5I74C

X-ray structure of the ts3 human serotonin transporter complexed with br-citalopram at the central site
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
214
structure length
214
Chain Sequence
b'DIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYSIPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sodium-dependent serotonin transporter
publication title X-ray structures and mechanism of the human serotonin transporter.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 39
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2016-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i74C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i74C01
3QBTB 4Y1AB 2BVOB 3QISA 1WVZA 4WEUD 4C4KT 5FGBA 4P57A 4NKOA 3PF2A 5FO8A 4MJ5A 4XPFH 4YE4L 3A6OA 4OF6A 3P11H 3MCLH 1RK1A 1JWUA 3TCLB 5J7CC 2PO6D 1ZHBB 1BGXH 1QKZL 2VLJB 4P46A 4Y8DC 3UZEA 2D03H 4L4VA 3BGMB 2DLGA 1A1OB 3VFTB 3QAZC 1TETH 4M3KB 1ZGLM 1KB5A 5F1IA 4ZFGH 3LKSA 3CK0L 5BZWA 1A14H 1PBYA 4NPYB 3FHAA 2QKIA 3N1QC 2FB4H 2P5EA 4L9LC 1NJ9A 4GXUN 3QQ4A 3QB7C 1CVSC 4I9WD 1R5VA 3V4PH 3VRJA 3H3BC 1KXTB 3ESUF 1K2DA 5FCUH 1DBJH 2H26A 1CD8A 1BOGB 1FE8H 4HK0A 4XBPB 4PRHD 4XPFL 4S11A 4ORZC 2AERT 4FTVA 5F89A 4U1JB 1KGCE 3P11L 3MCLL 5FCSH 1II4E 2GJ6D 3BEWA 4WJ5B 3IDMA 2NXZD 1BGXL 2MKLC 4F3FA 2D03L 1UEYA 4DVRH 2D9QB 3W82A 4E41E 1TETL 1DQQB 1NSNH 1A14L 3G5YB 3OHXA 3TEUA 4Y19E 1QFUH 4LLDA 2FB4L 2IF7A 2R1YB 3WNMA 3CFJB 4BJLA 4ZNEE 3MYZA 3WFZA 2W1NA 3V4PL 1S7WA 2F53B 4M4PA 2R9HC 5E9DE 1N6UA 5K9KB 1DBJL 1RVFH 1S5HA 1DTUA 2JJTC 1FE8L 2J4WH 1E4KC 3T0BA 1QLRA 3U48A 5B4MC 1LP9B 1BPVA 2X4NA 3E6FB 4R4FL 4DVRL 4O00A 4WHYG 3DNKA 1AXTL 1E6OH 1NSNL 1FZJA 4NSKB 4JLRB 3LN4B 2DBLH 4TSBH 1BF8A 2H9GA 1XGRB 3TV3H 1QFUL 2Z4QA 4QRTB 1AGCA 1ES0B 3H7BA 4I2XE 4Q6IA 1YYMH 1FAIH 2QHRH 1UXSB 1FIEA 2JIXD 3KLAA 2FO1A 5GZND 4PJ8C 5GS2D 5I2IA 5JNYB 5EPMA 2OLDA 1RVFL 3I02B 3MGOA 3O2DA 1N4XH 4LPXA 3QFJD 2J4WL 4G8IA 1KT2B 3IFOB 5DD0H 4HGWA 4NQSB 3QH3B 2PR4L 3VDBA 2NX5D 3MTRA 1I1FB 2R0ZH 4CNIA 4PJ7B 3B9KB 1OTUC 4M93B 1JPFA 1E6OL 1P7HL 2MTPA 5SWZA 2DBLL 2CIIB 4LAJH 3TV3L 1Q8MA 3MRKA 5DC0A 5CLTA 4X6EA 1EJ6A 1YYML 1FAIL 2QHRL 3MZTA 4KROD 5EN2B 4RRPG 3ULVF 2ARWA 4H1LH 1S8DA 4N9GA 1HHIB 2B8OT 4JFED 2HLFC 5CJBA 4PJHF 4P3DB 1H3GA 1N4XL 1N7MH 4OQTL 4AIZA 3I3EA 1UH2A 4M61A 3VXRD 5IJKC 4HK3N 3C5ZD 5F1NB 4KJYA 1BZ7A 3UTTA 4I4WB 3HLAA 3F7YA 3IDGB 4LP5A 5DD0L 4I1NB 2XWTB 1YNTB 4G8GE 3W81A 2EXYC 4R26H 5LBSL 2BMKA 5EULV 1RMFH 3HUJE 1ZLWH 4N0UA 5CCKH 2R0ZL 4X8XA 1KEMH 3K1KC 1J05B 5GGSA 4DAGH 3GKWH 4PUBH 1MJJB 1NCAH 3DX6B 4Z78B 4RFEA 3I3DA 3B9KC 5DHYB 4M93C 3ARXA 4PV8A 3HZYA 4XRCA 4YHMH 1HDMA 2ICEA 5F88B 4ONFH 2W65B 3EDKA 5INDB 1EDQA 1UM4H 12E8H 2WP3O 4ORGA 1AR1C 2Y07H 1CXLA 2R69H 3D25A 4LKXA 1KPVB 1H3UA 3GB7B 3HRPA 1KTKE 5HGHB 3EJZD 2BNQB 4LOUC 4R26L 2PCPB 1RMFL 2BERA 5FF6A 4HFWA 3ZE0E 5CCKL 3D39D 1GC1C 1KEML 4IMLA 3FONB 1P2CB 3O3UN 4DAGL 5DHVH 3VGBA 3GKWL 3F12B 5F1SA 3LY6A 4GKSB 4LCWD 1NCAL 4N5EC 5L2JA 3T77B 2VDOL 4JFDA 4U6TA 2C3VB 1SYVB 1E27A 3MLTB 5DQ9B 2VXQH 3HN3A 1U8NA 4N0FA 2IANB 4DGVH 4Y16B 3TYGH 4YHML 1Q9KA 1U2CA 1F2QA 3AB0B 4JGJA 3V0AC 5CJXC 3RVXC 3X11B 1RSFA 1M7DA 3WKNA 1LK3H 3QO1B 1UM4L 12E8L 1P7QA 2Y07L 5C08A 3G04B 1I1RA 2R69L 2PO6B 5C0JB 3ZYIA 5C0IA 1NEZG 1W2KT 4LEXH 3MLVH 1L4IA 3FOMA 4D0BB 4FA8A 3TF7C 2VDLH 2E6JA 2OJEB 1H8OA 1ONQA 3BO8B 3B9DA 1NFIB 1NCDH 2Y9RT 2YD6A 4OV6F 2BVEA 4U49A 3NIGE 3BW9A 5E5UB 2KZWA 4CGTA 1ZHNB 5SWSD 1HH9A 2VXQL 5MERA 4Y5VA 3BD4A 1VDGA 4DGVL 3TYGL 2CDEA 5FA4B 4ZMAT 3VD3A 1IRAY 3OKLB 3JWDC 4NIKB 3UBXA 3T4AA 1AGFA 5L2KE 2FH6A 2GY5A 3K81A 4UBDD 3U7WH 5ALCH 1QSFE 4YWGH 1LK3L 4Y16C 5IB4A 4OLYH 2OX5A 2WBJD 1M6OB 2VZVA 4TOYH 3AB0C 5CJQH 2NXZB 5HBBA 1MAMH 3C87A 3EOTH 4NUGH 5ETUB 1S3KH 4UQ3B 2VN7A 1PEWA 5ANMB 2AQ2A 4LEXL 4DTGH 3MLVL 4V2BA 2VDLL 2JCCF 2PO6C 5EH1A 2ZWLT 5C0DA 4WHTB 1REIA 1CXEA 4CU6A 3MLYH 2HFFA 3S4SG 1JZ5A 3HZKA 3HNSH 4NNYA 1F5WA 1KLFA 3T0WA 5IKCA 2AJZA 3GHEH 4PRHA 3WMSA 1J1OH 1LE5B 1MF2H 1CICB 2X6MA 3IS1X 3X14B 3SDCD 2N7AA 5IOPB 4NDMA 1OTTD 3GNMH 2IEPA 3MX0A 4KY1H 4GAYA 1UC6A 4F7EA 2OZ4A 1X4ZA 1KULA 2BY3A 2Z93A 3U7WL 2GHWB 4OZ4B 5ALCL 2PYFB 3SKNB 1T4KB 4OLYL 4TOYL 5CJQL 4HIJA 1MAJA 4NUGL 1IQDB 4ELKA 4KTDH 1J12A 4ODSH 1SJHB 4KUCF 2X41A 4DTGL 2CDFA 3D48R 4D2NA 2NXZC 4JO1H 4NNXA 2NZ9D 3MLYL 5ISZB 3QG7H 2GK2A 1KJVB 1R3LB 1W8OA 3MRNB 1KIRB 2FL5B 2XWBB 3B2VH 5DRZB 5C07A 1V7NH 2XQBL 3HNSL 3HE6A 3GIVB 5D7JB 3UYOD 3WEXA 3L3IB 5ANME 3GHEL 2HJFA 1LO4H 2OTPA 1MF2L 5DVKA 3HI1A 1E4WH 5GQBA 2OXHA 3GNML 4KY1L 4R96A 4LPVA 3ARFD 3BVNB 4TNWF 4YZFE 1IGJA 3QFJB 1CICC 2UY7A 2DQJH 1UM6H 1NFDB 1NGPH 3EDFA 3BISA 5FOJA 5FHAH 3DHJA 1EZVX 2E9IA 1RUAH 3C5JB 5ID1A 4YFLI 4KTDL 1JHTA 4ODSL 4MXQC 4ZFOA 4OZHB 4LLUA 2WW8A 5L6YL 1D3CA 3MOQA 4JZJA 1F4HA 4JO1L 3TZVA 3QG7L 4IRJD 4KKNA 4X7FC 3ZHKA 4YXHH 3B2VL 3W39A 1V7NL 2P45B 1S9YA 4LEOA 3ARWA 4PLJD 1HYSC 1CXKA 4K9EC 1LO4L 3UC0H 5D7JC 1E4WL 1CLOH 4JFEB 2R56H 3AAZB 4IRSD 2V5MA 1D5BA 2IBZY 2ZUVA 3QEQD 3VXRB 4FZ8H 1UM6L 1ED3A 2VABA 1NGPL 1QSEE 1F13A 4NO0B 2PN5A 2UZYB 5HYJD 4GO6B 5F9JB 4MCZB 2L7JA 4ZPVB 1T22B 1CIUA 5DD5H 4JN2B 4V1DD 5JOEA 1KCVH 4X99A 4XWOD 1FZMB 1NLDH 3L3DB 4ZYKB 2Y7QB 1N5AB 2IAMB 3AROA 5TE6H 3MZGB 1CGYA 3OKOA 4MQ7B 4MXWH 4YXHL 1T2XA 3MRLB 4LF3A 1QYGH 2BCKB 5A2JH 2VL4A 4BK4A 3UC0L 3WHE1 4BZYA 3LH2H 4P2CG 3T3ME 4NQEE 1CLOL 2OR8A 2R56L 3PWJA 3QDMA 4CRPA 2E7LC 5E94A 5C0AD 4FQPA 4FZ8L 4WUUA 2BSRB 2C4FT 3RTQA 3S34L 3K4AA 2DWEA 1J5OH 3ARBA 5CP3A 5DD5L 2PUQT 2Q7YB 3EYQC 5E6IB 1JHLH 1KCVL 3O41A 2XG4A 5I1DA 4ETQB 3WXVL 3BDYH 4KZDH 3HFMH 4JY6A 5TE6L 2ESVB 5HD8D 2QQKH 5KN5A 4NQCD 3FFCE 2DI8A 3OB0H 3UJJH 2IAMC 4ZOCA 4JDVA 5T3XE 2SEBA 3B6SA 3BP5B 1QYGL 6FABH 4ZUSA 1P5VA 1TENA 1S9VB 1KCLA 5IQ7H 3K2UH 2R4SH 3D69A 1I7TA 4NWUH 4JANB 4UQ2B 1RU9H 1LE9B 4L3EB 5CEXA 3D39A 1JRHI 1U3YA 4KGJA 3HI5H 3OGCA 2CH8A 2RBLA 1SMAA 5HGAB 1J5OL 4IM8A 3DXAB 4LCWA 4KU1A 1W0VB 3C6LA 2FCBA 1PG7X 1JHLL 1S7UA 3C6SB 5TF0A 3IU3A 1AHWA 2N56A 1S9KC 2ITDB 3BDYL 4HPOH 3HFML 3NZHH 4QHKJ 1HOCA 1GC1H 2QQKL 2OTWA 5E6IC 4R90H 3EO0A 4WNQB 4FOMA 1U93B 5J89A 1JUFA 4H26A 3UJJL 4MNHB 1BQHA 4JPWH 1EFXD 5AYQA 2DQIL 2FLBT 1WZ1H 2B1HH 1CT8B 3K2UL 4JFQA 2WINA 2ESVE 3FB6A 1ZHLA 2WUCH 1S9WA 1YEFH 2BSSB 3QT2A 2UZIH 1RU9L 5JDJA 3DMMD 1J0KA 1S7QA 3WFDH 5IB5A 1HIML 1LK2B 1MI5E 2IPUG 5DEFB 5H35B 3X3GL 3HI5L 4L8BB 5T33H 4XNQB 3PHOA 3JV6B 1Q0XL 2YXMA 1R6VA 4PGDB 3TYFB 2XG5A 3CVIH 5FM5M 3MBED 4KGLA 3TM6A 1HI6B 3QWOB 3T4YB 3JV0A 5J1SC 4KRPB 4NQDB 1C08A 3NZHL 1G7QA 4TPRH 1GC1L 4R90L 3WSQH 3I6KA 4G3YH 1BD2A 3JV5A 8FABA 4OLZH 1NCBH 2OR9H 4JPWL 3CFKB 1MWAA 3P40A 5D7KE 3UPCA 1WZ1L 3GMQB 2B1HL 2ZUSA 5DJ0A 1VHPA 1U58A 3MLZH 2XZCH 3UTOA 2WUCL 2W9EH 4YR6A 3D0VB 3JWDH 3JTSA 3OKKA 2UZIL 3OB0K 3OF6D 1HINH 3CDFA 4F7CB 3N06B 4E5XB 1BMGA 3WFDL 1JNJA 3FB8B 3SN6N 1QO3A 5EIIA 3AVEA 3SJVD 4QRSB 1S78D 4JFYA 3DRTA 5T33L 2VL5B 5IVXA 1K4CB 4HMEA 1ROWA 1FNFA 4FQXA 3F6IA 2JK5B 4LSUH 3CVIL 4FXGB 3SDCA 4XCCH 3O9WA 3CX5J 5DDHB 4C83B 2NXYB 3I6LD 3TVMD 5C7XH 1ZS8B 1FYHB 3CDGB 1X4XA 3WSQL 1FCGA 3MV7B 1BEYH 1NCBL 2IALA 4MDJB 4OLZL 4KRPC 1EPFA 2XA3A 5BQ7A 3GSRB 4PP1C 4P3CL 1YN6B 3PIQA 3MLZL 3EOAB 4QHMA 3WL9A 2XZCL 4X9BA 1YDPB 2W9EL 3JWDL 3TA3A 3SGEI 3KPSD 3ET9F 1HINL 4YHNA 3BKJH 1TZHA 5LCVH 4ZFFA 1PKQE 4QO1A 1M7XA 4P5MA 5D72H 4AT6B 4AM0A 5C09B 3U36A 3B4NA 3HPJA 5IR1A 3TBSB 5DVMA 1ULVA 1G7LB 1PW3A 3U4EB 1CS6A 3RL1B 3KXFB 2FJHA 4LSUL 4S2SB 3VI3E 5J06A 2MPAH 2R8SH 4HLZH 4FQHA 3QWRD 5ACLA 2CXKA 4FZEH 2YEZA 5C7XL 4JDZA 3PDOB 4HIIB 1CWVA 3T1FA 4Z7VA 1BEYL 1N6QL 3KJ4B 1RZ8A 4I5BB 2NXYC 3HAEA 2EKJA 4M6NH 3UBXG 3EOBB 1QR1A 1P84K 5C6WH 1YMMD 1IAMA 4ZS7H 4APQD 1CDHA 3LQZB 4CMMA 2IPTH 1D6VH 4BFGA 1I8LC 2ICWI 2VTFA 3MRCB 3BKJL 4L8CA 2XACC 3D0LA 5LCVL 3IKKA 1EO8H 4WU5A 5D72L 1OP9A 4H25B 4RMWA 5DMGD 5CZKA 3F7VA 1RHFA 4X80H 3ZYJA 3MRRA 2MPAL 2R8SL 5EZIH 4FZEL 1HKLH 5T1MA 3TPUA 4BK5A 5DS8B 4PJEA 4F8TA 3MBXH 1ND0B 4PBWD 1OVZA 3E6HB 4LHUD 1XR8A 1J88A 3VFRB 5C86A 3F5WB 3O3AB 3WE6A 4K9EH 5INCB 4M6NL 1HCVA 5IBLC 5HY9B 4Q9CA 3QQNA 1PZ5A 3KPPB 1YA5A 1Y6NR 5JW4N 1I8KA 3KJ4C 1XGPB 4ZS7L 3BDXA 5E7FA 2IPTL 3QIWB 1OP3H 3MRMB 4XP5H 4IRSC 1PFCA 1QP1A 4Q2ZB 1R0AH 1U8KB 2BZDA 1EO8L 2NW2B 1NGYA 3RQ3A 3TESA 3MUJA 1CBVH 2BSTA 1AC6A 1MCBA 2YPVL 2UY6A 4XCNB 2EYSB 3QXAB 5F44A 3NBNA 1BFVH 4X4XA 1FGNH 4FFYL 4UINH 2F54E 4X80L 4G9DB 2Q87A 5CWSA 3QDGE 1UVQA 1Z0MA 4RGOH 3IDUA 4WTXA 3EUUA 1C5DA 1HKLL 3MBXL 2VJXA 5I30H 5IB3B 5IQ9B 2VISB 4K9EL 3WN5A 2JB6A 3RWEB 1T0NB 5FYKD 1EVTC 4KI5D 4JG0H 5E2JA 3TO4B 4F7TB 3VWJA 1PKOA 4I0PD 3ARED 5HGDB 5CP7B 4YGAB 1GOHA 4LLAA 4QWWC 3MMEB 4XP5L 1A9BA 4LKCA 3T2QA 1R0AL 1Q9OA 4HV8A 4JVWA 5J9PB 3BYYA 1MHCB 3Q3GB 1CBVL 2AKRB 3QIWC 3WFEL 5E5MA 3EHBD 3RI5K 2F74A 2BC4A 1BFVL 4UINL 4ZSOE 1OF2B 4HDIB 2GW5A 2XI9A 5CD3B 1FYTB 1GGUA 4MD4A 3QUYB 4M3JA 2P49B 3LZFH 4RGOL 1VFMA 3BUYB 3MJ7B 3X3FH 3ULVE 4I3RH 4KRNA 2VIRB 3FB5A 5KSUA 5I30L 1YNKH 4O2EA 2A6JA 3V4VH 1HXMB 4HWBA 4PJHE 4NFBA 4OUOA 3W5NA 1DP0A 2WP3T 2VLKD 1U92B 4R4BB 1IEAB 2XN9A 2MQ0A 4OFKA 2VZUA 3DSFH 3HPLB 5AZEH 1KLGA 3VA6A 3VDCA 3C9NB 3RWCB 4U1IB 3TO4C 4D0DB 3IETA 3FFDB 3VWKB 2Y5TA 32C2B 4PREA 2EIZB 1H3XA 5DTFB 4OF0A 1BLNB 3MBEB 1P4LA 2ZJSL 1G9NH 4GT7A 1T83C 2IADB 5E8EB 3TNNA 3LZFL 4KKBD 5ITBH 3X3FL 4I3RL 2A6IA 1YNKL 5CJOL 3QUYC 3V4VL 4YGVB 3EZJB 1W0YT 4TSAH 3UTSE 1X7QB 2YSSA 1F4AA 1NEZB 3BMVA 3TBWA 2BY2A 3U0TA 4GW5A 1F4XL 3PNWB 2ICWB 2XKUA 3BH9B 3DSFL 4NZRH 5AZEL 5IWLA 1FNGB 3FO9A 4X6DA 4MAYD 1WEJH 4S10A 4DCQA 5FYJH 4P23A 3SDAB 2NY2B 1T1WB 5GHWL 2GTWB 4JAMA 2H6PB 3DRQA 1AGEA 2CD0A 1F90H 3BZFA 3TH2T 1KNOB 1IL1B 4JO2H 4HAGA 3U1SH 3VWKC 2GK0A 3QFDB 3DBXB 3TVMB 1VEPA 1X5HA 1WAAE 2F5BH 3MBEC 3GM8A 2WBKA 4C56A 1QNZH 2ZCLH 2P5WB 4RMSA 5J6GA 1KXVC 4O4YH 1JGEA 3SJVA 1TQCB 2VDRL 4TSAL 2DJ4A 1EERB 1IT9H 5EIVA 3S9DB 3OB8A 2HT4D 2WMPA 3D87B 4K71B 2HLAA 1U3ZA 3DX8A 3VGFA 3HC4L 2HTKD 4XVUC 4JKPH 5K33A 4NZRL 1WEJL 3HTLX 5FYJL 3R0NA 5HJ3B 4ACPA 4JFFE 1J1XH 2VQUA 2HVKB 3BEVA 4JFPB 3IKCB 1KJ3H 4JO2L 1UEMA 3ZE2E 3H9HB 1KTLB 2Z91B 1MFEH 3CGTA 3ILPB 3BIKB 3SDAC 4D0CB 2NY2C 2OL3A 1BQHG 1ZWIB 1FZKA 2GFBB 1K9TA 5LG1A 2F5BL 4NM4H 4MJ2A 5J6HB 5KANI 5EU3A 1WITA 4WWKA 2ZCLL 3REVA 3TVMC 3SE8H 5KS9A 1WWWX 4O4YL 5HHPB 1DVFB 1NC2B 1PQZA 5JPMA 5F9WB 3MRDA 2YPKA 4JO3H 1XGTB 4APQB 1DQJB 1JGUH 2APFA 2YMXH 4JKPL 4EUPG 1KIPB 5IK3B 4EI5A 4LBEB 2R0LH 2BY1A 2W38A 2JCCE 2CDGA 4K71C 1YY8A 3RNKB 2C4XA 4MVBD 1KACB 1J1XL 3RWFA 1PX4A 1C12B 5GJTH 1MFEL 3E1F1 4QRPA 4P57B 1FNLA 1WFUA 2EDDA 1UKQA 4NKOB 5BRZA 1NUFA 4MJ5B 2YUXA 4P2RA 2XXMB 5ESQB 3QJHA 2AJSH 4HEME 2A6DA 4NM4L 4LPYA 4LHUB 1RK1B 1JWUB 5DFTA 3CFIC 3MRJA 1WICA 4MLSA 5C9KA 3SE8L 5CJ8A 2XKNA 2M2DA 4J3OC 1BQSA 1KB5B 4JO3L 5F1IB 1JGUL 2UVEA 3LKSB 3DTXA 5F7EL 4P4KA 2YMXL 1DVFC 2QKIB 3V5DA 2F8VA 5F9WC 1QHOA 2EYRA 2R0LL 2P5EB 4LDOB 4APQC 3LEXB 1NJ9B 5JZ7D 3QQ4B 4XPHH 1R5VB 1U95A 1BP3B 3T0ED 1Z5LB 3LS4H 4XP6H 3JBG7 4K23H 4RFOH 2CUIA 5C2UB 3PWPA 4MCYA 2AV7A 5KSAA 2EDHA 5DMGC 3ZTJG 3PWLA 4MQXC 4HK0B 2R2BA 1SQ2N 5GGQH 5E8NA 3L5WA 1AO7D 2YWYA 5I17A 5F89B 3L3OA 4NC0B 2I9TA 5FGBC 1PSKH 3SGDI 1GYAA 3BEWB 3IDMB 2I27N 3P4NA 3CUPA 4F3FB 2IFFL 4UT7H 3QQ9C 5DJ6A 4RAHA 1IAOA 4WIQA 5ICZB 5JHLL 1B2WH 1HQ4B 2EDXA 4LLDB 4WDIA 1HHGB 1LO2H 3ARTA 4L4VE 2EDNA 1S7WB 1H9VA 3BX7C 1JRHH 4GLRI 3O6LH 3LS4L 3ARUA 4XP6L 3GEWB 2ZOLA 2ZCKH 1Q72H 4K23L 4RFOL 4H5SA 3RVTD 2IPKA 4QRQA 1S5HB 4B50A 1KLUA 2DM7A 1SHMA 5GGQL 2QEJA 1QLRB 2P5EE 3AGVA 4I0PA 3AREA 5MEOA 1AI1H 1WC7A 2X4NB 2OS7A 4M1GH 1IC5H 2Q1EA 1PSKL 4MZ3A 4Z7VF 1HNFA 3PGFL 2X9WA 1RURH 2J5LB 3O2VH 2K9UA 4LLWA 3UTPD 4HX1A 4NQVA 2EH8H 2EKSA 4WUKH 5FUCC 25C8H 4FTVE 4G9FA 1FZJB 3WS6C 1B2WL 1SYSB 2AJYH 2H9GB 1FG2B 2Z4QB 3PQYD 3GM0A 1AGCB 1HSAB 1OM3H 1U9KA 3MROA 3CSPA 1LO2L 2Y6SD 5E00B 3KLAB 4RGNB 4NKMA 1HKFA 1JRHL 5EPMB 2ZCKL 1Q72L 3MGOB 3O6ML 4NN5B 1A47A 4CVXB 2VOTA 4GG8A 4WW1A 2VLKA 3WKMH 4CVZA 2H3NA 2EDYA 1XF4A 4JPVL 3VXME 3CU1A 2W0LA 1G7HA 3LKPA 1AI1L 5EU4A 3RWIA 4M1GL 2O93L 3REWA 3FO2A 4KDVA 1OSPL 4HGWB 3QI9A 1P6AB 3UO1H 3Q5OA 3TP4A 4GQPH 4OZIE 4X8JA 3JUZA 1AP2A 1RURL 4NHCH 3O2VL 4YDIL 3HG1A 3WHXB 5KSBA 4CNIB 2XTJE 2EH8L 3P77A 4RX4D 4WUKL 1JYNA 2NR6C 3WDIA 1JPFB 5J0BA 4EXPX 2VLRA 2J5LC 5SWZB 2AJYL 1Q9LA 3VXUD 3MRKB 4X6EB 1OM3L 4WO4D 3TJHD 5GRYA 4MX7A 2DLEA 4ZUWA 5E8DH 5IG7A 1S8DB 5EZOH 4XP9L 4WFFD 4WEBH 2LAAA 4RGNC 5GGTH 4AIZB 1FH5H 2X05A 1KYOK 4YNYB 4M61B 3VJ6A 3WKML 3D2UA 5HHNA 1EK3A 4KJYB 1BZ7B 4NN5C 3UTTB 5FKPB 3BPCA 3V5HA 3F7YB 3V6FA 5KBNC 3UO1L 4Z77A 3K4DA 2BMKB 3L5XH 1RULH 2FDBP 2K7QA 3LS5H 3L6FB 2YC1A 1BWWA 1ACZA 3OAZK 3OKNB 4G43A 1X3DA 1XGUA 5GGSB 4E9LA 3LQAC 1H3TA 5IMLA 4UUJA 2VZSA 2YPLE 5CEZD 3GGWA 4LVEA 4RFEB 4FG6C 5F7YC 3EFFA 1FVDA 1BFSA 4F9PA 3SGEH 3HZYB 4BQ9A 4PP2A 4XRCB 1ZGLA 4ZS6D 2ZP0T 3ZL4H 4MAYC 4J3VA 1HDMB 2WWKO 2ICEB 5E8DL 5EZOL 4HS6A 5C0CD 4BUGA 4BH8B 5GRXG 3C2AH 4AZ8A 3U46B 4DUVA 1FH5L 2QJDA 4JB9H 3A67H 1AXSA 2VR9A 3MV8E 5KG9A 3LPFA 2LQRA 4M7LH 4S1RH 2UZXB 2APXA 4P0DA 1B0WA 2D0GA 3L5XL 4MNGE 4LVNB 4PJ9A 1N59B 5F7HA 1RULL 3LS5L 5FF6B 2XWJA 4HFWB 4IMLB 2VDMH 4TVPH 3QUZD 4JVPA 3JUYA 4L29B 3NABL 5EU6E 4LMQI 4LSTH 3EYVA 4U6HA 2HT4C 1IAIH 5L2JB 4JFDB 1GPOH 2X4PA 2HTKC 1E27B 2DLIA 3NCBB 1A6AB 1U8NB 4N0FB 4N0UE 2CUMA 1BHGA 4NT6A 1Q9KB 5D1QD 2C4FU 5ACMA 3IVKA 1AQKH 1U8OA 2C3GA 5GSVB 3IFPA 1WBZA 1EUUA 3C2AL 2XY1A 1M7DB 3X13A 2HRPH 1A6ZA 4KTEL 5CAYB 4JB9L 3A67L 4OCWH 3OX8A 4YXKH 3TNMA 3ULUF 4M7LL 4S1RL 5D96B 5C0IB 3MJ8A 2F15A 5IESH 2DM2A 4L1HA 1TZIA 1I7UA 3UDWA 3KG5A 5TQ0H 1ONQB 2PTUA 3PJSA 4MJIB 4F7MA 2E6PA 4TVPL 5FYLD 3CMOH 4LVNC 1R5WB 4CKVX 4OV5A 1NBQA 4LSTL 4N90E 3BW9B 5IW1A 1IAIL 3MC0A 3FN3A 1HH9B 4OZGA 4X6DF 3KPRD 2PW2A 4Y5VB 2YWZA 2FX7H 3VFSA 1QLFB 2CDEB 2AVGA 5BS0A 4Y5YA 1AQKL 4MVBC 3T4AB 1AGFB 2BNRD 2OXGA 2HRPL 3IJYA 3L3KA 4OCWL 4PJBB 1RIVH 3WJLA 4TRPH 3Q5TA 4YXKL 4MHHI 4XMPH 5L88H 3NH7H 3MLRH 5IESL 2VXVH 4LLYA 3MOBH 1OW0A 3FCTB 4HFUH 5D96C 2YD7A 2E9WA 4Z7OF 3RZCA 4LDLB 3CMOL 5C08E 5GZOD 4Y4FB 5IKCB 4NNYB 1CDCA 2AJZB 4JG1H 2AEQH 4Y4HD 3P30L 4RWHA 4NRYA 4NDMB 2FX7L 3EZ8A 1R3HB 1I85C 4XCFH 4AG4H 4F7EB 1CYGA 5DK2A 2FBOJ 5EB9A 4JM2D 4Y5VC 4KH2A 2Z93B 4ZTOL 4CW1A 5AUMA 3G9AB 2NTFA 1RIVL 1XGQB 1VENA 4URTB 4ELKB 4XMPL 3PV6A 4HJ0D 3SDDA 4D9LH 3K4ZA 3NH7L 5L88L 1FG9C 3MLRL 2CDFB 2VXVL 5F7DB 4OUUA 3P4OA 5KS9F 4QXGH 3MOBL 1ITBB 4R7DA 3DUSA 4NNXB 4PY7A 4HFUL 5DGQA 5IMOA 1UJ3A 3SQOH 5D1XD 5DWUH 3QIUD 2GAZA 5C07B 1I3VA 3HE6B 3AUVA 5IVOA 5JR1L 3WEXB 4JG1L 3E2HB 4QOKD 2HJFB 2AEQL 1KB5H 1DDHA 4Y4FC 3HI1B 4I9WE 2BOBA 5B8CA 1L0YA 1UKSA 2VDPL 1I3RB 5FHBL 4Z7WA 5MENB 5E7BA 2HKHH 4R96B 3U0WH 4XCFL 4UIMA 5BMFH 4AG4L 1IGJB 1CGXA 3MGTB 4JJHA 4PJXF 4PRHE 4NO3A 1OAQL 4EN3A 2EDKA 4PR5A 3QEGH 5TE4H 1HHJA 5SV4A 3SGKA 4BSVA 5ID1B 1TJIH 2GJ6E 5HPMB 4X9FA 4D9LL 1JHTB 2EIEA 4ZFOB 3T3PE 4U1NA 2ITCB 4S0TD 1CL7I 3RL2A 1YPZA 4LSDA 4OIAA 3TZVB 3SQOL 5DWUL 5FYKH 2HKFH 2XFXA 3W39B 2VE6A 1FP5A 1U3HA 4HXAH 1S9YB 2G5RA 4LEOB 4TTDD 1UACL 1XH3A 5DQJA 1KB5L 2HWZH 4MDIA 3HE6C 2Z0BA 3QRGH 1ZAGA 2NYYD 3E2HC 2HKHL 3U0WL 5T1LD 1IKFL 3LKRA 4ODXA 2VABB 3P4MA 2XXCB 1T5WB 3R8QA 4NC1E 3QEGL 5TE4L 4XNYH 1XF2B 3QNZA 1TJIL 4RCAA 3NPSB 4X99B 1QRNA 1XIWD 1QG3A 3WLBA 4DKFH 3DVNB 5HVGB 4PGJA 4M6MH 4DUXA 4PJIB 3O4LA 1SEBA 3MV9A 3BIBX 5GJSH 3OKOB 2AK4D 2KBGA 2HKFL 5F3HB 2EEDA 5CSGA 5T1DH 1TLKA 2WSKA 4LF3B 1H3VA 1T66D 3TZVC 2DM4A 5D7LD 3F62A 3TBVA 3H3PH 2HWZL 1A4KA 4ODWA 3QA3A 3GJEA 2XNAA 3QRGL 1QBBA 4ODHH 4CN4A 4PRID 2MMXA 5E94B 1OTSC 4WI6A 3BUTA 1PLGH 4NO5A 1MH5A 3P0YH 4WUUB 5I1AA 1H8NA 1ORQA 4KI5F 5GRJH 2DWEB 1EEYA 3O11A 3O2DH 4RMTA 3ARBB 4B7LA 4XNYL 5EBWA 1MJ8L 4OQ1A 5MHSE 2NX5E 1G7PA 3O41B 4PJFE 1UB5A 5ESVA 2E7BA 4M6ML 3WNKA 1N5YH 1E6JH 4K7FA 4OLXH 4XMLH 1A02N 1GZPA 3NPSC 5TDOA 5JW4M 4MQSB 4RAUA 2M26A 4JDVB 2EEBA 2SEBB 3GSOA 3HC3H 5F7WC 1ZK9A 5T1DL 3WHE0 4ZUSB 3SE4C 2GEEA 5D2LA 2N4IA 1D9KD 3WV0A 2JJWA 3GSXA 5D1QB 3GUTA 5E2TH 1I7TB 3P9MA 3KLHC 4LARH 4ODHL 1KV3A 3BZEA 5F8QC 5CEXB 1PLGL 3P0YL 4WFEE 4EQ3A 2ID5A 1MCDA 4QF1A 1I1AB 3OGCB 5GRJL 2PXYD 3F6LA 3O2DL 3PP4H 3MREA 4MA7H 3T09A 1U36A 3C6LB 3IU3B 3QDME 3QWQB 2Y5EA 4X9GA 1XR9B 3ARBC 1N5YL 1HOCB 1E6JL 4OLXL 4POZD 2OTWB 5KSBF 4HC1H 4H0HB 3ESVF 3LQAL 3S36X 5KANG 1JUFB 1L0QA 1A3LH 2AABH 1YUHB 3D85D 1GGIH 3GMMA 4JFQB 2WINB 4L4TD 5E2TL 3GMNA 3FB6B 1ZHLB 1S9WB 2AP2A 2BNRB 2VDKH 4LARL 1AGDA 4KJPD 2J1KA 1FNHA 5D1QC 1S7QB 5GGRA 5IB5B 5L9DL 2ATKA 2FATH 4LHQB 1CE6A 5MEPA 5IIEA 3CFEB 3BOVA 3PHOB 3PP4L 4MA7L 1LEKA 5CHNB 1I1AC 3MACL 2GJZA 3K8KA 3KPRA 1RJYA 3SGDH 1EIBA 1C08B 1FL5A 3D39E 1G7QB 3C6LC 3HZVA 4HC1L 4YHZH 3IAPA 3I6KB 5DA4A 5J3HC 5MEQB 1BD2B 3EYFB 5DC4B 8FABB 1LDPH 4Y2DD 4PYGA 4LCWE 1MWAB 4YHPA 4BM7A 3WUWG 1A3LL 1T1ZB 2BRRH 1A7PL 1GGIL 5DJ0B 5F6HJ 1U58B 1MFDH 1VPOH 1NMCB 4KWUA 2VDKL 2WLYA 3JTSB 5FB8A 4JGUA 3R06A 2IMMA 2RFXA 3KLSA 4GKZA 4Y19A 2WZPD 4Z0XA 4GLRH 1J87A 5ACZA 2J3SA 4JRYD 3G5VB 1F11A 1QO3B 3ARGD 5EIIB 2EXWD 4Z76A 5EUKB 3DRTB 2NY6D 3C8HA 5E9DA 5IVXB 4F37K 1TJHH 2CQVA 1KCUH 3OGOE 4FQXB 3RBSA 3V8CA 3SKMA 1U41A 3PWNA 3TH3T 4KQ3H 5EC1A 3QIUB 5HYQB 1U8HA 1QACA 1I1YA 4YHZL 3DARA 5DZNA 1CU4L 3DI3B 4MA1B 2IALB 1LDPL 4NRXB 3F7RA 5BQ7B 3D3VD 2BRRL 4AEEA 3PIQB 3WL9B 1MFDL 4JKWA 3TA3B 3BSZH 4YHNB 4WENB 4ZFFB 4M02A 4I2XA 4PGEA 1NMCC 4P5MB 2RCSH 4W4OC 1A7NH 2H45A 2R2HB 1J1PH 3U36B 4AM0B 3HPJB 2W59A 4QOKA 2Z35B 3CSBA 1NBVH 1TJHL 1KCUL 3S88H 2E7CA 2FJHB 1ZE3C 4LPUA 1VFAA 5KTEH 4ODVL 3QJFA 4IOIB 4EI6A 4JY5H 4KQ3L 5JOFB 4RA0C 4YBQD 3IFLL 2NY3D 4FQXC 3G08A 1R24A 1TTGA 4Z7VB 5IBUG 1MQ8A 4XCEA 5TDPA 3QIUC 1RZ8B 5ICXA 3HAEB 4XPGH 4HK3J 4KAQL 3G6AB 4OZGF 1QR1B 4MA1C 4JY4A 4WEMB 1DN0A 1AD0A 1Q9WB 3LOWA 4J1UA 1OP5K 3QEUA 1INQA 4HG4K 4GFTB 4CMMB 3BT2H 4K94C 2K3TA 2QADB 3BSZL 3D0LB 1A6UL 5E5RB 5KZCB 4M62H 2X70A 4WU5B 5I1GH 3TA3C 1J1PL 1JNLH 2YD2A 2YA2A 4R0LA 5LQBL 1NBVL 3S88L 5FA3A 5KJRH 3MRRB 5KTEL 2WK2A 3N9GH 5SX4I 1KJMA 4JY5L 4XAWH 1CDUA 2YD3A 1ZT7A 1BX2B 2BOCA 4L4JA 3TPUB 4PJEB 1NCWH 4P2OD 1RIUL 2DYPD 4G8GA 1FIGH 2YD8A 4K55A 5L8KB 1XR8B 1JPSL 3VRLF 3WE6B 1NCTA 3NIDF 3D6GA 3BN3B 3RIFF 3UPRA 4XPGL 3UAJD 3HNTH 5I16A 3ZKMD 1I8KB 3VGGA 3BT2L 4X7CC 3O45A 4M62L 3OR7A 3WNLA 5I1GL 5DVOA 2XPGB 2ENSA 2QADC 4MNQD 1JNLL 5D9SA 3ZDXF 5DF0A 3MQIA 4Q6YA 4XH2A 1JGDA 5AZ2H 4YK4B 4EEEA 3RX8A 5KJRL 3N9GL 5CWSB 4YDVB 3VFOA 4FMFA 3VDAA 4YHYB 1JZ8A 2P8PA 5IB1A 1NCWL 5BJTA 5C70A 2Q7NA 4ZO8A 1FIGL 2AJUH 1J7VR 5HDLA 1KPRA 4XB8A 3HNTL 4HAFA 4U2YA 4KDWA 3QDJD 4X4YA 3VWJB 4Z7WF 2Y1VA 4DZBA 2OSLB 2FD6H 3QEQE 3EJYD 5K9QI 2QSCH 3R1GH 1MCLA 1A9BB 4LKCB 5HYJE 2ARJQ 1Q9OB 2DAVA 4HV8B 5DJYB 1KTRL 3VFWA 4QRUA 3VXQB 4I13B 2ED7A 3W0WD 1BVLA 5E5MB 4V1DE 2F74B 1NL0H 4XNXH 1G1YA 5AZ2L 3FT3A 3LKOB 4OF5A 4MD4B 2EE2A 2LV4A 1UWGL 2C3HA 2X4SA 1YPZF 1CFVH 1A4JA 4ZFOL 5I19H 4MGXA 2WWKT 4YK4C 1CGTA 3FB5B 4O2EB 2AJUL 4YHYC 2EC9T 4Q9QH 3IF1A 1A7BA 3U2SA 1NC4A 5CEZH 4LPWA 3PWVA 3Q5YA 2BJMH 3N85H 3ZYOA 1J11A 3KYNB 1FNEA 3OXRA 2VNCA 1H5BA 5L7XH 2XN9B 3WIHA 2FD6L 5DK0A 5HHMD 5C0AE 4F7PA 2DS4A 1RHHA 2QSCL 4GSDH 5JMRA 3IETB 4EJ1C 3GBNH 5DI8A 5IM7A 3VWJC 2Y06H 5EC2A 5E8PA 4MXVF 3VXSD 1BZQK 5D1ZD 5DJXB 4CJ0A 1P4LB 4KKAC 1NL0L 4XNXL 3T8XA 2Z92A 3EW3B 3D85A 4HSQA 1JI1A 1QSFA 2P42B 3TNNB 3QHZH 4OLVH 4PTTA 3GZKA 4U3CA 2EH7H 2JB5H 4NQCE 43CAB 1BFTA 5I66A 4LVOB 1MCFA 2A6IB 4KPHH 1B6UA 5KW9H 4Q9QL 2A73B 4JHAH 4TUJB 1WF5A 2EDEA 4KXZH 2EDOA 2BJML 4XAKE 2X44D 3TBWB 5D5MB 4GW5B 3NFSH 2LABA 5L7XL 1UWXH 4UDUB 5T3ZD 2KPNA 3FO9B 1RJZA 3AMLA 4X6DB 3ARQA 4GSDL 3FQRB 3OJDA 3GBNL 4P23B 2Y06L 2VUOA 4XI5D 4CN6A 4JAMB 3RUGA 3MRBA 4YX2H 4Y2DA 2PTVA 3BZFB 2AXFA 5CBAA 3RFZC 4ZUTA 1LD9A 3RHWF 4L8SA 4I0KA 1HCFX 3QNXA 3EYOA 3PXJA 3VW3H 3QHZL 4OLVL 4U6VH 4OTXH 1CLYH 4EXKA 2VYRE 2EH7L 2IQAA 2JB5L 4BFEA 1NMAH 3P4LA 1VGKA 5F21B 4MB5A 4KPHL 4C56B 3VA2C 3U4BH 4JRYA 5FYLH 1CVRA 3V6BR 5KW9L 2VLME 1IKNA 3ARGA 3ULUC 4E0RA 4JHAL 4PJDE 4DKAA 5ID0B 4LVOC 3B9AA 2YUZA 4YHIB 4JRXB 2HLAB 2VDQH 43C9B 3DX8B 3NFSL 1JV5A 3BMWA 3MRQA 1AD9A 3CX2A 1F3JA 2HA1A 1YEDA 1X5JA 2AGJH 3BEVB 4JQIH 5IWLC 4KRMB 8CGTA 5B38G 1LEGA 4OF7A 4P23C 1FNAA 2VXUL 1GGCL 2OL3B 5MP6H 3NACH 3VW3L 1FZKB 4U6VL 1CLYL 4UT9H 5C0BD 4EBQH 3BP7A 1SJEA 1CL7H 3MR9B 4XNUH 4WWKB 1NMAL 5HI3C 3REVB 3U4BL 5FYLL 5ILTH 3RVWC 1KIUA 2CIKA 5KS9B 1RUPH 2VAAA 4JEGB 3MO1A 4WFGE 5GGSY 3MRDB 1J0ZA 1T7WA 5DMIH 5HXMA 1JCKA 4PJCA 3P9LB 3HRZA 2VDQL 4KKLD 5T1KA 3I6GB 3PP3K 4EI5B 1WTLA 3TT3L 4OZFG 4Z7UF 1RIHH 1OGAD 3ARDA 3SJVE 2CDGB 4IOSD 1UXWA 3U9UA 3MLUH 4XHQA 1XMWA 3CXDH 3RWFB 1INEL 4JQIL 4F2MB 1F4WH 1J8HD 3KNBA 1O5DT 4QRPB 1UWXK 3GJFA 4X9IA 4C4KO 5MP6L 5JIHA 1QSEA 5BRZB 3NACL 4P2RB 2YD9A 3QJHB 4UT9L 3I6LE 4EBQL 2DJUA 2A6DB 1CL7L 3OZ9H 4XNUL 1JIBA 4QCIA 5HHOD 1D5XB 4XBEL 4LDEB 5ILTL 3CD4A 3FN9A 2FEEL 3KPNA 1RUPL 4FP8H 3SOBH 3MFFA 4WWKC 2ZCHH 4QHLA 5DMIL 3QXTA 3K8MA 1IJ9A 1MWAL 1ZXQA 3DTXB 1J10A 3KPSE 4K94H 4P4KB 1TVBB 5C0FA 1HYRC 2EYRB 1HEZA 2EE9A 3LRSA 3ROLB 4L8DB 1RIHL 3KYMA 4FQQA 2J88H 1U95B 3QIBD 3CH1A 4NQEA 3MLUL 1PAMA 1FDLH 3CXDL 4AEHH 1T7ZA 4EI5C 5LJYH 5HHQB 1F4WL 4MCYB 1IM3A 2AV7B 5BO1H 2ZNXA 5KSVA 5HYFA 3PWLB 2R2BB 1I9RH 5E8NB 2X4UA 3L5WB 5EFIA 1JJUA 4U1MB 2J6EA 3L3OB 1CXIA 2I9TB 2BHYA 3OZ9L 1W72B 2XZAH 3P4NB 3K80A 4JM2F 5HI5C 1NLBH 3CUPB 3DO7A 2E3VA 2UUDH 3WIFB 4FP8L 1YMHA 3SOBL 4EVNB 4MNQA 4PJXE 2A38A 1GJIA 1V05A 2WWMC 5K9OA 3O6FD 1YMME 3FFCA 3OJ2C 3S37X 3HAEH 4K94L 4KJQC 2Q20A 5JLZB 3VGEA 3PABA 4PIRF 4DFIA 5GIRA 1IC7H 2J88L 3HC0A 4P4KC 3AS2A 2ZSWA 1FDLL 3ZMRA 4AEHL 1L0XA 2ZOLB 3V7AG 2DI7A 4NCC1 2BXYA 4DKDC 4H5SB 2IPKB 4QRQB 4R9HA 5BO1L 4J4PA 2XT1B 4Y5XA 4OGAD 3MRIA 2Y72A 2KQNA 2XA8H 3AM8A 2E6QA 5BW7C 1ZTXH 2DQUH 1WC7B 2I07A 1MLBA 4E42A 2XZAL 5LGJA 4X7TA 1NLBL 1OY3B 3PWPE 2NW3A 5BZDA 4OGYH 4QT5B 5FGCB 5GRZA 3VE0A 4HX1B 4GQ9H 2EKSB 1OL0A 4G9FB 5IJVA 4PRAA 3OKEA 4AIOA 1I4FA 4G7VH 5JQ6H 1DANT 2D7PA 2D7TH 1IC7L 4NKMB 3QZWA 5HHXH 4W81A 5EU7E 5AWNH 1KOAA 4L5FH 1K8IB 5F97E 4M6OH 3UTQA 5BCAA 4RAVB 5E70A 4WW1B 2BFVH 1T5XA 2EECA 3QCVH 4I3SH 3F58H 2XA8L 4CVZB 2H3NB 2WBWB 2VRAA 2CMRL 1ZTXL 2DQUL 3LKPB 5EU4B 5EOCJ 1BREA 3RWIB 2LU4A 2LU3A 3FO2B 5ICYA 4LCCA 3RBGA 4X8JB 3BJLA 5CEYA 5C0ND 1L9MA 4OGYL 3VXSA 5FYKE 1CR9H 4PJ5D 4DGIH 3IXTA 4KI5E 5D7IE 5D8JH 1AY1H 3HG1B 4WGWB 3VFPA 4GQ9L 3IRZA 2AXJA 3NAAH 2A0LC 3ARVA 4PRPA 1XEDA 3V5KB 5JORA 2VLRB 5DMYA 2GITA 2Q76B 4JFHE 3IGAA 1Q9LB 4LCYA 4Y8AA 5JQ6L 3DYPA 1S7VA 2D7TL 5JHDD 1MCRA 1T20A 4GRMA 4ZUWB 1A64A 5IG7B 5HHXL 5AWNL 3TPKA 1G0DA 4L5FL 3BPLB 3HE7A 4M6OL 2X1OA 3FAXA 4XC3H 2D7OA 2DQHH 3Q6FA 1P4BH 2BFVL 4DZ8A 2O61A 3QCVL 4I3SL 3F58L 1JTPA 3OKDA 1P1ZB 5FK9A 4G6FD 1GOFA 4GJTB 4PRDA 3BPCB 3V6FB 4S1SH 4Z77B 2NY1D 2CLVA 4X5WB 2AAVA 3SCMD 3BXNA 1IM9D 4XNZB 2X5PA 4DGIL 1CR9L 3FHQA 2VLKE 1CFQB 1EA9C 4IOFD 1AY1L 5D8JL 3BN9D 4G43B 1XGUB 1Z3GH 2X1QA 3NAAL 4P5TA 2XTLA 3GI9H 4NCDA 5IMLB 4UUJB 4M48H 4GKOA 1ZVSA 4TVSa 3VRIA 4HZLA 4L3CB 3RGVD 4D3CH 3EFFB 2RGSA 1FVDB 2JELH 1BM3H 5D6DA 3I3BA 1ZGLB 2EO1A 2X4RA 2PYEA 4YDJA 5KSBE 1A1NA 4HS6B 2UWEE 5HYIA 3ROOA 4XC3L 4PGZA 2DQHL 1P4IH 4JKKA 5C0BB 4P2QA 4HF5L 4OCYH 3DOSA 1AXSB 5JUEL 3BPLC 2A6KB 4R2GB 1YYLL 2ICCA 4M5ZH 3DJ9A 2C1OA 4S1SL 5JTWA 1FVCA 1Z6JT 1HSBA 1CTNA 3ULUH 2B1AL 4ZD3H 1XCTA 4O2CA 4F9LA 1DLHA 4GRWB 3MCKB 1JWMA 5GS1A 3GRWH 1Z3GL 3GI9L 3R0MA 4XNZC 4M48L 4U6HB 3NIGF 3T0AA 4D3CL 4JKMA 2X4PB 2JELL 1ZANL 1BM3L 1NGXB 5HSFA 3E8UL 5IMMA 1WT5A 1B4JH 1U8OB 3IFPB 1WBZB 3PL6A 1P4IL 2X1XR 3X13B 1A6ZB 3KDMA 4GMSH 3B5HA 3Q0HA 4OCYL 3NZ8A 4U0QB 1H3WM 3OX8B 3TNMB 4M5ZL 5DYOA 5AG9A 5FM4A 3STZB 3RVUD 4XPAH 2B2XH 1NQBA 4AENA 3WFBH 3ULUL 1TZIB 2PTTA 4MAUH 4R2GC 3UEZA 1HXYA 2V9QA 1FV1A 4ZD3L 2V2WA 4KDTA 4F7MB 3GRWL 1HHHA 2W92A 4OB5L 2A83A 3NMEA 1TFHA 4OV5B 3PGCB 4PLNC 3OPZH 5IW1B 2FYYB 3QUXA 2BVQB 2D31A 7FABL 4A2LA 1CFSA 2A74A 3VFSB 1F58H 3RUGF 1RD6A 3FRPA 5BS0B 4Y5YB 5I8CA 1DUZA 2ADIA 4L1DA 4OM0H 3GSQB 3IJYB 4QRRD 4RIRA 4GMSL 3B3IA 5E2WH 3O8XA 2KH2B 5DRXA 2OL3H 2GIYA 2B2XL 3OL2A 1T7XA 4WRLA 2GY7B 4ZUVA 3WFBL 5I1JH 3L3HA 4GAJH 1AFVH 4LLYB 1NDGA 3QIBA 1BJMA 4KTYA 1KELH 1NUDA 1S9XA 2OTUA 1LHZA 3RZCB 3BQUA 5JW5A 1IAIM 3MRPA 5CKAA 1ERNA 1KGCD 4TUKH 3UDWC 3OPZL 4DOHB 4D9QD 5BXFB 3LRHA 5CUSL 4LK4A 5BVPH 4Y1AD 4NRYB 4NBZB 2GT9A 2VDNH 4N8PA 3HMXA 4WCYH 1F58L 4E41D 3SY0A 1U8PA 2V17L 4FQCH 3PV7A 1G7IA 4HXBH 4XCYB 4W4NA 3RIAK 4D8PB 4CW1B 1Z2KA 4OM0L 5AUMB 2ENYA 2J2ZA 4OZGE 4Y5YC 2HT2C 5E2WL 4OIIL 1YQ2A 3PV6B 2OL3L 3SDDB 4DJMA 4HZAA 4O9HH 4IHOA 2YA1A 1WBYA 2P8MB 3L7EA 5I1JL 4OUUB 5KVDL 4GAJL 1AQDB 4PJAF 3SQBA 4R7DB 3WJLC 1KELL 3DUSB 2FEDC 3FTGA 5IMOB 5JQHC 1UJ3B 2DB8A 2R9HD 3FB7A 1EAJA 1ZLVK 2DQFA 4K07A 4PJCF 1QFWH 2FX9H 4RQQA 2R1XA 4TUKL 1OW0C 4PJHA 1QRKA 1A7OH 2HJKA 3RZCC 2ATPA 5B4MD 5BVPL 2YN3A 4RRPA 1BIHA 2BOBB 3T0EE 1EEUA 3QQ3A 4FQCL 2R2EA 3MJ9H 4UIMB 4OM1H 1Q38A 4IS6A 4S0SD 2ZUQB 3NIDE 3FQNA 5K9QG 4NO3B 1CDJA 4EN3B 2KUTA 1IGFH 4I48A 1AO7E 1IGIH 4NBXB 1HHJB 1OLZA 2ICES 3AMKA 3FZUC 4O9HL 2CSPA 4U1NB 1I9JH 4LQ1A 1BZ9B 3TIDA 3WLWC 1D5ZA 1T7YA 1R3JA 3V8OA 1MFBH 3RL2B 4M1DH 3RY6C 1YPZB 3RP1A 1W72H 3SDDC 2CGRH 2YN5A 3IDIB 2XFXB 2VE6B 1QFWL 2FX9L 1U3HB 4PY8I 1S7XA 2I9LA 4LRNL 4NNPH 1G9MC 5EO9B 2F53D 1UJ3C 1XH3B 4OBRA 3CVHH 5ECJE 4M7JH 4P99A 3GBMH 1CGWA 2X4TB 1P84J 3L7FA 4WV1A 1JMXA 2ZUUA 3LKRB 4OM1L 4PJ5A 3EDJA 3P4MB 1BVKA 4LPTA 4G6FB 4H1LA 1OTUD 2DBJA 1IGFL 1IGIL 1EAPA 3QNZB 4M7ZB 5H94A 2ZUQC 4Z7WE 1J0IA 3V6OC 1I9JL 1QRNB 3X12A 3WLBB 4EN3C 1MFBL 1C5BL 3O0RH 3O4LB 1SEBB 1NANI 1W72L 2A77H 3MV9B 1WAAA 2CGRL 4ZXBA 2HLFD 2DJSA 1N8ZA 1N2RA 4NNPL 3PQYE 4ZNCD 3BZ4A 3TBVB 3BH8B 4M7JL 1ETZA 4ODWB 5HI4C 3GBML 3QA3B 1U3HC 3GJEB 1LO5B 1WISA 3EYSH 2EXYD 5EG6C 5LXGH 5BV7B 4H0IA 1IM9A 3NOIA 2H2SC 1MCCA 1MH5B 4HUNB 5I1AB 1KSRA 4GG6B 4CAGA 5DHXB 4EOWH 1JE6A 3O11B 2Z8SA 3WFHA 3HI6H 1MOEA 1LVEA 5EBWB 1A3RH 1GVIA 4ZOEA 2UV3A 2ADGA 4QXTB 2W9DH 1G7PB 3LAFA 4H8WC 4KMTH 4XXCC 1U8IA 3B9KD 1JZ3A 5ESVB 2LFGA 3O0RL 5TGBA 4K7FB 2GYSA 4M7ZC 2A77L 5ALBH 1GZPB 1MCPH 3HZMA 2C3WA 4MXVE 4PBXA 3DIFA 5D6CA 5TDOB 4XB7A 1ZSDA 1EMTH 2DLFL 4RAUB 2VXTH 3BN9C 1ZT1A 3QZWG 4LMQE 3GSOB 1KCRL 3VXUE 3LN5B 1AR1D 2HJLB 4JFOA 5D2LB 3TN0A 5HPOA 5DHVA 5T3ZH 3U0PA 3GUTB 4LOUD 3EYSL 4FXLA 5LXGL 3BZEB 4ODUB 4WFFE 1WWBX 3WXWH 1ZKAA 4QF1B 1VESA 4EOWL 4ELMA 5BV7C 4OCNC 3MREB 1BWMA 3D9AH 4NJAH 4N5ED 3ZKNC 1CGSL 2W9DL 1MLCA 4KMTL 3L5JA 2B4CC 2H32H 1FRGH 1XZ0A 3S4SA 2J7LA 2EDBA 5DJDA 4MLIA 2MNUA 5ALBL 4WW2B 1FVEA 3K46A 1EMTL 4NQUA 3RVXD 5CEZE 2VXTL 3ALWA 4K3DH 2WIIA 1QOKA 2YHGA 4LGSB 2XV6B 4U2ZA 3DVGA 3GMMB 3CCHB 4IIQA 4YE4H 3GMNB 1MAKA 4POYA 1TDQA 1AGDB 1FORH 5LVEA 5K93A 5L8LB 3N1FC 4DN4L 3WXWL 5GGRB 2BNQD 2ATKB 1UQSA 1UGNA 2ZPKH 5MEPB 2WNGA 3QUKA 5IIEB 3LKQA 1LEKB 1PX3A 3D9AL 4NJAL 4O5LH 3M17A 1U42A 3U9PL 5GRVL 5C0EA 5L2KD 1FRGL 1FL5B 1CGVA 3HZVB 3B8SA 4LCIH 4KMLB 3ZZ1A 4K3DL 4B5EA 5CIPH 1B0GB 2IAND 4FMKA 4GRWH 4Y16D 4W6YB 4YHPB 1HHKA 1VFBA 5DD3L 1FFOA 4E41B 4WW2C 1NPUA 4KKCD 4Y4KA 1DLFL 1QUNA 1QVOA 2EYTA 3R06B 2RFXB 3TT1L 1FORL 4GKZB 4Y19B 1LNUA 2QSQA 4Z0XB 5JPNA 4CMHB 5ACZB 4PRNA 4HUVA 5IB2B 1G7JB 4JZOA 5KOVC 4Z76B 3F65A 1NCCH 4RBPH 2ZPKL 3FO0H 5HVWA 4FABH 5E9DB 5HVFB 2V2TA 5GGUA 4O5LL 3TJEL 3KPOA 3DURA 3SKMB 1KG0A 3VI3F 3KYOA 5EC1B 4BZ1H 4Z7UE 5CGMA 3BE1L 1U8HB 4M7KL 3NFPA 1I1YB 4LCIL 5JW3H 2WUBH 3CPLA 3MUY1 4U0RB 4GAGH 2VLJA 3KPRE 4GUPA 5GRVK 1VEMA 5DJAA 6CGTA 3VFTA 4O2FA 1A3QA 2F58H 4X7SH 2BK8A 2BHZA 4R4FH 4WI8A 4I2XB 4PGEB 1NCCL 4F57H 4U3XA 3FO0L 4FABL 1WZMA 1AXTH 4CMHC 4IMKA 2I24N 4LVHB 1VFAB 3OR6A 4GRLB 3QJFB 4LRIA 2CLRB 5ABDE 4BZ1L 2X4OA 2FIRT 3QEHB 1FZOA 3VXMA 3ISWA 4XBPA 2VB5A 1R24B 1R3KA 4LFHD 3B5TA 2GTZB 5JW3L 1CICD 5DUBB 3RZWA 2WUBL 1YEHH 4XCEB 5TDPB 4OZIA 3MA9H 3FRPG 5ICXB 5EUOF 4GAGL 4HULB 2CRYA 2OM5A 4W68A 4EDWL 5IEHA 4JY4B 1DN0B 1AD0B 4PJGE 4MXQD 5FO7A 3WS3A 4U0RC 2F58L 1INQB 3QEUB 4P9MH 4X7SL 3P73A 3DYMA 3G5YA 1AGBA 2PR4H 1BJ1J 2H8PB 2D7MA 1BF2A 4PJ8A 4HHAA 2X70B 4QHUB 1T21B 4F57L 1CLCA 1PY9A 2IH1B 5JXEC 4R0LB 3TIEB 1NMBH 3CZFA 4M1CC 1ZT4A 1I9EA 5DJCA 5ISZD 5FA3B 1D7FA 1HYSD 4MA3A 2XQYK 2C26A 5K9KA 2FJGA 3G6JF 1KJMB 4DUWA 5IFJA 5D7JD 4ZDHB 4RZCA 4I3GA 1Y6MR 1K5NA 1ZT7B 2BOCB 4LVHC 4N8VA 4G8GB 4GRLC 1YEHL 3WJJA 4QOKE 1G9MH 3HUJB 3MA9L 1PG7H 4OQTH 2Q8BH 1C8PA 5IUSA 5I16B 1JBJA 1KB9K 1DQLH 4UV7H 3V7AE 4BA8A 2YPLA 4P9ML 4NSKA 4JLRA 3LN4A 5LBSH 5D93B 3O45B 1KPUA 4ZG1A 3OR7B 1ES0A 2QV2A 2QL1A 3GBLA 3ZO0A 5DZLA 5T5NG 1NMBL 4BSJA 5IJKA 4XH2B 5CD5C 3PUCA 3S5LG 1T1XB 1WK0A 3F7QA 4R0LC 1BFOA 3MV8A 3J8F7 2HG5A 5T5NF 1KT2A 4X4ME 5IB1B 5BJTB 2LAGB 4CDHA 3QO0A 4MNGA 5EOTA 1G9ML 3QH3A 1PG7L 1QLEH 1Q1JL 4MD5A 4OFYD 4OFPA 2Q8BL 4TN9A 3EYQD 4ISVB 1MIEH 3VXOA 4X4YB 4Z8FH 1DQLL 4UV7L 4PJ7A 5H37H 1X6NA 4NO0D 5I76B 3IAGC 4LIQL 2ZG2A 4HUWA 5EU6A 1EH9A 4MQTB 1UENA 5EDXA 4QYOA 3D5OF 4QRUB 2DTMH 2IAMD 2UYLB 5EN2A 3CAFA 2A9ML 1BVLB 5D93C 3NCCB 3MXWH 5I8EA 3T08A 1HHIA 3FT3B 3O2WH 4HUKB 5CLWA 2VDOH 2V5RA 2X4SB 1UADC 4YEFA 1A4JB 2OMNA 2AK4E 5DUMH 2OQJB 5F1NA 3VD4A 5J12B 2XWTA 1YNTA 3H9SA 3IF1B 3LB6C 2MQ3A 5D7LE 1NC4B 1QLEL 3O3BB 1FNEB 3OXRB 4H1LG 1MIEL 4Z8FL 1J05A 1H5BB 2E5EA 4PRIE 4UU9B 5DK0B 2D0HA 4F7PB 1RHHB 3IDNA 4RMUA 1MJJA 4Z78A 1WTGT 1CQYA 3KPQA 5ENWA 5DI8B 5E6ID 5IM7B 5EC2B 3GKZA 2R29H 1RZKC 2YS4A 2KL6A 2DTML 2DD8H 2DQEH 2ESVD 4GMTL 4H8WL 3MXWL 4XZUA 5EZJB 3T8XB 2Z92B 5L2KB 2ED8A 5F88A 2B4CH 4NP4L 1F4YH 1QSFB 3OMZA 2W65A 3O2WL 5INDA 2F5AH 4ZAKA 4PTTB 1UZ8B 1MI5D 5E56A 1WAAF 5C0GA 5DUML 3S7GA 1E28A 4K7PY 5F6HI 5HGHA 4X83A 1AIFA 3DETC 5FYJD 4HKZA 3D1MC 2P43B 4L3ED 1P9MA 5J12C 1I7RB 3FONA 3KYAA 1KC5L 4PD4K 1DANU 4KHTH 3UJIH 4CUCA 1RJZB 3DXAD 2Z9TA 5IP4A 2GCYA 1DQTA 1IGTA 3OJDB 1VACB 3QDAA 3UZQA 4DW2H 1H5BC 1SYVA 4KHXH 5BV7L 2R29L 3MLTA 5DQ9A 5JIKA 1FHGA 2ADJA 2AXFB 5CBAB 2DD8L 2DQEL 4HKXA 1LD9B 2JLLA 2B4CL 3ZE2F 1F4YL 5CGYC 3QNXB 3EYOB 2X9YA 2JJSA 2PETA 1KYOJ 2F5AL 2VWEE 1PY4A 3QO1A 2IQAB 1ZLWK 4XX1G 2PO6A 3QG6B 5C0JA 1K8DB 2HP4A 3KLDA 4UAOB 4E0RB 4D0BA 1UA6H 4L4TE 2WQRA 3IJHB 3RU8H 1TXKA 4YQXL 4KHTL 4KKCC 3UJIL 1AD9B 4AK1A 1YEDB 2I5YH 5C92A 4DW2L 4KHXL 3KPTA 1A9EA 4ELMF 1QBMH 4KRPD 4NQDD 4P9HC 4AEIH 5FA4A 4RNRA 2XQBH 3EYUL 4PP1D 1JNNH 4Q9BA 2GI7A 4TQEH 3BP7B 4OFDA 5TDNA 1SJEB 2GJ6A 1Z9SA 2MKWA 3RUGE 5B3JF 2C9AA 5ETUA 2X4QA 2CIKB 3ECBA 3UXFA 3VD5A 3MO1B 3I50H 1B6DA 3L3JA 1UA6L 3AS0A 2FECI 2ZSVA 2Q86A 2YA0A 3RU8L 1IKNC 3HRZB 5C3TA 4UAOC 5T1KB 3MJ6A 3O81A 4HQQL 4JRYE 5GXBB 5L6YH 1CDGA 2I5YL 1LE5A 2C5DC 3GSNA 3U9UB 3GMOA 1AKJD 1QBML 5FEBA 3SE3C 4AEIL 3WO4B 2NXYD 4JHBA 1EX0A 3K3QA 3GJFB 1FC2D 1JNNL 2ORBH 5IBTH 1QSEB 1X5GA 3MV7D 3TWCH 3K8LA 2DQGH 4TQEL 3SKNA 2J8UE 1T4KA 3BYTA 1EGJH 3NA4A 2WAHA 5F9DC 4QCIB 1EZVY 5EO0A 1NANH 1IQDA 5C8JA 3D3VE 4GXVH 3I50L 5SX5H 2NNAA 5DQDH 3MFFB 3K2MC 4M7LT 4QHLB 4LQFH 5HYSG 2GSIA 1QHPA 4HS8L 5FGRA 5I8KH 2FL5A 3EO9H 4YUEL 2HYMA 3I75A 5C09D 1F3DH 4KRLB 3L3IA 4KK9C 1HEZB 4PJAE 2JIXA 4FQQB 3KXFD 2FZ3B 2W0FA 3CH1B 4NQEB 4OI9A 2NPLX 4OCRH 3BWAA 3GK8L 2VSCA 4PJCE 4XPBH 3RDTB 3QSKB 3S3PA 3BVNA 5IBLD 3L9RB 2ORBL 3QFJA 5IBTL 3TWCL 2DQGL 1F2XK 1GXEA 3WO4C 4P5KA 1EGJL 1C16A 2DQDH 1IZJA 2NX5A 1NBZA 4PJFA 5CSZA 5JA9A 4BH7A 4GXVL 2F54D 1YMHB 5DQDL 2E7HA 1DUYB 5K9OB 4LQFL 1GSMA 2VN4A 5EBLA 2X10A 3S34H 1EO7A 2NY7H 2QQNH 3FFCB 3PG2A 5I8KL 2I25N 1INDH 3EO9L 3RWHB 1T03H 1IMHC 3OG6B 1UZ6F 5GIRB 3VCLA 3Q1SH 2OJZL 3WXVH 2E7LA 3CC5B 2ZSWB 1KF9B 2Z31B 3N1GC 3S3SA 4G80B 4AMKH 4OCRL 4JFEA 4OIBA 1JF1A 1T04B 4XPBL 3SBWA 1JN6A 3LCYA 4Y5XB 1F00I 3VXRA 3MRFA 3E3QE 1VFUA 4TNVF 2P44B 3C5ZA 2P4AB 3RDTC 2CKBB 3KR3L 4LP4A 2DQDL 1A1MB 4E42B 4HBQA 4QWWD 4ZPVA 4GKNA 4GBXB 3QR2A 4LGRB 4X7TB 5HGBB 4OZIF 4KJWC 2BVPB 1N5AA 3VE0B 3QIWD 5I15H 2D4DA 2NY7L 2QQNL 3CH8A 4PRAB 3KS0J 1INDL 4MS8C 1I4FB 1T03L 3FQTA 3RX7A 2HFEB 1P7KA 1IEBA 4N8CH 3Q1SL 2BCKA 3VXTA 2R1WA 2V5YA 3NIFF 5SX5K 4XHJC 4MNQE 4AMKL 3UTQB 1HH6A 4S1QH 3FOLA 3RWGA 2ERJB 1QBLL 4N8VG 1T5XB 4TNVK 4F15B 2X89D 1MI5B 2Z31C 3FQWA 2OMBA 5D70H 2DQIH 2XYCA 3OAYH 3GFUA 2CUHA 3SPVA 4J4PC 4Y5XC 4QY8B 5EORH 5ICYB 1OHQA 3TO4D 1BJ8A 5E6IA 5ESAA 1MFAH 5EBGA 4EKXA 4BZ2H 3T04D 1F8TL 3IXTB 3VFPB 1HIMH 2FO4A 1BQLH 4Q74A 3X3GH 3QDJE 5I15L 4GBXC 3CZJA 5JORB 2GITB 3M1BB 3JVGA 1Q0XH 3IGAB 3TH4T 4LCYB 2BSED 4N8CL 3HB3C 3V52H 1ZGLP 4OKDA 4YO0A 1MUJA 1S9VA 4GRMB 1RZKH 1LO3H 1T3FB 3W0WE 1OWRM 1FYTD 3OXSB 3QUYD 3H2WA 1EHXA 1H15A 3WNPA 3HE7B 4S1QL 4NKIH 4UQ2A 3Q6FB 1D5IH 3F7PC 4DZ8B 2O61B 2V2XA 4DK3A 3OKDB 5D70L 1NGQH 5FK9B 3ZE1E 4PRDB 4XTRC 2HMIC 1MVUA 2ERJC 1DEDA 4F15C 2F8OA 2CLVB 4X98A 5EORL 1JMZA 2FX8H 1MFAL 1FCCA 4G6JH 4BZ2L 4FQ2H 5IMKA 4RWYH 1QSZA 1BQLL 3V0WH 2CRIA 4P5TB 3W11C 1KEGL 1F3RB 2FHFA 3KPLB 4EUPA 4PJ7F 3VWKD 2HTLC 4WNQA 5HHME 1ZVSB 3VRIB 1U93A 2GUOB 4HZLB 4U1KA 5SWSA 2X7LA 5I9QB 3DX7A 3V52L 1FN4B 3WIHH 3VFGH 3VXSE 1RZKL 1CT8A 1LO3L 4YDJB 1A1NB 4QXUH 3GMPA 3W9DA 5TH2A 3CSYA 1GZQA 3FL7A 1OD9A 4PRPE 4NKIL 1D5IL 4PV9B 1PKQB 2DQTL 2WBJA 3SKOA 4TVPD 4P3CH 1LK2A 1NGQL 1NUGA 3STBA 1QZ1A 3HE7C 4XVUD 1CTOA 1G6RA 3WD5H 5F1KC 3JV6A 1FVCB 1OLLA 4LAQL 2FX8L 1G84A 4X7EC 4G6JL 3VI4E 5I1IH 1XCTB 4FQ2L 4O2CB 3T4YA 1DLHB 5F93C 1JWMB 4RWYL 4NQDA 2BVUA 5DVNA 1QPPA 3KAAA 3V0WL 4OCSL 1FBIH 5DC9B 3SDAD 2NY2D 1JZ7A 5T3ZE 4WI4A 2W60B 5KAQG 4HIEA 3ZYZA 5GRWA 4PGCA 4P5TC 1AKJB 3WIHL 3VFGL 5AG8A 3GMQA 4J7RA 5JW4R 4QXUL 5IMMB 4G6MH 1TVHA 1QTYT 5I9QC 5KAQF 3RGHA 1I8MB 1MHHB 2E27L 3PL6B 1VFOA 2VERN 3M45A 1N6QH 5DZOA 3KDMB 2P5WD 4KK6C 3NZ8B 1M05A 1T0MA 1H0DA 3FB8A 4X0KB 3WD5L 4AQ1B 2PYEE 1JTTA 2VL5A 4P4RA 5I1KH 3NFNA 1K4CA 4AENB 2R23B 3C60D 1HXYB 5I1IL 1FV1B 2V2WB 4MWFB 4P2QE 5CS7A 5DDHA 1HHHB 1FBIL 3UMTA 1ZA6B 1NCNA 1ZS8A 1CE1H 3CDGA 2FSEA 3MV7A 2W91A 4F9LC 3VG0L 5GSRA 3QUXB 3VD9A 1MCJA 1XGYH 2D31B 5FM5O 1CFSB 2A74B 1I8LA 3QUMA 1YN6A 5FKAA 4P9HL 3ARFA 5E03A 4G6ML 2APBA 2BNUB 3G5ZA 4S1DD 3BHBB 3ETBF 4KUCD 5DD1H 3U7YH 3B3IB 1QPXA 3O8XB 2EICA 2MJWA 4A6YB 3JTTA 4MD0A 1DVFD 1YY9C 3PL6C 4JQVC 1NC2D 1IAII 3SGJA 1AH1A 3MPCA 1O7SA 5I1KL 2F54B 4TSCH 4ZUVB 35C8H 1NDGB 3QDGB 1RZGA 2PKDA 1WZKA 2HFGH 2RR3A 4IRJA 2OTUB 3BQUB 5IW3A 3MRPB 1CE1L 5EO1B 1IARB 2YPVH 1FFNA 3PDOA 4HIIA 4MQXD 4KDTC 4FFYH 1OGAE 1XGYL 2GT9B 2K1MA 1LMKA 2HVJA 1EJOH 1U8PB 4IRSA 1R3IH 3AU1A 2MOVA 2GJJA 3QUXC 1J8HE 3QEQA 3C08H 1Y0LA 5EUOE 5DD1L 4HLZG 3QQ9D 3U7YL 5HYJA 4JN1H 2NY0B 4V1DA 4H25A 2EDLA 1EEZA 4IHOB 3T3PF 4M9OA 4ZSOB 5CMAA 4TSCL 35C8L 3O8XC 1I75A 2HFGL 5IF0A 3RWJB 4JZNA 2YZ8A 5DURD 4C54A 2P5ED 1B0RA 4LFHG 1PZUB 4RQQB 2R1XB 3WFEH 4NYLA 4PJHB 4Y7MA 3G6JE 1GOGA 2DKSA 3BQUC 4U6YA 3RI5F 1MHEB 2B0SL 4D94A 3FQUA 1G9EA 4LLMA 1EJOL 1R3IL 3QQ3B 2R2EB 1T2QL 5E2UH 5C0AA 2QSVA 3C08L 3QIWA 1RUMH 5M95B 4UMGA 3LSOA 5A40E 4I48B 3GSVA 4NQXA 4K8RC 3WDJA 3FQXA 4JN1L 1WQVT 3OKMB 2NLJA 5D2NE 2VITA 4XCNA 4CADA 3TIDB 2ARJA 3CIQA 1D5ZB 4P59H 1R3JB 4LGPB 2J6EH 5DMKA 3RPKA 4G9DA 2NY0C 5I6XB 5CSBA 4NQCA 4U7MA 3DGCR 4YDLB 2EZ0C 1NKOA 1CG9A 3LV3B 1S7XB 2X89A 1OOAA 1FO0A 1M71A 2ZJSH 3TO2A 5LWYH 5IB3A 4LNRA 5IQ9A 2IH3A 2VISA 3UTSB 2NZIA 3ULVC 4D9RD 4WTZG 3RWEA 1T0NA 5T3XH 3VXNB 4WV1B 4HG4J 4F7TA 1G0XA 5E2UL 5CP7A 5CJOH 1BVKB 1DSFH 1CI5A 1RUML 3QPXH 2NR6D 5EZLB 1NFDF 1EAPB 1H8SA 5DRWA 4PLKC 5FYJU 2LE9A 1P53A 5GGTA 2AKRA 1F4XH 3X12B 4P59L 2WIMA 1U8MB 1U3JA 2J6EL 4PJFF 2CKBH 4HDIA 1QFWM 1FYTA 3WDHA 4HEPG 4ZXBB 5GHWH 1LWRA 5K59F 2FR4A 1N8ZB 3MUHL 4N0CC 2G5BB 4RGND 1EFXA 1F02I 3WFCH 3CFDB 5I6XC 5LWYL 4PJDA 3BZ4B 4YDLC 2NQCA 2FGWL 1BECA 1IILE 1WCBA 3MUGA 1OPGH 1OP3K 3A6BH 5T3XL 1GL4B 1U92A 1UH4A 3R4DA 1OB1B 3DMMA 4ZPTA 2V7NA 3HPLA 4UOW1 1A8JH 4Y89A 1DSFL 3C9NA 4KV5F 2VDRH 3QPXL 1CD1A 4D0DA 4WV1C 4JFFB 1Z9OA 4MJ6A 5SV3A 2ADGB 2EIZA 3UYRL 1G7MA 5DTFA 4FG6D 1JWSB 1U8IB 1BLNA 3HC4H 3MBEA 1YQVH 3ZDZF 4PJ5E 2CKBL 5TGBB 5SWZD 2HN7B 5D6CB 1EHAA 1MREH 3QPQC 4HWEH 1YJDC 2IC2A 3WFCL 2V9TA 5JXAH 2AJXL 2EDFA 4ZXBC 5DHVB 5JHDE 3DI2B 3S96A 1AE6L 1OPGL 3A6BL 1NUNB 4ZO7A 3DV4A 4J3UA 4AYFA 3OF6A 3PNWA 1KUMA 2ICWA 3UTTD 3EOYG 2JCCB 2G2RA 5HDOA 4N5UA 2CK0H 3JXAA 3RVVD 5C71A 5C2BH 3SDAA 2GKIA 4ESKA 2GTWA 4X5LA 4KVNH 2CR3A 3UCRA 1ZHKA 3C60B 1MLCB 4X6CE 1YQVL 3VFNB 3S4SB 3CDCA 3QFDA 5DJDB 3TVMA 5IHBA 4HCRH 5FDWA 5IV2A 1MREL 1FVEB 2VH5H 4HWEL 2FECL 1BBDH 3U6RA 2WIIB 5JXAL 1MQKH 5DJ8B 1OSZB 5F3BA 5DRNA 3AS3A 5JDSA 2VQ1B 4HD9A 2FHCA 4IIQB 3G5XA 3V9FA 3K0WA 2PF6A 4JQXA 3DUHA 4EQ2A 3KPSA 2FGZA 4UOJA 5A2KH 2AV1A 1NAKH 5F9OH 1UQSB 2CK0L 4XX1E 3O6KH 3QUKB 5C2BL 5DJZA 3LKQB 5HJ3A 4YAQA 4KVNL 4JFPA 2XRAH 3GDBA 1A5FH 3IKCA 3M17B 5F7EH 1TQCC 2YK1L 5C0EB 3H9HA 1J86A 3RY5A 2Z91A 4B41A 3BIKA 4D0CA 3MSPA 3QWRA 4QHNB 4HCRL 3H0TB 3C60C 4QKXB 2H2PC 4JFDD 4ELME 1HQRA 5DFVC 1GHFH 2VH5L 3FT4A 1BBDL 1HHKB 1MQKL 2JE8A 2EDQA 4PJXA 5J13B 5FO8B 4YIQA 4Y4KB 1YMMA 1QVOB 1XGTA 4APQA 5B3JE 1DQJA 5C08D 1LNUB 3Q6GH 5I1CH 5JPNB 4YFEA 4IIQC 4KI1A 4HUVB 4WI9A 4LBEA 4P46B 2IFFH 4S1DC 1NAKL 4L4VB 5F9OL 3O6KL 4U1LA 3I9GH 2V2TB 4YFLF 1C12A 4MJID 5GGUB 5BZWB 5JHLH 2XRAL 4HMDA 1A5FL 4EIGB 3ILQC 3KPOB 1OGTA 3DURB 1KG0B 3QHFH 5DURB 5AD0A 2IJ0C 3KYOB 3LPWA 1S7TA 1JHKH 3NFPB 5ESQA 3VRJB 5ADOL 1CZ8H 4KK5C 1GHFL 3CPLB 2YRLA 4LHUA 1K2DB 3C8KA 2H26B 2ILLA 4GUPB 4K2UH 5EA0H 3GO1H 5DJAB 4FTVB 4O2FB 1RZIA 5HVHB 3EGSA 3Q6GL 5I1CL 5J13C 2AQ1A 3PGFH 4O58H 4QRRE 4Y4KC 1VCAA 5DR5H 3LEXA 1TZGH 3QNYA 3I9GL 1Z5LA 1ZLSH 1T6VN 1D5MA 2V7HA 3OHXB 4P46C 3OR6B 4J23A 3K74B 4Y4FD 4A6YH 3QHFL 2X4OB 2JJUA 1FZOB 4BSWA 1JHKL 3VXMB 1R3KB 3UTZA 1CZ8L 5I1LA 4WHYH 4U3HA 2N7BA 4OZIB 2QSTA 2Y4SA 3SKUD 4D9QE 3O6MH 4JPIA 4Y1AE 3WS6A 3HA0A 4GOSA 5D7IA 5IEHB 3P0VH 4K2UL 5EA0L 3IDYB 2XTJB 4FN0A 3GO1L 5FO7B 4CJ1A 3WS3B 4JPVH 4RMQA 4YBHA 4ZFGL 5ICZA 3P73B 1OSPH 1AGBB 1HQ4A 4PJ8B 3HMXH 4KK8C 4O58L 5JW4Q 1A6PA 4HHAB 2O5YH 5EIQA 4K8RH 5HVHC 1P69B 4YDIH 5DR5L 2VLJE 1HHGA 1TZGL 3P0GB 3ELAT 3SKJH 3TFKC 3CZFB 2R15A 3QXVA 1ZT4B 5DEZA 5I75B 5DJCB 1ZLSL 4MA3B 5FCUL 2G9HA 4FQIH 2FJGB 5C07D 1UZ6E 4A6YL 5IFJB 3HE6D 1WUNT 4RZCB 2Q6WA 3H7BB 4Q6IB 1K5NB 4IMKC 4N8VB 4LRIC 2E9JA 5I2IB 1JPTH 1NGZA 1YC7A 3PHSA 4XP9H 3RPIA 5MEND 2L4OA 1TNNA 3ULVH 3EJJX 2BHUA 2IFGA 3UBXI 3ARSA 3P0VL 4G8IB 2RAMA 3IT8D 1L9NA 2HFTA 2YPLB 4M00A 2NY4D 3S36H 1L7TH 1SYSA 3IDYC 2XTJC 1FG2A 3S8WA 1KPUB 3HMXL 4Q0XH 2O5YL 2JF1A 2DIJA 4I18A 1HSAA 4K8RL 4NZJA 1M4KA 1FL3A 3H6JA 2P47B 5E00A 3SKJL 4WHCA 2EE3A 2UWEA 3SEPA 4CU7A 3TZVD 1PYWA 1OWWA 4X6BA 4FQIL 4NFDA 3FO1A 4CVXA 1FJ1A 4M5YH 1BFOB 3MV8B 4H0GA 3NIFE 2HG5B 5I75C 5FOBA 4F33A 1OTSD 4MA8H 5E4IA 5HYEA 4XC1H 1K6QH 3QO0B 1JPTL 4MNGB 4N9GB 5EOTB 5MHSD 2AXGA 2F53E 4Q6IC 1NGWA 5E1AA 4MD5B 2E7MA 3ULVL 3DECA 1DR9A 4BQCA 1VKXA 3MNZA 1JZ4A 3VXOB 3WJJC 3WHXA 2A2QT 5EU6B 4HUWB 3HLAB 1LO0H 1LP9E 3JWOC 2Y23A 3S36L 5KVMC 1WGOA 1L7TL 4TSBL 4NZTH 4MAYA 4Q0XL 4OFVA 4N0UB 4QYOB 2XICA 5KVFH 1X5ZA 3NPZB 5I8EB 1JYWA 3NABH 3DX9A 3ZKXB 3GIZH 5KVGH 4M5YL 4WFED 4YNYA 3KLHD 4PV8B 3MNVA 2YRPA 4MA8L 2HH0H 4XC1L 5FKPA 1YJDH 1K6QL 1E4JA 5DO2C 2LTQB 3H9SB 3WUWA 4HUMB 1CCZA 1MCOH 4HC1A 5A16A 3QDMD 5J1TC 3L6FA 4KTEH 3W9EA 1YNLH 3LD8B 3MYJA 4LCUA 5F7LB 5F96H 4ORGB 4WUUD 3OKNA 3RTQD 1P5UA 3D25B 1KBGH 1X44A 4LKXB 4WWID 2CJUH 1LO0L 5KOMC 3ARBD 3IDNB 4NZTL 5ENWB 3KPQB 3ARPA 1OT2A 3AC0A 1SY6A 5A43C 5KVFL 3BWUC 3RVVC 3BZDA 4PJ7E 4XZUB 4BH8A 1IAKA 3GIZL 1N7ML 5KVGL 4LSRH 4ZAKB 4HJGA 3U46A 4GS7B 5DLMH 5C0GB 1WV7T 3MV01 3KJ6H 4TTGA 1E28B 2HH0L 3ZKXC 2DMBA 5L0QB 1YJDL 1DBAH 1JFQH 4OI7A 1AIFB 1WJ3A 1MCOL 3JV4A 1N59A 4HKZB 2EE6A 4PJDF 2X40A 2V5TA 4ZFZA 1YNLL 4AJ0A 5F96L 1P7QB 2VLLA 5C08B 2LTQC 1DBMH 1I1AD 1NDMA 1KBGL 2CJUL 1S7RA 4L29A 1M7IA 3LD8C 4PUBL 3FOMB 2GCYB 3C6LD 1IGTB 3H9SE 4UV4H 4Y0GA 5FAAA 5J3HD 1A6AA 2DRUA 5ELIA 2ADJB 4HKXB 4MJ4A 4PPTA 2VSDA 4ONFL 3WIIH 5GSVA 3LKNA 2CRMA 5C6TH 1I7ZA 4LSRL 2APWA 3P30H 5DMJB 5MERB 1N0XH 5DLML 4K7PX 1VB9A 3KJ6L 2J8OA 4ZAKC 1DBAL 1JFQL 1KJ2A 5DA0B 1CXFA 4GS7C 3UBXB 4ZTOH 5GS0C 5FIEA 1HNGA 5IB4B 2X1WL 1NAMA 1MY5A 5L0QC 1X4YA 4MJIA 4IEFB 4XNMA 3Q2CA 1DBML 1R5IA 1LEIA 1R5WA 4FRWA 1P9MC 3MNWA 1I85A 4B53A 2BNQE 1PEZA 4UV4L 3T0EA 5C0DB 5EOCH 1A9EB 1CFTA 2HFFB 4WFHD 3S35X 1QLFA 4RNRB 5DD6A 2KZ1B 3HZKB 5JR1H 4KXZI 1ZMYA 1A6TA 3WIIL 3M8OH 3DGGA 1BD2D 5C6TL 2W0KA 5IW6A 5J57B 4PRHB 1AO7A 5TDNB 1N0XL 2FNBA 4Q97A 2GJ6B 2VDPH 4PJBA 5FHBH 1OAZH 4GAYB 2X4QB 2JJSC 2IANE 3OJVC 4QNPF 4HKBA 3ECBB 3EDDA 3L3JB 2C1PA 1OAQH 2ZSVB 3FCTA 3A6CH 3QULA 2Q86B 4QEGA 1TPXB 1NCDL 4RISH 4HIJB 4Y4FA 5FYKU 4NOBA 3H7LA 4FQXD 3GSNB 5EOCL 4WI3A 3GMOB 3RKPA 3ME0A 1R3HA 3O9WD 5F7KC 4DK6A 3M8OL 1UACH 1AXIB 4HJJH 3MCG1 4YWGL 5C1MB 2Q3ZA 5EO0B 1FFRA 1MAML 1OAZL 1XGQA 1B9ZA 3EOTL 1S3KL 4G8FA 5C8JB 1IKFH 5TJWK 1IVLA 2NNAB 5F1OB 5F7DA 3TA3D 3BDBA 5IFAH 2GSIB 4ETYA 1F6AA 3A6CL 2VAJA 2NY4B 1RQ5A 5JO5A 3G9VA 4RISL 2MCG1 5E0QA 3I75B 3PQYA 4HIHA 3T0DA 1A2YA 4LLUB 4JZJB 4Z95H 5GRUH 1J1OL 1TPXC 4F58H 2JIXB 4PRBA 3NN8A 1MEXH 1K3IA 2W0FB 1P6FA 4U7SA 4HWZA 1I3RA 2L7UA 5ITFA 3BWAB 3ORJA 5MENA 2FEEI 3QXDA 1X5FA 1KTDA 3V0VA 4JFXA 4LHUG 4XP4H 2YUWA 4EDXA 1MNUH 3LN9A 4NHUA 3VG9B 4HJJL 3MGTA 4P5KB 3INUH 1C16B 1IBGH 3CXHK 2NX5B 1NBZB 2P46B 4G5ZH 5HPMA 4NC1C 4PJFB 5CSZB 1D5BB 4BH7B 2ITCA 1ED3B 2FH8A 4HT1H 2QADD 4RX4A 5IFAL 3T65A 3MLPA 4ONHA 5EBLB 2VXSH 3SO3B 3GMRA 5KZCD 3OKYA 1MJ8H 3AY4A 2JKXA 3VXUA 3DV6A 3MLSH 3VCLB 4WO4A 4Z95L