4WI8A

Structural mapping of the human igg1 binding site for fcrn: hu3s193 fc mutation y436a
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHATQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional mapping of human IgG1 binding site for FcRn in vivo using human FcRn transgenic mice
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 34
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wi8A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wi8A01
2V2WA 3WBDA 1X5XA 3SO3B 4FQQB 2IC2A 2NY3C 2DB8A 4I4WB 2V5MA 1C08A 5F97E 5I71C 2EH7L 1IC1A 3SKMA 3N9GH 4FTVD 5I1AA 4BH8B 3CUPA 5FCUH 4JKWA 1HI6A 4O02H 3RWEA 4NKIL 1NMBH 4BQCA 4IJ3C 1XT5A 5KAQG 5IB5A 3U9PL 3EYUL 3V0WL 1R3IL 3S7GA 3CFDA 4QCIB 4PJEA 4HS6B 3KDMB 3O6ML 5A16B 1KPUA 4KKLC 1Q94A 4X6DA 1I9IH 4PJIF 1IL1A 2HLAA 5DSCB 1VHPA 3BIKA 4XXCA 1KCSH 2ZOKA 3CDGB 4XP5H 2EE6A 1HSBB 4OF3A 4I18A 1IGYA 1Y6MR 5F1KC 3V6OC 4CDGC 5B38G 3OJ2C 5HPOA 2ITDB 4NO5B 4NCC1 5C08A 4PLKD 1TZHA 4RWYH 5D1QB 1AGCB 4FS0A 1FORH 2O5YH 3MCKB 2AJVH 3NIDE 1G6RB 1NPUA 2LTQB 4MB5A 2FR4B 4KY1H 5D71L 1T6WA 5SX4H 1FGVH 3IJYA 1AXTL 3O3BB 4ODSH 1ZT4B 4X83A 2AEQH 2BHYA 2XA3A 1FVDB 1IZKA 1A14L 1ACYL 2NTSP 4JFXA 2VSDA 3QXDB 3HZVA 4ERSL 4DN4H 5HHNB 1TVDA 5KSBB 4PJCA 3IDJB 4XX1E 2XTLA 1I9JL 3DGGA 5D1QD 1P69B 1MHPH 4I3SL 2C4FU 1ACZA 1OAYH 3KXFD 3QQ4B 4X8JB 1CF8H 2GT9A 4P2OB 1KCRL 3C6LD 3OMZA 4J6RL 4HHAA 1N59B 4M1GL 2ZUQB 4Y2DB 3V6FB 2Z31B 2A6DA 3TGXA 4CBPA 4RMVA 5DLML 3TA3B 3DXAA 3LKNA 1U2CA 3O8XD 3ARGB 1CD0A 1AR1D 3A67L 1ONQB 4HC1L 3PNWB 5IEKB 3BYYA 4JFZH 2ED9A 5C0DA 4DWHA 2WBJB 1SJEA 4RX4A 2Z91B 3MV9E 3MV9A 3JWNC 1CK0L 2OK0L 3MMEA 1JYXA 4LSSL 4NZDA 1DSFL 2EDKA 5KSAC 4HMEA 2E6JA 1AGBB 3OPZL 4U4BA 7FABL 3MFFA 1CFQA 5BVPH 1GZQA 1FZJA 1RURH 4NP4H 4OGXH 1FG2B 4UTAL 5HDBF 2YD1A 3W2DH 2VAAA 5C0BD 1RUQL 4OSUL 5E4EB 3WL9B 4WW2A 1JYVA 4PJ8A 1E4XI 3LN5A 2V6HA 5DGRA 1CDUA 1I9EA 3OJDA 5K9QI 5IK3A 1OAYL 3JWOC 1RUPH 1YEIL 2APVA 5JW5A 4L9LB 2Q86A 3VXRA 1Y6NR 3QPXL 3MLSH 1U3HD 4NQCA 3PQYA 3RZCC 3UMTA 3LRHA 2UUDK 4Z7WF 5B21A 4MNQB 4Z7UF 4XP9H 4WRLA 4O02L 1KEMH 2DLFL 2ZUQC 3RRQA 3BMWA 5CGTA 1OW0C 4UT9L 3GKWH 1MHEA 3RDTB 3MLTB 5BOPA 1MRFL 3SDCB 3SJVE 5KVMC 1T4KA 4PJBB 4PS4H 5GRVK 4QRSA 1Q9WB 3M07A 5GIRA 3HPLA 4N0YH 2VKXA 1LILA 5DK0B 1KN4L 4UNVA 1IC5H 4U2ZA 3C5ZD 3AFLA 3O4LE 2WWMD 4P5TA 1BJ8A 3OKOB 3ULVC 4L8CA 1RFDL 4JREC 1VFOA 4JN1H 2PYED 2R8SH 3FQWA 2QSCL 3T0ED 2PTUA 1WBXA 1J8HA 4JHZA 4Z77A 4K8RD 2OQJA 3HG1E 3V7AE 4IDJL 1MLBB 1UC6A 1I4FA 4OAWB 3RGHA 4MXVE 4TSCH 2XY1A 5EUOA 3ULVL 3FQXB 1BX2B 2FX8H 3HC3H 2EO1A 3UPAA 2H9GB 4P9HH 1H3PL 1KTRL 1UKSA 4FZ8L 1UKQA 1ZSDA 1N6QH 4KZEH 4X8JA 1ZGLM 4L8SB 4AJ0A 5JPMB 5C0BE 3RIFF 4N90D 1EJOL 1FRGL 3FQTB 1MHCA 1A6ZB 5C0GB 3O9WA 4QHUA 4ZUSA 3AS3A 2GJ6E 4Y4HD 2ILLA 4KGJA 4YGVB 5JXAL 4XC1L 4LEOA 3REWA 3DGCR 2NW3A 3QEGL 3GJFH 3GNMH 3BKMH 4PJ7E 1OTTD 4H25B 3WIHL 4B53A 5GZOC 4Q97A 3GIZH 4IBLT 4KJYB 1IM3A 4Q9CA 1J0ZA 2FBJL 4H5SA 1JTTA 4PJDF 5F7UA 5C2UB 3V6FA 1MJ7L 1ONQA 3JWOL 4NNXB 1A7QL 3HB3D 4E41A 1OGAE 5IEHA 4DK6A 5F9OH 5E00B 3TO4B 1J0YA 3QXVA 4PGCB 4OFPA 4O2CA 2BVEA 4PRHB 1F4XH 3BO8B 2NY3B 4P46D 1CL7L 4ZS6D 3F58H 1ZEAL 2K1MA 3WFZA 4UI2A 3MX0A 1QD0A 4KGLA 5FGBA 1FZJB 5DYOB 3U0TA 3OR7A 4RFNC 2DM4A 1PZ5B 5EU4A 4ZOAA 1QA9A 1AGBA 4KROD 1U8JB 1I1FB 3TF7C 4PJCB 3SQBA 4YEFA 3DXAE 2HG5A 3RUGB 2OZ4L 3FZUC 3ULVD 4WI3A 3ZYOA 1T7VA 4PRBA 2AV1A 4Y8AA 3QEHB 4YXLH 5LJYH 5FHBL 1F11A 4HIJB 4P99A 2Z8RA 2BSRB 5DHXB 5J1AB 1B88A 2HTKC 5D7IF 4MJIA 3QHFL 3C2SA 2ARJB 2PW1B 3CC5A 1B4JL 3NA9H 4XNYL 3I84A 2D03H 2CIIB 4J7RA 3U36B 1BAFL 1KTDA 3T0VA 1HQ4A 4XB7A 1R5WA 3D0VA 4JZNB 2YXMA 5CSZA 3ZKMC 5I1KL 3MRPB 5D70H 1T1WA 1HILA 1AIFA 1QFWL 3DRQB 4JFOB 1KXQE 3TBVB 3K2UH 1BOGA 2R15A 3C08L 4GBXC 5DJXA 2C9AA 4YBLC 1R5VB 3QQ9D 1A9EB 1UCBL 2VJXA 1Q9LA 1DQMH 4HPOH 4WTZA 5ICYB 1PBYA 4NZRH 4FXGA 3A6OA 3MOAH 4HXBH 2P5WB 4KROC 1FAIH 1DBKL 1ZV5A 3MROB 1CE6B 1I7RA 3WJLC 3SKUD 4QXUL 5T5FL 5EIVA 2IQ9H 4KI5F 1Z5LA 2IAND 4HCRL 4YPGA 4S1DC 2V5YA 3BWAA 5D7LA 1Y18A 1KT2B 5CMAA 4PJ5D 1JGLH 3OKKB 4XCFH 2MMXA 2PTTA 3NN8A 1L7IL 4PB9L 4WFGD 3NCBB 3FN0H 2X70B 3MYZA 4NPYA 4PP2B 2DQIH 3JUYA 4MNHA 4WGVB 3U30B 4I0CC 1E4WH 1X5FA 5D4QA 5DMKB 1EUTA 1EFXD 5DDHA 1L0QA 3SGEI 1DBJH 4JHWH 2WUBL 4JFFE 4QF1A 3E0GA 4HK0B 3CSBA 3LN4A 4Z7VB 3LKQB 3BRDA 1TNNA 1HK6A 5CEZE 2WBWB 4AMKH 4LP4A 5B39A 1HHIB 5B39G 5C0EB 1YZZA 1I8IB 2X10A 1F11B 2H26B 4HIJA 3ZHDA 1EUUA 3V5HA 1N6VA 4LDOB 3R8BB 2AJYH 4K3JH 1XGUB 3BPNB 1IM9D 1NCWH 3ETBF 1UVQB 2YUXA 3AB0B 4R7NB 1S3KH 1G7IB 4FN0A 5FDWB 3O41A 2DQCL 4F7PA 3P30H 3JXAA 1UT9A 5FA4B 5DRXB 4MZ2A 2RFXA 2CD0A 4P5KA 5BQ7A 4PBWD 1C5DB 2I5YH 3Q1SH 2QADB 3G6JB 2EEDA 3NCMA 4PGCA 3H7LA 4N5EC 1FZMA 5EBMA 3E2HC 1T22A 2DM3A 4X80L 1VPOL 5E8EA 3P77A 1JGEB 1DL7L 1MPAH 1PFCA 1C16A 1KV3A 1MFDH 5CJBA 5F3BB 2MHAB 1MJJB 2EYRB 4P9MH 5MENA 5MENE 1RIVL 2P24A 1T1YA 3UYRL 1VACA 4X5WA 4ODUA 3KYAA 4NQTA 1NUNB 4ODVL 4J3SA 1C12A 4UUJB 1UH3A 4WCYL 3NZ8A 2VDML 4HKJB 4XP6H 2VXSH 3QUYD 4X4ZA 3RWGA 5JMOC 1RJYA 2WM0A 3NPSB 3MBEC 4D0BB 3W9DB 1T2XA 2QKIB 3TBWA 2K9UA 4WU5B 3BW9B 5GGQL 3I3EA 5ANME 3RGVA 3E3QC 4HK3N 3L3OB 2FJFB 1HXMA 1INEL 2Z4QA 5HGHA 4D9LL 5DUMH 2AKRA 3PXJA 5ALBH 2ORBL 3EYVB 2A6JA 3B2UD 4KRNA 5I8OL 5DO2D 3HMXH 4NRZA 2GAZA 1QHPA 5I1EH 4XWOD 2O93L 2HFGL 4KZDL 2JCCE 1CXHA 1XF2B 5BVJB 2Q6WB 4RAUB 3QUXD 2DQHL 2F74B 5F7WC 1T1XA 4G6JL 3U0PA 3QQ9C 3QDME 4PRAB 5EPMA 1JJUA 1K3IA 5CEYA 5L2KA 1UH4A 4OZIB 2ZG2A 1QSFD 4NT6A 5E5UB 3JTSB 1WAAA 4PPTA 3CMGA 5DJ8A 2C3VA 1ED3B 1D5BA 3BPLC 4PJFF 3ARPA 4OKDA 2R1WB 3WNLA 2NXZC 2Q76A 2BOCB 5E1HB 1MWAH 1INDL 5F89A 3MLRH 4PJHA 3SQOL 5IHZB 3SDCA 5GGTL 4WTWA 4YBLB 5D6DC 2V5SA 5DFWH 3RGVC 5F96L 4W4OA 4HS8L 2VLKD 4V1DD 2ATPA 2PO6B 3S34H 3DVFA 3UYPA 3PQYB 3BP4A 2CIKA 3ES6A 5AWNL 5L2KE 3ROOB 2DLIA 2WAHA 3DYOA 4HHAB 4G9FE 4M5ZH 2VABB 4UQ3B 2JCCB 4EUPG 5C0RH 3A6CH 2GKIA 3WFDL 1JI2A 1KJ2B 1IQDB 4UV7H 5JDSA 3LKOA 1JGUL 2ZOLB 1P84J 1Q8MA 2CXGA 4M4RA 1EERB 3NBNA 2XN9E 4FFVD 4NZUH 5EWIL 1ITBB 2I60H 3ARBD 4FQXA 1M7DA 4PJ5A 5C6PB 1XF1A 4LQFH 1QVOA 1QG3A 1FC2D 1A4KB 1DVFA 1SMAA 1X5IA 3QUZA 1VEMA 4LKCB 2VZUA 3ZSSA 2ICWB 1A0QH 4OLWH 1MJJA 5DEZA 2CJUH 2DTSA 2W07A 4M48L 5B4MC 1UM5H 1DFBL 2FR4A 5GGRA 1MCWW 1CQKA 4RWHA 4OB5H 4S1RH 1CGYA 4KJPC 5DMYA 3MJ8A 1NCNA 3QXAA 1T21A 3RP1A 1ES0B 2PTTB 2YD7A 1O7SA 2IAMB 5D96B 4Q58C 1KIRB 4XI5C 1UWXH 3QDMD 2VZ1A 2UVEA 3QUXC 4HV8A 3MJ6A 3TZVB 1UKTA 3AY4C 4EI5C 4XPBL 4WV1A 5F1OB 3S98A 3VG9B 5CUSH 4LGSB 2XY2A 2DQFB 3LZFL 4XMPL 3QH3A 2OZ4A 5TDOA 3VXNA 1VFAB 5JW3L 4JHBA 5KS9A 2YD5A 4LSTL 5HHMD 1KC5L 2E7MA 2CXKA 4QHLB 3RWCB 3I9GH 4RFEB 5I1GL 1MOEA 2Q8BH 3QEQE 5FFLA 5KVFL 3MV01 4E9LA 1QNZL 5IBLC 4R26H 5KSBF 4PJDB 1LD9A 5DK3A 1U91B 5J0BA 5FYKL 4PG9A 2AW2A 1FN4B 3IJHA 3X13B 1BJMA 1T5WB 1W72H 3L5JA 3L95A 3BKCH 1V7NH 4MNHB 2GFBA 3HE6A 3S88L 3EDFA 4GMTH 1JPSH 4JE4B 3PWNB 5BJTB 3JWDH 2RGSA 4KK6D 4ZNEE 4WEBH 4H26A 1TXKA 2VISA 4FQJH 2F19L 1IGIL 2E3VA 4O2EB 1F2QA 2ADGB 3ZDYF 4UOJA 1WC7B 3BZ4B 1HYRC 25C8H 1U6AL 2DAVA 3PWLA 2Q7NA 1Q94B 4X6DB 2DQDL 3GHEH 5C6TH 5I76A 3BAEL 5T33L 3NACH 4LF3B 1OP3H 2AGJH 4M7KL 3H9ZA 1RUKH 3QT2A 1ZHBA 1II4E 3EFFA 3KHOA 4FTVB 1INEH 1S8DA 4U33A 4HIXH 3G5YA 4TUJA 5IM7B 3P9MA 4LP5A 4Y89A 3VD9A 3TJEL 5J3HC 5E8PB 4BQ9A 1IBGH 4BZ2L 2GY7B 3GSNH 1ZKAA 1MJ8H 4K9EC 3RDTC 1G9NC 2KDGA 3WV0A 4E42B 2JE8A 3QXWA 2N56A 1F8TH 3H0TA 1A3LH 4JPIA 2VDMH 4JVWA 5DTFA 1LEGA 3P0VH 3L3KA 4P59L 5DEGB 3TNNB 3SBWA 4QGYA 1ED3A 5FOJA 4X6DF 4PJBF 3QWOB 3LHPL 3WE6B 4MAYB 3BUTA 1UXWA 3N1GC 1WTLA 3QRGH 3DX8A 3I2CH 3GBML 2HJKA 1OSPH 1A64A 2E7LC 3HC4L 3ORJA 4HWNA 2VITA 1OCWL 2Q6WA 4OZIA 4CU8A 3O8XC 4RBPK 1ZGLA 4LSUL 3C60C 1LGVA 2NY2B 2VRAA 4PJIE 3MRDB 1TZGL 3CSGA 3VD5A 4G5ZL 1J9CT 1CGSH 1RMFL 1JZ4A 3WNPA 3RHWK 4M7LL 3RNQA 1BX2A 3Q5TA 5D5MB 4NNPL 3REVA 3WNOA 2B20A 3WLWD 3RWFB 4AY0A 1XIWC 5C0IB 1XCTB 2JCCA 1WITA 4HKZA 3MJ8B 1A1MB 4NYLB 1MY7A 2HJFA 3F6IA 4NJAL 3UTQA 2JLLA 3GJFB 4HAFA 2X9XA 4NCC2 4TTGA 3CXDH 2Y4SA 4GAYA 2EDEA 3EUUA 4XHQA 3GSXA 3AMLA 3ISWA 2P7TA 3U48A 5IOPB 5L0QB 1NFIB 4J3UA 3VH8A 3BIAX 4WU5A 1NCBL 2LVEA 2O5XL 5JOEA 1BZ7A 3DMMA 4Z0BH 5D8JH 3QI9D 5KAQF 1NDMA 4OZHE 1CD1B 4YK4B 5T5NF 1DBJL 3WDHA 3WN5C 3S37H 4PB9H 2D31A 2A1WH 3EAKA 1NCDL 3P11L 1TENA 3THML 4U1NA 2CDGA 1LK3H 1RVFH 2DBLH 3CLEL 3VGGA 2HT3D 3O4LD 4NSKA 3X11B 3VWJC 1EPFA 3BPCB 4PJ9D 1JZ7A 2HRPL 2ATPB 2AJXH 2M8XA 2F5AH 4FXLA 3HPJB 5E2TH 4HPYL 4QXWA 1YEHH 5C0FA 3EO9H 3MA9H 3SJVD 2E8YA 5C09D 4PGBB 5F89B 4LSPH 1CE1H 4JKPL 2AP2A 5DQJA 2I27N 3V0AC 5BMFH 3QJFB 1JE6A 3FFCD 1OAXH 3V4VL 4C59B 3L3HB 4D0DA 3DMMC 3TNMB 1W0YT 3GMNB 2RCSL 4R96B 4R9HA 4KPHL 5ELIA 1W8OA 4JKPH 4L29A 1CCZA 1FCCA 1MNUL 1TCMA 4R4FL 5IQ7L 1NC2B 4N5UA 4OQTH 5D7KE 1CICD 4PREA 1CD1A 5DJAB 5IWLC 3QQ3A 4H0GA 5CJQH 3JSSA 3V5HB 4DW2H 5GGVL 2IF7A 3PWVB 5AG9A 1KEGH 3MLTA 2IANE 3NA4A 3NABH 4IJ3B 1MIML 1YMMD 4F2MA 3C8KB 1IEAB 4GKNB 1MAML 3UAJD 1NBYA 3HUJF 3MBXL 4R97B 3WKML 3NN8B 4LKXA 3C5ZC 1I1AA 2AQ3A 5L9DL 3O3AA 4JN2B 1J05B 4PYGA 1QKZH 1MQ8A 3R8QA 5JLZA 5IB4B 4BKLB 2UZXB 2AK4D 4PJFB 5IROC 4F7PB 1QSFA 2ADJB 1A6AA 4P23D 3CX2A 2E7LA 4RMQA 1RK1A 3OAYK 2X4PA 4BSJA 4PBXA 1JPTH 2PYEB 5FUOH 1R3LA 4Z0BL 2HLFC 4LCUA 1FL3B 1GGYA 2A6IB 1CVSC 5C08D 1QBLH 1OAKL 1FGNL 1FFOA 2NXYD 3QEUA 1HZHL 3P0YL 1C7TA 1YEFH 3KYMA 1I3GH 1UWXK 4MJ6A 3TCLB 3BH9A 4JPWL 5CSZB 4PB0H 2FBJH 1OTSD 5DJXB 3ZDXE 4K3HA 4JDTH 1S7VA 2R9HC 2APFA 4HS3B 5JIPA 4HKXB 1F3JB 4GXVH 2BY0A 1A3RH 1V3LA 3QEGH 2DD8L 5HPMA 3VGHA 1BOYA 5DK2A 4H1LH 3ARYA 4MAUL 4R4BA 2P8PA 2O26U 5E6IB 1F4YH 1HXYA 4JM2A 5FM4A 5KSUA 1U8QB 5B8CA 1H5BC 1N0LA 1IAII 3DTXB 5J4MA 3BN9D 3CFJA 1RHHB 5DJYB 4KZEL 2OL3H 4Y1AE 1RIUL 2W0KA 5JZ7C 1Q9LB 1JL8A 2IBZX 3B2VH 1R3LB 2VWEC 4WGWB 5D5MF 4AIZB 4LLDA 4X98B 5E70A 1PZ5A 1KELH 2VC2H 3ARRA 2VDOL 2BSSB 1TJIH 4YFLF 1I1AC 2QSCH 5D8JL 1F8TL 1G84A 1P2CB 3TA3C 5T1MA 2DKMA 4J4PA 1MJ8L 3B9VA 4G6MH 1IAOA 5T3XD 4P23C 4GW4A 4UU9A 5ANMA 4PP2A 2B1HH 3WUZA 3BH8B 2ARJA 2PW1A 3G04B 2VMFA 2EYSA 1QEWB 1P7KA 3DRTA 1PZUB 4NNXA 1YC8A 3LMJL 1WAAE 3U6RA 2APBA 4OZ4A 4XXDA 2X1WL 2XPGA 1RJLA 4LFHG 3GM0A 1BVKA 4B41A 4GXUN 2ZOKB 2A9ML 2E5EA 2QADD 4ODHH 4YHIA 4DKEL 4NUGH 3PGCA 3IS1X 3QR2A 4QEGA 4G7YH 2FZ3A 4OF0A 4D9QE 2FB4L 3B9KB 5D72H 5IW1B 2JELH 4U6XA 4ZFFA 3WHXA 4JQXC 4DVRL 4JGMA 5HYFA 5IV2B 5DVKA 3MLSL 1FAKT 3ARWA 3P4OB 1U8JA 2YD9A 2JJTC 5J89A 4BH7B 1AIFB 3Q3GA 2VXQH 3BKCL 4K2UH 4PG2A 4NN7C 2LAAA 1IC4L 3LEYH 5AAMA 3QWRD 5DFTA 4Z77B 4XPHL 5C0CA 4JANA 5C0CE 2H41A 4FFZH 2L4OA 1X6NA 5E9DD 3SGJC 5DWUL 4O58L 4PGDA 5FK9B 4AK1A 5HJ3B 8FABA 3OAUL 3I9GL 4JZOB 4IS6A 1J88A 1DUYA 1TCRB 2D3VA 4WFED 4WNQB 5INCB 1O0VA 1YY9D 2IANA 1BBJB 4MX7B 2APXA 4K7PL 3LD8C 1ZHLA 1U8NB 5DJAA 2Q76B 1HKLL 1BZ9A 2A83B 4NOFA 4NWTL 3KYMB 1XGRA 1F6AB 1L7TH 5F72S 2ZG3A 3WCYA 1XGTB 3DIFB 3UJTH 2IG2H 2Y5TA 1LO4H 4TOYH 5EOCJ 3Q6GL 4A6YH 1WJ3A 1FNSH 1I7UB 2ZJSL 2PETA 3HE7D 5IHBA 3UTPD 4ZPTA 4H1LB 4Z7OE 3TZVC 4XP1H 4NC1C 4CU7A 1J1PH 4AH2A 4QNPF 3FO9B 1RZ7L 1F02I 2W92A 1MLBA 2EIZB 4F7MA 1LP9F 5CBEA 1QP1A 4WY7L 2L7UA 4OZFH 2AKRB 4UAOC 4U6YA 4L9LA 3VXRB 4TRPH 2BJML 3KPRA 5FO8A 4XVUC 3ARDB 5KOMC 5EORH 3I6LE 3HC0B 1SQ2N 1W72L 4FRWA 1NGYB 5ISZA 4NQED 5J57B 4GW1B 5F7EH 2BP3A 2VH5L 3FT2B 1VGEH 4YHOH 4QHNB 3LS4H 5J7CC 3ZDXF 4RMSA 4UV7L 5ACZA 2FJGA 2BC4B 4PYHA 5HHXL 1AHWA 2R1WA 3CXHK 4TVPL 1CDIA 1FORL 4QTHA 4DTGH 1P4BL 4PD4J 4L4VD 3NMEA 3MRGA 3V95A 1VFBA 4LVOB 1NFIA 2B1AH 5HJ3A 8FABB 2WBJA 4OLXL 4OQTA 2MQ0A 2X7LB 1J18A 4WV1C 4I5BA 2GSGA 4NQCB 2XTJE 3NAAL 4OTXL 2A6DB 4EXPX 4CMHC 2XTJB 1FVCB 3A6BL 4KVCL 3DUSA 3U4BL 2PO6C 3VRJB 2FGWH 3CFCH 3MUY1 3MACL 4QXGH 4LASL 2VLRD 1IAIH 5DHVA 4PJ8B 2CUMA 4IRJA 3LDBC 4O00A 3S37X 3HZYB 4U1NB 1DBML 3FO2A 1UYWH 5J3HD 3UTPE 4ZTPH 3SY0B 1C5BL 2P5EE 3TBTA 2FZ3B 4NQCD 3O9WD 2ZSVA 3L6FB 35C8L 2JK5B 1GSMA 4FQPA 3IYLW 1UXWB 1FFRA 4GOSA 1D5MB 4J3OC 3RWJB 2W91A 4IS6B 1F6AA 2A77L 1U8HA 1FDLH 4JO3H 4LCCC 3HS0B 2J8HA 4M8QA 2KQNA 2EYRA 4YDJA 4X6CF 4XXDB 4QWWD 1HHJB 4F37F 1F4AA 3GJEA 4TVPD 5E8NB 1KFAH 3ULVE 3ARGA 2EYSB 1CLYL 5I1IL 2DM2A 1BQUA 4PGDB 3HG1B 3IFNH 1U8OA 3E1F1 4GW4B 4UU9B 5EU3A 1H0DA 3DHJA 1LD9B 2EDHA 2A2QT 3QCUL 3S4SG 5IESL 1WF5A 4OCSH 5A16A 1GL4B 4OD1L 1Z3GL 3O0RL 1C5CL 4PY8J 3OAYH 2CGRL 3IB4A 2HT4C 4F15C 2WBJC 3SQOH 1N4XL 4FFWD 3CVHB 2XTJD 4LRNH 2VLJB 1EV2E 4PV8B 4JO1L 5FUZL 1X5JA 2OL3A 3RA7L 4NZTH 4ZAKA 5IW6A 3ESVF 4OD2B 5EBWB 3WO4B 4HZAA 1FZKA 4R90L 2AJUL 4E41E 3VWJB 3W5NA 1JF6A 1W0WB 1WFUA 2F54A 4W68A 1NGZB 2QQNL 4BUGA 2Y36L 3S4SB 3MCKA 5LXGH 5TF0A 2OR9L 4PJ7A 2GFBB 3IAQA 2VXTL 3QDGB 2FSEB 3H7BA 4F33A 5J6HA 2MNUA 3GHBH 4G8GD 5I8OH 3TPUB 1S3KL 2VDPH 3KPOB 4YBQC 1N59A 2HTLC 4G43B 2OYPA 3QUZB 3S5LA 2EYTB 2YRLA 4X5XB 4WO4C 4OFIA 4JPVH 1QSVA 3FONB 3NH7H 4MMZC 3WUWB 5I1JL 1P53A 1ZE3C 2PCPB 4AIZA 1JGVH 3KS0J 4ZUVB 3VXMA 4MCYB 5DT1H 5GJTH 4M1CD 5MI0B 2ZCHL 4LDLB 1KULA 5ABDE 2ZOLA 3B9KA 4TSBH 2XV6B 4PGJA 5DQ9A 4LSQL 1QZ1A 2NY4B 3KYKL 3UEZA 3MJ9H 1TPXC 1A9EA 4IRZH 1RZFL 4GAJL 1RQ5A 3KAAA 1WEJL 3QZWB 4JN2A 3LKSA 3P4MB 4PJBE 4NWUH 1FNLA 2XZAH 3BT2L 4LLUB 4JZJC 1QRNB 3HI5L 3KPRD 3O6FA 2BVTA 3LOWA 4G9FA 5IQ9B 3VD4A 1U3HB 2IQ9L 1PAMA 2K7PA 1ERNA 3OGOE 4QXUH 3HR5B 5JOFA 5ISZD 4GG8A 1D5IH 5C0AE 3ZKQD 4Z7OF 1RZJL 5SV3A 3UTTD 5E94A 5HYJB 1AKJD 1ZT7B 3V8CA 5HYJE 4MJIB 4DVBB 1A6VH 1FNGB 4X4XB 1M6OA 1GC1H 1U0QA 4TVSa 3DBXB 5CP7B 3GGWA 4OUUA 3DETC 4GT7A 1UXSA 3GMNA 1JGVL 1T2QL 4NFCA 5EFIA 3CNKA 3RUGA 2XNAA 5A40E 1EO8L 2BNUA 5IBUG 3MRBA 4HKBB 4PJAB 2FATL 5E9DE 4NN5B 2AJYL 3IDNA 3PL6B 2VR5A 3MV7D 3HPJA 4G80B 1QSFE 4A6YA 1JZ6A 2FWOA 4PJGB 3LSOA 5J56B 2OTWA 2AK1L 5H35B 3W0WA 3ZDYE 5K9OB 2YKLL 3MJ7B 2VXTH 1A1OA 1A6VL 1CG9A 4ZOEA 3WJJA 2Y72A 3NA9L 4X6BA 1YEJL 2BX5A 4JG1L 3BJ91 2NPLX 3IFOA 4UV4H 4GRWF 1TPXB 4WDIA 2NY1C 5IG7A 2H8PB 5ADPL 4KXZI 4MA3B 2YXFA 5FV2A 1FFPB 2OZ4H 3CFKB 3CK0H 1MCHA 4XCFL 1A02N 3AU1A 5E0QA 3O2WL 5D2NA 3CGTA 4P5TB 3RI5K 1SY6L 4K7FB 4RAHA 5HGDA 3X3GH 3ZT5A 1DUZB 5GRXG 2G75A 2YKLH 2VLME 4Z78A 3IDIA 1P5UA 1DN2A 1CGXA 4K3EL 1ZEAH 1NMCC 2YD8A 3FT3B 3QUYC 1FL3A 3H9SA 3F5WB 2F74A 3O45A 2ZCHH 3ULUF 3U4EA 1CLYH 3MC0A 2VDPL 1A1MA 2HFFA 2LU3A 5EH1A 1IAKA 5CD3A 2CO7B 4UTBL 3AGVA 4Q9QH 3OZ9H 1G6RL 1QLFB 1XCTA 1IGTB 5C3LD 3FHQA 1NCCH 4X7SH 4LOUD 5JW5B 4PJCE 2AQ2A 4LRIA 4I48B 4WFEE 2BDNL 1G7MB 2R4RH 3VXUD 5L8JB 4P46B 3OAZH 4FABH 4ODXB 3WHE1 3R1GL 5D5ME 3REVB 6FABL 3NZHH 4UDTA 1B4JH 3H9SE 1S5IH 1AXSA 4JO1H 2C3GA 3S35X 1FG2A 5HI4C 5F7FA 2QLVB 3EDEA 2YD4A 3V6OE 4GAJH 3BPOB 1N6QL 4L29B 1H3PH 1BZ7B 4P2OC 1YPZB 1FNGA 3ILQD 4YHIB 5LVEA 4NQXA 3RVVD 3Q5OA 3QCUH 4PRAA 5EPMB 4RAVA 1GXEA 4XB8A 5C0DB 3EOBA 2DI8A 2MSPA 5ITBL 3CFKA 3C9NB 5EG6C 3O4OC 3CAFA 1JGEA 5DT1L 5K59F 1MFCH 1TTFA 3QI9B 5E2VL 1DLFH 1CL7H 2P44B 2P42B 2W60A 4B0MM 5FO8B 3E8UL 1KCVH 3EDDA 3GSUA 2A77H 3PWPD 1CQYA 1AGFA 3SDXB 3JWOH 2C3HA 4ELMA 3QIBD 1G9NL 5D1QC 4Y19B 3VI4E 3MRRA 5DUPL 3O2VL 5E99H 5HI5C 4HT1L 3IDJA 4Y8DC 1I7ZB 2QEJA 3G08A 5JA8B 4LIQL 4LHUG 2ERJC 3OR6B 3D18B 1BOGB 1T7XA 2X2YA 4F3FB 4MD5B 2H26A 1UFUA 4I0PB 3FONA 3PGFL 2WQRA 3VGBA 2PYEE 5HGDB 4DGVL 4PRPB 4NZJA 4JDZB 4N0FB 4FNLH 2ZUUA 5JZ7D 4H88L 5JHDE 1EBPA 3IETA 1CR9H 3O0RH 3DO3A 3HUJE 1DE4B 1QLRB 1WCBA 1Z3GH 2CO6B 4L1DA 2FX8L 3HC3L 4XAKE 2H8PA 5FAAA 3H9SD 4IOFD 1NLDL 1K9TA 5DFVD 2EE9A 1FO0A 1PX4A 2CKBA 5DRWB 3C6SB 3KPNB 4M1DL 3A6BH 2LVCA 7FABH 3O41B 5FYJL 4MXWH 4LSSH 2B5IB 3C8DA 4C56D 4URTB 3OX8B 4HQQH 1FSKB 1KYOJ 4LF3A 3EYFA 2OJZL 4OJFL 1XR9B 2KQMA 1EFXA 3MZGB 4I3RL 3TVMC 1ZHBB 3RZWA 4HJ0C 1XGQB 4WV1B 5B3JF 5F7EL 1CICB 1M05A 2VISB 3DYMA 3V6ZA 4ENED 3RWEB 1CGVA 5IVXF 5HHXH 4M93C 1DANU 5GGUB 3RWIA 1C5BH 2VR9A 3NOIA 2HRLA 2VQ1B 1HXYB 3C60D 1X44A 3U6RB 1AC0A 3IXTB 5EOQH 2BJMH 3F7YB 4TUOA 5HY9A 3ZT6A 4JRYD 1KB9J 3T1FB 5K9QG 1A4KA 1DVFB 3FB8B 4OGYL 3ZTNL 3O6KL 4LASH 3MRNB 1YN7B 4HKXA 1XIWA 2PYFB 4DN4L 4PJEE 3UP1A 4PG9B 4PRPA 3AROA 1MCPH 1P7QA 4OZHF 5TE6H 1EAPA 4APQC 4HDIA 1GH7A 2OL3B 1AD0A 5C8JB 4NP4L 2WLYA 3PJSA 4MJ5B 3DROA 2A74B 4U1IA 1ZSDB 5C6WH 3LEXB 2BSED 4JB9H 3BZ4A 1B4RA 1YY8A 3ARFD 4CVZB 4RZCA 2IADA 4JM2D 3UPRA 4M7JH 4HJGA 5B38B 5IWLA 4GUPA 1FV1A 1T21B 2MTPA 1AGFB 5SWZA 3SDXA 2X4SA 1CN4A 3DUSB 3A67H 4G8GB 3TPUA 5DD6B 3TZVD 2OM5A 5EORL 1IAIM 5IIEA 3MRCA 4OCWL 3ZYJA 2NQCA 2X4QB 1A7OL 1JHLL 2W0LA 4U7KA 4WY7H 2R0LH 5JO5B 3REWB 3DSFH 3MRGB 2NZIA 3FOMA 4KKAD 4PJHF 5C0ND 3STZB 4M62L 3C8HA 3AXLB 5D72L 5EO0A 4EDWL 4ORZC 3P9LB 1BQHB 4WJ5A 3SKJL 1DDHA 4AIOA 3D85B 3H3KA 3FRPG 2ZJSH 4YNYA 1CLOL 3Q6GH 4A6YL 3LQAC 1J1OL 3BRFA 4Z0XB 3GSVA 5T3ZE 1ZXQA 1OT1A 1KJ2A 5A3IC 5JDSB 4I0KA 5BVJA 2GSIB 1JPFA 1KIRA 3OGCA 4PRHA 5JOPD 4WW2C 2ADFH 2EIZA 4F7MB 3VD3A 2DQUH 4DN3H 4JPKL 1G9ML 2VLKE 4LSVL 4V1DE 1EJ6A 4S2SB 1HHJA 3U1SL 1TJIL 4O58H 3O45B 1EO7A 1D5XA 1FG9C 2FWOB 2HVJB 4FFVC 1WZKA 2A6KB 3MLWL 4XCCH 2VDRH 3FT3A 1KBGL 4PGEA 4OZGE 1FGNH 1I8LA 1G1CA 1QBLL 3ECBB 2BNQE 2Y25A 5GRUL 5HD8C 2FD6L 3DWTA 1XGTA 2CLRB 1Q1JH 1H3TA 4PREB 3C6LC 1LEIB 3GMRA 1UZ8A 1BVZA 4F9LC 3MNWA 2XRAH 1N64L 4WIQA 3WNKA 5INCA 3JV4B 4YZFE 4X7DC 3V4PL 1A5FL 4R7DB 3CCHA 1QKZL 5I8KH 3VH8B 3CVHH 4JKLA 5INDB 1D9KD 3DXAB 4ZO9A 43CAB 2WIIB 3D39E 1H3GA 4OGAD 3EJYC 2W38A 5GRYA 1HINL 4GG6F 4E0RB 5FO9A 2N7BA 3KVQA 4ZMAT 3OKMB 1IVLA 4XBGA 4LAQL 1QFUL 3DUHA 1F4YL 1FZMB 5KS9F 3MRJA 4ELME 4K71B 5CJQL 3LVEA 4P5TD 1VA9A 1DJSA 2YMXL 5IMMB 1MNUH 2ZG1A 3QUYB 3BUYA 4IOIB 4YFEA 1V3JA 3ILPB 2WWKO 5D7SH 4DOHE 1A3RL 3VH8G 2XNAB 1N26A 4GXVL 4MA1C 2MKLC 5C9JB 4PB0L 1X5YA 1C12B 4OT1H 3IFLL 1CXLA 3T0WA 1HOCA 4NFBA 5HI3D 5BRZA 4M00A 2C26A 4LNVA 1EGJA 4KQ4H 4P2RD 4YLQT 5IMKA 5E2TL 3AXLA 2BY1A 3OXSB 4OZ4B 1AC6A 1S9XA 3RY6C 5EUKA 4NQEB 5I1HH 4HUNB 3T0EA 2FYYA 3NPZB 2A38A 4F8TA 4XNXH 4HH9A 5FUOL 3CX5K 2B4CL 4YHPB 2A6KA 4K9EH 4QYOA 1D9KC 2GAZB 4AT6B 2OL3L 4O2FB 3VW3H 4LLUA 3V5KA 1NGQH 2G9HB 3LN4B 3VW3L 1YNLH 1ORSB 4PY7B 2X1PA 4LARL 3M1BA 3G5VB 2B4CH 4Y2DA 1N0XH 1NCDH 1S78D 2GTZA 1AP2A 4OFVA 3W0WB 5K9OA 3S37L 1LDPL 1JVKA 2A73B 2NW2A 5GGVH 3TFKC 5HHPA 1IL1B 1FYTB 5TQ2H 3K1KC 4KDVA 4X9HA 3BWUC 3VD7A 2FO1A 3MBXH 1F6LL 2UWEF 5EDXA 4Y4KB 2EDJA 4K94C 5IW6B 5FKPA 1T6VN 4N0UA 3EOAA 3GMQB 4DW2L 5AD0B 3KG5A 3HZVB 3DI2B 4M5YH 4A2MA 3EYFB 2VLJA 4S0SD 3ROLA 5ERWB 1JV5A 3CFJB 3VFGL 4Y16A 3S96B 1NSNL 4MNQE 1J1XH 3IT8D 1PSKH 3IAGC 3AREA 3HI1A 2G5BA 2IANB 3LEVH 2YBRA 4LBEB 1JI1A 1ITCA 2XWTA 1C08B 1H0DB 4FFWC 1R24A 4M7LH 2UZIL 3ARQA 3LCYA 5C08E 1FL6B 4IRSB 3L3GB 3AUVA 4JG0H 1CWVA 4XPGH 4ZXBC 5IB3B 1F3JA 1RUAH 4I9WE 1MFAH 5T1MB 1T89C 1S9YA 3VFTA 2WINB 5FDWA 4JY6A 4HIIB 2DBLL 3CLEH 3WKMH 1YY9C 3FOLB 3KDMA 3O3DB 3LHPH 3C09C 3IDXH 1BGXL 3RZCB 5KS9B 2V5RA 1CFVH 3O2DH 1ORQB 4JFQB 1MCOL 1MHHA 2R2EB 5KS9E 1QACA 3BFOA 5AZEL 2XWJB 1FL5A 2YA1A 3CXDL 4GG6E 5LWYL 2A73A 2NW2B 4M6MH 3HE7B 4KPHH 2VDNL 2RCSH 1EEYB 4ZSOA 1G9MH 4WUUB 5D7KD 5IVNA 4HX1A 4NN6B 4PLNC 3CPLA 3OG4B 2HAZA 4IMLA 5BMFL 2AK4B 5DDHB 2A0LC 3H42H 4F33B 2C7UB 4I4WA 4J4PD 3U7YL 3HZKA 3UBXA 1CDHA 2X9WA 3UBXG 4X6EA 3KPOA 4NJAH 3S8WA 4EN3C 5HD8D 5D7LB 1IZJA 1M4KA 2YOCA 2AJXL 1IEBB 4EJ1C 1WCQA 2P49B 4BK5A 1HCVA 4D8PB 4PJ7B 2HG5B 1G7QB 2W0FA 3NCJH 2E8ZA 2NXYB 4YQXL 3I2CL 1PKQE 1LK3L 1EHAA 5E7BA 3V4UH 3MRFB 1CICA 5SX5K 1A5FH 3RQ3A 1OCWH 3WXVH 3QJFA 4AEEA 1HHHB 1QFWM 1VKXB 1JHLH 1FC1A 2YK1H 4NC2B 1Z0MA 4Z18A 4G6AC 1IQDA 4LLWA 1QO3B 4KDWA 2XKNA 5DJYA 3QRGL 2GQHA 1YDPB 2C1OA 4QRPB 3E6FA 5DQDH 5B8CB 3VA2C 2BSTB 3WXWH 1W8NA 2P8PB 3MLWH 2UV3A 3OJMB 1IBGL 5EZOL 1CBVH 4EQ2A 3TJEH 4Q6YA 1KPRB 2FJFA 5GGTA 4HIXL 3TO4A 5A2JH 5I6XC 1J8HB 2EDXA 4PP1C 1TJGL 3IETB 4JB9L 1WICA 2DN7A 4LPXA 4QY8B 3WSQH 3NCYS 5JW3H 2KZWA 3UTSD 4L8BA 3OL2A 2J1KA 4PJHE 5IMKB 4KMTL 4NKDA 5CUSL 1EEUA 4L9LC 5DZOA 4JY5L 3GSOA 4F7CB 1LQSR 3MGOA 4Y5VB 3CFEB 3MRMA 4M6OH 1RAMA 1BJ1J 5C9JA 3BKYH 5DFVC 4L8SA 5CEZL 4LHUB 3L3HA 4D0DB 3O9WB 3SGEH 1BZ9B 2F8VA 1I7ZA 3ILPA 4RIRB 2R39A 3O6KH 3HC4H 3SKJH 4GQPH 5F1NB 3F8UB 5DUBA 2VUOA 2W0PA 4L3AA 1TVBB 3RU8H 4JZOA 4XPTH 4MDJB 1BVLA 4O2CB 3NIFF 2CUIA 2ICWI 4JFEB 4Y7MA 4XAWH 2A6JB 1I3UA 2N7AA 4GMTL 1U42A 3FQWB 4KKAC 2BSTA 3PF2A 4KJYA 3JVGA 2ICEB 4HMDA 1A3LL 4JY4A 3W9EB 4Y5YC 4B50A 3CCHB 1FVCA 4Z7UB 2D31B 5C0BB 2E7CA 5GGRY 2QJDA 2ZUSA 2ED7A 4JJ5B 2F58H 1CIDA 4G42A 1LEKA 1CGWA 2MCPL 1FNHA 1QNZH 3RJQB 1XGPA 5TGBA 3QDAA 4JRXB 5JIIA 3MFFB 5KZCD 4JJ5A 1JRHI 3MMEB 5AWNH 4M1DH 1YJDH 3SE3A 4M7KH 2XTJC 2FJGB 3UAJC 5FGBC 4UBDD 4Z7VA 1EGJH 5TE6L 5B22A 5KVGL 2XKUA 3A0OA 4RGND 3DRTB 2CDFA 1JZ5A 4FQJL 1U8LB 1WTGT 1KUMA 4H88H 4G8EB 1DR9A 4F15B 4OGYH 3WMSA 4LQFL 4K07A 3EFFB 4J3VA 1OW0A 3PWJA 4YO0A 4M48H 2XWJA 2P5WA 3D85A 5FYKH 2HFEA 2X4NB 4WO4D 2DQTL 5DUPH 4N8CL 4YE4H 2YRPA 2D4FA 1OB1B 4WHTA 5TDNA 1YJDL 2ORBH 3ABZA 4OFYD 3VWKA 4OJFH 2CR6A 3L3KB 5TQ0H 3VXMD 1JGUH 2BVPA 3QISA 1U8QA 5JQ6H 4CUCA 2EDBA 5JR1H 3A6CL 4QWWC 2IBBA 1PEWA 2MCPH 3PWPE 5I75B 2EEBA 4POZD 3IJHB 3X13A 4OLUL 2I07B 3MRKB 5C09E 4BFGA 2C7UA 3O11B 4HWBH 2Q1EA 1NLDH 2VXSL 1Z2KA 4KRPB 4ZS6C 2NZ9D 3QIUA 2UVFA 4TTDD 5F9AC 5FA3B 1NAKH 2BFVH 2B39A 3PG2A 1WK0A 2BERA 4Y2DD 3SDXF 2XKNB 5CD5D 5EUOF 1A0QL 4R7NA 4QT5B 4C83B 2HFTA 3AM8C 1G7HA 3RU8L 5LGHL 1S5IL 3PHSA 5JMRA 3PDDA 4HFWB 3KPSD 4RGNE 4JAMB 4D8PA 3PDOA 3QSKB 4KZDH 2X4UA 2HFGH 5E6IA 1JWUA 4W6XB 5K59E 3S3JA 1U3YA 3MRPA 4LVNC 3DTXA 1CU4H 1Q0XH 4PR5A 1H9VA 4U1HA 1NCCL 3UTOA 4MQXC 2R1YA 5EU6A 4P23B 4Z5RA 5JUEL 4NKQB 3T2NL 1DE4A 1QLRA 3I6KA 1G6RH 3QUMH 2R2BB 3KNBA 5GGQH 5I71B 4U3CA 1T80A 2X4OA 4I0PD 5ALBL 3MLPA 4NPYB 3TIEB 1NAMA 3KWWA 1U8HB 2GYSA 4ODWB 3QQ4A 3PUCA 4NHCH 5CMAB 3S4SA 3KJ4C 3QEUB 5I66A 4FQXB 3FCTA 3L1OL 4ZSOB 1P2CA 5LBSL 2XIDA 3ULUD 5GS0C 1FFNA 3GMLA 3X3GL 1RIVH 1HCFX 1T5XA 3GSQB 3WKNA 4CADB 2VB5A 4KUZL 4PJEB 3B3IA 3DOSA 3WNMA 1F42A 3N06B 5BS0D 1G7JA 4HF5L 4K23H 3WUWG 3FOLA 3G5VA 3EJZC 3QULA 4R8WH 1J0HA 5IMLA 4YDLC 4IRSA 1TZHB 3DECA 5D1QA 5BRZD 4YQXH 1S7UB 4U1GC 1GGBH 5E00A 5EIIA 1Z9SA 3VXTA 4HWUA 4JZNA 4LSRH 4S0TD 2R4RL 5D7IA 1HSBA 1S7VB 4IRJD 1N7MH 2W65A 2CLVA 2NY7H 3HNTL 3MODH 3QDJD 4K3DH 3MGTB 4NZRL 1EO8H 1OY3B 1S9KC 3OZ9L 1HYSC 2B0SH 4IMKC 2UY7A 1N8ZA 3S96A 5H37H 1IGJB 5BRZB 3NCYP 1JFQL 3M8OH 4WENB 3S35L 5F7LB 1NC4D 3RVTC 1VERA 4O51A 2YD3A 3ARTA 3UJIH 4XP6L 2QTEA 5C0BA 2FECI 2XQYG 3EJJX 4P5TC 4HUUA 3MQIA 3FO2B 4ODVH 3SHSA 3HC0A 1CFVL 4HV8B 3MUJA 2FEEL 1NUGA 4QXTA 5E8DL 4XNYH 3FN0L 5EUOB 1L7IH 1A1NA 5GZNC 4NYLA 4U6VL 2R2HB 2WUBH 4M6AA 1DL7H 3B8SA 1VPOH 4KKBD 1E4WL 4YXHL 4K8RC 5EZIL 1EVUA 2R1XA 3PWVA 2VE6B 4H5SB 3ZL4L 3L9RA 4KK5C 1ZOXA 2HT4D 4UV4L 4GKNA 3P9WB 12E8H 4MJIE 1RD6A 4LEOB 5ITFB 5F7NC 5IFJA 3NCFB 3P9LA 4WJ5B 3K2UL 4MD4A 2X89D 4QRPE 4KHTL 3ZKXB 2MFNA 3MOAL 4Y4FA 1SJEB 4JPVL 1NCWL 1F4WL 2CK2A 3HNSL 4WUKH 5E9DB 4FXKA 1DQQA 4HJJL 1JN6A 3GMPA 4EDXB 3EOYG 4X9BA 2VL5A 1GC1L 2MQ3A 5D70L 1J8HD 2Q20A 2OR9H 4OBSA 4LOUC 1IGTA 5GZND 5C0FB 1A9BA 4LEXH 4PRPD 2OSLA 4FP8L 3TYGL 4XC1H 5FYLL 3CDCA 1ZLUH 4JHWL 4X7CC 5C0IA 1G9MC 5KANG 2AJUH 1DEDA 3MXWH 1MJUH 4D0BA 3LN5B 1R3HB 4CVZA 1FRGH 4IIQA 2XZAL 3MLYH 3H9SB 3OKYA 4GW5A 4EUPH 2PNDA 1DTUA 1S9WA 1YNLL 5D7JC 3QO1B 3BGMA 5C0AD 2W9DH 1NEUA 3VMOA 3D85D 3F58L 4X5WB 3AY4A 5I1HL 1MCCA 4TSCL 2Q8AL 1SEQH 4U1MA 3KPRE 4RGMB 1TLKA 1KB5H 4UQ2A 2XPGB 2R1XB 2AJ3B 2HT2C 1F13A 2VIRB 4L8DA 3AREC 4RFNB 3JV6A 3MNZB 4OCNC 4MB4A 4BFEA 3L95B 4UZGA 2OX5A 2DIJA 1MVUA 3FB6B 4XX1G 3K4AA 4P9HC 1IARB 4OF7A 3T2PA 2WV3A 1DVFC 1MCIA 5L2KD 3C60B 3VCLB 4D3CH 3HRZA 1LO2H 3F7VB 3FO9A 4JRXE 4P48A 3GMMB 5GS2D 2P47B 1HSAB 2PXYB 4LLDB 1A6TB 3BKML 3WIHH 4F9PC 3O6LL 4P2RE 4ZPVA 4JM4L 3PP3H 3CVHL 5ACLA 3GGWB 5I8KL 4KI1A 4NZTL 3QP3A 4OZFG 5D6CA 3EYOB 5AZ2L 2AI0H 2P24B 1CLCA 5L2JA 1BVKB 4WTZG 3IGAB 3MACH 2DQJL 1U92B 4QOKA 1BBJA 4MX7A 5L88H 2FGWL 3CFCL 5IB3A 3U4BH 3EYQD 4KVCH 1S9VB 1H3VA 3VXTB 3BH8A 3DURA 4QHKJ 2DICA 4L8SC 1QFHA 4TYUA 3V0VB 1ZLWK 4OSUH 3FRUB 5AUMA 1IKNC 4M9PA 1U2HA 1RURL 4OGXL 3NFNB 1HQRB 4P3WA 3FQNA 4KV5E 4YUEH 4WUUA 3I6GA 2PR4L 3U1SH 3CDGA 5FUCE 4JDZA 1F3DH 2P4AB 4MQ7A 3BDXA 4JN1L 4XMLL 5I0DA 3GIZL 1I1FA 2FLBT 4TVPH 1UVQA 5C8JA 3IDGA 3TPKA 4OIBA 5CHNA 3BE1H 3CVHA 5AD0A 3GNML 3U0TB 5LAXA 4WEUD 2NY6B 3P4OA 1MRFH 3LEXA 4P4KD 4HC1H 3BGAA 4UT9H 5KOVC 5C1MB 5I6XB 3QIUB 5AYUL 4TVPE 3QUZC 1EHLL 1CIUA 5L7XH 1EJOH 2AERT 4Y4KD 3SGDI 3T3PF 4ZTPL 1CFNA 4J6RH 3RTQC 4OCMC 1KEML 2DLFH 3BQUA 1NMAH 4S1SH 3HFML 4HLJA 3NIGE 4P9HL 4EUPB 1KIUA 4O2FA 1YN6A 1UB6A 4WI7A 1CDYA 3RWIB 3F7YA 1I9JH 3QWRA 3T0AA 4MVBC 3VXSA 1MQKH 2EE3A 3W2DL 5IJVB 4QXGL 1SEBA 1KJVB 4CAGA 4I18B 2YSSA 4UQ2B 3QQ3B 3VXSE 4OBRA 4OD2A 5EBWA 2APTA 1CFTA 2IG2L 3RDTD 3NAAH 5DJ6A 4U6TA 1YPZA 2VERN 3MROA 5TDOB 3VXNB 1AXTH 4ODSL 1RFDH 4EN3A 4HUVB 1WWCA 4OCRL 1DEEA 3FN3A 1T0NB 5BZDB 4FXGB 1IC5L 1DCLA 2O5YL 3CDYA 4JRXD 5E4EC 5KZCB 1OAQL 2YA2A 2WQ8A 2HKFH 4P3DB 4N0YL 1JIBA 5A3ID 2OK0H 1HQRA 4YXKL 1J0JA 4Y1AB 1SHMA 3VE0B 3QG7L 1MFNA 2CR3A 5HHQB 4G9FD 1VGKB 4EVNA 3BPCA 1MCPL 5DMIH 5C71A 2OI9C 3C9NA 1NANH 4XP9L 5E2JA 2J8UA 2VTFA 1K2DB 2W9EH 4KMQA 1AD9B 2G5RA 1YEKL 3HS0A 3T2QA 1MQKL 5D2LE 1ZMYA 4CMMB 3EFDL 3DX6A 5DJ8B 1KCRH 4QRTA 3EOTH 1RZ7H 5DMGD 2O61B 2JELL 2Z31C 3QO1A 1P1ZA 5F8QC 5GSVA 4S11A 2V17H 3U7WH 4L3CB 1A14H 1ACYH 4JQXA 3RL1A 3GMOB 1DBAH 2AEQL 4NCDA 1JYWA 3VG0L 3QHTC 2P5EB 1GHFH 4FQHA 3EDJA 5SX5H 4D9RE 3OTTA 1OAUL 4CKVX 2ICEA 5DZNA 1GGIH 1U93B 3VXME 1JHTB 2J8UF 4NWTH 5LG1A 1CK0H 4ODXA 5MEPB 2R69L 1PYWA 1Z6JT 1ZHNB 3DV4B 5D71H 4ZNEA 2EKSB 2XYCA 3RGVB 3OAZK 1QQDA 1QR1A 4D9QD 1KIQA 1TZIB 5H37G 4DCQA 1S7XA 5DRXA 4WWKA 5E2WH 3EJYD 5I18L 3BZEA 3O2DA 5A2IH 4TNWF 2QHLA 4KRPD 4XCYA 4QRPD 3U4EB 1R3IH 1UZ6E 1UGNA 4X6CA 1NFKA 1FIGH 1ULVA 3F7QA 4YR6A 4QRRA 1CR9L 1RIUH 1LHZA 4QOKE 5HVWA 4UNTA 2DQJH 4QRRE 3PGDA 3KGRA 1B6UA 3VFSB 1VSCA 1WFTA 2EDQA 4QY8A 5IP4A 1R0AL 1ZLUK 2GITA 2HA1A 3CVIL 1WSST 1D9KA 5B39B 1FVEA 4DVRH 1FBIL 4P46A 2WUCL 3M45A 1BQSA 3U4AA 5IIEB 5DS8A 4NUGL 2NXZB 4DKEH 3MA7A 5EBLA 3RTQD 3RKDC 4Y4FD 2YN3A 1JYNA 4MA3A 5SWZB 5E03A 3TFKD 4Z7QE 2AJVL 1H3UA 1MREL 4JPWH 1OP5H 3QULB 4RWYL 4N0RA 1ZTXL 5D7JA 4YAQB 2Z4QB 5HGHB 2PXYC 3BEVB 4P3DA 1ZANH 2IH3A 4W81A 2I25N 4ZPTB 5C70A 3L3JB 4JZJB 1G7IA 3PJSB 3T4YB 4V2CB 4XVUD 3MRHA 4HUVA 4OUUB 1EXUB 2V9TA 1FVDA 4AQOA 4N9GB 1I9IL 3X12A 4Q6IC 5EU6E 3EYSH 4AG4L 2EDYA 4K8RL 1VDGA 4MAYA 5CJXA 4M43L 4D0CB 1L0XA 2D4DA 4H20H 5HYSG 5TE4H 4KUCF 2W9DL 3G5XA 3HE6B 1I8KB 4OKVA 5L9DH 1AD9A 4HIEB 4GG8B 2J88L 4DJMA 3VWKC 3C5ZA 3O3EB 4G9DB 1MAMH 3O6LH 3UTQB 2BNRD 1CFNB 3MLYL 1G7LA 1KJ2L 3NZHL 6FABH 3FO1A 2GT9B 1CI5A 3MPCA 5E8PA 1B0GB 4FTVE 1BD2D 1QO3A 3UPRB 5C0NC 2Y06H 4LEXL 4LHQB 3OQ3B 2AXGA 3FB5A 5C0AB 3MRBB 1DQLL 1UENA 2R56H 2EO9A 5EC2A 1EEQA 1WV7T 4KFZC 5CILL 1AE6H 5IB5B 4NQDD 5FKAB 1OAXL 2DQFA 5KVDL 3TCXA 4M7ZB 2VDKL 3CSPA 3PGCB 4MJ4A 5C7XH 5IVZB 5E4IA 3P0YH 3QNZA 2Z91A 3I6GB 1P5VA 5DEFA 4JM2B 1MFEL 4HZLB 4X0KB 4LCWB 3BP7A 2ITCA 2QL1A 3PQYD 4NN7B 4GKOA 2HRPH 1GAFL 1G0XA 1MAJA 1ES0A 2P5WD 3AB0C 4RGOH 2J6EL 4G43A 3KXFE 1SY6H 2H6PB 1P4IL 3CMOL 2YBRB 5CZVL 3RIFK 1I1CA 4G8FA 4L3ED 3WYRA 2BVPB 3PABA 4PJFE 43C9B 2VLRA 2NW3B 4NRYA 1OGAA 2BSSA 1JV5B 2CRZA 1NEZG 3VI3F 3EO1A 3ULVF 4ZUUA 3GSQA 3MUHL 5C3TA 3JBG7 2JIXB 4QHLA 3RWCA 1MIMH 1RY7B 3G08B 5GHWH 4S1QL 3QUKA 2UYLA 2RHEA 5DR5L 1VFAA 2AK1H 2PYEA 5GXBB 2OJEA 3H6JA 3KR3L 3LKOB 4ODTL 5J1SC 3BPOC 4OQTL 3VU2A 3VFNB 3GSNB 4JGUA 3U0WL 5DO2C 3UJIL 2WINA 4HW6A 1R5VA 2BXYA 4GRLA 5FM8A 3ROOA 4UIKL 3MRLA 4RDQF 2VLLA 2CKBB 5DRWA 3SCMA 3BO8A 1T2QH 2GK0A 3KPSA 1CE1L 3R4DA 4YZFF 1RJCA 3BYTA 3PWNA 4KROB 2IAMD 5HI4D 1NH6A 4MXQD 3EO9L 1YMHB 4NO5A 3JV5A 3WNNA 3TIDA 4PJ8C 2F5BH 5EO1B 3HI1B 2CK0L 2AV1B 3HE6C 1SJXA 1YNKL 4X4ME 4PRDA 2DKUA 3DVNB 4MS8C 1U91A 5SWZE 3D5OF 4ZUTA 1KGCE 1IQWL 3ARZA 3LKRB 2ZPKH 2YPLA 5TGBB 1NGPH 1HNGA 2A1WL 4UILH 1BHGA 3GK8H 5F6IB 4GW5B 4YK4C 1Q9KA 2APWA 3FQTA 4NDMB 3RVUD 4IRZL 2XXMB 5FYLD 3P0VL 2P46B 4J3TA 3IKCA 3LN9A 3U0WH 4KHXL 4UQ3A 2EIDA 5GJTL 3L3IB 3K3QA 3LH2L 5I1LA 3C5ZB 3O3EA 2Q86B 1JF1B 3ALPA 1IM3B 2B0SL 1XEDA 3HHRB 4RA0C 3G9VA 4OM1H 3RHWF 2ZUXA 2XWBA 3VFPB 4QYOB 3S97C 4YHMH 3SKOA 5DUBB 4AH2B 2WANA 4NQEA 3T0EB 3OXRB 5DVMA 3DARA 2J3SA 3TVMB 2DMKA 2QQLL 5E2UL 1P9MA 2PKDA 1ZA6B 4PRNA 1S7SA 2Z0BA 4LSRL 1HNFA 2EDRA 2BRQA 1FO0L 1SVZA 3HUJA 3BZFA 4NN5C 3RWJA 3MSPA 3DMMB 2N4IA 4NO0A 5I17A 3L7FB 2CRIA 2D9CA 1T03H 2XN9B 1S7TA 1YEEH 3D2UD 4K23L 3HI6H 3LS5L 3JWDL 4R90H 4HF5H 4Z7QF 1UJ3C 3PWUB 4EI6B 5FCSH 1V7NL 2DQEL 2AJSH 4P2QB 4UB0L 1TZIA 3TESA 3S36H 5HYIA 4YBHA 1SYSB 1SBBA 5EN2A 3KLHD 1FE8H 4DEPC 3NFSL 4N0CC 1L6ZA 4P2QA 1QBAA 1S7WB 1X5AA 1E6JL 1UA6H 1X6LA 2GCYB 2CH8A 2R56L 1AO7A 4AZ8A 3BDYH 5I2IB 3BXNA 4HLZG 4UINL 4NHCL 3MRDA 3UDWA 5EIQA 2EC9T 2PW2B 4A2LA 2OP4H 1K8IA 2I9LB 2J12B 4F7EB 1MCDA 3TM6A 4Z8FL 1KN2H 4HKBA 5HVGB 5I1IH 3K81A 1ZLSH 3TO4D 4WFHD 2FHBA 4XMPH 2WLZA 1XGRB 3OKOA 4L8CB 4KTDL 4LAJH 5D1XA 5DD0L 4WHYG 3C5JB 3PV6B 3EW3B 1IGCH 4MD4B 3OKEB 5F88A 1ZHLB 3SDCC 4D9RD 2DMCA 1N3NA 1HWHB 2YPLD 3BZFB 4G6KL 2VZOA 4Z7VE 3EBAA 5DEGA 4CN4A 3MV7E 3RL2A 1CXKA 2AGJL 2ARWA 3BAEH 1BF2A 5T33H 2A9NL 4V2BA 3U0PB 3ZO0A 2VXVL 1ZS8A 2DQDH 2MHAA 3CD4A 5C6TL 4HBCH 1KTLB 4GH7B 1FPTH 3TIDB 1YECL 5E8EB 3TA3D 1DQJA 5IVXE 1FHGA 1F97A 4WEBL 2M26A 1UM5L 4MXQC 4P2OA 2H1PL 2GJJA 2XZZA 2BFVL 5B38A 3IDMA 5F70A 2HJLA 2JB5H 3FFDA 3WL9A 2VSCA 2P8LB 5ETUB 1F58L 1C8PA 5F7HA 1SJHB 1J8KA 1E6OL 5DJ2A 4XBPA 4GRLD 5GZOD 3OSKA 4XPAH 4TSAH 4FQ1H 3MLZL 1IKNA 3DV6A 3GRWL 4UDUA 4HUMB 1J10A 3BN9C 1A7NL 5HSFA 3PWLB 2BVQA 3KLAA 4LPTA 5KVFH 2JIXA 3J7HA 3L5WA 1OARL 3HR6A 4P46C 3S3SA 1QOKA 4MLSA 1I7TA 3STZA 3MRNA 4XXCC 4JVPA 1YMHA 4U31A 4JFPB 1R0AH 5HHVH 1ZLVK 1KB5B 2NY6D 4X4YB 3B8YA 1W0VA 3HR5A 5JOFB 3KNBB 4HXAH 3KPLA 1U8IB 4Z7NF 1MI5E 1CTOA 1JHKL 3BKJH 1MI5B 3ZSTA 2C1OB 5ESQA 3U9UB 2BHUA 1CGUA 3N1FC 1T1ZB 3LPGA 4CL7A 5BQ7B 2DM7A 5DEFB 3SOBL 5FXCH 5K93A 4NDMA 4MJ2A 4LPUA 4P4RB 5HHNA 1XR9A 2J4WH 4Z6AT 2NR6C 4H8WH 5ADOL 3MV8E 3WLWC 1FNEA 3QIBC 1FNFA 3OR7B 4HMCA 4HS6A 4MVBD 1BPVA 5CD5C 4ONHA 3QUKB 3ZE1E 5DA0B 1U9KA 2WP3T 5GSRB 4OLZL 2I60L 2NYYC 1WT5C 1GGIL 4DUXA 4XNUH 1HI6B 5GGSY 2NX5A 5CEZH 1GVIA 4WFGE 1J7VR 4G6KH 2IBGA 4OI7A 1AR2A 3HRPA 5I1AB 1XF3B 3UJTL 3LDBB 3VG0H 1QYGH 1R24B 4L4VE 2BCKB 3RY5A 2Z31D 1DBAL 4JFFB 2GHWB 3AAZA 2X1XR 4PJXF 5J13B 4GRWH 1TFHA 4NJ9L 1KJMB 4WHDA 4EQ3A 2D7NA 5FF6B 4MDIA 4P4KC 4Z8FH 2R1YB 3MRIB 5HPMB 3IU4H 4NFDA 3QFDA 3S34L 1BM3L 4W6WB 2ITCB 4WCYH 4ZG1A 4HWZA 1CBVL 4O5LH 2FGZA 3GMQA 3EOAB 4Y16C 2YZ1A 4C54A 4JO4H 3QI9C 2V2XA 1MWAL 4PV8A 1JGDA 1GGUA 2HFEB 5FYKD 1Z0NA 3E6HA 4UB0H 5SV4A 5AG8A 4LVEA 5SWSE 1WZMA 1XAUA 2E7BA 3FFDB 5IW3A 2G60H 2LV4A 2HKFL 4MHHG 1XF5A 3L5HA 5B3NA 5ICZA 4G9DA 4N1CA 1A6AB 1WFOA 1MCBA 2D2OA 4NKOA 3QI9A 2L7JA 4BKLA 5CJ5A 3R06B 1RJZA 2VLJD 3WIHA 4ODHL 5IFHL 3M1BB 4KRLB 5J06A 3AREB 1G7PA 5HVHC 2EEAA 4U1MB 1KACB 5E8OB 2AJZA 1E0OB 4PRIB 5F7YC 1AO7E 4YBQD 1HOCB 2FYYB 4JFHE 1NKRA 4KK8D 5JHDB 1ADQA 3NPSC 3BGMB 5TFSH 3RTQA 2EICA 4Q0XL 5F9WB 4DGIH 2BVQB 1QBBA 2H2SD 1QRND 5TH2B 4FQ2H 4YFDB 1BD2A 2R0ZL 3ZLQC 4AEIH 2XI9A 3SGJA 5EU4B 2Q3AA 5GS2H 5L7XL 4XNQB 1NGYA 5ISZB 2V5TA 1FYTA 1NC4A 2AVGA 3HRZB 5AZEH 1VFUA 4O4YL 2F15A 4MQSB 2YK1L 4NBYB 3QDGA 3OV6A 3ARDA 5C86A 3PXHA 2ED8A 3H2WA 1CT8B 1AP2B 1AKJA 5E56A 2X4PB 1RZKH 2C4FT 1M7IB 1K8DB 3KPQA 4LLQA 4LLYB 1NUFA 2BRRL 4KAQH 5TPWL 1AI1H 2WW8A 3ESUF 2J2ZA 1ZVSB 1QRNE 2F53D 3G5XB 4IMKA 5IK3B 1EAJA 1LDSA 5JLZB 2CDFB 4XMLH 3P4NB 1X5LA 3BVNB 3FT4A 1F2XK 3H3PL 3O4LB 2IFFL 2LTQC 2OR8A 1FAIL 3F5WA 1IILE 4XRCA 5IROA 1DLHB 4YUEL 32C2B 3BPLB 3X14A 5DJDA 2Q87A 2FX9L 1JF5A 5SWQA 5F8RC 4X6CB 3VFSA 1NAML 1MLCB 4F7CA 4ZXBB 2XFXB 1PY4A 1KSRA 4IRSC 2BC4A 1BECA 4QRSB 5HDQL 5L88L 1GIGH 3QNXA 1T3FA 1MY5A 4M6ML 3QO0B 1OP5K 3ZE2E 4MA7H 4GRWB 3D3VB 3ARBB 2IPTL 4LCCA 5AZ2H 3HNVH 3WLBB 4FQIL 4J4PC 3NVQA 5CZKA 5DD5L 3TA3A 3T0EC 3HMXA 1OAKH 5DR5H 1MCFA 2E9JA 5MEQB 4JR9H 3IDXL 4POYA 1BMGA 3D9AH 4OAWA 4J3XA 5C07D 4EVNB 5DD3H 2DQGH 1TJHL 2ZNWA 3OGCB 2DI7A 1LO2L 2DQIL 1UM4L 5I1DB 1MFAL 2VLRE 3KYOB 2DYPD 4YFLI 1B9ZA 4OZIE 5CBAB 4TN9A 3L7FA 1J12A 4YC2B 1Q38A 3WE6A 3VJ6B 2XZQL 1LMKA 3ECBA 4ISVA 5IT2H 5JXEC 4R2GB 2JJTA 1X7QA 1JPGB 3TN0B 3RNKA 1EZVX 4FG6C 5DD1H 3BMVA 4P2QD 5DD1L 1T83A 3LKPA 5KN5A 1KCUL 5F44A 1AQDA 1TDQA 3C08H 3T1FA 2VXUH 4RGMC 1EA9C 2XWBB 2QADC 4JRYA 2ZUYA 1ZHKB 4TULL 3ZMRA 1YEGL 2AS5M 1UWGH 1Z9LA 2ITDA 1KCKA 2Y1VA 3I75B 1MIEH 4BK4A 2DLTA 4XVSL 2VLLB 3LQAL 3JZ7A 1I1RA 1RK0B 3D69A 4EBQL 3MA9L 1FN4A 1Q0YL 2ESVE 3R0MA 4PJ5E 3WHE0 3W39A 4FQHB 4WEMB 3VFRB 4B7LA 3VE0A 2JJWA 2QQKH 4NRXB 4BH7A 5DQ9B 4TUJB 5IM7A 2VZTA 5FYLH 4LAQH 4BELD 4RFOL 4GLRI 1D3CA 2HJKB 4JDVB 2J5LC 5TF1H 3N85L 5I9QC 3WHXB 3MOBH 3TBVA 3VWKD 3THMH 3CH1B 4RMUA 4F58H 3UROR 4HDIB 1OGAB 2EKJA 1UJ3A 3VGFA 1YMME 2CLZA 3O8XA 3QHZH 5KBNC 3IDUA 3KJ4B 3UO1H 4U1GB 4OIAA 5DD6A 3KPPA 4GFTB 4KHTH 1Q1JL 3L3GA 2E9IA 1KTDB 4WHCA 2R8SL 3BP5B 2X70A 5GRUH 4WU7B 1KLUA 2EDTA 5IF0B 4N8VA 2EXWC 4YEEA 4LPCA 4F7TB 4HS3A 5IBLD 4ZO7A 1BQHG 4RZCB 3ZL4H 5L2JB 4NHUB 1XCQA 5EZIH 4ONHB 2AABL 4YXHH 3L5XH 2V7HB 5GGSB 4CJ0A 4PS4L 1MHHB 2R2EA 4B5EA 4DZBB 4IHOA 3QYCA 3HMWH 3QDMB 1GCFA 1CGSL 3QCTL 1MF2L 1D5ZA 1HILB 2WUCH 4O4YH 4LSUH 4OV6F 3D2UB 4MQ7B 2PO6D 3O3BA 2I07A 3MRKA 3FQRB 5H94A 5H2BB 4FQ2L 1RUPL 1NCUA 3IU3B 1TTUA 3MLVL 3OKLB 4OCXH 2FSEA 1F3DJ 4YDKH 1GZPB 4M8QB 3FQRA 4PD4K 2GJ6D 3DSFL 1TITA 4GS7B 3VWKB 2FX9H 1T20B 3TO2B 4UTAH 3CH1A 4OCWH 1JTPA 1J5OL 1U92A 4QOKB 1T0MA 3DLQR 3Q6FA 3FB7A 4JFYB 4QHUB 3V9FA 3WFBL 2Y5EA 3DI3B 3KLAB 1DSFH 1ZT1B 4WWKC 3SDXE 5ALCH 1GOGA 1X3DA 2JKXA 1KIPB 4NUJA 4JPKH 1TQBC 3B9DA 4TPRL 1G7HB 1LE9B 3DX9B 1Q9OB 3VWJD 4BZ2H 1IFHL 1PG7X 4Q6IB 1AFVL 5TPWH 3TNMA 1ADQH 5FHAH 2WNGA 2OS7A 4M7JL 3CFDB 1KN4H 4X7FC 1GYAA 3V52H 5DF0A 3VXQA 5E08L 5T3XL 1AXIB 1LP9E 1UQSB 2IGFL 1J87A 4OIIH 1J1OH 4X7EC 4Z95H 4F7TA 1WBZB 5I75C 3I75A 1N2RA 2FO4A 3SPVA 1S7RB 4BQBA 3V0VA 2HMID 4BSWB 3CFBB 1LE5B 4U1KB 5HDBE 3UZEA 3OKMA 4XBGB 5IVXA 3PP4L 3VA6A 5JQHC 4XPFL 3VFMA 2V17L 5E1AB 3U7WL 4Q0XH 4M93B 5TFSL 2VL5B 1T83C 4KMLB 3L3OA 4N0FA 3L1OH 1PG7W 5HVHB 2R0KL 4WW1B 1CTNA 1PG7H 3DPBA 4MSWA 2OI9B 4D0CA 4Q9RH 2QSVA 3GUTB 5JA9A 3GEWB 2ENYA 1U36A 1H5BA 2X09A 4M61B 4HGMA 1I8MB 3DO7A 2ESVB 3NZ8B 1MELA 1RUQH 4G6FD 4PJ5B 1FNAA 1HSAA 2PXYA 3BEWA 2VNCA 4ODUB 3MBEB 2LABA 1CU4L 1Q0XL 5E6IC 4NC1E 3VCLA 2DMBA 1SY6A 3BUYB 1UZ6F 3QNYB 1AXSB 2VE6A 4QOKD 1KC5H 4GJTB 4M02A 1S7WA 2X4TA 1JPST 4LSTH 4N9OB 4KKNA 1F5WA 1BFOA 1OD7A 1ZHKA 3VMNA 1WWBX 1CICC 2Z8VC 5HYJD 3QG6A 5T5NG 2R23A 2NTFB 5FYJH 4PRID 4E0RA 5F1NA 1A6PA 1U95B 3W9DA 4Z7VF 5E6YA 5ICXA 1YPZE 1YQVL 1U3JA 3RWGB 2J8UE 4R7DA 1DQQB 3T4AA 2ERJB 3INUH 2QKIA 4GRWE 5CGYC 2D7TL 4KRPC 3HUJB 1CF8L 3T09A 4NJ9H 1IGJA 2CMRL 4YX2H 4HXAL 2DWDB 1SYVB 3VDAA 1T1XB 3AU1B 5JR1L 5FCUL 1VADA 2Z92B 3N9GL 2G75B 3E3QE 4LVHB 4JM2F 2EH7H 4ZFOL 3X14B 3GZKA 3ZTJG 3PIQB 1OARH 4NZUL 4QF1B 5EWIH 4BA8A 4RAUA 1PJ9A 1PKQB 1RIHH 5D93C 5IFAL 3G6AB 2QSTA 1LO5B 2OTWB 3T65A 1E4KA 1MRCL 3RBSA 1IAKB 1TVBA 2UWEB 3OJDB 3IFOB 3GI9H 5DRZA 4EXKA 2PR4H 1UQSA 5E5MB 4Z9KB 1HIML 1HXMB 1G7JB 2XXCB 3UTTA 4JFDA 4ORGA 1DQTA 3WFEL 2YPVL 2UZYB 3FJTA 3DNKA 5EFIB 3IDNB 4RA3A 3BSZL 4OD3H 4ZXBA 3EGSB 1CZ8L 5IFJB 1LVEA 1Q9OA 2Y5TB 3MREA 3GSWB 4ZSOE 4LSDA 5ICYA 3GMOA 5ESAB 2AXFB 5T1KA 5FGCB 2H3NB 3FMGL 3VFOB 1OWRM 2VXVH 5LKNA 1KJVA 3ARGC 4DGVH 1AY1L 4MSWB 2OBGA 4JQVC 3BJLA 3MRIA 1J11A 1I3VA 1ZT7A 4NKIH 3QA3A 4QKXB 5GS0H 1K2DA 5DXWA 2AK4A 2BNQD 5BXFB 4X5LA 3HAEG 5J6HB 2XG5A 3QZWG 4P5KB 2X89A 4HT1H 5E99L 2M2DA 4LPWA 2DYPB 4W70A 4NN6C 1ZA3B 5DC4B 5DURB 3T3PE 5IKCA 1OPGL 1T5XB 1F58H 5K9JH 3MCLH 4PJXA 4Y4HA 4CN6A 4HFUH 1DBBL 1WZ1L 5I73B 3RFZC 1HN1A 1CLZH 5MEOB 5KJRL 1BF8A 3K2MC 4YWGH 4LLVB 1DLFL 4GSDH 4XAWL 1WVZA 3OX8A 4UTBH 1MFCL 1NFDA 2DWEB 1RZ8B 2BNQB 5E2VH 4C57C 4M4PA 2EDFA 3QFDB 5TE7L 3GMLB 4JQIL 2HWZL 2AJSL 1YECH 2D7OA 5F9DC 4KWUA 5IJKA 3TV3H 3HB3C 3FL7A 3FQNB 3HI6L 3LS5H 4W4OC 2A9NH 3DRQA 4PJ9B 2R0WH 2X6MA 3PL6D 3SJVA 4N8VB 1I8IA 3D48R 4MCZA 4QGTA 5KTEH 1AGCA 4K3EH 3HG1A 1MCWM 4UMGA 4KV5F 4M6OL 4MDIB 2P48B 4EI5A 1HH6A 2MQCA 3F62A 3SJVB 4KMTH 4BFIB 1W0VB 1IGYB 2HYMA 3GO1L 1BFVL 1PKOA 4QRUB 3V79C 2QQLH 1MJUL 1MPAL 1RUMH 5AEAA 3MXWL 5DZLA 4X80H 4RQQA 4DGYH 5ADPH 5BV7C 1MWAA 4DEPB 3NCCB 1QA9B 3EKCA 3SE4A 4PJDE 5DJZA 2IJ0C 1JWMB 1P7QD 3ZKND 3D0LB 1JNJA 1Z5LB 4ZAKC 4X7SL 2A6IA 4NM4H 5GRVL 4PJXB 2RBLA 3TWCL 3MLXL 4Q9QL 3WIIL 4P2QE 1MCEA 3Q48A 3RWDB 2DIAA 2ZSWA 2IBZY 5CWSA 4XP4H 4HJJH 3GMMA 4O9HH 2CDEB 5DYOA 3QB7C 5IMOA 4NHUA 4WI9A 1U3HC 3AS0A 1AGEA 1KJMA 2O5ZL 4BJLA 1JK8A 1XH3B 1E4JA 1JNHB 3GJEB 2LFGA 2W1NA 1T04B 3FAXA 3FRPA 1KLUB 5IF0A 1NBZB 5JOPE 1WISA 4AMKL 3MV8A 4E5XB 3EZ8A 1IT9H 4ZFGH 4C56B 2I9TB 5HHOA 4HZLA 4HLZH 5GPRA 5HYSA 3CK0L 3MFGB 2F5BL 3PHOA 5ESAA 4ZAKB 3QIUD 4IDLA 2ZSVB 4GKSA 3SE9H 3CDFA 5FV1L 1U58B 5LQBL 3VRIB 1BQLH 3SKNA 3U7YH 4F3FA 3OKEA 3IRPX 1XGPB 1MCLA 2JTDA 2IH3B 4HIHB 3LH2H 4IOIA 4L4JA 1LEKB 4ZQKA 5IB2A 4FMFA 4RX4D 5D7JB 1RK1B 3SY0A 4X6FB 3KYKH 1ZA3A 3ALXA 5FM5O 3HZYA 4KTEL 5TJWK 4NQSB 4ELKA 2LU4A 4XTRD 1A6WH 4GAGL 1CDCA 4XZUB 4UILL 4JFFD 2BOBB 2XQBL 2YRZA 3PDGA 4P4KA 1NGPL 2ZCLL 1GOFA 1FZOA 4PJCF 1K3ZA 5EBGA 4F8QA 3TLRA 4Z7UE 5CP3A 4HGKC 1OTUC 1QHOA 5F1IB 4MMXC 4NQEE 4OQ1A 1NCAL 3K4DA 1CFSA 3RVVC 3ARFA 3GHBL 3KJ6L 5MP6H 1IT9L 3C5JA 3PV6A 3OBAA 2NXZD 3U79A 5KG9B 4P2OD 4BSVB 1LP9B 1P4IH 4QNPE 2LE9A 4CGTA 3J8F7 3QHFH 4IIQC 4NWUL 1KJ3L 3C6LA 1KLGB 2PW2A 1W72A 1TMCB 3BPNC 2Y36H 3NTCL 1WEJH 1Q9WA 4ORGB 5EU5B 5HGAB 1C1EH 3UDWC 5I8CA 4WWKB 3STBA 2DDQH 1NEZA 2G2RA 2RJMA 4XHJD 5C2BH 1NANI 3N1PC 3VRJA 3KR3H 3VXRE 1C5DA 5LCVH 4YC2C 1JZ8A 1OD9A 4UBDC 4OD1H 5MEND 4XI5D 3GBNH 5I1JH 3GMPB 4HIHA 3SGKC 4FQCH 1QUNA 4KKLD 5KW9H 5I17B 1QPPA 3P73B 3GI8L 4XH2A 5D1XD 5KSBA 1A7QH 3X17A 4R3SA 1LEIA 4LHJB 2JF1A 4UT7H 4WI6A 5CIPH 4LVNB 2J7LA 2YPKB 3IKKA 2Q7YA 5HTSA 3SDDD 5C0CD 5CGMA 4JM2C 1WBYB 3CSYB 5IB1A 5LXGL 3HPLB 5KTEL 1X5KA 4M43H 5JXAH 4ZYKA 5HHMB 4NQCE 1MFEH 1JNLL 2OR7A 1JNNH 4OZIF 5I30H 3GJFA 5LGHH 3G04A 2IWGA 5DHVH 5CFHA 3VFPA 2Z8SA 4XCNA 1OAZL 3IFLH 4OT1L 3G6JA 4Q7DA 4LLQB 1N2RB 4LLYA 4U6HA 2GSIA 4Y1AA 5CGYD 4L5FH 1Z9OA 2EDNA 5C0CB 1HEZA 4LVOC 1HHKB 4HBQA 4DKFH 1WIOA 5SWSA 1O7VA 1JWMA 3EIFA 4U6XB 4ZFFB 4OLUH 2WZPD 2VN7A 4XMKH 1UEMA 3QDJE 5EO9A 4ZTOH 5J1TC 1JMXA 5GJSL 4KKBC 1KFAL 1EAPB 1YC7A 3RPIB 3UZQA 3IAPA 1HINH 3T0DA 4RSVA 5A43C 1I9RL 4F57L 2ADIA 4APQB 4PV9A 3LKRA 1B90A 3DBXA 4QLRA 4YHLL 1H8NA 3G6JE 3X3FH 1OTSC 1R5IB 3CVIH 4BH8A 4GMSH 3V4PH 1P4BH 4KC3B 4YE4L 4P5MB 1N5YL 5IJKC 2H32H 1UWEH 4UT6H 4NGHL 2DLEA 4FZEH 4YDLB 1TIUA 1CL7I 5GRJH 5BO1L 3SCMC 1TQCC 1QR4A 4P23A 4Z5RB 2VH5H 5C07B 5IMOB 3GKWL 5IMLB 1FLRH 2NZ9C 4XCEA 4R0LA 2NX5E 5I18H 4M6NH 4LLVA 1QRKA 1ORQA 4FTVA 4JFQA 5E2WL 2JJSC 5MERB 4LLMB 5LAXB 1FL5B 1V05A 1CE6A 4LGPB 3V5DA 5ERWA 4LSVH 4YDIL 2DQUL 4DN3L 5JIKA 5DGQA 1YJDC 2DIBA 5EOTB 5CJXC 5I19H 5EA0H 2Z35A 4RDQG 1B0RB 3KPSE 4QRUA 3SO5A 3VFUB 3UTSB 3FCTB 2EXWD 4TNWK 2GUOA 5T1LB 1FBIH 2E6PA 1GHFL 3OB0K 4DKAA 3HA0A 1UM6L 1ZT4A 2EYTA 2P1YA 4XHJC 4MQXD 1IE5A 4FQQA 2FL5A 4XNZB 2VDQH 3WIFA 2WIMA 1YN6B 5IR1A 3T1WA 3ZDZF 3Q5YA 5F7DA 1R5WB 1T04A 4NO3A 2QR0B 5E5RB 3BESR 4HSQA 2FX7H 3DYPA 5I15H 4F37K 2CIIA 1FYTD 3EOTL 5GGUA 1EEZA 4KDTA 5DURD 2HLAB 2R0LL 2CDEA 4J1UB 4POZC 5B3JE 4FFYL 2NX5B 1A7OH 1K5NB 1NLBL 1CXFA 4AEHL 3V7MA 1T7ZA 4ZUSB 2F53B 4XVJH 4I2XB 1QBML 5T1KB 2JCCF 3N1QC 1RPQA 3M17A 4XPHH 5FYJE 3MJ9A 5HI3C 1X5HA 1CXIA 1MFBL 4XGZA 4JKKA 3QG7H 1MHPL 3PWJB 4HAGA 1IMHC 5D1ZD 4PUBL 3MUGB 3MZTA 1LO0L 1HHKA 3SCMD 3I3BA 4PJAF 1CFBA 2CRYA 4XCEB 3IS0X 1MEXL 4U6HB 1FP5A 4ALAH 4CU6A 1HDMA 5KSVB 4Q2ZA 1WLHA 4PBVC 3PHQA 4HH8A 1I8KA 4OKVB 3G6AA 2BNRE 4H8WC 1IEAA 2I26N 1IGFL 2OXHA 2V7NA 1IGFH 5HHME 1F00I 1FGVL 1NDGA 1OVZA 4NKMB 3LQMA 1SBSL 1I1AB 2P43B 1ZWIA 4KY1L 5D2NC 5I73C 5FYJU 4LKCA 4ZS7L 4OF8A 3MNVA 5GGVY 1VB9A 5D6CB 4PRIE 3ZTNH 2B1HL 5CP3H 4KK8C 2R0KH 4DFIA 3TYFA 2F53E 5DWUH 2B8OT 3HFMH 1P7HL 4L3EA 1A6ZA 1AHWB 1NMAL 3IJSA 3QIWB 3WXWL 4EEEA 3IFPB 5DQDL 5C9KA 3DV6B 2MJWA 4XBEL 3EGSA 4Y19A 4HD9A 2NTFA 5CKAA 5GRJL 1QLEH 5C0JB 5HDLA 5IOPA 1OLZA 1SJHA 1PGRB 5AYUH 1YMMA 4NGHH 1ZGLP 3T08A 4IRJB 4OIIL 2IGFH 1G7LB 3B4NA 3KPMB 4HULB 1VESA 3V0WH 2X4TB 1F90H 1KIQB 4XWGH 5BXFA 5CBEB 2FLRT 1NMBL 2G9HA 5DS8B 1X4YA 4EDXA 3QPQD 1OOAA 1OGTB 5J8OA 4BZ1L 1VCAA 5DVNA 2NY5H 3CZFA 5ALCL 5JIHA 5JNYB 3D39A 2IPUG 2EH8L 2WIIA 2B5IC 2B2XH 4H1LA 1J5OH 5C09A 1W72B 3KPTA 3U82B 2ICES 1H5BB 3RVXC 5GRZA 4ZO8A 1NDMB 8CGTA 3VFVA 1D6VH 3VJ6A 3WS6C 1DUZA 5L8KB 4JZJA 3T4YA 5A2KH 4S1SL 1YEDA 3L3DB 4HUXA 1LNUB 32C2A 2O61A 5CIPA 3KYOA 2JJSA 4FNLL 3ZHKA 4TQEH 4POUB 1R3HA 1OAZH 1KG0B 1T7WA 4NKMA 1I3GL 4U0RB 2X44D 1YYLL 2AI0L 2VDOH 3QG6B 4I18C 1H8OA 4M6NL 5EOCH 1IGMH 3O2DL 4JM4H 4KI5E 2FO4B 4S2SA 3SPVB 5DC0A 5L8LB 3UTSE 3FQUA 1AR1C 3CFBA 5J13C 4OI9A 1E4XH 1A6UL 1E27A 2W9LA 4G3YL 4CNIB 2P8MA 1LO3H 4KQ3H 5INDA 3CU7A 3TBYA 1PYWB 3DV4A 1X5ZA 3L5XL 3RWFA 5DI8A 5F6HJ 2G2RB 3ZE0E 5F3HB 1BD2B 2HT2D 3GIVA 1VKXA 1XR8A 4M3JA 5A2LH 3TJHC 4JG0L 3T0XA 4I2XA 1EX0A 5EU6D 5FIEA 1XZ0A 4YHYC 2CSPA 3FKUS 4XNMA 2DD8H 3VFVB 1WZLA 4U1JA 4D2NA 1GGCL 3B43A 1JRHH