4WI8A

Structural mapping of the human igg1 binding site for fcrn: hu3s193 fc mutation y436a
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
208
structure length
208
Chain Sequence
b'GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHATQKSLSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Structural and functional mapping of human IgG1 binding site for FcRn in vivo using human FcRn transgenic mice
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wi8A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wi8A01
5DWUL 3CJJA 3RAJL 1T0PB 1CLZL 4XZUB 1I7ZA 5KSUB 1UACL 5CJQL 4OLZL 4Y8DC 3ROOB 1NFIA 4NQCE 5HI3D 3JV0A 5F21B 1MREH 2V9TA 4PRPE 1F4XL 5HI3C 2IH3B 4OZHE 5CP7B 3T1FB 5DJDB 3CH8A 4D8PA 1W0VB 1NMBH 1VACB 3EFDL 2VDKH 4JRXD 4KVCH 3PXHA 2H8PA 2NY3D 2VLKD 4DZBB 3PP4H 5TGBB 1KXQE 5AYUL 3BZFB 1IKNA 4O2EA 2NY3C 4KAQL 1M1SA 3H2WA 2APXA 2B1AH 4P2OA 2C3VB 2OL3B 2R9HD 4KK9D 4ODHL 3MRRB 4OIIH 4R4FH 4LOUD 5CWSA 4Z7VB 2R9HC 4KK9C 2AERT 3MLXL 5T1KD 3DV4A 3IFPA 4LOUC 5D1XB 3RBSA 3P0YH 1QHPA 1NSNL 1JGVH 4JO4L 2YUVA 2AJZA 1D5ZB 3SDDD 2D31A 4E41D 4Q9RH 3T0WA 5JW4R 1GAFL 1UWEH 4O2CA 3VXSB 3SDDC 1T21A 3UMTA 5J6GB 3BDYL 4X8XA 3BOVA 4ODUB 4LVNC 1QSEB 4UILL 4LSUH 3K7UA 3GUTB 5E5MB 4J3WA 3KPLB 2AJUL 5T5FL 3TGXA 2EXWD 1C16A 1XIWD 2L7JA 1OD9A 1F4HA 3KLDA 1YEFL 4OCXH 4G7YL 5GQBA 4J12A 2EXWC 1RZJC 1XIWC 5DEGA 2XTLA 1OAQL 5MERA 5C0JA 4OZGA 1JZ5A 2CDFB 3IDJA 4WI4A 4DKFH 5DA4A 4QRQB 3T8XB 2W65A 3QDJE 3H9ZA 3QWOB 5F7DA 2J7LA 3MV11 5E8PB 1JWUA 1A8JH 4K8RD 2EH8L 3VXNB 2EXYD 1I9EA 2HP4A 3T2NH 2X4RB 4K8RC 1J1OL 4NKOA 5HHPA 2ZG2A 2FHBA 3C5SA 1KC5L 2EXYC 5H37G 4KTEL 2WWMD 3GMPA 3FB8A 3UXFA 3LHPL 3U7AA 4M8QA 4HZLA 3G5YA 4Y4FD 5LAXA 1ZHLA 2KDGA 2WWMC 4FQCH 3MLYL 1A1MB 2AXJA 5CIPH 4CN4A 4ODWB 4Y4FC 1C5BL 2R4RH 4IIQB 3ARYA 1N6UA 4DGIL 4MAUH 5DEZA 2Q6WB 3JTSB 1OAXH 3EO0A 4Z8FH 3MODL 4PJEE 3PWLB 4P5TB 2DWDA 2ZOKB 2OK0H 5MEND 1Q38A 4HHAA 5F9OH 5C0EA 1JBJA 5C9JB 2BNQE 2FCBA 2BK8A 4OI7A 2CUHA 1EGJA 2MQ0A 3TH4T 2H3NB 2FGWH 3WFZA 4W6WB 3MBEB 1TCMA 4P23D 4JM2A 3CH1A 2P47B 4YQXL 3D25A 4P23C 1GC1C 1MAML 4M7JL 4BQ6A 4EI6A 1UJ3B 5TE7H 3QZWB 4OTXL 1NKOA 3KWWB 1WT5A 1WSST 4NJAH 1E4XI 3VD5A 1RHHA 3CXHJ 5IROC 3RWCA 3S4SB 1QQDA 1KG0A 4DFIA 4JO1L 3SHSA 5FYJL 3VFOA 1N2RA 4CADA 4BZ2L 2NX5B 3DETD 4EBQL 5F9JB 1KTKE 3HG1E 1Q9OA 2QHRH 4NUJB 3DETC 3WEXA 1MJ7H 3FQNA 1K2DA 1WFTA 3MRLB 2R15A 3FJTA 1LNUA 4YHMH 1F58H 5IBTL 1YUHA 1ZTXL 3MPCA 1Y0LA 1LO2L 3U0TA 5I30L 2JK5B 2NLJB 4ZUUB 5I6XB 4KGLA 4WW2F 2CD0A 3L3JB 3MYJA 3VXUB 4BYHA 3KPMA 4Q6IA 4CN1A 1FSKC 4WUUE 4S2SA 2BVQA 2VZ1A 5BQ7B 2ZUXA 2G5BA 3QH3A 5J13B 1WVZA 4QY8B 1G9MH 4GMSH 1A02N 4MLIA 3VRIB 1X5GA 3ULUH 1T0NB 3HI6H 4LCCB 3GBNH 4JFQB 3P0VL 5HGBA 3S8WA 4C58B 5CJOH 5GSVB 4YDVA 4DQOH 1IC7H 1XGYH 4OD3L 4NZTH 2VABA 4X4ME 4ZFGH 1ERNA 2Y7QA 3RTQB 3ARGD 1RPQA 2VZUA 1RZFL 1IEBA 3S96A 3THML 1BEYH 1EHAA 3ARGC 1KBGL 4H8WL 3MRNA 3GSUA 1K6QH 4DVBB 5F93C 1NUGA 2IMNA 4GJTB 3DYMA 5TE6L 4QT5A 4HWEL 4YZFF 2Y36H 3UJJL 4WWKD 4ZPTB 3JV6B 1L0YA 3QUYA 3IDNA 2YSSA 4WWKC 1XGPB 1U8IB 1A2YB 1QSFD 4O02H 3FQRB 1KCVH 3CPLB 3ULUE 3HMXA 1FG2B 3OX8B 3PV7A 5HHMD 4D9LH 4G6ML 1NFDB 4HD9A 1FZOB 4I8DA 1DQDL 5JW5A 1CIDA 3GM8A 3LKOB 4ALAL 4FQQA 4FQXD 5F3HA 3VD9A 2JCCA 4F33A 2ZUWA 3OJVC 3TA3B 3KPPB 2O5YH 4FQXC 1H5BC 4KQ4L 5BRZA 4JG0L 5KVGL 4HQQH 1EZVY 2VL5B 4WRLA 3EOTL 5KS9E 2GSIB 4KDVA 4FA8A 3PL6D 1RZ7H 3VXMA 4QHUB 3HZMA 3DROA 2IAMA 2NCMA 2HA1A 1Q0XH 3PL6C 3CFKA 3EYFB 3IDMB 5LGKA 1KT2B 4A6YA 2WUCL 2X2YA 5HJ3A 2FJHB 2GW5A 5D2LF 4JCLA 4WJ5B 3RDTA 3SE8L 1H0DB 1OP5K 5FECB 4UT6H 4XCNB 2J8UF 4X9HA 3DXAB 4L3EE 2VLLA 5C07E 5C1MB 4HXAL 2M1KA 3C09B 4OFYA 4F7EA 1FFOB 5DURB 1HKFA 4D2NA 3RWIB 4YX2H 5AG9A 2BXYA 1UT9A 4M7ZB 4OJFH 4KZDH 5FOBA 3PJSA 4P3DA 3WE6B 5HHOA 4NC2B 5EBLB 4XCCH 3C6LD 4TUOB 4GKSA 3OKLA 4PRDB 3A6CL 1I8MB 5D7IF 1DVFA 3DTXA 2EDKA 3C6LC 4KROD 5IT2H 1T22A 1EHLL 2DL9A 2AV7A 3WLWD 3OTTA 3CFCL 5DF0A 3C60D 4KROC 4NQXB 2EDFA 3LRSA 4FQIL 4OCSL 3WNLA 4ZO7A 3WLWC 1EIBA 2H1PH 3C60C 5DT1H 3WDHA 1NDMB 5E5UB 1JPSH 1PY4A 5EWIL 4H1LB 2F58L 3VG9C 1GSMA 2EEDA 4P46B 4Q7DA 1P4BH 5HHXL 1NGZA 1H15B 3C08H 2P42B 2YBRA 3GSWB 4IMKA 1F8TL 4H5SA 5J9PA 1FV1B 1JNNH 1YEKL 5IVXE 5L2KA 3ULSB 1QO3A 3V0VA 2OQJB 3WHXB 5BV7B 5ANMA 1YYLL 3DUUB 5GGRB 3WLBA 5IF0A 2AEPH 1NPUA 4F2MA 1NEZB 1AY1H 1P9MC 3B6SA 4NKIH 1JPST 2F74B 1LMKA 2VQUA 4KRPB 4I77H 1A1OA 4M1GL 3U0WL 5IEHB 2GY7B 5EU4B 3RAJH 4JRYA 4PREA 5HGGS 3WO4C 2CSPA 3OJMB 4M62H 5CJQH 3MJ8B 4PJXA 4OLZH 1I7RA 1JI2A 3ZSTA 5DRNB 1HHGA 4LP5A 5FGBC 3NIGE 5MHSD 5CCKL 3D3VA 3IJYA 1B2WL 3O2VL 4U1JB 2H9GA 1ZT7B 2HKHL 5I1KL 4JFFD 2D7MA 1S7TB 1YDPA 2GJ6B 3EFDH 3U30C 4UT7L 2NY2B 1QD0A 2XWTA 4K23H 3RZCD 4K7PX 2EYSB 5AYUH 4LP4A 3WUWA 4KAQH 4Z7UB 1Z2KA 3RZCC 5FYJU 4Y4HA 4ODHH 4GXUM 3HUJE 1VFBB 4OF8A 5DJAB 4PJ9D 4BFIA 1JK8B 2UZXB 3MLXH 5E1AB 4PJ9C 1E0OB 3GSNB 1QLRB 4PJCA 2E7HA 4UV7L 2A6JA 1NSNH 4JO4H 5DRWA 1YMMD 5I75C 4LAJH 5EORL 5EUKB 1GAFH 2UWEA 3GSRB 4U2ZA 2BC4B 4MJ6B 4PRIE 2AXGA 5F7HA 4DKEL 3WKNA 3BDYH 5CKAA 1Z3GL 1HZHL 3GO1L 1TVBB 4UILH 3CMGA 4H26B 1R3KA 2AK1L 4IJ3C 5T5FH 3GNML 1I75A 4X6DE 3RWFA 2VLRA 2E9IA 5DA0B 5AYQA 1YEFH 4G7YH 5E8OB 4N0RA 3UTSD 1UA6L 4MA7H 3RL1A 4ZFFA 1U92B 3EDEA 2OTUA 2CO6B 3HFML 1OAQH 3K8LA 2NW2A 1J0JA 4G42A 4MNQB 4YHOH 5HVWA 3OWEA 3GHBL 4QHNB 5F1OB 1P6AB 2VYRE 3ZSSA 2XOTA 5JIPA 5DVLA 3OB0H 1S7UA 2EH8H 3HC0B 1G6RH 5E6ID 4HGWB 1EERB 5HHQB 4XPAL 5D96B 2VWEC 5FYLD 4OZGF 2GTWA 5E6IC 3B9EA 1KC5H 1NBVL 4KTEH 1X6LA 4CVWA 2XKUA 1CFNA 1FQ9C 3EBAA 3QHTC 3LHPH 4Z7OE 3G6DL 3HAEB 3BMVA 1UXSB 1DFBL 4U2YA 4EJ1C 3MLYH 1KTDA 4BQCA 3VD7A 2B0SL 1DDHB 1C5BH 1XGQA 2Z92A 4XPGL 4YK4C 5EO9A 4DGIH 4DK3A 1A3LL 1G7QA 4RDQG 2EYTA 4ZNEE 4YDKL 3TZVA 4CJ0A 2ESVE 3MODH 3BIKA 5DXWA 3G04A 1JGUL 1U8JA 3HR6A 1I8IB 4LNRA 5IIEA 3F5WA 1BF8A 4V2CB 1LD9A 3TPUB 5J3HD 3KPSD 4ONGL 1PG7H 4GRMA 3RWGA 4ZXBA 3Q48A 1XCQB 4PJGE 5J3HC 5I8EB 2X10A 3E3QE 5CLTA 1JN6A 4XBEL 2I27N 3EFFB 3L5XL 3RPIA 4EI5B 1XF5A 3VMPA 1GGBL 1HSBB 3PNWA 1U58B 4YQXH 3VI4E 1FORL 4JANA 2OM5A 2NW3A 4OTXH 1QSZA 4LHUA 1QA9B 4Q6YA 1MFAL 1UB6B 4FTVB 4JM2F 1K4DA 1NC2A 4JO1H 1FVDA 4ETQB 5FYJH 3DX8B 1U91B 1FNAA 1U3ZA 5L2JA 4LGPB 2DBJA 5GGQH 2XKNB 4Z7WF 1CGTA 1FCGA 5CGMA 1MWAL 5ALBL 5ISZE 3QXVA 2UYLB 2BDNL 1AP2A 3MCLH 1ZVHA 2GJZB 1SBBA 2XA3A 3FO2A 1U95A 3PHOA 5DEFB 3RJDA 1XF4A 1FO0A 1ZTXH 3UBXG 3HLAB 5I30H 1MFBL 4FXLA 2IANA 2W91A 4M3KB 5EOCL 1NCWL 4PRHD 1IRAY 2OI9B 1EJOL 3PIQA 3EAKA 3EUUA 4Y5YB 3KYOB 1CXIA 3NCYS 5C0CE 3MO1A 2X9WA 1IEAA 5H94A 3UCRA 5D8JH 4ZUWA 1NCTA 1NH6A 3BRDA 4YHKH 3ZKSD 5ACZB 1SM3L 3KJ6L 3L5WB 4NQCD 5FYJE 3P0VH 5E4IA 4P9HL 1FHGA 4PRPD 3GZKA 1DANU 5BW7A 1KB5A 1MI5E 2R4SH 1HHKA 4AH2B 2W9LA 3NABL 4N0UA 1BECA 3KLAA 1RZFH 3IFLL 4Q74A 5KVMC 2EDXA 3S37X 1PKOA 3BWAA 1KBGH 3QNYB 4X0KA 1HDMB 4H8WH 1RIUL 4LHQB 4P4RA 1MRFL 3R1GL 4RZCA 3PGDB 5TE6H 2ADIB 3MRPA 5CEYA 4HWEH 3NFPA 2K3TA 3P73A 1CD0A 5GGSY 3UJJH 2AV1A 2R1YA 1MH5B 3NCEB 1U3HB 2RIKA 2VIRB 2ADJB 3EYOA 4PBVC 4F15B 1S7QA 3A67L 4Y16B 4POZD 4QRSA 2VKWA 3L95B 4JY6A 1SEBA 3P2TA 3PWPE 3ARPA 1B90A 3JWOL 3QO0A 3VMNA 4O51A 4POZC 3RNQA 4G6MH 1DQDH 1F5WA 3MRMA 3FQWB 5I17A 4ALAH 2AABL 3AM8C 4EN3B 3PGCB 1MJUL 4NZUL 3DGCR 3MFFB 3P11L 2R1WB 4RMSA 4W6YB 5INCA 2CIKA 4EXPX 5CEZL 4KQ4H 4YNYA 4JG0H 5KVGH 3CLEL 5GRWA 3EOTH 1JTOA 1N5AB 3STZB 1N59A 4QRRA 4QOKD 3G5ZB 2EIBA 2DJSA 2JCCF 3ARBD 5BS0A 3ARBC 1OSPL 1XGTA 1XH3A 1RJZA 1I3GL 5T1LB 1QTYT 4JE4B 3SE8H 2I9LB 3QDJD 4Z77A 1NANH 2BY1A 1CK0L 3VXRE 4NQDB 2F8OA 4HXAH 2YD7A 1HYSD 2SEBB 3ARWA 4MQSB 3PP3H 4DN4L 4JY4A 5EFIB 2Y5EA 1HYSC 1ACZA 5KW9L 1WCBB 4IRSA 2DD8L 4Y88A 1FZMA 1SEQL 1ZANL 3VRLF 2WM0A 3A6CH 3E6FA 5CKGA 4OZFH 5I2IA 5FYKL 2FEDD 2ZCHL 5CJ8A 3ZYIA 4QLRA 1EHLH 4LCWB 2NNAB 3BZEA 3CFCH 2FEDC 4NNYA 1T5WB 2XY2A 4FQIH 3O4LE 1Z5LB 4OZ4A 3FN3A 4ZPVB 3SBWA 3SOBL 1WFOA 1YPZB 3ET9F 1PAMA 5EWIH 4XH2B 4OF7A 4LASL 2F58H 5IHBA 5HHXH 1G7JB 4PRAA 3U9UB 4M61A 4U1KB 1YEKH 3STBA 1G9NH 4QGTA 4F7TA 5IMMB 3MLSL 1YYLH 3VFMB 1UCTA 5JR1L 3RL2B 5E0QA 3B43A 4M1GH 4FQJH 5LQBL 3U0WH 3MSPA 3LPWA 4UQ3A 2CDEA 4F9PA 4V1DE 4X6EA 3V52L 2QQKH 5CP3A 4UU9B 1UVQB 3HG1D 4OGAD 2OL3L 3SGDI 5B3JF 4R7DA 5FO7A 2A2QT 3QYCA 5DC0A 4Z0XA 5CCKH 1EVUA 3GMOA 4GXVL 1GGUA 3VI3F 4OGAC 1DLFL 1JYNA 1B2WH 5EO0B 3O2VH 4G6JL 1X9QA 3VFVA 1F90L 2HFFA 2HKHH 4MAYD 4PJXF 5AUMA 5I1KH 4JO2L 4UT7H 1UJTA 4Y5VB 3HNVL 4XI5D 1TQCC 1OW0C 1R3HA 4MAYC 4WUUD 1PJ9A 4H25A 4R9HA 1KPRB 5DDHA 1A7RL 2ORBL 4XI5C 5D2NE 5DJYA 1AQDB 4WU7A 5CBAB 1UADC 2HN7B 3MUHL 4HWBA 3BGMB 4NT6B 4XB8A 1OAZL 4IRJB 2VDNL 5DGRA 5I76B 3VFWA 3BPOB 3O81A 3NA4A 4PJFA 4PV8B 4UV7H 3CFDA 4PJ5E 3NN8B 1ZHNA 4LK4A 1CICA 1HH6B 5EORH 1JNLL 1AFVL 4I48B 2KQNA 2X7LA 1D9KB 3MRBB 5E8EA 4NRZA 3CZJA 1AD0A 5CSZB 3T4YB 4PJCF 3EYVB 3RI5F 3LKNA 1Z3GH 1HZHH 3GO1H 3H9HB 5ADOL 2AK1H 1CGUA 2FLRT 4NNXB 5C0AA 1XF2B 4LCIL 4YFDB 2UWEF 2FR4B 1MRDL 4TUJA 1ZLSH 1DEEB 3Q2CA 1UA6H 5EIIA 4WI7A 2WIIA 3GSQB 4MXQD 4GG6A 3HFMH 3PABA 2QSTA 3HE7B 3GHBH 4MXQC 3T4AB 1G9MC 5CJBA 3SGEI 3QEHA 1HYRC 1KIPB 4GS7B 3ZKXC 4JRXA 4XAWL 3TEUA 3ULUC 1CS6A 2R2EB 5LVEA 2VLKA 1K5NB 1JPTL 3IU3B 1D5IL 4XPAH 2ZUVA 4G7VL 2C1PA 3IFOA 4NO2A 3B9AA 1NBVH 3IDUA 5HPMA 3KPRE 3WS6C 1TIUA 4GKNA 4G8GE 3G6DH 1WIOA 2FBJL 1FGNL 1ZLUK 5T1KA 3RFZC 2B0SH 4HK0A 5HHNB 4X99B 1BMGA 3VFTA 2JIXD 1WLHA 4XPGH 1B0RA 1TQBC 5D5ME 1A3LH 4B41A 3TO4B 4ETYA 4YDKH 3GJFB 2ADFL 3FFCE 1PG7W 3SDDA 4CDHA 3F58L 1WBZA 4E41A 3IDGA 1JGUH 3E6HB 3PDOB 1I1FB 4L3ED 1VGEL 2V2TA 4R7NB 2JKXA 1EFQA 4KXZI 4RQQA 3T3PF 2BVOB 3GKZA 1IJ9A 1A9BB 4YC2C 3RWDB 43CAA 1MY5A 1AGFB 2OR8A 1G1CA 4XBEH 3L5XH 3QDMA 1ODAA 1DUYB 1XIWA 5DYOA 1R0AL 3BPLC 2BX5A 1GGBH 2F5AL 4MJ5A 1FORH 3B2VL 3NACL 1MCCA 3CC5A 1T03L 4HBQA 2CLRB 2GHWB 1W72A 4OZIA 4FOMA 1MFAH 3LQZB 4NIKB 2JJTC 2EDHA 1XR9B 1BZ7A 2DLFL 5C2BH 1YJDL 2MHAB 4XP9H 1UWXH 3RIAF 1WFNA 5H35A 1MWAH 4NHCH 1JHLL 5ALBH 3NPSB 2Z8SA 3VFPB 4U1HA 4MVBD 4Y4FA 4NGHL 2VLJB 4OGXL 2X4TB 1T1WB 2P24A 1S7VA 4LLVB 4MVBC 5FKAB 2AKRA 2NR6D 5FCUL 4OSUL 3MV9E 5MI0B 2B39A 1NCWH 2NR6C 3MJ9L 5EOCH 5FYKU 3MV7B 3E8UL 5LGJB 4AIZB 1EJOH 1MCWW 4RGOL 4BSWB 4O58L 5J8OA 3SY0B 5MENA 4NM4L 4L29B 4RGNB 5FUOL 5MEPA 1N3NA 1I1AD 3LS5L 5SWZB 3SO3C 2R0WL 3VG0L 2FEEL 3UZEA 1JIBA 3KHQA 4HPOL 4PP2B 1I1AC 4WGVB 3KJ6H 3IF1A 3ME0A 4J2XA 2XZAL 5J11B 3BPCA 4P9HH 3MZGB 4DGVL 3SDAD 4YIQA 4P23A 1EHNA 3SDAC 4LL9A 4RAHA 3GSVA 4TQEL 4JREC 1VDGA 4L5FL 1R3JB 2GQHA 5DHVH 5DSCB 3JSSA 3IFLH 5I19L 4G9DA 1VGKA 5HYSG 5IQ9A 1V7ML 1OM3L 4RWHA 4NRXA 1MRFH 3O6FB 3R1GH 5DO2D 3W39A 4G6FD 4NFCA 4L8SB 5DO2C 3TYFB 4EDXB 1LE5B 1OQOA 3TC9A 4ZMAT 3A67H 4WWID 3DJ9A 5CBEB 5GGUA 3HCVA 3JWOH 1LO5B 3RWJB 3MOBL 2AABH 4UDUB 4PRID 2ITCB 1MJUH 1S8DB 4NZUH 1A9EA 3P11H 4WW2B 2XG4A 4XNZB 3UBXA 5CEZH 2O5XL 5K9QG 4N9GB 3TBSA 3VGHA 5B21A 1H8NA 3NZHL 2A83A 2X4UA 1O5DT 4LMQE 2IMMA 4NFBA 4JO3L 3DVIA 1ZA3B 5EU3A 4ZUTB 4I13B 5H2BB 3TO2B 1BGXL 3IETA 3BZ4A 4OFPA 4NN7B 4OF0A 1OSPH 2DYPB 1I3GH 2UZIL 4KUZL 1CK0H 2A6IB 3ARGA 3MYZA 4L4VA 1U8NA 1Q8MA 1ZWIA 1EX0A 3BUYB 4DN4H 1ZVSB 4JKKA 4N8CL 5KW9H 3GB7A 3Q3GB 4XBGB 2Q7YB 2DD8H 1SEQH 3MRDB 3PWUA 1ZANH 2LAAA 4TNVK 3BDBA 5GIRA 3FRPG 5AAWA 4OBSA 2B20A 2B5IC 4WWKA 3MV8E 5CEZE 2P5WE 4ODTL 1J05A 4JFDE 2A9ML 1MHHA 5FYKH 2ZCHH 4HLJA 4PJDA 1QSFA 2ESVD 4KMTL 3ARRA 4UDTA 2DOCA 3PWVB 5B8CB 2F54B 5KSBE 5HGDA 2FJGB 3ZDYE 2HJKA 2DM2A 3MNVB 4TSCH 4FQXA 4XPFL 3SOBH 1H5BA 3MNZB 3BFOA 2R29L 1KN2L 1OGAE 4NWUL 1PBYA 4LASH 4JFEA 3V5DB 4KJQD 5K9OB 1T1YB 4M6ML 3OG6B 5HDBF 5C0IA 3OKMA 1D5MA 4KJQC 4MMZC 3PL6A 1IEHA 5E94B 2BNRB 3ZKND 3MLSH 5HYJE 1T0MB 4GKZB 3C8HA 3N0PB 3ZKNC 1IM3A 1FIEA 4Z9KB 5C0BB 3WUZA 1I1YB 3GSXB 4JFOA 5T5NG 4U6YA 2CKBA 5LQBH 2Z91A 4BJLA 2EO9A 5FYKE 1KJ3L 4FNLL 2XN9D 4LDEB 3V52H 3QIBD 4WHTA 2J8UB 5F88A 4RFEA 5ISZD 3QUMB 3QIBC 1KIQA 2CR6A 3KNBB 4GXVH 1DLFH 5KTEL 3HMXL 5MEOA 5F97E 4G6JH 3GI9H 1CXKA 3OXSB 1F90H 5DJ6B 4JO2H 3T77A 3HNVH 1PD6A 2D7NA 5EU6E 3C60A 3HKFA 5D7IB 1H3VA 2BZDA 3DNKA 2X4OA 1N6VA 2IG2L 3K46A 3QAZC 4ELKA 1HSAB 2DAVA 2FIKB 1OAZH 5DD6B 2VDNH 2XQYK 4QO1A 4GRWF 2YPKB 1GGIL 1M6OB 1PY9A 3GK8L 4GAYB 5DHYB 4OKVA 5ACMA 3MNWB 1MI5D 4RRPG 1JNLH 1AFVH 4LVHB 1P9MA 2DQFA 3DMMD 3X17A 2FWOA 2IBGA 2VR9A 3V4PH 4PJFF 3T0DA 2J88L 3DMMC 2NY0D 2V5RA 4OCWL 3RWEA 2BVEA 4J3SA 3NCYP 2XPGA 1XGUA 5DGQA 2CH8A 5ADOH 3VWKD 2NY0C 5SX5K 2F19L 4P5MA 4U1IA 5FGBA 3SDXA 5ITFA 4LCIH 3EOAA 3VWKC 1MRDH 3BT2L 1RU9L 5D2LE 2BVPB 4H0GA 1J1XH 2N4IA 3MMEA 2HRPL 4HPYL 1HNGA 1Q9WB 3W9DB 2NYYD 1V8HA 4HS8L 5IQ7L 4YGVB 2FNBA 43C9A 2NYYC 3IVKA 4JFFA 4X9GA 3OBAA 2YKLL 4XAWH 3SKNA 4L8CB 3CU1A 2EDBA 3RZCA 1T7WA 4GG6F 1DJSA 3SDCB 1JPTH 2A9NL 3I02A 4UI2A 1D5IH 1PX4A 4G7VH 4UOW1 1JCKA 1NFIB 3WNMA 2G9HA 3OSKA 3L3OA 1B6UA 3QNXA 1S9KC 4PJAA 4HWZA 4PJ9A 2FBJH 1FGNH 1ND0A 3KS0J 3X11A 5I8KL 1AD9A 2MNUA 4D8PB 4WUKH 4JR9L 4H8WC 2H8PB 5ABDE 1JYXA 1B0GB 1YMMA 1MFNA 1CGVA 1F3JA 2ADFH 3QQ3A 1T89C 4O2EB 3BN3B 3F58H 2QADD 2QL1A 3VXRD 1GGCL 1T6VN 2GY5A 5C8JA 1YC7A 1VGEH 3F7PC 3QI9D 3ZE2F 3QEGL 2QADC 3VDCA 5CWSB 4LVEA 3QI9C 1HN1A 1RK0A 4UIMA 3O2WL 1BLNB 1I3UA 4ZFOL 3O3EA 1I3VA 2AJZB 1G7MA 2AJSL 2CK0L 2F5AH 2CQVA 5SWSB 3UTSA 3VFNA 3DV6A 2D31B 2BSSA 4YHLL 2B8OT 3B2VH 3NACH 4O2CB 1T03H 4NN6C 2V9QA 1A4JA 3BP5B 3LKPA 1JPGB 1AC0A 4PUBL 4YBHA 4ELME 3O4LD 1NBYA 2IPUG 1R3LA 2DLFH 2AEIT 1UG9A 1YJDH 3JZ7A 3FQTA 1ROWA 5E6IA 4F7PA 1AGCA 4C54A 4P2YA 1GRWA 2QKIA 1JHLH 4L1DA 1A7QH 4WI3A 4OZIF 5LCVL 3O9WD 2BHUA 4LEOA 4PJ7F 1E28B 3MLZH 3PWNA 4KK6D 5MERB 4NGHH 2BVUA 2AS5M 4OZGB 4OGXH 1JRHL 3O9WC 3IDJB 4GBXD 4RBPH 2BSTA 5FCUH 4KK6C 2W65B 3P4MA 1C08B 4I0KA 1MRCL 1I8LC 4Y1AE 5F7DB 1A6UL 5LWYL 3P3YA 1J8KA 4GBXC 1H3UA 1JWUB 4HXBL 3E8UH 5EZLB 3CXHK 4NQED 4H0HB 4RGOH 4LBEA 5HHPB 3DUHA 3GMPB 5F89A 3FB8B 2IPTL 3F7VA 4V1DD 4BQBA 1FVCA 3HRZA 3LS5H 1ZHLB 2R0WH 3BJ91 3KPSA 3VG0H 5F6IB 1MCEA 1E6OH 4NNPL 2N56A 4HPOH 5KG9A 2XZAH 4I3RL 4DGVH 2MKLC 2X44D 3HN3A 1HEZB 1J7VR 1K4CB 2Q3AA 4DWHA 4RDQF 2DWDB 4RGMC 4TQEH 1EZVX 4L5FH 3WIHA 4HHAB 3MLUL 1B6DA 5C0EB 5I19H 1H3PL 1WJ3A 3UC0L 3QEQD 4XXCC 1MFDL 4GAJH 5EBWA 3SQOH 1V7MH 2RCSL 1OM3H 3T09A 1WTLA 5GRVK 3UDWC 3GSOB 2UVEA 4XPHL 1G7PA 5D6DA 2XQBH 3D0VA 4CVXA 4U3XA 5FGRA 3CH1B 4MQ7A 1DQLL 4EI6B 5E24E 4Z7WB 4PJ5D 1EXUB 4XNQB 1NGQL 3PQYD 1RVFL 1RHHB 3K2MC 3RWCB 1BIHA 2AJVL 1KG0B 1YC8A 2GT9B 4PJ8B 4PD4J 3RVWD 3OAYH 1HHHA 4CADB 3F12A 4K71B 3U7YL 4F3FB 4HV8B 1BJ8A 3BE1H 3MOBH 4PRHA 1CFSA 3IAGC 3EIFA 2C1OA 3RVWC 3RWHB 3BD4A 3Q6GL 1Q0YL 2O5XH 1QBML 3OJDA 4KV5F 1CFTA 4JN1L 1K2DB 1S5IL 4NPYB 4PB0L 5A2IH 3A6OA 3NZHH 4JO3H 1NFDE 1Y0LB 3FOLA 4Z0BL 1BVKA 3KAAA 4U3HA 3VFUA 1BGXH 3UTTA 1U9KA 1YEDA 3MYJB 3KPMB 1T1XA 4PRPA 4S2SB 4WHYH 2BVQB 1WBXB 3QH3B 1X4XA 5F7NC 4J6RL 2UZIH 1KJMA 3M45A 4KUZH 5JXAL 1JZ4A 4M6NH 3D39B 1G7LA 4NRYB 1X5HA 3ZDZF 3ZTNL 5CJXC 3QHFL 1L7TL 5FA4B 4Z18A 1CGSL 3LCYA 4N8CH 5FAAA 3AB0C 3WV0A 3FHAA 3O2DL 2PYED 5HGBB 4QNPE 4G8GD 5L7XL 4MX7A 4YDVB 3KDMA 3DIFA 4L9LC 3S35L 2WUBL 5HYSA 2VABB 2Y7QB 2KPNA 5B4MD 1I7UB 2A9MH 4MA3B 4K55A 5B4MC 1IGYA 1FNSL 1IEBB 2NXYB 3OXRB 3VGBA 3OKKB 4HJJL 3V8OA 4M3JA 2WLYA 3AM8A 4MYWB 4YJZL 2XWBA 3GSUB 3GGWA 5BZWA 4XPFH 3T65A 4FMFA 4PJDF 2R29H 1A1NB 1KN2H 2IADA 2IBZY 1B0WA 4G8EB 4NWUH 4XB7A 5E9DB 3MLRL 1I8KB 4WU5B 3G9AB 3QUYB 2YSSB 4NFDA 3TCLA 4Q0XL 5IFHL 1D7FA 4QOKA 4PBWD 3P30L 3ARBA 3U36B 3WL9B 5FUZL 4KGJA 4U6XB 2Q87A 3DRTA 4U1NA 4FQQB 5F3HB 3E2HC 2JCCB 4F33B 3Q0HA 2IQAB 4UBDD 4YHYC 3QDJA 2XG5A 5BRZB 4X5WA 3SE4C 4UBDC 5FDWA 4FNLH 1TZIA 5BO1H 5F7YC 4Z78A 4P5KA 4L4TE 4CGTA 3FO1B 3VXMB 4QRPB 5ALCL 3HZMB 2IALA 3H9SB 3UTPE 3O6ML 2MSPA 1UZ8A 4QHMB 5E2JA 5KTEH 4LPCA 3HMXH 4A6YB 5CMAB 2MTPA 3K2UL 3RDTB 5GGTL 1MCDA 4HW6A 1JGEA 3MV9D 5HDLA 5JUEH 3D2UD 4F7EB 5TDPB 5D9SB 1FBIL 3FRPA 5GJSL 3H3PL 3I6GA 1P7KA 1TETH 1ZVYA 2IG2H 3SEPA 1JGDA 5C9KA 5FOBB 5FF6B 3LRGA 2W0KA 3PJSB 4P3DB 5KOMC 1Z9LA 2ATPA 5HHOB 1M05A 1SMOA 3X12B 1MCFA 3CDYA 3MXVL 1XAUA 4JAMA 2V5SA 2F53E 1A6WL 1GGIH 2APVA 2E27L 1T22B 3GK8H 2FGZA 5F7LB 1VEMA 3K4DA 5C2UB 3SJVE 4HX1A 3QPQD 1BIIA 2A74B 3V9FA 2UY7A 4FHBD 3QPQC 2J88H 4OCWH 5CIPA 4KK8D 1A6TA 1SJEA 2D4DA 4JHAL 2F19H 4LF3A 4KK8C 2ZPKL 5J9PB 3BT2H 3HG1A 5J6HA 1RU9H 4LCUB 3V0VB 5ANMB 2HRPH 4HPYH 1LVEA 3SKMA 2O5ZL 5IF0B 2YC1A 5D93C 3WLBB 5IVNA 4NWTL 3D18A 4HS8H 5IQ7H 2GAZB 3B6SB 1TZGL 1OW0A 1S9YB 4MAYA 4DUVA 4JRYB 2YKLH 4PREB 4M4RA 5M95B 3LH2H 1ETZA 4LPWA 4WUUA 2A9NH 1I7RB 1HHGB 4P9HC 1RULL 3CDGA 3LEXA 3IJYB 1VESA 1MCOL 1F02I 2PXYD 3UPCA 2AJ3A 2EYRA 5I8KH 1RZGA 4JR9H 1KCLA 3AXLA 1J5OL 2PXYC 4CRPA 1YDPB 1WF5A 2DL2A 4G9FD 3ILPB 2Q20A 1FFPA 4CVZA 4X4MA 4NC0B 1CLCA 2I07A 1GGCH 4XGZB 1S7XA 4Y4HB 1LEIA 2DTML 3GIZH 3QEGH 4MNGB 1P7QB 2X4QA 1QKZL 1ZA6A 4KHXL 4RRPA 3O2WH 3DSNA 5MEQB 4BH8A 4PJCB 2AK4E 1XGRA 3JWOC 1AXSA 3PG2A 5DRWB 2FRGP 5EUOA 1U8MB 2AJSH 2CK0H 1T20B 4RA0C 4AQ1B 4C83A 5C0RL 5CEZD 2P5WD 1FLTX 4LLYB 4JFDD 4YHLH 3O3BA 2UWEB 1ZHBA 4EZMA 1ZT4A 2AXGB 2VSDA 1BD2B 4DZ8A 5DS8A 4JHBA 2CLZA 5L8LB 2V9RA 5C7XL 1K3IA 2XYCA 1MFCL 3IDIA 2JB6B 4CVUA 4X9IA 3RWFB 2ZCKL 4P48A 3WS6A 2YPLB 1PZUB 4UNUA 5GGSB 1OGAD 4XVJL 5LCVH 3DO7A 4KKCD 4PJXE 2OTUB 3QSKB 5IM7A 2P48B 4KKCC 1JRHH 1RUQH 4H20L 3T1WA 5I1GL 4F58L 3D3VE 1MRCH 2NZIA 4UINL 4XT1C 5A1AA 5HBBA 1A6UH 3EO9L 5LWYH 2R0LL 3EJJX 5FO9A 1R24A 2EICA 1CDCA 1Q94A 2E7LA 2GTWB 3HE6B 1WITA 1CFNB 4L3EA 2PCPB 5IW1B 5GHWL 1MF2L 5KVFL 3G6AA 4N0FB 4N1HB 5ICXB 3QEUA 5FHBL 2Z92B 5EO9B 1IAKA 4HJGA 4I3RH 1G7QB 1NCBL 2EIZB 2EYTB 3H8NA 4QHLA 5IESL 2DM4A 5F9WB 3G5VA 3C9NB 4G3YL 1U8JB 4LNRB 2JJTA 3F5WB 3MLUH 3QO1B 1LD9B 3MUGB 5EU6D 1H3PH 4GRMB 3HR5B 3RWGB 3UC0H 1MFDH 3O3DB 1S9WA 3ROLB 3B5HA 4XPHH 4N1EA 1JN6B 5GS1C 3RPIB 1XF5B 1ES0A 1CFVL 5IKCB 5J89A 4H88L 3L5HA 1AGDA 3P4OA 3PNWB 4RMUA 1DQLH 2VLRE 4ORGB 2NW3B 4J1UB 1A4KB 1P4IL 4KU1A 5DRZA 1TJHH 5L6YL 1BOGA 1RVFH 5IVXA 1GPOL 2AJVH 2OSLB 3DBXB 1FVDB 5IB5B 2P1YA 5L2JB 4ACPA 4LRNL 3Q6GH 4BKLA 3ZKMD 2X1WL 5FM5O 3HI1B 2ZUYA 1Q0YH 3MA7B 5GISL 1XF3A 3ZKMC 3O8XD 1P53A 3FO2B 1S5IH 1I1AA 4PB0H 3PHOB 3K80A 4R96B 1XF4B 1FO0B 2DQJL 3O8XC 4HUWB 4Z0BH 3VXSD 4U1GC 4WCYL 3T0BA 1W72L 1DCLA 2IANB 3V79C 3IU4L 1FP5A 4NO0D 4HAFA 2DQEL 3QHZH 4M6AA 3T3PE 4GSDL 2Y72A 5JXAH 4J6RH 4RFNB 1I1RA 3G6JA 4TYUA 5ERWA 3ZTNH 3TWCL 3QHFH 1L7TH 1D6EB 2OX5A 3EYSL 3B83A 4CL7A 1A6ZB 1CGSH 3H7BB 2IFGA 4QXUL 4AL8L 3O2DH 1VFMA 3HC3L 2X1PA 3HUJA 2P8LA 5L7XH 2ITDA 2HRLA 3BIBX 3S35H 2WUBH 1KB5B 3KXFB 4O2FA 5T33L 3T0XA 3OKOA 4N0UB 5DR5H 3KLAB 4YXLL 1FNSH 2Z0BA 1KFAH 1T2QL 4HJJH 3VWJD 4X0KB 3MLPA 5DK2A 3UTQB 3ARQA 3VWJC 4P4RB 3MRPB 1XCTA 4PRIA 5DC9B 5CEYB 4QXWA 3P73B 4ZSOE 3NTCL 2R1YB 4AT6A 1YQ2A 1M7IB 1XZ0B 4MCYB 2R23B 1U8OA 2ZOLA 3VE0B 4IIQC 3X3GL 1T04A 2Y5TA 5FA3B 4X6DA 2ZNXA 3DVFA 3LDBB 4Q0XH 1P4LA 4QRSB 1UQSA 4JY6B 5IFHH 1SEBB 5IVOA 4AIOA 3P30H 3V8CA 4PFEA 5SX4H 5FUZH 1G0DA 4D0CA 5CHNA 5F1SA 2NY5C 1GOHA 2ZUQB 4HGMA 3VFRB 1DE4B 1SYSA 2OYPA 5INCB 2CIKB 2ZNWA 2YD9A 4YNYB 3MBED 3SKOA 4HMDA 1L6XA 3MBEC 2Z93A 4QRRB 5DJXA 1IGTB 1PX3A 2R69H 5ALCH 1ZK9A 5BS0B 1WIUA 4NHUB 1J86A 1XH3B 1I9JL 3K2UH 1RJZB 2JB5L 1RFDL 5GGTH 4LQFL 1JUFA 3K1KC 4Z77B 3NAAL 4OFKA 4Y1AD 3LRHA 2QLVB 2VXVL 2Q76A 3K8MA 4P57A 4XMPL 1FBIH 2ESVA 5GJSH 4R2GB 4NSKB 4I3SL 1LK2B 1BHGA 4JDZA 1YNTB 5E03A 4E42A 4OAWA 4AM0B 3RU8H 1Y18A 4P2OD 4PJGA 1QBAA 4NO3A 3SPVA 5F7EL 3MX0A 5I73B 1A6WH 5JPNB 4PJEF 2E27H 5I6XC 3A0OA 4P2OC 4CKVX 5I18L 2WP3T 5JTWA 3BZEB 2FH6A 4W6XB 3S7GA 1YJDC 4YUEL 3LD8C 3BGFB 1AH1A 4KI5D 4ZYKA 1A14L 2PTTA 1J8HB 5IG7A 4KI5C 1HILA 4JHAH 5LGHL 5F7MC 5KJRL 1NCCL 2HT4D 1FAIH 2XN9A 4M61B 2ZPKH 3S3PA 1KULA 3QIBA 5K9JH 4U1LA 2HT4C 1AIFA 2Y06L 3HRPA 3NH7L 4WY7L 1KCSL 4HEME 4X4XA 5ISZA 5C09B 2O5ZH 2J1KA 4NWTH 2HVKA 3OV6A 4YBLB 1KCKA 4JZNA 5HGHB 3HS0B 3P4LA 1QRNE 1OP9A 2BMKA 5T3XL 5BXFA 5T5NF 5JW4M 2VR4A 2P8PA 4X6EB 2QBWA 4G5ZL 2ICEA 1D5BA 1RULH 4PS4L 4Z0XB 2ATKA 1A22B 3HMWL 4EOWH 2Z4QA 1MCOH 4OCRL 2V2XB 5C86A 1EH9A 3VFVB 1RAMA 5F7KC 2HFFB 5AUMB 1J5OH 2CKBL 5F7FA 4GRWB 2VISB 4BZYA 2HVJA 1MI5A 4JPIA 5DDHB 1CT8A 3QUZD 5DJYB 5BVJA 3VXOB 3D85D 3DMMA 4LLMB 1OTTD 2VSCA 4PR5A 3QUZC 5ID1A 3ELAT 3CX5K 5HDBE 5GGRY 1EHXA 1OTTC 1QKZH 4KHXH 3VFWB 1E6JL 3TIEB 4KFZC 3VWKA 1QYGL 4EUPB 5IV2A 4PJFB 5IMKA 3CFDB 1ZHNB 8CGTA 4ZUSA 1X5ZA 4PJBE 5BVPL 1I9IL 1CICB 3DXAD 2BHYA 4QXTA 5C0RH 1F4WL 4Y8AA 2XV6B 3MGOB 4X5LA 4NRZB 4HKZA 4K7PY 3QDGE 4PIRF 4YXHL 1AD0B 1AR2A 1J88A 2DWEB 2O61A 5F70A 1QZ1A 5DJ2B 2YWYA 3TV3H 5C7XH 1CFQA 4HWBH 4OFVA 1P84K 1INDL 2DIJA 2ZCKH 4QRUA 2WBJD 4MD4B 1ED3B 4JCMA 2EEAA 2WIIB 2WBJC 2XFXA 4NO5A 3OKNA 5MP6L 3ULUF 4HAGA 3L7FB 4LFHD 1HK6A 3BH8A 3MBXH 1UXWB 2YN5A 4PJIE 3QFJE 4H20H 4JVPA 5JHDE 3FOMA 5I1GH 4F58H 4UINH 1RJLA 3QEHB 3EO9H 4JRXB 4Y5XC 2R0LH 3UTZB 5KBNC 1NGWA 2NY3B 2XKSA 3AFLA 4NN5C 2DN7A 3EGSB 4P2CG 3IFOB 4NO2B 1YN6B 5I1DA 4NOFA 3VXRA 1IM9B 3AU1A 4PG2A 3QI9A 1FPTL 3QUXB 5GHWH 2J12B 4L4TD 1RV6X 5KVFH 2X70B 5T1KB 3Q6FA 2CJUL 2X4PA 4HK0B 3BEWA 3UTPD 1G0XA 5HDOA 3WFHB 3VFTB 5FHBH 2NY4B 1B0RB 3V5KA 3VGAC 2G2RA 4KRPD 4IMLA 2ARWA 2QSCH 3KLSA 5IESH 2KUTA 3SDDB 4KRPC 4EVNB 2R2HA 2VITA 4J23A 1BVLA 1IBGH 4OLYL 4XP1L 3S36L 4MMXC 3GI8L 2ADGA 1MFEL 1WEJL 3BWUC 4RQQB 2C26A 4X4YA 3O4LA 1FC1A 4NQSA 4U0QB 4PGEA 3CFEA 3S6CA 1HXMA 1CTOA 4NM8L 1CFVH 3HZYA 4H88H 1ZSDA 4OLUL 3QQNA 1BJ1H 3O9WA 5C0AE 2F53D 3KJ4C 5E7BA 1CL7L 5E8DL 4XRCA 4FP8L 1PQZA 1IE5A 4OZIB 5L6YH 2CR3A 4GBXA 5ID0A 1GPOH 1OGTA 1I7TA 4PJ7B 4YHIA 4YPGA 4GG6E 4XWOD 3SJVD 1BZ7B 3NCJL 3BKYL 1U41A 2ZZUT 1N0XL 3PP3K 2EDYA 1XEDA 4XWOC 2E9JA 4OV5A 3GKWL 4NQEA 3QP3A 2GITB 1EO8L 3ISWA 4OD2B 2VO5A 3BKCL 2VLKE 5IVXF 3VXPA 3O41A 4YHZL 5GISH 1MOEA 3U0PA 4U1HB 4V1DA 2YD4A 4Y4FB 3PDGA 1CDBA 1TJIL 1GZQB 2P24B 1S7VB 4GRLD 2AKRB 2DQJH 1W72H 4GRLC 3IU4H 4R0LB 1ZXQA 3QCTH 3VU2A 2DQEH 2IAMD 2Y6SD 1JWSB 1CWVA 2WV3A 3MRQB 4GSDH 2IAMC 2Y6SC 5MENB 4XXCA 5MEPB 1N3NB 3TWCH 1CFBA 3UDWA 4QEGA 4E41E 3EYSH 1JYVA 2VOTA 3MREA 3QEQA 2XT1B 1QLFB 1BBJA 2HFGL 2VZSA 4IHOA 5EG6C 3DYPA 1UH2A 1TTFA 3IF1B 4QXUH 4AL8H 3HC3H 4MNQD 2QR0B 2H32H 2HT2D 4Q9QL 3QISA 2NY1B 3UROR 3C8KA 2HT2C 4IS6B 3H0TA 4HDIA 3QDME 3GSVB 5I8CA 5T33H 1S5HA 1OL0A 4PJ5A 2J5LC 4YXLH 3PQYA 4G9DB 1VGKB 1P2CB 4FQPA 3UPAA 1WBYA 3HUJF 4YDJB 5IQ9B 4W4OC 5F7WC 1X3DA 1TVHB 4WI2A 2FDBP 1T1ZA 4HG4K 2Z8RA 2D7PA 2EKSB 2EDTA 3O3AB 4MXVF 1BAFL 5DVNA 5FV1L 4WDIA 5DMKB 1L7IH 3NTCH 1ORQA 3W39B 5I16B 2PUQT 3X3GH 2AK4D 1BF2A 3AUVA 1KJ2L 1FSKB 3QXTA 1MCPL 1A6VL 4BUHA 4NUGL 4TRPL 1A9EB 1P1ZA 1OF2B 4X6DF 3FQUA 5JW3L 3UBXB 5CJXA 2F8XC 1IMHC 4DJMA 3TBSB 1KLGA 2JTDA 4JHZA 4QYOA 2A83B 3H7LA 1MIEL 1UC6A 1HI6A 2YZ1A 1WQVT 1V3MA 4L9LA 1KGCE 2PYEA 4LSDA 4G8GA 2D4FA 1EFXB 4JG1L 5DHXB 5E70A 1I9JH 4U6HA 2J2ZA 4YAQB 5IR1A 2JB5H 1RFDH 4HKJA 4LQFH 2GK2A 3D3VD 3L7EA 1RK1A 3NAAH 3GM0A 1P7HL 1X5KA 2DKMA 4HIIA 1AGBB 3ARGB 2VXVH 1KJVA 2B4CL 4XMPH 3AY4C 2OCFD 4NOBA 4Z7OF 3BRFA 1J0HA 3QFDA 4I3SH 3GB7B 3UJIL 4C56B 3UEZA 4JDVA 4FQ1L 3F65A 4WWKB 5TF1L 2CO7B 4PGCA 1J05B 5F7EH 4TSBH 1MHHB 1OLZA 3HZKA 4F9LC 3HNTL 1QSFB 5I18H 4D9RE 1TPXB 4UNVA 4UDTB 5I1LB 4Y5YC 5FGCB 5HGDB 3KVQA 4H0IA 3FN0L 4PJGF 2W9EL 2HJKB 3D9AH 4FQXB 1H5BB 4NBXB 3NFSL 3RKDD 3AMKA 1A14H 3SE4A 4N8VB 4IOFD 1N4XL 3CZFA 1HINL 2D7TL 3RKDC 5KJRH 1NCCH 4IOFC 3VI4F 2HAZA 3OR6A 5AAMA 1MHCA 3OKMB 3PL6B 5KZCD 2Y06H 3NH7H 4WY7H 2N7AA 5D7JD 3LV3A 1KCSH 2WWKO 5HI4D 2VXQL 5D7JC 3ALPA 1TNMA 2C7UA 5EDXA 5HI4C 1FFRA 4XMLL 2WWKT 4I2XB 2FX9H 4HC1A 3MV9A 5IMLB 3BH9A 5T3XH 3D2UA 1DBKL 1N26A 3VXTA 4R3SB 4RNRB 5IJKC 3LY6A 5DD3L 4WHTB 5C0GA 4G5ZH 3RY6A 4JKLA 1U3HD 4L4VE 1MCBA 5F88B 4RFEB 4PS4H 1EEZA 4Y16D 2L7UA 1U3HC 3HMWH 4IRZL 2ZUSA 3TT3L 1VFUA 3L3GB 3LKSA 2PN5A 4DOHE 4KHTL 4OCRH 3C6LB 4Y16C 3UPRA 4KROB 5GJTH 3MUZ1 3T77B 4OLWL 4LLQA 2CKBH 1DTUA 3WNNA 1GL4B 1KXVC 3QCUL 1ZLVH 3GBML 5BJTA 3V4VL 4RX4D 1WZMA 3IGAB 3VG9B 2RGSA 5B39A 1E6JH 5DD0L 3FCTB 1QYGH 5T3XE 5GRYA 4ZXBD 1TVDA 3NZ8A 5T1LD 4JFEE 2BCKA 3I84A 4LSVL 5BVPH 1HCVA 1I9IH 4XP6L 4ZXBC 3PHSA 1EMTL 3KPQA 1F42A 3JWDL 3A6BL 1FZKA 4HWNA 2FWOB 4YXHH 1LK3L 5E95B 4WHYG 4N8PA 3LQAL 3NMEA 4L1HA 3S34L 2LVCA 3WO4B 3U82B 3QWQB 2XPGB 3FFDA 4HK3N 3ES6A 1UKQA 4LFHG 1KTLA 4LHUD 5FUCE 1T4KA 1INDH 4K3JL 1JZ8A 1H3TA 5ITFB 5KSVA 3QUKA 4FFWD 1BJ1J 5GRJL 3OHXA 3TNNA 3DHMA 3MMEB 1D5XB 4FFWC 1KPVA 3OMZA 5E6ZA 5MP6H 2FO4A 3VGGA 3HI5L 4LIQH 3VXQB 4H1LG 3EW3B 3QIWB 3U30B 1W8OA 1T3FB 2BSRA 4JFFB 4JLRA 1MSPA 4MD5B 5TF0A 3SKNB 1IAII 1DSFL 3CCHA 4G9FA 2V5YA 3I02B 2WMPA 4G6KH 3QNXB 1XF1A 2V2WB 4PJ9B 1FPTH 1QPXA 1ND0B 3FT2A 3X11B 1AD9B 2CJUH 2QQNL 2C3HA 3FRUA 4WI6A 2ILLA 3V6OE 5I66A 4XAKE 1AR1D 1JWMA 1F3JB 3GRWL 4S1DD 5KANG 3TN0D 1AR1C 2P5WA 1J0YA 4JFDA 4OLYH 5IB1A 1QFWL 4MDJB 4S1DC 1O7SA 3TN0C 3S36H 2CLVA 2LVEA 2APTA 3GI8H 2W07A 1MFEH 1WEJH 1QR1A 1AJ7L 1YN7B 4IJ3B 1WZ1L 5KSBA 1J11A 4XC3L 4X7TA 4NM8H 4DCQB 2EDDA 4HIHB 1JL8A 2H6PA 3O3EB 1EO7A 1G7MB 1OGAA 4OLUH 1VFAA 3VFNB 3DV6B 1J0IA 1TITA 4HLZG 3SDXE 4YWGL 2BSSB 1C5DA 5JMRA 1CL7H 5E8DH 3QDHA 4FP8H 4PLJD 4CAGA 4YR6B 5MHSE 4PLJC 1CIUA 2X5PA 1DP0A 1K9TA 4LDLB 4S11A 1R3LB 3NCJH 2W92A 2DQIL 3BKYH 1N0XH 3IJSA 4IRJD 1QACA 3E0GA 3ZYOA 3GKWH 4F7PB 1J12A 1ADQL 2LV4A 2ZWLT 4IRJC 4GW4B 4WW1A 3BKCH 4YHZH 4UTBL 3BPOC 4K9EL 4LEOB 1A6AA 1VEOA 3QNZB 1JHTA 1TJIH 3REWA 3MRCA 2FSEB 4HUVA 4YK4B 2BSTB 3FHQA 4PJAE 5LBSH 3O6LL 4NKMA 5KSAD 2I9TA 4Q2ZA 1SJHA 2YS4A 3BAEL 1PKQE 4JY5H 5DK0B 4DEPC 2X6MA 2IBZX 5KSAC 1U93B 4PD4K 1QRND 5KSUA 1HHIA 1YMME 2BJML 4XVSL 3F7VB 3ROOA 3BKML 3EDKA 3MUJA 1UB5A 2ZG1A 3V6FB 2HFGH 2A73B 2BP3A 2W9DL 3UAJD 1HHJB 5KG9B 4X7SL 5DK3A 4BM7A 1RHFA 2IH3A 4Q9QH 4ZDHA 4HIEA 5CP7A 1CQKA 4XBPA 4YHPB 1IKFL 3C5ZB 3UAJC 1W0VA 4JPVL 2AW2A 3QWRD 1VACA 3D39E 4J3VA 3BGAA 4X8JA 2GK0A 4V2BA 4AENB 3ZTJG 3DUSA 4IOIB 2ARJA 2VJXA 5TGBA 3UTSE 4UOW0 1FL6A 1FFNA 5EC1A 4JJ5A 5EBWB 2OL3A 4RFOH 4HWUA 3TH2T 3BP7A 1L9MA 1OAUL 3ARFB 3GMQB 5D1XA 4MQ7B 1HE7A 4DGYL 3WCYA 3SE3A 3O8XA 2E7MA 4LLAA 1D5ZA 2JJUA 2DIAA 3UBXI 5TDNB 3VXSA 1KJ2H 1OP5H 4Z5RB 2QEJA 2VQ1A 1HHHB 4NO0A 2DMKA 3QDGD 5J6GA 1MCPH 3AROA 1CFSB 3K3QA 2C1OB 1A6VH 4LU5L 4NUGH 4TRPH 5AZ2L 3GUTA 5DQDL 5D7LE 1IC5L 5JW3H 3KPLA 3HHRB 4Y19E 3OJDB 1OOAA 1CFTB 4GKOA 1MIEH 2I26N 2J6EL 1SY6L 4U7KA 3FOLB 4NQCB 3VFUB 3H3BC 2CDFA 12E8L 1NEUA 4QRQA 3T8XA 4JG1H 1FDLL 4OZHB 1ZMYA 3QFJD 5GGVY 4Z7NE 5JHDD 4AJ0A 4P2RE 1EAJA 5E8PA 1K8DA 1KJMB 3VXNA 1A7BA 1G7LB 1MEXL 2X4RA 3VD3A 2B4CH 3BRGC 3WUWG 1U8KB 3VWJA 3CD4A 1GOGA 4X4ZA 1JHKL 3UJIH 3GMLB 3ZO0A 2FD6H 4F80A 1OCWL 1A1MA 3WJJC 4MX7B 1NBZA 3KDMB 4ODWA 5D5MF 4IIQA 5HYSB 4FQ1H 5TF1H 3D87B 1NAML 1LO3L 4M93C 3DSFL 4J4PD 4WVRA 2Q6WA 3JTSA 1RD6A 5MI0C 1ITCA 3HNTH 4ZTOH 2E9WA 3PWLA 4PYGA 1MHEA 4J4PC 4LPTA 5D72L 2VZVA 2DMCA 2ZOKA 4TULL 2LFGA 4RGND 2XWBB 4LLDB 1CDGA 3FN0H 4DUXA 2BHZA 1J0KA 3EOBA 3T65B 4RGNC 3FB7B 2YN3A 2KZWA 1FN4A 2IADB 3TVMD 2H3NA 4NCC2 1N4XH 4G43A 4ELMA 1S7WA 2ED7A 1HINH 3QG7H 4KDWA 4PRHE 5DQJA 3U2SA 5E1HB 4KZEL 1ZHKA 2D7TH 3MBEA 3TVMC 2CUMA 1X6NA 3TCLB 2ZSWA 1NGPL 3ARBB 2K1MA 3KWWA 5C0AD 2VXQH 3DRTB 4U1NB 3DX9B 3QJFB 1RI8A 4PGDA 3IDXL 3R0NA 3S4SA 3UTTE 4XMLH 3QDJB 3O6FD 4Y1AA 2D0HA 4M5YL 2M2DA 5T3ZL 2GSGB 5F9JA 4DN3L 5A2KH 5CGTA 5FDWB 1S7RA 3BKJL 1DBKH 3O6FC 4Z78B 4OCMC 4NUJA 4P5KB 5DD3H 5IK3B 1HKLH 4BK4A 4MXWH 1AQKL 1CR9L 1OSZB 3BO8A 3MRLA 1GHFL 3STLB 1UZ8B 4L8SC 3WFEL 2FH8A 4OM0L 3C2AH 4IRZH 5T1DL 4KHTH 2JK5A 4FXGA 2NLJA 4ZUUA 2P7TB 2JJSA 3L3DB 3L3JA 3VXUA 1KLUA 4Y0GA 2P4AB 1J9CT 3VDBA 5IHZB 3CSGA 5BQ7A 4OLWH 3U6RA 4K2UL 2VDQH 1KEGH 4D0BB 5IHUL 2BNUB 4UQ2A 3I6GB 1P7KB 4PJEB 4QY8A 1UWGL 3X3FH 1JGDB 4HKXB 3VRIA 3EDDA 3QCUH 4ORZC 3GBMH 3V4VH 4QRTA 4OV6F 3RBGA 2BNQB 3TBWA 3VDAA 3F8UB 4JFQA 1JJUA 4JKPL 1YY9D 5C6PB 5DD0H 5GSVA 4ONFL 3MJ9A 1MAJA 1YY9C 2PNDA 2X09A 1EMTH 1QNZL 2J4WL 4LHUG 3QDMD 1V5JA 3JWDH 2UV3A 3A6BH 4HUXA 5IOPA 4QOKE 5T1MA 1LK3H 3PV6B 3LQAH 2VL4A 1PLGL 3BW9A 3S34H 4CNIB 5CIPB 1LWRA 2Q8AL 1SJEB 1J18A 3VA2C 2VUOA 4WO4D 4K3JH 5A2JH 3W9EA 4LSPL 3JV6A 4WO4C 3HG1B 5J6HB 5GRJH 3ARTA 1XGPA 1U8IA 1H8SA 3SKMB 5C0DB 5TE4H 1AXIB 3FQRA 3CPLA 3D18B 3HI5H 5FFLA 2W0FA 4B5EA 4NQVB 1TLKA 2XZQL 2F54D 1NFDA 1FZOA 2RHEA 5CUSL 3LKOA 3MTRA 3IJHA 4MAYB 2FECL 2YPLE 3TA3A 4TTGA 1DSFH 3KPPA 1CLYL 4WUUB 4BFBD 4N9OB 3VJ6A 3OGCA 2VL5A 1X7QA 3QUZA 3D85A 3RIFF 4HFWB 5EC2B 1TDQA 4CUCA 2AJ3B 5DI8A 3ULVL 2YWZA 5TFSL 2QQNH 1EBAA 1RMFL 3FT4B 4TUKL 3HZVB 5EOQL 2CRMA 5F8QC 1DLHA 3AXLB 2OJEB 1KGCD 3D5OF 2FJHA 5C0BD 1F45A 3JV4B 5GXBB 1H0DA 3TIDB 5HYEA 4XCNA 3OAYK 4CVZB 3DXAA 4YXKL 4QHKJ 1CF8L 3CVHL 4XVUD 4OQTA 2APWA 4WFFE 1QFWH 1S7XB 3RWIA 4F7MB 2CGRH 4LKXA 2UZYB 3GHEL 4XVUC 3VRJB 1AJ7H 2DQCH 5I74C 1F4YL 1WZ1H 2X4QB 4PV9B 5GRXG 1BBDL 1ZA6B 3WE6A 3BYTA 4FMKA 4XC3H 4BH8B 4TUOA 1XGRB 3BN9D 1AXSB 3M8OL 1I8MA 2WBJA 4WFEE 3BN9C 5IMOB 1AO7E 3WNOA 1ZEAL 4YWGH 1A7NH 2R1XA 3ARED 2B2XL 4QHKI 1ZHBB 4MHHG 5KSBF 1ZV5A 1K85A 2V7NB 4DZ8B 3AREC 3ZDYF 3ZKXB 4D9RD 4Y5XA 4HUMB 2HKFL 7CGTA 4U7SA 5DZOA 3TNMB 2DQIH 5HTSA 1I3RB 1SJXA 3G08A 2W1NA 3IDIB 1JVKA 3VGEA 3S5LB 4H1LA 5JOFA 1ADQH 3WXVL 4ODXA 3DO7B 1T5XB 4UTBH 4ZO8A 5JQ6L 4K9EH 1FV1A 3N1GC 3ULSA 4GLRH 2OQJA 3WHXA 5KS9B 2ERJC 1CU4L 5IM7B 4L4TA 2IBBA 3DUUA 1INQB 1TQBB 1F3DJ 4XCEA 5GS0L 2AQ1A 1A21A 2UUDH 3O6LH 2JIXB 1NEZA 3VFGL 2F74A 3BAEH 1LQSR 5FO9B 1R24B 1CGWA 5IEHA 4YDIL 5EU4A 3RUGE 1S9VB 1FNHA 3MJ8A 4L3EB 2Q86B 5JORB 2BJMH 5C07B 4XVSH 3NBNA 1CN4A 4YC2B 5TH2A 3BKMH 4XNMA 2VTFA 3G6AB 3D48R 1KUMA 4L4VD 2W9DH 5ACLA 2YD6A 1S7SA 1MCHA 4X7SH 5H8DA 3BPLB 4YO0A 1EPFA 1IAKB 1IKFH 3MRFB 1HOCB 1RZKL 4JPVH 4U1JA 1ZT7A 1FLRH 3BEVA 4O5LL 1DN2A 2D9QB 3R06A 2E6PA 2F53A 2EYSA 5IVZB 3SDCD 5EUOE 2LAGB 2PR4L 4YHNB 2MMXA 1IAIM 3SDCC 1S9WB 4EDWL 3SJVA 3GMMA 3T3ME 5DJAA 1JK8A 1OAUH 5E1AA 4X80L 1GIGL 1Q9KA 5I1CL 4Y4KD 4Z76B 1AGDB 3P4OB 5F6HJ 2ARJQ 1EUUA 1OD7A 3DI3B 4Y4KC 5T3XD 4X6CE 3ZHDA 5DRZB 5EUKA 1BOGB 3QQ4B 4GRLA 4JFED 4UT9L 5IVXB 1Q1JL 1YYMH 5DVOA 3GSRA 4MJ6A 3WDIA 3OAZH 3UJTL 5L0QC 1YMHB 1WWBX 2H45A 2BOCA 2LABA 1CCZA 1MJJB 4H26A 5AZ2H 4BKLB 1Z0NA 5DQDH 1IC5H 3SO3B 2DLEA 5F6HI 2A0LD 2R39A 5FUCC 2J6EH 1SY6H 2YRPA 2A0LC 2MCPH 4MNQA 4PJHE 1LEGB 5J7CC 4QHNA 3KR3L 3SDAB 4JZJB 1FDLH 4JREB 3RHWF 1MCKA 3WFDL 3U1SL 2AVGA 3HC0A 4HGWA 1MEXH 1IGJA 3CSYA 5C0ND 4W4OA 1ULVA 5C0NC 4L8DA 4U49A 3X13A 3HAEA 1JHKH 4S1QL 3TF7C 1UXSA 3M17B 2A6KB 2NXZD 4RMRA 1OCWH 3HUJB 2P8LB 4Y2DD 5FM8A 1DDHA 3SCMD 2NXZC 2HFTA 3GDBA 1VPOL 4O2FB 1NAMH 4HBCL 3ECBB 4M00A 4Y2DC 4E5XA 1LO3H 3DSFH 3SCMC 1MHPL 2AK4A 3OKOB 4XAKD 3PHQB 4BSVA 4U4BA 5D72H 3V6OC 5ITBL 4QTIL 1C12A 2ZP0T 3TPUA 3I3DA 4PRIB 2BFVL 2YR3A 3WN5B 5I8EA 3P77A 2NPLX 5E99L 3DX7A 4JFHE 4KZEH 1DZBA 3WYRA 1T04B 3V0AC 4X6DB 1HSBA 1U58A 3DARA 1YNLH 2P5EE 4OBRA 5DWUH 5DMIL 1NGPH 2BERA 3LKQA 1CLZH 3V7AE 1RIVL 2DB8A 1UACH 4JKWA 2NMSA 1QA9A 5K9KA 5CHNB 4ELMF 3I75B 3IDXH 1UB6A 2VAAA 2R0ZL 2PF6A 4WEMB 4M5YH 3AY4A 3QJHB 5T3ZH 1E4WL 3OKDA 1F4XH 3SKOB 2XKNA 2XRAL 4PLOB 3BKJH 4WV1C 1FJ1A 4AMKL 2Z93B 4ZFOA 3G6JE 2UYLA 3H42L 3KG5A 4EIZC 3VW3L 2GJZA 2W0PA 1AQKH 1CR9H 4OFIA 1GHFH 2GI7A 1JF1A 3WFEH 2B5IB 2DS4A 4ZOEA 1KENL 4PJ8D 4OUOA 1JUFB 4F9LA 4PJ8C 1U36A 3L3IB 2EO1A 4K71C 4Y5YA 4P57B 3KYOA 4PTUB 4QCIA 5IHUH 3FAXA 4R6UA 2ESVB 4MXVE 1SMAA 1UWGH 1MCSA 4K3EL 3B2UD 1CG9B 1LE9A 4E42B 4GH7B 4RMQA 1WISA 3RI5K 1Y18B 5EO1B 3NA9L 3B2UC 4GW1A 4PJGB 4JKPH 3QIUB 5T3ZE 2IQ9L 4ONFH 1G6RB 5IP4A 5CSBA 5CGYD 5D7JA 3D39D 4KI5F 1QNZH 2AJUH 2J4WH 5CGYC 4HS3A 4ZNCD 1WIPA 2DQHL 3QNYA 1FH5L 2DQTL 1PLGH 2PTTB 3RA7L 1JMXA 1I85A 5IG7B 2Q8AH 5IJKA 1HILB 1X5LA 1HNFA 1MQKL 4B50A 4LSPH 3QIBB 4LKCA 4QXGL 1U3HA 3N06B 4NP4L 5D7SL 4X4XB 5ISZB 1IAOB 4Y16A 2FBOJ 2CRYA 3L95A 1J1OH 2HVKB 4AYFA 3OL2A 1QR4A 4HZAA 5B22A 4WNQA 3FQWA 5CUSH 3PGCA 1RZIB 2BMKB 5BXFB 5GRZA 3KPNA 4OF3A 2R1WA 1CLYH 3VCLB 2Q3ZA 5D7LD 5J12C 5C0CB 5KVEL 1NFDF 4Y19D 3STZA 4RX4A 3G5ZA 4Z95L 1QBLL 1PG7X 3N9GL 3RX5A 1ZT1B 2KBGA 3ULVH 5TFSH 5EOQH 3MRHB 4GQ9L 3SGKC 5T1LA 4XPBL 2I9LA 4HC1L 5JDJA 1NC4D 4LGRB 2HVJB 1T6WA 1MI5B 2OR7A 2DQDL 4KTYA 4P2RD 4YXKH 4M48L 1CF8H 5BVJB 3CVHH 3BVNB 4ZOCA 1E4XL 1BFVL 3GHEH 5ID1B 1A64A 4M7JH 1MAMH 4QNPF 1T7ZA 3L5JA 1BBDH 4X6BA 3VWKB 1UH4A 4FFYL 4NZRL 5IV2B 5IMKB 5F71A 3RIAK 4I4WB 3M8OH 4ZSOA 4ZUSB 1LHZA 1BFOA 1FRGL 4ZAKD 4BZ2H 2Y07L 4C59B 1ZEAH 2XN9E 2DF3A 2XNAA 4LCWA 3U4EB 4EBQH 5J57B 4P2QE 2KH2B 3MCKB 3REVB 4ZAKC 2B2XH 3ZMRA 5EBMA 5IGXL 1TCRA 2RBLA 3HPLB 4GO6B 4G6AD 3FONA 5D6DC 1Z5LA 3PWPB 3ULVE 4PY7B 1HQ4A 1CFQB 4G6AC 3O2DA 4HUKB 5ESAA 1WAAE 2GJJA 1R6VA 2YUWA 5IBTH 1LO2H 4PPTA 4Y7MA 4GOSA 1G7JA 2OBGA 2MQ3A 4XC1L 3T2PA 3WXVH 3U9UA 2YD8A 5SV4A 2XFXB 5JQ6H 4NO5B 3L6FA 3OKNB 4JFPB 3BH8B 1CU4H 5I9QC 4TSAL 3MJ6A 3FOMB 1AKJB 2B4CC 5GS0H 4I0PB 3IAPA 4R97C 3RL2A 4X5XA 2GTZB 4N0YL 4YDIH 1QFPA 3UTTD 4LSTL 3TN0A 5I1DB 5ETUA 5GRVL 1R5VA 3VXRB 4OD3H 1DQTA 3AU1B 3FKUS 4UU9A 3QI9B 1UVQA 3MGTB 2X4PB 5EO0A 3THMH 1X5JA 1KNOA 3V5KB 1RZKH 2LE9A 4NN6B 1ZE3C 4O5LH 2VITB 2FJFB 1S9XA 3V6BR 3NCFB 2PR4H 1EBPA 1KPRA 3DURA 5EN2B 5CBAA 5ELIA 4EDWH 3O4LB 4NQSB 2VXUL 3MCG1 3GIVA 4PGEB 4NT6A 4P4KD 1NMCB 4MQXD 5HHVL 3K4ZA 3KYMB 4IRJA 2I25N 5I76A 4GW5B 1GIGH 4HGKC 4QGYA 4P4KC 4KPHL 4X80H 2F15A 4MQXC 5I1CH 2FYYA 5GGTA 4PV8A 3WIFA 2VDOL 1F2QA 5EZJA 5A3ID 4XRCB 1MUJA 5DC4B 1HH6A 4UT9H 5A3IC 1LDPL 1N8ZB 1Q1JH 1OGTB 1I7TB 4F7CB 4MLSA 4YPGB 2EKJA 1U42A 1CE6A 4I3GA 5KSAA 3UJTH 1FNEB 2V7HA 3EYVA 1P7QD 3C2SA 2G60L 4OV5B 5HYFA 4PGJA 5HY9A 3WXWL 4OZFB 2WUCH 1QRNA 3BIAX 4M02A 5ESQA 1H8OA 3VXPB 1XF2A 3U0PB 3TLRA 3DWTA 1IGIL 2Z8WC 2R0KL 2D0GA 1TENA 4LPUA 2Q7NA 2E5EA 1MCLA 3MRJB 3V2AR 1BD2D 2ZUTA 3MLTB 3R0MA 3T4AA 3AC0A 3KR3H 3BP6B 2DLGA 4RGMB 3QWRA 3WFDH 1QEWA 3U1SH 5C0FA 2QQQA 3DPBA 4U1SA 1NFKA 1IAMA 3F6IA 2YPLD 3D1MC 4IDJL 3K0WA 2Z8VC 3MREB 4OD1L 4FQLL 3ZYJA 1BBJB 3AAZA 4IHOB 5D2NB 4S1QH 3D6GA 4OCSH 1VADB 2O26U 3JWDC 3C8KB 5HHNA 4OQ1A 1CXFA 1VPOH 3H0TB 3SKUD 4WI9A 3ZLQC 3LQAC 5CD3A 3CDCA 4HFUL 3G9VA 5FO8A 1URLA 1MHPH 3PP4L 3GJFA 4PJ5B 4HULB 3LKRB 3HE6D 1GVIA 4GT7A 4OFDA 4PJBA 5ITBH 3QXUA 1WBYB 4DVRL 3DVNA 1X5FA 3IDYC 3NIDE 3P9WB 4K94L 1F8TH 1KIUA 3HE6C 1UH3A 2BVOA 4WFFD 3QDGA 2BFVH 3ZDXE 2CDGA 1BFSA 3RWDA 4WDIB 2PTUA 5E99H 5C70A 1I1CA 1DUYA 3OKYA 4NQEE 3QA3B 1JTPA 2VE6B 4HEPG 1BWWA 4D94A 2J8HA 1FE8L 4MJIE 5A2FA 5DMIH 4Q9BA 5F9WC 3WIIL 4WFED 1AO7D 1RIVH 1U3JA 4EQ2A 4AIXA 3LQZA 4GMTL 1NCAL 4M9PA 4PJIA 3QFJA 5JHDA 2R0ZH 3KYNB 4LSUL 1P1ZB 5C08E 3C87A 2HLAB 3VFSA 5DMYA 1GXEA 1E4WH 1T7VA 5E2TL 1KLGB 4M5ZL 4F37K 1NGXB 5C6TL 5IHLB 1T66D 3I50L 4QYOB 4AMKH 3H42H 3VFPA 3WJJA 1HI6B 3C8DA 1XMWA 1T66C 1HQRB 1MELA 4L9LB 3KPRB 1T1WA 4G8GB 3QEQE 1IQDB 4LLWB 4I2XE 1KENH 2ID5A 3F6LA 4HKJB 3L7EB 4J4PA 4HIIB 1M71A 2XXCB 5K93A 5D5MB 4BSWA 1EA9C 1KJVB 2WLZA 4Y89A 2GUOA 3FFCB 1I4FB 3UO1L 1F2XK 4LPXA 4K3EH 3PQYE 4GAGL 4FQCL 1AXTL 4D9QE 1KF9B 4FS0A 5KAQG 3TVMA 2W60A 3MJGX 3NA9H 5J1TC 4PGCB 2IQ9H 4ENED 4NCC1 4DKEH 3LZFL 1KPUB 3U48A 4ENEC 1H3WM 3E2HB 1R3JA 4JQIL 3GNMH 5SWQA 5DSCA 3HB3D 5F9OL 4YHYB 3B3IA 2DQHH 1FH5H 2DQTH 4ZD3L 3HB3C 4K9EC 3RA7H 1M7DB 5EU5A 3CZFB 3O6FA 5IB4B 3S9DB 3BESR 4JZOB 1MQKH 2IGFL 3KXFD 4MZ2A 3OR6B 4R8WL 3DRQA 4L8SA 4QXGH 5TE7L 4NP4H 5D1QD 3TYFA 1LE5A 5D7SH 2C3WA 3KHOA 1Q72L 3CX5J 1ACYL 4FXKA 5D1QC 2C7UB 2NY5L 3BISA 1LO5A 2DM7A 2C4FU 3RWJA 5I71C 2PYEE 1FIGL 3N85L 5CS7A 3MV9B 1DFBH 3BH9B 1S8DA 3D2UB 3DGGA 1S3KL 3T0EE 4JRWA 1FYTE 4N9GA 5HVHC 4TTDD 1N0LA 4UOJA 2D03L 4TVPL 1U8HA 4TTDC 4Z95H 1QBLH 4ZUTA 3N9GH 3LKSB 1K8IB 3TO2A 2VMFA 3LDBC 4R4BB 4MA1C 1P84J 4X7DC 2E7LC 3UPRB 2LU4A 4ONGH 2DYPA 4FG6D 4GQ9H 5CJ5A 1SVCP 3TYGL 4XPBH 4HC1H 3R8QA 4FG6C 1MWAB 2DQDH 1JV5A 2Y1VA 4M48H 4NKQB 3TBVB 1E4XH 5DJZB 1BFVH 4YPJA 3BUYA 5A16B 5BJTB 1ZVSA 3O4OB 3INUL 4JFZL 4OIBA 3GBNL 4P99A 3DOSA 4XBGA 1V3JA 5DFVD 4KUCD 4PRBB 3MRDA 1YEIL 4WO4A 4FFYH 4NZRH 4PLNC 1IC1A 5DFVC 1MNUL 2XWJA 3NZ8B 1CXLA 4U3CA 2BCKB 5J0BA 2Y07H 2NY6D 1FZKB 1FNGB 5IGXH 5KN5A 4R2GD 2NY6C 3JV5A 4U31A 2F54A 5HYQA 4M1DL 2BDNH 3W82A 2FX7L 4WTZG 1JTTA 2FJGA 3U4AA 4R2GC 5EPMA 3FFDB 1UYWL 1T4KB 2H32A 4ZUVB 5KSVB 3QUKB 1MFBH 1EVTC 4TPRL 3V5DA 2Z9TA 3NCBB 1ONQB 5K9OA 1CQYA 1T1YA 1PSKL 3OHXB 4XC1H 1U8LA 4JFHD 4DW2L 1KPVB 2FO4B 5I73C 5DJ0B 5DHVB 2P5ED 2PXYB 3RX8A 4TSAH 1T0MA 4GKZA 5J1AA 2BSRB 3FQXB 3NOIA 5CAYB 1WCQA 5C0BA 2FL5B 4BQ9A 4O4YL 4LCYB 3CCHB 1J8HD 1P5VA 1SM3H 4N0YH 4CJ1A 3EJYD 4LSTH 3DVGB 3EJYC 3H9YA 3UYPA 1RZ7L 4RAUA 3FT2B 2DJUA 3NGBC 3F7RA 1M7XA 2APFA 3NABH 5L9DL 4I5BB 5D70L 3WFCL 4W70A 1BX2B 1C1EL 2XXMB 4RIRB 1RIUH 2VZ3A 2Z31B 3N1MC 3MV8B 3QULA 2P5WB 4JFDB 3K8KA 3AREA 5IB1B 4YX2L 2CLVB 4OJFL 3N1FC 2D9CA 1NANI 2XA8L 3O45A 1LGVA 2VXUH 4HUUA 1BQHG 5KSBB 1FZJB 5HHVH 2FIKA 2C4FT 2BVYA 5DD6A 4UAOC 4KPHH 2YPKA 3TBYA 4NZDA 1OGAB 2KZ1B 4IDLA 3OKEA 5A40E 5T3ZD 5DHYA 1C5DB 5IB3A 1OTSD 3B9KD 3MNWA 4BFGA 5FB8B 1F11A 4LVOC 4ISVA 1OTSC 4OQTL 1LDPH 2Y9RT 3B9KC 1VSCA 1LP9E 3CLEH 1A5FL 1SBSL 5HYJB 2EE3A 3IJSB 5DQ9A 4AEHL 2G60H 2L0DA 5DUBA 4WW1B 1CXEA 4G9FE 3RGVB 1A6AB 1JNNL 4LLUA 1IGIH 1DN0B 1JHTB 3MRCB 2FZ3A 1GCFA 1Q9WA 1KTRL 4WFGE 4HG4J 4NKMB 3RVTD 1AY1L 4NKIL 4YGVA 4Q2ZB 1SJHB 1UEYA 4C55A 3T0VA 3RVTC 3EHBD 1IZJA 4L8CA 3NFNB 4M62L 3EHBC 1HHIB 3SDCA 4IDJH 2YA0A 3W0WE 5EU6B 4OD1H 1UB5B 4FQLH 4TOYL 3RVUD 5GS1B 2ICWA 5BV7L 3RVUC 1M4KA 4HIEB 4G8IA 4ZDHB 3WS3A 4XBPB 3CX2A 4ONOA 4MZ3A 4Y4KA 2A38A 1OARL 4GUPB 2AP2A 1YEGL 4X8JB 2GK0B 3LSOB 2O93L 4HFUH 3DUSB 4K23L 3V5HA 2ARJB 1B0GA 4KY1L 4CMMB 1FL6B 2CXGA 2XACC 1AHWB 5TQ2L 1FFNB 5DD1L 5EC1B 4JJ5B 4DVRH 4E0RB 1IM9D 4K7PL 4LPYA 3E1F1 4K94H 1OWWA 3BP7B 4W68A 3QUXD 4FRWA 3QUXC 1MLCB 2QTEA 2NY4D 1BLNA 2PW2B 4PJBF 1CZ8L 5JR1H 1HH9A 2PW1A 3O8XB 2NY4C 5SWSA 4U1GB 1FE8H 5ICZB 5D2LB 3WIIH 1A6PA 4J3TA 3SQBA 1WZKA 3C5JB 2VQ1B 4P2QD 3CFBA 3BP5A 4NO0B 1FL3A 1JPGA 3ETBF 2JELL 4GMTH 1NCAH 2OL3H 5D4QA 3IXAB 3QB7C 2DLTA 2V17L 1ZLVK 3ULVD 5HXMA 3F7YA 2GFBA 4NDMB 1W0WB 4GXUN 4TNWK 5E2TH 2VAJA 3ULVC 1N64L 3FB6B 3GSNL 4M5ZH 5DRXA 2ENYA 5C6TH 2ZSVB 2NTFB 3I50H 4MA7L 4ZFZB 4A2LA 5DMJB 4PJIF 1E28A 4I18B 2DICA 4YHOL 4F37F 3IT8D 3LN5B 3G5XA 2YA2A 3GMNB 3P4NA 3S98A 4Y2DA 1CD1B 1A7RH 2ORBH 1OPGL 1C08A 3B9DA 5F1IA 1MCIA 3SCMA 3LQMA 4PTTA 5E5RB 4APQD 1K8DB 3HNSL 4GFTB 1R5WA 1G6RL 5EZLA 3V6OA 1FG9C 1UZ6E 4APQC 4F57L 4BH7A 4ONHA 2DMBA 4PRNA 3VWJB 3O11A 3JUZA 3UO1H 1CD8A 4PP1D 4ZQKA 4GAGH 5GZOD 1EAPB 4OLEA 5DVMA 2FIRT 1GZPB 4PP1C 1AXTH 1NBZB 5GZOC 2BOBB 4M43L 5HGAA 2B7DT 4Z7VE 3BHBB 4NZJA 3LZFH 4D0DB 1HEZA 4R0LC 5I1JL 2WINA 3DO3A 1K4CA 4MD0A 1MHEB 4JQIH 3MRKB 1DQQB 1PG7L 5FXCH 3EOBB 3VXSE 5D1ZB 4ZD3H 3FB5A 3TCXA 3GSOA 1FN4B 2OTPA 4G43B 4WV1A 4ELMB 1S7WB 4HIXL 3U2SB 5GS0D 5DQJB 4RAVB 1ZHKB 2NY1D 1QSEE 2RFXA 2VNCA 4L9DA 1IL1B 1JGLL 2IGFH 5GS0C 4R8WH 2NY1C 1IGCL 3V6ZA 2ZSWB 4M9OA 4Z7WA 5IEKA 1I7ZB 1EXUA 4XCYA 4XNQA 1Q72H 1ACYH 4PGDB 2NY5H 5DLML 4AZ8A 1E27A 2GT9A 4PJ8A 3N85H 1FIGH 1V3KA 5F1NA 4F3FA 2YPVL 4HV8A 4Y1AB 3WMSA 5GGQL 3RWHA 1S7RB 1PKQA 1S3KH 3I6LE 2R56L 5JOPD 5EOCJ 3HA0A 3MCLL 5E7FA 3S3JA 2MCG1 4NPYA 3BO8B 1RZKC 2D03H 4TVPH 4X7EC 4FXGB 4MCZA 4P2OB 1KLUB 3I3EA 4PG2C 3TYGH 3U6RB 1IZKA 1WBXA 3DV4B 3IFPB 4JQVC 3LD8B 3D39A 4UNTA 4UQ2B 5EIQA 4NRYA 3OZ9L 1CXHA 5D8JL 2X4SA 4WTXA 1R0AH 5FA4A 2JJWA 4YHKL 4QRTB 4CU6A 4R4ND 2QSQA 3INUH 4JFZH 4P0DA 3TBWB 2HH0L 1WWWX 2E8YA 4R4NC 1T21B 1EFXD 4URTB 1YEIH 3DLQR 3B8SA 1MNUH 3IKKA 2R4SL 1I7UA 3LAFA 5IBUB 3WJLC 1NMAL 4MA3A 3UYRL 1C16B 1RUKL 3OXRA 4HUXB 3OKKA 5IOPB 4TVPE 5T1MB 1DBJL 1W8NA 2GCYA 4BSJA 3BW9B 5DEGB 4M1DH 3VMOA 2FX7H 1QFOA 2FATL 3S37L 5C0JB 4C56D 1Y6MR 1UYWH 1A1NA 4PGBA 4LMQI 4G8EA 5F96L 5E9DA 3W9EB 1I8KA 4OSUH 2NX5E 4TPRH 4WU5A 5D7LA 3MJ9H 1PSKH 3ZE1E 3V7AG 3JWNC 4DW2H 2IPKA 4Y19A 2W0FB 4NKOB 3C5SB 4MJID 4O58H 4XNYL 3U36A 3WL9A 4U6XA 1NAKL 1TPXC 4NM4H 3SGKA 5J56B 3B4NA 5FUOH 3IJHB 4M8QB 2GEEA 3G5YB 4HZLB 5LAXB 2IQAA 4O4YH 1S78D 3VXUE 1NGYA 1NC4A 3VJ6B 4P2RA 5JW4Q 5C08D 1S78C 3OGCB 1X7QB 3QUZB 5F8RC 3TFKD 3D85B 2ED9A 5HD8D 4KKNA 3EO0B 3FO1A 1CDJA 4PB9L 2YEZA 3MJ7A 4QRPA 1OP3H 3TFKC 3H9SA 5HD8C 5DI8B 2RAMA 4QHMA 1HIML 5AWNL 1KJ2A 5L9DH 1OB1A 4J8RA 1DLHB 4KI5E 1ZGLA 5CMAA 5D70H 3WFCH 1C1EH 2RJMA 1CVRA 4ZAKA 1JYWA 4ZO9A 4JM2B 5TDPA 5D9SA 3RPKA 4LKXB 3D25B 1U0QA 4Z7QF 5J06A 5FF6A 2XA8H 3GBLA 1BQLL 3X12A 2WSKA 1JF6A 2PO6D 4QTHA 1QQDB 2CRIA 4D9QD 2E9BA 2WBJB 4KJYA 3VFOB 1N2RB 4BK5A 2PO6C 4WTZA 2R1XB 4AK1A 1Q9OB 1FL5A 3WEXB 4OQTH 4EUPG 2A74A 3FQNB 4Y5XB 2JE8A 1A5FH 2LTQB 1SBSH 3BJLA 4OLXL 4NN5B 1LNUB 3G08B 4AEHH 2Z35A 5ICYA 5F72S 1YUHB 4FABL 1C8PA 4EKXA 3U0TB 4HMEA 1G0YR 5JOFB 1BQUA 4K3HA 3LOWA 4ODXB 4Q6IB 2VXSL 1U8QA 4GG8A 3WO3B 1G6VK 1G9NL 4LCUA 4XP5L 2G5BB 1MCWM 4L4TB 4K7FA 3VGAB 4XCEB 2GAZA 4NJ9L 4FQJL 1S9YA 4BZ1L 5D7KE 3ARDD 1T83C 4H1LH 2QQKL 5A43C 1Y6NR 3ARDC 3DXAE 5TH2B 3T0ED 2HLFD 2FX8L 4XNMB 4ODTH 1FYTD 4TOYH 3WKML 2WBWB 3T0EC 2HLFC 1QSVA 1S7SB 4P4KA 3S96B 5BV7H 3QIWD 1CDHA 3I85A 4YO0B 4DAGL 4KMTH 2E3VA 3WHE1 5FHAL 3MRNB 5AD0A 1DQJA 1AGEA 3QIWC 3KJ4B 4XP4L 1OARH 3BEVB 3U9PL 1YEGH 2AQ3A 2OXGA 4QT5B 4LGSB 1BQHA 3R06B 2F53B 2X40A 3ILPA 2D2OA 2WIMA 4JFYA 2VLME 4KY1H 2VH5L 5K33A 3CUPA 2AQ2A 5TQ2H 4WI5A 5DD1H 1FVEA 4XGZA 4M6MH 3IDNB 4K7PH 3SJVB 3GMMB 2G75A 4MNGA 1P7QA 3RNKA 4PG9A 4DK6A 3V95A 1H3GA 1Q9KB 2X9YA 5MEQA