5I74C

X-ray structure of the ts3 human serotonin transporter complexed with br-citalopram at the central site
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
214
structure length
214
Chain Sequence
DIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYSIPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sodium-dependent serotonin transporter
publication title X-ray structures and mechanism of the human serotonin transporter.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 39
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2016-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i74C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i74C01
1TZHB 3QQNA 1CFTB 4PJ5D 1HCVA 2ADFL 4PV8A 5EIQA 3VXQB 5I66A 1WFUA 2VQ1B 2QADB 4UB0L 3UMTA 4ZFFA 3IXAB 1IGFL 3IXTB 1CGXA 2NY0B 2FD6H 3MUJA 5I1AB 2E7HA 4QRRB 5E1HB 2XG5A 3ARRA 4Y1AD 3CSPA 1J05B 4GRWB 2BERA 3B2UC 2VOTA 3ABZA 3UEZA 2E7LA 4I18C 5CLTA 2D03L 5BO1L 3D2UD 3FT4B 3U0PA 5T3ZE 4MSWB 3A6CL 4KMLB 2EDHA 5GS2D 1HH9A 4WJ5B 1RUPH 2FATL 3QIBA 4K9EH 4OAWA 3NA9L 4GMTL 5GGSA 2AEQL 3HS0A 4HD9A 1TIUA 3IU3A 3RGVB 5I8EB 3G08A 1I8IB 3S3SA 5CJQL 4XI5C 4Y4HD 4BZ2L 3U2SB 2AK4B 4WUUB 1J88A 4KUCF 1L9NA 1QSEB 2AJXL 3VU2A 2ZUWA 3K8KA 1KTRL 1G9NH 1IQDA 5EC2A 4D9LH 1T3FA 1KG0B 3IAGC 3GBMH 2EYTA 3MRHA 1R24B 2PN5A 4BSWA 2EDEA 4WHYH 4DGYH 5DF0A 2F53E 3U0WL 4FFZH 4APQB 1P2CB 5I1LA 4AG4L 2X41A 5IEKA 4P46C 2EZ0D 3ARGA 4XCEB 2IAMA 5KAQG 5IT2H 1C08B 1CFQA 4GKSB 4UOJA 2F19L 5D71L 3IFPB 1X5YA 1BJ1H 1VGKA 4QEGA 1RZ7L 3F62A 4JVPA 3DO7A 3D5OF 3E2HC 1HH6A 3OKLA 1AGBB 2Z31C 1KB5B 5GRUH 3LEYH 2QV2A 3LN5B 1R0AH 4J3SA 1D9KA 1SYVA 4Y5XC 1U3HC 4M6ML 4PS4L 4U05A 2W9EL 4CJ0A 1MJ7H 5KBNC 4X98B 3GNMH 4OQ1A 2Q8AH 2Y9RT 5IOPA 1I3RB 2Z0BA 5F89A 1H15B 1UH4A 4HWZB 1QRND 1S9WB 1T21A 1V05A 2VRAA 3M07A 5C71A 3TA3D 3TBSB 3BKYH 3JWDL 4RMQA 3T2OA 3OAYK 3RUGA 3MMEA 4GW4A 3T1FA 1PKQE 2JB6B 4GAJH 5HD8C 3CZFB 4P3CL 4U0RB 2XTJB 1N0XH 4LASH 5E9DD 3KLDA 3T4YB 1CE1H 1UGNA 3PWPE 2COQA 3OB0H 1F3RB 3CUPA 1Q72L 5IM7A 1T6VN 4HKXA 3REWB 4NO0D 3HTLX 4JY6A 4OLVH 1F6FB 4A2MA 4N0UA 5IV2B 2EKSB 3DYOA 3V79C 4NQCD 5MENA 4KDTA 4BA8A 4YX2L 4O5LH 1ZHNA 2X1QA 2GSGA 3BP4B 3VCLA 4EN3C 1FYTE 2P47B 1JZ3A 4H20L 5HGGS 3SDYH 3KPRD 5DMYA 3DBXB 2HMID 4X7SL 5IFHL 2JJSC 4FQCH 4G8EA 4YFLF 2CR6A 1UM6H 3EGSA 5MEOA 3RZCD 3HNTH 3MXVL 4LRNH 2JJTC 1X5AA 3ARVA 4X6DB 2VLJD 1U3YA 3C8KA 4NQEB 4LPUA 4HGKC 1KUMA 3RVTC 4I9WE 3U6RB 5FF6B 3RWIA 5KSAA 2V5RA 2VXSH 3LB6C 2XZCL 3HCVB 4P9HH 3FO2B 3ALWA 1ZA6A 1VFBA 3OKMA 4GG8A 2IG2L 1WFOA 4BH7A 4G5ZL 4F80A 5F7HA 1WC7A 3WEXA 1OARH 3PWUA 1AHWC 4P2OC 1YNTB 3DPBA 4OZGB 5KTEL 1LO0L 5BOZG 4HCRH 4X5XB 2A83A 4WTWA 4XMPL 4GW1A 1QPXA 5HI4C 5CINL 5LVEA 3MNVA 3MV9E 1OP5H 4LLWA 4PJIE 1JWUB 2R0KH 4FA8A 2V7HB 1MH5A 3BX7C 4BSJA 4TTDC 3BP7B 3OPZH 1CGWA 1WZKA 4UI2A 3KDMB 2DIJA 3VFOB 1KTDA 2Z8WC 4K3EH 4I18B 4L29B 2I9TA 5C07D 4ODHH 5I71C 4OF0A 2DBJA 5E8OA 3UTPD 5D7JA 1RZKH 3MJ8A 5F7LB 4JFHE 4O9HL 4OLWL 1HZHL 4X7TA 3MLTA 4YXKH 1E4XL 4HS6B 2H8PB 2RAMA 4AEIL 3T0EA 2NR6C 4PV9A 4Q9RL 4NUGH 4HUMB 4N5UA 2VNCA 1FL3B 4LOUD 4L4TE 2D7PA 4KK9C 4NGHL 1YPZA 5TQ2L 4U1NB 1NGWA 3PHSA 2FHCA 2P42B 4KJYB 1W8NA 5E6IA 4WTZA 5HHNB 3H0TA 1EHLL 5DVLA 2A6JB 3ARPA 4PBXA 1EZVY 5HXMA 4LLMB 4XVSL 3MRLB 1T0MB 1XFPA 4I2XE 4PG9B 3L95B 4P46B 2E8YA 5CJ5A 3GJEA 3VXTB 4P4KC 1C16A 2AJ3A 1QSFB 4QHNB 4G6AD 5EO0A 4OM0L 2EIBA 3B6SA 3E2HB 3ARDD 1IVLA 1GZPA 4NO0A 4K8RD 4OGZA 2Z31B 1L0QA 3GB7B 4NQCA 1KC5L 2AJYH 5LWYL 4Y5XB 4OCYL 1L7TL 1U3HB 4XNXL 1I9IH 4X6FA 1SMAA 1V8HA 2D0HA 2V5YA 1OTUD 1RULH 4GLRI 3VXOA 1KTKE 3WUWG 2V2XB 4D3CH 5I76B 5D93C 4NPYA 1MCDA 2AXFB 1G6RL 3UTSB 4MJ4A 3RZCA 1B0GA 4WW2A 4HCRA 4U3HA 4WWID 4NQTA 3DOSA 4S2SA 4F3FB 2ENSA 1MFBH 5A16B 4IHOB 4K8RH 4FFVC 3NIFF 4QCIA 3X14A 3SY0B 4LMQI 3ZKMC 5DHVB 5C0IB 3DARA 1HIMH 5IVXE 1UXWB 3V0AC 2H1PL 1LNUB 4UT9L 4Z7OF 2F58L 1HCFX 3W5NA 4MWFA 3UBXI 1UCBH 4KY1H 2P5WD 5DA4A 2OK0L 5D1QA 5DMKA 5TE6H 1CZ8L 3GO1H 1FO0H 2FZ3A 3QIWC 5I17A 4EN3B 5FYJD 2DI7A 4MJ2A 5C0CE 1SJHB 4Y19B 3QUXC 1AGDA 1CLCA 1NPUA 1T04A 3LKSB 1VADA 1MCJA 4P99A 3TF7C 2F8OA 4G8IB 1NCCL 2W65A 5MERB 1FL5A 1UH3A 3CX5K 3PHQA 3GK8L 3HZMA 4RQQA 4OUUA 25C8H 3U4AA 1MCIA 1MIEL 4LP5A 5EZLA 1MCWW 1ZVSA 1IAKB 4NRZA 1FHGA 2YD6A 1Q0YH 3ILPB 4V1DB 1R3LB 4LKCB 4S1DD 5FYJH 3TPUA 3PNWA 2HA1A 1OT1A 3DX8A 4JZJC 3ULUF 1Q9KB 1AHWB 5E99H 4TOYH 5E8DH 4P2OB 4YWGH 5T3XL 4P59L 2HH0L 3SGJC 2AEIT 5I1HL 3ULUL 3DETD 1A3LH 1UCTA 1FYTD 1GC1L 5BZDB 4PY8J 3QWRD 4RRPG 4A6YH 3BPCA 3SDAA 4H1LB 4BKLB 3NCMA 4UT7L 3KPNB 4LSQL 4YGVA 1BZ9A 1RFDH 1J1XH 4PRDB 1TTUA 5FYKL 4AMKH 1X4ZA 3MLUL 3QA3B 4ZUUA 1ZXQA 1I7ZA 4OQTL 4KI5E 5BV7L 3KLSA 2F5AH 3QFJA 4HX1A 3P77B 2XXCB 3B9KC 1R5VB 2CIKA 4G6FD 3H3BC 4PGEB 3G5VB 3TO4C 5I71B 1KJVA 4JPVL 4OM1L 5C0GA 4P5MA 4MZ3A 2IPKA 2X89D 2DKSA 1A02N 3KPLB 4YNYB 1TQBC 1FAIL 2GY7B 4KV5E 5ISZD 1J8HD 5DK0B 1CE6A 3NTCH 4NZRH 2HP4A 3KR3H 4J3UA 4XP1L 5IB5B 4NBZB 4YDIL 1G9MC 1H5BA 4ZFOL 5FO8A 4P2CG 2OL3H 3WMSA 4M1CD 5SWZD 3FOLA 5C0AA 3V4VH 1KB9K 2E27H 3SGKA 2MNUA 4ESKA 1ITBB 4LSTL 1KPVB 5KS9F 3UTTD 4UUJB 2HFEA 3B5GA 1DQDL 3OQ3B 2YD8A 4JRXB 3VGFA 2D7TL 3A6BH 4LHJB 2H32H 3KLHD 4IRSB 4BFGA 4YAQB 1EEYA 3C9NB 1UZ8A 4X8JB 4G43A 1NGZB 1SEQH 4QXWA 4EVNB 4G3YL 2X42A 5D7IB 2NY7L 4G8GE 3BRDA 2PO6C 1XIWD 3WNLA 3CMOH 4PJ9A 4Z7UE 5LCVH 2A0LC 4ZOBA 2PUQT 3DRQA 1T1WA 3HUJF 5GS1C 1BEYH 2OP4L 1DUZA 5JW4R 4J4PC 3DMMA 3V4UH 2GEEA 3U83A 1U8JA 3IFLL 3IGAB 2FO4A 5SWSA 3GJFA 3LKQA 1VKXB 5J7CC 2CLVA 1T7ZA 4XNMA 2F74B 3T3PE 1YJDC 4XC3H 3LY6A 1IC4L 3TVMC 5LAXA 4HKZB 1PZ5A 2LAAA 3LAFA 3FN0L 3PQYB 4DKFH 4P23D 4U2YA 1MHPL 4FQHA 5A2FA 1YC8A 3KJ6L 4OI7A 1E28B 4OCXH 4LIQE 2BK8A 4WIQA 3U4BH 3EFFA 1A14H 3F7VA 2H9GB 3PL6D 4HWEH 2YD3A 1A7BA 4LK4A 2EDLA 2IANA 2D9CA 3GSXA 4ZTOL 3UJJH 3VMOA 3LKRB 3U0TA 2WIMA 2F5BH 3RQ3A 1QFHA 1AGEB 3HE7B 4YFEA 4YO0A 1YEEH 5I15L 3L5XH 3D9AL 2H2PC 1I4FA 1FL6B 5DJ8B 3QIWB 5TF0A 1IT9H 2I07A 4NKOB 4NBYB 1ZT7B 3VWKC 3MV7E 1XH3A 2H41A 4X6CA 3KWWB 1JNJA 3QUXB 4R8WL 2FJFA 1JZ8A 1SJEA 4JRYA 1P9MC 3LQZB 4MQ7B 2K1MA 2XWBB 1DBML 4QO1A 4OZHE 1KBGL 5KJRL 5JQ6H 5JIKA 5HHME 5DEGA 1LDPL 5E8EA 2FWOA 1SY6L 5HDOA 1W0VB 3PWLB 2NXZC 3RI5K 4KK8D 4PFEA 1F13A 4JDZB 5EZIL 1P4IL 4G8FA 3OKDB 2F15A 3F58H 3FT3B 4QLRA 4LARL 5JORB 1UFUA 1K5NB 1FH5H 5DJ0A 4JZJB 4GS7C 1BECA 3RVXC 5D9SA 3DLQR 3OXSA 2HN7B 4JFEE 2X40A 1QFWH 4PJAB 4N9GA 5HY9A 2ZOKB 2PYEE 5HGBB 1DDHA 2VXTL 1S78C 1HSAB 4N9OB 5D8JL 4L8BA 4AIZB 2VDRL 5HYSG 3T2PA 4XAKE 3IFNL 4ODWB 3UPRA 1CXEA 1OAXL 4P5KB 3A6OA 3N85L 4NUJB 5DRXA 4ZXBD 2WNGA 3WN5C 1J5OL 1GHFL 1IGFH 3TCLB 5D6DA 4WI3A 3ROLB 1JPGB 2I5YL 2X7LA 4O51A 2DM4A 4GUPA 4XPBH 3W9DB 5JMRA 1TVBB 3I6KA 4UNVA 2WZPD 2RFXA 1NFDF 5EIVA 1N5AA 1VERA 2D03H 5BO1H 1TVHA 1ZHKA 2EIEA 3OR6A 5JOFA 2DQUL 3A6CH 3VDBA 2RGSA 3BWAB 1KCUL 1S5HA 5B38A 4PRAA 5GRVL 3B9KB 3WD5H 2BHZA 4X80L 4N90E 3TO4B 4OBRA 1XF4B 2FATH 2N7AA 4HK0B 4TSAH 3S5LG 4JCLA 2AEQH 2NY2D 2Y07H 3LKOB 3EO0B 4CRPA 3LSOB 1GGUA 5HYJA 3IFOA 5CJQH 4BZ2H 4QWWC 1G7IB 1TQBB 3S4SB 2BMKB 3RI5F 3TNMA 3SPVB 5L2KE 1NUFA 3L7EB 3VFPB 4TPRH 1S7WB 3WFDL 3QDGE 2B1HL 1GOHA 3UXFA 2ICES 2PYFA 3MRFA 1YUHB 4IMKC 3Q5TA 5F1IA 2GJ6A 3IF1B 1U0QA 4PJHF 2WUBH 5C0NC 2PW2B 3QI9D 4YHKH 4YR6A 2YPKB 4WEUD 1QLFB 1I8MA 3GHEL 2VN4A 3RWHB 4AG4H 5I6XC 3MRCB 3DV4A 1CN4A 1S7TB 5D2LA 1QO3A 5ESAA 1XF3A 2RIKA 1WAAE 3QCUH 4Z0BH 3V0WL 1KPUB 4LPXA 2P8LB 2EDYA 1CFVL 1JK8A 2OMNA 5HYEA 1IEBB 2PO6B 2ZUXA 1H9VA 2AJSH 3P0YH 5HTSA 1FCCA 3QDJB 2X44D 3QCVL 3JTTB 4MCZA 5T1DL 2ICWJ 5CJXA 1ZMYA 1JF1A 4H26B 1MUJA 5GS1B 4PRID 4MDJA 3IDNA 3SDCB 4XAWH 3WE6A 2XY2A 4F33B 1BZQK 5DJAB 1LE9A 5IW1B 4G42A 4M6MH 2DLEA 4P2RE 3W0WA 2W9EH 2DQIL 5DEFA 2OSLA 5EOTA 4S11A 3QXUA 4X4MA 1QFUH 3V6OC 2CRYA 4JJ5A 2GK0A 4HJGB 3VFNB 4HDIA 3P30L 5ANMA 3TVMB 4XP6L 2EYRB 3KXFA 3FQNB 5EUOA 4EI6A 1LE5A 1T4KA 1P7KA 3ZMRA 1GGIH 5TE7L 1KN2L 4P3CH 1F6AB 3RGHA 3SDDD 3L9RA 1QLRB 1I1YB 1CU4L 4UTAH 1OF2A 4G8GD 3BRGC 2CLRB 2UUDK 4G9DA 3HZYB 2EYSA 3VG9C 2YPLA 2HVKA 3QFDA 2VLRA 3PGCB 1PG7H 3BDBA 4IRJA 1BQHG 2F54D 5T3ZL 2VLLB 1RMFH 1ZANL 4HAGA 1FN4B 2HT3D 3D18B 3HA0A 3HKFA 4LLVA 4B50A 4HMCA 1KIRA 5KN5B 4CVZA 2Q6WB 1LEKB 3D39A 4H20H 1DR9A 1JNNL 1CBVH 2E9BA 4YHPA 5D4QA 2A6KA 2XFXB 3VWKB 4GO6B 3H9SE 1MCCA 5FEBA 4MA7H 4NWTL 5CEYB 1FPTL 1RZIB 4X6EB 1S7VB 3CXDH 5F7EL 5JTWA 3IJHB 5L2JA 2P48B 3U9PL 5CKGA 1LGVA 4PR5B 1Q94A 2G75A 2P44B 2AJVL 4K71C 3BI9X 1TPXC 4YDVA 5IB3A 4M7KH 2BRRL 5FYJU 5IESH 3VXUA 3BEWA 4S1RL 3NIDE 4ZQKA 3BT2H 5DYOA 1IFHL 2NXZB 2IG2H 4H8WC 4J3TA 2XWTA 4H0IA 1TZIB 4Y2OA 3QQ3A 3GSVB 2VQTA 1OAUL 3DIFA 2AW2A 1C12A 1LO0H 4QXUL 4GS7B 1NGYA 2X05A 4XWGH 2QHRL 3OAYH 4YIQA 4J12A 4U1MB 3QZWB 5J8OA 3OZ9L 5E2UL 4EDXB 2X9XA 5LGHL 1T83C 4JPIA 5A40E 4JFFB 5FAAA 5CINH 5DQ9A 1H3GA 1PSKL 4LEOB 3REVB 1CT8A 4PYHA 2IALA 3QG6B 4U1JA 3WJLC 4TVPD 4U6VH 3WN5B 2B5IC 2BP3A 3QUZA 2EDWA 1CG9B 2NY4C 4Y2DD 3RA7L 1KNOA 2DJSA 5GRXG 2FNBA 3T4AA 5C09A 2BRQA 4KMTL 1CF8L 3MYJA 2J4WH 1A7NH 4J2XA 1MPAH 5CGTA 5HHMD 2VDOL 2X4TA 5AZ2L 1R3JB 2HT4C 2AQ1A 4PJXB 5FM4A 4JJHA 5HBBA 1KIQA 5ID0B 2VJXA 4CU6A 4HS8L 4OD1L 5IQ7L 1DBKL 4JHWL 4TSBL 4O9HH 1D6EB 1HZHH 2BY2A 4XP9L 1E4XH 5GIRA 3CH8A 4AEIH 5F72S 3TZVD 5DZLA 4GG6B 5BS0B 5J06A 5KSBB 3UTZB 4DUWA 4DGVL 1KSRA 3LPFA 2ZPKH 5HPMA 5TQ2H 5EU6E 3QNYA 3MUHL 5GS0D 4HUUB 3W39A 1FGVL 1YQVL 1H3TA 5CWSB 4P57A 1EHLH 1Z9MA 2HVJA 4N0CD 1DN2A 1FE8H 5BZWA 3NAAL 2KBGA 4ZSOE 1KT2A 3O2VL 5HI5C 5I6XB 2VLKB 4XVSH 3DVNB 2HJLB 3P9LB 1K4DB 2DN7A 5DJCB 4OM0H 5GJSL 3O2DL 4JFDA 3C60C 2B8OT 5FKPA 4LPVA 2FECI 5EU4B 2BDNL 5GS0H 1KC5H 5IB1A 5IHLB 5GGQL 4I3SH 3HAEG 2A9ML 2IFFL 4UTBH 3GMMA 4OCYH 1L7TH 4EI5C 5AAMA 3KLAB 1BZ7A 1M6OA 1RZ8A 5I18L 5E95B 3B9VA 3UYRL 4I0KA 1RJYB 2GW5A 5F9WB 2FCBA 5BW7A 5GHWL 2V17L 4PJIF 3T0DA 4HT1H 4MXVE 3TBTB 3BH9B 4JY4A 1AIFB 4QRRE 4H25A 3SE4C 4JN1L 1X5KA 3Q48A 4EKXA 1XF2A 2CD0A 5EA0H 4ZUSB 1VFOA 4U3XA 3SBWA 2P24A 1S8DA 1M7IA 4HW6A 1JGEA 3G5YB 3K74B 3VG9B 4UT9H 1T22A 2MSPA 2V2WB 2Z8SA 4X99A 3F7PC 3MRMA 3DX6A 3DUSA 1JPFA 3O3BA 4HUWB 1J0HA 5HHXL 2B0SH 4XP4L 1MLCA 1U41A 2N4IA 5JHDA 4UIMB 5FIEA 3IJSB 4XPFL 2F9BT 4Z0XB 4P2RD 1AC0A 4CKVX 3FQTB 4QRPB 4WUUE 4KK5C 1UM4L 3QUKA 4N0FA 1ZLWK 3SO3C 1T7VA 2YEZB 4JFOA 2YSSB 5T1KB 3MRJB 5CJ8A 4NN5C 5J9PB 3MRGA 3QIUD 4E0RA 2APBA 4XGZB 3CFKB 1JGUH 4TUOA 4X7DC 5D7LB 2X9WA 2WUCL 3GK8H 5CSZA 3L7FB 4X9FA 4PJCB 3QJHB 2XPGA 2GAZB 1MIEH 4K71B 1LK2B 5C8JB 1TPXB 1DBJL 2BJMH 2R0LL 1AJ7L 2OLDA 3VRJA 4ONHA 5FYKD 1IGYA 1JJUA 5LXGL 3CPLA 1K9TA 1MI5A 4UQ3A 2C26A 1VACB 3LIZL 5EH1A 4XTRC 1S7SB 4BJLA 3SJVE 4QHLA 2HH0H 4JLRB 2QQQA 3CK0L 2ZUYA 5I1HH 1CDCA 4TUJB 3ULUH 1YQ2A 4LLYA 1P7QD 1GC1H 3GMLB 3T2QA 3DVGA 2DYPD 4LSDA 4HG4K 1UB6A 4UT7H 2LTQC 2GITA 4XBGA 5FM5O 4LSQH 1UA6H 4PJGB 2B5IB 1CICC 4L3EA 5FYKH 2FL5A 2NY4B 3KPQB 3WLWD 2C3VB 3TCXA 3V95A 1BM3L 3MFFB 4PRHE 5HHVH 4OQTH 4QOKD 5JDSA 3ORJA 3O0RL 1U8NB 2FX9H 4XH2B 4Q2ZA 3V6BR 1E4JA 3PABA 3BXNA 4LCIH 4P2QB 4OM1H 4XCYA 4XB7A 1TCRB 1HILB 4OGAC 3NBNA 1MWAB 1CGSL 4PJBB 1ND0B 1G6RA 5T5NG 2UWEE 2DI9A 4BQ9A 3CXHJ 3H42L 4UZGA 5CEZL 1FAIH 3AB0C 1JGDA 4PP1D 5TFSH 5IVXF 5HYFA 3O8XC 3HLAA 4NFCA 4F58L 4XP1H 1FZKA 1NMAL 1CDHA 5JUEL 3FT2A 2VZ1A 4YDIH 3RPKA 1VCAA 3A0OA 5D1ZD 3BKML 2JIXD 3VXNB 2FO1A 5JW5A 1TNNA 4HK3N 2M1KA 3T0BA 5JA8B 1HHGA 1XCTB 3QEQB 1I1RA 3VFRB 4R4BB 1A1NA 4MJIB 4WDIB 5IMOA 3LQAL 4K7PX 3U7YL 3K46A 1BD2B 2GSIA 2Z8RA 1DQDH 1A1OB 2YK1L 3C6LC 3O2WL 1S9KC 1G1YA 2DQDL 4WI6A 3EBAA 1H3PH 5IQ9A 2X4SB 1MHCA 2VZ3A 4S1QL 3I02B 3QAZC 2P8PB 2QKIA 5INCA 4G3YH 1KJ2L 2NY7H 4PTTA 1IGCH 3TM6A 3VXSE 1AE6H 3G6JE 4NQDA 2EDQA 3BPNC 3HE6D 1NANH 2WINB 2PTTB 4BQCA 2CKNA 3LH2H 3P73B 5IHZB 3SKNB 3C60B 4JG0L 2ZCLL 4LHUA 1T0NA 1OW0A 1F6LL 4X4XA 1WFNA 3F6IA 4GW5B 1HOCB 1XGPA 1OGAB 3LS4H 1HDMB 1N3NA 4K94L 4EI5B 3QP3A 4P3WA 1IGTA 3FFCD 3E3QE 4OZ4A 3MGAA 5B3NA 4CW1B 4CJ1A 1TTFA 4I5BA 4NO5A 3CFEA 1XZ0B 1YEHL 1G7PB 4HHAA 3O6KH 4I4WB 5FO9B 4NKQB 4KQ3L 2BNRB 5F93C 4JPWL 1MHPH 2IF7A 3RWCA 3PDDA 3MRNB 2E7LC 2R4SL 3VWJD 5JHLH 4LSPL 4KI5F 2VZUA 4M6NL 3RDTA 1TTGA 4ZTOH 5CP3A 1Q0XH 3RNQB 3VE0B 3UBXB 3MQIA 3W11C 5F9OL 2W9DH 1WBXB 3H9HA 4EQ2A 4IOFD 4OZFH 1ZGLB 5B39G 4OFYD 4OQTA 4ZPVA 8FABB 5D5MB 1PD6A 3QCTH 3ZL4H 3WFHA 5I15H 4KVNL 1T7WA 2N56A 5HYQB 2BVOB 2HG5A 4QHMA 4KV5F 1LD9B 4MYWB 3ARFA 4DKEL 1S9XA 1J0JA 1WICA 3CDGA 5KVEH 3SO3B 3BFOA 3QNZA 4R8WH 1XF1A 4K23H 3STZB 4CL7A 4NN5B 2QADD 3ILQC 1DBMH 4PP2A 5FECA 1KBGH 4L8CA 1F4WL 1FRGL 2GT9B 3DXAB 2H45A 1LDPH 4HPOL 4MMZC 1YMME 4CAGA 3UAJC 1DZBA 5DSCA 4OCLC 3S36L 4Z7NE 1U93B 2B4CL 3RY6A 1AKJA 4ZFOA 1HQ4A 5J4MA 4URTB 1X5XA 2Y23A 2IAMC 5KG9B 4KGLA 3I75A 3IVKA 4LARH 2NX5B 3MUGB 1PEZA 2VUYA 4OFDA 1CLOL 1QSFE 3T77A 4NC1C 3RGVD 5ENWA 3MNZB 5KS9A 5D8JH 1A1MA 2AK4D 4FMFA 4E41E 1VGEL 1D9KC 1QSED 5C0BE 3IFNH 1CL7L 4Y89A 1OAXH 2CDEB 1XAUA 4F2MB 3N85H 2OTWA 2AJZB 4GRWH 1J5OH 1GHFH 1Z3GL 2LTQB 2YRPA 4NQXB 2I5YH 1DQML 2EECA 3O41B 1IM3A 2EDDA 4W70A 1CICB 2NQCA 4ZAKA 3X13B 3T3PF 4OTXH 5IMKB 3UTSE 3KPMA 3MRBA 4APQD 1KCUH 2P1YA 5DRZB 5FK9A 2R39A 3EJZC 4OLZL 5F9JA 1Y0LB 4LLQA 4X80H 5C9JB 3TIDB 2X6MA 2R69H 3FO1B 1PLGH 1H3VA 3B3IA 2I60L 4HWBL 4XMKL 4ZFZB 3C5SA 3F8UB 5ESQB 4KDTC 5BXFB 3AB0B 1A0QH 1AO7E 2HT2C 2PNDA 2VZTA 5KSVA 3O8XB 1DBBL 4KKBC 5FUOH 1FZJB 1KTLB 2ZKHL 3KNBB 4K3GA 3VXRA 5I1EH 4YHMH 5F3HB 1J86A 3JUZA 2W0FA 4NN6C 1FNSL 2ADIB 2X4OA 3WFDH 2B1HH 1T80A 5ETUB 4AENA 2DDQL 1YMHA 4Y19E 3RZWA 2ATPB 4NFBA 4RAUA 4OZIE 2W0KA 4R7DA 4RMUA 2BSSA 1QSZA 3EHBD 3EDKA 1KGCD 5HDLA 4NRYB 4IS6B 4Z7VE 4EUPB 3H3PL 2EDOA 4I0PA 5IHUH 2AK1L 4FOMA 5KSAC 3QAZB 3QG7L 3V0WH 1CFVH 4Z5RA 2XTJD 3K7UA 3O3DA 4YE4H 1X5FA 4GKOA 1KB5H 1KIPB 5EPMA 3VMNA 4ENED 1AFVL 1F2XK 1G7LA 1EO7A 4NYLB 3QCVH 4YHIB 4RZCB 4CMMA 5T1DH 3V5HB 4F7MB 3PP3K 2VABB 4YK4C 4PLKC 3GIVB 1QVOA 4QRUA 1SY6A 3VG0H 4GAYA 4PD4K 5TDPB 5HHPA 5F96L 2FJHA 3BN9C 3EYVB 4KRLB 3ZE0E 3V9FA 4U7SA 5GGRY 4G6ML 4PV8B 1D6VL 4JR9L 3FKUS 3NOIA 1XMWA 2DL2A 4WNQA 5I66B 5DHYA 5IB4A 3PWVA 3WFCL 5JNYA 4ZFFB 1RUAH 1MCNA 3TYFA 3O3UN 4LBEA 5CIPH 1KN2H 4C56E 4HUXA 4NQED 1NUNB 1DN0A 1OCWH 4M7JL 1CU4H 4CU8A 3U0PB 3WIHL 4LRIA 4D2NA 2HRPH 1EIBA 5B4MD 1ZV5A 5D7JC 1HH9B 3QIBB 4NP4H 4OAWB 5GGSB 1P5VA 3HS0B 3IU3B 4FQ2L 1LDSA 3G08B 2Q1EA 1NFDA 4J6RL 2VKXA 3T0EC 2NZ9D 2C4FT 1IQDB 5EC2B 3EYFA 1FP5A 1T3FB 2R2EA 4NWTH 4PJDE 1FPTH 2EYTB 5TQ0H 4MVBC 3FL7A 3U9PH 3MRHB 1EV2E 1RJZA 4BSWB 1W2KT 4ZYKA 1WZLA 5DD6A 2BRRH 3HB3D 1OGTA 4RBPK 5ILTL 4PRPE 3G5XA 5A3ID 5I1LB 4ALAL 3NGBC 1PFCA 5IEKB 1RI8A 2HAZA 4WU5A 3ARGB 2IAMB 1CFQB 5CD5C 1LWRA 5F88A 1CXLA 1OAUH 2W07A 1VGKB 2BSRA 4QXUH 2QHRH 3DO7B 4PJHA 1HH6B 3OKLB 2PR4L 4YFLI 2YMXL 3AROA 4FFYL 4XI5D 3T65A 1PSKH 4K3HA 3MLSH 1JFQL 5FYKU 1D9KB 1I3GH 4P9HC 1SYVB 1AR2A 1QFOA 5DUBA 1T1YA 4KTEL 3MLZL 4GQPH 4L8SA 1F4YL 1QOKA 4B5EA 2LVEA 2Q7YA 1CLZL 3MRDA 2VDPH 5IOPB 1AXTL 4Y8AA 5F89B 4RGNC 4JVUA 3RZCC 2I27N 4JQXA 1OAKL 1T21B 4WW2C 3M1BA 5AZ2H 1TJGL 3PQYE 4F9PA 3RUGB 1CGTA 3MMEB 4GW4B 3T1FB 2IH1A 4OD1H 2BNQA 2BXZA 1OQXA 3S8WA 4KH2A 2GK2A 3SQOL 1DBKH 4JHWH 5CGYD 1P1ZA 4ZUTA 4M8QA 4M9PA 3CUPB 5IM7B 1QNZH 4HKXB 3IDGA 4JY6B 4XP9H 4UBDD 4N0UB 5CIPA 5MENB 4WY7L 1AR1C 5D1QC 2Z31D 1ZHNB 2GSGB 2EDNA 4YXHL 3VCLB 1J12A 1YYMH 4OFVA 4OKDA 5EU5A 4DGVH 4NN6B 2BVQA 1ADQH 1HWGB 1U3HD 4QHKJ 3ZSSA 5DK2A 1RZKC 4G8EB 1FGVH 1YQVH 5FHBH 1LO5A 4C58B 3EGSB 5MEOB 3O4LE 4KFZC 5JW4N 2RJMA 3SEPA 1KCLA 1RU9L 1U6AL 4GAFB 3R8BB 2GFBA 4ZS7L 4ZDHA 3C8KB 3O2VH 1CXKA 1MQKH 5JQHC 1B0RA 3P4LA 1E4XI 2N7BA 3RWIB 5KSAB 3MYZA 5DWUH 5HD8D 5D7KE 1ZA6B 1VFBB 3OKMB 1EO5A 3ZLQC 3NIDF 1RIVH 5GJSH 4GG8B 1BQLL 1BOGA 4BH7B 4KPHL 2BY3A 1WC7B 3WEXB 2Z4QA 3AS0A 3PWUB 4YK4B 4KKNA 1DLFH 5GGQH 1ITCA 5IW6A 3ZTNL 5KOMC 2P46B 3P40A 5I18H 1BWMA 4MXWH 1EEQA 2A83B 4P9ML 1RSFA 4GW1B 4EN3D 2NLJA 4ELME 2ZJSL 4P4RA 1DVFA 3SDAC 3MNVB 4D9RD 4KXZH 5JR1L 4Y19D 4LLWB 4C4KO 5GHWH 2V17H 2DTSA 1MH5B 2WLYA 2ZCKH 4POZC 4YHLH 2V7NA 1GPOL 2EDKA 1IGJA 4R90H 4JO4L 2HFGL 1KTDB 3IDYC 1BMGA 2D4DA 3KYOA 3RVTD 3ZSTA 1KLUA 2I9TB 4Y4FA 3LB6D 1SJVA 1J0YA 1F90L 5E8OB 4V1DD 4FQXA 5D7JB 2MTPA 3MJ8B 2K7QA 2OZ4H 5HHXH 4C57C 3QO0A 3CFIC 3DVFA 2F8XC 4P2OD 5E5RB 4X7TB 3MLTB 1G1CA 1UM4H 3T0EB 3L3IA 4PV9B 5CHNA 2GJZA 1H5BC 3MRIA 3BPOC 4JGUA 4O00A 1V7ML 1PKQA 5JPMA 3NIGE 5A1AA 1GIGL 1DQTA 3CH1A 4XC1H 3PWPA 1DQQA 1YPZB 1FFOA 3SGKC 2WUCH 2VLME 1NGWB 5E6IB 4PBWD 4TTDD 1Z9OA 2D9QB 3H0TB 1DBJH 2HFFA 1AJ7H 5IBLD 5LXGH 2OJZL 4DKAA 5C0EA 3NGBB 4BK4A 1E6JH 5IJVA 4PJ9C 4XT1C 3GJEB 2OJEA 1C16B 2AJ3B 4Q6IA 4LCWE 5EO0B 5GISL 4PJGF 4H1LH 2AGJL 3B6SB 4LDLB 4NQVA 1GZPB 4NO0B 2FLRT 2VUOA 2XT1B 4AIXA 3DMMC 4NQCB 3OJDA 2AKRA 4R96A 1U58A 2NR6D 3D3VE 2NTSP 4WRLA 1JF5A 4X6FB 3O2DA 5EOCL 1A6WL 4PGDA 3VXOB 1MCWM 1IEHA 4KK9D 1BM3H 1N26A 4NPYB 2PCPA 3VI4F 32C2A 2VAAA 2XZAH 3HI6H 4RGNB 4XPGL 2ICWA 1NMBL 1B0GB 3RZCB 4WW2B 5C08E 1ZLWH 2FR4A 1F02I 4JRXD 2HKFL 4S2SB 1FVCA 1H8NA 4IRSD 4PTUA 3CIQA 4O2CA 4QCIB 4OSUL 3CFDA 3X14B 1CVSC 1NBYA 4EQ3A 4LSRH 3H42H 1OQOA 4PB9L 5CEZH 4QXGH 2Y36L 3BIAX 4MCYA 3MV9A 4I77L 1WWBX 4NZTL 4XPAL 1HKFA 4PJIA 4MWFB 3VFGH 1NMAH 5JUEH 3WL9A 5D1QB 1CVRA 5DMKB 1CD1A 2FZ3B 3JBG7 5I17B 1HNGA 2HLFC 2L4OA 4ZO9A 4ODVH 3LRSA 3C2SA 3MCLL 3DYPA 1AGDB 1MLBA 3QWOA 4XNUL 2ESVE 1T04B 5IW3A 3ALPA 1VADB 3O2WH 1S9YA 4MLIA 2W65B 2I25N 4FFWC 1FL5B 2Y5EA 3PHQB 3PQYD 1WZ1L 3HZMB 3C2AL 1S9VA 4OUUB 4RQQB 3ELAT 4H5SA 5EZLB 5E8PA 3MBEA 1EPFA 2GCYA 1N2RA 1ZVSB 4G9FA 4NRZB 4FFVD 5MHSE 4LSSH 4TSCL 1PJ9A 5C70A 2MKWA 3TPUB 3PNWB 4L4TA 3DX8B 4DFHA 5F21B 1GRWA 4ZO7A 3HE7D 2OI9C 4K94H 1NBQA 5MI0C 3OGOE 4CNIA 5TGBA 4NOFA 1R3KA 3QIWD 5KVFL 4CDGC 3BPCB 3SDAB 4TRPL 1GGTA 2J7LA 5D6DC 3QUXD 4YGVB 1BZ9B 3TT3L 4I2XA 3MLRH 4M1CC 4ZUUB 5I1GH 1I7ZB 3NH7H 3ULVE 3TV3L 3IDYB 1EZVX 4HX1B 3QFJB 2VO5A 3QQ4A 4QRSA 3HPLA 1X5IA 2HKHL 2DJ4A 2CIKB 3MA7A 4HKJA 1KCRL 1IKFL 5F9OH 1N6QL 1KJVB 5KVGL 4JB9L 4UOW0 1NAKL 5C0GB 4MNHA 4P5MB 2OXGA 2IPKB 1INDL 2UWEF 3LKNA 3TJEL 3MV8E 3KYNA 4M1DL 4KZEH 1CE6B 5L9DH 1LK3H 3I9GL 4MMXC 4GG6E 1H5BB 4NNPL 3BPOB 3V4PL 4AYFA 5FO8B 2CLZA 3I85A 4HGWA 1NLBH 1I3UA 1ZE3C 5F8QC 3FOLB 5C0AB 4F8TA 2IBZY 1DANU 4KKLC 4RX4D 1F4WH 1U8MA 3TPKA 3G04A 3HG1E 1ZWIA 5IVXA 1OM3L 2HFEB 3S36H 3LV3A 1KEGH 2B4CH 2CKBL 1EEYB 1UZ8B 1EDQA 4MNGA 2BVPA 5I19H 2YKLL 4G43B 3BQUA 3B9KD 2IGFH 1LEGA 1AD0A 4F7PA 3TO4D 4PJ9B 3PL6C 5IVZA 3IU4H 3G6JF 5C0CA 3FB7A 3DRQB 5CJXC 1MIML 1T1WB 5IGXL 3BZEA 4WFHE 5F8RC 4DOHB 4R9HA 4Y88A 4B41A 1KJ2A 1YNLL 1DUZB 5L7XH 3BYYA 3DMMB 1U8JB 2FO4B 5GRJL 5SWSB 3GJFB 3LKQB 4I8DA 5FGCB 1F3DJ 1MCOL 1CS6A 2CLVB 1MJ8H 4JM4H 2NTFA 4HXBL 4XNMB 1MY7A 4O58L 3RY5A 3QSKB 3GHBL 1IGIH 4M8VA 5ERWA 5LAXB 3DV6A 4PYGA 1AGFA 3RFZC 1PZ5B 1N64H 3N9GL 2AI0L 3BZ4A 4U6HA 5A2IH 4FQHB 4WU7A 3SKMA 3EFFB 4QTIH 2XN9E 3F7VB 5DJZA 3CSYA 3JUYA 4WI2A 1QBAA 4RGOL 5ADPL 2IANB 2PO6D 4XMKH 3GSXB 5IK3A 3QDJD 2DQGH 4IRJC 1G9MH 4Z76A 3U0TB 5AWNL 5I1JL 3EJYC 3H8NA 3IAQA 2EKJA 5E03A 4OZFG 4GKZA 4YO0B 1BVKA 2VDQH 3SDCD 4HWUA 3SCMA 1W0WA 1FNSH 3K2UL 4J4PD 4MA1C 1I4FB 2CXKA 3T08A 2DTML 1VEOA 3LCYA 2I07B 2DDQH 4CMHC 1BP3B 1K8DA 4X6CB 1XH3B 3CLFH 3I3BA 2O5ZH 3NFSH 2JE8A 2FJFB 3STBA 1SJEB 3F5WA 2CMRL 4JRYB 2ZP0T 4HQQL 1LP9E 3TVMD 3FB6A 2E5EA 3H3PH 2CDGA 4QHKI 1INEL 3QG7H 5DEGB 5E8EB 2FWOB 3CX2A 3ESUF 1EO8L 1A7PL 1AFVH 5GGVL 4Z7NF 1H0DA 1A6VL 1QBMH 3E6FA 3L1OH 4G8FB 1DE4A 5H2BA 5DJ0B 1WWCA 3T0AA 2D2OA 3MACL 5D9SB 3OXSB 3TT1H 5HY9B 4N9GB 4M43H 1DDHB 1YJDH 2OI9B 2Y7QA 4J3OC 5MI0B 1FVDA 4L8BB 5T5FH 1D6VH 1OAQL 4MS8C 2H2PD 1Q9WA 3UPRB 3IDMA 1K2DA 5DRXB 3M17A 3WFCH 3VWKD 1DL7L 5J13C 5ITFA 4YDJA 3QUZC 2DQEL 2QJDA 2R2HA 2X7LB 1ZLSH 4M7LH 4O51B 2AS5M 4GUPB 4NKIL 5F6IC 3I6KB 2WSKA 2RFXB 4Z7UA 1MNUL 1N5AB 2WBJA 1TVHB 1ZHKB 5DVKA 1BOYA 3OR6B 5JOFB 4AIOA 1S5HB 5B38B 4PRAB 3FQUA 3EFDL 1F4HA 4CADA 4YHZL 2NXZD 4BYHA 4PJ8A 3KYKH 2Z91A 3WFBL 3D1MC 4FQ2H 1JWSA 1M4KA 3GSNL 4JQIL 1MVUA 1XGRA 5HYJB 3EDEA 2VITA 3IFOB 3JWDC 4J6RH 4U6XA 3RVXD 4LAJH 1MFCH 4X4ZA 1JTOA 3TNMB 4RWYL 4MAYA 1PYWA 3C6SA 1JRHL 4JFFD 3SGDI 4X6BA 4NNXA 3MRRA 4HWBA 3PP3H 3WS3A 4JAMA 1X5HA 2PYFB 3MRFB 1NL0L 3EYUL 5F1IB 2GJ6B 3QEQE 3QH3A 3RVVC 4FXGA 4D0CA 2XG4A 2GY5A 4YR6B 5HHOE 4OZIF 1OP9A 4W4OC 1WEJH 2BC4A 1I8MB 3J7HA 2A73A 3GSOA 4LF3A 5CJBA 5HGAA 4ALAH 3DV4B 4Z7VF 3P4OA 5D2LB 1QO3B 6FABH 5ESAB 2IPTH 1XF3B 1JK8B 3DURA 4OGXL 4ELKA 3IDJA 1KYOJ 2AQ3A 1JPTL 3MV7A 1MF2L 2LE9A 1NDMA 4MCZB 3NMEA 1YN6A 1JF1B 1R6VA 1MUJB 1FV1A 4MDJB 2YMXH 4FFYH 3SDXE 1U8IA 3WXWL 3IDNB 4QWWD 3WE6B 1DQLL 5ICXA 1YY8A 1LE9B 4G42B 4OZHA 3W0WB 5JW4Q 4MD4A 5DEFB 3ECBA 5BS0D 2OSLB 5EOTB 2EEDA 1R3HA 3MLZH 3ZE0F 5DD1L 4EEEA 3SE9L 2AEPH 1F4YH 5T1LA 4JJ5B 2GK0B 1CLZH 3AS3A 4L9DA 1SBBA 4NQUA 1AXTH 2BOCA 5BW7C 4HDIB 3MRPA 1GYAA 5ANMB 1OAKH 1UJ3A 1NDGA 3KXFB 3WJJA 5DO2D 1TJGH 3RL2A 3QXAA 5EUOB 4EI6B 1LE5B 5HYIA 1T4KB 3DX9A 1P7KB 3NCJH 4LMQE 2G60L 4GFTB 4JFEA 4LPWA 4JDTL 2VLKD 2D3VA 3BDXA 2PYEA 3SQOH 3L9RB 3RIFF 1OF2B 3SBWC 5E2TL 2PW1A 4G9DB 3VGAC 5CKAA 2EYSB 4NDMA 5CZVL 3HZVA 4J8RA 2YPLB 2HVKB 3QFDB 2VLRB 4AK1A 4IRJB 4WY7H 5ACLA 2UY7A 4DGIL 4RBPH 2NW3A 1OSPL 3RTQA 4LLVB 4YXHH 1KIRB 3WIHA 4BELD 3UTQA 4CVZB 3D39B 5DMJB 3W82A 4MA1B 1A7QH 4X5WA 4XXDA 4YHPB 1UEYA 1U42A 2A6KB 4CMHB 1C7SA 4GQ9L 2LV4A 5CUSH 1T03H 4R4FH 4PJDF 1YYLL 2OMBA 4KUZL 5L2JB 2AAVA 4ZS7H 5FDYA 4MNQD 1S5IL 3L3GA 4F57H 1IRAY 1Q94B 2FDBP 2G75B 3NZ8A 1I8KA 5F7DA 3MCKA 3MROA 3BZDA 4PRNA 4YDVB 5IB3B 4K55A 3VXUB 3BEWB 3N1MC 1K4CA 4WTXA 4ZQKB 5BRZE 2NYYD 5DYOB 5D2NA 4RCAA 4CN4A 1BQLH 5T1MA 2DKMA 2XWTB 3IDUA 1LMKA 4XCNA 3QQ3B 4HIIA 4PPTA 1D5XA 4OLEA 4JO1L 1RVFH 1ZT4A 3DIFB 3QDGA 3VXME 1GGYA 5C6WH 1C12B 2DIBA 3ZTNH 1NGYB 2OXHA 4YIQB 3KJ4C 2O5XH 1NCUA 4JPIB 5CAYB 4QRPD 4YQXL 2ZJSH 5DQ9B 2UYLA 2Q76A 3O3AA 1CT8B 5JR1H 2IALB 1TXKA 1BHGA 4OB5L 4C4KT 4U1JB 5IF0A 1TQCC 1MRFL 5J13B 2CRMA 3QUZB 5J6HA 4NZUL 1NFIA 1KNOB 3B9EA 4XNYL 5EWIL 3T4AB 5F6IB 5C09B 3PXJA 2HFGH 4JO4H 1JL8A 5D7LD 2IQ9H 3MYJB 1SEBA 3EDJA 1N4XL 4PY7A 3DI2B 2X4TB 2NY1C 2GYSA 3K1KC 1KIQB 2VZVA 1F90H 3ZT6A 3GM8A 1J1OH 4ZNCD 2EIDA 3MREA 4LSVH 5F1SA 2Q86A 4WUKL 4KXZI 5HDQL 2E6PA 5GIRB 5IJKA 1SJXA 4KDWA 4U4BA 4GXUN 3ZDXE 1G0DA 3TNNA 3BP5A 1YECL 4Q9QL 1BPVA 4XXCA 4P2YA 5LGJA 1NGQH 1GIGH 5HPMB 5JOPD 1TDQA 1WT5A 3QNYB 2PXYA 2VC2L 1LO2L 5F3BA 3W39B 3Q0HA 2BNUA 2NY4D 1JTPA 4H8WH 4DVRH 4P57B 2HVJB 3ZKQD 3HMXL 2W59A 4GRMA 5BZWB 1YN7A 1GZQA 1U91A 4NHUA 1KT2B 4RAVA 2OJZH 1BAFL 2Y1VA 2HT4D 4P2QD 1UC6A 3FRPG 1OTTD 2W38A 2NNAA 2HTLC 1RZGA 1A6ZA 5GISH 4JFDB 2AGJH 5DRNA 5FKPB 3H9SA 4IMLA 1OW0C 3WDIA 1Z9LA 1QA9A 1JNLL 1YDPA 3ARBA 2OBGA 3V52L 5IB1B 3DUUA 1W72L 2OR9L 3BD4A 3GMMB 5JOEA 1BZ7B 1CFNA 1M6OB 1RZ8B 2J5LC 2QL1A 1OWRM 5K93A 3S7GA 4V2BA 1S7RA 4AEHL 4ELMF 4KTDL 2IPUG 1YC7A 1MRCH 2EC9U 5F71A 1DUYA 4DK6A 4MJID 4LEXL 3ULUC 2B2XH 1NMBH 1ZK9A 1BD2D 4JY4B 1GC1C 4BM7A 4H25B 5DGQA 1BFTA 4MNQA 5DD3L 2O5YL 1LVEA 4WW1A 4ODTL 1T6WA 1XF2B 4NM8H 5HI5D 3QHTC 4U1IA 3BGMA 3FAWA 3I6LE 3RDTC 3MFGB 2P24B 1S8DB 1M7IB 3MV01 4PB9H 5D1XA 5DMIL 1JGEB 3VGAB 4LCCA 4OT1H 4HPYL 4I77H 4NZTH 4XPAH 1T22B 4X99B 2WP3O 2FJGA 3MRMB 3DX6B 3DUSB 1JPFB 2V5SA 3O3BB 2IC2A 2BXYA 3R06A 5BV7C 1RUQH 2ZG3A 3OR7A 1MLCB 2D31A 4XVJL 2C1PA 4WCYL 3GI9H 5JHDB 4G80A 3CFJA 5I73C 1OGAD 3ARFC 4XVTL 3QUKB 4N0FB 5I30L 4EI5D 2DD8L 5HSFA 3MCLH 5T33H 4JFOB 5EG6C 3PV6A 5I74C 3MRGB 4E0RB 4LSUH 4HIJA 5EO1A 3DTXA 3NIGF 4TUOB 1GAFL 1EUTA 1NBZA 5C0DA 1WZ1H 2BNRD 5FUZL 5CSZB 3X3FH 2SEBA 4YEFA 5EO9A 2XPGB 1FDLL 3RY6C 2G5BA 3VRJB 4J3WA 3HC0A 4ONHB 1IGYB 4TSCH 1HKLL 3SOBL 3CPLB 5F7KC 1MI5B 3ZKSD 4UQ3B 1AXSA 2PETA 2YC1A 3AAZA 5EUKA 4ZS6D 3TO2A 2X4NA 1BFOA 3GRWH 4QHLB 5EU6A 4OCRL 2YPVL 3VD5A 4Y16A 4N0YL 43C9A 4LLYB 1EHNA 4UILL 5SX4H 3KJ4B 3T0VA 3QUML 4RAHA 1EAPA 2WMPA 3DVGB 4H1LG 5KVFH 43CAA 2F8VA 2A9NL 4KK5D 5CEXA 1UB6B 2GITB 4XBGB 5D70L 5FM5M 3TT3H 2HRLA 4L3EB 4TULL 3ARZA 2FL5B 4MHHI 1CD0A 4ZAKC 2ZOLA 4W81A 3GJFK 2GUOA 5JDSB 2ITCA 3TV3H 3DXAD 3P0VH 5DC0A 3OG4B 4Q2ZB 2X4PA 2NY1B 1QR1A 1YEJL 2XYCA 3PABB 1N6QH 3BXNB 5KVGH 1NAKH 4XCYB 1VHPA 1G6RB 1INDH 2NX5D 3BZFA 4WEBH 3TJEH 3RWGA 1JGDB 5D7SL 4HUNB 3EYOA 4M1DH 1J87A 4S1SL 3HLAB 4X83A 1IQWL 4O02L 1FZKB 3FT2B 1EMTH 1UACL 2C1OA 4JFZL 2LAGB 3VH8A 3D0LA 3V4PH 3G6AA 3QDHA 5JW5B 5J6GA 2UZIL 3MOBH 1R5IA 1HHGB 4NBXB 4Z77A 7CGTA 3HNVH 1A2YA 1A1NB 1CICD 5IMOB 4NO3A 1IAIH 2VH5L 3RBGA 2GSIB 2XRAL 5IVOA 2C5DC 1A8JH 4I0PC 5IQ9B 1MHCB 3QRGH 3RWFA 1U92A 4EDWL 5INCB 2QKIB 1JZ4A 4Y1AE 2JELL 4PTTB 4NQDB 4M00A 1KCVL 5CBAA 4FRWA 1A21A 5C2BH 4RMVA 4OGAD 3BW9A 3TLRA 4LHUB 1T0NB 4HIEA 1WZMA 2VN7A 4X4XB 4ODUA 4M5ZL 5BCAA 3O8XD 1KFAH 1XGPB 5IKCA 5GRJH 2ADJA 1MCOH 1N3NB 5KW9L 4UMGA 1IGTB 1K6QL 4PB0L 2J5LB 4OZ4B 4DUXA 1MVFA 3VRIA 4I48A 2ZNWA 3WIIL 4DW2L 5J57B 1U3JA 1ZT1A 4O58H 5KAQF 4WI7A 5FA3A 1QD0A 1TCMA 4LP4A 3GHBH 4I5BB 2J8UE 4NO5B 3CFEB 1A6AA 3L3JA 4HHAB 2J3SA 1M05A 1AXIB 3N9GH 3FB8A 3K0WA 1TMCB 5DK3A 4Y0GA 1F8TL 1WF5A 4OCWL 2RCSL 3RWCB 3SJVA 3V8CA 4F7EA 3ARUA 1JYVA 2WAHA 4M1GL 3ULVF 4LRIC 4XZUA 3LN4A 4RGOH 1C5CL 5ADPH 1ZLUK 5HVFB 1FLRL 5FDWA 3RDTB 5E56A 3ULVL 5JXAL 4E42A 3B5HA 4JEGB 2D7NA 5I1JH 3H9HB 4NIKB 3RNKA 5EZOL 4ZPVB 5BV7B 3WFHB 4JZNA 2YA1A 2JJUA 3K2UH 4PRHA 1F11A 3RGVC 2HG5B 2DTMH 1VSCA 2A6DA 3LHPL 5I73B 4QHMB 1KEML 3ARFB 1S9XB 4MB3A 3CDGB 3QNZB 3I2CL 1LO3L 1HXYA 1Z0NA 4YGAB 2C7UA 1NKOA 5I74B 4ZPTA 5DS8A 4G7YL 4PP2B 5FECB 1RUKL 1INEH 4L8CB 2R4RL 5IBUB 5E5MA 2UWEA 2EDRA 2R29L 5IBTL 1EO8H 5DSCB 1NEUA 2AV1A 1VENA 4NJ9H 5GGVH 1AKJB 4ZFOB 1A6VH 1QRNE 4RDQG 1FVEA 1HQ4B 2H26A 4CVXA 3C87A 1CXFA 3I6GA 3I75B 3RRQA 3IVKB 2R1YA 3W11D 3JVGA 3QIBD 1GL4B 3T77B 4YHOH 4B0MM 2CKBA 3P11H 1OAZH 1ORQA 5ENWB 5KS9B 2YOCA 1F45A 1A1MB 5L6YH 3EUUA 1IM9A 3OL2A 3NABL 3MNWA 2NPLX 1OTSC 4NQCE 3AS2A 1IE5A 1X6NA 2OTWB 4UDTA 5ADOL 1IL1A 2W91A 4UU9A 4JKLA 1IM3B 3B43A 4L8SC 4NKIH 3MOAL 3RU8L 3VXSA 3G6JA 3KPRE 4ZAKB 1MNUH 4U6YA 3QR2A 1EHXA 4JQXC 2VIRA 3KPMB 3MRBB 5HVHC 4ZMAT 4F9PC 3ROOA 5FK9B 2EH8L 3UAJD 2UZXB 5F9JB 4LLQB 4YHZH 5FUCE 2VLJE 3MPCA 4FZ8L 3MODL 1IC5H 1E4KA 3AM8A 3ARGD 3B3IB 2IAMD 4QYOA 4JQIH 3S4SG 4ZG1A 3BEVA 3C5SB 2DRUA 4U1GC 5BOPA 2BOBA 4NT6A 5KSVB 1JRHH 1X5LA 1QYGL 1FFRA 2VISA 3VXRB 1U8PA 4FNLL 5MP6L 1S3KL 2W0FB 1D9KD 3VD3A 3WKML 3B83A 2X4OB 5FO7A 4AENB 5CZXC 3EYUH 5D2LF 3UJIL 2BZDA 4HGMA 4F8QA 1YMHB 3T0XA 4RAUB 4R7DB 1JGVL 2BSSB 1GXEA 1SM3H 3G6DH 4I1NB 3PGFL 4YDKL 4I0PB 1ULVA 1LP9F 4Z78A 1X7QA 5J1AA 4MJ5A 2R1XA 4OLUL 4IJ3C 1EBPA 3EJZD 5E8NA 4Z5RB 1B6UA 3O3DB 4YUEH 3FFDA 5EPMB 4F9LA 4OGXH 1G7LB 3BDYH 3OGCA 3R4DA 4HH9A 1MF2H 2O61A 4CMMB 5B4MC 2MWCA 3AMLA 1UWGH 4JGMA 5C07E 1RUML 4HXAL 4XP5L 1B2WL 1B90A 1QSVA 2V6HA 5MEND 4PIRF 1LILA 1QVOB 3PE9A 4QRUB 3UTPE 1DQLH 1IEAA 4LU5H 4GAYB 5HHPB 1JGLH 2HT2D 4ONFL 2FJHB 1TITA 3ULSA 2EDFA 4KKBD 4KVCL 2EDJA 4BUHA 1CCZA 2AERT 1YMMA 3SE9H 1MCPL 1DVFC 4JM2F 3QEHA 3BJLA 4N5ED 4NHCL 4WNQB 4D8PA 5DHYB 5IB4B 3A67L 4GMSL 3PWVB 4OFPA 5JNYB 1JV5A 2MHAA 3TYFB 4LBEB 4NNYA 1HHJA 4OD3L 1TETL 3DX7A 1FIEA 4HUXB 4JDTH 3UZEA 1DN0B 3HB3C 5E2TH 5KSAD 1MJJA 3VFWA 4E41A 4KK6C 5C0BA 4QKXB 1BFSA 5A3IC 4FQXC 4UIKL 3QB7C 5AUMA 2YZ1A 2VXQL 3E0GA 5C0JA 4PLKD 3ZT5A 1NFDB 1I1AA 2IADA 4ISVA 4MLSA 3BN9D 4PBVC 1JHKL 3CZJA 2P49B 1HYRC 4YPJA 4IM8A 1IAOA 3EYFB 4GQ9H 2R2EB 3GSNA 1U8KA 4J3VA 4LVHC 3B2VH 1S5IH 1RJZB 3OKKA 2JJWA 2R0ZH 4HLZH 4JREC 4NWUH 2ZUSA 3GMOA 2FIKA 4ZYKB 1UWEL 4TUKH 5DD6B 2BCKA 1HEZA 1OGTB 5GSRA 1FNEA 2ILLA 5DJDA 5E7BA 5JDJA 1AO7A 3G5XB 4XPTL 3EYSL 3F7YA 4FQLL 4WU5B 4O4YL 4JHBA 5F88B 4JO1H 3QZWG 4NC2B 4Q6IC 1ZOXA 2FB4H 1O7SA 4LFHD 5D7JD 2BSRB 5CGYC 1AQKL 1VFMA 2J2ZA 4Y5VA 1OB1A 1YY9C 3Q1SL 4PJHB 1T1XA 1RY7B 3QHZH 1Q9OA 1MFDL 2R2BA 4OZIA 1QHOA 5I0DA 4UBDC 4DWHA 1T0PB 2CJUL 4MQSB 3T65B 3SDXF 3EOTH 2JJTA 3T0ED 4OB5H 3KS0J 1AP2A 4Z7VA 1HXMA 2DM7A 4Y5YA 5DUBB 5I8OL 2DM3A 3VD4A 3L5IA 1T1YB 1MRFH 1UENA 2P5WE 1SYSA 2MQ3A 3BMWA 3HC4H 3H9YA 4NZUH 5GZND 5JO5A 1U2CA 4XNYH 3L3HA 4FQIL 4L8SB 5EWIH 5L88L 3WSQH 2Q7YB 5FYJE 4MVBD 3MRDB 1E4WL 1BIHA 4JKWA 4EOWL 2ZCHH 1N4XH 3CVHL 5E6ID 3QEGL 3M1BB 1NGPL 5HVHB 5EU7E 4LVEA 4GBXA 1CDJA 4HUKB 2IH1B 5K9JL 2BNQB 4QRQA 1TENA 1P1ZB 1T2QH 4ZUTB 4M8QB 4ACPA 4WO4D 5CD5D 1ORSA 4WUKH 3IDGB 5HDQH 3U7AA 4DVBA 2FGZA 3OJ2C 5CIPB 2XACC 4JRWA 2EH7H 2QBWA 3G9VA 4KHXH 4U1GB 4JGJA 1YECH 3TH2T 1AD9A 1VESA 4NSKA 1X4YA 4GRLA 2CO6B 4X9HA 3S97C 4FQQA 1TZGL 4M61A 1U8OA 5EU5B 4IOIA 4C56A 9CGTA 2BVQB 1IC7H 4PUBH 5C0RL 4HFUL 1LO4L 5DK2B 2VC2H 1BBDH 1LO2H 3UO1L 1LO5B 3VA2C 3ESVF 1JZ6A 3HMXH 4GAGH 3LS5H 5GPRA 5H35A 2GFBB 4ZDHB 4PJEE 5LBSL 4RGND 2AVGA 4NJAL 1HK6A 1BAFH 2WW8A 1B0RB 1A5FL 4QF1A 1TNMA 3MBEC 4XRCA 4IJ3B 5A43C 4NFDA 4P5TA 3DROA 4PLNC 2KPNA 4P3DA 1BOGB 4IIQA 5DJ2A 2Z4QB 1I85A 4PJDA 2DF3A 4IBLT 1QP1A 1JHLH 3ZDYE 1VFAA 1W72H 3QO1A 5F1OB 5IW6B 1AR1D 3GSUA 2Y6SC 5J1TC 5D1QD 5FOJA 1MEXL 4JN2A 3NCYS 4C59B 1N59A 2XQBL 3IJYA 2NLJB 3FONA 4P4RB 1DVFB 4PRPA 5ISZE 1J8HE 1H8SA 4KTDH 35C8H 3BE1H 3EOAA 4FHBD 1BREA 3HI5H 3WHE1 1WITA 5FYLL 5EBWA 1FNGA 3NN8A 2V7NB 4BSVA 5DD3H 2QQLL 1IGJB 2O5YH 1LQSR 4P4KA 5SWZE 1NEZA 4M6OL 4AJ0A 3N1GC 2JK5A 3KYOB 4WGWB 5AYUL 1O0VA 1MREL 5IBLC 1KLUB 3UTTE 4Y4FB 5HPOA 5DMIH 2WWKO 2VXVH 1UKQA 2WP3T 4FQXB 1YEIL 5I2IA 5ACZA 3QO0B 1T5WA 2GTZA 3D0VA 3T2NL 1UH2A 4XVJH 4WCYH 1HSBA 1GCFA 4RWHA 3ARED 3I3EA 2XKNA 3O6FA 2Q8BH 2DQTH 4XVTH 4KQ4H 3IT8D 5I30H 2DD8H 2Q20A 3L3IB 2M26A 5CHNB 2GJZB 3MRIB 4GXVH 4UV7L 1ACYL 1PKQB 3SDAD 5JPMB 3CH1B 4LVHB 3PWPB 3OX8A 4M4RA 1DQQB 3W2DH 1FFOB 4OV6F 3RWJA 2DQJH 5FUZH 4HJ0C 4POZD 3QJFA 5DFWH 4JREB 1FDLH 4N68A 2HFFB 2OR7A 2MCPL 3C8HA 3QFJD 1HKLH 5C0EB 2A77L 4IRSC 5IJVB 2ATKA 3LQAC 1MCFA 2OJEB 4YH6A 4Q6IB 2JB5L 4WFFD 3JWOL 3HMXA 2YPVH 4HIHA 2B20A 4N0YH 4ONGL 4U33A 4WO4A 3QUMH 3PDOA 4ZD3L 4NQVB 3HR5A 4HEME 2BVTA 3O4LA 2RHEA 4Z7WF 3NACL 2WK2A 3OJDB 2AKRB 4R96B 1U58B 5D70H 1FORL 2B39A 4TULH 1DEEA 4PGDB 2OTPA 5FKAA 3ZE1F 3O6ML 5C0AD 3WXVL 1BFVL 1BJ1J 4M7ZB 2PCPB 3DGGA 5H37H 1OP3K 32C2B 1W72A 2VAAB 5ANME 4WI8A 2ICWB 4K94C 4JZOA 1KJ3L 4C55A 1YEJH 1PGRB 5EUOE 2FR4B 5DT1L 5HDBE 1FVCB 4PTUB 5SX4I 1P84J 4O2CB 3SGJA 3CFDB 1JBJA 4OCSH 1NBYB 2VDNL 3RIAK 4OCMC 4PJ9D 4ELMA 4KC3B 5ALBL 1NSNL 4MCYB 5D7SH 3MV9B 4S1SH 3HNSH 4PJIB 3F12A 1IQWH 4O02H 1KN4L 3WHE0 1RPQA 3SCMC 3WL9B 1UACH 4UV4L 3HE7C 1CD1B 3DMMD 2PTVA 1UKTA 4KI5C 5SWSD 3LKPA 4M5YL 1A6PA 3LRSB 3QWOB 1MLBB 3QXDA 3DECA 4CGTA 3S9DB 2Q3AA 2AJUL 5E2VL 5IFJA 3H6JA 2XRAH 1S9YB 2VDKL 4EDWH 2NY3C 1F4XL 4K7PH 4WWKA 2DQFA 1S9VB 2CK0L 4L5FH 3V0VA 4H5SB 5EBGA 3ZKXC 1C5BL 2XTLA 4Z95H 5E8PB 3MBEB 2GCYB 1KCVH 1N2RB 4G9FB 4JANA 3UX9B 2W9LA 1NCDL 4HAFA 4N8CL 1IBGL 5FOBA 2IAND 3GJFH 4L4TB 2WWMC 1D5IL 2ORBL 3U9UA 5I1CL 3WCYA 2B4CC 4G7VL 1KOAA 1IAII 3PF2A 4PB0H 3AREA 3RIAF 4CNIB 5TGBB 1R3KB 5F1KC 4DW2H 3LVEA 2HLFD 1HYSC 3DHMA 5DVMA 2XOTA 3C5ZA 4K2UH 1NCNA 4NRXA 1I7RA 2BY0A 1P4BL 4I2XB 1S7QA 4JRYD 3L3KA 3ZKND 5E2WL 5AG8A 3QUMA 2ZSVA 1F8TH 2RCSH 3OJMB 5MEQA 3QBTB 2DMKA 4LCWA 4FFWD 2WBJC 4M1GH 1C1EL 1VA9A 1WFTA 3N06B 3UBXG 4QRSB 1C5CH 3QQ4B 3HPLB 1FLRH 3G5ZA 3ULVH 3BP6A 3MA7B 4HKJB 2CQVA 5JXAH 1FFPA 1IC1A 1VEMA 1WIPA 4PJ8C 3SO5A 2V2TA 3D25A 3GFUA 4NKDA 1P7HL 5IP4A 3JV4A 1E6OL 3C8DA 3D3VA 4MNHB 5EZOH 1U36A 5E08H 4M6AA 3MC0A 1A22B 5HGDA 3LKNB 3LHPH 5I1DA 3KYNB 4MAYC 2KH2B 3OAUH 4PRIE 2FD6L 1LO3H 4PREA 4XMLL 5C08A 3PDGA 2JJVA 3EDFA 2CLZB 4X9BA 3WNNA 4G7YH 4J23A 4HGWB 3IB4A 1RUKH 4IDJL 3PHOA 1U8MB 2AXHA 3G04B 2R29H 5GRWA 5IBTH 1ZWIB 4ZFGL 5IVXB 4FS0A 5MEPA 1AGCA 2E9JA 3LV3B 5M95B 4K9EL 2EXYC 4KRNA 4MNGB 2BVPB 3BQUB 2A74A 1LEGB 1I7TA 1AD0B 3EDDA 4F7PB 2ZUVA 5IVZB 4FZEL 5C0CB 1I7UA 1M71A 4ETQA 2QQKH 3FB7B 2FX8L 3BZEB 5EU3A 1G9NL 5HYJD 2ESVA 2Z35A 4PJ7E 1KJ2B 3AC0A 5ALCL 3GBML 1ZLUH 2F54E 4MAUH 5DJXA 1JMZA 3OF6A 4WFED 3SDCC 4XPHL 5CILL 5ADOH 1G7HA 1XGYH 3WDHA 4DGYL 2DAVA 1BBJA 3X17A 2NTFB 3MOAH 4FFZL 3NVQA 2P4AB 3CU7A 2WBKA 3TJHD 4HKBA 3SE8H 1MCKA 2GJ6D 1UJ3C 5ERWB 4KKLD 3DV6B 4KJWC 4YDLB 3WJJC 2J8UF 1AGFB 2EH8H 1JTTA 5IT2L 3BZ4B 4U6HB 3STLA 1H8OA 5AD0A 4WU7B 3SKMB 4I3GA 3NA4A 5DJZB 4HJJH 3CSYB 1CTNA 3U7WL 3LEYL 1UM5H 5H94A 5IK3B 5HHQA 2MJWA 4DEPC 4Z76B 4RA0C 2ID5A 1WWAX 3RTQC 3BOVA 3HFML 2VR4A 5EBLA 4GKZB 5DQJA 1BVKB 5MP6H 1FFNA 1S3KH 1KJMA 3SCMB 4DCQA 5AYQA 3WKMH 1W0WB 2Q8AL 3AUVA 3W0WD 1D5ZA 2XZZA 1EJOL 1K8DB 3UCRA 4JE4B 4QNPE 4EUPG 2WM0A 3BKYL 3F5WB 2IBBA 5GRVK 1YEDA 2L7JA 4OJFL 3EKCA 1N0XL 1ZA3A 1KLGA 3O9WA 3FB6B 4TVPE 4YDKH 3KXFD 2CDGB 3QPXL 4LPTA 2MOVA 4RISH 4OLUH 1AI1H 2NY3B 2XI9A 1QLEH 3HN3A 1QBLH 4ZTPL 2X2YA 4OLVL 3ZKXB 3MV8A 5D2NC 1JRHI 4NM4L 2JCCF 1GGBH 1H0DB 1YNKH 4KRPC 1Q9LA 3E6FB 4O5LL 4HXAH 1DE4B 2YPLD 5H2BB 2QSCL 2VLRD 4IRJD 2DLGA 1J9CT 5HVGB 3SDYL 4XX1G 3EJYD 4KVCH 4JO2L 4POUB 3P9MA 3HG1A 2Y7QB 1UM6L 3D39D 1MCPH 1FVDB 4J1UA 4R3SA 2G2RA 3GMRA 1Q9WB 4FQPA 3IDMB 1MFEL 1T7XA 1K2DB 3M17B 2ADFH 2FBJL 3LEXA 2JTDA 4JY5L 4YDJB 5ITFB 2IBZX 5CD3A 2CUMA 2R2HB 1HHIA 4UB0H 1KCKA 2N1KA 3OTTA 4Z7UB 3ME0A 3S37L 2WBJB 3BHBA 3AVEA 4KUCD 4X7CC 3VXUD 1OARL 5IMMA 2I9LA 3FQUB 1MELA 2HWZL 4CADB 3QUYA 3GSQA 3IS0X 4PJ8B 5E00A 2XQYG 4UIKH 3GKWL 2OYPA 4HV8A 2Z91B 2VXQH 5TJWK 1JWSB 2R15A 1MVUB 1M7DA 1XGRB 5EZJA 5IJKC 2VITB 1QFWM 3SHSA 3NA9H 4GMTH 4U6XB 1JPSL 4GKNA 4MAYB 1PYWB 3C6SB 4XXCC 2AJXH 3BD3A 4X6BB 4NNXB 4MS8D 1QQDA 3OPZL 3MRRB 3WS3B 3NIFE 4JAMB 1WT5C 2PXYC 3QUZD 2XN9A 4K3EL 3EZ8A 4XHQA 3QH3B 4FXGB 1UWEH 4D0CB 5C09D 1DJSA 1GJIA 4Z7OE 2BC4B 1JUFA 4GXUM 1A4KA 2A73B 3GSOB 4LF3B 4NCC1 3U0WH 5HGAB 5DO2C 3EYSH 1U8LA 3P4OB 1U9KA 3QDMD 5GGUA 4FQLH 4NC0B 2X4RA 1SVCP 5DVOA 1EK3A 4OLXL 3U46A 5BJTA 1T5XA 3DURB 3DRTA 4ELKB 1G0YR 3IDJB 1BX2A 5BVJA 3MV7B 1NDMB 2F19H 5D71H 1BIIA 1R3IL 4ODBD 1YN6B 4NUGL 1FV1B 1RZ7H 3ARBC 1PKOA 1UKSA 1U8IB 1F97A 4QTHA 4GT7A 1Z6JT 4Y4KA 2FECL 4MA8L 1YY8B 5ICXB 1LP9A 4OZHB 4MD4B 3O6LL 2ICCA 5ESVA 3ECBB 3WNOA 4JHZA 1R3HB 4PS4H 5T1LB 2BOCB 4CU7A 4EXKA 3MRPB 2FEDC 3TESA 3V6ZA 3CVHH 1D5BA 5CFHA 1DANT 1UJ3B 1NDGB 4R26L 3RVVD 1NGPH 5F9WC 1WBZA 3BUYA 3RL2B 3QXAB 3DX9B 5F6HI 5CJOL 5K9JH 1FG2A 4JFEB 2PYEB 3JWDH 2EO1A 4JM2A 2PW1B 3RPIA 5D1XC 4OF3A 2OS7A 4NDMB 2NYYC 4LCCC 3HZVB 1T83A 4NCC2 4J8RB 5FYKE 4JFDD 1Q72H 4DEPB 4JFQA 1JF6A 2NW3B 3RTQB 4AY0A 3DI3B 1I9IL 4F7CA 3RWEA 2GQHA 1TZGH 3UTQB 1RULL 3VA6A 3JXAA 4YX2H 4X5WB 4XXDB 1KENL 2XA3A 1LO4H 4Z6AT 5IR1A 3UO1H 2Q3ZA 3MCG1 4X7SH 5IFHH 3WUWA 5B21A 3MRQA 1L4IA 4D9QD 3L3GB 4K8RL 4NJAH 4R4NC 3MXVH 5IEHA 2R8SL 3NZ8B 1I8KB 2BSTA 1A5FH 5F7DB 3MCKB 3EOYG 3MROB 4PRNB 1R5WA 4M93C 4QOKE 4HC1L 1K4CB 1W8OA 5FYLD 2NCMA 5D2NB 4PJFE 4WHCA 4WHYG 5T1MB 1UCBL 2XZCH 4KRPB 1PAMA 1PDKA 3BMVA 3U36A 4XCNB 1CIUA 2E9IA 3UP1A 4HIIB 1WBYA 1D5XB 1FO0L 1ZHBA 1T66C 1ZT4B 4G5ZH 3QDGB 4Y16C 3FCTA 4M4PA 4KKCC 1MEXH 5JHDD 1TVDA 5KS9E 5KTEH 5HHOA 2UYLB 2Q76B 2NXYC 3O3AB 4QGYA 4EIGB 1AH1A 4XMPH 5IF0B 3VFMA 2QSQA 2AP2A 5AEAA 4JFXA 4Q9CA 4TNWK 5FYLH 5J6HB 1NFIB 25C8L 3RAJL 3INUL 2DMBA 4M6OH 1SEBB 3HUJE 1Q0YL 3IKCA 4PY7B 3HC3L 3CSBA 1MREH 3O45A 5FYJL 4LFHG 3SDXA 2WWKT 4OF8A 4YWGL 5DZOA 3TN0A 1Q1JL 1BLNA 1MI5D 3QDMA 1OD9A 3CFBA 3MREB 2HJFA 3CVHA 1OTTC 3AGVA 2Q86B 4AT6A 3CCHA 2FHBA 4A6YL 1EXUA 4OLWH 3MUY1 3KPOA 3FQRA 3TNNB 1J0ZA 3BP5B 2FHFA 3GKZA 1RFDL 2JKXA 2VR9A 4AMKL 4RRPA 5EC1A 5LGJB 1PVHA 1MQ8A 4Q9RH 4WTZG 3RL1A 5J0BA 2PXYB 5F3BB 1FNAA 3FFCE 4L3ED 2BNUB 4NGHH 2MCPH 2QSTA 3P4NA 4GRMB 4OIIL 1YN7B 3K4DA 1GZQB 1U91B 4NHUB 1IAMA 2APTA 3FZUC 4RAVB 2LU4A 4U1SA 2NY1D 3LOWA 4TNWF 1FZMA 4IDLA 4CVUA 5HVWA 2JB5H 3JWOH 2PF6A 2NNAB 4ZUWA 1RZGB 1A6ZB 3QPQC 3NTCL 5DGRA 4NZRL 3SGEH 1J0IA 3KR3L 5DRNB 3VJ6A 4ZD3H 3H9SB 4IMLB 4JQVA 1QA9B 1YDPB 3ARBB 7FABL 3DUUB 2OL3L 4AL8L 2DICA 2L0DA 1JP5A 3ZDYF 3NCEB 1OLZA 1IILE 1H3WM 1FORH 1CFNB 3K3QA 2QLVB 1B6DA 5LWYH 1MCSA 2J8OA 1WCBA 3QRFM 1S7RB 4XNXH 5DLML 5BRZA 3WXVH 1HQRA 1XR8A 5DFVC 1DUYB 2CR3A 2ZWLT 1KJ3H 4NZDA 3THML 3GBNL 1G6RH 4EJ1C 5L8LB 3CMOL 4MNQB 3VXMA 4WW1B 5JPNA 2BVUA 4U1IB 1BWWA 3BGMB 1J18A 3UPCA 4LKXA 1BEYL 4B7IA 4GRWE 4NQDD 1RK1A 5D1XB 2ZUTA 3OWEA 4LCCB 1NSNH 3HR6A 5EOQL 2HTLD 3V4UL 2FJGB 3R06B 1D5MA 3FHQA 4LHUD 5I75C 3OR7B 4ZS6C 2H1PH 2D31B 2C1PB 2F58H 4G80B 5D72L 3CFJB 2OK0H 4XC3L 4M5YH 5GRZA 4U1KA 1WIOA 1CZ8H 3FRUA 4R0LA 2ZUQC 1PBYA 2AK4E 3PV6B 4DUVA 2AJUH 1QSEE 2EIZA 5DDHA 2L7UA 4HIJB 5EO1B 3FQXA 5T3XD 3ZYZA 3DTXB 4C83A 5B3JE 3U4BL 3ULUD 1F4XH 3VFVA 2H3NA 1FC1A 1NBZB 5C0DB 2MMXA 1NCCH 2SEBB 5E4IA 2CK0H 2DWEA 5EO9B 1EFXA 1CDGA 3UJJL 2G5BB 4M93B 4WHTA 4WI4A 3HC0B 2VYRE 3GSWA 4N8CH 1IBGH 4RSVA 3RDTD 2UVFA 3IKKA 1QKZL 3VD9A 1AXSB 2YC1B 3AAZB 3L5XL 5EUKB 3TO2B 3JVGC 2XV6B 1D5IH 2X4NB 1BFOB 5I1CH 1IT9L 5EU6B 4G7VH 4Y16B 3VMPA 1B4RA 43C9B 4L4JA 5T3XH 5J11B 1VPOL 1EAPB 4P59H 43CAB 4UDUA 3ARFD 1Q38A 3C6LA 5CEXB 2NXYB 3GDBA 4LQ1A 2YD9A 3LRHA 4TNVK 5JQ6L 4YBQC 3PGDA 4KKAD 2ZOLB 5CP3H 5IWLA 2GUOB 1PX4A 2ITCB 3MOQA 1C1EH 3WLBA 3MLUH 2DL9A 5H37G 3BYTA 3KVQA 4Z7WA 2EXWD 3N1FC 4S10A 3BH8A 2X4PB 1QR1B 5BV7H 1NC4A 3F58L 1KGCE 2ZUUA 1AKJD 5HDBF 1E4KC 1E6OH 2CIIA 3VI3E 4MZ2A 3AM8C 4NQSA 2BNQE 3K4ZA 3E3QC 2PTUA 2CRZA 4OLYL 4JPVH 1M7XA 2XTJE 5IMLA 4DK3A 3BZFB 3EJJX 5K33A 3RWGB 3CLEL 1L9MA 4FXLA 3EYOB 3ZHDA 4YJZL 2CDFA 5FFLA 2VSDA 5EIIA 4XMLH 2C1OB 3VH8B 4XPBL 3KPPA 3D0LB 2WQ8A 2AEWA 5HYSA 3G6AB 2FEEI 5J6GB 1JHTA 1CDIA 1QHPA 2YD7A 1R5IB 4BUGA 3OG6B 4IDJH 3U79A 5KSUA 4Z77B 12E8L 4JFPA 1A2YB 2GKIA 1MFAL 4ZFGH 4NO3B 4ZAKD 1NMCC 4QT5A 3WD5L 1XGTA 2NY6C 4LSTH 3RWFB 4TSAL 1U92B 1RK0A 5E2JA 3ISWA 3R1GL 2Y07L 2Y06L 4TNVF 2D7TH 4X6DE 1ES0A 4F9LC 4NQEE 5CBAB 1F3JA 1QPPA 4FZEH 3F6LA 2YS4A 4IEFB 3I84A 3GEWB 2FX8H 3S5LA 3BW9B 4HIEB 3EZJB 4TPRL 4ODUB 5ALCH 5IKCB 2OP4H 1DFBL 2ADJB 4XPHH 5CILH 3VXRD 5GS2H 2WUBL 4L4VD 4OZGE 3IFLH 4YHKL 3VRIB 4HS3A 4I48B 1OVZA 1ZT1B 1ROWA 5FA3B 3MJ6A 4L3AA 1NH6A 3E6HA 1A6AB 3L3JB 1M05B 2A1WL 3V5DA 3FB8B 3QCUL 4Z0BL 3Q5YA 1IC4H 1P4LA 4LHQB 3SJVB 2AJSL 3P0YL 4I0PD 4F7EB 2FBOJ 3FN0H 4XZUB 4R2GD 3LN4B 5E4EC 1ZEAL 3KJ6H 5HGHA 5FDWB 3U7WH 2XXMB 4XAWL 4E42B 2YD2A 2DOCA 5J89A 3RNKB 3HFMH 1NAML 3ETBF 4H88L 3TBWA 5I75B 4JZNB 3QIBC 3W81A 1QFUL 1I1AC 1TJIL 4PRHB 1F11B 3AY4A 3R0MA 2A6DB 1EJOH 3D9AH 3NPZB 1HXYB 1CLYL 2ZUQB 2ZSWA 2C7UB 1GGIL 4OJFH 3BVNA 4ZPTB 2Z8VC 5DS8B 5E6YA 3O3EA 2EC9T 3QPXH 5EORL 4UTAL 5E5MB 2UWEB 2APFA 1ACZA 1BQUA 4MGXA 3SKOA 5DXWA 1HINL 3MJ9L 4ZTPH 2P5EA 2AV1B 2VZSA 5KJRH 5EBMA 2CO7B 4NM4H 5J56B 1PG7L 1FVEB 1YZZA 2H26B 1RMFL 1SY6H 4CVXB 1FLTX 2YD5A 2FLBT 3BESR 3CXHK 3I6GB 2QSCH 2R1YB 1PQZA 2YA0A 3D69A 1CBVL 4AEFA 4Y5VC 3IDIA 3ARGC 5EZIH 1P4IH 2E6JA 1BQHA 4JO2H 2CKBB 4FTVD 4PJ5A 1ORQB 2OCFD 2D7QA 5CSGA 1TJHL 5KVDL 1WTLA 4WV1A 1IM9B 4MA7L 4TVSa 2K9UA 3MNWB 4RMSA 4Z7UF 3CXDL 5CP7A 1MFEH 2VXTH 4PJ7F 4Y5YC 5DQDL 3H7BA 2AV7A 4UDTB 2FBJH 4JY5H 5IHBA 2VDRH 1IL1B 3MGOA 4UU9B 3U1SL 4Y1AA 1P6AB 4ZNEE 2IFGA 3TWCL 5DEZA 4HIXL 3KPSD 4M7KL 3VXSB 3G6JB 5IESL 4YLQT 1S7UA 2GIYA 3BT2L 3S37H 5TDNA 3D2UA 4U6YB 5B38G 4JFYA 2VIRB 4AQ1B 4M62L 4LLUA 5HJ3A 3ROOB 4GBXC 3HAEH 2HWZH 2LU7A 4PGBA 4XBPA 1GSMA 3HRZA 3MTRA 2DQUH 2Y25A 3GKWH 4XWGL 3BISA 1QFWI 4QYOB 3BEVB 4XB8A 4Y4HA 4KHTL 4BFEA 4PG2A 1ODAA 5ICYA 2IMNA 1JPSH 5SWQA 2J8UA 1MHEA 4HEPG 2BOBB 4NT6B 4GRLC 4LIQL 4U6VL 5TF1L 2VISB 1U8PB 1OTSD 1WTGT 2BVYA 4M7LT 5FO7B 1QR4A 2YRLA 3MUZ1 4OF7A 2J4WL 3RJDA 1A7NL 1MPAL 1CGVA 4LL9A 4PGZA 4L4VA 4RMWA 4N5EC 4QNPF 4D9RE 4D0DA 1NMCB 3QULA 4Y7MA 3CX5J 1G7MA 2NY6B 4Z78B 1X7QB 5J1AB 4MJ5B 2R1XB 3T3ME 1HI6A 3GHEH 5E8NB 3KYMA 4M48L 1L6XA 4P5TC 4TVPL 1SBSL 4OLXH 3FFDB 2BNQD 4OZHF 3WIFA 4RNRA 4G9FE 3OGCB 4IIQC 3UZVB 4HH9B 2O61B 3I50L 4Q74A 1JMXA 1R3IH 4TYUA 1I85C 4UAOC 2V9QA 2BX5A 4V1DE 1IEAB 4MA8H 2ZPKL 3FO9A 3QWQB 2MCG1 3ULSB 1XGUA 3O6LH 1YMMB 3TP4A 1RV6X 3QEHB 3NPSC 2JCCA 2DQIH 1IGML 1I9JL 1L7IL 1EAJA 1UVQA 1FE8L 4D8PB 5CZXD 1QRNA 1JE6A 5T3ZD 1JV5B 2MHAB 4R26H 4U7KA 3TA3A 1O7VA 1PX3A 4WI9A 4KDVA 4NNYB 1HHJB 1OHQA 3DX7B 5CJOH 3P30H 5E9DA 4XP6H 3RX8A 1MOEA 1Y6KR 1KELL 1V3MA 5TE7H 1MJJB 1KXQE 3VFWB 5E4EB 4OD2A 4E41B 4DTGL 5C0BB 3V6FA 5GS0L 3UZQA 3LQMA 4I3SL 3E1F1 1CFBA 3IETA 4UTBL 5AUMB 4HSQA 4HZLA 2ADGA 4PLJC 5C0JB 3O6FC 3O11A 5T3ZH 3H9ZA 1ZANH 3KPRA 1I1AB 2IADB 4ISVB 3T04D 1U8HA 1EX0A 1KENH 3HAEA 4FTVA 2OTUA 3MGTA 1JI1A 4NO2A 5L8JB 2F53D 1JNNH 1IAOB 5DI8A 4HT1L 1DVFD 4HBCL 3GSNB 1U8KB 3ARQA 1QFPA 2VLJA 1KB9J 3ALXA 5DTFA 3JV6A 4R7NA 5CEZE 2ARJA 2R8SH 3WFEL 5GZNC 4LLAA 3OKKB 5F7EH 5EA0L 3GMOB 2FIKB 3KPSA 1RZJL 2BCKB 1HEZB 5C6TL 5SX5K 2DBLL 2E7MA 5GSRB 4HC1H 1FNEB 5E6IC 2E7BA 5DJDB 5GS3A 2AJVH 1AO7B 1MAML 3L5JA 3IRZA 2B0SL 2EEBA 3F7YB 4MNGE 4Y4FD 1B9ZA 4S1RH 4JRXE 4KK6D 1IFHH 3LEVL 4FQXD 2QTEA 5DA0B 4Y5VB 1OB1B 3C08L 4MB5A 4WO4C 5D7IE 3PP4L 1T1XB 1WAAF 1Q9OB 3HPJA 4OZIB 2R2BB 4KU1A 4JKKA 4LDEB 3TH4T 2OQJA 1YEFL 2KKQA 3D85D 3OZ9H 5E2UH 1GVIA 4WI5A 4Z7VB 1AP2B 5LGHH 1HXMB 4Y5YB 1JGUL 4ORGA 4FXKA 4PRBA 4HWNA 1SYSB 1T20A 4N1CA 5TPWL 2UUDH 1UYWL 5JO5B 3RAJH 2VZOA 3L3HB 3INUH 2EE6A 3NFPA 2BJML 3PWPD 2ARWA 1MY5A 1V3LA 3RA7H 1A9BA 3HRPA 3HC3H 3AU1A 1FC2D 3N50A 4KMTH 1G7QA 5C07A 2HFTA 1UQSA 1CF8H 4OKVA 2AQ2A 5FCUL 4KZDL 3JTSA 4GBXB 1A4JA 3NCBB 2VDOH 3AFLA 4WFGE 2ICEA 1Q1JH 3OSKA 4QRQB 3RHWK 1SHMA 2UVEA 4HS8H 4XVUC 4R97C 3FB5A 5IQ7H 1ORSB 4DVBB 4TSBH 1K3ZA 1QEWA 3ARYA 1YY9D 3BKCL 1AD9B 1UA6L 4NSKB 3ZE2E 4GRLB 4FQQB 3ZHKA 3PWJA 4M61B 1U8OB 4C56B 4IOIB