5I74C

X-ray structure of the ts3 human serotonin transporter complexed with br-citalopram at the central site
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
214
structure length
214
Chain Sequence
DIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYSIPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Sodium-dependent serotonin transporter
publication title X-ray structures and mechanism of the human serotonin transporter.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2016-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i74C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i74C01
1P5UA 5D4QA 4MAUL 4DUVA 2DQUL 2BOBB 3REWB 4DZ8B 5LQBH 4IDJH 5E7FA 4ZXBC 1J05B 1FAKT 5GSVA 3O0RL 4P3CH 5F96H 5I1EL 4X6DB 2F74A 3TBSA 3PGFH 4EUPH 4GKNA 4ODVH 5ACLA 3W11D 4HFWB 2W9DL 3FOMB 3LS5L 1DBML 4XPGH 4MVBC 3B6SA 4HWBL 4PJFB 3HG1B 4XPTL 3C2AH 1P7KA 4GAYA 3E3QE 3CVIH 3GKZA 4QHNB 1NFIB 3VRIB 5E70A 3ROLB 2IBZX 5FHBL 5E8OA 4M7JL 4LRIC 1ZGLP 4UUJA 5TF1L 1AD9A 4NQDB 4O51B 5J13B 1Q9OB 5E99H 4WY7L 5JNYB 4OV5B 1HILB 3DTXA 4X9GA 1TQCB 4LSPL 1IQDB 3HPLA 4WUUB 4MJ6B 3S3SA 4ZTOL 2VL5B 2Q76B 4CADA 1IBGL 4NRYB 4M6MH 5GGVL 3O6FC 5K9JH 2V5SA 1FV1A 2M8XA 4OGAC 3IFNH 2AV7B 1I9IL 3ARPA 3QUKB 3TH2T 1JWMB 4X6DF 5DEFB 1RZKC 4Y2DD 2BOBA 3REWA 3VD7A 2VB5A 4DZ8A 1IM9D 4F8TA 2OR7A 3LKQB 3HLAB 1J05A 4NZJA 4PJFF 4IRJC 1TTGA 1KPVB 4P9HH 3SBWA 2OTUB 1MCDA 5HHOD 1IQWH 4X6DA 3NFSH 1CLZL 1W8NA 5HHOE 3B2UC 4HUMB 4K7PH 4HFWA 3FOMA 1NAMH 4PJFA 1HCFX 2E7LA 3HG1A 3BD3A 3ZE2E 2FIRT 4ZSOB 3MRCB 2EDXA 4QWWD 1FIGH 5CEZH 3O9WC 1V05A 4QHNA 1NFIA 2F58L 4Y5YC 3RGHA 3VRIA 4R4FH 4QRPB 5GRZA 3ROLA 3ULVC 4QHKI 4O00A 3U9UB 5H8DA 1MCPL 3G6DL 3OSKA 4MA1B 4AEEA 4O51A 1A6VL 1Z3GH 5A16B 4MDIB 3B2VL 4P2OD 4KMQA 5JNYA 4LDOB 3W39B 4OV5A 1HILA 1FPTH 4NC1E 1IAKB 4QRQB 1OLZA 3OB8A 3LMJL 3EDDA 1R3KA 3QUZB 5FCUL 3VXUE 1IQDA 1HINL 1VFOA 5IMKB 4WUUA 4MJ6A 3BPOB 1X5ZA 5HPMB 3OAZH 1B4RA 2VL5A 1DBAL 2Q76A 1P4IL 4NRYA 1J7VR 1KOAA 3QA3B 3MXWH 4MS8D 1U2CA 2NY4C 5CZXC 3T4AB 2AV7A 3QUKA 1JWMA 5DEFA 1M1SA 5C0ND 5BCAA 1X4YA 5CD3A 2EYRB 2MKWA 3LKQA 3HLAA 3CFJB 4XWGH 1KPVA 1C08B 1C5BH 2X4TB 5GJTH 1E27B 2OTUA 1IEAB 4APQA 2Q7NA 3B9KD 2LTQB 4QXTA 3GRWA 5GZOC 3ARUA 3UX9B 3SOBL 1YNTA 2IH3B 4OLVL 3MV11 4C59B 2CO6B 1CQKA 4ZSOA 3MRCA 2Y36H 5EOQL 4FXGB 1S5IH 2HTKC 1A5FH 5IBTL 2AEPL 3BSZL 4QRPA 3MBXH 3U30C 5HHVH 5C09A 1N3NB 3C5SB 3CCHB 3U9UA 3WCYA 4NBZB 3IJSB 5DS8A 4M43H 3B4NA 2HKFL 5A16A 2BY1A 4MDIA 2I27N 2JLLA 4UILL 3DX8B 3W39A 1Z9MA 5KSBB 1IAKA 4K23L 4QRQA 1I85C 4OIIL 2VQ1B 1UM6H 1WZLA 5GRJL 3QUZA 3BGAA 5IMKA 2XY1A 5HPMA 2ZSWB 2NY3C 1CTNA 4JFED 3FOLB 2X4SB 5ISZB 3SQOL 3S37H 3AB0B 3OB0H 3T4AA 4RZCB 4JFEE 2CLZB 4ZG1A 4KPHH 3MLYH 1FFPB 3W0WD 4X99B 3U0WH 1GJIA 1XGYH 4HW6A 4JFFB 1YMHB 3DXAB 2EYRA 3V52H 4YQXL 2XQBH 3QWQB 2DICA 4ZUUA 4NUGH 4MB4A 1DLFL 4GH7B 1C08A 3QUML 1JPTH 4AT6B 2X4TA 1E27A 1NSNH 3V0VB 2A74B 1IEAA 4H8WC 5L8KB 1NMBL 1KXVC 1DDHB 4RFEB 1VSCA 4JANB 5DMGC 2D31B 4LMQI 3SO3C 1U8HA 2ZG2A 1CZ8L 3C60C 2IH3A 2R4RL 3DBXB 2ICES 4FXGA 2EDEA 1U8NB 3NCYS 4TSBH 4WW1A 4YH6A 4WU7B 5KVDH 2HRPL 2AQ2A 3X3FL 1I3GH 2B4CH 3MRPB 5KSBF 1N3NA 2NX5B 3C5SA 3CCHA 3KPNB 4K94C 3IJSA 1IGCL 3IDJB 9CGTA 2VZVA 3NH7L 5HGHB 5EOCL 5JA8B 2UZIH 3DX8A 4IJ3C 5KSBA 5GS2D 2AK4D 4GG6E 4XP5H 1ACZA 3T2PA 5JDSB 2AERT 4JG1H 2AK4E 2ZSWA 1PKQB 1NMAL 1FN4B 5ANME 3FOLA 2X4SA 5ISZA 4X83A 4XNXL 3BO8B 3I50H 4HJ0D 1FYTD 2J8OA 1NC2B 4RZCA 3RGVD 1O0VA 2CLZA 3LQAH 5KSUB 5IW3A 1NCUA 1FYTE 1FFPA 4X99A 4JFFA 1YMHA 3DXAA 5FB8B 3IAPA 4DKAA 3SKNB 4K2UH 3V0VA 2DQHH 3ZYOA 2G5BB 5KJRH 1DDHA 4G8IB 1BZ7B 4RFEA 3P30H 4JANA 2D31A 3LZFH 4IDLA 2OMNA 4MMZC 5IOPB 1YNLH 2CKBL 4ODSL 1LO2H 5F7EL 2J7LA 2HMID 1ACYL 1S9KC 1L7IL 3SGKA 1AGDB 2QEJA 3LDBC 4TSAL 1U8NA 3VU2A 5D8JH 2GUOB 4M02A 4WU7A 5BO1H 2I60L 5EU3B 2A0LC 3MRPA 5TE4H 3QIBB 2AABH 5EOCJ 2NX5A 3SQBA 3KPNA 5DXWA 1ADQH 1U8OB 3IDJA 3UJJH 3GEWB 4BELD 4XB7A 4HWEL 5HGHA 3S36X 1V7ML 4GG8B 4LLMB 4Z77B 1QD0A 1FRGL 2HKHH 4ELKB 5JDSA 3NPSB 3RDTC 4EN3D 5FYKL 1PKQA 4GUPB 3TIEB 1FN4A 1NGXB 5H37H 3DO7B 3BO8A 5C0AB 4K8RC 4F37K 1NC2A 5IB2B 5KSUA 3GHEH 3WO4B 1JWSB 5D1QB 1KN4H 1TPXB 2XTJC 2JJUA 3SDAB 2XACC 3L7EA 5HGAB 1BFOB 5FB8A 2C7UB 3SKNA 1ZXQA 4M7KH 4CN4A 3KPPA 3RVXC 1NCCH 3KNBA 3KJ4B 3QI9C 2G5BA 2CK2A 2JJWA 4CVWA 4G8IA 1BZ7A 3D9AL 3T1FB 2Q7YB 1F90L 3MGAA 1DANT 4PBVC 4Y4KD 1A7QH 5IOPA 4MAYC 4KUCF 2QL1A 3BPNC 3W2DL 4U6YB 2BVPB 1C1EH 1AGDA 4D8PB 2GUOA 3K8MA 3DUHA 5HHXH 4TVPH 3MJ8B 5EU3A 2IALB 3O2DH 1RK0B 3QIBA 2IPUK 5KZCD 4E41B 5CIPH 5EU4B 1U8OA 3V4PL 3BFOA 2WLYA 3VFPA 2MCPL 2HVKB 5L6YL 5SX5H 3ARFB 4GG8A 4LLMA 4Z77A 2V2TA 4DAGL 3X14B 2JELL 4DN3L 5C92A 4ELKA 5JW3H 1UB5B 1YUHB 2BNQD 2V9QA 5HDQH 4J2XA 2DLEA 1T2QL 4GUPA 3TIEA 1NGXA 2BNQE 3KYKH 3DO7A 4O02L 5C0AA 1ZLSH 3UAJC 3B83A 3TN0B 5D70H 5IB2A 1G1YA 2YPVH 3QYCA 1JWSA 5D1QA 3LD8B 5EO9B 3WFBL 1AGEB 3SDAA 2X4NB 1BFOA 4JY6B 1E6OL 2GFBB 3IRZA 3PE9A 1A7PH 4M7LL 1MH5A 4QEGA 1EEZB 5EBMA 4NGHL 4S1DD 5IBLC 3FT4B 2CO7B 3MLVH 2XKNB 3T1FA 2Q7YA 1YEGH 4XCFH 3VRLF 3O2WH 4ORZC 3RKDC 2F19H 3RZCB 4JPVL 5KN5B 5I66B 4LHUD 3UDWA 1KXTB 1XR9B 3VH8B 4U6YA 2BVPA 1T7ZA 2IBBA 4HPYL 4D8PA 3O8XD 4PRPB 4QRRB 2IALA 1RK0A 1CD8A 4E41A 2UUDH 5EU4A 1PG7W 1OCWL 4OAWB 3MA9H 2HVKA 4PJXB 4LLDA 3ARFA 3EHBC 3OR6B 3X14A 1SJEB 3NCJH 4U1SA 1CGUA 1UB5A 1YUHA 2NY1D 2OLDA 3IDNA 1T1YB 5BOZG 3L3GB 5EZIL 4F7PB 3HZKB 2D7TH 4UIMB 5JW4M 4J4PD 4WV1B 3QUMB 3TN0A 4OBRA 4N90D 1JI1A 4P4KB 1FJ1B 1RUPL 5EO9A 2JCCB 4UU9A 1AGEA 2VQTA 4N90E 5FUCE 2X4NA 4JY6A 1CU4H 1D5BB 2VR9A 5ILTH 2Z31C 4LGRB 3AM8A 3VXUB 1CGWA 3FT4A 5F7FA 2XKNA 1CXLA 4NM4H 4JY5H 1N6UA 4P9ML 2GJ6B 3RZCA 2YKLL 5KW9H 5KN5A 5I66A 1A9BB 3C9NB 1XR9A 3VH8A 1WWBX 4OLUH 3BKJH 1U8QB 2EIZB 3MREB 4XC1L 4PJXF 4RQQB 2XIDA 5IB4B 4PRPA 5F70A 4QRRA 3T4YB 3ULVF 2J88L 5I9QC 4XMPH 5EO0B 2AEQH 4OAWA 3HS0B 4S2SB 3VWJC 1O7SA 2CR3A 1MVFA 4PJXA 3OR6A 4Y5YA 1W0YT 3DVFA 3LV3B 3CDCA 4YXLL 4RMUA 1SJEA 5DC9B 2ENYA 1MCFA 3RX8A 1Y0LA 1T1YA 4L8BB 3L3GA 5DLMH 2G9HA 4F7PA 3HZKA 4J3UA 1FDLL 3IB4A 5AZEH 1OAYH 4UIMA 5KVFL 4WV1A 3QUMA 1T7XA 1I1CA 3SDDC 1KFAL 2DQGL 1E4KC 4P4KA 1FJ1A 3OKYA 5AYUL 1T7WA 2JCCA 3IDYC 4PJHE 5HYJB 4I13B 2VLLA 2NY3B 4HC1L 1D5BA 3FAXA 4JHWL 1QHOA 3DRTB 3S3PA 2VDRH 3QG7L 2CKBB 4PBWD 3NOIA 1KENL 4RISL 1P7QB 2QHRH 3MA7B 5I76B 3CX2A 2IGFH 3HR5B 2GJ6A 3S7GA 1A9BA 3C9NA 5IF0B 3MRBB 1PLGL 3D1MC 3WIIH 1N7ML 1U8QA 2EIZA 5J06A 3MREA 5IB4A 4RQQA 3WN5B 3H42L 3SO3B 1F8TH 1PQZB 4R2GD 5EIVA 2JJTC 3TO4D 1BBJB 1CG9B 3FN0L 4HWZB 5EO0A 4S2SA 3HS0A 4K94H 5KVEL 1MCHA 3BGFC 5F1OB 1INEL 3GZKA 2O5ZH 3LV3A 3BH9B 1MFAL 2LQRA 4R90H 2IPTH 1TMCB 3H3PH 4L8BA 1CDJA 4GMTL 3D0VB 4D9LH 1SBBA 2EO9A 4TVSa 1A47A 5FDYA 4YHOH 3D25B 5I1AB 1C5DB 1RV6X 2EH8L 4FNLH 1LO4L 5HYJA 1LNUB 3D39B 5GS1B 4W68A 4WDIB 1DQDH 4OFDA 3L95B 4HH9B 1JYNA 5AZ2L 3DRTA 4KVCH 1A2YB 2CKBA 3ARWA 4PJEE 1GH7A 1I7RB 4HSQA 5K93A 2ZCHL 3BHBA 3DURA 3MA7A 5ANMB 5I76A 1PYWB 4HJJH 3U7YH 3HR5A 4JCLA 4OLWL 2DJSA 1NCWL 3BP5B 1V3LA 4BSJA 3EDFA 1UVQB 2ZPKH 5IF0A 2C4FU 3OXRB 3MRBA 5JLZB 1GRWA 4X6EB 3WSQH 5JXAL 3G6JB 3WN5A 4S11A 4UT7H 1T1XB 4Z0BH 1BBJA 1CG9A 2GKIA 2BDNL 4HWZA 3JUZA 2EZ0D 4Z76A 3DGCR 1SY6H 1G7IB 4ODTL 5DHYB 1U3YA 5C6TH 1QPPA 3NA9H 4JKMA 4NC0B 3NIGF 2BMKB 4ONGL 1CFVL 3BH9A 1EBPA 4Y4FC 4I2XE 4TPRL 4JREB 2R23B 1HOCB 1AXTL 3HAEB 5ETUB 4CNIB 1CICC 3D0VA 5DUMH 3MR9B 5CMAB 3HI6H 3LN5B 2VLJB 3FB8B 3VGGA 2BERA 3A6BH 3D25A 5FYLH 4OD1H 5I1AA 3GSNH 2PR4H 4LEOB 4WW2C 5E2VH 4JFYB 3D39A 3HA0A 3PV6B 3V6FB 4IBLT 1XGTB 5FUZL 5JW4R 4WDIA 1EBAA 3L95A 4HH9A 1MJ7L 4RGNC 1A2YA 1J1PH 3GNMH 4Y88A 3KWWB 4FQHB 4N1EA 4AG4H 4CU6A 4UINH 2AS5M 4HXAL 1PYWA 3G6JF 1J0ZA 2E6PA 3TZVD 4KK5C 1I7TA 2BX5A 3VGBA 1WZ1H 3BP5A 4X7TB 3MJGX 1YY8B 3VFPB 3PWNB 1UVQA 4GKZB 5HD8D 4YFDB 4G6FD 1JZ4A 3OXRA 5JLZA 2J5LB 4WWID 3G6JA 4EIZC 3DARA 1G0XA 1A6UH 1I1AC 2DAVA 1S78D 5F9AC 3UTPD 1T1XA 1A22B 3OF6D 4LIQE 3BP7B 1MHCB 4JB9H 3TBYB 4CL7A 3UTPE 1PG7H 5HHMB 4JHZA 4EQ3A 1G7IA 4GBXB 5DHYA 2P7TB 4PY8J 3WE6B 4MJIB 5LVEA 4K3GA 2BMKA 3SE4C 1KELL 1CDYA 3M1BB 3N0PB 3K1KC 3WHE0 1UACL 2WINB 4RRPA 5HI4D 2R23A 1HOCA 3OWEA 5HHNB 4APQD 1BLNB 4P49A 5E95B 3HAEA 4Z7WE 3QNXB 5ETUA 4CNIA 3MR9A 5CMAA 4ZNEA 3E8UH 1QSFD 2VLJA 1JFQL 4JN2B 4UBDD 1QSFE 4G6AC 5F1KC 4F9PA 4LEOA 1OWRM 1QFWH 4JFYA 3QQNA 2CUMA 3PV6A 3V6FA 1XGTA 3QZWA 4XZUB 4Z7VB 1JYXA 1RZ8B 2G75B 3EYUH 2IADB 1DL7L 3V6ZB 1OTSC 4YDLB 3FN3A 1CFSB 5KANI 5C09D 3KWWA 4FQHA 4YZFE 5HJ3A 3T3PE 4V1DD 3OKOA 5J1AB 5IJKC 1B6UA 3INUH 4ZQKB 4V1DE 1XF1A 5CEZE 3KG5A 1YY8A 4JZJC 1EJOL 3PWNA 4GKZA 3GBML 4PJDE 4JRYD 4XPHH 1A0QL 3HNVH 4YDIL 5DC0A 4P2RB 1E4JA 3QI9A 1A7NH 4CJ1A 4JRYE 5LQBL 1SM3H 1SYVB 1NAKH 2P42B 5TFSH 1QLRB 2GSGA 3LIZH 3STBA 3IFOB 3QNYB 2HLFC 3QEHB 4GAJL 1I9JL 3MJ7B 3BP7A 4JO2L 1MHCA 3OGOE 4P3CL 3TBYA 3L3HB 4R0LC 3JUYA 4E5XB 4J3SA 5AYQA 4ODVL 4UI2A 4BQ6A 4GBXA 2P7TA 3C09B 4MJIA 2J8HA 1KB5H 2Z4QB 4XPGL 5IM7B 4NP4H 3L5WB 5L9DH 4WI6A 5DQ9B 3M1BA 3PGCB 4XBPB 1FVEB 2WINA 3V8CA 3C2AL 5JUEL 5SWSB 4CMMB 5HHNA 1BLNA 5C0FB 1YMME 3QNXA 4JQIH 4Z7VF 4YR6B 5TQ0H 1FZOA 3IJYB 4JN2A 2DWDA 5F89B 4LNVA 4N9GB 1JF1B 1BX2A 2EYTB 4RWYH 3K74B 4FQ2H 1BF2A 3CK0H 3D85B 3GFUA 4UIKH 3SKOB 3O11A 5I19H 4MA3B 1KJ3H 1OOAA 4XZUA 4Z7VA 1RZ8A 2BOCA 2G75A 4N5UA 2IADA 5E99L 3V6ZA 4WI4A 2D0HA 1CFSA 1OTUD 5DUBA 4KJPC 2P8PB 3HE6B 5GS0C 5ADPH 4NSKB 4XCCL 4K71C 5J1AA 3V7AG 3IF1B 4ZQKA 5K9JL 2AJSH 3LVEA 3D87B 3KLHD 4WUKL 1RPQA 1TLKA 4P2RA 2HN7B 4YFLI 1TTFA 1SYVA 1QLRA 3IFOA 3QNYA 5C07B 4KK9C 3QEHA 1J86A 3PV7A 3MJ7A 4P9HL 3L3HA 1IQWL 1KTDB 1WAAF 4O2CA 4E5XA 3NFSL 2W60B 4NRXB 4PG2C 3TJHC 1RIUH 5ITBH 3HZMB 4JFFD 4M1GH 1NAML 5IM7A 2X9YA 2Z4QA 3L5WA 3QWOB 1Z0MA 5DQ9A 3PGCA 4XBPA 1FVEA 1LK2A 5SWSA 1WAAA 3C5ZB 4CMMA 2CRZA 1V3MA 3V9FA 1FIGL 5CEZL 3TNNB 4YR6A 4JPWL 3ULSA 2V5TA 4HC1A 1U8MB 4C57C 3IJYA 4LCUB 3TEUA 4BUHA 5F89A 4N9GA 3S88H 5I74B 1NMCC 1JF1A 2EYTA 3D85A 1RY7B 4MA3A 4U3CA 2V9TA 5KOVC 3GMMB 1OW0C 4XHJC 4M6AA 3STLB 4Y19B 3MLUH 5D1ZB 2P8PA 1YY9D 4Y2OA 2YR3A 5HTSA 4LVNB 3B5GA 4KRPD 4NSKA 1CDCA 3S3JA 3IF1A 1S5HB 2KUTA 4M62L 3HB3C 3MXWL 2DKSA 3O6LH 4LL9A 4JZNB 1JHKH 3O4OB 2Z31A 3VH8G 1NLBH 3RX7A 5CJQH 3ZLQC 1UYWH 1ZLWK 1KYOK 5T3XD 1U3ZA 2HN7A 2AGJL 3T3ME 5C07A 4XWGL 3VXRD 5T3XE 1F11B 3T8XA 3NABL 2ICEB 2GK2A 3VXRE 1E4XL 1KTDA 2CUIA 2W60A 5C6PB 4NRXA 3BMVA 5MEND 1X5JA 3HZMA 1HZHL 3PL6D 4MD0B 4KGLA 5CD5D 4X5WB 3QWOA 5MENE 4G7YH 3UZVB 2ZNWA 3PWPB 2B5IB 2IANA 3C5ZA 2Y36L 4HV8B 3TNNA 5D7KD 1S5IL 1EJ6A 2FEEI 1U8MA 3MBXL 5D7KE 4LCUA 5HHVL 3VMNA 1JL8A 1RSFA 4BH8B 4OTXL 3VFGL 3HC3H 1X44A 1TJHH 1GIGH 4LCWB 1AQDB 1D5MB 3GMMA 3ZKXB 4M43L 4D0DB 1LE9B 2X89A 3DHJA 1EHLH 3STLA 4Y19A 4FTVD 3U1SH 1Y18B 3U7AA 2F5BH 4XXCA 4FTVE 1MIML 3MRDB 4KQ4H 3PQYB 1IC5H 1S5HA 5C9JB 4MNHB 3KXFE 4PRBB 3S37L 4JZNA 4W4OC 4ZOBA 1PEWA 4O2FB 2GY5A 5BW7A 2EDJA 1F4YH 3P9MA 3U0WL 1TCMA 1H5BC 1BZQK 3DROB 2XQBL 4PJEB 4W81A 3V4VH 1F11A 2R9HD 4PG9B 2ICEA 1NSNL 4M00A 2V9RA 5D1QD 1LEIB 1X3DA 5E2UH 1O7VA 4H1LH 4X4ZA 5FO7B 5T1KB 2FB4H 4MD0A 5MP6H 3CUPB 3SE9H 3NZ8B 4X5WA 3PWPA 4DJMA 1N2RB 2V7HB 1I1FB 3U82B 35C8L 2JJTA 3QFJD 3ZE1E 5J11C 5GQBA 2NY0C 4N0CD 3CFKB 4HV8A 1DZBA 3QFJE 4TSBL 3B5TA 3PP3H 3HZYB 4ZXBD 1I3GL 5I1IH 1N0XL 2P5WB 2WM0A 2CGRL 1AFVL 3GJFB 3WEXB 4BH8A 3VD9A 2AXGB 4LCWA 1AQDA 1D5MA 4D0DA 1DUZB 1RU9H 2B2XH 4I2XB 4JPKH 2UZIL 4RBPH 1Y18A 1R5WB 4MVBD 1CXIA 2BNRD 1NGWB 4HPOH 5DGQA 4MD5B 3VXMB 1OP5H 5TQ2L 4JG1L 4XVTH 1MFNA 3MRDA 2BNRE 3PQYA 1FL6B 5GRVK 3VXTB 5GGQL 5IROA 1CFBA 5D7JC 3HE7B 3L3JA 4XRCA 3BYYA 5C9JA 4MNHA 3I50L 5EWIH 4O2FA 2NXZC 3LQAL 4TVPE 3WHXB 4EUPB 2YK1H 4P46C 4UTBL 5EU5B 2CDEB 3DROA 2I07B 4EI5B 5KVGH 4X9HA 2DBLH 3JTSB 4K2UL 2X09A 1U58B 4PG9A 4XAWH 1UT9A 4GOSA 4YHLH 4DQOL 3MLXH 1LEIA 3P9WB 1D5IH 2PO6C 1GOHA 5IFAH 3LN4B 5FO7A 5T1KA 4GRMB 3MZTA 3CUPA 3NACH 1R5VB 3RU8L 5HDBF 3NZ8A 3O6FD 1N2RA 2IMNA 1I1FA 4EQ2A 1LO2L 4IOFC 4OGAD 3K4AA 4LLQB 5EUKB 4M1DL 1EXUB 5GRXG 1D6VL 1UWXH 4JKPL 5D8JL 1YPZE 4S0TD 5BO1L 5DI8B 4X4YA 1DQJB 5CZVH 3HZYA 5TE4L 4IRJD 2AABL 3W82A 2P5WA 3GJFA 1NBQA 2AXGA 5FV2A 3T2NL 1DUZA 1IAIH 3H9SB 1QYGH 1CICA 3B2UD 2J12B 4X98B 5HSFA 5MI0B 4KHXL 1R5WA 4QRRD 5T1LD 1NGWA 2HKHL 3EO1B 3ZKSD 4MD5A 5D71H 3VXMA 2W92A 1AJ7H 3VXTA 1CBVL 1FL6A 5F9WB 5HDLA 1VB9A 3MUY1 1G9MH 2E3VA 4LVHB 3ALXA 3UBXB 3O9WD 2V17H 4M5YH 5I15H 1XIWC 1YC8A 3ULVD 1FNAA 3WHXA 1U2HA 3S4SB 2CDEA 2I07A 4LCIH 1NAMB 4JDZB 3T0AA 3VI3F 5I0DA 3JTSA 3MFFB 4D9RD 1U58A 4ZTPL 5E4EB 1U3JA 3RTQC 1RZGB 4D9RE 2XNAB 3QQ3B 7CGTA 1D9KC 4G6JH 3LN4A 4GRMA 1I8LC 5LWYH 1R5VA 1A7QL 5FYJH 4C58B 1B6DA 4MZ3A 5CZXD 2NY4D 4RRPG 5IV2B 4CW1B 1BMGA 3RWGB 5EUKA 4LLQA 3HAEG 1EXUA 2AK1L 1P7HL 1JHLL 1BJMA 1ZLVK 4P2QA 2B1HH 1MLBB 5FA4B 3FB7B 5DI8A 1DQJA 3B5HA 2Q3ZA 3TWCH 3O2DL 1DBKH 2RJMA 2VDQH 2BSED 3QZWG 2J8UB 4N1CA 5TDOB 4JVPA 1HIMH 3H9SA 4OF6A 5EBWB 4X98A 2AVGA 4G3YL 4IMKA 2R39A 5TJWK 5GZOD 2R29L 2BY0A 3EO1A 2RQ8A 1YMMB 1FGVH 3UPRB 2NY6C 4OZGE 4BSVB 3KYKL 4BZ2L 5GS0H 2HTKD 3UBXA 1ZLSL 1H8NA 4Q9RL 4U1HB 3LRSA 5E2WL 1JNLH 2PF6A 2YPVL 2GTWB 5C0DB 3FO1B 5CCKL 2F54E 1IAOB 4JPIB 3S4SA 3JWOC 4BQCA 1CXKA 1NAMA 5TPWH 5IFHH 4JDZA 3SDXE 1JVKA 3MFFA 1PFCA 3BESR 3CZJA 4JKLA 4M7ZB 3T04D 3CVHH 1FE8H 1RZGA 2P1YA 5EO1B 3QQ3A 4JDVB 3MLVL 2M1KA 2NY3D 1X5HA 4O9HH 1QHPA 2F19L 3G5VB 1K8DB 4FQPA 5EZLB 4PJCE 5IV2A 4LVEA 4CW1A 1GXEA 4CDHA 3VXSB 5JOEA 2J8UF 1CLYH 4R6UA 5CSZB 4LQ1A 1GHFH 1MLBA 5FA4A 2GK0B 3FB7A 5E94B 4KMTH 1UEMA 5B4MD 4EDWL 4PY8I 4QTHB 3RHWF 3UPCA 5M95B 1RUQH 2VUYA 2J8UA 4ZDHB 5TDOA 5EBWA 3N1MC 5DMGD 1OAZH 2AJUH 5CJOH 3C60D 4KY1L 2EDRA 3UPRA 4N0FB 4BSVA 1GYAA 2DQEL 5JQHC 2D7TL 4Y0GA 2K3TA 2EDNA 1MAJA 4XPBH 4U1HA 5C0CA 5A3IC 5F3HB 1JMXA 3FO1A 1IAOA 4JPIA 1G9NC 2Y1VA 5JA9A 1I8IB 4PV8A 1INDL 4WI5A 2P48B 4NCC2 3PGDB 4U6XB 1MOEA 4JZOB 1R5IB 3RRQA 5EO1A 1Q9LB 2NYYC 4JDVA 4K7PX 4NYLB 3Q3GB 4PGZA 1KCSL 3MNWB 2FHBA 1C7SA 1FFRA 1K8DA 4YWGH 4L8SC 5EZLA 2DD8L 2XZAH 5ERWB 2QJDA 2OXGA 3VXSA 4OLUL 1KT2A 3BKJL 5CSZA 2VJXA 3IDIB 1A14L 4OV6F 3BPLB 1JBJA 1A6PA 1DVFC 2GK0A 5E94A 2F53B 2YWYA 1XF2B 4QTHA 3P0YL 4IRSC 4KAQH 1I8KA 3ZDZF 4NQCB 1VADB 2O5XH 2YA0A 2GJJA 4KV5F 2AEQL 4JQXC 4ZDHA 3T65B 3JWDC 1OP3H 2AXHA 1F3JB 2YD5A 2Z92B 3MACH 5FIEA 2NY5C 3MRLB 3S6CA 4UZGA 4N0FA 2Q8BH 2SEBB 5DLML 2MOVA 4R3SB 2ATKB 5AZEL 5H2BB 1WICA 1OAYL 1S3KH 1PJ9A 1QNZH 5BQ7B 4NO0D 2PYEB 1N0LA 5F3HA 2A0LD 3C6LC 1HXMB 2C3WA 3R06B 1T66C 1P84J 1I8IA 1YNKL 2X42A 3KPSD 3QJFB 4OQ1A 4R97B 1XGQB 1KLGB 4YLQT 3DX6B 3W5MA 4JY4B 4U4BA 2VDRL 3KPSE 1NDMB 3PGDA 4U6XA 3WHE1 2KQNA 5JQ6L 3U6RB 1Q9LA 2EEAA 2B1AH 4NYLA 2IGFL 3RDTD 2QSQA 3H9HB 3MRKB 3MNWA 4KRLB 4Z7UB 1JGLL 3BKCL 5FYLD 3HN3A 4K8RD 1NFDB 1DSFH 4GXUM 5FYLE 3IDIA 2XTJD 5IQ7H 4Z7QF 2EYSB 2F53A 3RBSA 2VSDA 2XTJE 5CEYB 3TGXA 1JRHI 4NQCA 1VADA 2ZP0T 4TUKH 3V4UH 4XNZB 3FHAA 3RVXD 1WZMA 1IGMH 3QI9D 1C5CH 2NY0B 3F6IA 1UCBH 4OZHE 3T65A 4QHUB 1F3JA 4X4MA 3CFDB 3ZYIA 2BRRH 2Z92A 4DW2H 1NCBL 4MAYD 3MRLA 1JN6B 3OKNB 2I9TB 2SEBA 4R3SA 2ATKA 5H2BA 3O45A 4MJID 3T2OA 3VFRB 3T77B 4YHOL 4OGXH 5BQ7A 5DVMA 2KL6A 4G8GD 2PYEA 1O5DT 4PJIF 2HWZL 1HXMA 25C8L 3R06A 4G8GE 4NWTH 3P4MB 1MHEB 5B3JF 4FG6C 5L88L 1SYSB 3E1F1 2APTA 1A1OB 3TV3H 4Z8FH 1DQDL 4Z7UF 3QJFA 1XGQA 5D7JB 3U2SA 1KLGA 1AIFB 4JY4A 4UQ2B 4BYHA 1YEKH 3MLZH 1NDMA 5J3HC 1NFDF 2EH7H 5DWUL 3I6GB 2NY5L 1MCQA 3H9HA 3MRKA 4HJJL 4Z7UA 2ESVA 4JFXB 5MEQB 1RQ5A 3UAJD 1NFDA 2ZPKL 3R8QA 4G9DB 5CIPB 1ZT4B 3WSQL 3L3IB 1MCWW 4KROC 5JMOC 2KH2B 3BH8B 4KUZL 4XMKL 2M2DA 5DJDB 2EYSA 4OD3H 1MCEA 2CR6A 1JZ2A 2D7QA 1A3LH 3PJSB 3ARGB 4KZDL 3DHMA 1G6RL 5F1IB 5DJZB 1YEEH 4GQ9L 1T1ZB 5IBLD 5C6TL 4QHUA 4L4VE 3CFDA 4IOIB 4UQ3B 3RKDD 1JZ5A 2VWEC 1JN6A 1Q0YH 3OKNA 4MSWB 4PP2B 4DFIA 3MGTA 2I9TA 4WTZA 2R2CA 4L3ED 5DUML 3VGHA 5BS0D 3VFRA 3KLAB 1QFWM 3T77A 4L3EE 3A6BL 1RI8A 3O3BB 5BS0E 3U7WH 4OD1L 1JGDB 2VXTH 2PR4L 3QCVL 1MHEA 1AXIB 1SYSA 2J2ZA 2OCFD 2EE2A 3BEVB 5D7JA 4N8VB 1AIFA 3QEQD 3L7FB 4UQ2A 3QDGD 1J1PL 3GNML 3HNTH 3EHBD 1FGNH 2VXSH 3BIKB 2R0KH 2I26N 3QEQE 3I6GA 3QDGE 2VXQH 4UINL 1FORH 4QHMB 3O4LB 1X5IA 4JFXA 4OKVB 4Y5XB 3UEZA 1WZ1L 3FQRA 5MEQA 1JYWA 1H3PH 1XF3B 2NQCA 4H0GA 3O2DA 1NCAH 1HEZB 1BQHB 3ARDB 4G9DA 1JGUH 1ZT4A 3L3IA 1MHHB 2FBJL 2PCPB 2X4OB 3BH8A 3ZTJH 4ZFFB 4ZNCD 2FX7H 2DOCA 4MXWL 1BM3L 4BJLA 1M7DB 2R8SH 2JB6B 4LVOC 1MI5B 2Z31D 1ODAA 3PJSA 3ARGA 1CR9H 4Z5RB 1PG7L 4UAOB 2OSLB 5F1IA 5DJZA 4AL8L 5BVPH 1T1ZA 4JFDB 5MHSD 5ICXB 3U36B 5BMFH 4IOIA 4NN6C 3P4NB 5I75C 5MHSE 4UQ3A 4RMSA 1GOFA 2YD6A 3UPAA 5CZKA 4FQIH 4MSWA 5BV7H 5FGBA 1U36A 3KLAA 3MRGB 5CBAA 4K9EC 3O3BA 4EUPG 1JGDA 1A7RL 2IAND 1QFWL 5J6HB 2UZXB 4AEFA 2JJSA 2IANE 3VWJD 3BEVA 3JWOH 5FXCH 4N8VA 3L7FA 3OZ9H 4TSCH 1IEBB 3BIKA 4U6VH 3CZFB 4LQFH 4QHMA 1WBZB 3O4LA 4Y5XA 3K2UL 4OKVA 4ZS7H 1KV3A 2YRZA 4JGMA 5HYQB 5EUOF 1GSMA 3HRPA 1XF3A 2F54B 1EO8H 1HEZA 1BQHA 3ARDA 4XPHL 3REVB 3SDDD 2NZIA 2V2WB 1A7NL 1LDSA 4N0UE 1MHHA 1MCBA 2FGZA 4PS4H 3CSYB 2PCPA 2X4OA 1NAKL 4ZFFA 3BJLA 5TFSL 4LCYA 2E7HA 4WEUD 1M7DA 4K3DH 2JB6A 1MI5A 5BZDB 1OAQL 2D03H 3UO1L 4Z5RA 3S96B 1TIUA 3VW3L 2OSLA 4JFDA 4M03A 2CK0H 5ICXA 3U36A 1DJSA 1KB5L 4G8FB 4NP4L 2QSCH 3P4NA 4K3HA 1DQML 2NW3B 1NCDH 3GMNB 4JM2C 3NIFE 5GGTL 3GI8H 3ES6B 4JQIL 5TQ0L 3UJIH 3UBXG 3WD5H 1MRFH 3MRGA 2K9UA 4GS7B 4YXKH 3Q0HA 2ED9A 5GGRY 4RWYL 4FQ2L 3S4SG 1WFOA 3D3VD 4UIKL 3GB7B 4HDIB 5J6HA 1KJ3L 3A0OA 3GMPB 3MTRA 5EIQA 3D3VE 1BOGB 3ZHDA 4HG4K 1IEBA 1KCRH 5ADPL 3CZFA 2LVCA 3TJEH 1HI6A 1J0YA 1WBZA 1QRNA 4GW4B 5HYQA 3QIWC 1SMAA 1AGFB 5C0BB 2AJSL 4PY7B 3SKJH 3OL2A 3EYVB 1B0GB 3QP3A 2Q1EA 3MLSH 4XBEH 2V2WA 4G6MH 5HI5C 1S9YA 2OR9L 3CSYA 5HGDB 4WFFD 2WP3T 4ONFH 5BZDA 4HF5H 4WFFE 4L8SB 2I9LB 4O5LL 1N8ZB 3R0NA 2BP3A 5I71B 1SMOA 2W9LA 4M1GL 4G8FA 3QQ9C 3DMMC 3JWDH 1IM3A 4HS8H 3GMNA 2NW3A 5C0RH 4JM4H 5KS9E 5IK3B 3DI2B 1DANU 1NCNA 1EV2E 1QBAA 3ES6A 5DD3H 2MWCA 1T5WB 3V95A 4NNXB 3U0PB 2BXZA 2BXYA 3BJ91 1G7JB 5I8KH 2D0FA 4OT1H 4MXVE 3GB7A 4HDIA 2YHGA 4PB9L 3GMPA 4PD4J 3FQUB 5C08D 3EGSB 1S9XB 4YHMH 2WAHA 3TBTB 3VI4F 1BOGA 4GRWH 5C08E 3MLUL 4Y4FD 2P5WD 3UTTD 1IGFL 4ZFGL 4PGBB 3UTTE 1CICD 3KR3H 4WFHD 3O6LL 1AGFA 5C0BA 3CXHJ 4M9PA 4PY7A 3EYVA 1B0GA 2YD7A 5BRZB 4WFHE 5CJQL 4KGJA 1UYWL 3CLEH 1G6RB 1MLCB 5IFJB 4OI7A 1ZKAA 2RBLA 5A2JH 5HGDA 4RGND 5I8OL 4L8SA 4WHTB 3IS0X 4JO4L 2MMXA 4RGNE 1N8ZA 2WQ8A 4RMQA 3LAFA 1NGQH 2D7NA 6FABH 1UXSB 3PHQB 1RZIB 5CINH 4G7YL 4KK5D 4MB3A 1CCZA 5SWQB 3O41B 4XX1E 4MQTB 2VDLH 4JQXA 3ZMRA 1T0NB 4ZUTB 1T5WA 4ODBD 1VPOH 4NNXA 3U0PA 5F6IC 1I1AD 1QKZH 1TXKA 5DJCB 3MOAL 5SV3A 1G7JA 4ZO8A 1TZGH 4PJ8C 3FQUA 4P2QD 3EGSA 1WIPA 1S9XA 2XZZA 5DDHB 3NBNA 3TBTA 5E2TL 3GM8A 1KEGH 5GGSY 4ODHH 4ZOCA 4P2QE 1JNNL 4MA8H 2IBGA 2F5BL 5CAYB 1H9VA 4B53A 4LLYB 4YEFA 5FV1L 4KQ4L 3VDCA 4PGBA 4H5SB 2YPLB 1K4CB 2CLRA 3AREC 4PJ5B 5HHQB 2IH1B 2FIKA 5C2UB 4M5ZL 5BRZA 4AIXA 4MNGB 4G6AD 1G6RA 1UH3A 1MLCA 4NPYB 3TLRA 5IFJA 1X5GA 4P5TC 3WFHA 3V4VL 1F3RB 1ZTXH 1K6QH 3QISA 1KCLA 1KB9K 1BD2E 1JHTB 1OTSD 4WHTA 3IJHB 4EI6B 5E2UL 3NPZB 4EOWL 3LS4H 4KROB 2DQJL 1UXSA 1WF5A 3PHQA 3SE9L 1RZIA 2ADIB 4PRIB 5SWQA 3O41A 3NTCL 4M6NH 3G5ZB 3RZWA 5JIKA 2DB8A 3F58H 5C0GB 3C6SB 4ZUTA 4QCIB 4LFHD 3RUGE 3QXTA 2HLFD 1LO0L 4JRXA 5DJCA 3BPCB 1IAIM 1F97A 5I30H 2KZ1B 2IEPA 4L4VB 1RU9L 3BDBA 1LO3H 5DDHA 3LQMA 4XAKD 4JPKL 2EDWA 2JB5H 2AAVA 1YEDB 3WKNA 1TTUA 3AY4C 4MDJB 4XAKE 4HPOL 5FYJE 4KKAC 3FQXB 4LLYA 4XVTL 3L6FA 3O6KH 4H5SA 4NT6A 2YPLA 1K4CA 4PJ5A 5HHQA 2IH1A 5JHLL 3QXVA 4NN7C 4KMLB 5EWIL 4Q97A 4OGYL 1FSKC 2YK1L 4MNGA 5HVHC 1RZJC 4NPYA 4QNPE 4Q9QH 4QHLB 5KVGL 1KB5B 4JO1L 1RJCA 2DBLL 3BDYH 5C0CD 1JHTA 2CLVB 1UZ6E 3IJHA 4KJPD 3RBGA 1D5IL 1T83C 5C0CE 4EI6A 4Q74A 4EIGB 5IFAL 5GS0D 5H37G 1ZMYA 3NACL 1P5VA 2DLHA 2ADIA 3HRZB 4PRIA 4DN4L 3G5ZA 3GM0A 4AMKH 4WTZG 5DFTA 2EXWC 5C0GA 3C6SA 1CN4A 4QCIA 1OP9A 5CZVL 3VFSB 3MRMB 4MWFB 2ORBL 1L7TH 5E0QA 2GJZB 4KK9D 5CLTA 2O5YH 3FHQA 2CRIA 2EIEA 2BVOB 1ZHBB 4PYHA 5F7MC 1QYGL 3MRNB 3TJHD 2H32H 3MBEC 1KC5H 4B41A 1YEDA 4MDJA 4KQ3H 3T0BA 5D71L 4HIHB 1AJ7L 3WJLA 4F7TB 4WEBL 3CMOH 1PX3A 3BOVA 3WXWH 5F7WC 1R24B 2V17L 4G6KH 4YJZL 1FG9C 4DCQB 5DURD 4QHLA 1KB5A 4XHJD 5D6DC 2XOTA 1EFXB 2XA3A 5F9DC 5JHDB 3MV8B 4FN0A 3WFDH 2CLVA 3GBLA 1AHWB 1Z9LA 3QPQC 1II4E 2R2HB 1HSAB 3AS2A 5GGTA 4CGTA 1BF8A 3TYGL 4K07A 5LWYL 1V8HA 2DI8A 5CUSL 3OG6B 3WS6A 3HRZA 2R1WB 3HB3D 2FECI 4PJ7E 3T0ED 2I5YH 1AQKH 3T0EE 3K8KA 2QV2A 4U3HA 4LSQL 1C16B 3VFSA 2BFVH 3DGGB 1AO7B 4MWFA 1DBKL 5EU6D 2GJZA 4F8QA 2VDQL 4DK3A 2BVOA 1OM3L 5EU6E 4PGCB 3MRNA 4N8VG 1BAFH 3QCTH 1AY1L 2DTSA 2F53D 1TVHB 2WQRA 3WNOA 3LH2H 4HIHA 8FABB 4F7TA 4ZAKC 4GFTB 4NZRL 2ZJSL 2B0SH 1X5XA 1NLDH 2VDMH 1R24A 1YEJH 1BQHG 1JPSH 1JNLL 4Z7QE 4OCSH 4PP1C 4NIKB 4OZ4A 3GJFK 4DCQA 5D6CB 3Q1SH 3X3GH 1UM4H 5TPWL 5IFHL 5BZWB 1EFXA 1B9ZA 1WQVT 4JJ5B 5JHDA 3MV8A 1KNOB 1MFCH 1AHWA 5D2NC 1FE8L 2R2HA 1HSAA 4LF3B 3RWFB 4QOKB 5J6GB 3BZ4A 4JR9H 3GBNH 3I6KB 1F2QA 1FLRH 5FOJA 2R1WA 4YXHH 3BQUC 3FRUB 4UV7H 4JM2F 1JF6A 5DJ6B 3UTSB 3MODH 5DD5H 4PJIE 1ED3B 4OM1H 5ALBH 2ESVD 4KTDH 1C16A 1Z5LB 2UZYB 3DGGA 4KMTL 1I4FB 1AO7A 4L4TB 1OHQA 4NM8H 4YK4B 4JM2A 3QB7C 3CFCL 4NN5C 4WI9A 3VXOA 3QIUC 3BKML 1AD0B 4PGCA 4X7CC 2HT2C 1OAUH 1OAZL 4CVUA 1JK8B 3RL2B 1H0DB 1G7MB 4OD2B 1TVHA 1DFBH 1MFBH 3TVMD 5F7UA 2NY0D 1YZZA 5A1AA 2C3GA 4GRLB 5E9DD 2XN9D 1U6AH 2Z8RA 1UJ3B 2EO1A 2GT9B 4YHZL 1NBVL 5E9DE 2XN9E 2WZPD 2GEEA 4I3GA 1AI1H 5D6CA 2ERJC 4H1LB 1HQ4B 5LGHH 5E6YA 4HLZG 4KI5C 5BZWA 4MQSB 4OSUL 4WWKB 1BHGA 3QIWA 2JE8A 4JJ5A 1A02N 1KNOA 2D0GA 4HZAA 3FMGL 1CT8A 3MV9B 4LF3A 4I4WB 3RWFA 4QOKA 3JV4B 4F37F 5DRZB 4EBQL 3I6KA 2DKMA 1P6AB 5D7JD 3DI3B 5IHBA 1JPFB 3C8HA 2UY6A 4BQ9A 1MRCH 3FRUA 2NXZD 4WHDA 4YDVA 5DJ6A 3UTSA 1B88A 4P46D 1ED3A 3TT1H 3ULUC 4YC2C 1SBSL 4G9FB 1Z5LA 1WIOA 4W6YB 4ZPTB 1I4FA 3ARBB 1J8HA 1F6AB 3L5XL 4L4TA 2DQCH 4ETQA 1XFPA 1RHFA 4BFEA 3SY0A 1AD0A 1X5KA 2PO6D 1J1OH 3RWJB 2ADFL 3KPOB 3GSVB 2DKUA 4UTAL 1AGBB 2XRAH 5F6IB 1JK8A 1VEMA 3RL2A 1H0DA 1G7MA 4OD2A 4YDKH 5GRUL 2A9NH 3GHBL 2W0PA 4IOFD 2VDOL 2Q8BL 3EO0B 2W9EH 2VXUH 5EORH 1T20A 4GRLA 1HYSC 4PUBL 1S3KL 1A3RL 1GGUA 5KTEH 2VO5A 1UJ3A 2GT9A 2WIMA 2OS7A 5M94B 4WI2A 3BP4B 4H1LA 4WO4C 5TDPA 4MQ7B 2PYFB 4NHCH 2BVUA 3WJJA 4WWKA 3QJHB 2ARJB 4I3RH 1UG9A 3QUYC 4LKCB 3MV9A 2XICA 4I4WA 1IGIL 5EA0L 4HT1H 3JV4A 5F88B 5ALCH 5DRZA 1JPFA 2YD2A 3UJTH 3N50A 1X6LA 4FFYH 1DSFL 3FQWB 1XIWD 2AI0H 4CRPA 2A9MH 3HNSH 3QEGH 5IQ7L 5E6IC 1BD2B 4G9FA 4HIIB 4ZPTA 3ARBA 1F6AA 4LKXB 5DD1H 5SX4H 4ZO7A 4TUKL 2AW2A 2Y4SA 1QACA 5IKCB 3RTQD 4XNYH 1UCBL 2DIAA 3AC0A 4MNQB 1D9KD 1XF4B 3RWJA 2BRRL 3KPOA 1A6WH 3GSVA 5FDWB 1T1WB 3TCXA 1AGBA 2MTPA 1WT5C 3MLWL 2OJZH 5EUOE 3GO1H 1INQB 4O58H 1GOGA 3BEWB 3EO0A 3NGBC 4PRDB 4OF8A 3UCRA 4PJ8A 3ZDYF 1SJHB 5BJTB 3DX9B 4OGXL 3Q5OA 1GGBL 3D18B 4YFEA 1JUFB 5J12C 3PXJA 5L0QB 4FABH 3R1GL 4FFZH 3BP4A 4XI5C 5EG6C 4JLRB 4YX2H 2VIRB 4MQ7A 2PYFA 3UYPA 3G04B 3QJHA 2ARJA 3MLZL 4LKCA 2A73B 4NN7B 3OB0K 4N8CH 1NBZB 2BHYA 2X44D 4U33A 5D96B 3V6OC 2NY2C 2MJWA 3ZDXE 2XZCH 5HVHB 4HUVB 1K3IA 2O61B 2NY6D 4M7LT 5F88A 4Q7DA 3MOBH 4P5TA 5L8LB 3QDMD 3EYSH 3P3YA 1CD1B 4S0SD 4OUOA 5GS2H 4XP1L 3FQWA 3QDME 4FQQB 4OCYH 1Z9OA 2J1KA 4IHOB 1QRND 1DR9A 4HIIA 5HI3C 4LKXA 2W0KA 3Q2CA 3QDJD 3QR2A 5D1XB 15C8H 1A3LL 2Y07H 2ZUUA 3KPMB 5IKCA 1P2CB 3QDJE 3HI5H 4MNQA 1XF4A 5D5ME 5FDWA 1T1WA 2QADC 4JCMA 1Q9KB 1Q0YL 1AKJD 1INQA 3BEWA 4PRDA 1ERNA 1B90A 4OCRL 3IAGC 3RWIB 1SJHA 5BJTA 3DX9A 3RL1A 4Q9CA 1VFBB 3F7YB 2D7OA 5GXBB 1JUFA 2F8VA 4XPFH 1JI2A 2VXTL 1MNUL 3TYFB 4M3JA 5A40E 4JLRA 1RZ7L 2VIRA 3P4OB 4ETYA 5FM8A 3QRGH 3G04A 1ETZB 2E9IA 2A73A 3HNTL 5EB9A 1NBZA 4I77H 2APFA 4P2YA 4NRZB 3KYMB 1FORL 4HUVA 1Z9SA 4MZ2A 3S34H 3Q6GH 3HMXH 4NOBA 3SBWC 1H3PL 1CD1A 4U1IB 5EOTB 1NCAL 1JGUL 5K9OB 4FQQA 5A3ID 5DFWH 1A1NB 1MQKH 2FATH 4IHOA 4N0YL 2E7LC 5KOMC 4HQQH 4F7EB 5D1XA 1A21A 3OAUL 1DQQA 5GHWH 5CKGA 1CR9L 3KPMA 1P2CA 4U2ZA 5BVPL 4QRUB 4KKCC 2NYYD 2ID5A 4PV9B 2VSCA 3KVQA 2FRGP 5EBLB 3CPLB 4IIQB 3PWLB 1Q9KA 4FQIL 3L5HA 5HY9B 5J13C 5FM5O 4XTRC 2EEDA 3VMOA 4OF3A 4JFOB 2YZ1A 3QXDB 3RWIA 1F13A 1VFBA 1T80A 3F7YA 3MBEA 1DVFD 1RFDH 3RP1A 1MVUB 5C3LD 1TQCC 3CX5K 3SDCB 4IRSD 1TZHB 3TYFA 4ZAKB 3P4OA 1N64L 5A2IH 1ETZA 4P4RB 3MJ9L 3HZVB 3WNMA 4XVUC 1YEIL 4NRZA 3KYMA 1OARH 4R8WH 5AD0B 2JIXB 1U8PB 2YD4A 1XR8B 4U1IA 5EOTA 3K4ZA 4J12A 5K9OA 1BFVL 5CJ5A 1A1NA 1OSZB 2YD9A 3DYPA 1CGTA 3K3QA 4PS4L 3C6LD 3HUJE 1T66D 1MWAL 4F7EA 1EGJA 4PPTA 3BQUB 2F8OA 3S8WA 3T09A 5IHLB 5IVXE 2FZ3B 1R3IH 1MJ8H 4QRUA 3KYNB 1AR1C 1OGAD 4LARH 1I9EA 1HHIB 4PV9A 5JPNB 2QSCL 1OGAE 1ES0B 5F6HJ 5EBLA 3DSFH 4RMWA 3CPLA 4IIQA 3PWLA 2W0FB 2ITCB 5HY9A 4MA1C 1JIBA 4BKLB 4KHTH 1OAKL 3TO2B 1QSEA 3GI8L 1KN2H 4JFOA 3UJIL 3WD5L 3QXDA 1MRFL 1JNJA 5ESQB 1Z0NA 1MUJB 1MVUA 3QUZC 4LBEB 4PBXA 3SDCA 1TZHA 3BPOC 2X9XA 2E6QA 2VH5H 3SE3A 1E6JH 4ZAKA 4ZFZB 1LK3L 3HI1B 3U4BH 4P4RA 5K59F 4JRXD 1KCRL 2VOTA 3HZVA 3ZYZA 3MRHB 3DVNB 4LLAA 4LLVB 3QO1B 1YN7B 4H88H 3TJEL 1K9TA 2HJKB 5AD0A 2JIXA 1FL5B 1U8PA 1XR8A 2AXFB 3SKJL 4L9LC 3MLSL 4XBEL 1OSZA 4LPUA 4CJ0A 2ADJB 2LTQC 4G6ML 4Q2ZB 4DKEH 3ZSTA 4FG6D 1VDGA 4ONFL 1YQVH 4YPGB 1TITA 1RIHL 1MCSA 3BQUA 5J3HD 3IKCB 1ZANL 3ALPA 3VGDA 1HE7A 3U4AA 3KYNA 1HHIA 3C08H 4LPYA 5JPNA 4CKVX 4HS8L 5C0RL 1F4WH 1QLEL 4OFPA 2W0FA 2ITCA 5CBEB 1RURH 4BKLA 2UUDK 3TO2A 2L0DA 5DD3L 4KROD 1U93B 4PJ9B 2IMMA 1D5XB 4NQEB 5ESQA 4NNYB 2QLVB 4P2CG 4LBEA 5I8KL 2RCSH 4NZUL 1F2XK 1EO7A 4OB5H 4OT1L 3RJDA 3FJTA 3I3BA 1WTGT 5DEZA 5SWZD 3FFCB 3GSXB 4H20H 3SCMB 1N4XL 4EXPX 3AB0C 4HXBH 5SWZE 4ZFZA 4OZIF 3HI1A 1RD6A 2AQ1A 3ARQA 5DVOA 3MRHA 3DVNA 4LLVA 3SKMB 3QO1A 1YN7A 5F3BB 4Y16B 4JAMB 4WO4B 2HJKA 2VWEE 1OD7A 1FL5A 1DEEB 3OX8B 3G5YA 2UV3A 2AXFA 2HP4A 4X0KB 3QUYB 1U8IB 4QO1A 1VGEH 3CLEL 2ADJA 3EYOA 1ZHKB 1VGKB 2QQLH 4Q2ZA 5EC1B 2OM5A 5JPMA 3K81A 3GSRB 5DJ8B 2UVEA 4YPGA 3T0XA 2VLKB 1GC1H 1FNHA 3VFNB 2A1WL 2L7JA 3IKCA 4RFOL 3IFPB 4U1JB 3SGKC 4HAGA 3V6BR 2DLIA 5TH2B 3EFFB 1NGQL 2E7CA 2F9BT 5CS7A 4HBCH 1VCAA 4P3WA 3BMWA 5I73B 4AQ1B 2KDGA 3FB5B 5GISH 1A7OH 5CBEA 3WNLA 4U1MB 5L8JB 2VDLL 1XCQB 3QUXB 3ZE0E 1U93A 4PJ9A 4X6BA 2G2RB 1D5XA 4NQEA 1JWUA 4NNYA 1YJDL 2R0ZH 1QKZL 5EFIB 1IEHA 1BVKB 1TJIL 4HK3N 4TULL 3MLPA 3P9LB 3QG6B 4H1LG 1IC4H 3FFCA 3GSXA 3SCMA 3VFTB 1R3JB 3S36L 2YN5A 4OF7A 3UP1A 1U3HC 5T1DH 3FKUS 2GITB 3TBWB 1UWGH 5F3BA 4Y16A 4JAMA 4N0CC 1BZ9B 4WO4A 4OLXH 4OZFB 1DQLL 3OX8A 3RVWC 3AXLB 4X0KA 5GGVY 3QUYA 1U8IA 5EPMB 4QYOB 1DE4B 1VGKA 1ZHKA 3QNZB 2NY2B 5J0BA 2DYPD 3ECBA 4HLJA 3GSRA 1KCUL 2WNGA 5DJ8A 4DGVH 1F6FB 5AEAA 1IL1B 5F72S 4X8XA 1CTOA 2VLKA 4KJWC 4XP9H 3VFNA 4H0IA 3IFPA 1DQTA 4CBPA 1DN0B 2DI7A 2X4UA 4PJAB 4RX4D 4UDTB 4XVSH 5TH2A 3EFFA 3LS4L 4OLEA 4F7CB 5DFVC 3QBTB 3QIBC 3TFKC 3M8OH 2EE6A 4PJGF 3FB5A 3CGTA 3MV8D 2YD3A 4U1MA 3F58L 4XXDB 3L3OA 4DGIL 5D7LE 2ICWJ 1XT5A 2V2XB 3QUXA 1I1YA 5EFIA 3DOSA 1UC6A 3NPSC 3PWVA 4Y4HB 1BVKA 1FNEB 5F9OH 3W9DB 1WT5A 3P9LA 3NIDE 5HYSB 1EMTH 2Z35B 2VISB 1CLOL 3VFTA 3EYQC 1R3JA 3RA7H 3MLTB 3RNQB 3UROR 3WO4C 1AO7D 4WTWA 2X10A 5A43C 5LBSH 1TPXC 4JM2D 3SDAC 2GITA 3TBWA 3SPVB 1YEHH 2R15A 3O6KL 5F71A 1BZ9A 4UT6L 1ZK9A 4OZFA 4HKJB 1FCGA 1MWAB 1LD9A 3V7MA 3AXLA 5IMLB 3PHOB 1MREH 4LSUL 4QYOA 1DE4A 3QNZA 3V6OA 4PJAF 1JCKA 4MHHG 3AAZB 5FKAA 4WENB 4Q9QL 2FX8H 1W0WB 3UDWC 1IL1A 3BDYL 3T0VA 1X5FA 1LGVA 3WKML 1ZHLB 1LVEA 1T2XA 1DN0A 4PJAA 4UDTA 2W65B 3RWHB 4F7CA 5I6XB 1VA9A 3VG0L 3FN9A 1ZLUK 4Z95L 3QIWD 3P0VL 1OVZA 4KTEH 5EDXA 1UWEL 1JRHH 3N9GH 1NC4B 4XXDA 3CMGA 5JR1H 2V2XA 3ARFC 5HI5D 2CH8A 1L7TL 2YSSB 3MJ9A 4Y4HA 1FNEA 2R2BB 5HYSA 2BY3A 2HFGL 2VISA 2Z35A 4X7SL 1UCTA 3UTSD 4LIQH 2MPAH 3TN0C 3RNQA 4WU5A 1BEYH 1S7RB 1J8HD 3QQ9D 3DMMD 3HMWL 3LD8C 2WBJB 3SPVA 1Q1JH 2N1KA 4U31A 4TTDC 4HKJA 2IQ9H 1MWAA 3AM8C 3WXWL 2X4PB 4P3DB 2AJXH 1YECH 2G60H 5AAWA 2YPKA 5CFHA 5IMLA 3OAYH 2AJVH 4HUUB 3PHOA 3N1QC 1RUML 3MV7D 1RIVH 5FEBA 3AAZA 4NZTL 3RZCC 3GRWH 1W0WA 3MV7E 4GAGH 3MXVH 1FVDB 2HRLA 1ZHLA 5J56B 3MX0A 4XCEB 2E27H 1IGTB 2W65A 3RWHA 1NGYB 1VACB 4E42B 1WTLA 2D4DA 2OK0H 1CXEA 4K3JH 3B8YA 4AEHH 2JF1A 1Q0XL 5EBGA 1T0PB 4X80H 2WP3O 2XQYG 3S98A 2OP4H 1YN6B 1AQKL 1QFPA 4LLUB 4NKDB 2JJVA 1EEQA 4QY8B 4XMLH 1WISA 4GRWB 1SEQH 2YSSA 3CLFH 2R2BA 5DA4A 3SGJC 3BRGC 3P11H 1MFDL 1PY4A 4MA7H 4NQDA 4WV1C 1Q9OA 4U6HB 1BAFL 3QCTL 4XGZB 1S7RA 4P4KC 1J0HA 2R0WH 2IWGA 2WBJA 4MJ4A 4XP6H 3LH2L 1FH5H 3UMTA 4I0PB 3EFDL 3LEVH 4XNMB 1KEMH 1EHAA 3PHSA 2BSSB 3EYFB 4JVWA 2B0SL 3D2UB 1TETH 1NLDL 1YEJL 3ZKQD 3RNKB 4IOSD 1G1CA 1CE1L 5IT2L 4V2BA 4OCSL 4HUUA 2FX9H 1T6WA 1ZAGA 1UM4L 3UYRH 4RDQF 4PJ8D 1FVDA 1NANI 1A6ZB 2YRLA 1FZMB 4EJ1C 4KFZC 1MFCL 4L9LB 4Y1AD 5LGKA 2N56A 1ZGLM 3CFIC 1IGTA 1VACA 1DBJH 4Y1AE 4E42A 1FFNB 5FGCB 2HJFB 4JR9L 5IP4A 3GBNL 3AMLA 5F7YC 1CFNB 3ARED 4GRWF 2X41A 4UV7L 1YN6A 2EDTA 1EIBA 4LLUA 1MCOH 4I3SL 4NKDA 5ALBL 4P5TD 5LG1A 4QY8A 2XV6B 2X7LB 4DKFL 4PRHB 3LSOB 4Z9KB 5L2KB 1RUKL 4U6HA 4P57B 5ADOL 4XGZA 5J9PB 3HC4H 2YWZA 4QXGH 1OY3B 2MCG1 4YBLB 5TDNB 1MFBL 4I0PA 4OCNC 1ZLVH 2ZCLL 4XNMA 1RJLB 2VLRB 3T2QA 3ZTNL 2BSSA 3EYFA 2NXYC 3QA3A 5I1GH 1U6AL 3CSBA 3RNKA 2F8XC 1CF8H 1QBBA 1BFSA 1CVRA 2NCMA 4LOUC 5KSAB 4P5MB 5LGHL 5IVZB 3W0WE 3ILPB 3CFJA 4LPCA 4JFHD 1A6ZA 1EVTC 1FZMA 1QQDB 5IUSA 2EE9A 4L9LA 1LEKB 1CDGA 2XWJB 3NFNB 5D93B 3TCLB 4KZEL 4JFHE 1FYHB 5HHPB 2H9GB 4UB0H 4KKAD 3WN5C 1FFNA 2VQUA 2HJFA 4XCYB 4S1QH 5EULV 1H3UA 1CFNA 1N5YH 1WIUA 1D5ZB 1MRCL 1BGXL 2XPGB 4RGMB 2R1YB 2UWEE 5T5FH 2Q8AH 1FO0L 2IAMB 4Z7OE 5HYIA 3TT1L 1UB6B 2X05A 4P23B 4ZUVB 2EXYC 1S7XB 2X7LA 5F6HI 4PRHA 3LSOA 5T3XH 1TQBB 5L2KA 3MFGB 2GY7B 5AUMB 4ZS6C 1J1OL 4P57A 1CGVA 5J9PA 4A6YH 1ZS8B 2VQ1A 3SDYL 3CU1A 4Y7MA 3O0RH 2A9NL 5I1EH 4X6CB 5GS1C 4Z7NE 4JHAH 5TDNA 1ZOXA 1BPVA 5D2LE 5EORL 1RJLA 2EXWD 3LKOB 2VLRA 3TA3B 2YZ8A 3B9AA 2W9DH 3LS5H 1QR1B 2EIDA 5KTEL 2AKRB 3ETBF 4BZ1H 1W8OA 3H7LA 4XPTH 2VZ1A 3NFPB 5F1NB 1U3HB 5KSAA 2VL4A 4P5MA 5IVZA 5J7CC 3LPWA 1DUYB 3ILPA 3F12B 4QF1B 3MBED 4I3RL 4AT6A 1WWWX 1QQDA 4RCAA 2A74A 3ZL4H 5FHBH 2XWJA 1LEKA 3NFNA 3P4LA 3TCLA 5HHPA 2DM2A 2H9GA 3BGMB 5JXEA 2XA8L 2VDPL 5TF1H 4RFNB 2VITB 4XCYA 5ALCL 4OCXH 3ILQC 3UJTL 5T33H 5IG7B 5DTFB 3DBXA 1D5ZA 2XPGA 2AI0L 2HT3C 2R1YA 5T5NF 4PTUB 1KBGH 2A9ML 4QXWA 2IAMA 3QEGL 1UB6A 2H32B 4GJTB 4P23A 1IBGH 3SJVB 4ZUVA 4JREC 5CJBA 3L9RB 1S7XA 3WLBB 4YEEA 6CGTA 2YUVA 5I1CH 4XNYL 3QPQD 5K9QI 4ELMB 2DLGA 3IXAB 4UV4L 5AUMA 3IS1X 3EZJB 1NKOA 1WCBB 2B7DT 1ZS8A 4F9PC 5IGXH 5CEXB 4TOYL 3KPRB 3TH4T 3GO1L 4O58L 4LCCC 3TA3A 1MRDL 1QR1A 3OPZL 2AKRA 2OL3H 3BE1L 4YNYB 3IU4H 3QHTC 5EC2B 3NFPA 3GIVB 4FFZL 5F1NA 1U3HA 3FQNB 2ZUQB 2ZUTA 1QSED 4GW1B 1DUYA 4U3XA 1GCFA 3F12A 3KGRA 4HWBA 5IJVB 2F58H 4QF1A 4WTXA 1LP9B 4XBGB 4Q6IB 4XNQB 2J5LC 2ZG3A 3SGEH 1ZVSB 3MMEB 4KKLC 3BGMA 3CSGA 4NQVB 2C9AA 2FR4B 3TIDB 2VITA 2Y5TB 1WV7T 3MOBL 4ZAKD 3EYSL 3VWKB 5IG7A 5DTFA 5DJ2B 3O3AB 4LHQB 4OCYL 4GBXC 5E8EB 4PP1D 4PTUA 3RVTC 3HHRB 4LSTH 1DBAH 2H32A 1A64A 1P4IH 2WK2A 3SJVA 3UTQB 5AWNL 15C8L 3L9RA 5B8CB 3WLBA 3RPIB 3HI5L 4ELMA 3IXAA 5D2NE 1WCQA 1FC1A 1J0JA 2FEEL 3A6OA 3WUWB 5CEXA 3KPRA 3BQUD 4C56D 4KKNA 3ZTJG 1YYLL 5I1JL 1JP5A 4OZFG 2E8YA 5FF6B 4C56E 4YDLC 2MSPA 4HUWB 4X7FC 5GGRB 3EOYG 4YNYA 3SOBH 4OLVH 1ZEAH 5EC2A 3GIVA 1YEFL 3ME0A 3FQNA 5HGAA 1OP5K 1HHHB 1Q9WB 1RZKH 1UA6H 4GW1A 3V0AC 3MNVB 4HKZB 2C7UA 3QIUD 5IJVA 2ATPB 5IBTH 1LP9A 2HT2D 2Z8VC 4Q6IA 4XBGA 4E9LA 4XNQA 1ZVSA 3MMEA 4PJBE 1TZIB 4Q9BA 4Z78B 4NQVA 4UNTA 2FR4A 3TIDA 3S34L 2Y5TA 3Q6GL 5GPRA 2P5ED 2APXA 3HMXL 4HWNA 4YUEL 3LCYA 4U1GB 4F9LA 3VWKA 2P5EE 3K80A 4K23H 5DJ2A 4OIIH 3O3AA 1MQKL 2FATL 4Y2DB 5E8EA 3C09C 4L4JA 5D7IE 3RPKA 2DS4A 12E8H 3RFZC 1WBYB 3MJ8A 3SQOH 3UTQA 4HQQL 4KI5D 2FWOB 2EDFA 3P40A 5B8CA 5HPOA 3ULVH 2LVEA 3D69B 5HHOB 1H8OA 5HYSG 4OZIE 4ONHB 4KI5E 2KKQA 3RPIA 1I7UB 1YC7A 4YQXH 3BWAB 3WO3B 1OAXL 3JVGA 2ICWI 3WUWA 3MUGB 1HHGB 5E8DH 4IMLB 1SHMA 2K7PA 1B2WL 2DQIH 3S5LB 4E0RB 5FF6A 5E00B 4KTYA 4HUWA 3ULUD 1RFDL 5GGRA 3HE6C 5CGYC 5DMKB 3ULUE 3PDGA 1HHHA 2GFBA 4OFIA 3MNVA 3WBDA 3MRRB 2ATPA 2E9WA 4P2OB 1ZGLB 1IT9L 3MUZ1 4F58L 1EEZA 2HRPH 4ZO6A 1X7QB 4YHKL 3C8KB 1TZIA 2Z9TA 4Z78A 1IGCH 2GIYA 2A77L 1FO0B 1OARL 1QUNA 3NH7H 4U05A 3WXVL 4DVRH 3LPGA 3OKKB 3V8OA 3PG2A 1BQLH 4V2CB 3RAJH 1NMAH 1HXYB 3ZE2F 5C7XL 1FFQA 3PNWB 1WBYA 5INCB 2FWOA 3C5ZC 5CP7B 4KJQC 3D69A 3QUYD 5HHOA 1FNGB 1WUNT 4RAUB 5DZOA 4X5XB 5DRNB 1R3IL 1MJ8L 1A4KB 3B9KB 1I7UA 4LARL 1ITCA 5I74C 3DSFL 3MUGA 1HHGA 4GO6B 2N7AA 3MROB 4IMLA 2JCCF 3SGJA 1ZWIB 4FQJL 1JZ6A 1TJGH 1KN2L 2XXCB 3S5LA 4E0RA 5ICZB 5E00A 2YXFA 2XT1B 5D1ZC 5E6ID 4XXCC 5DMKA 4D94A 4LVNC 4BFGA 1S7QB 2VH5L 2DBJA 3WL9B 3GMRB 5E56A 4NO3B 3MRRA 1BECA 3O4OC 4P2OA 1ZGLA 4HUXB 2NXYB 4G43B 2MHAB 3U4BL 5FUOL 3VXUA 1MEXH 2BY2A 5BW7C 1X7QA 4NFDA 5K9KB 3C8KA 2XQYK 4PJGE 4H88L 1FO0A 4H8WH 4RDQG 4JFEB 3OKKA 4HWEH 1LO5B 3MPCA 1V7MH 1AGCB 4ZUSB 1DEDA 3ZT5A 3HFML 4MLSA 4DUWA 4DKEL 5I18H 1HXYA 4XI5D 1B3JA 1YQVL 3PNWA 3NA4A 3KPQB 3QULB 2B5IC 3T4YA 1UGNA 3JTTB 2Y7QB 2DQDH 5CP7A 1FNGA 3ROOB 4RAUA 3WIHH 4X5XA 3SEPA 4LPXA 5DRNA 3B9KA 1A4KA 2W91A 2DLTA 3C08L 2YOCA 4QT5B 1MY5A 5J1TC 4G8EB 2IG2L 1JTPA 3MRFB 4HJGB 2DWEB 3U0TB 3WFEL 1BREA 3MROA 2LU7A 3ZKXC 3GGWB 4X4XB 1RURL 1ZWIA 1FP5A 3N1PC 3NZHL 4YFLF 1HNGA 5ICZA 3L1OL 1F90H 2Q20A 5HI3D 2FHFA 5SV4A 4OB5L 3EOTH 3DYMA 1S7QA 2GQHA 4R7DB 5IROC 3WL9A 1CK0L 3IFLL 3GMRA 4HXBL 4NO3A 4GG6B 4HUXA 4G43A 2MHAA 5C86A 2AK4B 2QQNL 3O6MH 1P7QA 5DGRA 5K9KA 1L0QA 1WFNA 2QADD 3LEYL 4F57L 1OL0A 4HEPG 1MF2H 2DIBA 4JFEA 1LO5A 2WW8A 3DJ9A 5L6YH 1PEZA 1FYTB 2RFXB 1AGCA 4HCRL 4JJHA 3RGVB 5LGJB 5IMOB 2NR6C 2DN7A 4ZUSA 3MZGB 4DAGH 5JZ7D 1QOKA 1T03L 1VGEL 3AS1A 1J8KA 4ZPVB 4KRNA 2P8LB 1T2QH 4JFPB 3VA2C 3FONB 3KPQA 1PQZA 3QULA 5GJSH 4O02H 3JTTA 2Y7QA 2VYRE 3ROOA 3VD3A 3VRJB 3HAEH 1FNSL 2BNUB 3IDXL 1G7HB 5CSBA 3NMEA 3SKUD 3ORJA 4G8EA 4YE4L 3MRFA 4HJGA 2CKNA 2DWEA 3U0TA 1CDUA 3GGWA 4X4XA 1OPGL 1SJXA 3LHPH 3DNKA 4X6DE 5CJ8A 4PGEB 1Z6JT 1OP3K 4GG6F 2R0ZL 2A38A 1IGYB 3HG1D 1NUNB 1C5DA 4K8RH 4PJFE 5T3ZD 4M48H 4R7DA 1MCNA 1LNUA 5GS1A 3HG1E 4PRAB 3HE7C 4L3CB 2FYYB 5T3ZE 5MERB 4LCCB 3DETC 4HPYH 4KKCD 4DTGH 4GG6A 4HK3J 4LAJH 1GAFL 2D9CA 5ECJE 1I7RA 2AK4A 5HYEA 5ANMA 3GK8L 2AEIT 1OQXA 4EI5C 5IWLA 4NQDD 1I3VA 4OLXL 4XTRD 2E7MA 1L6ZA 2WV3A 1CGYA 2RFXA 1FYTA 1XF5B 5IMOA 4NJ9L 1DBBL 3CXDH 2R69H 4OIAA 4X6EA 1F5WA 4JO3L 4WUUD 4ZPVA 4JFPA 4KK6C 3FONA 4WUUE 3ZKMC 2DLFL 4HMCA 4LEXL 1PSKL 4XP9L 4J3XA 5T5NG 2OBGA 5CILH 4ORGB 1RUPH 4XVSL 4HULB 4XVUD 3VRJA 3FQTB 2BNUA 1G7HA 1UM5H 1P4BL 4Y4KB 3N06B 2AJYL 3M8OL 4Z0XB 3RY6A 3GJEB 1R0AL 4S1RL 2X40A 3DVGB 5MI0C 3TF7C 4IMKC 3LN5A 3FB8A 2BJML 4PGEA 4P9MH 1IGYA 3ELAT 3LB6C 5KZCB 5F9WC 4HS6B 2ICCA 1EMTL 4I0KA 4PRAA 4X9FA 3C5JB 3CFEB 4LVHC 2FYYA 4RA0C 4CU7A 4LCCA 5MERA 3HMXA 4ZSOE 1K3ZA 3BXNB 1AR1D 4QRPD 4P9HC 5D7SL 3TNMB 1C12B 4QRPE 5LBSL 2ADGB 4K3EH 2BNQB 1J5OH 5C09E 1D7FA 3DV6B 2WUBH 1RVFH 1GGIH 3CDYA 4X7TA 4KK8C 5E4EC 4FFWC 1XF5A 4YXLH 3QUZD 1MREL 3D5OF 1MAMH 4GXVH 4ALAH 5B22A 1KULA 5E1HB 4Q6YA 4IDJL 4OQTH 4LDEB 2EC9U 4OI8A 2BSRB 2FX8L 5L7XH 1T22B 1A8JH 1JTOA 2QQKH 5F96L 5FYKU 3CIQA 3PGFL 1KFAH 2DQGH 1S8DB 1HKLH 4ORGA 4D0CB 5JW4Q 3FQTA 1U95B 3WE6A 1ULVA 4YHIB 1KYOJ 1MSPA 4HC1H 3GSQB 4Y4KA 4Z0XA 4KTEL 1UKQA 3QG7H 4LHUB 3GJEA 1RAMA 4UOW1 1JRHL 1KENH 3N9GL 3CVIL 3DVGA 3F65A 2DDQH 4ZO9A 3O8XB 3RKPA 3CSPA 1BP3B 4HS6A 1PLGH 3A67H 3C5JA 3CFEA 1OTTC 1QO3B 4LIQL 1FZKB 4HD9A 1UKSA 5E8NB 3BXNA 1HQRB 1K85A 3TNMA 2DF3A 1C12A 1GZQB 2ADGA 1BJ1H 1T04B 2BNQA 2NY1B 3WNNA 1RMFH 3DV6A 3TP4A 1MIEH 3B43A 1Q1JL 5L2KD 2Z0BA 2ZSVB 4M6ML 1UADC 4KJYB 2AJXL 1YECL 4M7ZC 3IFNL 2Y06H 5KAQF 1VFMA 5JW4N 2R56H 5KSBE 3K4DA 1RIVL 1EO5A 2YBRB 3ARYA 2BSRA 5ISZD 4RGOH 4GAGL 1T22A 2HLAB 5ISZE 1S8DA 2EH8H 4AQOA 4K7PL 1LO4H 4D0CA 1U95A 1T5XB 3DXAD 4PB0H 4YHIA 4K3JL 5SX4I 3WUWG 3GSQA 4JFFE 2XWTB 3DXAE 4X80L 5AZ2H 4D2NA 4LHUA 1B0RB 5DHVB 2YMXH 2OP4L 1P69B 5C0FA 2ZCHH 4GLRI 2FBOJ 4NJAH 3MCKB 2F15A 4R4FL 3O8XA 2NZ9C 1NCWH 4RAVB 3CLFL 3SKOA 2Q6WB 4MA7L 5JXAH 1QO3A 2Z91B 1Z3GL 1FZKA 1VFAB 4LAQH 5IBUB 5E8NA 1CD0A 1HQRA 5E8PB 1FPTL 3QPXH 2NX5D 3HE6A 4JE4B 2OI9B 1T04A 4XP6L 1J18A 1FH5L 3LEVL 2NX5E 2ZSVA 4ODTH 4N8PA 3LRHA 2A6DB 4J4PA 4KJYA 5JMRA 4D9QD 4PTTB 4F2MB 5CWSB 1CFVH 4PJHB 4AM0B 4TPRH 3FO2B 4D9QE 1UZ8B 5E5MB 2YBRA 3UYRL 1PKQE 2ZUSA 1NC2D 1C5BL 3B9DA 1FLTX 4AIZB 5GJTL 1BWWA 1FFOB 2HLAA 4OLZH 1URLA 3EO9H 4D3CH 4TUJB 4IM8A 3H9ZA 1U3HD 3VGAB 3BPLC 2CIIB 2VZSA 2WLZA 3U79A 1T5XA 5FUZH 4Q58C 1J11A 1NL0H 5KANG 2XWTA 1GGCH 4R9HA 3RVWD 5DHVA 1ZT1B 3D0LB 3S5LG 1T0MB 2LE9A 1A5FL 2GCYB 4Z6AT 3MCKA 3WFCH 4Y8AA 3LQAC 1M6OB 4R2GB 4RAVA 3QXUA 3TO4B 4KJWD 2Q6WA 1VFAA 4LP5A 2XXMB 2EE3A 5E8PA 2FDBP 5DFVD 3RIAF 4HCRA 4KUCD 5D1ZA 1UM6L 3QIBD 4PJHF 4QXGL 3TFKD 7FABH 1MFEH 3BX7C 2ED8A 1Q38A 4R97C 4LGSB 2A6DA 1VEOA 3B6SB 1DP0A 4PTTA 5CWSA 4F2MA 4PJHA 1CF8L 4AM0A 1KTLB 4KPHL 3MLYL 1ORSB 3FO2A 1S7VB 1UZ8A 1XGYL 5GSRB 5A2KH 3FT2B 5E5MA 5TE7H 3V52L 3PDDA 2COQA 2N4IA 4N68A 2GHWB 3EYQD 4NUGL 5C0AD 1JPTL 4XC3H 1JFQH 4AIZA 2EIBA 5C0AE 3TH3T 4TUJA 2CIIA 3SDAD 2X1WL 4S1QL 5JORB 1KIUA 4QRSB 3RQ3A 3QH3B 2ED7A 1FC2D 1N5YL 3U9PH 4XNZC 4JDTH 3GJFH 1ZT1A 3D0LA 3OMZA 5JDJA 5T5FL 3EAKA 4Z18A 1T0MA 2Q8AL 2VUOA 2GCYA 2VN4A 5KVDL 4DZBB 1TENA 1ZVHA 1H3GA 1IILE 2WWKT 2B4CL 2J4WH 1FV1B 2O26U 4WHCA 1M6OA 3TO4A 1EJOH 1M7IB 4GAFB 3GBMH 3V7AE 1A0QH 5IESH 2E9BA 1LE9A 5T3XL 2O93L 4LPTA 2APVA 4U49A 5HGGS 1QR4A 2Y6SC 1JZ3A 3X13B 4A6YL 3VRLE 4GAJH 4XP5L 2YD8A 2KBGA 1I9JH 4JO2H 4J3TA 4E41D 1EH9A 4JHAL 5CGMA 2A6KB 3EKCA 4E41E 4PJEF 4PRBA 1M4KA 1KGCD 3ARFD 2V5MA 5LCVH 4DWHA 5AG9A 3FB6B 4BZ1L 1KTLA 4LPVA 3B8SA 1KGCE 1ORSA 1S7VA 1BFTA 4OJFH 5JUEH 3KDMB 5GSRA 3FT2A 4BK5A 4PJEA 3LY6A 3TN0D 2DQHL 3ZL4L 4PFEA 1KIPB 1HWGB 2IPKB 5KJRL 1J88A 2C5DC 3P30L 3LZFL 1ZHNB 3IT8D 3TZVB 4OCXL 5DZNA 5JORA 2OTPA 1YNLL 4QRSA 1NH6A 4TTDD 3ARGC 3QH3A 2V7HA 5T33L 2RB8A 4F15B 4G6FB 2KPNA 3CFKA 1R3KB 1KBGL 4L1DA 4DEPB 3ZHLA 5AAMA 2WANA 4XCCH 5JIPA 4DZBA 2BVTA 3EZ8A 3RZCD 4TNWK 5ICYB 1M7IA 1ADQL 3WEXA 4WUKH 3U83A 3UJJL 4H26B 5I1CL 5FGBC 2QKIB 4I2XA 2D7PA 5CD3B 1KLUB 2PKDA 4PRPD 3X13A 3RX5A 3G6AB 5IGXL 4NC2B 4Z7WB 2FL5B 1T3FB 4PRPE 4QRRE 1K4DB 2JJSC 4APQB 2A6KA 4HMEA 2XKSA 4HBQA 3HE7A 1TFHA 4QXTB 1QSFB 4EDXB 3ZHKA 3VDBA 1JGEB 3L5JA 1T7VA 2OL3L 3FB6A 4PJXE 3GHEL 2VABB 4EUPA 1YNTB 3IU4L 1KN4L 5EU5A 3KDMA 3ULVE 4Y5XC 5E08H 4EI5A 2WWMC 4JPWH 3VFVB 4TRPH 3ARDC 1CGXA 2DM7A 1NGZB 4M7KL 5C09B 1NCCL 3X12B 1KIPA 2IPKA 4PR5B 1E4WH 4P4KD 5DS8B 4V1DB 5F97E 1ZHNA 5F7DB 4PJDB 3TZVA 2JCCE 1KUMA 1J87A 5FCSH 3VXUD 4JRYB 4UAOC 1C1EL 3WNKA 4LSTL 4NBYB 2GJ6D 5HHXL 4TVPL 4M62H 2X1QA 3E6HB 3OF6A 5ICYA 2GJ6E 3I2CH 4Z7WF 4XH2B 1OSPH 1EZVY 4H26A 3CFBB 2DMKA 2QKIA 1SJVA 2AGJH 4EZMA 1KLUA 1CQYA 4P48A 2X4QB 4ZUUB 2EDQA 3G6AA 3NABH 5JW3L 3EJYC 5I17B 1XGPB 4Z7WA 5HDQL 2FL5A 3GSWB 1T3FA 1K4DA 5DR5H 1E4XH 2DMCA 4FXLA 4H0HB 1QSFA 1HZHH 4EDXA 1JGEA 1U8HB 4YZFF 5D70L 3T3PF 2VABA 1IJ9A 1ZEAL 5ENWB 1RZKL 1UA6L 1A7PL 5DJXB 3I02B 1M05B 4PJDF 3VFVA 4WW1B 5JOPD 3LPFA 1NGZA 1J0IA 3X12A 4PR5A 5JOPE 2XNAA 4FQ1H 4OTXH 2HJLB 3BT2H 3VFGH 5HYJD 4V1DA 1YEGL 4XCFL 4W4NA 5F7DA 3O2WL 4PJDA 4YHYB 3BP6B 5HYJE 5IB1B 2NXYD 2R1XB 4JRYA 3RWGA 3ZZ1A 1P7QD 1SQ2N 3OTTA 1MIMH 4LOUD 12E8L 2ZOKB 1BWMA 3E6HA 4RMVA 3ULVL 4HZLB 4XH2A 4I8DA 3CFBA 3MA9L 3WNPA 5B4MC 4GS7C 2X4QA 3NCJL 5I17A 3ESUF 1XGPA 1YMMA 5E8DL 3GSWA 1KIRB 1XH3B 1JJUA 2I24N 5FYKD 2DQIL 3UYOD 1IC1A 2QHLA 3LN9A 5FYKE 5CKAA 4U0RB 2FHCA 2GTWA 5C0DA 4B0MM 1CDIA 2EXYD 35C8H 2EECA 5ENWA 1S9WB 2P44B 4I18B 4I9WD 5DJXA 3I02A 1M05A 1CU4L 1NDGB 5ILTL 5KAQG 4I9WE 3IAQA 4ZS6D 3OGCB 3NIGE 1J1XH 2HT4C 1N0XH 2CGRH 1AFVH 2HJLA 3D39D 4KRPB 1RUAH 2D2OA 4NM4L 4JY5L 4MJ5B 5HDOA 4DVRL 3G5VA 3BP6A 5IB1A 3D39E 4IEFB 5KW9L 1BVLB 4LHUG 1REIA 1BQLL 4BQBA 1QFUH 2R1XA 1FZJB 5I71C 5DF0A 4CDGC 3RAJL 2X5PA 5TQ2H 3F8UB 1S7TB 4J3OC 4NUJB 1MCIA 3OJMB 3THMH 5GGQH 2ZOKA 3VXRB 3TESA 4A6YB 5F8QC 4XMPL 4HZLA 3BAEH 3H0TB 5MENB 4UTBH 4YHNB 3PWJB 3L7EB 1QBMH 3PL6B 1WGOA 3WV0A 5I8CB 3G6JE 3ILQD 4JGJA 8CGTA 5CJXA 5LXGH 4C4KT 3KPPB 1KF9B 1KIRA 3KNBB 1XH3A 4DQOH 1TJGL 2HT3D 4WI8A 2XYCA 3HPJB 5JTWA 1J12A 3RU8H 4PREB 4CMHB 3FTGB 1ONQB 3ZT6A 5C0JB 4WIQA 1S9WA 4I18A 4M1DH 3TPKA 1D6VH 1J0KA 1JZ7A 4JKPH 1NDGA 2VLJD 2VZUA 5DQDH 5IEHB 1BVZA 4FTVB 1MEXL 3FZUC 4ZNEE 3OGCA 4JZOA 1R5IA 2QHRL 2VLJE 1G0DA 1I7ZB 3T3MF 4FQCH 3CJJA 3KXFB 3ARTA 3Q3GA 4H8WL 3T2NH 4MJ5A 4YAQB 5INDB 1BVLA 5ERWA 4KHXH 2V2TB 1FZJA 3WIIL 32C2B 1SVZA 3I85A 1S7TA 2OZ4H 4NUJA 1CBVH 5I18L 3VXRA 1F8TL 1XF2A 4J6RH 4A6YA 3MO1B 3MV01 2DQDL 4ZFOL 2FECL 3H0TA 3WIHL 1WJ3A 4K94L 5K33A 5E4IA 4KKLD 5MENA 4YHNA 5IBUG 3PWJA 3PL6A 2O5ZL 4FRWA 5I8CA 1MH5B 3MOQA 5IR1B 4R90L 2EEBA 2OL3B 4Y5VB 2IPTL 2X2YA 4ZTPH 3QFJB 2Y25A 5EBMB 3STZB 3H3PL 4JFZH 5HHMD 4WGWB 5FO9B 4POZC 4GBXD 4D9LL 3HPJA 2YN3A 4RNRB 3RVTD 5HHME 3IETB 1I1RA 1JGVH 2B39A 4PREA 1A6AB 3FTGA 3OKEB 4ZXBB 4MJIE 1ONQA 3EOTL 4FNLL 2HAZA 5C0JA 1UH4A 5E7BA 4X9BA 2AK1H 1YA5A 1JHLH 1U8JB 1EK3A 4KDTA 1JF5A 1NKRA 3DX6A 4KVCL 3U4EB 5IEHA 4FTVA 1BJ8A 5DJ0B 2WSKA 3F62A 2BNRB 3O6ML 3U6RA 1I7ZA 4IRZH 3KXFA 3U7YL 1MF2L 43C9B 3BYTA 2QTEA 4L8DB 4YAQA 5INDA 4LLDB 4Z7VE 1DCLA 4G3YH 1NANH