4WI8A

Structural mapping of the human igg1 binding site for fcrn: hu3s193 fc mutation y436a
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHATQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Structural and functional mapping of human IgG1 binding site for FcRn in vivo using human FcRn transgenic mice
rcsb
source organism Homo sapiens
total genus 34
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wi8A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wi8A01
4IRZL 1ZLUH 4OSUH 4PGCA 5TPWH 1A1NB 4WW2F 4JANA 4XNMA 5CEZL 4JQVC 4N90D 3IDJA 1DN0A 2IGFL 5C0AE 2IWGA 4NKIH 1U8LA 1KPUB 1D5BB 4DFHA 5FUCE 5FK9B 1KTDA 3RWCB 2Y6SC 1MAKA 1J11A 4M7JL 2EC8A 2BFVH 3R8BB 1BD2A 1EXUB 4FFZL 1KJ3H 5TGBB 4YHOL 2Q8BL 3HMXL 4G8EA 4UT9H 5DURB 3KYAA 1TTFA 1H3UA 3CFKB 43C9B 5DQDL 3LKNB 2GJZA 4O2FB 1I9JH 2J8UB 4YIQB 2F53E 3X3GH 3C5SA 3IB4A 3DETD 4OZIF 3WHE0 1CZ8H 3QFDA 4C83A 4D0CB 2E7BA 3AREB 3CVHB 2C3WA 2IANA 4Z7QF 4P9MH 4JY6A 4YEEA 5CUSL 1Q9LB 1EAPA 2I9TB 2WUCH 4G43B 2A9MH 5DF0A 1MH5B 3MBED 1P2CA 3GJEB 4XCEA 4JQIH 3BPOB 3G5XB 3MFFB 3FCTB 5GRJH 1OAZL 4HQQH 1ZOXA 1RV6X 5T5FH 1YQVH 4CRPA 4ZSOB 3VXQA 4WDIA 1NMBL 1GVIA 5LAXB 1MHEA 4AM0A 4HGKC 2DM3A 5EBGA 5JPMB 2LVEA 3QIBB 5JOFB 2D31A 4HPYL 1KJ2A 4A6YB 1D5ZB 2FRGP 2OTUA 1IEAB 4ZO7A 3RL2A 3VE0A 4LEOB 4MB5A 2VDNL 5A43C 4P2RA 3F7PC 4U1IB 1CF8H 3SQBA 1H3WM 4BQ9A 4TQEL 1V3MA 4X6CF 4M3JA 1IQWL 4QT5B 3JV5A 3SGJC 4AK1A 2C9AA 1MHCA 1T1ZB 5EU4A 1QR4A 3EYOA 1QSEE 2ZUTA 2AAVA 5FECB 5IEHA 1H3GA 3UPAA 2YPLB 5SV4A 5FKPA 4OZHA 1QSVA 1JPSL 3IJHA 3AXLB 5ILTH 3DX6A 2GJ6B 3MO1B 2AW2A 3NFNA 5D7JC 1ULVA 3RU8L 4RX4A 4Z7OE 4JFDB 2PF6A 1A0QL 1HEZA 3ESUF 4TUJA 5DJ6A 4HLZH 4WUUB 4FQPA 4FNLH 5DD3H 5DQ9A 3DV4A 3CGTA 3IT8D 3FO2A 4I9WE 5LWYH 1IQDB 1JFQL 2DMBA 3Q5OA 5FHBL 4X7TA 1A1MB 2E8YA 3STZA 1T2QL 3HC3L 5EIQA 3CH1B 4NQCA 1V5JA 3HS0B 2VDKL 1MWAH 3QHFL 3HB3D 5DUBA 3TP4A 2NY7H 3A6CL 4KGLA 4LIQH 3QUKB 4FG6D 3WDJA 1ZHKB 1RJZB 5JORB 2YRZA 2AEIT 1HSAB 1BREA 4IRSC 4GAJH 1GSMA 2DI9A 3C08H 4JO4L 4UB0H 5AAWA 3EJZD 3QXWA 2H9GA 1K3ZA 4M4PA 2VLRA 4K9EL 3V6FA 5HI4C 4BKLB 7CGTA 2G9HA 1EERB 4NQEB 2P7TB 4YHKL 1F4XH 4POUB 2ADFH 2A74B 2N56A 5LGHL 3C2AL 4N0RA 2BY3A 5JQ6H 4XC1L 3WHXB 1WAAA 1U8KA 2FECI 1XF2A 5D6DC 2CRZA 1FIGL 4LVHB 1WZLA 4AIOA 3QNXB 2BCKA 3TA3A 3TBSB 4ISVB 2GSGA 5IM7B 1RVFH 3TV3H 3VXTB 5IB3A 5GSVB 4ODUA 5I1DB 5D8JL 3QXVA 3BQUD 1I1AB 3QJFA 2A73B 3VD9A 1Q94B 4NO2B 2BJML 2GUOB 5HDQL 5J11C 1U3ZA 2ARWA 3UMTA 4RA3A 3QUXC 3PGDB 5DQJA 4XPFL 4TN9A 1MQ8A 5D2LE 3QDMB 1MFEH 2GTZB 4YDIH 5JDJA 1R5VA 3H42L 3DRTA 2CRIA 3WO3B 3NCBB 4OCYL 3KPLA 4Q0XH 2EO1A 5EZJA 5KVDH 1ZHBB 4MSWA 5EOQH 3T09A 5TF1L 3QRGL 4C56A 1I8KA 2OTWA 5BJTB 3ULVE 4W6WB 2ZSWA 4WI7A 2E8ZA 2CK2A 1AGCB 1Y6KR 2HKFH 1LEIA 3GSVB 3OTTA 4IMLB 4XXCA 4KHXL 1VACB 3EYVB 5BRZD 4JAMB 5I1LB 3HR5A 3VWJA 5AYQA 4LP5A 1WQVT 2NY1C 3CPLA 5IMMB 4NHUA 5ALCL 5HVFB 4Y4KD 5AAMA 3KPOB 3DLQR 4PJFF 5JW4M 4MQXC 1HNGA 3DTXB 3V7MA 3LV3B 3MA7B 5KSAA 1RHHB 4YGAB 2I5YL 5E8DL 4KK8D 4LKXA 3X14B 1HDMA 5ACMA 5ACLA 4QOKD 4N90E 3VG0H 3D0VB 2VOTA 4U1LB 3TGXA 1PAMA 1UKSA 4HWBH 5DK3A 5D1QC 4Z5RA 4M6NL 3N1FC 1LILA 5IW3A 3SDCB 1NCAL 2ZUSA 4F7MB 2FYYB 5C3TA 3GSXB 4OF7A 3RUGB 1WBXB 3T65B 3MRKB 3GSOA 3EOAB 4PJEE 5C6TL 3EOYG 5DR5H 1DBAH 5GGTH 2BXYA 4H1LB 4LIQE 3MRGB 4P9HH 3T0AA 1JGEB 3ILQD 4LSQH 1NC2B 43CAA 4KZEH 3W82A 3DGGB 1RUML 1MRFH 5F9JA 1ZEAL 3VFPB 2ZKHL 1KT2A 2ZOKA 3FT2A 3O8XA 3UTTA 5GXBB 1N5YH 1CFTA 3E8UH 5IHZB 4O5LL 3S37H 1XF5A 5T3XL 3B43A 3FZUD 4DTGH 2EDKA 2F8XC 4IHOB 1V7ML 4G7YL 2WQRA 1IAIL 4TOYL 4JKPH 3F12A 5AYUH 4Y5XA 4NRZB 4HJJL 4TVPL 5SX5H 1YEGH 2JLLA 3CFDB 5EPMB 4XNXL 1UEYA 1NPUA 4LPCA 1EDQA 2HWZH 1BF2A 1X5XA 5DSCB 3HKFA 4EVNA 5B39B 1LO4H 1G7JB 5J4MA 3RGVD 1K4DB 3MMEB 1OW0A 1MJJB 1CLCA 2KQNA 4F58L 2VN7A 5IJVB 4HIJB 1XCTB 3G6DH 1I3UA 3ESVF 4ONFH 2DLFL 3NCMA 4F3FB 1OGAD 3NCJL 1YUHA 1FFPA 1H3VA 2ADIA 2R9HD 3GJFH 5E4EC 4FQ1H 4L8CB 1EFXD 3ZSTA 4LQFH 3D0LA 4XBGA 5B3NA 1D5MA 1KC5L 1X7QA 4UT7H 4LBEB 1TTUA 4HT1H 4ODVL 3BT2H 4XP4H 3QG6A 3RRQA 3W9DB 4JPWH 5IMOB 4NJAH 3VXMB 1CGWA 5D6CB 3UC0H 4KKAC 1JGVL 2ZUQB 5L8LB 3HRPA 3FOMA 2B1AH 2EDNA 1MCWW 4MJ6B 2V17L 1X5FA 5I1EH 1A6VH 5CEYA 2FSEB 3HMWH 3EYFA 3TLRA 4PRPD 2HMID 2ENSA 1ZV5A 3MZGB 4FQXB 3D2UB 3HPLB 5IROC 5I75C 3U6RA 1R5WB 5KSBE 3HG1B 1QR1B 4PJGB 4NN7C 3GKZA 4HUUA 1EO5A 3L5XL 3SDDA 3V8OA 2NW3A 4I2XA 1A4KB 3F5WA 3NABH 2H8PA 4XGZB 1T89A 1RUPL 1HH6A 5MEPA 5IMLA 1JZ3A 2CKBB 4HMCA 3RVWD 2R0WH 1Q0XL 1ZLVH 4I4WB 4QHKI 1RZJC 4RFEB 3B83A 2JJVA 4XP5H 1LK3L 5IB2B 3CFCL 2L7UA 1DJSA 2FGWH 3S5LA 3G04B 2FB4L 3T0WA 4Z7UB 4CVWA 4D8PA 1AO7B 4BQCA 1R3KA 2M26A 3TF7C 2Z9TA 4OFVA 2OI9B 5MP6L 3KHOA 3MRRB 4QRUA 3RTQD 4MNQB 1NBZA 4X8JA 2E7MA 4OTXH 1Y0LA 3VXRA 3KPQB 1HHIB 3FQXB 5GGSY 4DAGH 3RWJB 4U1GB 4OD3H 3QWRD 3S36H 4OIAA 2DAVA 3B3IA 5AWNL 2Q87A 5CGTA 2ZZUT 5HPMA 2XA8H 4AEFA 4QRQB 1E4KC 2G60L 5AEAA 4EXKA 3NZHH 3R1GH 4NM8H 1G7QB 2LU3A 4S1DC 3I2CL 2PR4L 1F4YL 2B5IB 3WNMA 3LS4H 3IFLL 3TT3L 1OTSD 3L1OL 4G80B 3RY5A 3CVIH 1HOCA 4I5BB 3V4VH 3DO7B 4F2MB 2VLLA 2VXSH 4FQHB 2E3VA 4MD0B 2VZUA 4P48A 2YEZA 3S6CA 3ARDC 2AGJL 3P11H 5FYLD 4R8WH 1EX0A 2R1WA 1G84A 1OCWH 1JN6B 4S11A 3IKCA 1OD9A 1TVHA 5KZCD 4TNVF 2D7QA 1VCAA 5E2WH 3S7GA 4UUJB 4TSAL 4Z7VB 5TQ0H 3WLBB 5L2KB 1D3CA 3RX7A 3C60A 2FR4A 3P9WB 4NYLA 5GGQL 4P4KD 3CFBA 4MCYB 5LBSL 1U92A 4FQJH 5DJ0B 1NGZA 4EDXA 5BCAA 1A9BA 4U6HA 2C26A 3W81A 2SEBB 5BRZE 4EOWH 1G7PA 2HT4C 4KHTL 1M1SA 5J13C 5DYOB 4YQXH 1JL8A 1UVQA 1UZ6F 4Q6IB 1GPOL 5K9KB 2R4RH 4PGBB 4XP6L 2HJFB 1U8MA 1OTTD 3HC4L 4MXQC 2YK1H 1BBDH 4UQ2A 1XH3B 4RMTA 4WWKD 2R2EB 2XN9A 3PV6A 1CXEA 4LPWA 2JB5L 1BECA 3GBLA 4QOKE 3UTZB 3DMMB 1G1CA 1FYHB 5IOPB 1XGUB 2AABL 4AL8H 4NKMA 4XVSH 1B90A 1D5IL 1QOKA 3G5YB 5BO1L 2F74A 2NCMA 5K59F 5K9JH 3V52L 1WLHA 3QCUH 1DEEA 5JHDD 4OFYD 3OF6D 1PY4A 5GJTH 3SKOA 5C0JB 1F3DJ 1FLRH 2X7LB 1M7XA 2HRLA 4U1KB 2P5ED 3SKUD 1RAMA 1JHKL 2N7AA 3ARFD 1H15A 5GIRB 2CO7B 5BZDB 4KROD 5JXED 1R24B 5I71B 1OWRM 3MJGX 3HNSH 2GK0A 1J0ZA 1YPZB 1NCNA 5E6YA 4H88H 3SKJL 1QO3B 4FABH 4ZD3H 5E4IA 3WIFB 3QJHB 4O02H 1IKFL 4PP2B 4P23D 3UCRA 3QNYB 5F6HI 3OX8B 4XXCC 2CK0H 2H1PL 1O7SA 3VWJC 5KVGL 1GC1H 3QDGB 3KPSB 3GEWB 3ISWA 2CR3A 5C71A 1DVFD 4N5UA 5MEOA 2WM0A 1WCQA 4K9EC 1SY6L 3UAJD 1FN4B 2K7PA 1T66C 2R1YB 5GSRA 3L3HA 2E27H 2P1YA 3EO9H 2Y36H 3DVIA 3BSZH 3DECA 4M7LT 2MKLC 2V2TA 2OXHA 2EDFA 4QTHA 2QBWA 4RGND 3P30H 4LPVA 1DE4B 1MFNA 5M94B 4QRSA 1OGAE 3DV6A 2DJ4A 1C5BH 3FFDB 4GQ9L 5HHXL 5TFSH 3G5VB 4U1HB 4HUVB 3FOLB 1FH5H 3L3GA 4TRPH 4HHAA 4XMLH 3KPNB 3ZKMD 4X4XB 5JTWA 5T33L 2Z93B 3ETBF 3D9AH 1WBYB 2XI9A 3GHBL 2KDGA 3L5JA 5E00A 4K8RL 4RIRB 3EO1A 3DURA 5EZOH 3B9EA 3K2UH 3OR7A 4HC1A 2GY7B 4X7EC 4R7NB 3X13A 1Q1JH 3ARTA 2QHLA 4FQIH 1SYVB 3PHSA 3OJDB 5CJBA 4XPHH 3DUUB 3VMNA 1FFRA 2QSVA 2R29H 2ZOLB 5GGSB 3L5IA 4PRPE 1KXTB 2X4QB 1I3GL 1WZ1L 3MCLL 3VI3E 1VKXB 3KDMB 2X09A 1BGXL 1N7ML 4PGDA 3NPZB 4E9LA 4M5ZH 1S9YA 1WWCA 3X12B 3H6JA 3OKLA 1MAML 4Y19B 1FPTH 4Z95H 3MLTB 1KG0B 1Q9KA 2DQDH 3O41B 3MJ9H 4EI5C 4WJ5A 3BP4A 4L5FL 3QUYD 2WAHA 3FONA 5DRWB 3IU4L 4IMKA 3MRDA 1FO0H 1HINL 5HYQA 2DLHA 4Y1AD 1A6WH 3QEQB 5IFJA 2G2RA 4N9GB 5CD3B 5KS9F 3U0WL 2ESVD 2N1KA 1O7VA 1EO8L 1BMGA 1IGIH 4DVBB 1FAIL 2IMMA 3U1SH 5DC4B 4JZNB 4PJ7E 2XZAH 3BEWA 4M3KB 1K5NA 2R8SL 3RNQA 5BVPH 3GGWB 3G08B 1F6AB 5J6GA 2B7DT 3VRJA 4GBXA 1W0VA 5D7JB 4ZS7L 3DROA 1TNMA 3V5DA 4MDIA 1F6LL 5JUEH 32C2B 4FTVB 2WP3T 1S9VA 3LN5A 4UAOC 1KEML 1T20B 5FYLE 5DEGB 4RGOH 3SE3A 2C3VB 4JO3H 3VG9C 4Y2OA 1YEEL 3GIZL 1SVCP 5JLZA 1K4CB 2CJUH 3IDMA 3SDDC 5KVFH 2YN3A 6CGTA 4KJYA 4HK3J 4BQBA 1T89C 3WD5L 1WFNA 2FL5B 1VA9A 2GSIB 1FG2B 4R9HA 4RWYH 4OZGA 3R06A 4X83A 4ZXBA 1CLOL 1IKNA 5E2UL 1MPAL 4DQOL 3E6HB 5IGXH 1J0KA 3KPTA 5JZ7C 1VGEL 1S7VA 4XMPL 1AC6A 1MSPA 3LD8C 2RFXB 1UACL 3V0VA 5D96C 1W72H 2BOBA 2Y5TB 1LO5B 1N64H 3GFUA 2NTFA 3PNWB 1OGTA 5C07B 2NR6D 3S4SA 4R3SA 3QUMB 1BQSA 2XTJC 1J1PL 3MLVL 3ELAT 5SWSA 1JE6A 3TCLB 5CD5C 4DUXA 5FO9B 4CJ1A 2FATL 1CD9B 1EMTL 4NHCL 1IFHH 1IEBA 1UCBH 1J9CT 2R2BB 5A16B 5CSGA 5HDOA 3PWUA 1N5AB 5C08B 3RZWA 5JHDE 1ZMYA 3QYCA 1JHTB 2CUMA 2X42A 4F9PA 4UOW0 1AXSB 2P5EE 3F58H 3ZDXE 3VRLF 1YZZA 4I0PA 3HR6A 3EDJA 5EOCH 3I50L 1I7RA 3QUXB 3OKMB 5IIEB 4AG4L 5ABDE 4UNVA 3C6LD 1OD7A 3EYQD 4K23H 1P4LA 4LRNH 1NCCL 3BD4A 2UZIH 4FS0A 3MNWB 3C09B 4G8GD 1EVTC 1MNUH 3C60C 4J4PD 1CG9B 2X4PA 4JKLA 4KUZH 1LWRA 3QQ4A 1L0XA 3SDXF 3VXNA 2ZNXA 4EI6A 4YO0A 4JFZH 3W0WB 4X80L 1XGTA 1A9EB 3GBMH 5DC0A 3ES6A 4XNQB 4UNTA 3ARGC 3I84A 4B7IA 2BSSA 4YC2C 2NY1B 3F7QA 3FMGH 5IHBA 4ELKA 5DS8B 5FKAA 4GMSL 4PRAB 3UTOA 5DJYA 1IAOB 1JUFA 3I02A 5CJXA 4ZTOL 5C2UB 3T77B 5A40E 3CUPB 4RGNE 3BKJH 5K9QG 4QNPF 1T03H 3SE9H 5HGHB 4R90H 1Z0NA 4BSVA 2XNAB 4YWGH 5D1QB 5HBBA 4MX7A 4LSTL 4NZRL 1K6QL 2FX9L 4XVJL 5E0QA 5JOPD 3RDTD 1X5GA 4JZOB 2FHBA 4RBPK 4AIXA 4FFYH 1VENA 2CMRL 1TTGA 2DQCH 4LLMA 4NC0B 2Q7YB 4GUPB 1IM9D 1YEJL 3S34L 4BM7A 3GRWL 1F00I 1KOAA 4MLSA 1DBJL 5DHYB 4LSRL 4YXLH 2AK4A 2Q76B 5C2BH 2K7QA 4F15C 4ODHH 4JY4B 5HHPB 4V2BA 5IVOA 5ID1A 2X05A 2VL4A 5DWUH 5BVJB 1NBQA 1NAMH 1UCTA 4N8VA 1AKJD 2Y5EA 4PLOB 5GRUH 3QSKB 2A1WL 3Q2CA 4HS3A 5E8OB 1S8DB 1G0YR 4TUOB 5DD0H 3P4NA 2VLJB 3TO4D 3TZVA 1PSKL 4U1NA 2D7TH 3PL6A 5SWQA 5HGAB 2FEDC 1RK0A 5I8CA 2A0LD 4JM2D 5T1LB 1AY1H 4U3XA 5GRXG 1JNNL 1XEDA 4Y1AE 3Q6FA 2NQCA 3PV7A 3RIAK 4EN3A 5C0NC 1TZIB 1A7RL 4XNMB 2ESVE 1DN0B 4JO1H 5DT1H 4UOW1 3FB7B 5KSVA 2R23A 4K94L 1KTDB 3T04D 5EORH 4HPOL 5LCVH 4TTDD 1BD2B 3PHQA 3QI9A 4QHKJ 4X4MA 4XNYH 3H9ZA 3TPKA 5ADOL 4AQ1B 4H0IA 5FYKE 1YYLL 5CS7A 2FO1A 1NANH 4ONHB 4CU8A 1HK6A 4WI2A 5KN5A 4XP9H 2IBZY 5F96L 1BIHA 4G6AD 4HBCL 4HULB 3WXWH 3O6FC 3QFDB 3FO1A 4C83B 5J8OA 1GZPA 3PP4L 3AM8C 2ICEA 3VDBA 1G7IA 4MQ7A 1J05A 4JY6B 3VFMA 1ZA6A 3RHWK 1BX2A 4AYFA 1EAPB 1I9RL 3JUYA 3UPRA 4Y5YA 2Q3ZA 4KKLD 3GB7A 4F7PA 4PJXF 5I30H 4XCEB 2DM7A 5EZIH 2LU7A 5I75B 3LPFA 1H8SA 3K46A 4PJDE 4NN7B 2J3SA 2DICA 3VXQB 1RMFH 2NNAB 4EDWL 1KN4L 1MHEB 4AM0B 3WDIA 4QWWC 3LS5H 2OS7A 2PO6D 5C09A 1BEYH 1UWXH 5IFHH 2IG2L 3I3BA 1OP3H 3QNZB 1KJ2B 1K8IA 8FABA 2UWEE 3O6KH 4X99B 4KKNA 1CDIA 1NL0L 3W11D 3LKSA 4LPTA 4NO3A 5IUSA 2CDEA 3KR3L 1YEDA 4M6AA 3VE0B 3WSQH 3ULUF 4J23A 1FLTX 1NCUA 5EU7E 4P2RB 2GT9A 1A14L 1ZXQA 3IS1X 2ADGA 1B2WH 2V7HA 4H20H 1AXTL 3VD3A 5DA0B 1CXHA 5BS0D 5SWZA 1AFVH 1MHCB 1OP5K 3GSNL 4DKFH 4I3SL 3TJEH 5CJOL 5HYJD 4XI5C 5EU4B 3TVMD 1TLKA 3EYOB 5IEHB 3WKMH 4XH2A 5F1IA 1VPOH 4BSWA 2A6DA 4OD2A 2XPGB 4P57A 4OLZH 4ZUSA 5TE7H 1OARL 4UQ3A 4OLVH 3NFNB 2BP3A 4BZ2H 4NO0B 2HFTA 4OQTA 1RZIB 4K8RC 5IP4A 1LQSR 4F37F 1HEZB 4TUJB 2OX5A 5DQ9B 4X0KB 3DV4B 4RQQA 3FO2B 5D7LA 5C6WH 3ARDB 4X7TB 1LK2A 1JWMA 3A6BH 1QUNA 3RWIA 3ZTNH 5LGJB 1XGRB 4NQCB 2D7PA 1HI6B 4P2OC 5I9QC 5FGCB 1FHGA 1C08B 1IRAY 1V3KA 3REVB 2XOTA 3HRZA 1A7QL 2UVFA 5CKGA 3O3AB 1HXYA 4MD4B 1IL1A 3JVGA 1BQLH 4GRWB 4XAWH 4XC3L 3T1FA 5L0QC 1VSCA 4RA0C 1PYWB 3JSSA 4Y4HA 5EO0A 5SX4H 4PJ9A 3ZE2E 4JFEA 3O11A 4P46D 1CLYH 3ARED 4JFYB 3VFSB 4DFIA 1NCWL 2G9HB 5J13B 5HGBA 3OXRA 3V4UL 5BV7L 3O3UN 1EHLL 2YUZA 1JP5A 2LAAA 1P5UA 5E5MA 5A1AA 4F57H 2W9EL 2WANA 2O5ZL 4ERSH 2F15A 4EKXA 2Z91A 1I9EA 3VA6A 4PJ8A 2BCKB 5F6HJ 3ILPA 1FRGL 1KFAL 1B4JH 1P84K 4TSBH 3I9GH 3CU7A 5I8EA 4Y5VC 2ARJQ 5DJXB 4ODUB 3HE7A 5JOPE 1CL7H 3IAPA 4PYHA 2VDPL 3O2WL 3QJFB 3B6SB 1AGDB 4OCLC 3ZE0E 3KLHD 4F9PC 2D0HA 1F6FB 2D2OA 3OKOB 2ZPKH 1CTOA 1WAAF 3WCYA 1MF2L 2IFFH 5J3HD 5CP3A 2B1HL 3ARYA 4X9IA 1KENH 4U3CA 3JWDL 1RZJH 4O9HL 1R5VB 2YPLD 3WNPA 3EAKA 4LSVH 5EC1B 2NYYC 2K3TA 4UILH 4XPGH 1R3HA 1I8KB 2OTWB 1DANU 1CR9H 4E41D 4KGJA 5IR1B 2WP3O 4JFDD 1G7MB 1LEIB 2VQUA 3LPGA 2DYPB 3HE6C 2NY2D 4WUKL 3CZJA 4LKCB 3VWJB 1WZKA 2FIRT 3LY6A 4J3WA 3CPLB 3T3MF 1Q9OA 3DVNA 4DOHE 3VGGA 3WV0A 1FSKC 2IF7A 3QCTH 4H25A 3R0NA 5IB1A 4IS6B 3TBYA 5KSAB 3HMXH 4AIZB 1LNUA 4JHBA 2EECA 3H2WA 3QG7L 2AJYL 2EDHA 4Y2DD 5LGKA 4N5ED 5DJDA 1MLCB 5HY9A 2VH5L 4QKXB 1NFDF 4Z5RB 1X3DA 5DFWH 3MOAH 2Z8WC 4OFPA 5HYFA 1UH4A 3P9LA 1OAYL 4NQED 2VJXA 4RNRA 1KEGL 1B0RA 2JJUA 5F1NA 4LFHD 1NMBH 3V2AR 3C8DA 2UZYB 5IJKA 5CIPB 3UTSD 4PJAA 2W65A 4XVUC 5I8OL 1HYSC 2VDML 4A2LA 1OTUD 5HGDA 43CAB 1L7IL 3QEGH 4XAKD 5F9WC 1D6VL 4PJBB 5F9JB 1ZLUK 5INCA 7FABH 3FT2B 4OZFG 1MCOH 1XF5B 5DFVC 2DQGH 2K1MA 1D9KA 1I1AD 5BOZG 1YEIH 2VLMD 4R4BA 5ERWB 4MMZC 3BAEH 2P5WA 4GRMA 3F12B 3PL6C 5GZND 3SBWC 2JCCF 4EUPH 1H3PL 4OGZA 2P43B 4MCZA 4YGVA 3U0PA 1HIMH 5IMKB 4EI5B 3N85H 3MRCB 2OJEA 4MAYA 1QRNB 5EN2A 3WFDL 2IMNA 3VJ6A 1KCRL 2X4RA 1CD1A 1OOAA 2BDNH 4EN3C 1UM5L 3DXAD 4WI8A 5KJRL 4PJ5A 1EGJA 1A0QH 4L1DA 3TIDA 3VD5A 2DOCA 5CCKL 1EZVX 1A2YA 1KNOA 1UT9A 2W0FA 1IC4H 5BMFL 1YUHB 1FFPB 5HYJE 2ADIB 3QUZD 1CFVL 3OQ3B 2Q6WA 3T2NH 2UV3A 5FHBH 2IPTL 5J89A 3BX7C 4GG6E 3WYRA 2HJLA 2VITA 4ZUVB 2R0KL 4D9QD 1X7QB 5HHMD 2KBGA 5IW1B 2VDKH 5CZXC 3QG6B 5HXMA 4JDZB 5TDPB 4CW1A 4ENEC 4XCFL 5HI3D 3WFZA 2JJSC 2AJ3A 5I15L 3N9GH 4CGTA 2BNRD 3FOMB 3EYUH 4ELMF 1PLGH 5AG9A 4JRYB 1TFHA 5GS1A 3OAZK 4RAVB 4UAOB 5CEYB 4JO4H 1P4BH 2EIEA 4K3DL 2PETA 2ZG2A 3HCVA 4OJFH 2NXYD 3MRPB 1F11B 4NT6B 3G6AA 4Z7QE 25C8L 4WFED 3SDCD 2GY5A 1NGQL 1JGDB 1DL7H 3VG9B 4YFLI 3U6RB 4XPAL 4UDUA 2VXUH 1BAFL 4XC1H 4HUUB 4UIMA 3SDDB 1XIWA 3ROOB 5A2JH 1JHLL 2NW3B 4MMXC 3F5WB 1NFIA 2LTQC 1MRDL 1I9IL 5IMLB 1JBJA 2RAMA 4HWZA 1HQRB 5L8KB 2YKLH 1NC2D 2FCBA 2GYSA 4HKXB 1J18A 2AEQL 1T5WA 3S5LB 4CKVX 4ETYA 3AFLA 4CDHA 4N0FA 5LXGL 3LD8B 2VABB 1H8NA 3UYRH 4UU9A 3RAJL 1FYTB 5D96B 2UWEA 5DMKA 1TDQA 1GGYA 4X6CE 1MEXH 4QRUB 4R97B 1E6JL 1NBZB 5HDQH 2D0FA 1Y0LB 2XTJB 2P8MA 3VXRB 1ZA3A 4XPFH 3FO9B 4K94C 1H5BC 1KJMB 5EU3B 4OIIH 1HYRC 3B3IB 2QKIB 3H42H 3KNBA 5L7XL 2MPAL 1UC6A 3NOIA 5CBAA 2DM2A 1KCLA 3IDUA 2EDQA 5TF1H 3QRGH 2MCG1 2VISA 3P0YL 4M6MH 5DJ8B 5I19H 3EGSA 1IM3A 1T1YA 3J8F7 1AD0A 4JHWH 1HOCB 4ESKA 3PGFL 2VLLB 4LOUD 4QXUL 1ACYH 2VQ1A 2YEZB 3U30B 1UA6H 5TQ2H 2YD3A 4HCRA 4J3UA 3LPWA 2R1WB 1OSPH 4XNZC 1CT8B 2EZ0D 2YPLE 1TVHB 5ALCH 3Q1SL 4HIXL 4P5MA 5IF0A 3BRFA 1CI5A 3G5ZA 3EFDL 4PS4L 4HDIA 2MHAA 3QO0B 4QGYA 4M93C 5BZWA 1RIUL 3C60B 1CGTA 2FR4B 2I5YH 4NYLB 4MNHA 1IGYA 4E41E 1F3JA 3CFBB 3VXMD 1ZGLM 4HUWA 1U92B 5B3JF 5F9OL 3BDYH 4JFDE 4EDXB 1YEFH 4U6HB 2OMNA 3X11A 2FX7L 2JTDA 2YC1B 1G7PB 1NCAH 5ICZA 3U82B 4OSUL 4KI5E 2BERA 2BSRA 5TPWL 3NIGE 4YK4C 3ARGB 3VXPA 3RBGA 4HF5H 4LDLB 4YC2B 1KLGA 2JJWA 3D2UD 1UVQB 4JN2A 4ZTPH 4JG0H 1LVEA 2XG4A 1Z3GH 3OV6A 4HFWA 4X4ZA 1U8MB 3L9RB 4NKIL 3BKYL 5C0IA 5DK2A 5IVXA 3ZHLA 3PV6B 1F97A 3QIUA 2HT2D 5ISZD 3SCMD 3VXOB 2BFVL 1MAJA 4NN5C 5GS0H 3IJYB 4Y89A 4PRHA 4KJWC 2F74B 4OBRA 1ZEAH 3HE7C 4B5EA 4CL7A 4O5LH 4WGVB 4KXZH 3GSQA 4QRRB 1DEEB 5T1KD 4NQEE 1I9JL 4HX1A 3SKOB 4HIHA 1XGQA 3X3GL 2YD7A 1P7QA 4DUVA 3P0VL 4PTUB 1CZ8L 5A2IH 1AO7D 3IAGC 4QGTA 1IAIH 1RULH 3T8XB 3KYOA 4YHZL 4P9ML 3GMLA 4MNQD 1KF9B 1H15B 4R26L 1CFBA 1E4JA 2WUCL 4TVPH 2A9ML 3VXUD 4F15B 5I6XC 3PG2A 4XNXH 4LRIA 3EHBC 4XAKE 4ONOA 4XPTH 3SOBL 3LKQB 2GK0B 4I3RH 3RPKA 2Y1VA 1BFVH 1NC4D 2XWTA 4Z7WA 4KDVA 1RD6A 1SEQH 5IW6B 2GCYA 3K4ZA 2BMKA 4F58H 4C59B 2A6IB 2VIRB 2FJHB 4PG9B 3UDWC 4F8QA 3BIBX 1FVEA 4NQDA 1IGJA 3HZYB 3BMWA 4YUEH 5L8JB 5E6IA 1CF8L 5MEOB 4P2QD 4UV7H 3MGOA 2HH0H 5GSRB 3L3HB 5BV7C 4ORGA 1DQQA 3TBWA 2QR0A 1HHGA 4LU5H 5LG1A 3PWVA 4B7LA 5EBLA 3AS0A 4QRSB 5D2NA 3U79A 1SBSH 4IRJA 1I1YA 1FNGB 4NC1C 5ILTL 1R5IA 2HYMA 3ULVF 3L3GB 5I0DA 3OAYK 4NZTH 5TE6H 2DI8A 2BNQB 4D9QE 5HHME 3P4MB 1HHHB 1CCZA 4NZDA 4P5TA 3TFKD 3EO1B 4FNLL 3L5XH 3DURB 5DD3L 1CFQB 5IB4A 4HH9A 5IJKC 5LWYL 2DBLL 3GBNH 3OR7B 2BNRE 3HPJB 1CGUA 3W5NA 4FXGA 3X13B 1BJ1H 1Q0XH 3MLWH 4B41A 3JWDC 3AC0A 3ZL4H 1MWAL 3WN5A 1LE5A 1AGBB 3QXTA 4LGPB 4WFEE 4LIQL 2FB4H 2XKNA 5B38A 3LQAH 3K80A 4I3GA 4HZLA 5E8NB 9CGTA 1A1OA 4PGDB 3RUGE 4L8DB 1FL6A 1RUQH 3OKLB 3C08L 3LH2H 4UB0L 3GJFK 3QBTB 5E5UB 2UZXB 4JRWA 2X6MA 1KCSH 1TVBA 2IALA 4LCIH 2RCSH 5I1AA 4WO4D 2ADFL 4JPVL 4PJEF 5ICXB 5T3ZD 2C5DC 1NEZB 4N1HB 4HK3N 1JJUA 3FONB 5FDWB 1WICA 3GI9H 5JQ6L 3N1GC 3OSKA 1ZLSH 2VKXA 5ADPL 5AD0A 3RI5K 2WBJC 4JQXA 2OL3L 1L9NA 4MB3A 3D25A 1KIPA 1T5XB 1RZ8A 4LEXH 3VH8A 3GSUB 1KTRL 4GJTB 4F33A 5B38G 4RGMC 2G2RB 3IFLH 3TT3H 1A6UL 3FQNA 3AS2A 5TJWK 3TNMA 4KK9D 1RVFL 2HAZA 1QVOA 4LCYA 4KKCD 5K9OB 2PYED 2AGJH 2AXJA 2EEAA 4DGYL 3LHPH 3HNVH 3BEWB 4P59H 3KPSD 3ORJA 4M1CC 1RPQA 4PJHA 3KG5A 4MYWB 2ARJA 2ZNWA 5I16B 1ZWIA 3W5MA 2FDBP 3VRJB 4Q9BA 1GOFA 1KLFA 3DROB 3V5DB 4MDIB 2NW2A 2I25N 4KJQC 1LEKA 1MFEL 4GG6A 1ZLVK 4OLWH 4L29A 4MQSB 4G42A 3B9KC 1PGRB 2V2WA 5GS1C 3FT3A 2FZ3B 2BVOA 2UY6A 3SDYH 1MQKL 1JI2A 4Z77B 1CXKA 5DRZB 1O0VA 1MWAA 5A2FA 5T1MA 2Y6SD 4H8WC 3R0MA 5JLZB 2BX5A 2HKFL 4W81A 3IDMB 4JGJA 4P2OB 1XIWC 5I9QB 4DZBA 2VE6A 4Z9KB 1YN7A 1KPUA 4KJYB 4JVPA 2NTSP 3B5GA 3VXME 2KKQA 3WDHA 5FO8B 4OZGB 3QFJA 5L0QB 1EXUA 3R06B 2LQRA 4U7SA 2YWZA 2DLEA 1S7VB 4N8CH 2WV3A 4HXBH 3LKNA 4X6FA 1I7ZB 2J8UA 3V0VB 2RGSA 4YIQA 1FNHA 3VG0L 3BKCL 3WFEH 1U3HC 4UIKH 3T2PA 3QIWA 4PJGE 1OGTB 3S4SB 4HWBL 2Z8RA 4R3SB 3CVHA 1I7TB 2WBWB 3IKKA 2EICA 2WUBH 1T6WA 1Q9LA 2Y9RT 5GZOC 1GL4B 1NLBH 5SWSB 1MH5A 2DB8A 2EYSA 1LE9B 5KSBF 3G5XA 2VWEC 1G7HB 3FCTA 2H32B 1IEBB 1CXLA 4DVRH 4Y5VB 5DR5L 1DBAL 5GGTL 1U8OA 3ARPA 3HI1A 3PWUB 4F9LA 1E6OH 4ZSOA 5AG8A 1II4E 4P9HL 2ID5A 4Z7UE 5JPMA 3QEQD 4FOMA 3ZYZA 3QIBA 1AO7E 2UUDH 4A6YA 4JM4L 4LSQL 1D5ZA 4KZEL 3UJIH 1U36A 4MNQE 3DI2B 6FABH 3MRFA 2WWKT 5DMIH 1ADQL 3E8UL 3VXUE 4MXWH 3S37L 4BH7A 3WNKA 5CSZB 3D39D 1SY6H 4MJIA 1WWBX 1CDYA 4PJIA 4KJPD 1T1ZA 1VB9A 3GMMB 1VFUA 1YJDH 2QQNH 5KANI 1T6VN 2X4PB 5AYUL 4WU5B 5D7JD 4PB0H 3QQ4B 1YEGL 4LSUL 3VXNB 2H6PA 1E4XH 2DL2A 4ZS6D 1XGTB 2OSLA 3EUUA 1LO4L 2GJ6A 3ES6B 4JEGB 5IV2A 4ELKB 5T33H 5FKAB 5JR1L 1DFBH 5F21B 5BQ7B 5DJYB 1FSKB 4WUUA 3I02B 1FCGA 3HAEH 3CLEL 2XZQH 4S10A 4APQC 4HSQA 2AJZA 3ARBC 1IQDA 4YBQC 2KQMA 5TDOA 4LQFL 3BDBA 4HWBA 1A1MA 1PKOA 3O2VL 2J7LA 1KB5H 3CH1A 4UT7L 4X8XA 5EA0H 3HS0A 2XKUA 4XP4L 5FUOH 3NCCB 4NUGL 1I3GH 3MCLH 5HI4D 3SN6N 3UC0L 4JRXD 1CE6A 2EKJA 1CICA 2B1AL 5DGRA 1RJZA 5KAQG 5DJ2B 5JORA 3IDNB 4X9BA 5C0CA 1KCKA 1A6VL 5I1EL 2J5LC 5C07D 2AK4B 3HMWL 2XY2A 3EZJB 3PQYD 1J8HA 2P48B 2YOCA 2P7TA 3GMRB 5B4MC 1QSFD 5ID1B 1WISA 4U1SA 2YZ8A 4LRIC 2A74A 4ETQB 3DX9B 1KULA 3PWJA 4LF3A 1NMCC 4N8VB 1HINH 1T7YA 5CWSA 3KYKH 3NABL 4HS3B 5C08D 4HLJA 3TYGH 3LZFH 5DDHB 2R0WL 5IG7B 3TBSA 1W0WB 2C3GA 5IM7A 3P4NB 4RAHA 1HH9B 4XP5L 1FAIH 4GW4A 3VXTA 1X44A 2A6KA 2FGWL 3TM6A 5I1DA 3PL6B 3WL9B 3OL2A 3TBVA 3QUXD 2YSSA 5T3ZE 1RK0B 4YHYB 2A73A 5JXAH 4OBSA 1KTLA 3MRQB 3Q6FB 4OTXL 3MRBA 3PGDA 4EN3B 4JFQA 5HVGB 1FZKA 4DAGL 2E6JA 4OD3L 3BP6A 3QDMA 3QHZH 3CXDL 3S36L 2VNCA 3MRMB 3GJFA 5D2NC 4IRJC 5KSVB 4HAGA 3W0WD 1GGUA 1ZHBA 1MY5A 4HEPG 4U7MA 3NZHL 4NM8L 4OKVA 3KPSE 4BZ1H 4PLJC 3PHQB 3LSOA 2NY1D 3RVVC 1YEEH 3CVIL 3V4VL 4P5TC 4U6YB 5H8DA 4IMLA 2VXSL 4KRMB 1VACA 2WW8A 4MQXD 4IOSD 4XPBH 3EYVA 1VEMA 5KN5B 1NBVH 3VFUA 3WD5H 3QPQC 3L7EB 1ETZB 4G9DA 1OCWL 1NANI 1JZ7A 3O3EA 3OHXA 1IGCL 2CH8A 1TMCB 1QLRB 4LHUD 3IRZA 4L4VB 5E2WL 2F8OA 2ICEB 2WK2A 5CHNB 1G7IB 3WLWD 3BESR 1J05B 4MQ7B 3DTXA 3VFMB 1ZA6B 1BX2B 5TQ0L 3KJ4B 3MA7A 4GMTH 3KS0J 5D1QD 3GB7B 5HHOA 2RHEA 4F7PB 4OFKA 3UTPD 1XGYH 2LV4A 2IAMC 1ZKAA 4FQJL 3DUSA 5GRVK 1EJOH 1SM3H 3D0VA 5FIEA 1FFNA 4FZEH 3T0XA 3ARZA 1A3RH 2LTQB 5C09B 4OFIA 3G6JB 3MLXH 1K8IB 4PG2A 8FABB 3SE4A 3GSXA 1WBXA 3MRKA 4HIIA 2R4RL 3EOAA 3LKSB 4NO3B 4NHCH 5D1XD 2CDEB 3KVQA 5IT2H 1YEDB 4JZJC 2GT9B 1BBDL 2AV7A 2XXCB 2ADGB 2V7HB 4H1LA 5JW4Q 3DYOA 5SWZB 1JGEA 4AH2A 2VYRE 4OGXH 4EIZC 1MI5B 3U2SA 1Z5LA 3DGGA 2E9IA 4Y19E 4Y16C 5K9JL 2UVEA 3VI3F 2Y06H 1RK1B 3DX8B 4QCIA 1H5BB 4XH2B 2Z35A 1FLRL 2DKMA 2A6DB 3MV7B 4OD2B 4BFGA 1NCCH 3P3YA 2VSCA 4ZUSB 5IHLB 4UQ3B 2AP2A 1MCSA 5F7MC 2DIJA 4HAFA 4H1LG 4HUMB 3QEQE 3CFDA 4E5XB 5EPMA 4JDTH 1I85C 3HNSL 4RQQB 4TNWF 4YHIB 5B39A 5D7LB 5DMYA 4H88L 4FABL 1JWMB 1S7QA 4ZD3L 4XNZB 4O02L 1GHFH 1MJJA 3D39E 1BD2D 1UENA 5IJVA 3ARXA 1G6RL 1XCTA 2ED8A 4POZC 5EFIA 4F3FA 2CK0L 4XBEL 4M93B 4DK3A 4M8QA 2VZOA 1GC1L 1IL1B 4PJ7F 3LIZH 4L8CA 2DKSA 4PB9H 1P7KA 3MBEC 4FTVE 4KKAD 5EO0B 3NCEB 2B0SH 4I8DA 4HXAL 4LBEA 2E27L 1KYOK 3EO9L 2Y36L 4JFEB 3O11B 4HV8B 4PJ9B 1YA5A 2IAND 5B39G 5SX4I 2PW1A 2WINB 3ULUD 3OXRB 4LMQI 3NTCL 5D6CA 3RKPA 3P30L 3PWNB 3BGMB 3QIWC 3AAZA 4MJ6A 3GRWH 1S9XB 1F90H 1JWSA 5TFSL 4U1JA 4B53A 4LSRH 5GHWH 1A22B 4TUKH 1FH5L 3GSNB 1HKFA 4FQXA 2AI0H 1M6OA 3D9AL 4NN5B 4WHYG 1R5WA 3HG1A 1FE8L 3HE7B 4NM4L 4JHZA 5DO2C 2A1WH 5EZOL 4NCC2 4P2RD 4GAFB 1A4KA 4J3SA 4EEEA 3K2UL 1CGXA 4JRXE 3D85B 4WCYH 3KLAA 3WMSA 1CL7I 5E2TL 1Q1JL 3MRLB 2P8LA 4I4WA 3RVTD 2QADD 4XPHL 5C07E 3RGHA 3PQYE 2R29L 3T0BA 2MQ3A 2MTPA 3F7YB 3G04A 1QSFE 4I0CC 5EUOA 4K7PX 3IAQA 2J2ZA 4J8RB 4M5ZL 3Q5YA 3UJJL 4JFXA 3MRRA 2C1PA 3LEYH 2JKXA 3OG4B 5DVKA 4Z95L 4PBXA 2D7OA 5C08E 4RX4D 3FQXA 4FMKA 1LP9B 2IPUG 3GKWL 4M6OL 3IDXH 4X9HA 3MREB 1MCPH 2ZJSH 4QRQA 3LQMA 1FO0L 4RISL 2JELH 3MZTA 4HPOH 1G7QA 3HB3C 4CN6A 1JNHA 4PRDA 1A6WL 5KG9B 4G80A 5DVLA 4H25B 3ZDXF 1MFBL 4LLVB 4NQCD 2YWYA 5GRVL 5BV7B 5B22A 1IGIL 5I1JL 3FN3A 4FQHA 3FN9A 1LNUB 1VHPA 1H0DB 4MD0A 1YYLH 2EC9U 1INEH 3U1SL 4KQ3H 5C0BA 3NVQA 5D7SH 2VUOA 3TN0A 3WJLA 3CXHK 4NRYB 2NX5B 4O00A 5BVPL 3RIFF 1ZHNA 3W0WE 4UUJA 3ULUH 4NNPH 5DZNA 4Z7VA 5L2KA 3BRGC 1DQMH 3S35X 1IC7H 3MCKB 2VLRD 2HT4D 4I18A 3P9LB 5JUEL 3FL7A 4NSKB 1EIBA 1CICC 1F5WA 2VZVA 3CMOH 4RNRB 2VLKB 5DJ0A 4W70A 4P9HC 5F1NB 2SEBA 4M7ZC 2PNDA 4X5XA 4RGOL 1KN4H 4MXQD 4X6DA 5MENB 4JCMA 4MLIA 1JCKA 4M1GH 4PJAB 2D9CA 5DYOA 1MUJB 1Q72L 4HWEH 3TA3D 1UEMA 1NL0H 1SJHA 1WFOA 3MRNB 2R0ZL 3UPCA 5INCB 2HJFA 2NY3D 5KVFL 4BFBD 1TQCC 1XH3A 4GRLA 3UTPE 2N7BA 2R2EA 3DMMA 5FV1L 4RWYL 2C3XA 5IOPA 1XGUA 1XZ0B 3MUZ1 4R4BB 3NFPA 2P5WB 4GRMB 2VZTA 3MJ9A 2WWKO 3OKKA 3U0PB 4K55A 3QEUA 3TH4T 2OJEB 3SKMA 1YY9D 2RQ8A 1W72L 4ZO8A 3SQOL 5B8CC 5CP7B 5EN2B 4R2GC 4MHHI 3WNOA 1BJ8A 2WBJB 1MCQA 3VJ6B 4R7DB 2X4RB 2EXWC 1WEJL 4C56D 3SO5A 4OLXH 1SJXA 5GIRA 5DD5H 4RGMB 3TIDB 1W8NA 1DN2A 1HXMA 2X89A 1A2YB 4L1HA 2W0FB 3EOBA 1DUZA 1UCBL 2VLJE 1YPZA 5E8EB 2B4CH 2Q6WB 4IOIB 3T3PF 3VWJD 1QO3A 4Q74A 4LAJH 2HJLB 2VITB 4KK8C 3WIFA 4GXUN 2DRUA 3QB7C 4FQLH 3F58L 1RURH 1T66D 4ODXA 1A7QH 5KSAD 1OQXA 2ZP0T 5EOCL 2AJ3B 3QDGA 5HDBE 3QXDA 1UKQA 1QBBA 1SMOA 5E9DA 5FOBA 2R2HB 1Z9SA 4K23L 1MJUH 1FN4A 1V05A 3B9KB 4DKDC 5GS1B 3WJJC 4ODSL 2UZIL 3HCVB 3D87B 3VFRB 1MIEH 3BDXA 1MNUL 1YEKL 4HMEA 1O5DT 3GMPA 4KUZL 3V4UH 1KBGH 2AKRB 4UDUB 5ALBL 1BD2E 1ZK9A 4PJCA 1PZ5B 2P44B 4JQVA 4JFZL 2W9EH 4UIMB 3RP1A 1XIWB 3IGAA 1U3YA 3GBML 5D70H 3G5VA 2F58H 4PGEA 4HUVA 2AK1H 2ADJA 3BYTA 3VRIB 3FMGL 4PG2C 3KPNA 3MX0A 4X4XA 3RWEA 1F4WH 1KFAH 5IESH 3FZUC 3JTSB 4YXHL 1WBYA 3TYFB 4HEME 1U2HA 1EPFA 1T5WB 2EE2A 1OM3H 5EIVA 5A3ID 2YUXA 2JIXA 1W72A 4N0FB 5C0EA 3UTTD 2NY6D 3O8XD 5EOCJ 4YXKH 3BKJL 1T03L 1NAKH 2RB8A 2YD1A 4UU9B 3RKDD 3SE9L 5DMKB 2X4TA 3O4OC 1MVUA 4N0UA 1DR9A 3OKDA 4YWGL 1MF2H 1XF1A 2P8MB 3DUUA 3M45A 2ZOLA 1ZA3B 5F70A 1A8JH 5GGSA 2X4QA 2VN4A 3RGVC 4KY1H 1CWVA 4FFYL 2DQCL 4PJDF 1VKXA 3KDMA 2W9DH 5CEXB 3KYMA 4CVUA 1MOEA 3L3JA 3X12A 2O26U 1MFAH 5MHSD 5C0AB 4QXTA 4Y19A 4P2RE 4YXLL 1KIRA 1MHPL 3AS1A 3EGSB 1IM3B 2R9HC 1T1YB 2UWEF 4ODHL 3ZKQD 5F7HA 1F4AA 1EJ6A 1XR9B 4GKOA 2VZSA 4YBHA 5DWUL 3K81A 1NAML 2VQ1B 3SO3C 5DRWA 3HZVB 5GRUL 4KRPD 2V7NA 3UBXB 3GSWB 5CEZE 2V5YA 4W4NA 2QSCH 3GNMH 4RMWA 2X70A 4P5MB 4OZHE 5IF0B 3G5ZB 4Z78A 4OCXL 4YNYA 2OZ4H 4HDIB 4NWTH 2F53B 3O6LH 5DD0L 2MHAB 3SGJA 4KK5D 1UXWA 5DJAB 4MNHB 4DUWA 1F3JB 4M00A 1C5DB 1JPST 4HUWB 3UJTH 1QQDB 1DBKH 2HMIC 4EIGB 3G08A 3X11B 2X4NB 1B4RA 5CMAA 1AY1L 5ICZB 5DXWA 2BSRB 4JY5H 4ACPA 3FRPG 32C2A 4FTVA 4DZ8A 4HUKB 4JO1L 5DT1L 4NQCE 1PG7X 4B0MM 3CXHJ 1KEGH 5FGCE 1LGVA 3VFWA 1T20A 5C0IB 5DK2B 5IVXB 3SDDD 3AS3A 4APQB 5EORL 3NA9L 3ARBB 5I8OH 5LCVL 2C3VA 4GRWE 2VDMH 1WFUA 1DDHA 1ITCA 4OV6F 3VI4F 3A0OA 3N0PB 1D6VH 5D9SA 3PWPA 4C58B 3LRGA 1K4CA 4NFBA 1FGVH 1I1FA 2V5MA 3RQ3A 2VLRE 4HKJA 3U9PH 2M8XA 4XP9L 2FL5A 4HX1B 1PZUB 4HIHB 1QSEB 1L6ZA 4KXZI 3WXWL 3H0TB 1PBYA 5ETUA 4X98A 3BIKB 4IRSA 4LVNC 3GMLB 2J5LB 1EAJA 1WAAE 1IAII 5I74C 4NRXB 2XTJD 4G6FD 3VXRD 1FAKT 1NAMA 3OPZH 2Z4QA 1CXIA 5I30L 2PN5A 3RBSA 5H37G 5FYJU 1OTSC 3VWKA 5CD5D 1BBJB 3IFNL 1NMCB 3WFDH 4CMHC 2HRPH 1KTKE 1RMFL 2GCYB 5E95B 4S1RH 5CBEA 1S7XA 2CQVA 1GGIH 2XRAH 5I1HL 1GC1C 5DHVB 1I4FA 3TCLA 1C16B 1UB5B 5FO9A 4NQDB 1IGJB 3WSQL 3WUWB 3QXUA 5A16A 1N5AA 3JWOL 3GZKA 3ZE0F 1B2WL 4H20L 1NGWB 2BSTA 4OFDA 2PCPA 5DTFA 1JHTA 4OF6A 1AFVL 4DKFL 3VFVA 4Z7WF 1DQQB 5I1IH 3OZ9H 4C56E 2PW2A 3TN0C 5H35A 1HHGB 5I15H 3C60D 5IIEA 1GZQA 4Z0XB 2BNUA 4OAWA 4CN1A 5EBLB 2XZZA 1VPOL 4PYGA 3GO1L 5D2NB 1X4XA 4IRJB 1I1YB 4XB8A 5TE7L 3MNWA 4OLVL 1UJTA 4BZ2L 1OTTC 1T1XA 4UZGA 1CG9A 25C8H 3KPMB 4I18C 1NGQH 3IJSA 2L7JA 3OJVC 3K3QA 4WWKC 3RWDA 1UQSB 4XPAH 4P5TB 4LCWB 1VFBB 3CIQA 4D3CL 4JFPB 4LCCA 5IB4B 4HH9B 5GJSL 1JHLH 4WTZG 3O2DH 4IJ3C 3NBNA 1FGNH 3CK0L 4OGAD 3WE6B 1I9IH 2XN9D 4PY7A 4YHMH 3ZTNL 4X6BA 3O45B 1MCEA 5GGUA 3DOSA 5FYJD 1ZVHA 1IAOA 1BFTA 1OY3B 3FHQA 4GW1A 4GRLC 2XKNB 2E9WA 1GOHA 4XAWL 2VXQH 4HZLB 3BH9A 1A1OB 1XMWA 2IAMB 3RAJH 4XB7A 1TIUA 5D2LB 2MOVA 4KROC 3V6OC 1JYWA 5JXEC 3RX8A 1N0XH 2X4SB 1E6JH 2R4SH 1CLYL 5I76A 2IALB 5I1AB 5BW7A 1U8JA 3LKOA 5IKCB 2OQJA 5GGRY 5IBTL 3U48A 3VFGL 4P23C 4F57L 4PJBE 2WMPA 1UZ8B 4JZJB 3MYJB 4ZFFB 3UTTE 4ERSL 3P0YH 1KIPB 1RZ8B 3VH8B 1AHWA 4F33B 1F13A 3IXAA 3FQNB 3N1PC 3FRUA 3TNMB 1B4JL 4TSBL 1B0WA 4R0LC 4YDVB 3UAJC 5CGYC 1QVOB 1XF3A 4U1MA 1MCNA 4MJ2A 3QCVH 4Q2ZA 1DTUA 4Y16B 1CL7L 1VFMA 1YECL 1NQBA 3NIDE 3TIEB 4PJHB 4HIXH 4MA1B 1S8DA 1CK0H 2ARJB 2FEDD 1ZWIB 2ZPKL 3BGFC 3BKML 5MHSE 2VLJA 2CLZB 2IFFL 4Y7MA 1RIUH 1JWUB 1NDGA 2NW2B 3M1BA 4AEIH 2ICWI 1KENL 1LEKB 3EJJX 3BN9C 3SY0B 1X6LA 4KC3B 1LDPH 3SJVA 4G42B 2V2WB 4PP1D 3OJMB 4XVTH 2BVOB 1CBVL 1HWGB 5T1LA 4UILL 4OM1L 2FH6A 4XPGL 5HTSA 3ET9F 4KZDL 1OAUL 4WY7L 1MWAB 5I2IB 1CR9L 5T1MB 4HMDA 1TZIA 5D7IA 2EDOA 4U6XA 1T7XA 4DZBB 2MWCA 1M4KA 2VE6B 1UG9A 3FB7A 3ZHDA 1YN7B 1VESA 1JYXA 2BHZA 3BKYH 4P4RA 3ROLB 5I1KH 3U7AA 4GG6F 1JRHH 2F54A 3QFJB 4K7PH 3MACH 1N2RB 5FYJH 1Q38A 2APVA 5JW3H 3QCTL 2ZG1A 5GISH 2YPVH 3SGKA 5GRZA 1KPRA 5CZKA 2JJTC 4ONHA 1FCCA 4DGIL 1BZ7B 4X6FB 5D4QA 5EC2A 4W4OC 1G9ML 3QQ3A 2APBA 3P0VH 3QIWB 1Z6JT 2Z8SA 4NQXA 3G9VA 3QUYC 1WJ3A 3CFIC 3SDAA 4ZYKA 4YHZH 2YUWA 1GGTA 2CUHA 3MOAL 5T3XE 3FAWA 4JKWA 4I2XE 4R26H 2CIKA 3JZ7A 1YC8A 1T7WA 2EYSB 4NNYA 5C0FA 5IROA 3SOBH 3MODH 3KGRA 4DN4H 4LLYA 4WW1B 1U8OB 3HI1B 3P73A 4WW2A 5EBWB 1T0NA 2NNAA 1K3IA 2J8UF 1DP0A 1T83A 4BA8A 3QNZA 3QEGL 4X99A 5F7UA 3ZYIA 2H45A 5LJYH 3MROB 3Q3GB 1OF2B 3S35H 3MRFB 4LP4A 7FABL 1VGKA 3PGCB 4EZMA 3NCYS 3ULVH 2XTJE 3VXRE 1MCOL 4BH7B 2DQGL 4ZUTB 4H0HB 4MJIB 4YX2H 1YEIL 1OLLA 4PJIB 4ZPVB 3BAEL 1AE6H 4OZIA 3RZCA 4GBXD 1HIML 2DMKA 1U9KA 1FVCB 2VDLH 1N3NB 4K8RD 2H6PB 3N85L 3Q48A 5B3JE 4O51B 2OSLB 3BUYB 5D93C 2XPGA 1E4XI 3O4LA 1E4KA 5IV2B 4NO0A 3AB0C 2BDNL 2PUQT 1RZIA 5FCUL 1DBBH 3HMXA 4XMKL 3NN8B 3DVGA 1IC4L 3K8KA 1ZANH 4X0KA 5DLML 2AJZB 4MDJA 2DBLH 3ARDA 3T2NL 5TDOB 4QO1A 4HC1H 5EU7C 1IT9L 1WTGT 3MUGB 1S3KL 4YHNA 5LGJA 1U8IA 4M9PA 1JPTL 1XGRA 1HI6A 2DWDA 1C08A 4XT1C 4ZXBD 2QTEA 3REVA 1RZGA 2NR6C 3IDYC 3O3AA 4L8BB 3F65A 4MD4A 3N9GL 3STLB 5KAQF 3L5HA 5GGRB 1CE6B 1CICB 3EYUL 2Q86A 1PLGL 1PYWA 1YNKL 5C0CB 1TQBC 1A4JB 4LK4A 1KPVB 1F58L 4U4BA 1P4BL 4KI5F 1X5YA 4OJFL 3NIGF 1J8HB 4JFYA 3VFSA 4NBYB 4U6VL 1VFOA 2XN9E 5HYSA 5J56B 1DL7L 4U1SB 4JPVH 1D6EA 5SWSD 2VXUL 3PWJB 3VWKC 4YE4L 4LF3B 3MUHL 5FYJE 5ADPH 5CWSB 3RWHB 5FGRA 2OL3H 1TQCB 4JO2H 3O3BA 4IIQA 1J1XH 4YPGA 2DBJA 3CCHA 3UYPA 1A6UH 3C6LC 3WHE1 2YKLL 4EUPA 4N0YH 3V7AE 4GW4B 1XAUA 2A6KB 5DJXA 5EH1A 3VGAC 1T4KA 3QP3A 1QFWM 3L6FA 4I0PD 3TEUA 4DGYH 3TBVB 4J4PC 2EDDA 2YSSB 4XCYB 3UYRL 1HILB 3B6SA 1S7SA 1AGDA 4XTRC 1JYVA 1WITA 4MNGB 1YNLH 1KTLB 1TXKA 3GMQA 5B8CB 3OKOA 1MEXL 2X40A 4R2GB 4BUHA 4YDJA 3MRBB 2NYYD 1BZQK 4BELD 4JFQB 1FZKB 5EU6A 4LDEB 3BP6B 3AU1B 4OIIL 4PREB 3GJFB 1ES0A 3IU3B 5EC1A 4EUPG 3RWFB 2W60B 4OKVB 1MQKH 3X17A 4RDQG 1AQKL 4M6ML 5I19L 1A7OH 1WIUA 3LSOB 3O6ML 5F6IB 2ZUYA 5IR1A 3FN0L 4JHWL 5I66A 2Q8AH 1G6VK 1G7MA 2X44D 3K4DA 3Q6GH 2DYPA 3STBA 4LCCC 2A9NH 1ACYL 3CZFB 1UA6L 3HTLX 4O4YL 5TQ2L 1ACZA 4LKCA 3VFUB 1OSPL 4G9DB 3O3EB 3OHXB 3RDTC 4TNVK 3PHOA 5F7WC 4X7FC 4RFOL 1IC1A 4GKSA 5DUML 4IS6A 2HFFA 3P4OA 1BQUA 4AIZA 4JKKA 2CDFA 5HHOB 5DVMA 4XRCB 1JMXA 1MLCA 3BDYL 3DUSB 1DZBA 2H2SC 5I0ZA 3BKCH 4PBWD 1YEFL 1GAFL 1FFNB 4NCDA 1AD9A 2ED9A 4P0DA 1QLFA 4WV1C 3OKEA 5BW7C 2AK4D 1A64A 4O2CA 4HF5L 4LLQB 4QYOA 4ZTPL 1AGFA 4JG0L 1YN6A 3ARRA 3JWOC 3D69A 4HIIB 3WXVL 1Z3GL 4G9FA 1EVUA 3RL1B 3ZTJG 2ZSVA 4U33A 2AV7B 3LKRB 2I9LB 1AHWC 4XNUH 5E8PA 5CIPA 2EXYD 3D48R 2KZ1B 1F8TH 2ILLA 4AH2B 5GS0L 1JNJA 3O4OB 4JM4H 5JNYB 1MJ8H 5AZ2H 3U2SB 1Z5LB 4KV5E 2A0LC 3QWOA 4PJBA 4KPHL 4JE4B 1FNSH 4JM2C 3TZVD 1ADQH 3RVUD 3PL6D 4PRIA 3RGVB 1A6PA 4QCIB 5FF6A 1MFDH 1T04A 3RUGF 4LSSL 2Z35B 1WBZA 3NACH 3M07A 3ZYJA 1PG7H 1JI1A 1RULL 5ERWA 1JNLH 2OCFD 1OGAB 2AVGA 2BC4A 1GOGA 4DEPC 5C8JB 2YHGA 5IMKA 4JFOA 4EN3D 4LSUH 1EFXB 1ITBB 5DI8A 4ONGH 4EI5A 3MRCA 4TTDC 2NLJA 3WS3A 4XPTL 3MGTB 1NUFA 1QRNA 4ZUUB 5EO1B 3SO3B 4I3RL 4AT6A 3MUJA 1BFVL 4AEEA 2NY4C 3HFML 2EE3A 4GAYA 1S7QB 5H2BB 1SEQL 3SPVB 1NSNL 1EEUA 2GFBB 5JR1H 3QI9D 1BPVA 4G6AC 1I8LC 2X9WA 1FFOB 5EFIB 2FNBA 5J06A 4M8QB 1R3IL 3CLEH 1KELL 4YUEL 4IOFC 2UYLA 1P7KB 3C8KB 4UT6H 4QEGA 4UV7L 2HH0L 4YDLC 3O2VH 4KKLC 4ZUVA 4ODTL 2VDQH 3NA4A 4I77H 3SGKC 5IW1A 3LKPB 5JMOC 4JDZA 3OXSB 5TDPA 4NQUA 2PW1B 4NUGH 3PXHA 2EDWA 4LU5L 5AUMB 1NGXB 1YMHA 2UUDK 3K4AA 3W2DL 2PO6C 3OGCB 4IDLA 1FZMA 1UWGH 4BQ6A 3AAZB 4QRPA 4JRYA 3SDAC 2AXGB 4JJ5A 1SBSL 4UNUA 5ESQA 4RAVA 1JWSB 4U1JB 3MRPA 4MXVE 1F11A 4NT6A 5C9KA 4NZTL 5TE6L 3EYSH 1JGDA 4WFGD 3HZKB 5C09D 1M6OB 4OZGE 5HVWA 4NOBA 4O58H 1QPPA 3D3VA 4WW2C 1U91B 4RFNC 4JGMA 3ROOA 5M7QA 3K7UA 3GBNL 3CX2A 1T83C 2Y72A 3KLAB 2AQ3A 4OI8A 3H3KA 4HJ0D 4PD4K 5JA9A 4Z7NE 2P8LB 3MLWL 1ORQB 5SWZD 1HQRA 5GGVH 3ZL4L 2CO6B 4HKXA 4LVNB 4P5KA 4QHNB 4YEFA 3T0EA 4JFHD 4KDTA 4H26A 1QBLL 3LQAL 2VABA 5SWSE 2BY0A 5EUOB 3BWAA 5T1DL 1U8QB 1FYTA 4PJGF 1KCUH 1IZJA 4NO5B 1K2DA 1RUQL 4JFXB 2EH7L 2C1PB 1S7WA 4FHBD 3LH2L 2IADA 3KS0H 4ZOBA 4CMHB 3RZCC 2MCPL 1KCSL 1Z9MA 2RCSL 4LCIL 3ZLQC 2DLGA 2VXTH 3FO9A 1KJMA 4R6UA 3CXDH 2X1WL 5EU3A 2FBJH 2QKIA 4LVOC 3GI9L 1ZLSL 3U46A 4J6RL 3RNKA 4OCMC 5KZCB 5F7NC 5D7LD 2J6EL 3S5LG 3FAXA 1KB9J 4Z7UF 1JNHB 1XF4A 4PRDB 3AMLA 2VTFA 2C1OB 4LEXL 5DJ8A 5J0BA 1KXQE 4S0TD 4CU6A 3MOBL 5C92A 1BJ1J 4PR5B 1JTTA 3I6GA 1R6VA 3THML 3LDBC 1T2JA 2V9RA 4LCUB 5C0BB 3HUJB 3TN0B 4P46C 1UKTA 3LHPL 3HNVL 4P59L 3MV11 4TSCL 1IGTA 1CT8A 1GIGL 1IGCH 4HK0A 1P7HL 5H94A 2QSQA 3VDCA 1ZHNB 5ID0B 1HWHB 4Y4HD 4J7RA 2RIKA 4X5WB 3MLUH 3S8WA 3QO0A 4XHQA 1AGEA 4PJ9D 4JFED 1L7TH 1X5JA 3V5HA 4I18B 2ATPB 3DNKA 4WWKB 4OLWL 4RRPA 4LQ1A 3C87A 3EOTH 1YYMH 3P9MB 5D5MB 2YC1A 3SDYL 4QHUB 4X5XB 4X6DB 3MXWH 4IJ3B 3RA7H 3C8HA 2FLRT 3DX7A 3ZMRA 3ARGA 1HQ4B 4OM0H 5EOTB 3CSPA 4PJ8D 3CMGA 1CTNA 5JHDB 3KLHC 1SJHB 4G6JH 3L9RA 2DD8H 2HA1A 2IH1A 1G0XA 4IIQC 4GRLB 1F42A 1CQKA 3HE7D 4D0BA 4GXVH 1CDUA 3QPXL 3QWQB 3VXOA 1ZVYA 1FNEB 1N6UA 3IJYA 4RRPG 4KROB 3NFPB 2FGZA 5IWLC 2YXFA 1S78C 2ICWJ 4N8CL 2AK4E 3OKKB 3HI6H 3QEUB 4HXBL 4ORZC 4QRRA 5HHNA 3SKMB 4OCRH 4LL9A 1FO0B 3MTRA 3WFEL 4PTUA 4UIKL 3EHBD 4CVXA 1YEHH 1BIIA 3T8XA 3U7YH 4UTAH 2WUBL 3AROA 5EWIH 1IC5H 2NY2C 4X7SH 4C55A 4IEFB 5T3ZL 1NLBL 2IBBA 1HXMB 3NAAL 4FQCL 1UADC 1ROWA 1DUZB 3EOBB 4ZFZB 4R0LB 3JWNC 1EUUA 4DVRL 3LKQA 4MVBC 1VERA 3NZ8B 1E6OL 1A6AA 2EDXA 4I13B 5IW6A 3C6SB 4Y2DC 3TESA 2ICWA 1EO7A 1FBIH 4N5EC 2AJSH 1V8HA 2A6IA 2VIRA 1G6RH 2BHYA 2FJHA 4PG9A 5FYLH 2MMXA 3V7AG 4XBEH 4ODXB 4QF1B 3UJIL 2O5XH 3HZYA 4K2UL 6FABL 5EIIA 2DQJH 3QXDB 5DMIL 3QULA 4MXWL 5HHQA 3CDYA 5E9DB 1R3LA 5FOBB 3NH7L 1V7NH 1FL3B 5JA8B 1ZT7B 4HXAH 3K0WA 1L0QA 1YPZF 1J12A 3FB5A 2ICES 1YJDL 2QQNL 3D18B 3GMPB 2BK8A 4IM8A 5D7KD 1U41A 3NTCH 4PB0L 2GITA 2B2XL 2WWMC 5IVZA 4PJCB 4U6TA 4X4ME 1JV5B 4PTTA 1E4XL 3ZDZE 4LVHC 3PP3H 3IGAB 3C5ZA 4EQ3A 1FNGA 1KACB 5CGMA 1FP5A 4GSDL 2K9UA 4PGEB 2C4FT 3TJHD 4HG4K 2ADJB 3RWEB 4Y8DC 2BNQA 4S1SL 1DFBL 3P4MA 2W07A 1HHHA 1I1AC 4FRWA 4QRTA 4L4TA 1QPXA 3DO3A 2EDBA 5FYKU 1FE8H 3DSFL 2JIXB 3RVXD 1W72B 5C0EB 1CFQA 2D4FA 2XZQL 1QBMH 4NM4H 4QXGH 2VMFA 3IFOB 3QEHA 4NDMB 2FX8H 4KTEH 3FB8A 3VCLB 3HPJA 1D9KD 2X4TB 1MVUB 5E2TH 5CZVL 5ELIA 4GQPH 2DI7A 4MS8D 4N0UB 3O6FA 1IVLA 1KB5L 5DZOA 4MAUL 5EA0L 1U0QA 2OR9H 3OKDB 3QUYB 3BISA 4PGJA 3AM8A 1UJ3C 5KW9H 5HI5D 2P5WD 1MCBA 4U2ZA 5FUOL 1N8ZA 1AGBA 4PRBB 4ZG1A 2DWEA 1FNLA 1YMMA 4WFGE 5C09E 4Y1AB 4GG8B 5CILL 5E8NA 3KYMB 4MAYD 1A7NH 4L8DA 3UJJH 3L3JB 4AJ0A 4RBPH 4PD4J 4XBPB 4QXTB 1KIRB 3QUZC 1H8OA 3GKWH 4M6OH 1HN1A 4BFEA 1B9ZA 4PJ5D 5SWZE 5ICXA 3BH8A 1NEZA 2F19H 5FDWA 2BZDA 2OBGA 5J7CC 4AZ8A 2V7NB 3AY4C 2FJGA 2QHRH 4RISH 4JFHE 1SY6A 3KYKL 4AENB 2X70B 1NJ9A 4AMKH 2I27N 2PKDA 1T5XA 3LZFL 5HI3C 3TYGL 4Q97A 3GSUA 2HTKD 2HVJA 2H2PD 4Z78B 4YNYB 4M1CD 1MFBH 2H3NB 4K3JH 1HHJA 1UXWB 5I1JH 1FZOA 5K9OA 4WI3A 5JW4N 2NXYC 3U4EB 2W0LA 5JXAL 2GK2A 4G8IA 2QQLL 3BW9A 3L3KA 1NEZG 5CMAB 5I16A 5D93B 1WFTA 4OZFH 1M05A 5D7LE 5FYKD 4ZAKA 3OG6B 1DQDH 1CXFA 3QHZL 3HAEA 4XHJC 4DZ8B 2FZ3A 3VFWB 4PLKD 1BQHB 3BZFB 5GS0C 1XIWD 4HGMA 3H3BC 4Z77A 4BZ1L 5DRZA 2V9TA 3H9YA 1DDHB 1Q72H 4OCSL 4Q9RH 1WK0A 5JW5A 5D9SB 3PWPB 1QLEL 2EYTB 2R0ZH 4P2OA 4KK6C 1I1FB 15C8L 1QEWA 4JFEE 4XPBL 4HKJB 5KS9A 3IDYB 1TETL 1NBVL 1UH3A 5FO8A 5IFAH 1J5OH 1EV2E 1TQBB 5ETUB 4X98B 4IRSB 2YD6A 3T0EC 4GMTL 5I73C 1PX3A 4KDTC 4GKZA 3MOQA 4PUBH 5F97E 1NAMB 2Z4QB 4M5YL 1XGYL 4WIQA 3U0TB 5GZOD 1I7ZA 3CDCA 3QH3B 4L3EA 5JO5A 3SQOH 1EJOL 1SM3L 3VWKB 1NUNB 4FZEL 1T0MA 2GKIA 1NCBH 1ZTXL 1I7TA 3FB6A 1A3RL 4LOUC 1Y18A 1WEJH 5CBEB 1A5FL 1S7XB 1EGJH 4D0DA 4MA7H 5JPNA 3MLXL 2YD4A 1I4FB 3QXAB 1LE9A 2YUVA 2EZ0C 4KMTL 3C6LB 1T0PB 5IT2L 5FO7A 1G7HA 2H32A 1JZ2A 4R4NC 4Y5VA 2X4OA 3TT1H 1RZ7H 2Z0BA 4G8GB 1SYSB 3TPUA 3MRIA 4LLWA 2BSTB 2PCPB 5DTFB 5E1AA 4J2XA 1IJ9A 5J6HB 4LSDA 4OGXL 3S37X 4CADB 4IDJH 1BVKA 1Z9OA 3VFVB 1RUKH 5FGBA 1IILE 4HWNA 4Y4FA 5HDLA 3S4SG 5J11B 2PW2B 5H35B 3BOVA 1T1WA 1BLNA 1U58A 1GZQB 5I1CH 2Y06L 1ZSDA 2BNUB 4OAWB 2DQHH 1JGUH 4G8FA 3JV4A 5CSZA 4ODSH 5FYKH 3UBXI 2PTTA 3GMMA 1T1XB 4D9LL 4LLUB 1YEKH 3IJSB 2XG5A 1MIML 4WU5A 3RWDB 5ALBH 35C8L 3SCMC 4QTIH 2R56H 4JDTL 4OZ4A 3QRFM 2XV6B 4GKNB 4LCCB 1F2XK 2YBRA 3HE6A 2DQUH 1QSZA 1TJHH 1KSRA 2EKSA 1B6DA 5F72S 4PY7B 3QIUD 1GHFL 3RDTB 5TE4H 4JLRA 4YXHH 1F2QA 3F6IA 5BQ7A 1PG7W 3FFCA 4X6BB 5GGUB 3LQAC 4PRHD 5D72L 3H7BA 4GW1B 3KWWA 4GLRH 2XFXB 3LIZL 5D7KE 4GW5A 3ZDYE 1RJCA 4PB9L 3BH9B 1RU9L 2P49B 4HG4J 3W9EA 3VGFA 4TPRH 2B0SL 1P7QD 1MHHB 4XZUA 3IS0X 5ANMA 5GS2D 2J8OA 5C0GB 3O9WA 1MJ7H 2E9BA 1WVZA 4MJ5B 5IHUH 4H5SB 3VGDA 4WV1B 5I76B 2G5BA 1U8JB 3LKOB 3MRJA 1EH9A 2OQJB 4PJAE 1TITA 1FNFA 1OWWA 1QFOA 2AJVH 1CGYA 4D2NA 1ZT4A 4NCC1 5DJ2A 5F7EH 1TCRA 3IDNA 5J1AB 5CINL 1F90L 1VEPA 1QFWH 4YZFE 2YZ1A 1RUAH 3VFTB 3SDXA 2I24N 5GHWL 4TUKL 1AHWB 1MHPH 3WFBH 1FIEA 3GMRA 3IXAB 2AI0L 3FRUB 4CMMA 4ETQA 3DX9A 1PQZA 2Y23A 5DMGD 5J1SC 5EUKA 1XF3B 4U1MB 1C1EL 2P5WE 4NQDD 3MV8A 4Q2ZB 4JM2B 1F4HA 2BVYA 2V5SA 5E6ID 4ZDHA 3T3PE 2O93L 4WCYL 5DDHA 2CLRA 3UO1H 4OCXH 5IG7A 1W0WA 2PXYA 3OGOE 5HD8C 1HH9A 4URTB 5C0DA 1NDGB 4NQTA 3M1BB 4M62H 3WL9A 3SBWA 1INQB 1XGPB 2DLIA 4DEPB 3SJVB 2HT3D 3LQZB 4PJ5E 3FQTA 4UINL 3V6BR 2D9QB 3S36X 4IRJD 3TFKC 3U4AA 5E56A 3LEYL 4XWOD 4N8VG 1AR1D 3MRQA 4Z76B 2NY4B 5FUZH 1BOGA 5D7IB 3IDXL 4U6XB 3MRMA 3C5ZC 1MCPL 4P5TD 4DKAA 3V5KB 2ZJSL 4OUOA 4P4RB 4BK5A 5F88B 2JELL 4ZOEA 5E4EB 3NA9H 3ARUA 2LAGB 2F54B 3QPQD 4YDLB 1TNNA 2OR7A 4AQOA 1JRHI 2R0LH 4JHAH 3MLZL 3BJLA 4U6YA 3MXVH 3QDJA 1PJ9A 1KPRB 4LPUA 5HDBF 2WLZA 1N6QH 1INEL 3KPPB 2V6HA 4KQ3L 5D7SL 1YY8B 2JJSA 3GRWA 5EC2B 3L7EA 1ETZA 3QQ3B 1NBYB 4WO4C 4NQXB 5GS2H 1UWEH 1QLRA 3SDAB 4L4VA 4ZYKB 5CHNA 2C3HA 2HLAB 1AXIB 2HTLC 3ULUL 4NNPL 1DQML 1IC7L 2CIKB 1A21A 2XWBB 3B2UD 3QISA 2F5BH 1INDL 2XICA 3V0WL 4M7KL 4NNYB 2HN7B 3F8UB 3CMOL 5C0FB 3JXAA 3MLYL 5BS0B 4LLYB 3FQUA 4LASH 3P73B 2CR6A 3IFNH 4WW2B 1CN4A 4KK9C 4RFNB 2R69L 1T0NB 4KKCC 1TZGH 2HLFC 4O2EA 4M1GL 2ITCA 3RJDA 5LQBH 3G6JA 5I1HH 1BFOA 3E3QC 4HWEL 1MCKA 2IEPA 5TDNB 4S1QH 4PV8A 4GFTB 1I7UA 2YD5A 4YR6B 3H9SA 1VGKB 3DRQA 2HFEA 4P99A 3JWOH 5J12C 3BP7B 1QP1A 4HH8A 5D1ZA 5DA4A 1YJDC 1UM4L 2DQFA 2VWEE 1MI5A 1DLHA 5DRNA 5F7KC 4OZIB 3RZCB 3WNNA 2FO4B 5IQ7L 2ATKB 2X41A 3CFEB 1RK1A 3DX8A 1H5BA 2ZUUA 3GO1H 3BPLC 4LVOB 3MV7A 1ZGLA 1BP3B 3K1DA 4PJXA 3O4LB 4LAQH 2A77H 4ZAKC 4V1DA 4HKBA 4NKDA 4OLXL 5ACZB 2HG5B 1CFSA 2DMCA 5DD5L 3OR6B 4E5XA 3EFFB 3DVGB 4TVSa 4D3CH 2IC2A 5GJSH 4POZD 2OK0H 3LDBB 4YHIA 2B4CL 4MDJB 1FC2D 4KFZC 1KIQB 12E8H 3CK0H 4P46B 3FQRA 4OZHF 4YHNB 1X5AA 2IBGA 2OTPA 1U8IB 2W59A 3QFJD 1KV3A 4LHJB 2DWDB 3VI4E 4FQLL 1RURL 1RZGB 5MERA 4M9OA 4X6CB 5DFTA 5DURD 4Y0GA 3ARWA 5F7DA 2CRYA 3MV9A 1QKZH 2YD8A 4ZFGH 2Q86B 1MJUL 2X1QA 1CVRA 3QIWD 4NOFA 4HV8A 1MIEL 1BFSA 5IVXE 2WINA 4KQ4H 1RZFH 2BHUA 4I48B 5HYSB 3OAZH 1D6EB 1KBGL 4KVNH 3PWNA 3BGMA 5IBTH 1UH2A 4PRHE 3U9UB 2JK5A 3VFGH 1S9XA 2NZ9D 1I8IB 3QDHA 1VFAB 5D70L 3O3BB 4IIQB 3P40A 2F58L 2J4WL 4GRWF 2AK1L 5DO2D 3GSNA 1OPGH 4YPGB 3CCHB 1A6TA 4DKEL 1OL0A 5EU5B 5JIHA 1F4WL 4ODWB 5IESL 4L3CB 3AMKA 4GO6B 3QIBD 4EUPB 2LFGA 3ZO0A 4WTWA 4KJPC 1OM3L 1T4KB 3L6FB 4KTDH 2W0KA 1YECH 5SV3A 4CNIB 3MR9A 4YXKL 4FFWD 1NAKL 1S7SB 3D85A 3UYOD 3ZE1E 4UV4L 3V4PH 4E41B 3GMQB 3MRLA 3IF1A 4MJID 5FGBC 1D7FA 4YDJB 3BKMH 4Y4FC 4RMQA 4ZS6C 5C3LD 1LO3H 4Z7WE 1FVDA 2NY2B 5EU6B 3F7YA 3BE1H 4KY1L 3HI5H 2H26A 1P4IH 1WCBA 2W9DL 1ES0B 3EDFA 4J8RA 3T0VA 1CBVH 3V8CA 4NQDE 1AH1A 1AJ7H 1DSFL 1MFAL 4RDQF 4KZDH 4OM1H 2VZ1A 2WQ8A 1S5IL 1OAUH 2GJ6D 4ZO9A 1FL5B 4WY7H 2ZG3A 3ARVA 4XCCH 1LP9A 3FTGB 4Y2DB 5I66B 1JYNA 2IPKA 3MREA 2V9QA 5DEZA 4UOJA 3UDWA 4WUUD 5L88H 2P8PA 4ZOAA 2QSCL 3GNML 4KI5D 4YFDB 2CXKA 2J12B 4WEBL 1S7TA 5KG9A 5HGGS 3PHOB 3Q0HA 3TH3T 2OZ4L 3MC0A 4NWTL 4GKSB 5D2NE 3O6LL 4LLVA 1CGSL 3LAFA 2HFFB 3P4OB 1U8HB 2CDFB 1H0DA 1NGYB 4DGIH 4FQQB 3UEZA 3QQ9C 3UJTL 1DLFL 1DBKL 2MSPA 1G9MH 3UTSB 1CICD 4NRYA 2NX5A 1AD9B 2QQKL 4F7EA 1UYWH 3CVHH 4LCWE 3O9WC 5C0CD 5GRYA 4MD5B 1QLFB 3OKEB 1GH7A 4G7VL 1RIVL 3MNZA 4HGWB 4GAGL 4JY5L 3MCKA 4O2CB 1J8HD 3DVFA 4QYOB 5C0RH 2GAZA 4JFFA 2I60H 4NSKA 1AGFB 1YN6B 2DLTA 3D69B 2VLKA 3MSPA 4G9FB 2O5YH 1TVDA 1P6AB 2ZSVB 3RPIA 4BH8A 5F3HA 1BJMA 5E8PB 5MENA 5FA3A 4RZCA 4A6YH 1MUJA 2DQIH 3QWOB 3MRNA 3NIFE 5GQBA 1FGVL 1UJ3B 3WIHH 3U9PL 4PRIB 3GDBA 3C09C 4PJFB 2XYCA 5FF6B 1T04B 5CJQH 4E42A 4L9DA 4OI9A 1WBZB 3DXAB 4NP4L 2ZWLT 5FGSA 3N1MC 2PXYC 2NY5L 1XZ0A 1MREL 4PRNA 1ZAGA 1E4WL 4R2GD 4JB9L 3QT2A 3GIVB 2BC4B 3QUZB 5ECJE 3KHQA 1NFDA 2EXWD 5K9QI 4JFOB 1OLZA 3OPZL 3MNVB 5DI8B 3QDMD 2NLJB 3WS3B 4PJBF 5ITFA 1NCDL 1NKRA 5CP7A 5GS3A 3K8LA 5HHMB 1VADA 4WFFD 4Q58C 4AT6B 2AXFA 2WBJA 2HRPL 4ZQKA 4GAYB 4R7DA 5FDYA 4S1RL 2OZ4A 1KGCD 4HS8H 1GGIL 5FCUH 2XRAL 4G5ZH 3VFOA 4YPJA 4XMKH 4JR9H 4PJHE 2BNRB 4WU7A 4X7CC 1U93A 3UXFA 5MEQA 4BYHA 2XACC 1I8MB 2XIDA 3WLWC 1ZS8B 5DLMH 5E8EA 2UYLB 3NIDF 1NH6A 4IOIA 2NXYB 1IT9H 4ZODA 5DD1H 4KKBD 3DYPA 4L3AA 1S3KH 2DDQH 1JPTH 3QAZC 4F80A 2BVTA 2Z31A 3VXSA 3HC0B 4MA8L 5I1IL 4XXDA 3U36A 5DK0B 3OZ9L 3I3EA 3LRSA 3WO4C 1SEBA 1KCVH 4WGWB 1X5LA 5HHOD 1YMHB 2DN7A 4HD9A 4LHQB 1SQ2N 1FZMB 2R2HA 2VXVH 3L3IA 4QRPB 1YNKH 3KPRA 5F7FA 5FAAA 2JCCA 1G7LA 3B9KA 4JJ5B 4ALAH 2GW5A 5ESQB 1F58H 5D1XC 2DQEL 3VFRA 4U6VH 1ODAA 5IB5A 4P3CH 3LEXB 1MCJA 2AQ1A 4KDWA 2AKRA 3QFJE 4BSJA 3ALWA 4YE4H 3D3VB 1PZ5A 5IBLC 3OAYH 2PTUA 4J1UA 3LMJL 4JG1H 1YQ2A 3O2DL 1AP2B 2R39A 1FGNL 4OGYH 2CIIA 4CN4A 3VRIA 2J8UE 3KXFA 4YHML 1HCVA 4N1CA 4WI9A 3I6KB 3JTSA 1M7DA 3TYFA 4R4FH 5I18H 3PWLB 2GHWB 4P5KB 1H9VA 3T0EB 5I73B 1OAKL 4H26B 4K7FA 5D1ZC 1IGFH 2VXQL 3BWAB 1NEUA 1K2DB 2ITDB 2EIZB 1S7WB 1N0XL 1U3HA 2R4SL 2IADB 2A6JA 4NBXB 3HZMB 1JPGA 3S98A 4A2MA 4ZSOE 1TJIL 4ELMA 4S2SA 3P4LA 2VR5A 1NUGA 2DS4A 1OAQH 2Y7QB 5CEXA 2IJ0C 3RNKB 2BY2A 3U46B 4EQ2A 3NGBC 4OLUH 5FB8A 2BOCA 2WIMA 1ED3A 5A2KH 5C0AA 3SGDH 1XF4B 3VGHA 4ZFOL 1AQKH 4K3GA 3O6MH 2E6PA 5CAYB 3FN0H 1A3LH 3RJQB 4MJIE 1XR9A 1S9KC 2CPCA 4PJIE 4LSPL 2D03H 3I6GB 2W38A 2XQBH 3HZVA 4O4YH 3QCVL 3UBXA 3GSWA 4KRNA 5KTEH 4CU7A 4GS7C 1IGTB 3ULUC 4HK0B 5H94B 1VDGA 5DJZB 4BJLA 4RFOH 1CK0L 3GMNB 1JF1B 5FEBA 4FZ8H 2BRQA 2F53A 4G6KH 5DUMH 1AGEB 3P77B 5DJAA 2GJ6E 4YDKH 3V5HB 4AEIL 1MY7A 1LDPL 1C5DA 5I17B 1QQDA 4FXKA 5IQ9B 1EEYA 3O2DA 5ISZB 3SCMB 1GAFH 4FQ2H 2NXZC 4XVTL 4WUUE 2X4NA 4ZOCA 4X7DC 3NPSC 3DX7B 3UBXG 3T2QA 3L5WB 4FQXD 5T1KB 5DEFA 1A7BA 3WXVH 3RX5A 1GGCH 3HG1D 1HKLL 2IH1B 3RVTC 2QADC 4H1LH 4D0BB 5I1KL 1FV1A 3GSRA 4APQA 1JZ6A 4ZNEE 3ARBA 1RJLA 1JRHL 4K7PL 1FZJB 1AQDB 3MACL 3VXUB 5FYJL 5JW3L 1P69B 5C0CE 5GISL 3LOWA 2BRRL 2YPVL 4KPHH 4NZJA 2X9XA 3I75B 3WIIH 1J8HE 2J88H 3TWCL 1EZVY 4OIBA 3EDDA 5HHNB 1NC4B 4LSSH 3PDOB 1QSEA 4NC2B 4NUJA 3H0TA 2ORBH 4JN1H 5EO9B 1P1ZB 3C9NB 4ZFOA 4CVXB 5L6YL 1BIIB 3BIKA 3MLRL 1HZHH 3MA9L 3T4YA 1ONQB 4KVCL 1SVZA 1BVZA 4BFIA 4NRXA 1QFUL 1F45A 2B4CC 3IDIA 4P2QB 2XT1B 1OB1B 2FD6H 3MODL 4DN4L 3K74B