5I74C

X-ray structure of the ts3 human serotonin transporter complexed with br-citalopram at the central site
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
214
structure length
214
Chain Sequence
DIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYSIPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures and mechanism of the human serotonin transporter.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Sodium-dependent serotonin transporter
total genus 39
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2016-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i74C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i74C01
5JXED 4POZD 2Y23A 4JY6B 4L4VB 1XFPA 1LEGA 5C08B 5E00A 2JCCA 3MNVB 4M6OH 2D7MA 3L3GB 3V4VL 2WINB 5E2TL 5TGBB 2Y06H 2HT2C 4ORZC 1R3JB 3HE7D 3TN0D 4O58H 5B38B 4PJ8A 3VG0L 2IH3A 4QTIL 4LPYA 4IRSD 3UPAA 3AREC 4LNRA 2NLJA 1RUAL 2YUVA 4FQ2L 4XXCA 4LARL 3L1OL 3QDMD 4WU5B 3SE4A 4PY8J 2YZ8A 3O6MH 2A77L 3E6HB 1FBIL 5GSVA 1NCDH 3VMOA 1I7RA 3LAFA 2AXGB 5GJTH 4OTXH 3UTTD 1KULA 1RVFH 5DEZA 1FV1B 3QIUD 1W0WB 1NKOA 4GRWE 4JHZA 1YNKL 4NJAL 3SOBL 2OR8A 5EU4B 4TQEH 4XMKH 1L6ZA 4XBEL 3GEWB 5LKNA 4F7CA 4U6YA 3GJFA 1XZ0B 2VDRL 5FKPA 1PQZB 1VFMA 1JVKA 2VTFA 3CZFA 3MGTA 1SYVA 5TQ0H 2GSGB 4NQXB 2LFGA 1JCKA 3UO1L 2ESVB 1CGTA 4NQEA 5E7FA 4DN4L 1HYRC 2X4PB 4M5ZH 1KGCE 4W4OA 3FB7B 4NWTL 3TA3D 4MA1C 4QOKD 2Q8AL 5ILTH 1W72H 1WC7A 1W72A 1NBZB 2VLJB 5TE4L 3TPUA 3P4NA 2GCYA 4MJ6B 2V17L 3MR9A 3L9RB 1K8IA 2VLJD 4K55A 1NBVH 3PGCA 1BLNB 3LV3B 4R2GB 3RHWF 1CXEA 3JSSA 2FIKB 1ADQH 2HH0L 2ORBH 3BKJL 4M8QB 3WIHA 1E4WL 1MWAL 1Q9WB 5DRNA 4KJYA 1MNUL 3VXUB 1L0QA 5BJTB 3CFCH 2EH7L 2WLYA 1FG9C 3FTGB 1W2KT 3TBSB 2JB5H 3QXDA 5AZEH 4L1HA 1FZJA 4QTIH 1ZS8B 3GSVA 3QNYB 3LS5H 3D2UD 4DKEH 25C8H 4XP9L 2VDNL 3QI9B 4E42B 1A2YA 5FUOL 4WTZG 3GSQA 4R7DB 2VAAA 2QTEA 4M93C 4ENED 3REVA 3P4OA 4NO2A 1JRHL 5JZ7D 4AENB 3HC3L 4H26A 4KZEH 3UC0L 2YSSA 4M5YH 5GS1A 3ZDZF 5LGHH 4Z8FH 4RGNC 2CXGA 4JJ5A 3QUXB 4QHNB 3GSXB 3QI9C 3DUUB 5LVEA 4KRPD 3EFFB 5CD5C 2ZSWA 1XGUB 2MCPH 1P7HL 3OKKA 5GGUB 3RP1A 1UZ6F 5JIHA 2MHAB 3TJEL 4XNMA 4ENEC 1BWMA 5LJYH 2V5MA 4PGZA 2D7OA 4S1QH 2DWDA 2APWA 3FO1A 1JV5B 3JV6A 3T4AB 4H8WH 5ICXA 1BBDH 3HNSH 1I1YB 4L8SA 2DQIH 4U3HA 1DN0A 3B2UC 1A14H 5DJAA 5IP4A 4DGIH 1GGUA 1U8HA 1LP9A 3DGGA 4CGTA 4LVOC 4KK5D 4LPTA 5ALCH 2P8PB 1TVBA 5DJ6A 1NCUA 2E7BA 5EBGA 1C5CH 4C56B 2VDLH 4XVUD 5KSUA 3P77A 3W0WA 5GRZA 5AG8A 3B3IB 5CEYB 2YD3A 5IVNA 3BT2H 1NC2A 1XGYH 3INUL 1B6DA 1J1XL 1BJ1J 5HGDB 1UM5H 5EUOF 5IVXA 1FFOA 4JY5L 4IMLA 2XI9A 4F8QA 4M03A 1HHJB 4LHUD 3WJLA 5EBWA 5ITBL 3V5KB 3EOBB 4LSSL 1C5CL 3JBG7 4ZMAT 4XP9H 4P5KA 4LCUA 1Q94A 1ND0B 2XZZA 3SPVB 1O7SA 3EJJX 4LVEA 5DJ2A 1F5WA 5T1MA 5DJZB 1RUKH 3W39B 3DX8B 2FSEA 4A6YB 5IB2B 1D5ZA 5DJ8B 4ODBD 4P2RD 1QFPA 4BSVB 1A1NA 5IBUG 4X4ZA 5IF0B 5T1LB 4PY7A 2ATKB 5ITFA 5JOFA 4NOFA 5C0RL 1A0QL 3QR2A 4MXWL 1S7WA 4Z7UA 4G5ZH 3GJFH 1J8HD 3NCCB 5DA4A 3FT3A 1TJHH 5GIRB 3DRQA 5F96H 1P7KA 3H9YA 1MUJA 1NEUA 3UTSA 5IMLB 2EH8H 3KNBA 1FFNA 3U9UA 1CBVL 2NY3B 5ABDE 5I15H 3W9EA 3NCYP 3VGDA 2HTLD 2YN3A 3Q6GH 4FXGA 3WNMA 5IROC 2C3GA 2AI0L 4GRLD 2PN5A 1CVSC 2ATKA 4P46B 3GHEH 1CU4H 2YEZB 4K9EH 1B4JH 2I60L 1FIGH 3G5ZB 1INQA 4OD1L 3BH9A 2R2EA 4P46D 5JXAL 3VFSB 3FL7A 4N1CA 4WI6A 1SMAA 4ODUA 3ZE0F 1UJ3C 1VEMA 2A0LC 3C9NB 1IAKA 4IM8A 1S7QA 1PGRB 3BZFA 4PJ7B 3H3PH 4XNYH 5EG6C 2VKXA 5A2LH 3U9PH 4Y5YA 3QFDA 4PRNB 4L3CB 3LKOB 4AG4H 1BREA 3M8OL 4NQVB 3VDCA 3TYGL 4Q6IB 3SGEI 4PRIE 4XC1L 1CDYA 1Z0NA 3QJFA 1QBBA 1T5WB 4AH2B 3RI5K 4X5WB 2LAGB 4P2OC 4JGJA 1OAXL 4MD4B 4M93B 5HI4D 1XGRB 4M5ZL 1I3GL 1K8IB 5I1JL 3T3PE 2CD0A 3PV6A 3D3VB 1BIIB 4AIZA 2XRAH 2HFFB 2AK1H 3ZSTA 3MO1A 4F2MA 2FJHA 4LKCA 1JPSL 3VDAA 5E6IB 2G5RA 4BQ9A 2NYYC 1OTTC 1YMHA 3KG5A 4YHIA 5IESL 2CO7B 4JDVB 1KYOJ 3IDJB 3HNTH 1GZPB 5AWNH 1TJHL 1I3UA 2EYRB 2FO4A 3PWLB 4N8CH 3DARA 4RNRB 4LEOB 1XF2A 5L9DH 5A43C 5C0BA 2QHRH 4FFZL 4G6ML 2CUHA 3SKNB 3BEWA 1FL3B 3NA4A 3DYPA 3D25B 3MBXL 3PNWA 3MJ9H 1ZV5A 1NJ9A 1CICA 2VH5L 1ZWIA 3PGFL 1DVFC 4QHNA 2P44B 4HKBB 2PNDA 3NACL 1DUZA 2WZPD 4NO0A 1A4JB 3UC0H 1AIFB 3C08H 3L7EB 4L8BA 2YD5A 4OKVA 5HHXL 5IEKB 4NOBA 3GO1L 2C3HA 1X4YA 4UDUB 1BZQK 3T0DA 2ICWA 5DHVB 2BNRD 2DQUH 2W0KA 4OQ1A 4K8RC 4POYA 4XPHL 1MIMH 1IQDA 3MXWL 2MJWA 3BPLB 2A1WH 3WO4B 3OB0K 4HFUH 3IKCA 3KYNB 4MMZC 5IVOA 3QO0A 5IM7A 5GRJH 2OBGA 5EZIH 1NCBH 4JKLA 1KTLA 1JMXA 1Q9WA 2HKHL 4PJCB 1F2XK 2YA1A 4MCYB 5HSFA 4XNMB 5B4MC 3MLYL 1A6VH 1F3RB 5IV2B 2G60L 2YPLE 3GMRB 3MRHB 1MAML 3IRZA 4KH2A 2W9LA 2IWGA 1G7QB 5BV7L 4M7JH 3SGJC 3HE6C 4PS4H 1BOGA 3OGCB 1A6WL 3RNKB 1JRHH 1ORQA 5GRXG 1O0VA 3ROOB 4XNXH 1GHFL 2GK2A 3PDDA 1A9BA 4NZTL 2GJ6B 5F3HB 2RFXA 3NFPA 3O6FA 5EZJA 1BJMA 3KPQA 1SY6L 3PWVA 4JFZH 4U7KA 1R3IL 2VLKE 3HAEB 4S10A 4YQXH 2WAHA 1MCFA 5EO1A 1BP3B 4LEXH 5HD8C 1PZ5B 2A6JB 2CUMA 2KQNA 3B43A 4MJID 2HJKB 4LVNC 4KDTA 2OX5A 4WGVB 1KV3A 2KKQA 3IS1X 4OKDA 4LCUB 4HMEA 4WO4C 5E03A 5K9JH 4NZDA 3TH3T 2GJ6A 3QISA 4JFZL 5DO2C 2GTWB 4QRPD 4GG8A 1AHWC 5INCA 4UV4H 2GSIA 2V7HA 4X98A 5IMKA 2IANB 1Y6NR 4JN2B 5JDSA 4P9HH 4QRPE 4R4BA 2DKMA 4QNPE 1NC4B 3BMWA 1IAIM 3AU1B 3BP7B 2MQ3A 5KOMC 4OZIA 4FP8H 4HIHB 2WK2A 4NQCD 3TT3L 3JWOC 1AD9B 5E8OA 3MLUH 1KLGA 4HAGA 4M1GL 4JKWA 1JUFB 3LQAH 4APQA 4OF0A 3KLAA 1J8HE 3T2QA 2R69L 1FDLH 1BJ8A 1KG0B 4L3CA 3DVGA 2CRZA 5C9JA 3LEVL 1JFQH 5CZKA 5DSCB 5T1MB 3AS1A 3CMOL 4JRXE 3OKNA 3EYOA 1C08B 3MFGB 3MJ7A 3O3BA 4D0DB 4H1LA 4WI5A 1BM3H 4HIJA 3CNKA 3O3AB 2ZUVA 1E4JA 4AG4L 3KPQB 5D72H 3QUMA 2V2XB 3ES6A 3W9DA 1TJIL 1MFEL 4CVZA 4P4KA 1IGTA 3T09A 1A6ZA 3ZL4L 4WW2B 1XR8A 4M02A 5EH1A 4N0UB 1FRGL 2IFFL 4NDMA 1MEXL 5FGBA 1MJJA 1A8JH 2AJUL 4PJGF 5CEZD 1DQQB 1KJMB 2XN9B 1A2YB 3I6KB 3KR3L 2H2PC 4KUZL 2ARJQ 1K6QH 1S78C 4NJAH 4U1SA 4P2OB 1SMOA 5MENB 3WLBB 2FEEI 4MD5A 2JCCB 1G9MH 3L5IA 3SE3C 1EXUA 4N0YH 3VFTB 3SDXE 4N0UE 3WIHH 1A9EB 5IB3A 4JR9H 3F5WB 2VLRB 4G9FA 3Q3GA 3MLRH 1SEBB 2QQNH 5BS0A 1B3JA 1I1FB 4DOHB 4OLXL 3U6RA 1QG3A 2CDEA 1IM3A 5D2LF 2HVJA 3VXSB 1NC4A 1MJ7L 4R90H 2H2PD 4GXUN 4LOUC 1E28A 3C60C 3OZ9L 4OIAA 3LZFL 4NKMA 1INEH 1OM3H 3TBTB 4ZFOB 4G3YL 2Z8VC 1U8KB 3HRZA 1OPGH 1FG2A 1CICD 3G5XB 4QHKI 3GJEA 3FB5A 1IEBA 3V5HA 1UKQA 5GGSB 1GGBL 3S8WA 1R3LB 1Q0YH 5TF1L 2H3NB 2Y36H 1GC1H 2X1XR 4NC1E 3VFMA 1FGVH 1PSKH 3KYMB 1G6RH 4OIIL 4FFVC 3U83A 4LIQH 4OLWH 1HHHA 4XP4H 5GGSY 4G80A 4M1DL 4JCLA 5JPMA 3SDXB 4ELMA 5IEHB 3V5KA 1RJZA 5DQJB 1KPUA 3GKWH 3MUHL 3HCVB 3WN5C 2Y72A 4Y1AB 5E99L 2I25N 3H9ZA 2JF1A 1FL5B 4JO2H 2ATPA 1CLYL 5T5FL 1F6LL 4HLJA 2M2DA 4QXGL 5C0AA 4Y1AD 3MNWA 3JV0A 1T1YB 3PGCB 4ZNCD 1WEJH 4LCWD 4ZNEA 3GMPB 5B38A 1G0DA 1TQCC 2GITA 4UT9L 3Q48A 2UVEA 2OTWB 5F72S 1TZIA 5I8CB 1QBLL 1E27A 4UTAL 4S0TD 3TNNA 4WNQA 4WDIA 3NZHL 4QCIB 1IKNC 5ID1B 1YQVH 2J4WH 1WFUA 2NY7H 3TO4B 4MCZA 2NY3C 2FNBA 5E2WL 2LABA 2VITA 4HIXL 4R3SB 5JLZB 1ED3B 1QRND 3MV8D 3IXAB 2NX5D 5CJ8A 3S3PA 1OHQA 4UIMB 2VQTA 4G7VH 4TUKL 2GUOA 1RSFA 5DS8B 5IQ9A 5IT2H 1SYSA 1BQSA 2HT4C 1EEZA 1F11A 1F8TL 5HYJE 3SDDD 2ZUUA 1IBGH 5KSBF 3PL6D 1S9YB 3RVTD 2IADA 3U4EB 4DN3H 15C8H 5BZWB 4GRWB 1J0ZA 3ARRA 1ADQA 1P1ZA 3SKJL 4F3FA 1T4KB 1J1PL 2ZPKL 1SM3H 1X4ZA 1WT5A 4OCYL 4JGMA 5IT2L 4M4RA 1ONQA 1CFQA 4H8WL 3PGDA 2A74B 3MRDA 2AJVL 1Y18B 4NQDD 4CU8A 3GZKA 3KYAA 4M6ML 2E5EA 4EUPG 1CFNA 3KPTA 1CLOH 5HDQL 3I6GB 5C0CB 5T1DH 3RUGB 2NNAA 3TO2B 1F90L 5F44A 1VESA 1M7DA 1IAOA 1XZ0A 4RIRA 1OAXH 5E5RB 1MHHB 2V9QA 1X5JA 4WY7L 5EFIA 4CW1A 2ICWB 4KZDH 3UTSB 2P47B 5C08E 5KSAD 3NCYS 5DD1H 1QPPA 1FVDA 4LQ1A 4TYUA 1CLCA 3OJDA 3TBWA 2Q3AA 5E7BA 2O93L 1H3WM 4K94H 5IK3B 1PFCA 4P0DA 4GG8B 1UM5L 5INCB 3QIWD 4ZAKA 2PUQT 4P2RA 4DZ8A 1C08A 2UY6A 3RTQD 1OWRM 1OT2A 4GMTL 2FWOB 2PF6A 3TVMB 3C5SB 4XPTH 4ONGL 5K9KA 3U7YL 1C12B 4IOFC 1ZT1B 3UTSE 5C6PB 4IS6B 4NKDB 2MKWA 2V5SA 2N1KA 3HI1B 5ALCL 2DLIA 3BFOA 5ALBH 4EN3B 1IJ9A 2W59A 3RAJL 3KVQA 4XVTH 1NLBL 3I6LD 3L7EA 3P11L 4L8BB 4DQOL 1WAAA 2XZCH 4HIIB 1JUFA 5MP6L 1FFQA 4MNGB 5KS9A 3HUJE 4TOYL 1A9BB 4HS3A 3WN5B 1N5AA 1V3MA 4K3GA 2N4IA 3PV6B 2E9WA 2IANA 1DLFL 1CN4A 3EO9H 3IS0X 1XF3A 4EUPH 2X4OA 5ADPH 4K3HA 3KPSE 1EAPA 2VZSA 2N7BA 1FNSL 4FQLH 3VXRB 5IR1B 3FFCB 3QQ4B 1CDGA 2JJTC 1G9NL 4KAQH 1NFKA 3EOTH 3QUZD 5F97E 1I9JH 4F7EA 5E6IC 5BW7C 5BS0D 4KFZC 4PJFE 3N1FC 3QCUH 1JZ2A 4Y16D 4LKXA 5D72L 1D5IH 1G6RL 5B39B 5K9OB 5HD8D 1HINL 3FRPA 5GHWL 1K2DA 2W60B 7CGTA 1C5DA 5HVFB 4C83A 3I02A 1FRGH 2IFFH 4RMQA 3UCRA 1NGQH 3H0TA 3QHZH 4XNZB 4HBCL 3ARBA 4OZHE 5GGRB 5GGVH 2PXYC 3D6GA 4MMXC 3MRIA 2APXA 1U9KA 4XC3H 5JIPA 2DS4A 1CDHA 3O4OC 2CR3A 3V8CA 4YBHA 2HTLC 1N0LA 5D7KE 4RFOL 1QLEL 4V1DB 4R7DA 4MSWB 4NM8H 5F1IA 1MSPA 1RZKH 5F88A 3ARFC 1R24A 5A2JH 1D6VH 5MEQA 2IEPA 5GJTL 1PEWA 1B0GA 5GJSH 3KHQA 1LP9F 3QJHB 4Z7OF 5C0BB 3TYFA 1KPVA 3EO1B 2QSQA 4OM0L 2XQBH 3CVHL 2DDQL 1JPFA 1H5BB 2Z31A 4PJBE 1K6QL 4MLIA 4H25B 1KN4H 2VXVL 3GMQA 5GGRY 1U3ZA 1MLCB 4YDJA 3RDTA 4OSUH 1LEIB 4QRUB 3LEXA 2DI9A 12E8H 2BXZA 4EDXB 4L4JA 4JG0H 5HPMB 3CXHK 3VH8A 3Q6FB 2HRPL 1WBZA 2KPNA 3ARFA 3NIGF 3T0VA 5IG7A 1QBMH 2IBBA 2YD1A 4B0MM 4RSVA 1JWMA 3BYTA 1I7UB 1Y6KR 1KPUB 3BEVA 1UXWA 4EXKA 1BQLH 2VXSL 5DD5H 5GISL 2H1PL 1PKQB 3TT3H 4GRLC 1NAKL 1KIUA 2XKUA 1E4XH 4WUKH 4ZPVB 4O5LL 1RK0A 1IKFL 4LCCB 1VDGA 2F74B 5C0JB 2RJMA 1KLFA 5JUEL 3TF7C 5EBMB 4HT1L 3STZA 2AJXH 4MZ2A 2VZ1A 3KPLB 5HY9B 4XWGL 4PJCF 3WEXA 2JIXD 1AJ7L 4H0GA 4ONFH 4BJLA 1IEHA 3E2HB 1QSED 4JDVA 3EOBA 4P3CH 4NT6A 1DP0A 3FRUA 4LCIH 5D1XB 4HKZA 5AAMA 3TM6A 2IJ0C 4Q74A 1J5OL 5BW7A 4OBRA 3I2CH 3OHXB 3S4SG 3T65A 1KTDA 2CH8A 4Z0BH 3DO3A 2HKHH 5TGBA 4M1DH 3FN9A 5TPWH 4K7FB 3ZMRA 4ZO8A 1V7NH 1JI1A 1AXTL 1LO3L 1V05A 4OCMC 4LLQB 1DE4A 4E41D 5C07A 3O0RL 3RIFK 3GSWA 3GI8H 4LLMA 3AS0A 4X83A 3CX5K 4XVSL 5JW4R 3M17B 3K8MA 4Y5YB 1I75A 1AXIB 1V3KA 2FR4A 1GHFH 3BYYA 4XCEB 4YDLB 4PTTB 2WUCL 4NQVA 5ICZB 2WUBL 4WI8A 2CMRL 4QRPA 1JJUA 4I0CC 3M1BA 1IQDB 4PBXA 2XFXB 3MBEC 2XIDA 4YHZH 5GRUH 1XGRA 1KENL 3OKMA 3OZ9H 4NIKB 1OTUC 4GW1A 4MNQE 5E5UB 5T1DL 4CMHC 1TITA 1PKQA 4J7RA 2P7TA 2R2EB 1P7QA 1KPRB 2Q7YA 2XWJA 4JM2F 4HLZH 4HK3N 3QB7C 3QZWA 3MRJA 4FZ8L 2B4CC 1X44A 4NBYB 4R97C 1TFHA 4KVCH 1CK0L 4UT6H 1RMFH 1ED3A 3EOAB 3OKLA 4JPIB 3F7VA 1DLFH 1ZA6A 4MWFA 1KFAL 4X6BA 4J4PC 3SGDI 1J5OH 1NUGA 4XP1H 1OP3H 5FA3A 5DRXB 1S7TB 4MZ3A 4M48L 3VFRB 2Q87A 5JW3H 1IGYB 5EZLB 5KSBE 3T3PF 4BSVA 5H94A 2F58L 3DROA 5DRZA 3DGGB 2VISB 2BJML 1QYGL 5JW4Q 2HAZA 5IM7B 3NGBB 4FMFA 3RJQB 2AJYL 4G8GD 1RIUH 4KJQC 1FNEB 1NGPH 4X6FB 4ZODA 3V6OC 2HLFC 4G9FD 3WE6A 5FOJA 1RUML 2GITB 1RHHB 2ZG2A 4PJAF 2V7NA 4G3YH 3OKYA 5F1OB 1MHCB 2GTZB 1WT5C 1RJLB 1K4DA 2ESVA 3O81A 4MD0B 4JRWA 4N8PA 1HWHB 3GMNA 4UU9A 2P1YA 5KVMC 1M71A 5JHLH 1EA9C 2GAZA 1K8DA 4YFDB 4U0QB 5ERWB 5F7FA 1N5YL 2AEPH 3B2VH 2EIZB 3V2AR 1SYSB 1QFWI 2G75B 5GQBA 4ODTH 4XNZC 3QG6B 1N4XL 1AP2A 2E8ZA 2EDHA 1CFVH 4TOYH 3OQ3B 4HS8H 4HFWA 1BVLA 1YNLH 4OFDA 4PJIE 5GS0L 1VGKA 4AMKH 2JELH 2E7LC 2GEEA 1WFTA 4MNHA 3BRDA 4JZNB 4X0KA 5M94B 3ILQC 1ORQB 4PYGA 3UJTL 5IVZA 4N0CC 1J86A 3B2VL 5A2FA 1CFTA 1KFAH 1WZ1H 3H9HA 3OR6B 4FXLA 1BQHG 5DR5L 4Q58C 1GGTA 1U8QB 2AKRA 2J12B 2R15A 3BQUB 5IJVA 3PQYE 4XWOC 4KK9D 3MCKB 3CMOH 3ZDXE 1FORH 4X6DB 5GS1B 5FV1L 4YHYC 1IM3B 1HKLL 1Q0XL 2YD9A 4TNVF 1PLGL 4KKBD 3GHEL 1OAKL 3U9PL 3S88L 2NY6D 4KY1H 5KTEH 1S78D 4UINH 1NDGB 1KYOK 1U8IB 2LU7A 5FHAL 1J0JA 3DECA 1I1RA 2JJUA 2NR6D 3PWJA 2XWBA 3E3QE 3O3EB 5DJZA 1MQ8A 3LHPH 4P5MB 5KANI 2ZCKH 3IYLW 4LAQH 1NGXA 3RZCD 4OLEA 5BJTA 4EI5A 1T04A 1A5FL 3UAJD 3MCLH 1OCWL 1DQLH 1OD9A 5IK3A 4GKOA 3QUKB 4KRLB 4NO5B 4HQQH 4U6XA 1MCIA 2BC4A 1T5XB 4W70A 5H35A 2ICWJ 1I8LA 1MCLA 2ITDB 3E2HC 4R8WL 4PJGE 1T0NB 1T3FA 2WBJC 2NX5A 3DSFL 2Y07L 3ZLQC 2BSSA 1EHLL 5KVGH 1KT2A 2YA2A 5HPOA 3FT2B 3FB7A 2PCPB 1QEWB 3SDAB 1MHEB 2DTMH 4ODXB 4ONOA 3CFKA 1T1XA 3QYCA 3RAJH 5FCSH 5CJOH 4D8PA 4R9HA 1JZ8A 4ZDHB 4IDJL 4NGHH 4KJWC 4RISH 3NACH 4ZUWB 3DTXB 2H32H 2GY7B 1RY7B 4HSQA 4XNXL 1RZGA 1JHKH 3FFDB 3ZTNL 4L8CB 3ULVC 2Q7YB 3NGBC 5F7DB 1PYWB 4QHLB 4LIQL 4C59B 2XACC 4NQCA 4N0FB 2E9BA 2NTSP 2FH8A 4OSUL 1E6OH 4MB4A 2I5YL 4WV1A 1A3LL 3QWRA 4U6HB 1FP5A 4WW2F 4CL7A 3MRNB 4P5TA 3TJHD 2F54B 3BT2L 3IFNL 3VFPA 2R4RL 1QR4A 2VQ1A 5D70L 1RZJC 4JREB 4NN5B 4D0DA 4O51B 2LU3A 1WWAX 4OZ4B 25C8L 4WCYL 2AV1A 2GJ6D 5E95B 1P9MC 1AY1H 4LLUA 5B22A 4XCYA 5EOCH 1VADB 4N0FA 2A6IA 1KCKA 2VO5A 3IDJA 4NKIH 1AGEA 4ZTPH 3WFZA 3ULVL 5DVLA 3ARFB 5CEXA 5DFWH 1T21B 2WBJB 5KN5B 3L3DA 3MGOB 2FEDD 5KANG 5DHXB 5GRVL 5I6XC 2FGWL 5IV2A 1N6QL 2NX5B 3BMVA 1VGEL 2XNAB 3E0GA 1KTRL 3TPUB 4PJEA 2OTPA 3GB7B 2UWEA 5JNYB 1LP9B 3QCTL 1UQSB 3DUUA 1PAMA 3QJFB 1Q9LA 5BS0B 4B7LA 2C4XA 35C8L 3UYOD 1H5BA 2Z31B 1U3HD 1HH9A 5DJDA 1LE9B 1J88A 1B0RB 3MLVH 1EEYA 3OX8B 1IFHH 3UTOA 5DD0H 5KVFL 2IALB 2JLLA 4UUJA 1VPOH 3LS5L 4M1CC 4PUBL 3I3EA 4XBEH 1CZ8H 3Q6GL 2P5WB 3EDFA 5D8JH 3KAAA 2BMKB 4XPAL 2EC9U 1E6OL 1QFUL 2V2TB 4X8JA 2VSDA 1YEFH 4PG2C 4AEFA 1JWMB 1IC1A 1LK3H 4P4KD 3SE8H 2X09A 1HZHL 4O2FB 4RDQG 3BESR 5T33H 4F7PA 2GY5A 3VW3H 1M6OA 1OGTA 3NFNB 3PP4L 1OL0A 5IVXE 4X4ME 5I1IH 3D25A 4M62L 1BVKA 2RIKA 4W4NA 5MERB 1RK1B 3RIFF 3GGWA 4YHKL 4PB0H 2JB6A 4QRRE 3FN0H 5ICZA 5FCUL 3DX9B 2Y06L 4HWEL 1GGCL 1FQ9C 4EQ3A 1RUQL 3FQTB 3V4UH 3VJ6B 4ZPTB 4X4YB 4NNXA 3UTPE 3L7FA 4K2UH 1A1MB 4X6CE 4GSDL 4ALAH 1RUAH 4DCQA 1W8OA 1MHPH 4WWKD 5HHOD 1Z9LA 5C0AD 3MX0A 1W0VB 1S7RB 2UWEB 2Y4SA 1NCDL 2NY1B 3H2WA 2CIIB 5A1AA 1P1ZB 3U7YH 5DUPL 1T0MA 5GGRA 1OAUH 4PLNC 2DKSA 5HHOA 2X4NB 2NY4C 3MGTB 5FM4A 5IFJA 3SDCB 4Z7VB 5FYJU 3GMOA 2P24B 1FYTE 3QUMH 4QO1A 4U3CA 3HC0B 4K9EL 5F7LB 1YEIL 2VZVA 3VGGA 3HS0B 3WNOA 4XPFH 1MVFA 4XVJH 2C1OA 2HLAA 5TF0A 2XFXA 1YEJH 3V4VH 3TZVB 1SEQL 1U58A 1CICB 4XHJD 4NPYB 1GJIA 5CILH 2R4RH 1BZ9A 2GFBA 1LDSA 4PBVC 5D1XD 1CTNA 3QEUB 2FWOA 5L6YH 1FAIL 1IM9B 4F9LA 3MYJA 2HWZL 5FYLD 1I1CA 1YEDA 3X3FL 4Q9QL 3M8OH 2AP2A 4MXWH 4LSPH 9CGTA 1UCTA 4U1KB 2P46B 1Z6JT 1JGDB 1X4XA 1NSNL 4FFWD 4LBEA 1PYWA 4LHJB 1M1SA 3KLDA 3NABH 1XGQB 3SDAC 4FA8A 4JO2L 3CFJB 5I1CH 5IB1B 3QWOA 1JPTH 4NP4L 1C8PA 2IG2H 4L4VA 3AAZB 4DEPB 2VC2L 4CKVX 4K7PH 4FABH 3DV6B 2J6EH 2VABB 1LMKA 2MPAL 4Z0XA 2CLZA 2F53D 1LDPL 1S9VA 2E3VA 3L95A 4DKFH 2I9TA 5F89A 1E4WH 4J3TA 2J4WL 5BV7H 1CQYA 4PGBB 3ULUF 2IQ9H 1KJMA 5FO7A 1D5XA 1P9MA 4HD9A 4Y5YC 3MV7A 2R56L 5J6GB 2XTJC 3DX7A 4L1DA 3QDGE 5IHLB 2YK1L 1TIUA 3D3VE 3OKOB 1ADQL 3QEQD 3V0WH 3O6FB 5EZJB 5T3ZD 3LN4B 2DQTH 5DMGD 3RWJB 5ESAB 5F8RC 2ADJA 5KVDL 1S9YA 3S37L 4JFPB 3L5JA 4JO4L 4FZ8H 5IW6B 3WBDA 1ZWIB 1YECL 5CEYA 2DICA 3MUJA 4WFFE 2COQA 5TPWL 3T1FA 5C07B 4M5YL 4XGZB 2IBZY 5E8PA 1BFTA 2EECA 3GRWA 4PG9A 1CFSB 2DM7A 1ZGLA 3O45A 4ZYKB 5T3ZH 1UEMA 3OF6A 4F57L 2I27N 3CUPB 4NQEB 4HUWB 4YHLH 5EBLB 4WUKL 3U30B 4FQJH 1R5WB 5GRJL 1KXQE 2DLFH 5HDOA 5DFVC 3C6LB 5DJXB 4YFLI 3FMGH 5EU7E 4L8SB 1B0GB 1ZVHA 2P45B 1QTYT 4OI9A 5BO1L 5AZ2L 1P4IL 4OT1H 4FG6D 4TVPE 2R0KH 3K4AA 2FATL 1E4KC 4ZG1A 3DPBA 2FSEB 5IB2A 4JFEA 3EZJB 3I85A 4Z76A 2R1WA 3O6ML 3NCMA 1OP3K 3ARVA 1LHZA 2OQJA 4QXUL 4HC1H 3VCLA 1UM4L 3SDXA 4ELMB 5IEHA 4NT6B 4GAYB 5F7EH 3LDBB 4MA8H 4G9FE 4KAQL 3PHQB 5IW1A 3JV5A 4P2CG 4YLQT 2CO6B 1YMME 2VLLB 3TGXA 3V5DB 3LKOA 3CIQA 1KCUL 4LPCA 2EYTA 2EE6A 2GJZB 2IAMB 3RZWA 3WJLC 2C1PA 2IH1A 3D85B 2IAND 4DFIA 3SKUD 4ZFFB 1K8DB 1PW3A 5D93B 2H45A 1F42A 3C5SA 4XVSH 3BHBA 2ZWLT 1QSFE 3PWVB 4GW4A 2OP4L 3T0XA 4NWTH 5LG1A 4AMKL 4IDLA 4NZRL 5HI5C 3TO4A 1LE9A 1EAJA 4MX7B 1M4KA 4FQIH 1T22B 4PP2A 4GKNA 4YHIB 3VFNB 4XP1L 5IHZB 2BNQA 4I2XA 3X13A 2FB4L 3SHSA 4AEEA 1I8IA 1KN2L 5EIQA 1WC7B 3B9KC 2DWDB 4RAVA 3RL2A 4RFOH 1G7MA 1MHHA 5LXGL 4M7KH 2DOCA 5HHVL 2VDPH 3OHXA 2A38A 5MEPA 3FMGL 5FF6A 4PJIA 1FFRA 4WWID 3KPSB 3SKMB 1TXKA 3O4LE 4X7SL 5HBBA 2R9HC 2EE3A 2WQRA 5IF0A 4U1GC 4WJ5B 3T8XA 2G75A 1XGTA 5CMAA 1IAII 3DURB 5F7WC 2MPAH 2PO6D 5GS1C 1OGAE 5EOQH 3SDCC 1N7ML 5I18H 1PZ5A 2A6JA 4PREA 4NO3B 5FKAA 2Q20A 2H6PB 5CEZL 1JFQL 3FFCD 5CILL 5FGCB 3QQNA 1KEGL 4ZS7L 5C6TH 2ID5A 4KI5D 3MBED 1MOEA 2HMID 4OFPA 3CK0H 4WW2A 4KJQD 1NLDL 2ZG1A 5D5ME 2C7UB 5IESH 3KPRB 4DQOH 5IJKC 1Z9SA 5B39G 3S9DB 1ORSB 4XTRC 5IJVB 5A2KH 4PD4K 4X6FA 3SO3B 4ESKA 3VXSD 5DUBB 5DUPH 5MENE 3U46A 3NCJH 1EFXD 1FVEB 2J5LC 3MXVH 4OGYH 3VFGL 3JV4B 3QH3B 5EC1A 1C7SA 4Z7UB 5EOCJ 5CZVL 3GK8H 4IRSC 1HILB 4MJIE 5C2BL 3VXRA 4L4TA 4QXTA 4YZFF 5DJAB 5EOCL 2PTTA 3MRGA 2XG4A 4FQXA 3QHFL 4ODXA 2W07A 2BVOA 3MLPA 1RFDL 3FQWB 1G7LB 3DO7B 2XZQL 3MZGB 4PTUB 5BV7B 2FD6H 4DVBA 4U1NA 4HCRL 4G6KH 3STLB 4JM2A 3IFPA 4MQXD 1R0AL 3G04A 4DUWA 3WDHA 3MYJB 1B4JL 1A1OA 4YR6B 5C7XH 2IPTH 4JPWH 4MQ7B 2FBJH 2QSCH 2XTJD 4UQ3A 4UTAH 2EZ0D 4NUJA 1MCHA 1CD8A 4OGAD 4KK9C 4XWGH 3G9VA 4PJ5E 3QWRD 2YXFA 1XMWA 4HUVA 4P5TD 3NA9L 1FFPB 1Q9OB 2YPVH 4O5LH 5CJBA 4G8EB 3BQUD 1CDIA 2AW2A 1KN4L 3PE9A 5DC9B 4HKXB 4Q9CA 3ZYIA 5E9DA 3QXTA 4XPHH 1KCRH 5IR1A 5I71C 5E4IA 1KPVB 4MJ2A 3FB6B 1EHLH 2VIRB 1EHXA 3HZKB 1T3FB 2FDBP 4JZJA 2VLME 4LHUA 5HHXH 1ZGLB 3JV6B 5C9KA 1JTTA 5F7UA 5ANMB 3IGAA 1QKZL 1EMTH 2BHZA 2W9EH 3DJ9A 5GXBB 2OR9L 5CJOL 43C9A 2K7QA 4LQFH 3MLYH 3UBXA 4N5ED 2ATPB 3JXAA 2AQ1A 4XPGL 3TH2T 4S1DD 1C5BH 4HS6A 1Z3GH 2AEIT 5DRZB 3LVEA 1JZ4A 3BGAA 3MV11 4NO5A 2DJSA 1OF2A 5L9DL 1BECA 4XH2A 1LEKA 2A73A 3ARDB 1LK2B 3LRSA 5I1CL 3G08A 1XT5A 2FX8H 1R5IA 1QPXA 1EEZB 3HG1A 4I0PD 4NM8L 2DQFB 3JTTA 4JVUA 5ID0B 1UZ6E 1KB9K 4TSBL 3HR5B 2Y1VA 5JHDB 5TE6L 3CDFA 2VN4A 2NR6C 1MCQA 2ZSVB 2CLVB 1F4WH 3BXNA 4JPVH 5D70H 4OLXH 1X5YA 5J7CC 3DSFH 3IXAA 4UDUA 1OTTD 3WO4C 4CMMB 3K7UA 3FZUC 4GRLA 3MLXH 1T2QH 5L8LB 2XG5A 5BZDB 3ULVD 4YDJB 3RDTB 1M05B 4OF5A 2O61A 1RZ7H 2AK4D 2B0SL 3GBMH 3MACL 5HI3C 4ODTL 5IB4A 3KLHD 5EIIA 2Y7QB 1XIWD 4F37K 4DN4H 1QZ1A 2P48B 2HVJB 3B9KD 4FQ1L 4JG1H 4NQTA 3C5ZA 4AYFA 4DAGL 3QA3A 5KN5A 4J4PA 4IHOB 3D5OF 4MNQB 3FB6A 1GC1L 3MTRA 4G6FD 5EO0A 5MP6H 4GW5A 3RDTC 3EYUL 3PHOB 3UTTA 2R0LH 4G8GA 3HRPA 3X3GH 4NWUH 4JDTL 3S3SA 1NMBL 2NXZB 4NNYB 4HUWA 5EBLA 4OLWL 1XGPB 2IPKB 5D9SA 3KS0J 5GRWA 2FLRT 5CAYB 5TDOB 4RDQF 5KW9H 5E2TH 4KJWD 4QYOB 4YK4C 4ZQKB 1A7RL 1FDLL 1KBGL 1IBGL 2GYSA 5ACZA 2AV7B 4Y4FA 4F9PC 1DUZB 4X99B 3MBEA 3FRUB 1YJDH 2OL3B 4BSJA 5E5MA 4OV5B 2D03L 1LO0H 2QSTA 3ARSA 1I8KA 3CZJA 4F37F 2DQFA 3U2SA 2FX9H 4JFHE 5KAQG 4GJTB 1QQDB 1Y0LA 3J8F7 5ERWA 2EH8L 2D0HA 4U1LA 1IC4H 4NQDE 4ZDHA 4CAGA 3MOAH 2OCFD 4YBLC 3B9AA 3KJ6H 2NY0B 4YDVB 3VXNA 4OLYL 1FYTA 5ECJE 3VXRD 5E6IA 1BBJA 5IB3B 4P2QE 3GGWB 2XA8L 2H9GB 4JB9L 3C09C 2Y9RT 5T3XD 3U30C 2JJTA 4MSWA 5F1IB 4DTGL 3BPOB 1JGDA 4IRSB 3WUWG 2XZQH 4G43A 1VPOL 2FEDC 2WW8A 3MMEA 3O11A 4JO4H 1NCWH 4N1HB 4HGWB 5GIRA 4MAYA 1ZXQA 1MHEA 3VD5A 3X12A 2DM3A 4NHCL 5FM5M 3IAGC 1R3IH 1NH6A 3DRTB 2YUWA 4U2ZA 1MCWM 3IKKA 2NW3B 3VGFA 4POUB 4FQXD 5ESVA 5I1EH 4OQTA 3MRDB 3SE9L 2R0ZH 1L7IH 1MCOH 2BNUA 3ZDYE 2I24N 4RBPH 2EDTA 3WS6C 1UT9A 4H1LB 1PG7X 4XBGA 2VWEE 3QEHA 3MLZH 1JGVH 1U8IA 3BKYL 3AY4C 5SWSB 4X99A 5C0BE 1FCGA 5F9OH 3OJ2C 2D9QB 3DRTA 4WTWA 5IW1B 3R06A 4MCZB 4BZ2L 1P53A 3NPZB 3OSKA 1DEEA 1NCBL 5JNYA 4ZAKC 2I26N 4ODSH 1JP5A 5F7EL 1ZVSB 3MFFA 1I1AA 1K2DB 2W60A 1IC4L 2EDLA 5E1HB 3P4NB 3QNXA 3FQWA 4NFCA 1QBAA 4KK8D 1BF8A 3BUTA 4J23A 3NTCH 4RCAA 4X5LA 4UOJA 4PLKC 2AXHA 3RWHB 3RWIA 2VKWA 3S88H 3WIHL 1AI1H 2XWTA 3ULUD 4JPWL 2B5IB 3DUSB 3RGVA 4PRHB 2AS5M 4UI2A 3H9SE 1M7XA 1D5MB 2MCG1 4E41A 1T83C 2JKXA 4U2YA 4QHUA 5EC1B 1S9WA 1RI8A 4NZTH 2APBA 4KMTH 2A6KB 1H8NA 1J87A 3SGKC 3H42H 1AGFB 3L3KB 5IWLA 4NQSB 1S9KC 4N68A 4L3EA 1AR1C 2VDNH 4L9LB 1F00I 3FO2A 4GOSA 5JMOC 3BP6B 3MV9A 3IJHA 4OCNC 3VFVB 2BSTB 2VXTH 5D1QD 4OLVH 3VXUD 3QQ3A 3Q1SH 5ID0A 4ZD3L 1NGWA 5I1LA 5JMRA 2CKBH 2NY2D 4F15B 4CJ1A 2ZSVA 1WZ1L 3IFLH 2F5AL 3GSNA 2Z91B 3DHMA 2J8HA 3BZEA 4PV8B 5AD0B 3PQYB 4WI7A 4JFEE 4LGPB 3BIKA 4PRDA 3S5LA 1QVOB 2P5ED 1W72L 3HE6D 3SO3C 4MDIA 1G7IB 1I1YA 3HFMH 3KLHC 2VABA 4C56D 1YYLL 3EKCA 4E0RB 4JAMA 3HE6B 1CVRA 2PTUA 4PP1D 3QDMB 4LSRL 4IRJC 3NCFB 3QUXD 2HYMA 1MWAA 3QUYB 3K8KA 3VGEA 4DKEL 4OZFH 5DUBA 1UENA 3MXWH 4HX1B 5CD3A 3EYSH 2HVKB 3VA6A 4Q9RL 4JFDA 1T4KA 1KJ3H 4EDWH 1QOKA 1RJCA 5E8NA 3D39E 2ED9A 5IMOB 4MNHB 3Q0HA 1IGIL 2XY1A 4KMLB 3TJHC 1RIHH 1FFPA 1Q9OA 4XP5L 3S4SB 5CCKL 1N59A 1U3JA 1RUMH 1E4XI 4OZIE 2ESVD 4QHKJ 1FVCB 5D8JL 3VWKD 4S11A 3CFDA 5TH2A 3SJVA 2DQCL 4Y5VB 5EU5B 3ZYJA 5F1NB 2BJMH 4NCC1 1CGVA 1KPRA 4CBPA 3ARBD 4RZCB 4YR6A 3QXUA 2R0WL 3HC0A 2C3VA 2HFGL 3CH8A 4WVRA 4TRPL 3BD3A 4UQ3B 1L6XA 1RZ7L 3CSYB 3T3ME 5HVHB 3PDOB 1MRDL 1QFUH 5ADPL 3I2CL 1X7QB 1KIPB 3VD9A 5IG7B 2O26U 1QSZA 5DMGC 4ODHL 1WTGT 3O3DA 1T89A 3K1KC 3W5MA 1HI6B 1I1FA 3MLVL 3VI4E 3O9WA 5I0DA 4MX7A 4GKSB 3OXSB 4K3DL 2EDBA 1FE8L 3GSUB 4U1JA 3CAFA 4IMKC 2OS7A 5LAXB 4LDLB 3CPLB 2I60H 1V8HA 4JFOA 3KWWB 5I8KL 4ZYKA 4G8FA 3R0NA 5SWSA 3MNZB 2R2CA 3ZE0E 4EOWH 1MFNA 5CP7B 3MV8A 1FJ1A 3WFCL 5IBLD 3E6HA 1N2RA 3RU8H 1CGYA 3CJJA 4R4BB 3FKUS 2Z4QA 5GZOC 1I7RB 3WCYA 2YD6A 3LKRA 5TQ2L 3T2NH 5LCVH 4JM2B 1FZKA 2R2BB 1A6TB 1BIHA 4AL8H 1F4AA 4ZFOL 2IADB 3S7GA 5L2JA 1NFDA 5DZOA 4DWHA 5IHUL 4Q6IC 4IS6A 4NKDA 1FPTH 5DVKA 2LV4A 3RTQB 1JYNA 3JTTB 3BAEL 3MREA 3WV0A 3KLAB 4AJ0A 5H2BB 3CLFL 4KI5E 1IKNA 8CGTA 1VHPA 1TJGH 4HMDA 4JY4A 3SCMB 2HG5B 4QXTB 4WIQA 2ARJA 1K5NB 1RZFL 1XIWC 2ZOLA 2H2SD 4XBPA 2C9AA 4JFQA 3FB8A 3SE9H 5FHBH 3N9GH 5M95B 3VJ6A 1I8MB 3BZ4A 3TO2A 1DBBL 3PL6A 1WBXB 1DR9A 1P6FA 5CSBA 5E8PB 2H32B 3VXTB 5HYIA 3MREB 2CGRH 3TO4C 1JK8A 1FIGL 3RA7H 2D4DA 3IGAB 5JOEA 4HXBH 4LMQI 4D9RE 1MAJA 4YXHL 1S7XA 1TQBB 1UZ8A 1QNZH 3U2SB 1U8MA 1J10A 2BNQB 3X13B 4HJGB 5FHBL 5IVZB 2ZOKA 3QXAA 4LSQH 3CFCL 1MIEH 3C08L 3LEYL 2JJVA 1BD2A 4FQQA 2HRPH 4HUUA 3OKMB 3PQYA 3IF1B 3O3EA 3GIZL 3F8UB 4RRPG 4ZTOL 4Q2ZB 5CJQL 5CP7A 1IEAA 4Y5XA 3OJVC 4XXDB 4HDIB 2C1OB 5HDLA 2YPVL 3SKJH 5DK0B 3HZMB 5D1ZB 4ZPVA 3FQRB 2BNUB 3CC5B 4HQQL 3VRLE 3QDJD 3O4OB 2O5ZH 4FQHB 4QCIA 5I1LB 1FLRH 1T0PB 3VFGH 2AK1L 2NY5H 2OLDA 1KSRA 4HWZA 5D7IF 4PRHA 2PYEE 2VDKL 5FK9A 3C60A 3BWAA 5D7LA 2G2RB 4U1MA 5JORB 2F5BH 5EWIH 1DL7H 2P4AB 4R0LB 5FF6B 3FONB 5ICXB 1N0XH 2GUOB 3V95A 4L3AA 2UZIH 4R4ND 1W0VA 4HWBH 2GCYB 3HG1E 2W0LA 2J6EL 1AGFA 3L3KA 4R26L 5L7XL 5C0GA 4P57A 2ZCLL 3HE6A 4AIXA 5I30H 3MFFB 4V1DE 3O3UN 1IAOB 2VIRA 1FC1A 4I0PA 3HG1D 5DLMH 1TCMA 3DUHA 3RX7A 4D0CB 5SWZA 3RPKA 3D9AL 1LWRA 2L7UA 1TZIB 1XCQA 3OAUL 4JQIH 3RVTC 1GAFH 3C87A 3V4PH 3B83A 3MA9H 1FHGA 1R5WA 1HINH 1HSBB 5FGBC 3MYZA 4F2MB 4K94L 3EHBD 4Y4KD 3UBXG 1UG9A 1J0KA 1IQWH 1CFQB 2CDFB 5I8KH 5L7XH 4P4KC 1ZMYA 1FNGB 3EOAA 4JKKA 4LVOB 4K9EC 1TPXB 4UU9B 4EVNB 1HCFX 3KYOA 3D39D 5C8JA 2W91A 5I1KL 3VXPB 1P4IH 4DKDC 4HEME 4XP6H 4OV6F 4P5TB 1NEZB 1KELH 3OAZK 3PWNB 5E94A 4M43H 4UNVA 4HH9A 3UTTE 1PVHA 3LN4A 3QIUA 4MQXC 1TPXC 3W9DB 2ZCHL 1F11B 5HGDA 1SQ2N 3STLA 1WSST 1S7VB 1D5BA 4L8CA 2BCKB 5A16B 2P5WA 3RVVD 5HVHC 4ELKB 4XCEA 3BN3B 4RX4A 1B2WL 2HFEA 1X5IA 1DVFA 3PF2A 4OLVL 4P2RE 2QLVB 1ZLSL 1RD6A 3HI6L 3BSZH 4ZUTA 3EYUH 1VSCA 4NUGH 3ILQD 4KY1L 3U0PB 2Z93A 5CGTA 5LGKA 4MWFB 4KU1A 2PCPA 1A0QH 1UWGH 3U9UB 3RVVC 2ZUXA 4CJ0A 4PJEB 4GBXA 5E4EB 4Y4FD 4GKSA 4WHTA 3SKOB 1KIRB 1QBLH 2QKIB 4LLQA 3GSRB 4DW2H 3MRJB 1AHWA 3V7MA 3HZKA 1JWSA 3T0BA 5EU6E 1YEDB 4K71B 5HHMB 4LLWA 1YA5A 2ENSA 5D96C 4JZNA 5EBWB 1Y18A 4L9LC 4P4KB 4UBDC 3VXQB 3HMXH 2UWEE 3HZVA 3M1BB 2FHCA 4Z18A 3RWEA 5EUOA 5IVXF 3L3HA 1A21A 1E0OB 4WW1B 4LCCA 5CUSL 1GL4B 3HNSL 2VQ1B 1HQ4A 5D2LA 3W39A 4UIMA 2ZKHH 3VMPA 1NDMA 3RDTD 3D1MC 1TNMA 5BRZA 3TJEH 5C0RH 2Q8BH 1J7VR 4E9LA 4KKAC 4PJHB 4MQ7A 4UBDD 5IQ7L 1FYHB 4NKIL 5DJYB 2VXUH 2GK0A 3PIQA 3K2UL 2FBJL 5J1SC 3TBWB 3HPJB 5F7MC 2GTZA 5CHNA 4G43B 3G5YA 1L0YA 3K1DA 5IMOA 5DZNA 2R23A 4WFGD 3LEVH 5EORH 4OI7A 3UZEA 2WBKA 5C9JB 3RWGA 3FZUD 5FYKH 3SBWC 4DJMA 5J1AA 3RL2B 5IROA 5TDOA 2XN9D 5T1LD 4Q0XL 3L7FB 3FQNB 4Z7NE 4LEOA 5ICYB 2R9HD 2E7CA 3QDGA 5MEND 4HXAL 5CINH 3GSXA 3WO3B 4BSWB 3QHFH 2NXYD 3FOMB 4EN3A 5EIIB 4E5XA 4MYWB 3O9WB 8FABB 3VRJA 2AV1B 4K8RD 4QRRA 1P84J 4QGTA 2SEBB 4J3VA 1YYLH 1AO7E 3DX9A 4LVHC 2BSRB 5F88B 1I3RA 2AABH 4PJBB 4ZFFA 4M1GH 4GRLB 3MLTA 2VC2H 1ES0B 3DGCR 1NBVL 5FYKD 5E9DD 4V2BA 4HXAH 3IF1A 1CDUA 1RK0B 1DEEB 1JF1A 1RJZB 4HUMB 4PRAA 4KK6C 4GRMB 3N50A 3K3QA 4H1LG 3IFPB 3VD3A 1CG9B 1HXYB 4R6UA 4BZYA 5AUMA 3G6JE 2UUDH 4QRUA 5IB5A 1CR9H 2XTJE 1D5XB 4UILH 1I7TA 3MRFB 3Q6FA 2YPKB 3QDJA 3NH7L 2VXUL 4MCYA 1FNHA 2WWMD 1YEKL 1XCQB 2R0ZL 4R4NC 1XF4B 4LRIA 2BVQB 4JANB 3BDYL 1MEXH 1U2HA 3T3MF 1A5FH 4LGSB 3VFRA 1BFOB 3LKSB 1Z9OA 1MRCH 4U7MA 5F3BB 4O9HH 4CDGC 4CU7A 3QIBB 1T66C 3DI2B 3EUUA 3RWIB 3RWHA 4PJFB 4LARH 3EFFA 4D0BB 3UTZB 1S5HB 1VFAB 1H3TA 3BW9A 1HE7A 5I8EA 5KZCB 5ILTL 2Q8AH 3LQAC 1XIWA 3QIUB 4AIZB 4HG4K 4X7DC 5DO2D 4U1KA 1NGWB 4M7ZC 5D7LD 4PGJA 4QKXB 5CEXB 1P69B 3ZHDA 4Z7QF 2X4RA 4PGEA 5K59E 5JPNB 4MGXA 3VD4A 32C2A 5IFAL 3QI9A 4E42A 5I9QC 4TULH 4Q6IA 5BS0E 5C07E 4J12A 3HAEH 1RHFA 3ZDYF 2YKLL 4LPXA 4TVPL 2Q76A 1YN7A 1AH1A 4P5TC 5ETUA 3MV8B 3UTPD 1AD0A 4WV1C 3NVQA 4RNRA 3NIGE 1IGMH 6FABL 1UEYA 5GGVL 4ZUVA 2P5EE 1N8ZB 3D39A 3K80A 1YQ2A 3GSOA 3BSZL 3LN5B 3QFJA 4Y0GA 3BH9B 4XWOD 4DGYL 1NAKH 4Z95L 1D5MA 5TE6H 1QLEH 2D03H 4ZFGH 2YA0A 4LPUA 4Y4KA 5AG9A 2YKLH 4HC1L 5CJXC 2VR9A 1JZ6A 4MAUL 1NBZA 3P0YL 1G9MC 4RX4D 2HN7B 2DBLL 4U6VH 5FYLL 2W65B 5JHDE 3RWDB 3MGOA 2CMRH 4CW1B 5KSVB 3IDNB 1A6PA 4HH8A 2OI9B 3LKNB 3N06B 3DVNB 4U1MB 2ARWA 5JORA 4YDLC 5D1QC 5KAQF 5JW4M 5JOPE 5DJ6B 3QDMA 4HHAA 3IDXL 3PGFH 5DK2B 5F6IB 3S36X 1WBYB 2W9DL 2VXVH 5E70A 4MD4A 2JE8A 4PLOB 3TYFB 2XTLA 5L0QC 1J05B 4ERSH 3RVWD 2OI9C 5JA9A 3P2TA 4K71C 3S36L 5EZIL 4QF1A 4C56E 2NY2B 4O4YL 2NY4D 5MHSE 1M71B 1UJTA 1U91B 3LPWA 5C0CE 3RUGE 4LCWA 1L7TL 1S5IL 3VWJB 1PDKA 1KJ2L 3U79A 4IRJD 1N4XH 3V6FA 1YY9D 5FECA 1KLUA 3UP1A 1EUTA 3GBML 2E9JA 2YEZA 1H3XA 1CLZL 5IW3A 5F1NA 5CP3A 4YX2H 3BP6A 5ENWB 3U7AA 1YMMD 2CRYA 4XB7A 4RGOH 1AJ7H 2Z92B 1FFOB 4EIZC 2A6DB 5TJWK 2EYSB 2H6PA 4YHZL 2HVKA 4PRID 1ULVA 4KHTH 2VUYA 4HPYH 3ISWA 4L8SC 4Q9RH 1GOGA 3U6RB 4F15C 1OSPH 2AXJA 3VGHA 4EI6A 3LKPA 3FN3A 3NBNA 1WWWX 3HMWH 4UAOC 2DLEA 1AGCA 2ZOLB 5D71L 3GIVA 3CX2A 4IOIB 1NMCB 5IOPA 3SGEH 3UDWA 4M8QA 4FFVD 1YPZE 2AJVH 5F9DC 3BHBB 4BUHA 3GB7A 4HIEB 3BI9X 1NCWL 4P57B 3VFWB 4NCDA 1OD7A 4X6CB 4JN2A 2NY0D 3QUYC 4LHUG 2EC9T 2DQTL 4R7NB 2NW2A 2HTKD 1T22A 4NNPL 2DJUA 4CVWA 3ARBB 2RAMA 4X0KB 1FAKT 3VE0A 1GIGH 3MBEB 1N6VA 1IZKA 1ZSDA 3KYKL 3QO1B 4F80A 3NZHH 3AB0C 4CUCA 4PREB 1WZMA 4AENA 2Y6SD 3MOAL 1CIDA 1FNLA 4KTEH 2BMKA 5ANME 3W2DL 1MCPH 4L3EB 2AEQH 5DJ2B 2IAMA 2OZ4A 3FO0H 2F74A 5C0JA 3V6ZB 4P9HL 4NZJA 1MCOL 5EPMB 4YPJA 3QDGD 4XCFL 3ARXA 3AB0B 3OV6A 3P77B 1EFXB 4M9OA 2RFXB 4C55A 1ZHNA 5I6XB 4WI9A 4Y5VC 5D2NB 4LGRB 5IWLC 4Z77A 5HHOB 5CUSH 3UTTB 2Y6SC 4M7LT 1AKJB 1CXKA 1P4BL 1BD2E 4KKBC 4Y19E 1CTOA 3W0WD 5CJ5A 1YEEL 5I76A 1CDBA 3HI5L 5IBLC 5I75B 4XC1H 5J9PB 1QLFA 4UINL 5IHZA 2VAJA 2HT4D 4JB9H 3NTCL 3C8KA 3NCEB 4Y89A 4XCFH 3TCLA 3MV9D 3RNQA 4KRMB 2M1KA 2VLRD 4XNQA 4U0RC 4JY5H 3K2MC 4JPKL 2V9TA 2GTWA 5I75C 2X7LA 5DFVD 1RAMA 1FAIH 4TPRH 1WWBX 2J3SA 2P42B 4OFVA 1JHTB 1IGYA 2NX5E 1MFAH 3BJ91 1I1AC 3R0MA 5TDNB 5DVOA 5KS9E 1KNOA 5EBMA 4OFYD 1J12A 2H2SC 2DJ4A 5H2BA 4I48A 5GS2D 1MI5D 4N5UA 3KPNA 2X4RB 4PGEB 5JPNA 1YNTA 2VLRE 1INDH 4PGDA 2F9BT 3KYKH 1MI5B 1ZOXA 4JO3L 4OM0H 5HGAA 2LVCA 1ZSDB 4WFHD 1ZHLA 4NN6B 4LOUD 4ACPA 1BZ7B 4G8GE 15C8L 4G5ZL 2ILLA 3C2AL 1JPSH 4Y1AE 3TCXA 3D2UB 3WFHA 2BOCA 4XPFL 2VJXA 4PJAB 3BP4B 3QEGH 3FCTA 3LN9A 4LSUL 1QHOA 5JXEA 1P2CB 3UPRB 4S0SD 1FZJB 2CDEB 1ZT4A 2Y5TA 1EVUA 4KZEL 1NUDA 1A4KA 4MAYC 5GGTH 3ZHKA 2N56A 5FKPB 3LIZL 1R3HA 4LLYA 3DUSA 4QRTA 1OAQL 4ZXBB 4WFFD 3W9EB 1LE5B 2VZTA 5SWQA 5EZLA 3UX9B 4BYHA 1ACYL 5HDBF 1JGEA 2VH5H 4TVPH 3I6KA 2LVEA 3D18B 3ILPB 1F4XH 4G8EA 5IBUB 5IB4B 3C8DA 4EZMA 3RVWC 4U1SB 1TDQA 3VG0H 1KJVA 2IQAB 3OG6B 4YUEL 5HHMD 4JZOA 5HHQA 4YEEA 3HE7B 3TN0B 4EEEA 1MRCL 4LLDB 3TO4D 5FM5O 4HC1A 5AEAA 5HGBB 1KJ3L 2VDLL 2P24A 2R1XB 3EJZD 5JXEC 2JJSC 4JRYE 1DUYB 1ZA3B 3GMLB 4TSBH 1T03H 1EERB 2HJKA 3BKML 2EIDA 4MJ4A 4DGIL 3CFBB 1QUNA 4YHNA 4G6AD 1A7RH 1TTFA 4EOWL 3CGTA 3O2DA 4NQED 3B3IA 4FFWC 4Z0BL 2XN9E 4M6OL 4OZGA 1X6NA 3V0WL 3DYOA 1JGUL 1NLBH 3N1GC 4K8RH 5C0EB 1H15B 4ODVL 3T0EB 5BVPL 3U82B 2PW2A 2QSVA 1U8MB 1FZMB 2DL9A 1R3KB 4N9GA 1WQVT 4LSRH 4OZIB 4XMPL 1FO0A 4PJEF 3WJJA 3B4NA 2Z31C 4NQDB 1PX3A 1T6VN 3NCBB 3SDDC 4EI5D 1T66D 4Y4KB 4JRXB 3Q5TA 4LRNL 3GRWL 3WFBH 3C5ZC 4HJ0C 4X4MA 4BA8A 2DLTA 4GO6B 4BKLA 4LK4A 3D69B 5CINL 1J8HB 3KPOB 4B5EA 2DQIL 1JZ5A 1TLKA 4HKJB 5FB8B 1DQDH 1FC2D 3CDGB 2XKSA 4M6MH 4QLRA 1FVCA 4W6XB 2A6DA 5JQ6L 3ARBC 3H6JA 4YWGL 3BZEB 4Y5VA 2OM5A 4L5FL 4WO4D 5JOPD 3B8YA 4OCYH 1EGJL 1UC6A 3VFOB 1A3LH 3ARGA 5D2NE 3R8BB 4NUJB 4BQCA 4ZOEA 3DIFB 4QRSB 4D9QE 1IC7H 5HGBA 3GHBH 5IGXH 4AEIL 1A64A 3ZDXF 2Z0BA 2QADD 1IFHL 4CVXB 3BD4A 5DVNA 2KUTA 3FQXB 5CS7A 4C57C 1VCAA 4PRAB 2AJ3A 5IUSA 3KYOB 1HXMA 4J3XA 1T7WA 3RL1A 4NRXB 1NAMA 4JRYD 4YIQA 3I02B 2MCPL 1RU9L 4G8IA 1CXLA 1AE6H 4PJ8B 2DQEH 4X9GA 1AO7A 4GXVH 4LQFL 1RHHA 4X9IA 5E8DH 3FO2B 1E4XL 2OJEB 4EN3D 3DURA 5KJRH 4BK5A 2FHBA 5BVJA 3S3JA 3IDYB 3ZO0A 3FOMA 5FFLA 1T6WA 1UB6A 1T2JA 3QULA 2XZAL 2CK0L 3MV9E 3OXRA 2FD6L 4LDEB 5JOFB 4IHOA 5AZ2H 5LAXA 4YHPA 3S98A 1VADA 4U0RB 4OZHB 4EI6B 4YGVB 3WIIL 4ZFZA 43CAA 4DEPC 1AR1D 3C6SA 4NQDA 5DZLA 3BGFB 1U6AL 1INEL 1U58B 5JIKA 1TZHA 4NSKB 5KSVA 1OSZB 5I1AA 3MRMB 4HJJH 5CSGA 1KB5L 4M00A 2B2XH 3QDJE 3MO1B 5C09E 5DTFA 1F6FB 1T7ZA 4P2QA 4OCSL 3V4UL 3U0TA 4P3DA 4JJ5B 2OQJB 1ZHNB 4CVUA 2NY2C 1WIOA 3EYFB 5I1HH 1RQ5A 3PHQA 2AAVA 4LSPL 4JFFE 2W1NA 3WFEL 3I75B 3K2UH 5GS0H 4OUOA 3WHXB 1FNGA 4YXLH 3U1SL 5MI0C 2WIIA 2IALA 4XP4L 1MCEA 3O2VH 5GGQH 3KJ4C 1ZLVH 4CN1A 3BZFB 4A6YL 3JTSA 3RKDC 4I3RL 3PNWB 4QWWC 2EC8A 4TNWK 1B9ZA 4YAQA 2DWEB 2VLJE 4F58L 4ZUSB 1U8HB 3QUML 3Q1SL 1JGLL 1VKXB 4P2RB 3C2SA 3CFKB 5D7KD 2CDGA 4Y16C 3QDAA 1MLBB 2ESVE 4TQEL 1CYGA 4XMKL 1LDPH 5BQ7A 1G0XA 4F7TA 1ACYH 3V0AC 4QY8A 1OP5H 1NGZB 1K9TA 3TNMB 3D3VA 2FJGB 3RKDD 2H32A 1HYSD 5GS2H 4OGYL 2FJHB 3HPJA 4IRSA 1LE5A 1FL5A 3BKCH 2PXYD 1ZLSH 1K4CB 5HYJB 3IAQA 4X80H 5GRYA 1MHPL 4E0RA 2OMBA 2HTKC 3QCTH 2FL5A 4HLZG 5DR5H 1VA9A 2V5YA 3H9SB 4MD5B 2OTUA 4JLRA 2BHUA 5D1QB 4F33B 1G6RB 4PJHA 5ESQB 1HQRB 2VDQH 4RMRA 4ZS7H 4QOKA 4OD2A 1D5ZB 3MRFA 4Y2DA 4J4PD 4U31A 2AJYH 4PJ7A 4D9LL 3G08B 3QUZA 3UPRA 1EEUA 3RUGF 2A2QT 5FGRA 4PIRF 4XAWH 1GC1C 3CSGA 3QQ3B 4PJ9A 1LVEA 5MI0B 5KTEL 3MLRL 2W0PA 2P5EB 3OJDB 3WXWH 2OL3H 2LQRA 3VXPA 3LMJL 5K9QG 3A0OA 5DS8A 3N1MC 3S5LG 4MJIB 4JRXA 3L9RA 2A9ML 5MEPB 4QNPF 4PJXB 4XPTL 5SWSE 4JQVA 3VXTA 1QO3A 2VYRE 1GCFA 4D0BA 3KPMB 3I6LE 5CSZB 3EDEA 1T1ZA 1U92B 5T3XL 2EO1A 2PYEB 1ZVYA 1QRKA 4ODWA 1MLCA 2SEBA 1YMMA 2GJJA 2Z31D 3MA7A 4GKNB 5ALBL 1VKXA 3QCVH 1CDCA 1OAYH 5I30L 5F9WB 5A3ID 2X10A 5C0NC 5I2IB 1F3JB 4Z77B 1LO4L 3RZCA 3WFDH 2EDKA 4NNXB 4JM4H 2X1WL 2F19L 3CUPA 2YWZA 3TV3L 3IDNA 1IMHC 4GH7B 2AJSL 4H20L 5IIEB 2NQCA 5EA0L 4PFEA 1MRFL 5DJ8A 3RNQB 3KPMA 2APTA 5JDSB 2EZ0C 3VWKB 3WN5A 4RA0C 3T4YB 5JQHC 2R2HA 4UNUA 1WVZA 3SDXF 3DBXB 5FECB 3FT4B 2BNQE 4ZTPL 3RL1B 1S3KH 1I3GH 5I1JH 2C3WA 3P9WB 4P59H 1M6OB 2Q7NA 3GBLA 4HWZB 2UVFA 3E6FA 2AV7A 3KJ6L 2FX8L 4TPRL 1AXTH 5K59F 2AK4B 1MCNA 3IFLL 4FHBD 4HFWB 4IRZH 1K3ZA 4IJ3C 5JR1H 4PJXF 4RBPK 1KG0A 4DOHE 2X4UA 2KZWA 3L3HB 1JGEB 1G7PB 2FJFB 3AS2A 5D9SB 1UACL 3P11H 3WNPA 4RMTA 2DYPD 3RY6A 5F1SA 2ZOKB 4AL8L 3SN6N 43CAB 3MJ6A 1MPAH 2FO4B 1WBYA 1TZGH 2FX7H 2NXZD 4FQQB 1U93A 1QYGH 2FLBT 1B0RA 7FABH 3ESUF 5FV2A 3BQUA 3QH3A 2JIXA 3IJSA 1DQMH 1MFBH 3O2WH 4ORGA 4P9MH 5AAWA 4WEBH 3P4MB 2H26B 1FNEA 4RFNC 1EBAA 5ANMA 5T3ZL 2B5IC 4WFHE 2B0SH 3MACH 4F57H 4DUVA 4Q0XH 3ECBA 4UZGA 4R4FL 3VFNA 3SDCD 5DURD 1MCKA 3ULUC 3NH7H 4X7EC 2F53A 3SE3A 2WNGA 1AQKL 4MNGA 2NXZC 4JFQB 5KS9B 5DD6B 4HKZB 4O2FA 2AK4E 2YD4A 1L9NA 1JYWA 3RVXD 3B9KB 5JQ6H 1MY5A 1UWXK 1OGTB 2RGSA 3TIDA 3GSQB 3NAAH 4OAWB 4G9FB 2BVPB 3IJYA 5I0ZA 1XCTB 3MLWH 5F6IC 4BQBA 4B53A 2Q8BL 5IGXL 2WBJD 1R5IB 4XVJL 1DFBL 4PJFF 3EYQC 5C3LD 2B1AH 2DQDL 4HKJA 4JKPH 5CMAB 1U2CA 4P23D 5F6HJ 5C09D 1BFVH 3MRIB 1ZS8A 3GSVB 3LEYH 1U8NA 3WL9B 4JREC 4NN5C 4X6CF 1H0DA 3MCLL 1FG2B 1BD2B 3HNVH 1AR2A 1RZJH 3MLSH 2J5LB 2ZJSL 3VGAC 3G5VB 3CCHA 5FCUH 1TQCB 4UTBH 1FN4B 5TQ0L 3MODL 4PJGB 3PWUA 4QRPB 3LRGA 1G9ML 1G7LA 4TSCL 3DO7A 1CGUA 1SVZA 4RFEB 4PJDB 4ISVA 3QPXH 1EUUA 4DVBB 1OSZA 2IC2A 2Y36L 4BH8B 3I3BA 4UOW1 1IAIL 2FL5B 1JPFB 4PJXE 4XP5H 3D87B 3QCUL 2X1PA 4AEHH 4P9ML 2DQHL 2NMSA 2EKJA 4M61B 4GW5B 1P5UA 1YYML 1OLZA 1Z0MA 2X6MA 3L3JB 4BK4A 2DQCH 4G9DA 4MQTB 1UB6B 4LF3B 4YK4B 3AVEA 3GSNH 4K23H 1I7ZA 5I74C 1NAMH 4KQ3L 4MVBC 4PJBF 2FIRT 2EE2A 4M7LL 3WFCH 3EDDA 2AXFB 1Q72L 4U6HA 4V1DD 4F58H 4P4RB 1YQVL 4Y4HD 4Z7UE 4Y2DC 2UZXB 2BOCB 2VDRH 3QUYD 4L29B 2XZCL 1YPZF 3QUKA 3CVHB 5EOQL 4YNYB 1FZKB 4XI5C 2DRUA 4JFDD 4K23L 4LSUH 4JKPL 3TIEB 2B8OT 2VZOA 3GDBA 3FQRA 4XC3L 5DA0B 1SY6A 2YD7A 4ZTOH 5I71B 3BH8B 3O6FC 5DD0L 2O5XL 4WWKA 4Y2DD 5EU6D 3HNVL 5ETUB 3MQIA 5FAAA 1KLGB 1LO2L 5LGJA 1JGUH 4WENB 1YUHB 1F4YL 4RAUA 1RZKC 1NUNB 3AXLB 4Y16A 5ELIA 4O9HL 1A4KB 5EUOE 4ZUWA 1IGCL 1KB5A 1QP1A 3HI6H 1TCRB 5FDWB 3UTZA 1FO0B 3D9AH 4PRIA 1G7MB 1UWEH 4I0PC 1WAAE 5BOPA 3AGVA 5SWQB 4NGHL 1XF1A 5I76B 3VXMA 1VFOA 1YC8A 1V5JA 3S96B 2LTQC 3K81A 3QEGL 2GSIB 2V7HB 4CDHA 4Y8AA 5D1ZC 1CFNB 5ISZD 1NGXB 1EZVX 1IGJB 1QFWH 4YAQB 1JF5A 5DJ0B 4X8JB 5HYSB 1EEQA 3HUJF 3QO0B 4RGNB 5HYEA 5JW5B 4O51A 3BPCA 4XXDA 3O2DH 4KPHH 3U4AA 3VFSA 2UYLB 1D3CA 2QSCL 5TH2B 1J0YA 1TVDA 3AROA 4FQJL 1EPFA 5FYKE 4HH9B 1FLRL 4PG2A 3TBSA 1CICC 3DIFA 3QO1A 5DC0A 4LP4A 1CGSH 1G1YA 2XQYK 4MD0A 2BY2A 4ONGH 5D7JB 4YBQC 4CNIB 1UZ8B 5CWSA 4A2LA 1A7QL 4UIKL 2F53B 3ROOA 3OKNB 4LEXL 4O2CA 3HR6A 3MLTB 2IAMD 5INDB 4JFEB 1U41A 4TSCH 5CBAB 2VZUA 1F3DH 4LSVH 3IDIB 5I16B 3QRFM 3GBNH 5D2NA 3K74B 2FGWH 3O8XA 3ZTNH 2WUBH 5J13B 4X7FC 2BOBB 5E2WH 4WY7H 1HILA 1PKQE 3SDYL 2X70B 3O4LB 4ZOCA 5BOZG 4R2GC 1H9VA 2UV3A 1DSFL 4XVTL 3RWGB 4FQHA 4XHJC 4TUKH 1UM6H 3MRPB 2Q76B 1L7IL 1EGJH 1CFTB 2O5ZL 4HUXB 4PJIF 5I66A 3ARGC 1MJ8H 4CN4A 4PRBB 3GMNB 3RWFB 3ZYOA 1KCUH 5LQBH 1NL0L 1J9CT 3VI4F 2AQ3A 3VRIB 4LCIL 3HC4L 1HKLH 1Q0XH 1UKTA 1JPTL 3NOIA 1NEZA 1ITCA 3QFJB 3U0TB 2XWJB 1AGDB 3V6FB 5KSBA 2PYFB 1NBQA 1U42A 2YRPA 1UJ3A 2NZIA 1HCVA 2OP4H 3CD4A 1NC2B 2XA8H 5FHAH 3DETD 5J89A 5DEFA 1NCAL 3L6FB 2E6QA 4GS7C 1NANH 1VEOA 1OB1A 5IIEA 4P23A 5C09A 3KPPB 3HZVB 4L4TB 3ZKSD 3PWLA 1WGOA 1KB9J 1GGYA 3A67H 4K3EH 1RUPL 3LV3A 2NXYB 5J1AB 4MJ5A 5HDBE 2CK0H 4GG6F 1ZANH 3V0VB 2DD8H 1U8LB 4LSVL 3WE6B 1ZHKB 4GBXB 1JI2A 1XGUA 1YEHL 2DN7A 5B8CA 5EFIB 4LFHG 4V2CB 1A14L 4YJZL 2PW2B 4NZRH 3RTQA 1L7TH 4K3DH 1F6AB 3DYMA 3ARUA 1XR8B 4U4BA 3UTSD 1N26A 4PRNA 2EDDA 3S34L 1H0DB 3VA2C 3HMXL 2ARJB 1T7VA 3BKJH 2BVYA 1DVFB 3EHBC 1ZA6B 4AEIH 3X11A 2VAAB 1I8LC 4Y19D 1QVOA 2D0FA 2NY1D 3O2VL 3QIWB 3TVMA 3I9GL 3ZHLA 4F33A 3OAYK 4I2XE 2IQ9L 1RMFL 4ZD3H 1U3HA 4YUEH 1DL7L 2AJSH 4H20H 3DSNA 4Z7OE 1ACZA 2DB8A 5MHSD 1D5BB 5DJDB 2DIBA 2PYFA 2X4SA 3PXHA 1N3NA 2NLJB 3EOYG 1DDHB 1Z5LB 1NAML 5E8EA 4Z7WB 2XTJB 2BX5A 1HNFA 1FORL 4LBEB 3RWCA 4NQSA 1N5AB 1U8QA 3DMMC 1X5ZA 3BKCL 4KTDH 5GS0D 2PO6B 1ZAGA 3JVGA 1TVBB 4IOFD 4WI2A 2C4FT 5KSUB 4I77H 2VZ3A 4FOMA 4LVHB 4WI4A 4YHLL 3QA3B 3U4BL 4HWBL 1I9JL 1V7MH 3GBNL 3O6LH 5E99H 5FYJL 4R90L 4LIQE 1EZVY 4IRJA 3S35L 5DLML 5F9WC 4PV8A 5AD0A 1MCCA 2EDEA 2JB6B 5D7SH 1A7PL 4NJ9H 4PJGA 1IGFH 1TJIH 4NHUA 3MRNA 3FFCE 3ARDC 4YIQB 3TFKC 3TEUA 2XPGB 3V5HB 2BERA 1H3UA 4P4RA 1YECH 3SDAD 1VFAA 5CJQH 1EIBA 3FHAA 5FIEA 5B21A 3QDHA 3QHTC 1XIWB 3GSRA 4J3UA 1HSBA 1S7UA 3HPLA 4QEGA 4LF3A 4MNQD 1ZLUH 3X14B 3UYPA 4JFOB 3QNYA 2AGJH 3VXSA 1P6AB 1S8DA 3V52H 1IC7L 3EW3B 4HAFA 1BAFH 5I1GL 1YEGL 5JHDD 1BGXL 1F13A 3OKDA 4ETQA 1XF4A 4XPBH 4F7EB 1JPST 3ESVF 1FO0L 3TBTA 5DMKA 5C0FB 5C86A 2Q6WA 2VLMD 1JHKL 2R0KL 2ICWI 1RZJL 4UV7H 4ODWB 1UYWL 3LKNA 4WEBL 3LQAL 3KGRA 1LEIA 5BVJB 3MRQA 3QIBA 3RI5F 3P4MA 1A7OL 1S7VA 1JNHB 1BVKB 2NZ9D 4NM4H 4C54A 2FECI 3NFSH 1YEGH 5BZWA 1NFDB 4PBWD 4FQCL 3K46A 3LCYA 3EYVA 3OKDB 4ETQB 5I1DB 4KHTL 4CVZB 1LNUB 3HC4H 5ACLA 4K2UL 5I17A 4ZNEE 1M7IA 3L5WB 4J1UA 1JZ3A 4KQ4H 1WF5A 1CQKA 4XI5D 3F7YB 1H3GA 1F97A 1QQDA 1WFNA 1Y0LB 5JA8B 1NMAH 4OCLC 3O8XD 1KEMH 3BO8B 1UVQA 4GAJL 1UJ3B 2DDQH 4NKQB 1ZLWK 3AREA 3ZE2E 2FH6A 5I1DA 1F02I 4GRWH 3GUTA 3NMEA 4YNYA 3NIDE 4Z7VA 1RZGB 3FFDA 3D85D 3UJJL 4IMLB 2HT2D 1J1OH 1DN2A 4DK6A 1A6AA 3P4LA 2A1WL 2DTSA 3MV7D 1X5FA 3GHBL 1BEYH 4J8RB 1TZGL 4M9PA 5KJRL 5F7NC 4DTGH 2EICA 2YMXL 1LO3H 2HN7A 5LGHL 4D8PB 3X3GL 4HJ0D 4AQ1B 1I8MA 1PY4A 5LGJB 3OMZA 5KVFH 4FFYL 4X98B 1IL1A 4YFLF 1OSPL 1P4BH 5EZOH 1OW0C 1FGNH 4MDIB 4D3CL 3HMWL 1J1XH 3FN0L 3FQNA 1MAMH 4I1NB 1FVEA 1A1NB 5DJYA 3CC5A 4MHHI 5D4QA 3RIAK 5EO9B 1NSNH 3PV7A 5H37H 3AU1A 3BP7A 3KPLA 3F62A 2WP3T 2Y5TB 3GJFK 3BE1L 3C6LC 5DEFB 3OKKB 2QV2A 1G7HB 3SPVA 1CXHA 1WZLA 5I9QB 1KJ2H 2ICEB 1FSKB 3R06B 1RZKL 1YEIH 4YZFE 5CZXD 1T20A 2GHWB 4DK3A 2VERN 5LWYH 3WLWC 2XOTA 1JF1B 3ETBF 1YEJL 4P46A 1HH6A 4X6CA 3UJIL 4Y2DB 3E1F1 1KBGH 3GO1H 2E27L 3EDJA 1REIA 3P3YA 4NQCE 5T5NF 2O5XH 4LPWA 4Y4FC 5J6HB 3PWJB 3P0VL 4M61A 1P7KB 1WK0A 4BH7A 3PP3K 2YUZA 1IT9L 1OLLA 1YN6B 3KPRD 2B39A 2OK0L 3LKPB 3D69A 5SX5K 1G7QA 1GGBH 1RZ8A 4Y4HA 4CN6A 2ZUYA 3LMJH 3C8KB 3KPPA 2AI0H 3DNKA 5GJSL 4KHXH 1MELA 3LB6C 4WHTB 1XH3B 4F7TB 2DI7A 2V17H 5L0QB 1G9NC 4FNLL 5IB5B 3BDBA 4KC3B 3CLEL 4JZJB 4KMQA 1U95B 1P7QB 1HEZB 2L4OA 4GG6A 3T0EA 5FK9B 3CXHJ 4BM7A 1D9KC 1CS6A 1G7PA 1WICA 2FJFA 2BVEA 1S7UB 3HPLB 2I9LB 5IKCA 1H8OA 5HGHB 3OJMB 1IGIH 1UXSA 3MLSL 3LB6D 1NDGA 3FO0L 4P2YA 4JO3H 3WFEH 4WUUE 5J1TC 2LTQB 2WIIB 2J8UE 4O2EB 3BIBX 5K9QI 4YDKH 4OAWA 5J12B 4ZSOA 5C0DA 5BXFB 4GRMA 2VDQL 4UQ2A 1RVFL 4JPVL 1D9KD 4ONHB 1JTOA 2EDOA 5E6YA 3LPGA 5DDHA 5I8CA 4JO1H 2V2XA 3LD8B 5EC2B 2APVA 3BISA 4KMTL 5ID1A 3NIDF 1JGVL 5K93A 2NW2B 1E6JL 2BSED 4AM0B 4EIGB 3THMH 3MJ9A 4LRIC 3TNMA 3DX6B 4HW6A 5KVDH 3QUXC 1X5GA 2PTVA 1RJYB 2WUCH 1BEYL 2A77H 2X9YA 3WD5L 3M45A 1FL3A 4Z7WA 4IEFB 4Y1AA 1Z3GL 4Z7VF 1WZKA 1JMZA 2ZNXA 3BPOC 3OBAA 3O41A 1RZ8B 4Y4HB 5ITFB 5T1LA 1YMMB 2UY7A 3FB8B 1MFDL 4D9LH 4PG9B 3O6FD 2KQMA 4U1HA 3QXVA 4JZJC 4XCNA 1MFCH 5J13C 4HPOL 1SM3L 2CJUL 4FS0A 1U8PA 3OKLB 2XQYG 3D0VA 4ZO9A 1DDHA 3QIBD 5GS3A 5FGSA 3N85L 3OKOA 3V5DA 3IDUA 5DJ0A 2D9CA 5BV7C 4ELMF 1NC2D 1U91A 2WWMC 5ESAA 3T04D 3WIFB 4MDJA 4EN3C 1CU4L 3IDYC 4R96A 4N1EA 5I1GH 3T0WA 4I13B 2JTDA 2J7LA 4QTHA 4M6NL 2D7TH 4S1DC 1FO0H 3MRRA 4WHYG 1J18A 1JN6B 3IETB 3DMMD 4YXKL 4L3EE 3N1PC 5F89B 4I3SH 3REWA 2OR7A 3SBWA 1K4CA 1K5NA 3DMMB 2DQJH 3BD5A 1A02N 4JANA 1E6JH 1YY8A 5DWUH 2H8PB 3CPLA 3QWOB 3TC9A 4S1QL 5FEBA 5D2LE 4PB9H 4ODVH 4RGMC 4P2QD 1LO4H 2D0GA 3AC0A 3RWCB 3N9GL 3ZTJH 2EXYC 2CSPA 4QTHB 4I18C 4KVCL 1SY6H 4FXKA 3B5GA 4Q6YA 3NCJL 1DSFH 4JGUA 1RU9H 4XAWL 3QUMB 1MFDH 1J0IA 2EDXA 3JWDH 3VI3F 5EDXA 4JVPA 2QR0B 1CFVL 3WEXB 5JUEH 2YR3A 5CGMA 5D71H 4PV9A 1FIEA 3L6FA 1YNTB 4PYHA 2BRQA 1WCQA 1JE6A 1OB1B 2L7JA 1VB9A 4HDIA 4NN6C 1J11A 4WW2C 4PJ8D 4GMSL 3UZVB 3DVGB 4KXZI 5CCKH 4JFED 4WJ5A 5I1HL 4L29A 3GSUA 3UZQA 4APQD 2XPGA 1N59B 3LH2H 4PJHF 4KV5F 1D6VL 3G04B 5CEZH 1A4JA 4QYOA 4ZQKA 2NPLX 1PX4A 1DQJB 1WFOA 2DD8L 3P9LA 5HHQB 3CU1A 2VDPL 3HB3C 3WNLA 5DT1L 1VACB 4NWUL 4OGZA 1GZQA 5IVXB 3WNKA 3VH8B 3JUYA 3MV01 3ZKXB 2BNQD 2DMCA 3RWDA 2YXMA 4GLRI 3LKSA 2JK5B 4PJDA 2UUDK 1WJ3A 3MRGB 3W5NA 4HIIA 3G6JA 1I9RH 3RX5A 4CMMA 4JFYB 1MLBA 2C26A 2IGFL 4BUGA 4OFIA 5DI8A 3AFLA 1F45A 1GGIL 2PO6C 1EXUB 3VFTA 5L6YL 5DEGB 3QFJD 1U3HB 1M05A 4TTDC 1UKSA 1N8ZA 3T0AA 1HHKB 5F7KC 1P2CA 3ELAT 5L2KB 1T1ZB 3HZYA 3TBYB 2Y7QA 3C2AH 3QDJB 1GVIA 4LSTL 1QSVA 4B50A 1CT8B 1IQWL 4FQLL 2I9LA 5IKCB 2QR0A 4TUOB 2QHLA 4UNTA 1BFVL 4WU5A 3V79C 5FOBB 4X5WA 1U8NB 5I17B 4OKVB 1K4DB 1D6EA 4HS6B 4PGDB 1KIQB 4NQUA 5J06A 1A7BA 2ICES 5ACMA 4KHXL 3TYGH 3KNBB 3DVFA 3MV9B 1HHKA 4AEHL 2EE9A 5HYQA 4P48A 3VMNA 1R6VA 4QRRB 4TUJA 4PB0L 4DKFL 2X70A 4OZGF 5KVEL 3HG1B 2DBJA 3T8XB 1D7FA 5KBNC 3DETC 5CIPB 1I8IB 3ZTJG 1MWAB 3FQTA 1U8JB 3M17A 4B7IA 3RA7L 2OJZL 2V6HA 4OZHF 4O58L 4Z9KB 1MH5A 3Q5OA 1R5VB 4IIQB 4NN7C 4Y2OA 1EJOH 2VLKD 5GGTL 1W72B 2VLJA 5DD3H 4OZFG 3MRBA 3H3KA 3BKMH 2B2XL 4WHYH 5C0AB 3DV4B 1CL7I 1CF8H 2IGFH 4MJ5B 4U6XB 4HUNB 4EKXA 1OP5K 2A6IB 5EULV 3RVUC 1KJ2B 4NQEE 2BSTA 4OTXL 3FRPG 2RHEA 4Y5XC 1T21A 1G7JA 3KJ4B 3QNZB 4QXWA 5F9OL 4ZOAA 2RB8A 2EKSB 4Z5RB 2VL4A 1P5VA 2HP4A 2BHYA 5HHNB 5CBEA 1C16A 3HZYB 3TBYA 3UEZA 4OF8A 2E6JA 2ZG3A 3WKNA 3GSNB 2ZUWA 1IVLA 2QQQA 3WD5H 2I5YH 3MJGX 1NMAL 1S9WB 3VG9B 4JN1L 4GXUM 3GM8A 4HK0B 3WUZA 3VRLF 1W0YT 2A6KA 4Z8FL 3QIWC 3ARQA 4PJHE 2QADC 1AGDA 4M4PA 3WDIA 3O3AA 3KXFD 1G7JB 2EEAA 4JFHD 2R1YA 1IGCH 4Y4FB 1IM9D 1E27B 4J6RL 4LLMB 4H8WC 5IBTL 3IU4L 4I4WA 5DTFB 3GNMH 1NJ9B 1XF5A 4WO4B 5F7DA 1G6VK 5FYJH 5KS9F 3ARDD 3L3IB 3QG7H 4LP5A 3DVIA 2FJGA 3BWUC 1AXSB 2RR3A 1EGJA 4JO1L 1WAAF 5IOPB 2XQBL 3E8UL 1IE5A 1GSMA 3ROLB 3ARYA 5D1ZD 2F5BL 5T5NG 4HPOH 4XMPH 2HH0H 3S97C 4KRPB 3AMKA 4WTZA 4JRYB 4PGCB 2YPLD 2VXTL 3X17A 3GSOB 4OZ4A 5EPMA 5BVPH 2EO9A 1G0YR 1YY9C 3CH1B 2PYEA 5TDPA 2I07B 4X7CC 2AGJL 3OF6D 2EIZA 1NBYA 4PJ9C 2OJEA 2YBRA 3C8HA 4I0KA 5D96B 5D2LB 1UA6L 1OCWH 1XR9A 4OD2B 3KPSD 2NY7L 4Q9BA 3BP5B 2R0WH 3QUZC 3IAPA 1YPZA 2DQJL 2CKBA 4X6DE 4S2SA 1EFQA 4KDTC 1GPOL 3VCLB 3X12B 1X5LA 4PJ9B 2DYPB 1I7UA 3BEVB 2EEDA 1B2WH 1ZHLB 3KPSA 3IXTA 3W0WE 3P4OB 4NO2B 3QEQB 2XV6B 4NHUB 1UACH 2CDFA 4EI5B 5JDJA 5HVWA 5E56A 1MQKH 5AYUL 4FZEL