4WI8A

Structural mapping of the human igg1 binding site for fcrn: hu3s193 fc mutation y436a
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHATQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Structural and functional mapping of human IgG1 binding site for FcRn in vivo using human FcRn transgenic mice
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wi8A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wi8A01
1J0ZA 1MH5A 3QNYB 3LRGA 3QULB 2G60H 5DXWA 1YECH 1EZVX 2VDOH 1DEDA 3BGAA 3RKDC 4X4YA 1NEZB 5D7LE 2BVPB 1TQBB 3P0YH 5I1AB 3DETC 1JWMB 2HMIC 2DKMA 2Y6SC 3WSQL 1DFBL 3GSVA 5JXAL 1IL1B 1X4YA 4O9HL 4WW2A 3GB7B 5F1OB 1NFDB 2W07A 2X4OA 3MRBB 4HWZA 2X44D 3RL2A 4JM2F 5C0IB 4GAGL 4GLRH 1FZJB 1OAXL 1S8DB 3HLAB 1A7OH 4M48H 3R06A 1OD7A 3VXTA 3PHQA 2GJ6A 5DQJA 4N68A 4N0RA 4Y4KB 2ATPA 3O4OC 2G2RB 1R3IL 3L7FA 3AAZB 2JK5B 4HIXL 3LRSA 4HEME 1U3YA 3WCYA 4HIEA 4QLRA 1N7ML 2CLRB 2QQKH 3C2AH 3TPUB 1T20A 3GGWB 4HK3J 5DVNA 5IESL 4GRLA 1NCAH 1U3HC 1EO7A 5GPRA 4JQIL 4M3JA 3RY6C 3RAJL 4K7FB 4M93B 3M17B 3TIEA 5KVEH 1QBML 3GMQB 5JR1H 1HOCB 1BQLH 5JLZB 4LEXL 4Q0XH 2UZXB 3QIWC 3BN9C 5JQ6L 4CW1A 3VFGH 1WV7T 3C60A 1A7PH 5EUKA 2NY5C 2BMKA 5HGAA 4Z7NE 1RUAH 1ZGLB 2ZKHL 3DLQR 2P5WD 3RY4A 4KC3B 4OCYH 1RZIB 4LRIC 3TWCL 5F88B 4PJEA 3DIFB 1KT2A 4I3RH 4RBPK 4RGNB 3U48A 4NWUL 1S3KH 3STBA 1H15A 4CU8A 3SPVB 4KVNL 4MD0B 4MXWL 4Y1AA 2OBGA 4BYHA 1D6VH 1CDYA 3MV7A 1C5BH 2L0DA 1JV5A 2VZUA 3BPNB 4I18C 5FV2A 1NAML 1A6TB 1A21A 2FECL 4YZFE 1WZLA 3WUWB 4E42B 2VZTA 1EMTH 1LEGB 5SX4I 1JI2A 2NX5A 4M5ZH 2ADGA 1JWUB 3UXFA 1WZ1H 3QA3A 3A6BH 1P4LB 4IRZH 4JDTH 4GW5B 2F54A 5AWNH 2BVOB 2B20A 3FB6A 1AO7B 1EH9A 5F7NC 3P4OA 3Q3GB 3DUHA 5D7IF 1CI5A 1P1ZA 1VKXB 4X7CC 4WI7A 1JF6A 1SVZA 4JM2B 5C0JA 4WEBL 3VRIA 4IRJD 5JNYB 2BRRL 4D94A 3HE6A 3N85H 2DLIA 3LHPL 4G8IB 2F74B 3GDBA 4LVOC 2PO6D 1FN4A 4IS6B 4TOYL 4W6YB 4OBSA 1I75A 2OZ4H 5DUBA 5CJ8A 3QFJB 4AQ1B 4OF7A 2VXUL 2YC1A 4GW1B 2PTVA 2VE6A 2P5EE 4KTEL 1UWGH 4WY7L 5F96L 5EIVA 2W92A 3VWKD 4LGRB 1N4XL 1G0YR 1I1CA 2CO7B 3V4VL 5I15H 2AJVL 3BVNA 5AAWA 2EC9U 4UB0H 4ZTOH 3DXAE 3QUZB 2BX5A 5IVNA 1WT5A 3CMOL 2MOVA 4M7ZC 4OB5L 1J10A 1M05B 2G5RA 3T0WA 1I8MA 1SJXA 2B0SH 3LKRB 4LLMA 3KYAA 4XVJL 1ZTXL 5TQ2H 5JDSB 3I6KB 3WHXB 5B38B 1S9WB 1X5ZA 1CVRA 4WVRA 1GIGL 5CJBA 3NABH 1CQKA 2HKFL 4Q97A 1FO0A 4NHUA 4HG4K 4GXVL 4JQXC 4ZO6A 3AS0A 2I07A 5HGDB 1IGYB 4CU7A 5KJRL 1GPOL 1LVEA 3QISA 3UTSA 5K93A 1K85A 3U46B 3WSQH 1BJ8A 1DFBH 4HFWA 5JXAH 4WWKC 4UIMB 4O9HH 2JLLA 5LAXA 5EIQA 2J4WL 3GMLA 3NCFB 1VESA 3EGSA 4EXPX 1J0KA 4LPTA 2J7LA 2R1YB 3FFCA 1F6LL 3GSNL 3ZKXC 2MCG1 2VWEC 3FQWB 4GAGH 4P9ML 3ULUC 4LSUL 1OAXH 3EYVB 3H3KA 4ZS7L 4PREB 4K7PX 2IQAA 1I3RA 3SDDD 4KI5C 3RIFK 1QRND 1KBGL 1R3IH 1R3JA 1UVQB 4WI6A 3AB0C 4HIXH 5C1MB 1IEAB 4NRXA 4ZFFA 4JE4B 1KIRB 1N7MH 4MWFA 4PGCB 4U6HB 5J12C 4DCQB 3UTZB 5D7IB 1XGPB 1G7HA 5I17A 1XF1A 4OZIF 3MBEB 5IESH 1P4BL 3I02B 5C0BB 3TCLA 1FFRA 1KCSL 5D6CB 5J1AA 3GFUA 4XMPL 4JQIH 1VACB 1B0RA 3KWWA 1CTNA 3RAJH 1FC1A 3JTSA 3NN8B 1QBMH 5C0FA 4FFVD 3VFVB 2P7TA 2VXQL 3LH2L 4EQ3A 1NAMB 1IKFL 4O5LL 1WTGT 4D8PB 3ARGD 1X5GA 5JQ6H 2ZUWA 1JYVA 4NZJA 3UC0L 3WKML 5J8OA 1AKJD 4K8RL 4OZGF 1WF5A 3G04A 4TUJB 1E27B 4MX7A 3FFDA 5IJKA 4LNRA 2IAMD 1DVFD 3MNWB 1BZQK 3S35L 1IC5L 3PGFL 3S3PA 3TWCH 4A6YA 3UAJD 3ARFB 4U1LB 1QSEB 4OFYA 4NWUH 2XNAB 4PIRF 5EBWA 1A6UL 5ICXB 4KVNH 4MXWH 4BFEA 3NA9H 4X8JB 2P5WA 4U1SB 4Z7WF 4Z6AT 2ICEA 1FGVL 2R2CA 1WCBB 5DA4A 3OX8A 1NAMH 1F00I 4IDJL 2PXYD 3HCVB 2BVQB 4YHOL 4ZPTA 4HG4J 2ADJA 1R3HA 5D1QC 2A73B 3OTTA 3GSUB 3KXFE 2OS7A 3IDMA 5I8KL 5IB4B 1YJDL 2WQRA 4OZFA 3PNWA 4OLEA 3WFDL 3V2AR 2VLKD 1GGYA 4DWHA 4YEFA 3CCHB 2DQJL 1OP3H 2GK2A 4XBEL 1L0YA 4WEBH 5FGSA 2WINA 2XTJD 3ARRA 2BRRH 3M45A 3LHPH 1YEHL 2FR4B 1F4WL 4TOYH 3BW9A 4XC3L 1WC7B 5F6IC 4JY5L 4AMKL 3MRHA 2ITDA 4KTEH 4WY7H 5F96H 3ZKND 1FYTB 1V5JA 4IRJA 4R8WL 4WW2F 2VL5B 1FGNL 5IP4A 5CEZD 1N4XH 3LVEA 3BIKA 3V4VH 3EFFA 1GGCL 3QIUB 2PO6A 2X4PA 2HT2D 3ULVD 4EBQL 1R6VA 5KAQF 4OZIB 4UT6L 3OWEA 3SDCD 1A6PA 1A3QA 3LQZA 3QIBC 3CMOH 5E9DB 2WMPA 4OB5H 4CJ0A 3OXSB 1NGYB 5FA3A 4XVJH 1P84J 4HUNB 1ZTXH 3L3GB 3GSNB 3DVGB 5IFHL 3L5JA 1KOAA 1PYWB 2LTQB 3C5ZD 4KHXL 1GIGH 5EU7E 3DX8B 1VGKB 1XIWB 5DJAB 3RL1B 3L3IA 4MZ2A 1G7QA 2AJZB 5T3ZL 5HGBB 4OZGB 1BWWA 1KPUB 2HKFH 4Z7OF 4PJAE 2NPLX 2GTWB 3ARXA 4GXVH 4KGJA 3QWOB 4L4TE 2F5AL 1MCHA 3C8KA 2PYED 5KJRH 3RZCD 4U1JA 5D7JA 3DURA 1T2QL 1GPOH 2NY7L 4Y4HD 1TJGL 3TVMC 2YS4A 4X9GA 5IVZB 1F90L 2Z8SA 3KG5A 4LGPB 3LRHA 5KN5A 1SYVA 4P5TD 3FT2B 5BRZA 4NYLB 1XGTB 2A6KB 4HC1A 4Z7WB 2J4WH 5KTEL 3EOTL 3KPMB 3AS2A 3VXRB 3FCTB 5A16B 3WKNA 3HUJE 3GSNH 5FF6A 1CLZL 2VLRB 4P9MH 3SGJA 1J1XL 4GKZA 4LSUH 4JG0L 4ZO8A 1JNLL 2IPTL 2IANB 4GBXB 3IFOA 4ZS7H 4G80A 3MJ8A 1Q9WA 5DMGC 4PJEF 4ZUVB 1LO0L 5CSZA 4QCIA 5KSAD 4QRTB 1KBGH 3TZVB 2AP2A 3L5HA 4HIIA 4K23L 1PZUB 1MCOL 1AGFB 1RHHA 4I0PC 3MO1B 2F58L 4HMCA 4GXUM 1JFQL 1C7TA 2MCPL 3RVWD 1MH5B 5J13C 1P4BH 1QUNA 4KWUA 1KCSH 4WGVB 1LO2L 4X4YB 4M6NL 5MENA 4XMPH 4U05A 3O2VL 2VXQH 1TZIA 3GSVB 1W0VB 1IKFH 3JXAA 2E7MA 3DV4A 4I2XA 1CDUA 4O5LH 4WW2B 1TLKA 3B6SA 3FHQA 4KMTL 4PLKC 4L8DA 1S78D 5EZLA 4HWZB 1I8KA 1BAFL 4GKNB 2VQ1B 4KHTL 5FYKU 4F37K 3UC0H 2W9EL 3WKMH 5BQ7B 3CU1A 4K8RH 3MJ9L 3SY0A 1D5XA 1VFOA 5DFWH 5J56B 2AJSL 4G6AC 3ARGA 3R06B 3IKCA 3T04D 3VXTB 3PHQB 1NEUA 2GJ6B 4ZS6D 1A47A 3S35H 2ATPB 3OGCA 1IC5H 3PGFH 4NQTA 3L7FB 4K3EL 2HKHL 3LRSB 1AKJA 1FO0L 4PGEA 3BUYA 4HIEB 3B2UD 4KU1A 1M7DA 3JZ7A 4RMQA 4YHLL 2Z8VC 3ZHDA 1A6UH 1T20B 3QSKB 3NGBB 3OKDA 4UUJA 4Z5RB 3A6OA 2IAMA 3D0LA 3KPNA 1DVFA 2FBOJ 1FGVH 3DROA 4GRLB 5IMOA 1U8IA 1U6AL 2A1WL 3CFKA 5E94A 4L4VE 4V2CB 3TIEB 4IDJH 4R97C 1YEKL 4YHOH 5DZLA 3U7YL 3CIQA 4Z0BL 1OGTA 4JANA 5I8KH 1YJDH 4MCZB 3GBLA 4CW1B 3WFDH 5L7XL 3S96A 2XYCA 5HI4D 4YH6A 2DQJH 5HGAB 2BMKB 1P5UA 1U41A 1RULL 3MFFA 2Y9RT 3SGKA 5IWLC 4ODSL 3QDJA 1IRAY 5D1XD 1FP5A 1ZT7A 1Q0YL 4UQ3A 4V1DE 1NFDE 3GSXB 5GGQL 1PGRB 1YEHH 1F4WH 4XC3H 3W2DL 4X5WA 4PJEB 1KT2B 1H15B 1QA9A 4JY5H 4AMKH 5H94A 3PHOA 2JB6A 3LQAL 4R8WH 4Y1AB 1FGNH 3MV7B 3H7LA 4JO1L 1G7IA 4D0CB 1HIML 1FORL 1JV5B 2KPNA 1GGCH 1MHCB 5CEZE 5IR1A 4JRYD 3WLWC 4EBQH 3MGOA 1R5IA 3O45A 4R96A 4UT6H 5CZKA 4CVWA 3VW3L 4ENEC 3ULVE 3OSKA 1I1YB 1OY3B 2ESVA 2NX5B 1FNGA 3B5TA 3GJFA 2ADGB 1Y18B 2VZ3A 5A3ID 3MV9B 3QA3B 5IFHH 3DHMA 2MMXA 2F54B 3I84A 3IRZA 3SDCA 1WZKA 2YZ8A 3FB6B 4BQBA 2VYRE 4KHXH 1P1ZB 1RZKC 5C0JB 3AMLA 3P4NB 3VRIB 3WNNA 4A6YL 4RQQA 5T3ZH 5TDNB 4W4OC 4QHLA 3HE6B 3Q5TA 1QSVA 3P9WB 1JVKA 3G9VA 1FN4B 2F5AH 3BZFA 3C5ZA 1T5XA 3HB3C 2YC1B 4KQ3L 2VE6B 4EQ2A 1T2QH 2NY7H 4HQQL 3RWJA 1TJGH 1HKFA 1F90H 3ARTA 3MJ7B 3GUTA 3BVNB 3W9DA 1KB9K 1F8TL 4IMKC 4KAQL 3RZCA 5KTEH 1JPFA 3EOTH 4TVPL 4NQEA 3NIFE 1I8MB 2AGJL 1CLZH 3QWQB 4LLMB 1J1XH 4JG0H 1AGDA 3NTCL 1JNLH 2IPTH 4P5TA 5MERA 3MUJA 4H1LA 4EJ1C 5FECA 1LO0H 1I85A 5JIHA 5IFJA 2ADIA 2AXJA 1YEEL 4K23H 1MCOH 5JMOC 5D93B 2F58H 1JMXA 3PL6A 1BIIA 4E9LA 1JFQH 1FO0B 2MCPH 1GC1C 1YA5A 4NHUB 4PTTA 5IGXL 1AO7E 4PJ9D 1ZVYA 5KSAA 1LO2H 1W0WA 4PR5A 4M6NH 3H42L 5DC4B 4P9HL 4MCYA 3B9AA 1FSKB 3O2VH 3UTSB 4WI8A 2CRYA 4HFWB 4KDTC 5LAXB 5JW4N 3DPBA 3GMLB 3QFJE 1YNTA 4X6BA 1C16B 4KMTH 3EGSB 5DF0A 4XVUD 3HAEG 1KYOK 3FFCB 1BAFH 4G5ZL 2W9EH 3OG4B 4M6AA 3MGTB 1T1WB 4UNTA 2Q1EA 3MJ9H 4JVUA 2AJSH 3RKDD 2DMKA 2IQAB 4MVBC 1I3RB 2K1MA 2A38A 4Z7QE 3DETD 2HMID 1R3JB 2Y6SD 4JGUA 2HKHH 4K3EH 1FO0H 3ESVF 3OKOA 4OZ4A 4ZXBC 2OTPA 4NRXB 4ZFFB 3EAKA 2G5BA 4MWFB 3ZSSA 4YHLH 1YYML 2D0GA 4X6FA 2F5BL 4CVXA 5I17B 1KC5L 2G75A 2EDOA 1UENA 5IBUG 1MCQA 3KHOA 3OPZL 5FO7B 3TCLB 2AEWA 1U6AH 2FBJL 2EDKA 2A1WH 2RJMA 3SBWA 5J1AB 1NGWA 3MSPA 1ZGLM 3UPRA 1QEWA 3EDDA 1B0RB 3FN9A 3JTSB 5C0FB 3BFOA 2P7TB 1YEKH 5A2JH 4YFLF 4JFFE 5KSUA 3F58L 4NT6B 3U7YH 4NJ9L 4Z0BH 2W0KA 4NQCA 5LXGL 2NY1C 2P47B 4U1NB 4NBYB 1KN4L 3VFTB 3RNKB 2DQHL 3O2DA 5EU4A 1RULH 4Y5YC 1MCIA 1I9EA 3G04B 3TA3B 3PP4L 1U3HD 4ODSH 4MX7B 3FFDB 2CDFA 4G9FD 4LNRB 3B9VA 1Q0YH 2HJLA 3IDNA 5GGTL 4A6YB 4BSJA 5ESAA 5ACZA 3W2DH 1JF5A 1C12A 4WGWB 3QIWD 1KUMA 1NANI 3BN9D 4P59L 2N7AA 4U4BA 3FTGA 1K2DA 2E6PA 2P5WB 3LQAH 5D1XA 5C6TL 2ICEB 1FNSL 1CDHA 4JO1H 1HIMH 1UA6L 1FORH 3JWDC 1NCWL 3OX8B 2EH8L 5DRZA 1A4KA 3B9KA 4PBWD 5IG7B 3VW3H 3HZKA 1WQVT 4WENB 5F9WC 5K9OA 2ARWA 3T2QA 1LO4L 4ZPTB 4RZCA 1R3HB 5I9QB 3VXPA 3IDMB 2DQDL 4S2SA 4OZFB 4JRYA 3PNWB 5EN2A 3U82B 3LN4A 4ZFGL 1RMFL 2I9LA 4JGMA 1PY9A 5HYIA 4RIRA 5IMKB 2R4SL 2E6JA 4A6YH 2WINB 4M7JL 1YMMD 4Z95L 1MCCA 5DDHA 4LLUA 4NNYA 1J05A 5J3HC 5E99L 3BW9B 2EYRA 3CUPB 2W91A 4O51A 4KQ3H 3MRHB 3VD4A 2ITDB 3K7UA 4H1LG 1A6WL 4HQQH 3U1SH 1IKNC 4BZ1L 3BIKB 3EFFB 5C70A 3GHEL 2PO6B 2X4PB 4IHOB 2C3VA 1PG7L 5ESVA 1YN6A 1F8TH 4OQTL 2K3TA 4KAQH 1T7XA 3LQZB 4TVPH 5D2NA 3EYOA 3ESUF 5C92A 4K3JL 1AGBA 3ARPA 2AGJH 3U9UA 5FA3B 5J57B 2YUVA 1KPRA 4Y8AA 3NTCH 3VXUE 5I8OL 3WEXB 1QLRA 2HT4C 3NFPA 2QR0A 1A2YB 2BERA 2NY4B 2FWOB 4PRID 1PW3A 5HVHC 1JZ6A 1YEEH 3L3IB 1G7QB 5JPMA 3S97C 1DEEB 1UKTA 2NY2C 2W0LA 1P4IL 3FKUS 4CN6A 4QGYA 1YQVL 3OGOE 5IGXH 4U1JB 4U1HA 3DURB 5D7JB 5FKPA 3TESA 3H42H 4P9HH 4KK8C 1UB6A 1EK3A 4P5KA 5IROA 5KN5B 1SYVB 1YY8A 2X42A 5BRZB 1XGUA 3NFNB 3LKPA 4PJ9A 1OTTC 1S9KC 2L7JA 2E8YA 4XCEA 2AQ3A 3QO0A 3T2NL 2VDLL 4G5ZH 2PW1A 1RZJC 1FYTE 5FF6B 4Y5VC 2JJUA 2XY2A 5EDXA 3TN0C 3VFPA 3IFOB 4G80B 4L9LC 3MJ8B 4QRPB 1Q9WB 2X7LB 1SQ2N 1U8LA 1EHLL 4OZIE 3RP1A 2YBRB 4KKBC 5CSZB 5BS0A 4QCIB 1X5JA 5E9DE 3WNMA 4LMQE 4HIIB 5K59F 4M8QB 3O3UN 4WWKD 1SYSA 4PV8A 1F02I 5B8CC 1YYMH 1MHEA 2F5BH 1KC5H 3RTQB 4RX4D 3OPZH 5GGSA 2YUXA 3CU7A 4FG6C 2YR3A 3QCTL 3ULUD 2BSTA 2FBJH 5CHNA 5MENB 1CLOL 5IBTL 3UJTL 3CFEA 1ND0A 4KMQA 2J6EA 1TZIB 4OCMC 4KI5D 3F58H 4I2XB 3DV4B 4ZNCD 3V5HA 1MFAH 1RD6A 3GRWA 4LVHC 4NJ9H 4KDVA 3LEVL 3B6SB 1Q9KA 5LXGH 1N59A 4Y5XC 4FFWC 1CR9L 3GIVA 1CFTA 5EZLB 3MV8D 1IAIL 1KN4H 2VN4A 3DECA 4P4KC 3W5MA 3V5DA 2DQHH 4UMGA 2GSIA 3SY0B 4N0UE 1D5XB 4FQHA 5HVWA 3PP4H 4KKLC 4NQXB 3ARGB 3IKCB 4YFDB 3TO4B 1NKRA 4Z7WE 3V6FA 1T80A 3PV7A 5GGTH 2W9DL 4HD9A 1AKJB 4PGEB 4PG2A 5JDJA 4TTDC 5FV1L 3BUYB 3KPRD 3FHAA 1M7DB 4KH2A 1BPVA 2FNBA 2IANE 4P59H 5LQBL 3OKDB 1A5FL 4UUJB 1TITA 4KQ4L 5C6TH 1FL6A 3KPNB 3RY6A 3T2PA 1FNSH 3DROB 5IMOB 3ZL4L 1UA6H 1U8IB 5C2UB 1HCVA 1NCWH 4CU6A 2EH8H 2Y4SA 3QHTC 4K71C 1SMAA 3WXVL 2FSEA 3QIWA 5F9AC 4ZOAA 1S7TA 1LO4H 5IK3A 3TFKC 3VGAC 4BH8A 3I6GA 3SE9L 3TF7C 3HHRB 3EOAB 5C07E 1OGTB 3ARDC 2DQDH 4P0DA 1IEBA 3QAZB 1QR1A 4ZFGH 1RMFH 1ZKAA 5IBUB 3P0VL 1F97A 5IV2A 3C09B 5F1IA 2GI7A 2YMXL 1HH6A 3BD5A 5T33L 4LRIA 4Y88A 4RWYL 1NMAL 2XXMB 2R4SH 3QDJB 3MLXL 4Z7VA 4G7VL 4M7JH 4Z95H 4F58L 4UQ3B 2OP4L 4JZJC 1PBYA 1PG7W 1L6XA 3DMMC 5E99H 1INEL 4X5WB 2R9HC 2ENSA 3HAEH 5FCSH 1QA9B 5D1QD 5H94B 3PHOB 2JB6B 2LU3A 1A6WH 4HZLA 2ZG3A 4I18A 3RWHA 25C8L 4XC1L 4PJDA 1KJ2L 2GJ6E 1A3LL 3TNNA 2UV3A 4BZ1H 1G7IB 2Z35A 3UBXA 1RUPL 3GHEH 3PJSA 5DD5L 1UXSA 1PG7H 3ARBA 4OQTH 3MGOB 1X5IA 2EDHA 1R5IB 4BQ6A 4R96B 4HS8L 2ESVB 1FNGB 4K3JH 5I0DA 3ES6A 3GJFB 2IMNA 3JWOC 1NC2D 5AUMA 4S1SL 1NGPL 5I8OH 3ZE2E 2EIZB 4H88L 4Z7OE 3BRGC 5I74B 3SDCB 3PG2A 1AD0A 4CGTA 5EO0A 1C5DA 1V7NL 3KPSD 4RQQB 4BELD 4MDJA 4QHLB 4KUZL 1AI1L 4P2QD 1P4IH 3QIBD 1OB1A 4QT5A 4Y16C 4HULB 1X44A 3BZFB 5EU3B 5IB1A 4PRIA 4GMSL 1CBVL 4X99B 1T04A 3RWJB 5AD0B 4PRDB 4MHHI 2AERT 2A9NL 2HWZL 1KGCD 2A77H 5JA9A 3GUTB 1PLGL 4NGHL 3RWGA 3HMXA 4M61A 5T3ZE 1JNNL 4OGAC 2HRPL 4ODVL 5IHZA 1A7NL 5CBEA 3RZCB 3GJFH 1JPFB 3H6JA 4IJ3C 3VH8A 4NQEB 3WIIL 3T2NH 2VDLH 5EIIB 4E5XA 4PG9A 1XAUA 3K80A 4P5TB 1FL5A 5MERB 3W0WD 4C58B 3R1GL 4TUOA 4H1LB 1EHLH 2GK0A 1WBYA 2XG5A 5FGBC 5FECB 4JFHE 3TVMD 2XT1B 2PNDA 3UTTA 2L4OA 2WV3A 1ERNA 4G8FA 2NX5E 4JGJA 2ADIB 5IFJB 2CKBA 3VFUB 2IH1B 4YDLB 3PL6B 1BIIB 3MV9E 5H2BA 3BPCA 2DLFL 4GUPA 5C0DB 5ISZD 2JJVA 7CGTA 4IOIA 5I75C 4YFEA 3I3EA 4UBDC 3QCTH 1W0WB 4PR5B 2FD6L 1CLOH 1KXQE 4XNZB 2WBWB 5IBTH 5L8LB 4WWKA 4WO4C 3UJTH 2H45A 1B9ZA 1J8HD 4PJFE 5DMGD 1TJHL 4OUUB 5EPMB 1MAML 1F3JA 3BPLC 2X4SA 4NNXA 3TGXA 3EDEA 5ICZA 5DRWA 1YNTB 3LEVH 4I0PD 2JJSC 3EO0A 3WBDA 5KOMC 3ZO0A 1IAIH 2IFFL 3D39B 2OQJA 5LGJA 5TQ0L 2R15A 1HDMA 5EG6C 3BP5A 4H1LH 3O9WA 4M43L 4X4ZA 2VR9A 2YPLD 4AL8L 3BP4B 5E2TL 4BQ9A 5E2JA 5EBLB 3MLTA 2ZOLA 5D2LA 1KCRL 5FDYA 4DFHA 1CXIA 4QXWA 5DD0L 2W9DH 1LO5A 4OZ4B 1MLCA 3X12A 4CAGA 4NN7B 2G5BB 4JPKH 1DDHA 4X6FB 4YGVA 5LQBH 4PLKD 2RFXA 4L3CA 1A5FH 2G75B 4JRXD 4KQ4H 3VWJC 2BNQA 3IJHA 3QDME 3ZDYF 3ZL4H 1GYAA 2NW3A 4OLYH 4XP1H 4GRWF 1KJ2B 3UPRB 1QEWB 2EDXA 3KPRA 4G6AD 3WXVH 3LS5L 4K3DL 5D4QA 4QOKD 4R2GC 2YKLL 5KSUB 4LLYA 4X80L 2AJ3A 5T3XD 4NO5B 3SE9H 4NQCB 5JW4Q 4NSKA 2MPAL 4Z7UA 1I1AC 4I13B 3DX7A 3OL2A 3P0VH 5EU4B 2YMXH 3WJJC 4HUVA 5T33H 1TVBB 2I26N 4RWYH 1NMAH 4JHZA 3MLXH 2CDFB 3MLRL 1ZVHA 1OP5H 3CXHK 4G7VH 4MNQD 4F58H 2I25N 5GJSL 5FB8A 2HJLB 1ORSA 3IDNB 3V6OC 1CLCA 1HE7A 5ESAB 5ACZB 2LAAA 1INEH 1C12B 1VCAA 4NC1C 4LLWA 25C8H 5D1XB 4XC1H 4JLRA 1KJ2H 1A3LH 4GLRI 4M6ML 3CSBA 1RUPH 3UPAA 5F7UA 5DD5H 3WDHA 3B9KB 3HZMA 3HZKB 1FC2D 3GRWL 5K9OB 1JGEA 4HS8H 4NQVA 4N8CL 3O4LE 3SKJL 4RZCB 1BGXL 1A14L 4EIZC 3VXPB 5ELIA 2AVGA 4S2SB 5I8EA 1NGPH 4K07A 5EN2B 4LHUD 4H88H 2XQYK 3LN4B 1I9JL 1MI5B 4J12A 2I9LB 2CH8A 5KSBE 2O61A 2R1WB 3FQXA 4NCC2 4HUMB 4P5MB 1V7NH 5IF0A 3FQRA 3DGGA 3WLWD 1GH7A 5DDHB 4KUZH 5DJXA 1AI1H 4ENED 1BJ1H 1JN6A 1NSNL 3SQOL 3MLPA 2Q7NA 2EDTA 2APFA 1J05B 4LLUB 1D5IL 4NNYB 3KHQA 2P24A 4YHYC 2EYRB 2F8XC 1XGQA 4GMSH 4O51B 4Q6YA 1CBVH 3T0EC 1O0VA 3KPSA 2FJFA 4U1GC 2D3VA 2A9NH 3V0VA 4F7PA 2HWZH 2HTKC 1PLGH 4NGHH 1CDBA 3QIBA 4JPIB 2C3VB 1U95A 5ESVB 1JNNH 1YN6B 2HRPH 4ODVH 3MUHL 1A7NH 4MAYB 1H5BC 4LSRL 5D2NB 3WIIH 3EYOB 5FAAA 1H3PL 4GRWB 1AGBB 3U9UB 1H3WM 3CSGA 1HEZA 1KPRB 4YHPA 3D2UA 3HB3D 5GZOC 1X5KA 2VLMD 2CRMA 1QLRB 4X4ME 3NFPB 3W0WE 2QR0B 1C8PA 4XP4L 1FAKT 3HNTL 2UUDK 4HW6A 4UOW0 5JPMB 4PJHA 3IF1A 4X83A 1UCTA 4TVPE 3VA6A 2DLFH 2AJUL 1F42A 2WWKO 3NCYP 2DWEA 4XP6L 5GS0L 5DZOA 5ISZE 3ILQC 3OR7A 5DI8A 4U1HB 5FKPB 1EEZA 4PJGA 2FD6H 4HK3N 2D2OA 5DHYA 1MVUA 1FAIL 1UB6B 1WIOA 4HH8A 4P5KB 1TJHH 1KXVC 3L3DA 1TTFA 3CXHJ 3NA4A 1YY8B 4QRSB 1MAMH 4FTVE 5KZCD 1XGUB 3LKPB 4PJ9B 4XCEB 4KKAC 4EN3A 3QO0B 2IFFH 3MGAA 2PW1B 5TQ0H 4Z7VF 1J8HA 3LQMA 5CWSB 5AG9A 4JFYA 5K9QI 4M43H 2VDPL 3VFPB 3X13B 4PTUA 3QUMA 4AL8H 1ITBB 5E2TH 1U8LB 1LK2B 3OAYK 3WJLC 4I0PA 1KCRH 4IMLB 5BS0B 5I66A 2WP3T 3SO3C 3VFRA 5ID0A 5DD0H 2DF3A 1ORQA 4PJDF 1G1CA 1SYSB 1I3GL 3PDDA 4LSDA 2YPLA 4LP5A 4PV8B 5GS2D 1T83C 5CJXC 3BEWA 1MHEB 3FB5A 4FXGA 2HRLA 5CCKL 5GGSB 1F2XK 2BSTB 3E6HA 1WBXA 4H26A 2R0LL 5HY9A 2OJEB 2QTEA 1D5MA 2D4FA 4MVBD 4ORGA 3CFEB 3LS5H 4K3DH 1A1MA 1ND0B 2YKLH 4AEEA 4JRXA 4LVEA 5T1LA 4X80H 4ZD3L 4NFBA 4IIQC 3V5HB 2JJWA 1NMCB 1T0PB 4HPOL 4ZXBD 1Q9KB 1N59B 2MPAH 2Y36L 5F9DC 1CFTB 4UQ2B 2YRPA 4NO0D 1U8NB 5TF0A 4QEGA 5L8KB 4P2RD 4NKIL 2GSIB 5D5ME 5C0EA 3D85B 1UCBL 4I0CC 4FQHB 2XACC 4NIKB 2BVTA 3L3JA 4L4JA 3MLRH 1DQLL 3V6FB 5E6ZA 5GJSH 3RX7A 4LLAA 2O5YL 3D3VD 2VLJE 1KLGB 3TJEL 1XF2A 2ZNXA 3FONA 3Q1SL 2PKDA 2NY1D 1FZKA 3LCYA 4QRPE 4WU5A 1FL6B 2R2EA 4ZSOB 3MLUL 1NC4B 2P8PA 3UDWA 1HHJA 3BH9A 4M6MH 3BKCL 4JQVA 5E2VL 3ARUA 3T3MF 3HC3L 1XF5A 3QDGD 1KIUA 2FSEB 4G6KL 3NCJL 2IBGA 3GRWH 5I71B 5FM4A 1S7TB 4N8CH 5IK3B 3SKJH 4AENB 1BGXH 1A14H 1EHNA 3I6GB 1G7JB 5GSRB 3OJ2C 2A6DA 3U0WL 1IEBB 5MENE 1ADQA 1PX3A 4XVTL 4JJ5A 5IEKA 1I9JH 1QR1B 2XKUA 4DKEL 4B41A 2NY3B 1CG9A 5IV2B 5F1IB 1V3LA 5HYFA 4I2XE 4Z7VB 4Y2DC 2J2ZA 3I2CL 4KUCF 4LHUA 5FYJL 1P2CA 1NSNH 2H32A 3PGDA 4I77L 3SQOH 4UT9L 4TULL 1D5IH 5GS1C 1CIDA 4I4WB 5TH2A 1P7KA 3ETBF 1ROWA 4X5LA 3SE8L 1M1SA 4HZLB 4I18B 2ICWJ 2WW8A 1CT8A 4PJDB 3ULUF 4KY1L 3TNNB 5J6GA 2Z35B 3UBXB 3MNZA 5FUOL 4PJBF 4PRPA 3PJSB 2HFEB 1UXSB 2YD6A 4QRRD 3ARBB 3QXDA 2X9XA 4LSRH 2QSCL 5I1CL 2X05A 1H3PH 3DSFL 3ES6B 3VXSD 4MGXA 5D2LF 1Q8MA 5AUMB 2OSLA 5J3HD 1VFUA 1LILA 1ZMYA 1IAKA 4FP8L 3SQBA 5HHQB 5TE6L 3G6AA 1NMBL 3P9MA 1CDJA 2QQNL 4ZO9A 4XP4H 3HNTH 4W4OA 1AD0B 1VGEL 5FOJA 5EO0B 1C5DB 3QDHA 5DA0B 2FECI 4MDJB 1YY9C 2AJUH 3JTTA 5IMMA 3MLYL 3MZGB 5GS0H 4XP6H 4GKSA 3A6CL 1T0NA 4L8BA 1OB1B 4QT5B 3BX7C 4HPYL 4QWWC 5L2KE 5IB1B 4PRIB 3OHXB 5ENWB 1F11A 2OYPA 3V5KB 1T04B 3ZE1F 2DTML 5MHSE 1H8SA 3QDJE 1FAIH 1X5YA 4TSCL 4R4FL 1MFBL 2HT4D 4BUGA 1J1PL 1PEWA 3HPJA 4Z7UF 1JK8A 3RWGB 4M61B 1W0YT 5IHZB 4XNYL 5CBEB 2FYYB 4PP2A 3VH8B 2JELL 3CAFA 4R4BA 1OAQL 3FT3A 2WSKA 3HMWL 1CF8L 1PKOA 4ZAKC 4UDTA 2FL5A 2NY2D 3MRCA 5K59E 4X9BA 4E5XB 4PG9B 3QBTB 2VDPH 3SDXF 3F6LA 1FL5B 5I1GL 1KNOA 4TUOB 4GT7A 1WBYB 1NGZA 4KK8D 4WU7A 4JZOB 1XGRB 3OJVC 3UTTB 2G9HA 2ZPKL 2ESVE 2H41A 3EZJB 2VKXA 2B7DT 1WAAA 1CDGA 4HFUL 1I3GH 5H2BB 3FT4A 4GUPB 3WIHA 1OTTD 4J4PC 1XEDA 4G3YL 5EH1A 5CCKH 4IOIB 1CGTA 1JWSB 1MVFA 3VXQA 3TN0D 1ZEAL 2KQNA 2R0LH 1IM3A 1RZGA 3QDAA 4UTAL 4WWKB 3LPWA 4ZTPL 4KKBD 3TPKA 1F3JB 5C71A 3QFDA 2X4SB 4NNXB 4ZD3H 1AP2A 4OTXH 5ICZB 2W0FA 3ZKXB 4HPOH 5DRWB 3TT3L 1GOFA 2Y36H 3EO0B 5D70L 3HRPA 4C59B 3GMMB 4X7EC 4PJBB 5LGJB 2OQJB 2WBJA 5LWYL 2OTUA 2CLZB 1HDMB 3O9WB 4NKIH 2NW2A 3CLEL 3SGDH 2A6IA 1IC7L 4DKFL 1UCBH 2VO5A 4FG6D 2FEDC 3AB0B 4N0FA 3STZA 3MLTB 2JIXA 2ZOLB 3ZT6A 5D2LB 1DQLH 4L3EE 3BGFB 4KXZH 5TDPA 5J12B 3L95A 2O5YH 4OGZA 3VMOA 4DQOL 4P2RA 4LMQI 3TJEH 4PLJC 1MLCB 1TFHA 3X12B 1BREA 1NBYA 1DDHB 3Q1SH 4IOSD 5EZOL 4YGVB 1JBJA 4HV8A 2Z4QA 1JPSL 4FFWD 1EZVY 2BNQB 3IJHB 3VGFA 3MLUH 4P4KD 3R4DA 4W68A 5A2LH 3BKCH 2NW3B 3S9DB 5BMFL 3WFHA 5E2VH 5I2IA 5JOEA 4G8GA 3C8HA 4U7MA 1I7RA 1HKLL 1HHIA 3HC3H 5C0CA 4KKLD 4G6KH 4WTWA 3NCJH 2Q8BL 1IFHL 4LLYB 3MUGA 4NUJA 2AJ3B 5HHVL 4Y19D 3OKNA 5JW5A 1OM3L 3FAXA 4TTDD 3TO2A 3NMEA 4NSKB 3ARWA 3K4DA 3U0WH 1FFPA 4Y5YA 1F4AA 4U1KB 3HS0A 4XVTH 4Z7UB 3QDGA 2C3WA 4PJHF 1QFHA 3DX7B 3BDXA 5FYLD 5ITBL 4DKEH 2I5YL 3MMEA 4LDEB 1QPPA 5GZNC 4HUVB 1R0AL 2PYFA 1DTUA 1UWEL 5CUSL 2EXWC 5DJCA 4OF8A 3V7AG 3SDXB 4PJGF 5FYJH 2NXZC 5FB8B 1ORSB 3Q6FA 4I77H 4N8PA 4UT9H 3D39E 4TULH 4KV5F 5IVOA 4MQXC 2IPUG 1CU4L 4J1UA 2NY6C 2DIBA 3TFKD 3T77A 5B39A 1YEFL 1BHGA 1WZMA 4LARL 1UH2A 3SE8H 3ARDD 4LLWB 3V9FA 1TTGA 4KY1H 3U30C 5E7BA 4P49A 4CVUA 5FUOH 1V3KA 2Y5TB 4MSWA 3TBYA 1S7RA 1UKQA 3HZMB 3MLSL 4JREB 3T65B 1CXKA 3QI9C 2QSCH 1BBJB 2MKLC 4NQVB 5I1CH 3MR9A 3DSFH 4NZRL 3JV4A 1B3JA 3DMMD 3BQUC 2R9HD 5I8EB 4FP8H 4QRRA 1FV1B 3EO1B 1NMBH 1ZSDA 3OJMB 2QQNH 4D3CH 4PJ7A 1M7IA 2AJYL 3FQXB 5EO1A 4DOHB 4PJCA 1VGEH 3IAQA 3VXSA 1IARB 1JHTB 5IF0B 3CZFA 3PF2A 4B50A 5L0QC 3DGGB 5KVFL 3CGTA 5F6IB 4UV4L 5DJXB 3MLYH 1FLTX 1JN6B 3A6CH 4CDGC 4HPYH 2P24B 4WCYL 3MRQA 1XGQB 3MOAL 3OAZH 3KPSB 2FJFB 3DX9A 2DTMH 4F7PB 3V0VB 5BZDA 4TSCH 4R4FH 1MFBH 1RZFL 5BW7C 4U0RC 1P9MC 1J1PH 1ZV5A 1U95B 2BSRB 5J7CC 1J0IA 1OT2A 4XNYH 4LLQA 3MCLL 5FK9A 2JELH 2UY7A 1OAQH 3I50L 3HMWH 1CF8H 2WIIA 3AVEA 4F8TA 3UTPE 5ADOL 1JUFA 3EKCA 4Y16D 4OCXL 3GK8L 4I0KA 1HEZB 4YHPB 2X6MA 2LAGB 3D2UB 5I1GH 4NWTL 5AAMA 5E4EB 1UG9A 2OI9C 4ZPVA 2ZPKH 4QHNA 3VU2A 5DSCA 5MEOA 2F15A 3V8OA 4KRPC 1LE9A 2JE8A 3RWEA 4O58L 4PJHB 3IF1B 4HFUH 4OGAD 4R90L 1NGXA 2DWEB 3MZTA 3OB0H 2YUWA 4L8CB 1MI5E 4G3YH 3OR7B 1JIBA 5DI8B 3LB6C 4M7LL 2XWJA 1EEZB 1T22B 4BQ8A 1ZEAH 4PJGB 5HHXL 5DHYB 4HDIA 1UZ6F 2BXYA 1MVUB 3CK0L 3MRGA 2WWKT 3SOBL 5JOPE 3L3DB 3ARQA 4ZTPH 4OI8A 1U92B 3T2OA 4AEIL 1P6FA 5C6PB 1IM9D 2UWEE 3TT3H 1DQJA 2FCBA 5D70H 4EN3B 5JW3L 5LWYH 1XH3B 2O26U 4L9LA 4X98B 5DJ0A 3P11L 3OG6B 1J8HB 4XBPA 4A2LA 4JFYB 3EDKA 1GOGA 3CLEH 4PTUB 1IC7H 4DKFH 3QUMB 4UBDD 4OIAA 1MIEL 4LCIL 1EHXA 4LAQL 1T7WA 5I66B 4WO4D 5D2NE 5ID0B 1KG0A 3NOIA 3VD3A 4DQOH 1ORQB 2BNRD 2APBA 2AW2A 2YPLB 5T1MA 5EZOH 3BEWB 4YHML 3FB5B 1XT5A 4FXGB 1JPSH 1WBZA 3FZUC 5HYJD 2HVJA 1ACZA 4HKXA 1XMWA 4BQCA 4ALAL 2NLJA 1WBXB 4H26B 5BMFH 5HY9B 1HKLH 1D5MB 4OV6F 2ZUTA 3VGGA 1HHKB 4C56D 1Z0MA 2MSPA 4ORGB 2FX7L 2Q8BH 1A1MB 1I8IA 4Y5XA 4KROC 4DKDC 2QQQA 5ADPL 1GRWA 5T1LB 1IFHH 2DD8L 5LG1A 5HHVH 3DI2B 1FHGA 2DM4A 1OM3H 1MHPL 2P48B 3GSWA 4F7TB 3DSNA 2FATH 4GG6A 5ITBH 5C0EB 2I5YH 4R26L 3VWJD 5FYLE 1R0AH 2X1QA 3TEUA 2VN7A 1UWEH 5CUSH 3L3JB 1KACB 4DGIL 3WMSA 1L7TL 2BFVL 35C8L 4R2GD 3WIHL 1ZLWK 2VDRL 1A8JH 1E28A 5HYSA 1CU4H 4YPJA 1XF2B 1YEFH 3FONB 3I6LE 4JFPA 4LARH 4H8WC 4S11A 1PFCA 1FZKB 5ABDE 4WU5B 2R2EB 8CGTA 5FUCE 1FYHB 1I1AD 2P8PB 3BOVA 5C7XL 1HHJB 2NY0B 5IJVA 1OGAA 1XF5B 3MLSH 3E6FB 4QF1A 4CVZA 5D7SL 3PP3K 3ARDA 1GCFA 2X10A 2NXYC 4NZRH 3F7VA 4KTYA 2R0WL 2UYLA 2LABA 2A6DB 1B6DA 2M8XA 4MXVF 4V2BA 2E9JA 2W38A 3VGHA 5IEKB 1WAAF 4KK9C 1G9NC 3QNXA 1CG9B 2AJYH 5HHOA 4WFEE 2DI9A 2V5TA 3NIDF 2JKXA 5HSFA 3OV6A 5DLML 5EUOA 5KVFH 3UEZA 3ILPA 1PKQA 3OKKB 3CX5J 4JN2A 4LHUB 1T89C 1P2CB 1RJYA 2H32B 2KQMA 3C5JB 3PGDB 1T7VA 3K1KC 4HK0B 4Q9BA 4GG8A 5TH2B 4MJID 3MOAH 4AH2A 1P7KB 2BY3A 3ARSA 4I9WE 4MDIA 1U42A 1CT8B 4NQDD 5CAYB 5J6GB 1RZFH 3MNZB 4PRPB 5EOTA 5JIPA 3QJHA 4MA1B 3QXDB 2AK4E 3MCLH 1GGIL 3I50H 3Q0HA 4HS3A 4KKCC 5EA0L 4JJHA 3EIFA 5ADOH 4BSVA 4ZSOE 2OSLB 4OCXH 3GK8H 3S36X 3T0ED 4NWTH 4YPGA 1MFNA 1OCWL 3I3DA 4Y89A 3G6AB 3P9MB 4TSAL 1IGML 4JCLA 2VKWA 3F65A 1TVHB 2HTKD 2H32H 2B5IC 4O58H 1DP0A 4HH9A 3JTTB 3SJVD 5IMMB 4R90H 5IKCA 1OQXA 1OTSC 2X1XR 4GKSB 1T0NB 4HAGA 4L8BB 5DJYA 4JVWA 4QNPE 3ROOA 3M1BA 5F9JA 2KDGA 2NR6C 4YO0A 1A0QL 1YC8A 4FQQA 4M7LH 1I9RL 4WI2A 4WUUD 3K2UL 4IEFB 1F11B 5DGQA 5HHXH 1QNZL 2X2YA 3GBML 2VZ1A 4NKDA 2OR9L 3CK0H 5GZOD 1MJ8L 2BOBB 3QJFA 3SOBH 5HYQA 1JNJA 1E4JA 4MMXC 4LCWE 5CJ5A 3HPJB 43C9A 1JK8B 2D7NA 4M1CC 2FH8A 1FL3A 5E03A 5FGCB 2ID5A 4AEIH 5TFSL 2B4CC 4Y4FC 4R4BB 2D7QA 1Q1JL 3FT3B 5JW3H 4UU9A 3FO9A 1U8MB 5CLWA 4UDTB 2FL5B 3RIAF 3L5WA 3MRCB 3P11H 4PJDE 1KTLA 3BZDA 1I4FA 5FHBL 1X5FA 3ILQD 4WFGE 1E4KA 1V3MA 1MIEH 1TZHA 4ZO7A 4LCIH 4LAQH 1UJ3C 5B21A 1MCLA 1BEYL 1NGZB 3ABZA 4WU7B 2IADA 3REVA 2G9HB 3FOMA 4YHKL 1JNHA 3S34L 1EBAA 3FT4B 4YHMH 1Q72L 5EU7C 5JHDD 4KKAD 1P5VA 5IW3A 1K4DB 4WO4A 3VD5A 3VXQB 2X1PA 1RVFL 4UT7L 4S0SD 4ALAH 2BC4A 1IM3B 1CD1A 1RZGB 2BNRA 3B8YA 4U3CA 2FX7H 4Y7MA 3L3HA 2JJSA 5ADPH 1NFIA 3QFDB 2DD8H 5HYSG 5HYJA 1VFMA 1AP2B 2ITCA 2W0FB 2R2HA 4PBVC 4PJ7F 1MHPH 3NPSB 4LASL 1LEKB 2X40A 3CSYB 4FFYL 3PQYD 2WBJB 2OTUB 4Q7DA 1GAFL 3C9NA 4C56A 4HUWA 5L9DL 2NW2B 4R26H 2A6IB 4JKMA 4UIKL 2XN9D 2YD9A 3STZB 4N0FB 2JIXB 1PJ9A 2WANA 4HUUA 2YXMA 4DGIH 5TDPB 2BFVH 3L95B 4JKKA 35C8H 3WIHH 5D96B 2VDRH 4P2RB 2ORBL 4JDVB 3T3ME 3NCMA 1NBYB 4AM0B 2P4AB 2BNUA 3QQNA 2MWCA 4HV8B 2Z4QB 3O11A 3H0TA 2QBWA 4YFLI 2Y1VA 5C7XH 3UTTE 3WFHB 1XR8B 5I2IB 4G8GB 1I7RB 1HHIB 5C0CB 1R5WA 4LNVA 2LE9A 3R8BB 2VIRA 1KCVL 3ROLA 5D7SH 4K2UL 4OFIA 3QEUB 4NUJB 3MUGB 1AHWC 1WK0A 3OKNB 1I1AA 5JW5B 4DGYL 2R0WH 1QQDA 3V6OE 3TO2B 4ESKA 3S37X 1FFPB 4Y5YB 3H9SD 3WJJA 3HS0B 2DJ4A 1ZA6A 2P43B 5SWZD 3JUZA 3MMEB 3ZYOA 3MOBL 2PYFB 3VE0A 1UADC 2AJXL 3ZKMC 5DJCB 5DLMH 1DQML 1NQBA 4DEPC 4XNQA 3S4SA 4EEEA 2HYMA 4UTBL 3QEGL 4L8SC 3Q6FB 3CFDB 1FG9C 3W9EA 4PJBE 2XPGA 1U8OA 2D4DA 1OARL 1MPAH 1B4RA 3T77B 3HG1D 1B2WL 5F6HI 4YR6A 2QEJA 1TTUA 5EU6D 4X6DA 5D6DA 2YPVL 2P46B 2WM0A 5IFAL 4RAUA 4P23A 4MSWB 3TBYB 1S7RB 4U1IA 4W4NA 4XZUA 1AD9A 5FYJE 1S9YA 5J11B 3S3SA 1GGIH 2VITB 4Y2DD 3IRPX 1P6AB 3MR9B 2AK1L 3L3OB 5EA0H 2YK1L 3JV4B 5BV7L 3WN5C 5DJZB 4JEGB 1M7XA 1Z9OA 2YRLA 1CLYL 4E41E 3C5SA 4QRRB 2XTLA 2YD1A 5IM7B 1OCWH 2GY5A 3RX8A 4YDVB 1LE5A 1B0GA 1ZSDB 4TSAH 1IGMH 1QFWM 4PJ7B 1M7IB 1NPUA 5EO1B 4NBXB 4LPXA 2NTFA 3VXSB 3RBSA 3CZFB 4JFDB 1Y6MR 2F9BT 4XXDA 4AJ0A 1BZ7A 1TQBC 1DN0A 4Z7UE 3MRQB 1A0QH 3FQNA 2HA1A 1I9RH 1T6WA 3K2UH 3VI3F 4O2EA 1QNZH 3GBMH 3DX9B 2X4TA 2OR9H 5BZDB 1MJ8H 3MRMA 1F4XL 4KZEL 3SJVA 3HR5A 3SDXE 4M9PA 1H5BA 3UTOA 5FEBA 1PX4A 4XGZA 5FDWA 5I16A 1PVHA 4E0RA 4PJ5A 4P3WA 2GFBB 4U3HA 4WUUA 4LLQB 1OAYL 5TFSH 5E08L 5JXEA 5FK9B 5HPOA 1Q1JH 4LSVH 5D7KD 1YY9D 4K55A 3BRDA 3CH8A 5GJTL 1JUFB 5HHNA 1O7SA 3JV5A 4LKCA 4LBEA 5FHBH 5T5NG 2VTFA 4OGYL 4HF5L 4QWWD 4O2CA 5FM5M 1U8PA 3MREB 1A1OA 4WFHD 1BEYH 5IB5A 4OF6A 5DSCB 3RIAK 5MEOB 1LE9B 4YHKH 3S34H 3RWEB 5CJOL 5GRVK 32C2A 1O7VA 1NUFA 2VERN 5GGRA 4M93C 5HI3C 1NGXB 1SJEB 1Q72H 3RFZC 2I9TA 4ZAKD 4WTZG 2AV1B 1Q9LB 1RVFH 2XWJB 4UT7H 4XPTL 3WS6C 1Z9LA 3VDBA 4HDIB 3LKQB 3MRGB 3U4EA 3O6FC 4OLUL 5JHDA 3O8XC 2J1KA 1HI6B 5E8DH 3UCRA 2QHRL 3GBNL 5F3BA 4LASH 1ACYL 5C09B 4FFYH 2J8UE 1GAFH 5DJ0B 4J4PD 2DQEL 3WJLA 3PQYE 5HGHA 4YBLB 5L9DH 4UIKH 1CD8A 2N1KA 4W81A 5SWSD 4YAQA 4PGDA 4OZHA 3L6FA 2XN9E 1S5IL 4LLDB 5F9OL 3MX0A 4Z78A 5CJXA 3GI9L 4X0KA 3BPNC 2VISA 3VRJA 4BUHA 2ORBH 1SEBA 3C6LB 4RRPA 2CLVA 5T1MB 1X5LA 4ONGL 2X5PA 1BMGA 3ZZ1A 1WBZB 2HVJB 2E3VA 2E9BA 4HKXB 2NLJB 3MRJA 2ZUSA 2FZ3A 3OMZA 2FEDD 4PJHE 3S4SG 4IIQA 5KSVA 4Q2ZA 1MY5A 1KCVH 4F33A 4K2UH 3OR6A 4Y5XB 5JZ7C 1AGCA 1BFOA 4JM2C 1AXTL 4PLJD 1IAMA 4ELMF 4PJGE 5BV7B 3GSWB 3N1PC 4F9PC 4XHQA 3MQIA 1IJ9A 5HBBA 1YNLL 3RJQB 3OJDA 5FYKL 5GGSY 4KI1A 3MOBH 2AJXH 3L3KA 1DQMH 3RGVA 2RCSL 4OQ1A 2VZVA 4OI7A 3QEGH 5KVGL 1P7QB 5SWZA 1E28B 5HYSB 5D72L 5HD8C 1OARH 3V79C 5D7LD 1B2WH 3DGCR 1EAPA 3QUZC 4JFPB 4S0TD 3WFCL 4F15C 4EI5A 1IAII 4H0GA 1BX2A 4K71B 4LOUC 2YPVH 6FABL 5IFAH 5JW4M 5IJVB 5DC9B 1OGAB 1QSFE 3EZ8A 5GZND 4QF1B 4CVZB 3HG1A 2EXWD 3CFJA 1ZLVK 1CXHA 2AK1H 3T0DA 2NXZD 2YK1H 5BV7H 3F7VB 1S9XB 3ZT7A 4MQXD 2HFFA 1CLYH 4G6JL 2NY6D 4NN6C 4OKDA 1U8JA 2ZSVB 4Y2DA 1XGYL 1JGLL 5HHOB 2LVCA 1Z5LA 1J1OL 5GS1A 3TJHC 2XKNB 3JWNC 4J3TA 3ILPB 2VZOA 5T5NF 5EC1A 1PKQB 1ZS8A 3QQ3B 1DE4A 1E6JL 1RJYB 1OT1A 3QI9D 3E8UL 1EFXD 1DQQA 4GG8B 4LK4A 5GIRA 3BQUD 1I9IL 3T3PF 1VADA 2EECA 1F4XH 3D9AL 5D8JL 3MA7A 5E00A 1I7TA 4RGMB 5EOTB 1HILA 4FQXA 4KKNA 4MQSB 3HPLA 1S5HB 3IJSB 1OAYH 5E08H 3RDTA 4R4NC 4LCCB 4HS3B 4CUCA 5I30L 5GJTH 5E95B 2KUTA 1WFTA 4BSVB 3MLWL 2E9IA 4OGYH 2HG5A 2VR5A 4HF5H 1A6AA 4YPGB 2I60L 5AYUL 4FABL 4Y8DC 2H3NA 4PBXA 3LD8B 5CFHA 3MBEC 1N3NB 2X89A 4XAKE 4ELMB 5C9KA 4R3SB 3WO4B 3EUUA 5C9JA 5CJOH 1FE8L 5IIEA 4HH9B 1HXYA 4PGZA 3PGCA 2GT9A 5IKCB 1YEIL 2F53E 1XR9A 2AQ2A 5DJYB 5LKNA 3ROOB 3M1BB 5F9JB 2D31B 4YO0B 1N0XL 3H3PL 4FQQB 2EYTA 4XPTH 3DO3A 1BJ1J 1T0MA 3RWCA 1EPFA 4NKDB 5AZEL 1E0OB 1AQKL 2CKNA 1LQSR 3DYOA 3JV6B 4OLUH 4PY7A 5DEZA 43C9B 1KULA 4R0LA 1KCKA 1FL3B 4EDWL 4KRPD 4RRPG 2QHRH 3GBNH 4IDLA 2E5EA 1JE6A 1ACYH 4UU9B 5GRUL 3FO0L 4PY8J 2M2DA 5DRXA 4HEPG 4ZUTA 2DQEH 3QB7C 4XAWL 3RJDA 3ARFC 2GJJA 3LB6D 1YUHA 1V3JA 4PRPE 3K8LA 3BIAX 5SV3A 1S5IH 1LGVA 3REVB 5F9OH 3GI9H 1EUTA 3FOMB 4PY8I 4J4PA 1JNHB 3WYRA 1JZ3A 1OLLA 3SE4A 1RU9L 1PEZA 2P5ED 2X41A 3SCMB 4ONGH 3AU1A 5BCAA 4D2NA 3UP1A 3IDJB 4LPUA 4WO4B 3DXAD 1HXMA 1YEDA 4ZQKA 5DTFA 1CD1B 2E27L 3BPLB 4YX2L 2BNRB 1U3JA 1YPZA 2V2XB 2OCFD 3NAAL 4ZFOA 3L3HB 5EOQL 1H0DA 2DQGL 3SKOA 5HYJB 1V7ML 2QADC 2ITCB 3K46A 4ELKA 2R2HB 3I75A 5EWIH 4QRUA 1AXTH 4DVBA 1BQUA 1EDQA 2XRAL 1N6UA 1K5NA 1U58A 4AIXA 3C9NB 3X3FL 4HUWB 5DD1L 1YNLH 3FZUD 4WJ5B 5FYKH 5C0AA 5DHVH 4J3WA 4GAYA 3IU3A 4YDJB 4MNHA 3RVTC 3CVHA 3VFWA 2RCSH 2WWMC 3QXWA 5IB3A 2I24N 1EFQA 4NP4L 4HUUB 3BH8A 3EOBA 5KVGH 4W6XB 5C0NC 1XFPA 1K6QL 4M4RA 4KROD 3QIUC 2GCYA 4ODBD 4OIBA 5D72H 4MNGE 1U8KA 4RDQF 3WFCH 4FOMA 2UVEA 3O11B 2BY0A 3H0TB 5E8NA 4M03A 3SDYL 4BK5A 6FABH 4MXVE 1EIBA 1V8HA 1G7LA 5DGRA 1WAAE 3K0WA 1R5WB 5D7LA 2VIRB 3ROLB 1L7IL 3PWPD 2LTQC 3RIFF 2Q86A 2Y7QA 4OD2A 2YD3A 4YHNA 3NIDE 1I1AB 1ZAGA 3MYZA 5IOPA 1QQDB 3VXMA 1N6QL 4OSUL 4G6JH 1IE5A 4WI3A 1QVOB 1GJIA 1UZ8A 2DYPD 1XGYH 1JGLH 3KLSA 5LJYH 2GW5A 1PDKA 3VE0B 5HHPB 1J1OH 5EZIL 3BD4A 4XNQB 5IMLB 3S4SB 4P57A 1R5VA 1E6JH 4ZFZA 3VFOA 3W9EB 4OV5A 3E8UH 2XPGB 1U8OB 1I3VA 2NXYD 2V2TB 4PPTA 3MXVL 2IFGA 5IVXF 2Q3ZA 1I9IH 3RGHA 1IQWL 5D8JH 3U6RA 2B1HL 4KK9D 1EEYA 4XP5L 1PQZA 4RAUB 5DJ6A 2PN5A 3BP7A 4P23B 2XWTA 4U1IB 1NH6A 4XZUB 3NH7L 5CIPA 1AD9B 3P77A 3MJ6A 2XZQL 4K8RC 3DYPA 3BQUA 1IQDB 3BMWA 5I30H 1T4KA 1AGEA 3TZVC 3U4BL 3MLWH 4OCSH 3C5SB 4M6OL 1SVCP 4K9EL 1ED3A 2I60H 4FABH 1QHPA 3KPTA 3EDJA 1LE5B 1B0GB 1ZE3C 2XZZA 4WDIA 2NTFB 2Q7YA 4XPBL 4U33A 2DTSA 4XXDB 1FE8H 1BZ7B 4YHYB 3MV01 1DN0B 5H35A 4ODXA 3SDAA 1YEIH 2RGSA 4NHCL 3WFEL 3K8MA 4U1GB 4KKCD 1N0XH 3H3PH 4HWUA 5BW7A 5GXBB 1OF2A 4WW2C 1P9MA 4O2EB 4OUOA 2X4TB 2ZUYA 3MRRA 5AZEH 1AQKH 2CSPA 3MRMB 4UI2A 3SJVB 5C2BL 3HR5B 3BESR 2VL4A 5ESQA 5ITFA 1QLFA 1H5BB 1YJDC 2C3GA 4XGZB 3MA9L 5FDWB 4JY6B 5I16B 1NFKA 3KXFD 4EDWH 4E0RB 4PJ5B 4XXCC 1WLHA 4WUUB 5GRUH 1GL4B 5HGGS 5BVPL 2X1OA 1XCQB 3FO0H 1NDMB 5CKAA 2YXFA 1OTSD 1MFDL 2X4UA 4C83A 4LKCB 4LBEB 1XF4A 4Y0GA 4XAWH 3T0VA 2C1OA 2NR6D 3U36A 2DM2A 1CDIA 1T3FB 2XI9A 4O2CB 4FQ2L 1U8PB 3DI3B 2IALA 1HYSC 3NGBC 1A1OB 1MOEA 3O6KL 4YHZL 4K3HA 1RU9H 2YEZA 4M1CD 4WHYG 4OGXL 5GGRB 5JW4R 1NAKL 3E2HC 3RRQA 1ES0A 5D1ZA 3UROR 4XPFL 2IBZX 2GAZA 2I9TB 4PRNA 4PRHD 4IRSB 1DBBL 1BP3B 2FEEL 2DS4A 4J3OC 4PJ7E 5LGHL 1SJHB 2E27H 4YX2H 4JFDE 2P5EA 3O0RL 4POUB 3U4EB 1KTDA 3NAAH 4PYHA 1BZ9A 3TC9A 5EOQH 1EHAA 3BDYL 5IVXB 2DQGH 4JG1L 1V7MH 4RGOL 3G5XA 4UNVA 3DXAA 5KANG 2XRAH 5DMKA 1N8ZA 2VABA 3X3FH 5DD1H 5HGHB 2BVUA 3UBXI 4YAQB 1LEIA 2W65A 5HDQL 4PGDB 3L6FB 1KXTB 1BD2D 1B88A 4NP4H 2A83B 4PJ8C 2X09A 4M5YL 5JHLL 4L4TD 4Z78B 3QEQE 1K6QH 1H8OA 1CXEA 1KJVA 2VISB 4X0KB 5KAQG 2FGZA 1SEBB 3OQ3B 2CLVB 4ZUSA 1X6NA 3O3BB 3INUL 2HAZA 5FM5O 3SN6N 3AY4A 4XI5C 3SDYH 4LFHD 3MRJB 2FZ3B 3N06B 2CK0L 5GS3A 2V7NA 4IIQB 5KSVB 4Q2ZB 4CADB 4F33B 3OR6B 4R7NA 1BFOB 3PWPE 4JZNA 1T21A 1N0LA 1N6QH 4OSUH 5INCA 2M26A 1F13A 5CINL 4Z76A 2EDJA 4OCLC 3OJDB 1G7MB 4X6EB 1L9NA 2VQUA 4WEMB 4C4KO 3IAGC 1IGTA 3N1FC 4KGLA 3HI6L 3D25A 3L3KB 5EZIH 3RGVB 3RY5A 2R29L 2EDQA 3NPZB 4D9QE 5C09E 4NZUL 4G8EA 5SWZB 1G9EA 1A6ZA 3H9HA 2DYPA 1P84K 1T1YA 3KS0J 3BPOB 3MXVH 1EAPB 4EI5B 1OTUC 1WT5C 5M7QA 3DNKA 4F37F 1JRHL 1T03L 1IQWH 5EZJA 2B1HH 3KVQA 3SGDI 4XP5H 3P73A 3VXOA 4LEXH 2R8SL 3NH7H 2FHFA 3HG1B 3ZKMD 2XZQH 2XA3A 3CFJB 3HI5L 4KXZI 5I0ZA 3WS3A 1QBAA 5CS7A 4L29A 1D6EA 3GMPA 3U4BH 1DBKL 4GOSA 2HFFB 5E2WL 4WV1C 1BJMA 4M6OH 1D9KC 2ZKHH 4G7YL 4K9EH 1U8JB 3CVHL 3B9DA 2IBBA 3ELAT 3SO5A 3OB0K 3D18A 1T89A 1Z5LB 4XPBH 2X4NA 5GS1B 1VPOL 1MCBA 4P3DA 1KN2L 2IJ0C 1TNMA 3MNVA 4U2ZA 5C08D 4PJXA 4QTHB 1DE4B 1FSKC 4NHCH 5DURB 3WFEH 4MJ6A 4GJTB 4ZUWA 1DQQB 1YPZF 3DX6A 4L4VD 1I7UA 3DTXB 2CR6A 1VADB 2MHAA 3MRNA 5GGUA 4XCFL 1CD9B 5C2BH 4DUXA 3THML 3ULSA 5E00B 1ONQA 1I7TB 3MA9H 3PDOA 1HILB 4FQXB 3LKNA 1RURL 3HPLB 2VR4A 3RDTB 2FO4A 1FFNA 5BVPH 3IXTA 4NBZB 1MFDH 1AR2A 5SX5K 2HG5B 2DL2A 1A6AB 3KXFA 3KYNB 4FQ2H 3GSOA 3HI1A 4V1DD 5DVLA 2H3NB 1TNNA 4UDUA 1U8QA 3O6KH 4U6XA 4YHZH 1HWGB 4HJJL 5EOCJ 3IDXL 5F8RC 3LQAC 3GHBL 5E8OB 5IIEB 1HXYB 2WUCL 4OGXH 3PGCB 1NAKH 2Z91A 2VXUH 4XPFH 1XR9B 2CGRL 1EGJA 4JFEE 1DBBH 1JF1A 3RWIB 2EICA 4Z8FL 3V7MA 4PRHE 2EYTB 3FL7A 4XTRC 2AJVH 5LGHH 3IDYB 3ZE0F 1T0MB 4X5XA 3O0RH 3ISWA 4WFFE 4KJYA 5GQBA 2ENYA 1PKQE 4PY7B 4RFEA 3BDYH 4JG1H 4R0LB 3X3GL 4RGOH 3VI4F 4DK3A 1MQKL 3TA3C 3VWKA 4M7KL 5IJKC 1AQDA 1IGFL 3GM0A 5DRXB 4EUPA 5HI3D 1WITA 4LHQB 1UJ3A 5C0GA 1EXUB 4XNUL 4WHTA 1YUHB 3NBNA 5HDQH 1MCKA 4YXKL 1FG2A 3UYRL 5E4IA 5HHMB 5TGBA 4M5YH 1BD2E 1MNUL 5JHLH 3FQUA 3O6FD 2ZSWA 2BVEA 1ZVSA 2HTLC 4JKWA 3O8XD 3U4AA 5DYOA 4N1EA 4RFNB 5GISL 1FVDA 3INUH 3KYMA 4PJAA 1BFVL 2DQUL 4L4TA 5I9QC 4ELME 3QHZL 1HXMB 1YEDB 2ARJQ 4ZQKB 2CK0H 1YPZB 3STLA 4ZFOB 1H0DB 3WIFA 1Q38A 5ID1A 3I75B 4NPYA 4QRUB 4DVBB 1QFOA 1K5NB 1U58B 4Z7NF 1PAMA 2C3XA 1J0JA 1QR4A 1JPTL 3O3DA 4EI6A 5CINH 3HUJA 5C0AB 5HPMA 4GAYB 1KLUA 3IU3B 3M8OL 1ITCA 2HLAB 3CVHB 1Y6KR 2FX9L 3HI6H 1DUYB 4NKOA 3VFWB 3VMNA 5IB3B 2R29H 3FRPA 4NKQB 1MCRA 3QUXD 1NL0L 4GRMB 3EOBB 1GZQA 4NZUH 1AO7D 4P9HC 2Q87A 4OM0L 3SDDA 5JZ7D 1UXWA 3K4AA 1B90A 1QRNA 4FXKA 2YWYA 2DMCA 4JM2D 4F8QA 3LEXA 3Q6GL 5E8NB 5FYKE 1JRHH 3QQ4A 4G9DA 1T03H 4K3GA 3LH2H 4YZFF 3QFJD 2R8SH 3BRFA 1AHWA 5D7LB 3HI5H 4WHYH 2X4OB 4K94L 4RAVA 4AIOA 2Y25A 2NY4C 3BWAA 3RL2B 2Q86B 2Y7QB 4IOFC 4OD2B 1A7QL 1S7VA 1DBKH 4UNUA 4J6RL 4I5BA 5IOPB 5E2WH 3VXMB 1RFDL 5HD8D 5F97E 4G7YH 2R0ZL 3O41A 3QUZD 4FQJL 5DD3L 5GRWA 4GRMA 1UZ8B 5DQJB 3CVHH 4LOUD 3KPLA 4KK5C 5D7JC 1VPOH 1J8KA 1KN2H 4U7SA 2NY6B 4P57B 5EU5A 4OZFG 1R5VB 4ZFZB 1X9QA 4UV7L 5C08E 3VFOB 4F80A 4OV5B 2GSGA 3SE3A 5F7HA 3V4UL 5DR5L 1FDLL 3WLBA 3F7YA 3BIBX 4J7RA 4OFPA 3WO3B 1URLA 4R7DA 4A2MA 3U6RB 5DJDA 1EEYB 4JFFD 3ZDXF 1PQZB 3F12A 3THMH 3QUYC 3BP7B 3WE6A 2XA8L 5J0BA 1RURH 4L4VA 5CIPB 3WN5A 3P77B 3BQUB 3TJHD 1JZ4A 1T4KB 2AS5M 2PXYA 3G5YA 3C60B 5DS8A 5EUKB 3QNYA 1N64L 4M1GL 4XBEH 1ED3B 1DBML 3RTQC 4DAGL 1PY4A 3LEYL 1D7FA 1N26A 4GSDL 4WDIB 2VLKA 1IGIL 2Q3AA 3IDXH 3GHBH 4MAUL 2WUCH 5H35B 1S7SA 1BVKA 2LVEA 4ODXB 3SDAB 4EUPG 2OTWA 2ATKA 1RAMA 4R4ND 2CGRH 4V1DA 1SHMA 4H25A 2ZG2A 2PETA 4YUEL 4Z8FH 1JL8A 1OF2B 2VXSL 3K8KA 3MRRB 1ZHNA 1XF3A 5C86A 5CIPH 3ET9F 5ESQB 5ITFB 1QLFB 4XH2A 3MBED 2KKQA 3X3GH 5C0BD 2G2RA 1MQKH 2RQ8A 1G84A 4M7KH 2JK5A 1ZLSL 2HH0L 1NLBL 1IGFH 3TO4C 1Y0LA 3V4PL 2C7UA 1GOHA 3AREC 5A2IH 2X4UB 2HT3C 4BFIA 1XF4B 3BKYL 8FABA 3P4OB 3PWVA 2AXHA 2C1OB 2OI9B 4XNUH 3U36B 2ZUXA 1HHGA 1X7QA 4YXKH 2IALB 4XWOC 3UYRH 3AM8A 3QXTA 1F4HA 4JN1L 1MCWW 3VDCA 4K7FA 5EBGA 4ODWA 3GMQA 4OT1L 3QQ9C 4ORZC 1JYWA 2YEZB 3U7WL 5DUBB 1A7BA 1T7ZA 5B3NA 5D1ZB 4L1HA 3WS6A 3ZKSD 5GISH 2GAZB 4HCRA 4PRNB 3LDBC 1MEXL 1BFVH 5TPWL 4Q9QL 2DQUH 2E7HA 3LZFL 3ECBA 3O6FA 1CN4A 1CFBA 3QHZH 2VDQL 2PUQT 3ARFD 1QSED 1KV3A 3O8XA 4TVSa 3FRPG 2JJTC 2PYEA 4MMZC 3QAZC 4RGNE 3G5ZA 1HQ4A 3CMGA 1BZ9B 1PD6A 5FYJU 4Y4HA 3VGEA 1WIPA 4Z18A 3SGKC 3VXUD 2C9AA 3T08A 3H3BC 5F88A 3G5XB 3E3QE 3DXAB 1N8ZB 3R8QA 3EFDL 4QYOA 1JPTH 4LRNL 1X3DA 4PJXF 4AIZA 3HC0A 4FS0A 1RIHL 4JPWL 3M8OH 2W65B 2FX9H 1JCKA 4PJ5E 5ACMA 2GYSA 1NL0H 3L5XL 1KJVB 4OM0H 4TSBL 4E42A 1LEGA 2I07B 3ZYJA 2QADD 4ZUSB 2DB8A 4YE4L 4FXLA 1JWUA 2CUMA 2CQVA 1ETZA 3QUXA 1IGJA 1SEQL 1AO7A 2VH5L 1NUNB 2Y06L 1BVZA 5HI5C 2V7NB 3RVTD 5I74C 2AEIT 2WWMD 3B9EA 1FYTD 4R7NB 4K94H 3V6ZA 3QWRD 4JZNB 4KHTH 1A7QH 1T21B 5C0ND 4F9PA 4J6RH 2F74A 3QIUD 1D5ZA 2YA2A 4NM8L 2EC8A 2PTTA 1PSKL 4Q6IC 1SMOA 3QFJA 5INCB 5IT2L 2R0ZH 3G08A 4FQJH 5DD3H 1TPXB 4NZTL 4Z76B 5E9DD 5IVXE 1IGTB 1UWXK 4MZ3A 3D25B 3KNBA 1XCTA 4YWGL 1QPXA 4ONFL 1GZPA 3QUZA 1G7HB 4GAFB 4UV7H 1ZHLA 4KMLB 3DVIA 3V52L 4LEOA 3V4UH 3H9HB 4C4KT 2DYPB 1FDLH 2PTUA 5DR5H 5KVDL 5J06A 1QYGL 1T1YB 3SKMA 1BQSA 2EEAA 5DMIL 2BSSA 4M00A 3FB7A 3KWWB 1UH3A 3R0MA 4HC1L 2MTPA 3I6KA 3P73B 3VXOB 2NXYB 2XA8H 1EV2E 1ZT1A 4KPHL 4LP4A 3WS3B 3KDMA 3C87A 4DJMA 4L29B 1TMCB 1D6EB 4X7FC 5L7XH 3GMPB 2EDRA 4PRAA 4JFFA 1MCDA 1BIHA 2JCCA 1N64H 4YDLC 4M1GH 3PL6C 5HGDA 1IGYA 4Y2OA 1DBMH 1MQ8A 4DAGH 3LEYH 4O02L 3D18B 2VLRD 4GSDH 5GGQH 1TJIL 2HVKA 1OSPL 1IGIH 2HN7A 4YXHL 2X4NB 3EBAA 3ME0A 4MAUH 4XNZC 2IAND 3MNVB 4PJXB 4GH7B 4JVPA 5EBWB 3TM6A 4K7PL 4K8RD 3RWDA 1F3DJ 4MJ6B 4ZUWB 3DX6B 2GY7B 3Q2CA 4YUEH 3S35X 3TZVD 1I7UB 4NDMA 5E70A 4OLWL 2VXSH 1EX0A 4MA3A 3UZQA 3ZHLA 2MHAB 4PS4L 3S5LA 5GGUB 3O6ML 4PREA 4S1RL 3ULSB 3D1MC 5D7IE 5AEAA 3PDOB 3KJ4B 5C07D 2VNCA 2ADJB 2Q20A 3HE7C 3X14A 1LNUA 1ZLSH 5C0BE 2HH0H 1NLBH 2FO4B 1FFNB 1JZ8A 3V4PH 3IXTB 4U6HA 2ICWA 3BKYH 1CGSL 1MRDL 1BOYA 1FRGL 3JVGA 1DUZA 4D9RD 5F7FA 4NN7C 4NN5C 2DIAA 3GSOB 2PF6A 3HI1B 5D6CA 5KVMC 2J8OA 1J88A 4JN1H 4UDUB 4JO2L 3VFVA 4OT1H 3SBWC 3U7WH 3U9PL 3D5OF 4B7LA 4MS8C 3PV6A 4OIIL 4D8PA 2GJ6D 4IRJB 1MEXH 1JF1B 5TPWH 4Q9QH 3BJ91 3LZFH 2D9QB 2VDQH 1MCNA 4MB5A 4X9FA 1HYSD 2V9RA 1QSEE 2F8VA 3DUSA 4KJYB 1A7OL 1E27A 1KPVA 2XFXA 4RFEB 3MLVL 1NCNA 2VXVL 3GZKA 4OZFH 3VWKB 1K3IA 1CL7L 4RMVA 3ARFA 2Z31C 3EFDH 4FMFA 2XNAA 4MXQC 4EUPB 4GO6B 4LRNH 1UJ3B 5C0GB 4JR9L 2GHWB 5E2UL 1RIHH 4JPWH 4WHTB 2C4FU 3VXUA 4J8RA 1FG2B 1YEJL 5TGBB 5FM8A 1VEOA 3FQUB 1TETL 5ALCL 3L5XH 2ZSWB 2XQYG 1MWAA 1A7RL 1ZVSB 4TSBH 2CDGA 5KOVC 3P2TA 3MYJA 3C8KB 4M62L 3B9KC 3GNML 2APXA 4YE4H 3TIDA 2K9UA 3G5VA 3D6GA 1FVDB 3KYMB 5E8PA 1YQ2A 3FN0L 4EZMA 3OKEA 4L4TB 2X70A 4LPYA 1M6OA 5T3ZD 1SEQH 4MJ5A 2VH5H 4UOW1 4PD4J 2Y06H 4N9GA 3ZMRA 2EDYA 5FUZL 3WHE0 1VHPA 3STLB 5CEZL 1JPST 3WIFB 1OPGL 4PJ8D 3L7EA 1EJOL 3MV7D 4P2OC 3ULVL 5ID1B 2VDNL 3QNZA 4EUPH 2KH2B 4NPYB 5J1SC 5A3IC 4GKZB 4NM8H 1OQOA 3IB4A 3EYSL 3GKWL 1PSKH 2O5ZL 1QFPA 5IT2H 4JFHD 3O3DB 4N90E 4EI6B 4NZTH 2ED8A 2NX5D 1DR9A 2VL5A 3QWRA 5HPMB 1KLUB 2MFNA 4XI5D 4NKOB 3WL9A 3MV9D 1E4WL 1RHHB 3AMKA 3CLFL 3QIUA 1JYXA 4YWGH 1MHHA 4ONFH 4F57L 4TRPL 3V52H 3FQTA 1Z2KA 3SDDB 3IDIA 5E9DA 5HYEA 1UXWB 5KVDH 4HCRL 1QYGH 1QRNB 2DJSA 5DMIH 1NGYA 4FXKB 3V95A 2BOCA 4MAYC 4KZDL 2ERJB 5JMRA 3LEXB 5D2NC 2Y5EA 3MACL 3QQ4B 4G9DB 1REIA 5HHME 4HC1H 4OZGE 1PYWA 1GHFL 3ULVF 1F2QA 4NC2B 4KPHH 1J5OL 1KB5A 2K7QA 4OF0A 4L8DB 4KJWC 4RAVB 2AJZA 3IDGA 1I8KB 1S7VB 2CPCA 4I5BB 2C4FT 5AZ2L 4P46C 3S5LG 2NMSA 1OTUD 1YPZE 1OLZA 4DEPB 4O02H 1SBBA 3KPLB 3OGCB 3VXRE 1TJIH 4WWID 1OSPH 4N0UA 3N9GL 4YXHH 1YN7A 2EYSA 2VLRE 4PGJA 3RI5K 5EU5B 1U3HA 3DHJA 3QDMD 1KJ3L 4OFKA 4G9FA 2IAMB 3B8SA 3D0LB 3WLBB 1DVFB 3F7YB 4UAOB 5CD5C 4XMKL 1KTKE 4OLWH 3CFKB 5E94B 1ZLUK 1D9KD 4R7DB 1CXFA 2AXFA 2IANA 4PS4H 2YN3A 3O6MH 5DJDB 5ICYA 3QXUA 4S1RH 3F12B 3BSZL 1ZT4A 3WE6B 3D87B 1VFAA 3P3YA 4L4VB 3TZVA 3WN5B 5IB2A 4JANB 4HUKB 5FUCC 2W0PA 4Q9RL 1SJVA 5LGKA 5CGTA 5DMJB 3VD9A 2PXYB 3ZHKA 3S96B 5DS8B 1CGSH 1MRDH 4HXBL 1FRGH 2EEBA 4XP9L 3MFFB 4ETYA 5C07A 2NTSP 3RVVC 4D9RE 1JTOA 3IU4L 3FFCD 1ZT7B 2CUIA 4NCDA 4JO2H 2VLKB 4NO3A 3ZE0E 4RFOL 5FHAL 3U9PH 4AEHL 1W0VA 3VXME 1S7SB 1BVKB 4OIIH 3CX2A 2OTWB 2ATKB 4XMLL 1JTPA 2EDNA 4LIQL 2XTJB 4V1DB 3TBSA 3VI4E 4H25B 1YMMA 4GKNA 2VQ1A 1NMCC 5BQ7A 5IR1B 2VAJA 1ZHNB 2FX8L 1XF3B 4X7DC 3O45B 4XHJC 4XXCA 5F1NA 5ERWA 3O4LD 4XH2B 3MLVH 2VXVH 3RHWK 4M7LT 1CL7H 4WI9A 3UPCA 2YA0A 1Y0LB 2C7UB 3O2DL 4N5EC 4BFIB 5E6YA 8FABB 4JR9H 4Z5RA 4PG2C 4F9LC 3PWVB 5E2UH 1KELL 4Z7QF 1HHGB 1X7QB 4XTRD 2RB8A 1YEJH 1LMKA 2DLGA 3TBTA 3VJ6A 1WWBX 3D69A 2DLEA 1TETH 5ALCH 4ODWB 5FA4A 2D7PA 1A7RH 1YQVH 2FHCA 4M62H 3C5ZB 2YHGA 1T5XB 3GNMH 3TA3D 1MREL 1VB9A 5T1DL 2B8OT 5I71C 5BZWA 1IEHA 4MCZA 1H3XA 2IH3A 3FN0H 1FCGA 4HLZG 2DRUA 1DCLA 3O6FB 3ECBB 1G9ML 3QEHA 4JKPL 3KJ6L 4OFYD 3W9DB 3O8XB 5I73B 1MCEA 4PJEE 2PYEB 5FUZH 2JCCF 3G5ZB 5CEZH 1HQ4B 5F7MC 4Y4HB 2NY3C 1OPGH 3MODL 1AE6L 5J9PA 1YMHA 1EJOH 1QBBA 5K9JL 5DO2C 2FO1A 3ULVH 4Y1AE 2J3SA 2VDNH 1JGDA 3GSXA 5ANMA 2C1PA 1JTTA 2HTLD 2DI7A 3MV7E 2IMMA 1AGDB 3EYSH 4YGAB 3RPIA 3GKWH 4OFVA 2O5ZH 5GGRY 5EC2A 4ODHL 4QYOB 5J4MA 3BYTA 1LP9A 3S88L 4AIZB 2VAAA 3NA9L 3HC0B 4HWEL 2F19L 4PJ8A 5GS0C 3MPCA 4D0CA 4TVPD 5JA8B 1E4WH 1MHCA 1Y6NR 4JQXA 3CLFH 2OJZL 4DZBA 4JHBA 1FH5L 4F57H 4TRPH 1NGQL 4PTTB 4S1QL 1I1YA 1CK0L 4MYWB 2F54E 4CMHB 1NJ9A 4HCRH 3ARBC 1A64A 5KSAB 1Y18A 4KZDH 3HNSL 4N9OB 3MV9A 3IDUA 4OBRA 1ETZB 3MACH 4MCYB 3QUXB 1DZBA 2A0LC 4FTVD 1IGJB 1GHFH 1T5WA 4RX4A 1J5OH 4X6BB 3P4NA 4FHBD 1CR9H 1UM4L 3FRUA 3V6ZB 5TDNA 4PJFA 5F1KC 5DT1L 2YA1A 4TNVF 2O5XL 3DOSA 1D5ZB 3V6BR 1L0XA 3VRLF 2PTTB 5AZ2H 3G08B 2LQRA 4G6ML 1CFNA 1E4XL 1MCSA 4KFZC 3MV8A 3BT2L 4S1DC 2YD8A 2DQTL 3MJ7A 3N9GH 3OKOB 2WQ8A 1XCTB 3KNBB 1MWAL 4YBQC 5F3HA 4GAJL 3ZDXE 3KYKL 1GZPB 4CVXB 4OM1L 5BOZG 1ZHLB 4F15B 1KJ3H 4YK4C 2XICA 4LEOB 2NY4D 4IOFD 2DBJA 3SKMB 4XMKH 2NCMA 5K33A 2BSSB 4RMRA 2AEPL 3KPOA 1NGWB 3LPFA 1R3LA 3FB7B 4O4YL 2R1XA 3MJ9A 1T1ZA 3BSZH 3QDMA 5CSGA 4KK5D 1ZT1B 4EDXA 2NQCA 5D7JD 2DL9A 4DN3L 5I18L 1JYNA 4H0IA 2AXGA 3KDMB 4WV1A 1IC1A 3EYUL 4Q9RH 1D9KA 4RCAA 2YN5A 4NN6B 4PRAB 3C8DA 4JFFB 3UBXG 4CN4A 4HXBH 2JCCB 3UTSE 4XP9H 3WD5L 5BRZD 3VMPA 4NO2A 2EDLA 2YPKA 5I6XB 1MIML 4YDIL 3MUZ1 2D7TL 1UT9A 3IU4H 2CXGA 2VLJD 2OP4H 1CS6A 1RZ8A 2LV4A 1MCWM 1GGTA 4P2CG 4G6FD 2HVKB 3FFCE 2HN7B 4ONHA 4ZOBA 3QUYD 4RFOH 5FHAH 1RJLA 4AEHH 4QRPD 3F6IA 3RWDB 1C16A 4XMLH 4LIQH 3FTGB 1S7UA 1K2DB 1NCBL 2EE2A 4X7SL 4LU5L 4NDMB 3MGTA 1T1WA 4MA3B 1RJZA 1L0QA 2COQA 2J6EL 2FX8H 5DRZB 1A4KB 3DRTA 3P40A 3S5LB 5KS9A 5D1QA 1BQHA 3RTQD 1KB5L 1U93A 3O9WC 2V9QA 1UJTA 3VG9B 4ZG1A 2IEPA 3X14B 5MEND 1LNUB 1CGXA 4S1SH 3BGFC 3O2DH 4FMKA 4JRYB 2ICWB 2UUDH 3O4LA 4JM4L 1DUZB 3OF6D 1KELH 2H8PA 5FO7A 4RIRB 3QUKA 2EC9T 1NC2A 3M07A 3VH8G 5F72S 2NYYC 5KSBA 1VFBA 5HDOA 3PV6B 1MREH 4NT6A 3BGMA 4N0CC 5T1DH 3TO4D 4HHAA 4DFIA 4U1NA 3ARED 4HJGA 4ZODA 2HT3D 4P2QA 3VFTA 1G9MH 2XG4A 3RNKA 1WWWX 2E7LC 1J86A 4RMWA 4JKPH 3KJ6H 1NCUA 5F7EL 4BFBD 3ORJA 4OF3A 3TA3A 2H9GA 3DUSB 4X4XA 4XWOD 4PJXE 1KPVB 2XFXB 4FQLL 3MODH 3BP6A 2NY5L 1AE6H 1EBPA 2VC2L 2DICA 5K9JH 1H3GA 5BO1L 2QL1A 2P5WE 4FA8A 3QQ9D 2DDQL 3OAYH 2B2XL 1PG7X 3R1GH 4ODHH 2ICES 1NBQA 3OAUL 3IAPA 3S88H 4HWEH 2F19H 4O2FA 3VXUB 4J8RB 1FNLA 2OJZH 3WUZA 4X4MA 1FH5H 5IG7A 3W0WA 1NGQH 4S1QH 5L2KD 1MWAB 1CK0H 2RHEA 2CDGB 3TVMA 4WUKL 3MYJB 2DWDA 2BZDA 4JREC 3TIDB 5MHSD 3HNSH 3QDJD 3G5VB 5E8PB 3OKEB 5ISZA 2VLLA 2X70B 1M6OB 1AR1C 4MJ5B 3AGVA 3OKMA 1FQ9C 3FO2A 4N9GB 2DM3A 1KTRL 2QADB 4GRWH 5IMKA 2DN7A 2EDBA 5CEXA 1RHFA 3G6JA 1UM4H 3L7EB 4XNMA 2EH7L 3BUTA 5C6WH 5DT1H 3QNZB 2O5XH 4FTVA 2BVYA 5ACLA 3NZHL 3CUPA 2IWGA 4G6MH 4HX1A 1E4XH 2ESVD 4L9DA 4KRMB 1I7ZA 3BT2H 4C57C 1TVDA 3NZ8A 2DQTH 3WL9B 4ONOA 4TNVK 5E8EA 1RV6X 1MWAH 4IHOA 3MRFA 2D7OA 5HI5D 1G6RA 3EJJX 1MHHB 5KBNC 4GAJH 3KYKH 3QR2A 4OM1H 4ODTL 3FQTB 4GS7C 2FLBT 3IDIB 4JY4A 3RA7L 1QFWL 3TLRA 2AEPH 2BOCB 5CHNB 5DVOA 2ILLA 4M02A 4O4YH 3HMXL 3WEXA 2V5RA 1A2YA 2FWOA 4AG4L 3REWA 4PJIA 1OP3K 4DN3H 1KB5B 5E4EC 5I18H 3BAEL 1HSBA 4GMTL 1G0DA 3GIVB 3EYUH 1DEEA 3IDGB 2FRGP 3T0XA 5JIKA 3ZE2F