 5J6HA 3TBYB 4EQ2A 3HS0A 4WW2F 3V6OA 1A1NB 4PV8B 4HUVB 1KLFA 3PGFH 2AGJH 1FRGL 4LASL 1T1WB 5DGRA 3BKJL 4X6DB 4GW5B 1FNSL 1T7YA 4YZFF 1NC2B 3TVMA 3FCTA 1G6RL 4IRSC 5BMFH 1AY1L 4NHUB 4YHYC 2X9XA 3SCMB 4K8RL 5ETUA 3FONB 1FAIH 5DRZB 1IGMH 1CLCA 2F53E 3U48A 3L3GA 3OGCA 4HUUA 1X5YA 5BZDA 1P7QA 1KEMH 1X5IA 4FQLH 5IM7A 1S78C 5T1LD 4Z5RB 3MYZA 4LGPB 5F9WB 1HHKB 2ZG1A 4JQVA 4OZHE 3MJ8B 4X6EA 1NGXB 3P30H 1XF3A 4PJ9B 5DR5H 2CIKB 2GJ6A 3NACH 5K93A 3L3JA 4MCZA 5MHSD 5HY9B 5KVGL 1KB5A 3MRQB 3MRFA 2AVGA 1WWCA 1OSZA 5C09A 3KPQA 4PLJD 4YDVB 1CD1B 3MNWA 5F3BA 5MHSE 2H9GA 4P2OC 4JPKH 1YQ2A 4ZS6D 5J6GB 1NGZB 1MNUH 4ZUUA 4M1CD 1AD0A 4FTVE 5TF1L 1URLA 3VD5A 4HS8H 4JQIH 4N0UA 1R5IA 4MGXA 1UCBL 2H2PD 4IMLB 1QHPA 1YZZA 2I07B 3ILPA 3TO4B 4AL8H 5KSBA 4MXWL 5TE4L 1F13A 1BOGB 5F1OB 3RA7H 4KRNA 3UPRB 2J8UB 4XCEA 4DKEH 5ESVB 4F7EB 4WFEE 3LDBB 4I77L 2BOBA 1VADA 5BCAA 2JELH 1IC1A 3QCUH 4NNPL 2BXZA 5C6TH 3BO8B 4HULB 1S7UA 1BJ8A 4XP5H 4HWEL 5L2KA 1ULVA 1ZT1B 1QSEA 4LRIC 1CDIA 1G7JA 4WFHE 1CGSL 3SDYL 2XXCB 4OM0L 1P84K 5A16A 1WBZB 4NUJA 4N9GA 4AY0A 5IK3B 2QR0A 3WS3A 1I7RA 4JR9H 3VXUD 4NGHL 1QBMH 4FQHA 2F15A 1KCSL 1WZLA 2NY3C 3G6DH