4PJAF

Structure of human mr1-5-op-ru in complex with human mait b-b10 tcr
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
235
structure length
235
Chain Sequence
GVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASTLGQEGQPQHFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
publication title A molecular basis underpinning the T cell receptor heterogeneity of mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 235
sequence length 235
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjaF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjaF02
2HVJA 4O51B 4LSUH 2X1XR 1UWGL 4PGZA 4GW5A 2DJUA 3R8BB 4XP9H 3IU4H 2XTJC 4E41E 3T2PA 3KHOA 3T3MF 2L0DA 3HAEG 5I1LA 1LEIA 3T3PE 1JHTB 3GZKA 4KVNL 2VXUH 4ZQKB 4MJIB 4UV7H 4OZHE 3NIDE 4P3DA 5JW3H 2NX5B 4PV9A 3ES6B 4RIRB 2NY3C 5E8NB 3MCLL 3BRGC 5ACZA 1WEJL 4JQXA 4CVXA 5E08H 1AGCA 1F42A 1T7YA 2EEAA 5CJQL 1NBYB 2GITA 3KPSA 4EEEA 4S1DD 3QNZB 1XEDA 2AJ3A 4U1SA 2GAZA 1MFCH 5I66A 3VXTA 4M6ML 4WFHE 4Z7QF 1ZLUH 4L4TA 3IDNB 2M26A 4JB9L 1MSPA 5DD0H 2BY0A 4NNPL 4QRSA 4OGYH 1INDH 2YPKB 4L8SB 1ZLWK 5HHVL 4WEBH 1QSEE 1FFPB 3BIBX 5CS7A 1KJMA 3NFNB 2Z31D 4AIZB 2R4RH 4XMPH 4AT6A 2C3XA 5MEPB 4XAKE 4LGRB 1FO0L 1QR1B 2COQA 1UZ8B 4PP1D 1A6AB 1BD2A 1V7MH 2VWEE 3HE7D 4XVTH 4EI6A 3BW9A 5BOPA 2AXFA 3BP7A 5DEGB 1QFWL 3C60D 3T2NH 2ZUYA 4G9FE 2P24A 3SJVD 1MHCB 1UEMA 3N06B 2LTQC 1N3NB 2A6DA 1LO3L 1P2CA 1S8DB 3T1WA 4GMTL 3VXRA 3KPNB 3QFJE 5AAWA 3B43A 3SE4A 2J8HA 4KTYA 1ZKAA 1HOCA 2V7HA 1F2XK 3FT3B 5TFSL 3UX9B 1NFDA 3D1MC 3MV8A 2J5LC 5ILTH 4PBXA 4R7NA 5E2UH 2IBZX 2YUVA 3T2QA 4DFIA 3G6JA 5A1AA 3TZVB 3WIHA 5GS1A 1QLEL 5IOPA 2EIZB 5GGSY 1QBML 3ZKXC 3LQAH 3ALWA 3EAKA 3IDIB 1URLA 3TNNA 3CMGA 1CL7L 2YN3A 3QCUL 2NYYD 3AXLB 2Q76A 3ARDB 4KVCH 4S1DC 4X7DC 1EXUA 1J0KA 2R69L 2ENYA 3QCTH 1Z5LB 4ONOA 2PCPB 2AEQH 3MLXL 5D7IB 3MRGB 4E42B 2VC2H 3DX7A 3G04B 1BOYA 4KRLB 1ROWA 5LWYH 1BREA 2NR6D 1DBJL 4AEHL 1CICA 2AXGA 4K8RH 1CT8B 2SEBB 4OJFL 5FYKH 3WHE0 4Z7UE 2Z31C 1KJ3L 2VXVH 3DI2B 3MFFB 4M4PA 3T0AA 3OG4B 1M05A 5L2JB 2Y36H 3STZA 3TCLB 5E1AB 3OKNB 3H7BA 4Z95L 5D1QD 4PREB 5MENE 4M9PA 3IAGC 3T09A 1WUNT 4KUZL 5MEOA 1KIPA 1T7ZA 1AO7A 3G5ZA 4PP1C 3GMQB 4FQXD 1GAFL 1CR9L 3PF2A 5GJTL 3HE7C 4LLUB 4I9WD 3GSOA 5IR1A 1T20A 3B83A 3C60C 5DHXB 4XNQB 1IGTA 1G6VK 1Q0YL 5EWIL 4YDJA 4PJIF 4YAQB 4KMTH 2QV2A 3GMNB 4MQ7B 3BPCA 2ZCKL 5EC1A 5F89B 2W0KA 4OFIA 3MBXH 3UYRH 4U1HA 4R2GB 1XGPB 3ROLB 4F7PA 5HGHB 1SJEA 4HUKB 2YOCA 5CZVH 4ODUB 3GI8H 2VSCA 3O6ML 4YLQT 1FPTH 4UT9H 2IALA 4FTVD 1EHXA 1A9EB 4WU5A 1KB5H 1JZ7A 4E41A 4B5EA 5JOPD 5C0AB 4GKNA 3JWOH 2BNQB 3QUMB 4YQXH 1EIBA 3MCKB 4NCDA 5C0JA 4EUPB 1DTUA 2HT4D 3LHPL 1RZJC 2NYYC 4MB3A 4X0KB 3DTXA 3P30H 1FRGH 4B7IA 4Q2ZB 5E6IB 3DXAB 2R56L 3KVQA 4ZS6D 3F7VB 1TJGL 1WTGT 3SBWA 1VGKA 2NR6C 3A0OA 1T04B 4FRWA 4U6VH 1S3KH 3OMZA 4Y5VA 5IW1B 4ZXBD 5I1DA 4JRYA 2A38A 1KPVA 2H6PA 4DGIL 5HSFA 5FYJE 4Y5YC 2PYEE 5D1QC 2AI0H 5BZDA 4JDVB 1QSEA 4AMKL 1WC7B 1EFQA 1N8ZA 5CP7B 4PGEA 1RV6X 5DK2A 4X4XA 3ETBF 1N5YL 4FQXC 4YC2B 3UTQA 4J1UB 2EO9A 4NO0D 3RUGA 1WT5A 5J11C 3NA9L 2NW3B 3MUJA 4Z7OE 4D0DB 1N4XL 5FAAA 2FGWL 3KR3H 1MCQA 2KZWA 3X11A 5FXCH 2FEDD 4JO1L 2OTWB 1N64L 3MLVH 3CVIH 3E2HC 3JSSA 1JI1A 3BOVA 3DHMA 4X4YA 2DI8A 3GMLB 3BN9D 3BWAA 2FO1A 1UGNA 1CXLA 5EPMB 2BVOA 4M61A 2BNRB 1PJ9A 2OM5A 2BVUA 1U92A 3IXAB 2PW2A 4BK5A 4K23H 4Z77A 1XGTB 4N0CD 4O9HL 3HE6A 2VERN 5EU7E 2ZPKH 1V3LA 4Y1AD 5F88A 1CIUA 4KGJA 4DKFL 3H9YA 4FZEL 2VAJA 5T3ZL 1G9NH 3CH1A 1RVFL 1QLRA 2HT4C 1SM3L 4MA1C 3RWCA 5AZEH 5TH2A 4JKPL 1BLNA 4C58B 2EE2A 4AYFA 5HYSG 1ACYH 2GK0B 4ZS6C 5AD0A 1OP9A 2F74A 2K7PA 1WFUA 5KVGL 5BVJB 4IM8A 5I2IA 1YC7A 3QRGL 3ZSSA 3FB7B 4P23A 5ENWA 1KCVL 3NFPA 4ZXBC 3E6HA 2OTUB 2QJDA 4XP6H 3VE0A 3C5SA 5ECJE 3S4SB 2WK2A 4JDTL 4MDJB 3UXFA 2DL9A 1X7QA 4Z7UA 3WIIH 2VLLA 3ESUF 3QR2A 5ACLA 3WHXB 2GSIB 5IGXH 3OB0H 1ZHLA 5HHOB 3T0VA 2GTWB 2UYLB 3MO1A 1IKFH 2KBGA 3JWDL 2V2TA 1NCNA 1AHWC 1R3KB 1KIRA 2P8MA 3VU2A 2AGJH 2FEDC 5SWSE 4LNRB 2O5YL 3MRFB 1CGYA 5A2LH 1VACA 3UO1L 5D6DC 4NPYB 5KZCD 3BN9C 5C0CE 1HYSD 4WY7L 4C56B 1GXEA 2RAMA 2BCKB 1XF4A 5DC9B 4PRBA 4XCNB 3NPSC 4FFYH 2P8PA 4LHUB 2XV6B 4LLAA 4N0CC 3WFCH 3L3KA 1EHLL 1GGIH 1I9RH 2Y07H 3VFMB 5I16B 1HDMB 3Q6GL 4QOKB 3BGFB 2XWBB 3QEQD 4A6YL 4Z5RB 1O0VA 1OSPL 1NGZA 1OTTD 3IXTA 4XNZC 2XT1B 5CCKH 4AY0A 5ETUA 1J1XL 2KQMA 1PX3A 3GM8A 4X4ME 1CTOA 3FTGB 1YN7A 3EYUH 2A1WH 3N1MC 4PJ5D 4NZJA 1CFNA 4JZNB 1RIUL 5EZJA 1E4WH 3EOAB 3VXPA 4JY6A 3D18A 3BIAX 2P5EB 4MB5A 5LBSL 4RMQA 3DMMA 3FQXA 1JWSB 2HKFH 3HRZB 3BGMA 5HBBA 4XXCA 5H2BA 1MUJB 3T65B 4U6YA 5K9KB 4NQED 1HZHL 2CRIA 3EFDH 1MIEH 2R1XB 4M8QA 1S5IL 4XXDA 2JJUA 3LKRB 5JO5B 5K33A 4DW2H 4TVPH 2H1PL 1RZGB 1JPFA 1U58B 2ED8A 4LLVB 1FSKC 4ODHH 5FECA 3L3OA 1TZHB 2VMFA 3I02A 1A5FL 3HCVB 1IGCL 3I6KA 5E94A 3V7AG 4BKLB 1E28B 1BFSA 1IC7H 4ISVA 3GJEA 4ODVL 1HYSC 4XNYH 3N9GH 3ARVA 4LSPL 3SDCA 4HUWB 3D69B 4OKDA 4U1GC 1VKXA 1M6OB 2XQBH 2LU4A 3ZTJH 3ARBD 2QQLH 3QULB 4J3WA 1IC4H 3X12A 5CAYB 3GSNL 1CVSC 5FF6B 4GBXC 2DB8A 4Z7WB 2GTZA 1OTTC 4IMLB 3V4UH 1HILB 4ODSL 4U0RC 2RBLA 1A7PH 3GJFK 3NABL 3H3BC 1KB5B 1H5BA 4JFEB 2DKUA 3G9VA 2WINB 3L3HA 3I6LE 4OV6F 3QNYB 4PUBH 4TUOA 4M1CD 3WNLA 4OFYD 4MJ6B 3MOBH 3TV3L 5E5MB 3WL9A 5JUEH 3LSOA 2VDOL 4KFZC 1S7RA 3T4AB 3ALPA 2HP4A 2EE3A 4WI2A 4WFEE 1K85A 5L88H 3CU7A 2I60H 2Y6SD 1JHLL 3JWNC 3B8SA 1YEKL 2X4SB 1BX2B 4P5MA 1DLHA 1JWUA 1VFBB 5D2LF 4GQPH 3T04D 2A74A 4PJAA 1QYGH 3VXME 2W38A 4OCSH 4EN3A 5J6HA 3I3DA 2Z4QA 1BJ1J 1FVEB 5IHUL 4BZYA 2AABL 2WWMD 4MAYD 4J4PA 3ARGA 4XPGH 1GGUA 2MHAA 4WI3A 3PGFH 3VFGL 2W92A 4R4BA 1NFIB 4DOHE 3U6RA 5GGUB 5B8CB 3O6FA 3DROA 5K9QG 2FR4B 1FNFA 5SWSA 4XHJD 1QBBA 1D5BB 3B9AA 1WFTA 1AC0A 3ULSB 5DVOA 5JW4R 5EBWA 3ARBC 2VXSH 5IWLC 3V5DA 2V5MA 3BISA 1KFAH 1GIGH 1OB1A 3RL1A 4ZSOE 1NBZB 3ARPA 1I7RB 3A6BL 1MCWM 3HC3L 5I76B 5I1HL 5HPMA 4HT1H 3BZFB 4HMDA 4X80L 3KPRE 1CD0A 5TF1L 4UAOB 1G7IA 1MHEA 1RZ7H 4RX4A 3WYRA 1NL0H 1N0XL 2QR0A 3PGDA 4ZFFA 4LU5H 3C5JB 2NNAB 1BVKB 1E27B 1JRHH 1NCUA 1YPZF 2OMNA 2P5WB 4FXLA 1BQLL 1UYWH 4KDTA 4U49A 3KDMA 3IDUA 4M1CC 1W8OA 4OM1L 3CXHK 4U33A 4KC3B 3WKML 4HCRA 5F9JA 1S9KC 1G9EA 5CZXC 4QNPF 3U0WH 4N8CL 3O2DH 1MH5A 2Y6SC 3QEHB 1QSFA 5ITFA 4PJIB 1FV1A 3SE8H 3DSFH 4KK5D 3MLYL 5HDQH 3FONA 1FBIL 2AJYH 3SDDD 2X1WL 5C9JA 5BS0B 4HEPG 1KBGH 2X5PA 3UTZA 1RHHA 3FZUD 5CINL 2WWMC 3MRHA 3N1PC 4MAYC 5HYQB 1NAKH 5I15H 4NO2A 2NTSP 4NQTA 1ED3B 4DAGH 3S88H 1W0VB 1MF2L 2I9TB 3CFIC 1FYTB 3UZEA 1INQA 4H88H 4AENB 3ROOB 1GHFH 3LB6D 4DGVH 5D5MA 4XHJC 4PJ7F 2X42A 3WXWL 1RUKH 2XIDA 3VRIA 2VZUA 2D7TL 2FB4L 4F15B 4I4WA 1FG9C 2MQ0A 4O02L 4P2YA 1U8NA 4HHAB 3EYQD 3P11L 4MCZB 4QT5A 2CLZB 1JNNL 1SBSL 3T4YA 3TBVB 1JGDB 5DRNB 4BSWA 4G8GE 3LZFH 3L95A 4JM2F 4WFHD 4LLMB 4JFYB 4KKLD 3P4NA 3LV3A 1AR1D 3MRDB 5DC4B 2VYRE 2C5DC 1UXSB 3WJJC 2V7NB 2MPAH 4CVUA 2BVQB 4PJGF 3CX2A 1I8IB 2E7BA 3QO1A 1DVFB 5HY9B 2FECI 3ULUL 1GRWA 2BNUA 2MWCA 2VZSA 1TQCC 4YFDB 4XAKD 3JVGC 2VUOA 1EJOH 5F6IB 5JA8B 5T1MB 4X83A 4HUVA 2P44B 3U7WL 3BQUB 1LEGB 5DDHB 2Z92A 4ELMF 3THML 4CL7A 4HZAA 1I8KB 3LD8C 4RSVA 1YMMD 1S5HB 1A7NH 4Q9RH 1NGWB 4NC1C 4KK5C 4TULL 5ALBH 4G9FD 1K6QL 2CRMA 3SDDC 5LGJA 4XBPA 3FZUC 4OZFH 4LCCA 4GXUM 1XR8A 2D3VA 3QFJD 3V5KB 1R3HB 1KYOJ 3L5HA 4GUPA 3O11A 1MOEA 4F80A 1F13A 2UZIL 2FBJH 4R9HA 3M8OL 3UBXA 1KCLA 3HA0A 3REWB 4L1HA 4PBWD 3LB6C 4WUKL 3ET9F 1U36A 5LKNA 1JGVL 2AJSH 5EO1B 1WITA 4JO2L 4XVJH 3BP4B 5GGVY 1IEAA 3G08A 5C0RL 1A7RH 1KSRA 3QUXB 1BFOB 4HUUA 4YHNB 5MP6L 3EYQC 1JPSH 1XF3A 3OKOB 3LN5B 4M6AA 5L6YL 1Q72L 3ILPA 1JVKA 4EI5A 4JHWL 4L3CB 4FQCL 4OV5A 1BJ1H 1A1NA 5J1AB 3FB8B 3OAZH 4KKLC 1NDGA 4ZUTA 1AR1C 2D0HA 3LKNB 2EKSA 1CDJA 1FE8H 1R0AH 3HR5B 3KPRA 4JJ5A 4OCWL 1N5AB 3CLEH 3TESA 3FMGL 3G6AA 3VFSA 3MNZB 5F3BA 5SWZB 1LDPL 2WUBL 3H9SE 4G42B 1WT5C 4HS3A 5MEND 3BMVA 1KV3A 2ZG2A 4JN1H 5HYJD 1C1EH 3QI9B 2VDPL 1S7TA 2E6QA 3BZEB 4R26H 2VWEC 1Z0NA 2C1PA 1XZ0B 3W2DH 1N2RA 1PYWB 1DEEB 4R0LC 1XT5A 1T0NA 1TTGA 4U6HB 3L3GA 4RGND 4HJJL 2BSRB 1RULH 1AC6A 1D6VH 3QDAA 1DN0A 1IE5A 2V5TA 3DURA 5J12B 5DD3H 2A9MH 2Y5TA 4QRPB 3ULVF 1RZFL 4WW2F 3MJGX 4LKCA 4LK4A 2ITDB 3A67H 3QHFL 1NJ9B 4PJBB 4OZGE 4LP5A 3MRCA 4B50A 3FAWA 4NNXA 5FHAL 1FC1A 1Y0LB 2CUIA 2PUQT 3MJ8A 4Z9KB 3QJHA 4EZMA 3KYKL 5IBTL 1IAIM 2JIXB 3C9NA 4MX7B 4PJDA 3QWRA 4PJHE 1MI5A 3GK8H 2FX8H 1ZT1A 3K2UL 2GEEA 4Z78B 4V1DB 3TVMA 1RSFA 1Y6MR 1X4YA 3QDGE 1T0MA 1HXMB 2OTPA 4TUKH 3ZDXE 1TTFA 4UILH 5E2TL 3FO1A 3HZVA 4GG6E 4HPOL 4G8GA 4NM4L 2X1PA 2YBRA 2RFXA 5F7YC 5GQBA 3O6LH 1BWWA 5L8LB 4RMUA 1WICA 3L1OH 5DR5L 3O2WH 1JBJA 5BCAA 1M7IA 3ZHDA 4YBQD 3HC0A 3FT4B 4BQCA 2PYED 1DP0A 2R39A 3GSQA 4LP4A 1IQWH 2Z93A 4FP8H 4NBZB 4L1DA 4MXWH 1A8JH 1ZXQA 3W0WE 1DBKL 4N9GA 4UV4H 2E6PA 4JO4L 4YNYB 3VXQB 4RGMC 4IRSD 2Q86B 3LPWA 1KB9J 2H2SD 4TUJA 1G9MC 2EDKA 3O3AB 4JFXA 3UTTE 1PX4A 3WFDL 2Q7YA 2PYFA 2VLJB 3P9LA 3PDOA 4RGNC 2H32H 3UJTL 1J11A 3U0TA 4NHCL 3DV4A 3QDJB 5TGBB 4TNVK 1CDUA 1KEML 3LQZB 5EU4B 4YWGL 2DLFL 3O0RL 3EIFA 4NQXB 1CBVL 1KTKE 3HUJE 4MCYA 3OAYK 2Y9RT 2NZIA 4M5ZL 4I0PA 4ZAKA 2DMBA 2YRPA 1QFWI 4MMXC 4M6NH 5L0QB 2CDGB 4HUNB 1QG3A 4F57L 1NC2D 4L8CA 2DYPA 3HI5L 5E7BA 4OCXH 3M1BA 4PJCE 5EUKA 5I1AA 1WZ1L 1CLZH 4I48A 4M1GH 1AKJD 4JFFE 2R23B 4JZJA 4NUJB 4D3CL 4D9LL 3H9ZA 4LCUB 4PRHB 5AYQA 4PJ9D 4EDWH 5B39A 1GC1H 1IILE 3MGAA 4PLKD 2ITCA 4KQ4L 1NC4A 4PJXE 3TYGH 4L5FH 4RMSA 4XP1H 3DYMA 4O2CB 1MEXL 1RUQH 3BX7C 3UBXI 3O3DB 5E8PB 1CGTA 2AK4E 3QUZA 5FK9A 2OBGA 5D2LB 4YBQC 1NANH 4F7MA 2FDBP 3ULVH 5CJ8A 1CL7I 1V5JA 2OXGA 3X14B 1NGQL 1FIEA 4UDTB 1J05B 4E9LA 3H9SA 3FQTA 3MQIA 1UWXK 1HHGB 4IRSC 4L3EB 2H2SC 3VA2C 1YDPA 4AIOA 4HS6A 4YDLC 4P2QE 4JDZA 3HZYB 1FN4A 2QSCL 1DSFL 2JF1A 1A47A 4HDIB 3TO4B 3ZKSD 2UVEA 5SWSD 3DUHA 2XRAH 2IAND 1AI1L 4QYOA 2X4QA 5GGSB 1ZLSL 5C0CD 3C8HA 1CGWA 5LQBL 5JZ7C 1HWHB 5IVXB 3DVNB 1B4RA 4C57C 1ZLVH 3SGEH 4A6YA 1HINH 1LO4H 2D31B 4PTUA 5C0GA 5J13C 2HTLD 5EU7C 3RZWA 4N0UE 5H94B 1YEHH 2OZ4A 2HTKD 3WNNA 4U1LA 1T1WA 1HHKB 3I3EA 4H25A 2O5ZH 4HKZB 2E7LC 5I8CB 2PR4H 4P9HC 5E03A 1O5DT 5SX4I 4OB5L 3OHXB 4PJHA 5IJVA 2JCCF 1P4IL 3IB4A 4PJ9C 3BKCH 3KPQB 4PLKC 4XPHH 1HQRB 3FFCB 3IDJA 4XPBH 5F3HB 3RWDB 3UJIL 3QDGA 4GKSB 3LKOB 1JWMA 3VXOA 2Y72A 5KSAD 1JNHA 4N8VA 1BOGB 4GG6A 5IW6A 3CFKA 4OLZL 5EZLB 4R7DA 1XF5A 5IV2A 4O2FB 4JCLA 4U0QB 2VTFA 3UBXG 1FVCB 2OJZL 2IEPA 1DZBA 4JY4B 4NGHL 1OOAA 1UJ3C 4YBLB 4I3SH 1TXKA 3PQYB 3QEGH 4F7TB 4OM0L 1I8MB 4FFWD 3GM0A 2VAAB 1U8QB 2IBGA 5C6TL 2YUZA 3HI6L 5HGDA 4HGMA 3OAUL 1JGLL 3L5IA 3W0WA 1FAIH 4LIQH 1EZVX 3LS5H 3MNVA 4PJ7B 1PG7H 1MHPH 2DKSA 4UTAH 3AS2A 4LDEB 2DQEH 3MV9D 1MLCA 1LMKA 5KG9A 3SE3A 1A2YB 3BESR 5EFIA 2VDNL 1RK0A 3GSNA 4WTZA 1ZS8A 1PZUB 2Q3ZA 3RWIB 3VW3L 4GG8A 4NQUA 4TSCH 2J8UF 5FGBA 5J3HD 2HTLC 3HG1A 3V6FA 3WO4C 4BZ1H 1OP5K 4OI9A 1UQSB 1BZ7A 2CMRL 3BH9A 4QHLA 2HTKC 3D5OF 1S7VB 2VDML 2ZOKB 5GSVA 2DQJH 1BECA 5ID0B 3W9DB 1ADQA 4X7EC 1BAFL 4PJGB 2FWOB 4GW4B 4I0KA 3ARED 4KY1H 3IFNH 3K0WA 4HZLB 4WWKA 3I6LD 5IEKA 1NH6A 4JFFA 3NCFB 3CZJA 2I26N 4PB0L 5KSAC 4ELMB 3WDIA 3J7HA 2W9EH 3TYFB 2A6KA 4KRNA 2OSLB 1FNEA 4WFED 2PW1A 1A3LH 8CGTA 1IGJA 1W0WA 2AERT 2F54B 4ZFGL 1ODAA 1HHIA 5FIEA 4N1HB 5D93C 1CI5A 2AK4A 1IL1B 1FDLH 1B88A 4FQ1H 3OF6D 3GKZA 1I3GH 2FX7L 1M7DA 1FZJB 3VXMD 3GI9L 3ZE1E 32C2A 1YYLL 1HIML 4TOYL 4M5YH 2DL2A 1ZT4B 4AH2B 2FRGP 5EZOL 1A9BB 3BKYH 4NRYA 1MCSA 3ALXA 4H5SA 3G5VA 5I1KL 2YD4A 4P2QA 4PRID 4MWFB 2HRPH 4HJ0D 4MAUH 1RAMA 4LLDB 2H32B 4UU9A 1FVDA 2QQKL 2W9LA 4QCIB 4WHYG 1KTLB 4OKVB 4S1RH 4JKWA 4ZNEA 4NWUH 1JTTA 1JNLH 5J3HC 2B2XH 3PGCB 1A02N 1NQBA 1XAUA 4L9LA 3V52L 1V3MA 4P57B 3FO0L 1S9VA 4LQFH 2FIKA 1UVQA 5FUZL 2DWDB 4LKXA 4RWYH 2IQAA 1IAIL 3L7EB 4N0UA 1IEBA 5F9WC 4ZUUA 4UDUA 3PE9A 2CDFA 1QLFA 4HWZB 1A6TB 3VWKB 1AIFB 1DUZB 3IGAA 4JM4H 3AREC 4QHUB 1AD0B 3IKKA 2VZ1A 4XPFL 3HTLX 5SWQA 4M48H 4P3WA 1Z9MA 2EEBA 4MHHI 1X9QA 1FL3B 5LXGH 1BVZA 4ERSL 1ZOXA 5I1LB 1T3FB 3ARFB 1KG0A 3D25A 2CPCA 4LSUL 3H0TB 1OGAB 4PJ8D 3IFPB 1K8DB 4AIXA 4L4JA 3NCYP 2DLEA 2VABA 1NAMH 2AKRB 2GKIA 4LCCC 2W1NA 1F3RB 1QO3B 4XP9L 3IU4L 2QQQA 5ACMA 4U1KB 5C07E 4NDMB 5I6XB 4HF5L 5C92A 1NBQA 5HPOA 2AJ3B 4WW2B 2DDQH 1OQOA 2VXUL 4UV7L 1WFNA 4L4TB 4M62H 5JW3L 2DTSA 3L7FB 3JZ7A 3OKYA 3KYOA 2HVKA 1IGFH 2O61A 1R3IH 2MQCA 2FJFB 4HIHB 2IFFH 4HJ0C 5E08L 5B39G 2F58H 4NKOB 1KELH 4WEUD 1XGQA 2VLKE 1MFCL 3GSVB 3QHZH 1PEWA 4WV1B 4XGZB 1T80A 4ETYA 3D39D 2K9UA 2QTEA 5DD0L 5KS9F 4PTTB 4OGYL 4FXKA 4U3CA 5I71C 3OR6A 1INDL 4OZIF 1Z9OA 2NQCA 1YECH 1EK3A 2ZUQB 1JF1A 2R4RL 5HVWA 1X4ZA 2P24B 4XMPL 3UEZA 3K8MA 4G8GD 1P7HL 3QWOB 2IPKB 3PWNA 1G7JB 4I1NB 4UZGA 4R6UA 4HIJA 1LK2B 1V7ML 4P48A 3CDFA 3OKKB 4XVTL 3WFHB 3D85D 3DGGB 4XH2A 3L5XH 1E4JA 1X6LA 3T2NL 1OL0A 1UM5H 4K7FB 3VWJD 4NJAH 1GZQA 3ARWA 2I5YH 3VJ6B 4C4KO 1HE7A 2VISA 3TPUB 1RJYB 1HEZA 3RPIA 4PJ8C 15C8H 3DV6A 3C6LA 2OJEA 4QRQA 3RWFB 4Y19B 2ICES 1MFDH 4PG2A 3RTQB 3ZHKA 5DQ9A 3NN8A 3MJ6A 5JNYB 1CDIA 4GRLD 5I75B 1GPOH 5EIIB 5EBGA 4HUXB 5FYKD 5DEFA 3K4DA 4G8IA 1ONQB 5DJ8A 5E2UL 5D7LB 2GIYA 1PEZA 4KI5E 2AV7B 3UJJH 1TITA 4I0PD 5EOTB 4ZAKD 3U2SB 4ZDHA 2OP4H 1SMOA 3LQAL 2VH5H 1RJLA 3P77A 3IU3A 2CK0H 4MNQA 5T1KB 1AGEB 1I85A 1KACB 3FB5A 2X4TB 1CE6A 5DS8B 5GGQL 4KVCL 3D3VE 3H7BB 1WAAF 3QCTL 2Q8BL 3PV6B 4N8VG 3O4LB 2AEQL 5D8JH 3P73A 3QDME 2V17H 3O8XB 5EB9A 1X5ZA 2VC2L 2DBJA 3MZGB 4R97C 4GAYA 5C0FA 4K3JH 5LWYL 2NXYB 3SQBA 3T0EA 4K8RL 4M00A 2EE9A 5FYKL 2VXVL 1CGXA 1NC4D 2EH8H 4GRWF 3RNKA 2Y36L 4YXLH 3AMLA 1Q9LB 3NIGF 1RK1B 1AXSB 2Y23A 2LVCA 3MBEB 3QPQD 4MJIE 4RBPH 1P7QA 2I07B 5CIPA 2NX5E 1CLYH 2XA8H 3OKEA 4UOW1 5IM7A 1AGDB 2H26A 1I4FB 1SJEB 3MC0A 1ZSDB 1UM4H 4LCYB 3OSKA 3VWJC 4P5KB 4EKXA 2E3VA 3GJFA 4WDIA 1ITBB 3H9SD 4W68A 2ATKB 4KMTL 1VADA 3CGTA 4LLWA 5DUPH 5B38B 4WTZG 4OT1H 4YDVB 3AS3A 5GGRY 2EXYD 4NP4H 5GS0H 3MBXL 3UYRL 3RY5A 2BSTA 4GRLC 5CZVL 5F93C 1IAKA 3MXVH 1U8IB 2D7NA 4LBEA 3GMMB 1FPTL 4UT9L 5KSBF 4OIIH 3QWQB 1M71B 1HYRC 3GRWH 5EU6B 1BQHA 1KJ2H 1FFNA 3SKNB 1KB5L 2WLZA 3HI1B 4ZAKC 1U8LA 1U8HA 5JIHA 1VGKB 3JWOL 3L6FA 4YQXL 3FQNA 3C8KA 4HLZH 3TT3H 5KTEH 4AL8H 1UWEH 2ATPA 3EGSA 3P30L 2YSSA 1FRGL 1XGYH 3NCEB 5D72L 4YDKH 1R3LA 5GIRA 1J1OH 1YEDA 5DK2B 3GIVA 3PL6D 5EIQA 2JCCB 2VLKA 5C0DA 1ULVA 3MRLB 5EO0A 1I7TA 2NY1D 2FHFA 4PY7B 4LAJH 4LHJB 3LAFA 1S3KL 2ED9A 4WHTB 4POYA 2EIBA 4YPGB 3S35H 1DBML 4KK6D 2XZZA 2AI0L 1ORSA 2IGFH 5EULV 2BOBA 3VH8A 3QPQC 4OLUH 4GT7A 4ZYKB 4Q9QH 1G7HA 3PWPE 4BZ2H 4D9QE 3SGKC 2D9QB 4FZ8H 1TNNA 4NNYB 4BH7A 3HFMH 3VXUA 3CSPA 1I1AB 9CGTA 4P4KA 3KR3L 4CNIB 1TTUA 5JIPA 3PIQA 4WFGE 5EBMB 1BZQK 1PD6A 4YUEH 1KTDB 3CVIL 4XNXH 3LQMA 3F8UB 3QEUA 3PWUA 3QIWA 4KKNA 5HYEA 2PO6D 4ZMAT 1IAOA 4I0CC 3WN5B 4PJFE 4BSJA 3UTTD 4WNQA 3RWCB 2ZUXA 4K23L 5IB3B 5B21A 5T3XH 1ZGLP 3TBWB 1NAMB 1GOGA 2ZPKL 4XB7A 2AV1B 3NBNA 1AGBB 4Y8DC 4GRWH 1RFDH 1OARH 1TLKA 1YYMH 5DJ2A 4PGCA 5D6CB 5E2WH 1G9NL 4C4KT 3GB7B 3NFPB 2IQ9H 2XKUA 4HULB 3MRBA 5AZEL 1IM9A 4KZDL 2F8VA 2BHUA 2YUXA 3B3IA 4RA0C 5T5NG 3I75B 4GLRH 1ACYL 1G7LA 5E00B 5HI5D 5SV4A 4F7EB 2MCPH 1BBDH 3J8F7 3JTTA 3PL6C 1VFAA 3WSQH 3D3VA 2E6JA 2EDBA 3C5ZB 2NY1C 4O51A 3MO1B 4XP6L 4KAQH 4J3SA 2XOTA 4Z7VE 4KK6C 1JZ8A 3K81A 2C3WA 1MELA 3T77B 3WIIL 4K3DH 4X6FB 4UUJB 4ALAH 3UC0H 2OX5A 2XTLA 5IGXL 4MQTB 4EOWH 1JHTA 1F6AB 1VGEH 3QNXB 4ZQKA 4CN1A 4MJIA 1IKFL 1YJDL 2AK4D 3KJ4B 2NX5A 3ES6A 4RIRA 5M7QA 3S36H 5E8NA 3R1GH 5HHQB 3MYJB 1AY1H 4NN5C 3E6FB 4S2SB 1SHMA 1JZ6A 3TBYA 3DXAE 2XICA 1NBYA 4QF1B 4IEFB 5I1GH 3EJJX 3C8DA 3AM8A 3QNZA 3CU1A 2PO6C 4QTIH 4O2EB 3MGTB 3O45B 5HHNB 1AGFB 2Y06H 4LPYA 3IDNA 1XCQB 1I8LC 2C4FU 1A4JB 1OAQH 1D9KB 3MMEB 4FFYL 5BJTB 4L8SA 4HWBA 4KRPD 1D6EB 5C1MB 1FFPA 5A2KH 3WFCL 1GGIL 3NFNA 1I9RL 3NZHH 1QFWH 2Y07L 1YY9C 2DBLH 2DQIH 4JPVH 2F15A 2BFVL 5MEPA 4U05A 5CCKL 2NCMA 4HXAH 4DZ8B 1QR1A 4FXGB 1UZ8A 4ZUWB 5JPMB 1YJDC 5EG6C 1A6AA 4KKCD 1PW3A 4ONHB 4TVPD 1SEBB 2A1WL 3EYUL 4OGZA 3BGMB 1IMHC 5JQHC 1B4JH 4N5ED 5HI5C 1E4WL 5TDOA 1LILA 5TFSH 1LEKB 1N3NA 2BNRE 2AEWA 1S8DA 4XBGB 1QLEH 2NMSA 3KPNA 3UDWA 1QBMH 4EVNA 2HKFL 2GY5A 1JFQH 3JUYA 5C09E 1CLCA 5D7JB 1KLGB 2ORBH 3FT3A 3EFDL 1MIEL 3QG7H 5L2KB 2R69H 3OWEA 3TZVA 3K8LA 5K9JH 2R8SH 1MAKA 3MLXH 1J0ZA 4DQOL 2EIZA 3MNWB 4TVPL 4DW2L 1JJUA 2D0GA 3P4OB 4ODHL 4QRTB 4YHOH 3IFLH 4AEHH 2ZSWB 1C5BH 3IDIA 5ESVB 3X12B 3WUWB 2C26A 1IC7L 3AXLA 3ARDA 4Y2OA 5CEZD 3MYZA 1Z5LA 5F1KC 2PCPA 2OR9H 1MCOH 5D7IA 5D1ZD 3MRGA 4E42A 3G04A 3RWGB 2XQBL 4M93B 2XXCB 5CEYB 1U3HD 1CR9H 4KRPC 2QQLL 1H5BB 1CT8A 2SEBA 4HSQA 1RZJH 2YD8A 4LVEA 5EH1A 2H45A 3L9RA 5L2JA 2NLJB 3VFRB 3TCLA 5E1AA 3OKNA 4Q6IB 4PREA 4TTDC 2MOVA 4IHOB 1LDSA 3V4UL 5HHOE 1KOAA 4KXZI 2E7MA 2ZCKH 3VG9B 3FAXA 1A7PL 1KJ2B 4PRPE 3GMQA 1QRNB 3X13B 2BXYA 4KKCC 3KHQA 4LLUA 5SX4H 1HKLL 1MRFH 5F9OH 4N5EC 4XNQA 4PUBL 4HS8H 2F5BH 1NGYB 1JWUB 1EA9C 3MOBL 4OLEA 1OP3H 4C56E 4B0MM 4YAQA 4OCRH 3MA9H 4ORZC 3KLAB 5JUEL 4MQ7A 2R4SL 4HWNA 4YEEA 5F89A 1EEZA 3PHOB 4OD1H 3SDXE 3ZDZE 1U41A 1DJSA 1EVTC 5L88L 3ROLA 1XGPA 2OYPA 2I60L 2UV3A 3BKML 4LVHB 2DMKA 2LE9A 1IRAY 2APVA 2HA1A 1BQHG 3LHPH 1YY8B 4YO0B 3B9EA 1MPAH 4OCSL 3UPRB 2V2XB 4P4RB 1A9EA 1E4KA 2R56H 5C0AA 5HDBE 2GJ6B 3MV11 4XPGL 5KAQG 4UNUA 2BNQA 2YEZB 3QUMA 1A6VH 1I1RA 3V5DB 3PGFL 4BQ9A 3MCKA 1T1YB 4Q9BA 4DKAA 3Q3GB 4MD0B 4EUPA 5LCVH 4Y16D 4FQQB 4X0KA 3RWEB 5EOCJ 1JYWA 2CLVB 2A0LD 3PV7A 5HPMB 2P5EE 4MJ5B 4PRAB 4Q2ZA 2OL3H 5E6IA 5D1ZC 3DXAA 3F7VA 5FYJU 1U3HC 3GBLA 4P2RE 2VXSL 3ILQD 2LVEA 1T04A 4I5BB 1KFAL 4XC3H 1QBAA 4EXKA 5IW1A 5FKAB 5EZIH 3MJ9H 1N4XH 4XX1E 3VH8G 3V6ZB 4WHDA 2NY3B 2CXGA 2X44D 4HT1L 1WC7A 5CP7A 2X4OA 3NIFE 5GXBB 1RZ7L 4X99B 4J1UA 2ZUTA 4LU5L 4UIKL 1T5WB 2NW3A 1JRHL 3PXJA 4D0DA 1ZGLB 1NLBH 5F44A 1UYWL 5BW7C 5IROC 3VI4F 1AR2A 1F45A 1P7QD 3FFDB 2OTWA 4O9HH 3QFDB 4NQDB 4XBEH 5C9JB 5D2NE 4ZO8A 4HD9A 4KJWD 2MKLC 4K7PH 1U8JB 3GMLA 3U0WL 4YHZH 3O2DL 4OLVH 5EPMA 3KPTA 2BNRA 1RVFH 3IXAA 3SE8L 4Z7WE 5C0BB 3DSFL 5H35B 4RDQG 4JKPH 2AJYL 4PJEF 1XGTA 4JKKA 4O58H 1IZJA 1KBGL 2E7HA 1NEUA 2AQ3A 2R1WB 5J7CC 2DM3A 1RZ8B 3BDXA 3HHRB 1NAKL 2C3VB 2FNBA 4JFEE 5CZKA 1FZMB 4JVPA 5ESQB 4DAGL 5KSBB 2LTQB 3HPLB 4Y16C 1G7MB 4H88L 4TRPH 1CXKA 3I50L 4QT5B 1GHFL 4YHMH 5C07D 4DGVL 2A0LC 2YPLE 1IC1A 2EH7H 1RUKL 4RRPA 2GK0A 1OF2B 3QXAB 3DRTB 3HZKB 3E1F1 2J5LB 5CEXB 3BP6A 3ILQC 5BVJA 3SE9H 3FB7A 2DQCH 1VHPA 2OTUA 4IDJH 2AJZB 3HS0B 1EFXD 1FO0B 3PABB 3S4SA 3QG6B 4MDJA 1F4AA 2VLKD 3CZFB 4XT1C 2MNUA 3LZFL 3WHXA 1RMFH 4TTGA 3RJQB 3DVGB 3LKQB 1F00I 4LCIH 5GRJH 5A2FA 2CIIB 2GSIA 1C7TA 5B4MD 2GQHA 3AUVA 5HHOA 2GTWA 2F9BT 2UYLA 1Q0XH 2MPAL 4ODWB 1R3KA 2DS4A 5BRZE 4LNRA 2Z31B 4KJWC 1EJOL 1KLFA 3DOSA 4EIGB 4NPYA 4IJ3C 1XR8B 4C56A 1QA9B 2BCKA 4APQD 4HIXH 5DTFB 1A7NL 4Q9RL 3LRSB 4XCNA 5IFHH 1UZ6F 4LHUA 5ALBL 3HE7B 5GGTH 1T83C 3C60B 4OLWH 2ZKHH 3VFMA 5I16A 1HDMA 4QOKA 3SJVB 2XWBA 4Z5RA 1S7QB 5IMMB 3SDAD 3OR7B 4UB0H 3VD3A 5IVZB 3FTGA 1A4KB 4F9PA 1PGRB 2AJSL 4JZNA 1GCFA 2M1KA 4KI5D 3OTTA 3EOAA 2P8LB 1NFDF 3KYMB 1A7RL 1KEGH 2P5EA 5H37G 4PJIE 4BQ8A 4OFDA 4X6CF 3NGBC 1VESA 1JWSA 4ONGL 3MRJB 4LLQB 4G3YH 1D3CA 4W81A 3QQ4B 3UYOD 3HRZA 4MNGE 1E6OH 3D3VD 1MUJA 3IDYC 3T65A 4OFKA 5K9KA 4HS3B 2WWKO 43CAB 3QDMD 2R1XA 3D2UB 3NCJH 5B4MC 1FE8L 2BRRH 2JJTC 4MXVF 5F7UA 5E9DD 3X17A 4JG1H 1ERNA 4LGSB 3D9AH 3CLEL 1FYTE 5JO5A 3WJLA 4DN3H 4JEGB 1RZGA 5EOCH 1U58A 3CFJB 4LLVA 3KJ6H 1JN6B 2MQ3A 1TZHA 3L3GB 3HCVA 5KSVB 1E28A 1JYVA 4JN1L 2IH1B 2NX5D 5D1QB 4OTXH 4HUWA 4APQC 3FRPA 4R26L 3D69A 1E6JH 1M6OA 3I9GH 4FQXB 5GRVL 4P2OD 5J11B 3QULA 4YBHA 3TC9A 1N7MH 1AQDB 1RULL 5FF6A 1D6VL 4J3VA 4Z7WA 3SQOL 1IAII 4NKMB 4G6AD 4PJDB 1KB9K 5DD3L 2A9ML 2ICWJ 1HILA 5B3NA 3T1FB 3SDAC 3E2HB 1NMCC 2DQGH 1VFOA 3NZ8B 1KB5A 1QFOA 1JGEB 1FNHA 5HDOA 4JFEA 2NY4D 4PRDB 2WINA 5IMOB 2W9DH 3TH3T 4KI5C 5GRUL 3QNYA 2YC1B 4MJ6A 5ICXB 2BVEA 5E5MA 1NKRA 4FTVB 1T89A 4J8RA 2B7DT 3T4AA 3GK8L 2FX8L 4N0YH 4RMRA 2X40A 3DGCR 3ZT5A 2OL3B 3QXUA 3TH4T 2ZSVA 4NKIH 1FNGB 3F7YB 2A6JB 3WS3B 3T3PF 4TUKL 5DJXB 5IJKA 2X4SA 4UILL 1Z3GH 1GVIA 1BX2A 4OZHF 3NIDF 4LVNC 4MA1B 5J1SC 2R0LL 3KXFD 4X7CC 2E9JA 4Q58C 3S5LB 4LPXA 3U82B 2D7OA 1F5WA 2F8XC 5D71H 4N9GB 1FVEA 2FYYB 1FLRH 1TMCB 4U7MA 3O6LL 3RY6C 5IT2H 3TIDB 3L1OL 4EUPG 3O2WL 5I1JH 3OB8A 4X98B 1U95B 4X5LA 1G6RH 4ZXBB 3BJ91 1IQWL 4N8PA 5GGUA 5B8CA 3PWPD 1BPVA 1P84J 2N4IA 2FR4A 4MXWL 4LMQI 4UV4L 1D5BA 1U8OB 2Y4SA 4NSKA 3DRQB 3ULSA 2UZYB 2XWTB 1N0XH 1UACH 4NO0B 4P2OC 4P5TD 3P0VH 1I9IH 1SY6H 4WFGD 3WIHH 1NGXB 4L4VE 5LGKA 1NBZA 1OAYL 1J87A 1I7RA 1F90H 1AHWB 3JXAA 1XMWA 4G6AC 2DWEB 4UNTA 4ZPTB 5I76A 5CJOH 3BZFA 4C54A 2EKJA 2DAVA 3M1BB 3L3JB 3SOBL 1CFTB 5E5RB 3C5JA 5SWZE 2NNAA 1BVKA 2NY4C 5F6HJ 5F72S 1IEHA 2P5WA 3B5GA 4F2MA 1WWAX 2C1OB 1J0HA 1VERA 3KGRA 3WIFB 2DD8H 2AEIT 3NPSB 5ESAB 1NLDH 2UWEF 1FBIH 1YNTB 4RAVB 3AAZB 4TNWK 4X9BA 4OCXL 5HGAA 1KXTB 3EUUA 2XI9A 3MRKA 3F6IA 4Y1AB 1CLZL 3EDKA 5FDYA 4M1GL 3MV7E 5C2UB 1JV5A 3QEHA 1MWAL 5IB1B 2GSGB 4XNZB 3RY4A 4PJIA 2ADIB 4CU7A 1SBBA 4EDWL 1GC1L 5C70A 3MLRH 2EEDA 3TYGL 4L5FL 3ZL4H 3MRRB 3FT2B 4FQIH 3H3PH 5BS0A 4NBYB 4QRPE 1RUQL 3FQTB 4LOUD 1X5FA 4F37F 2D4FA 4YR6B 3U9PL 3RWJB 2D7TH 5HYQA 4PJBE 4M7ZC 1HHJB 1ED3A 1MQ8A 1W0VA 2I9TA 3ULVL 1FYTA 2A73B 1S9XB 4AENA 3ROOA 4RRPG 3QXVA 4FFZH 3OBAA 1LO5B 3IDMB 1XGUB 4P5TC 4V1DE 5DJ0B 2F19H 4IS6B 2XYCA 2WWKT 4F9LA 4TPRH 3GHBH 4HHAA 4JFOB 4OQTA 5CLTA 3MOAH 2EDEA 2XRAL 4MCZA 2CLZA 3ARUA 1FSKB 1GC1C 3TBVA 1JGDA 3F6LA 3ZKMD 5DHVH 5DRNA 3EYSH 4CRPA 1KLUB 2YXMA 2DTML 5FYLE 4JFYA 5KZCB 3MRDA 3U7WH 4WUUD 4LRIC 4UOJA 3FB6B 1HINL 1JGUH 1LO4L 1UXSA 2V7NA 3OPZH 1T2QH 1OAUH 3IDJB 1YEHL 1B90A 1K6QH 2IH3A 1TVBB 2O5ZL 1RI8A 2D9CA 2PR4L 4GBXB 1CFVH 5T1MA 5E6ZA 3BQUA 1LEGA 5DDHA 3NFSH 1I8KA 1BVLB 4MQXD 1RU9H 1S5HA 2XN9E 3S37X 3BKCL 2AK1H 4XPHL 1RJCA 3QDJE 1X3DA 3ME0A 4XPBL 1ZHBA 1JUFB 4ETQB 4ZFOB 2PXYA 2F53E 4PJ5B 4DEPC 5KOVC 4KUCD 1TPXC 2BNRD 4Y4HD 1UM6L 1QFHA 3RIFF 1RUMH 4RFNC 3EDDA 3V5KA 1R3HA 2JELH 4PJEB 3E3QC 4JFZH 4EQ2A 3FQWB 5C09D 4QRRD 3REWA 1YMHA 2B4CL 4WO4A 4I3SL 3QEGL 2X41A 5GGRB 4JHWH 5EO1A 3KS0J 4N0RA 3BP4A 5F21B 2VB5A 3MLZH 1FAIL 4LIQL 3LS5L 3QUXA 1BFOA 4YHNA 1TCRB 5FUCC 4Q6YA 2ZOLB 5IBLD 1PG7L 5DHYB 3OKOA 5JPNB 1MHPL 3CFCH 4UTAL 4S1QH 2V2WB 2DQEL 3ZKMC 5TQ2H 5JXED 4L3CA 4FA8A 1BZ7B 3VXSE 4XX1G 5GHWH 5ELIA 4WI9A 5GSVB 5J1AA 2CKBH 3FB8A 1U3YA 3UZVB 3V0VB 3LKNA 1I1FB 3HR5A 3A6CH 4TSCL 1N5AA 2N56A 3T0BA 5C08E 2IG2H 3NACL 3MNZA 4BZ1L 3EOTH 5SWZA 3BO8B 2B4CC 4G42A 4I2XE 2EE6A 4D8PA 4YHYC 4HJJH 4L3EE 2DQJL 5DD6B 5HHOD 1SYSB 2AAVA 1WVZA 3FRPG 1FZOB 1Q9KB 1ZTXH 1S9YB 4RMVA 1WISA 4PRPD 3QI9A 1X5KA 1XIWD 4MQXC 3BZEA 3JV4A 1XZ0A 3RHWK 1NGPH 4U1MB 1PYWA 4KY1L 3T0DA 1DEEA 2NW2A 1ZHKB 4HH9B 1BIHA 4U6HA 4MJ2A 4C56D 1U93B 3UTSB 2BSRA 5FB8B 1MQKH 1JPST 1VFUA 2W9EL 1VEOA 5JXAH 4Y4HC 5IVXE 1OW0A 4TVSa 3T08A 3DETD 1A3LL 3BJLA 4LHUD 4QRPA 4JRWA 1CFBA 1G9MH 1D7FA 2RHEA 4J2XA 3U4AA 1NJ9A 1FDLL 4PJBA 1NKOA 4FQ1L 2MCG1 2LFGA 3DUUA 1PDKA 2F5AH 1Y0LA 4JO3L 3UP1A 1G6RB 1K2DB 4UU9B 4MX7A 4M5YL 1FQ9C 2BMKB 3WXVH 3BKYL 1OAZH 4QHNB 1YEJH 3IFOB 4NM4H 5IBLC 3VGHA 4MAYB 4Z78A 3FFCE 4V1DA 2CLRB 4QRUB 2HRPL 5DR5H 4QNPE 5JXEC 4MAUL 4Y2DD 4KHTH 1HXMA 2VZOA 5CLWA 5I74B 1F3JB 4YEFA 4PRNB 4JPKH 4X6CB 4S1RL 2EDXA 3HZMB 4P2RD 3IGAB 1JNLL 2B2XL 2CKNA 3CX5K 3WD5H 3PQYE 4NFCA 4LQFL 5ID1B 2CGRH 3FT4A 4RWYL 5IB2A 2X4PB 3RNQB 1F4HA 5E8OB 1XIWC 2RB8A 1KG0B 3OKDB 4JM4L 3VXQA 4YNYA 2Q86A 3RDTC 2DLFH 5D7KD 2WBJD 3O3AA 1CDBA 4M48L 4JFPA 2VLJA 5LXGL 4AEEA 1F6LL 2HFFB 3G6DH 2BVPB 5F97E 2FH6A 3O2VH 3QDJA 1MFBH 5TGBA 3LQZA 3DETC 5EU4A 1TQCB 3JTSB 4NQXA 2Y1VA 1PQZB 2WIIB 5MHSE 3AS0A 2W91A 1ZV5A 3IS1X 2CDGA 3P2TA 4IRJD 2HFEB 2WANA 2DDQL 3CSYB 3REVB 2XY2A 3QIUD 1K8IB 2DICA 2VSDA 2P45B 4M62L 4JFED 2HJKB 3SGJA 4P46D 1IGFL 4LCWE 2X4RB 3DWTA 4XCCH 1A6ZB 2IFFL 4LEOB 4PFEA 4FS0A 4KU1A 2R23A 4NUJA 4Y2DC 4LPCA 5C2BH 4LCUA 5AWNH 4YDIH 2YPLD 4PRHA 4BFGA 4L29B 3Q5OA 4NKQB 3V0WH 1IGYB 3VI3F 3CIQA 3MZTA 3QHZL 1FAKT 1YN6B 1DQDL 5DA0B 4O2CA 4P9HH 4CMHC 2F54E 3O3DA 5FO9B 5E8PA 4Y0GA 2JB5H 3LKPB 4R96B 3ZLQC 2ZUVA 1QOKA 4OZHB 5D2LA 1YECL 4P59H 3KS0H 5K59E 2M8XA 1CTNA 3K80A 1C7SA 2F8OA 2DIBA 2W59A 3X14A 1JNJA 4UDTA 4U3HA 1J05A 5D1XD 2ZCHH 5F70A 1HHGA 3STBA 4L3EA 5DJ6B 5KN5B 4QRQB 2WBJC 3VFPB 2BSSB 2IMNA 4U6XB 3JBG7 2PN5A 1F8TH 2FBOJ 2JB6B 1UM5L 4HDIA 5BRZD 3TO4A 2I5YL 3L3DB 4JHAH 2C7UB 4KQ3H 5CJBA 5BMFH 5D2NC 5GGSA 2L7UA 15C8L 3MXWL 2ICWB 1FFOB 5FA3B 5DUMH 1MFDL 4Y8AA 4RNRB 1FGNH 5IVXA 3DVNA 1HH9B 1I9EA 3EJYD 1YMMB 2D31A 2R2EB 4IRJC 3O4OC 1QR4A 4OF0A 3QIUC 1L7TH 4R0LB 1Y6KR 5H94A 3RJDA 5CWSA 4G9FB 3UJJL 3UJIH 3F5WB 1HHKA 4HKZA 5I8CA 4P46C 1BM3H 2OP4L 1T03H 3OKMB 2VH5L 2J6EH 1FP5A 3VG0H 2P4AB 3OHXA 2CK0L 3QFJB 2UWEB 2O5XH 4DKEH 5E2VH 1HQRA 2EYRB 3FFCA 5D8JL 5F3HA 3RWDA 2VN4A 2V17L 4GKSA 3GSUB 1OGAE 4JKMA 3V4PH 5CIPB 4ESKA 3BPOC 4K3JL 4HAGA 5F1IB 5IFJB 1BOGA 2VLRD 5EZLA 1AD9B 2HWZH 4O2FA 2MMXA 3WS6C 2CKBB 3I84A 4HCRH 4PS4H 2EH8L 1FVCA 4YXLL 3BZ4B 4JY4A 4YHKL 5FV2A 1OHQA 5ADPH 3PQYA 5D1XC 4X7FC 4F7TA 1I8MA 4L4TE 1CLYL 2XA8L 2VAAA 1U8QA 3KPPB 3RX8A 2VDNH 3C08H 4MB4A 1BJ8A 3PDGA 1FYTD 3V4VH 4LPWA 1UM4L 3HC4H 5T1LD 3R06B 4PJ7A 3ZTJG 3C2AH 4WGWB 5DUPL 1EGJH 2UUDK 1HSBB 4OT1L 3UTPE 1KUMA 4NP4L 1A2YA 3BP5A 1U8PB 5MENB 3RIAK 3ZE2E 4NO5B 4PGBB 1U8LB 3VDBA 5HYJB 2LAAA 2NXZC 4GS7C 3EJYC 3CDYA 1S7SB 1BAFH 3RWIA 1JRHI 3C8KB 3MXVL 3GUTB 4RGMB 5IMKB 3MACH 3FRUB 4HFUH 4OUUB 1QBLL 2YSSB 1KJ2L 1ZVYA 2KH2B 2FZ3B 4OI8A 1P9MC 2HH0H 3DI3B 1S7VA 4RGNB 1ZE3C 5F7NC 3S3SA 1CWVA 2ZOKA 1UJTA 5EN2B 2AP2A 1DANU 2YHGA 4U3XA 5ID0A 1JPTL 5EO0B 3W9DA 4PJGA 3KLHD 3TT3L 5KTEL 1DBAH 2FWOA 1DVFD 5CP3H 4GW4A 3PWVB 5DURD 4AL8L 1UWEL 3TN0D 2HMID 4HZLA 2ESVA 1IAMA 1EAPB 1C12B 1XGYL 4YDKL 3DX6B 2FCBA 1WWBX 1UH2A 2BOBB 1J1OL 1MRDH 3AC0A 3GGWB 5JW4Q 4ELMA 3TYFA 4Y19E 2EYTB 5F7LB 2OSLA 3ZYIA 2FLBT 1JE6A 4RISH 4WVRA 4TSAH 2VE6B 3EJZD 3IS0X 2F54A 3S35L 2HT2D 4CN4A 3BVNB 5D7LE 2IGFL 3V7AE 3DUSA 1IL1A 4OLUL 3SCMA 4Q9QL 4BZ2L 1IM3B 1FZJA 4AEIH 3QEUB 4CU6A 1A1MB 4KKBD 5DVLA 4FZ8L 1F58H 2QQKH 2DIAA 3HFML 1ZT4A 4AH2A 4PG9B 1A9BA 1MJUH 1U9KA 4YFEA 4LSQH 1CFSB 3TA3D 2RJMA 4D0CB 4YUEL 3O4LE 4MWFA 4XNXL 4CBPA 4F15C 2PYEB 1KN2H 1MHHB 4LLDA 4EXPX 1I1YB 2H32A 3QUXD 3WNKA 4QCIA 1KTLA 2XWJB 3JUZA 3STLB 4OKVA 5MEQA 4JQIL 3AMKA 4AG4L 5A2JH 3V79C 4X6DF 1RY7B 4IRSB 1IC5H 3PGCA 5T3XL 3TCXA 4P57A 3AS1A 4YDLB 4L4VD 2VXTL 2J12B 2IFGA 1OARL 2JJVA 2DWDA 1YYML 3L7EA 1WGOA 1NCTA 2VZ3A 5E2WL 1V7NH 3ZDYE 4BUGA 1A6TA 1T5XA 3KLHC 3VWKA 1AIFA 2IQ9L 1DUZA 1DVFC 1AQKH 4U7SA 5SWZD 1XF1A 4QHUA 3TN0C 2HMIC 1AD0A 3KYNB 1RHFA 2BC4B 1FL3A 2MCPL 1BBDL 4HF5H 4LSSH 3WSQL 5I17B 1EEUA 5J13B 2ERJC 1T3FA 3ARFA 4HBCH 3D0VB 1NC2B 3EJZC 3H0TA 1OGAA 3MV7D 3IFPA 4KAQL 1K8DA 2FL5B 2YRLA 2HT2C 2AKRA 1MY5A 1PY4A 4K3DL 1AKJB 1QO3A 3TBYB 1U91B 4LL9A 4U1KA 4NDMA 4ALAL 1TJHH 4OF6A 3UC0L 4KKBC 4PJ9B 5HGGS 4HWEH 4QRPD 4EOWL 4WW2A 4PV8B 1VGEL 5D7SH 2R2HB 3TBSB 3L7FA 4JRYE 3S36L 4HIIB 1D5MB 3R1GL 3TA3C 3UAJD 1AY1L 2FJFA 4HIHA 4W4OA 2YD2A 2IAMD 4NKOA 3NCCB 2JIXD 2YA1A 3QZWB 4K2UL 5I1GL 2JCCE 7FABH 3RUGE 4QTIL 3GSVA 1BIIB 1UJ3B 2Y06L 4WV1A 4XGZA 2ZG3A 3RI5K 1OAQL 2FO4B 2JTDA 4HKJB 4PTTA 2E9IA 3V5HB 4MQSB 3CSBA 4YXHH 3NZHL 5TDOB 3BH8B 2DBLL 2DQIL 3QWOA 4JPVL 2IANB 3V95A 5HVHB 2IPKA 4HXAL 1G7JA 5C0CB 2Y5EA 2ZUWA 1CN4A 1LK2A 4EVNB 3OKKA 3WFHA 3FO9B 3DGGA 1B4JL 4K7FA 4BM7A 3WEXB 3K4ZA 3VJ6A 1NBVH 3WO4B 4ODBD 1MLBB 4PLOB 1CE1L 3TPUA 1RJYA 1LE5A 4OZGF 5JHDB 2Y7QB 1EO7A 2BSED 1S7WB 3MCG1 5DVKA 3RWFA 4Y19A 3RTQA 2XN9D 5EBLB 1JFQL 3PDDA 5JNYA 2ORBL 3QDJD 5EIIA 4HUXA 3QG7L 5GGQH 3VA6A 3VFUB 1ONQA 2F53D 1EVUA 5D7LA 1TFHA 4H8WC 5C0IB 3K74B 2AV7A 2R8SL 5K9JL 2Q8BH 4LAQL 2JJSC 4JFDB 1GSMA 3ZDXF 5KSAB 8FABB 5EOTA 3U2SA 2EDDA 3UAJC 4YHOL 4GG6F 3HMXH 3BWUC 3IFLL 2D4DA 5JQ6H 1C5BL 2IAMC 3SKOB 5KOMC 1AGEA 5T1KA 4NZRH 2X4TA 3RZCD 5DS8A 1NFKA 3L9RB 5F71A 3X3GH 1NSNL 5D93B 2HFTA 4D2NA 3PV6A 1OM3H 3O4LA 2OR9L 2VITB 1MCOL 5AG9A 4N0FB 3O8XA 4JG0L 3QRFM 1SVCP 4I3GA 2WSKA 3UPAA 1JZ4A 1KJVB 1RZJL 3OXRB 3T0WA 1NMAH 5DSCB 4G80B 5CSZB 1Q9LA 3TLRA 3VXSD 3BDYH 1RK1A 1AXSA 1R24B 1FCGA 3MBEA 3MV9B 3TP4A 2I07A 1PKQB 1EEZB 5FA4B 1AGDA 4CW1B 1I4FA 5C08D 2PKDA 1MRFL 5F9OL 5JR1H 1ZSDA 4LCYA 5DF0A 4P5KA 4HS8L 2F5BL 3P9MB 4Y4FB 3D48R 1UCTA 2ATKA 3HUJF 4OCRL 3MA9L 5T1DH 1KENH 1G1YA 1AXTH 3CVHL 1FL5B 5B38A 1LK3L 4A2MA 4YDVA 4OD1L 4IIQC 1A6UL 4Y7MA 1K3ZA 5SV3A 3LS4H 3B9KD 4HGWB 3HNSH 5F9WB 2VO5A 1ZLWH 1JYXA 1T0PB 3N85L 1U8IA 1WCBB 3GMMA 5GJSH 5GS2D 3VFOB 3AREB 2IADB 2H41A 4PJCF 2XACC 1M71A 1MPAL 5EU6A 2BK8A 5D72H 3SKNA 5GZOD 1I3UA 1J8HB 4QHKJ 1EZVY 3HI1A 4JQVC 4MD5B 1E0OB 2A6IB 2RGSA 2R0KH 3H7LA 5KVEH 4RMWA 5L0QC 1A6VL 5HHPB 4YZFE 4PJXF 3RZCC 1MFNA 4JFQB 5LCVL 2J1KA 4ONFH 2YK1H 2G2RB 1DBMH 4PY8I 5HI3D 2OL3L 2X4OB 3AY4A 3SDYH 2YZ8A 3QO0B 25C8H 3F7RA 4GQ9H 3VXMB 2JCCA 3MRLA 4WU7B 1B3JA 4PY7A 1S9WB 4XC3L 2OZ4H 4WHTA 1NANI 5EZIL 3MJ9L 4YPGA 5IIEB 3RX7A 1W72H 1IT9H 4K71C 4DOHB 4PRIB 4ZYKA 5E24E 2CDEB 3DO7B 3MSPA 3VGBA 1MIMH 5DJZB 4NNYA 5BOZG 5JLZB 5BZWB 5EC2B 1NLBL 3DSNA 1XF2B 4H1LH 1I1AA 4CNIA 1GZPB 3HRPA 1WF5A 3U48A 5CUSH 5I71B 5EBMA 3Q6FB 3TGXA 5CJXC 4XBEL 4ZSOB 3WFEH 1KTDA 3IETB 5JMRA 4K7PL 2EDTA 4YHZL 1OTUD 3B9KC 2W65B 4OLVL 1WWWX 4F58H 3ZE0F 3WN5A 3SGEI 3TT1H 3BFOA 3AVEA 3V9FA 4KZDH 5IB3A 5J4MA 3TBWA 4O58L 4C55A 1NAMA 3ARQA 5GZOC 2AV1A 3K1KC 1AGBA 1INEH 1CXEA 1UB5B 4IOFD 1T1ZB 1PLGH 3DO3A 4M43H 3BP6B 1CDGA 5D6CA 1H3UA 1NCAH 4IBLT 3S9DB 3GB7A 3TPKA 4PJ8B 3W9EB 5IKCB 4QKXB 4TRPL 2X89A 4YHML 4PJAE 3O81A 3C6SB 3I75A 5HI3C 4G6FD 2EH7L 5E00A 4N90E 5ALCL 4F7EA 3RA7H 5E8EB 2MKWA 3QSKB 1GGCH 2VZTA 3C5ZA 2YWZA 5JHLH 3SE9L 2DQCL 3DX9B 4LCWD 5DFVD 3QUYA 1HSAB 5F1SA 4IDJL 4BELD 1YJDH 1B2WH 1CIDA 3FJTA 1N6VA 1ADQH 3T77A 4X6FA 4UUJA 1QFPA 1RMFL 3QT2A 2GJ6E 4LCIL 5EDXA 5GRJL 4E5XB 5SX5K 2X2YA 4J7RA 1F6AA 1MFEH 3QNXA 2D03L 3O9WD 1Q0XL 4EJ1C 3D39B 4WW1B 3KNBB 4Z76B 4BUHA 1HN1A 4YK4C 5HHQA 3MYJA 2E9BA 3B6SA 3E6FA 5FKPB 3BEVB 4S2SA 5EUOF 5BVPH 1UCBL 4QF1A 1AFVH 4J6RH 5KJRH 1OTUC 4O2EA 3MGTA 1FL6B 3SEPA 3O45A 2BFVH 1A22B 5HHNA 4FABH 1AGFA 2NY5C 4HIXL 3SGDH 1XCQA 1A4JA 4I18C 4ZO6A 4JRXB 1IKNA 5I73C 5IFHL 1D9KA 1HXYA 2CJUH 3MMEA 4GXUN 5BJTA 2QSQA 2JJWA 1D6EA 3FO2B 5CGYD 5GGTL 5IUSA 5JDSB 3D85B 3ZYJA 2B0SL 4Y4KD 4L9DA 4OLWL 3NVQA 2ZKHL 4K9EC 1IGMH 3VWJB 4IOFC 4F3FB 3UMTA 4OGAD 4X6DB 3BGAA 1QSFE 3NIGE 4OF5A 4DZ8A 4LPUA 4FXGA 4ZUWA 4UB0L 5JPMA 2CR3A 2VLMD 4ONHA 4PBVC 1SEBA 2BY2A 4PD4K 1ETZB 3RQ3A 3TJHD 5C7XH 4GRLB 2Z8RA 4R8WH 5I8EB 4BSVB 2O26U 3VWKD 1DR9A 1LEKA 1CG9B 4J23A 1N59B 1KEGL 4JVWA 1U42A 5DFVC 3O3BB 4XBGA 4ZD3H 2YKLH 5C0BE 4DQOH 1WLHA 3RU8H 1F4WH 4G3YL 4ZFOL 2LAGB 3F7PC 3X3FH 5D5ME 1E6OL 4X8JB 1OT2A 5D7JA 2WQ8A 5H8DA 1KLGA 5J89A 5DYOB 5C8JB 3P3YA 5A2IH 5DJDB 4ORGB 4G5ZH 5L2KA 4OLYH 1OGAD 3NCJL 2ZUUA 4OD2A 2BRRL 3RVWD 4JG1L 3O9WC 5FGRA 4P3CH 4BFEA 3D9AL 3SPVB 3MNWA 4MYWB 4DN3L 5EOCL 3P4OA 3S37L 3KJ6L 4G6KH 4QRTA 4CMMB 3KPSD 1FZKB 5IHBA 2ZSWA 6FABH 5ESVA 4XI5D 4LFHG 2QSTA 3WUWA 3MA7B 2ZZUT 5HHME 1FNLA 5DK0B 4L4TD 4Q74A 4U1NB 4OTXL 4PYGA 3CCHB 5TQ0H 2ICEB 1DDHA 3CJJA 1E6JL 3RWGA 1SVZA 3I9GL 3QISA 2GFBB 5CEYA 1CQKA 5CGYC 1WZLA 1HKLH 1N7ML 4Y4KC 1B0GA 2YXFA 5BV7C 5CEZH 2JE8A 2KKQA 7CGTA 2NLJA 3VFRA 3OXSB 4Q6IA 4OGAC 5KS9A 4W6YB 2VDKH 4IHOA 1XFPA 4J8RB 3GRWA 1BD2D 1LP9F 1KJ2A 2DQGL 2R4SH 4NYLB 1QRNA 1L4IA 3X13A 4KGLA 2ZSVB 3BKMH 3N0PB 1W0YT 4UTBH 2W9DL 2G75B 3WLBB 3FOLB 1SMAA 1NGYA 4QXWA 1J1PH 5B38G 1XGRB 3Q1SL 3FQUB 3CXHJ 4ZTPH 3KLAA 3VXRD 1ND0B 1UXWB 3GIZH 2ADJB 4L8BB 5IG7B 1MAMH 4N0YL 3PHOA 2Y25A 5JOEA 4NKIL 3EYOB 4IMKA 3MV8D 5C3LD 3IF1B 1Z3GL 1EJ6A 2EYSB 1MJJB 3VRJB 4OZGB 1GGBH 1YY8A 3SJVE 4YO0A 1J86A 2YRZA 2D0FA 3RVWC 3KG5A 1BGXH 2V2XA 4P4RA 5D71L 3UPRA 1W72B 4KZEH 5E2JA 3K3QA 1FLRL 4NSKB 3P4MB 4JQXC 4Q7DA 5IT2L 1HH6B 3PL6B 2GJ6A 5I6XC 1CU4H 5I1JL 2YEZA 2NY1B 4XI5C 1T1YA 3Q5TA 5I8OH 1G6RL 3Q3GA 4MD0A 3U4BH 4FQQA 5TDPB 4H1LB 3RWEA 5LG1A 1DQMH 4NQVB 2CLVA 4MA7H 4M4RA 4MJ5A 4PRAA 1KCSH 1CICD 3WBDA 3DPBA 1UACL 3P0VL 1I9IL 4UIKH 4I5BA 5IF0B 1SY6L 1K9TA 3WIHL 4UQ2B 4XAWH 3BZDA 4OBSA 5FKAA 3RIFK 4F2MB 1F90L 4X4ZA 2ZCLH 3V6ZA 5F1NB 1AO7D 2OQJB 5CJOL 1YNKL 4NN5B 3K46A 1TQBC 2AXJA 1ZVSB 4X99A 5HGAB 1YNLH 4M3KB 3MRKB 1BFTA 5ISZA 2PO6B 1T5WA 1H15B 1JV5B 2XFXB 1ZGLA 3BPNC 5C0EB 4X9GA 3UTTB 1WIUA 2DD8L 3MBED 1EHAA 1NLDL 3LPGA 1G7QB 3FFDA 3B2UD 2I25N 1MAJA 3HPJB 3QFDA 4NQDA 1OLZA 4H26B 1NCDH 3SE4C 1LQSR 4EIZC 1FG2B 2FHBA 3RVVD 3PP3K 1U8JA 1RIHH 2A9NL 1BZ9B 2QQNH 1N6QH 4KI5F 4JVUA 3HUJB 3BRDA 4NKDB 3CNKA 5C0BA 5GS1C 5H35A 4KPHH 3I50H 2QADD 3MLRL 4PJDE 4E41D 3ZL4L 5I1EH 1OPGL 4FQIL 2BJMH 3H3PL 1MI5E 2R1WA 1E4XH 1RZ8A 2CUMA 4S0SD 5I75C 2W0FB 4CDGC 5J0BA 3GJFH 2C3VA 5DRXB 1MVFA 1NUFA 1FZMA 1EEQA 5ESQA 5KSBA 3IRZA 3ZKQD 1H8SA 4PJCB 3HPLA 4HG4K 3ZMRA 1NUNB 4E0RA 1O7VA 1G7MA 3W82A 2GW5A 1VA9A 1Q9OB 1GJIA 2Z91B 4FTVE 3BXNA 4M9OA 4FFZL 4GRMB 1C5DB 1RZKH 1CICC 1OF2A 2R29H 4RCAA 4YXKH 4G43B 3QXAA 3DRTA 2EDOA 2AEPH 3HZKA 4R4FH 2F19L 5CEXA 4JRYD 3RAJL 5F7EH 4TPRL 3KAAA 1KPRB 3GHBL 1QSED 2AJZA 3HS0A 5FOBB 3MOAL 1FO0A 3PABA 5DA4A 3QG6A 1F97A 3EFFB 1KGCE 3EYSL 2IH3B 1EUTA 3CZFA 3L3IB 2LU7A 3P9WB 4QXUH 3DVGA 3LKQA 2CIIA 2ENSA 4FNLH 1JL8A 4LVOC 1JGUL 4ODWA 3OPZL 4LF3B 1T2QL 3MBEC 1P4LB 1KNOB 4LLYB 1OAUL 5DVMA 4KH2A 3B2UC 1QNZH 1T21B 1ZA6B 4KRPB 2I24N 1ZHBB 2PXYB 2Z31A 1DFBH 2GUOB 4JAMB 3RVVC 1CFVL 1S78D 1DQTA 1R5WB 4DGYH 4PY8J 4ACPA 1QA9A 4Z0XA 2LU3A 3NFSL 3D0LB 3MJ7B 1RU9L 4GSDH 5DTFA 5IMLB 2AK1L 3HE6D 3LRSA 5T3ZE 4OGXH 2BHZA 5DGRA 1L7IH 4ZUVB 2YD5A 3QXTA 5DJCB 2QADC 3HE7A 1YMHB 4YGAB 4WO4B 1HI6B 1Y18B 2Z8VC 2ZUSA 4AK1A 5E99H 1AJ7H 3C60A 1TETL 1SJVA 1MNUH 2WMPA 3HMWH 3SJVA 1WBZB 3V6BR 1RUML 1S7QA 4GXVH 2JELL 4ELKB 5IMMA 1EO5A 4JFZL 1NCBL 1QPXA 3ECBB 1H0DB 4DVRH 3OR7A 4ONGH 5IVZA 1A4KA 5HXMA 2AJVH 2BDNH 3SBWC 5INCB 4X8XA 3BDBA 1YA5A 4P23D 4Y5VC 1WK0A 2P8LA 5IQ9B 3KYMA 4P49A 4NC2B 3MLZL 3OZ9H 1I3RB 1A7BA 4XP4H 3MRJA 4LLQA 3CFCL 1PZ5B 4S1QL 1CZ8L 3QQ4A 1W2KT 5TQ2L 5GHWL 1T6VN 4D8PB 2X9XA 4CVZB 43CAA 4AEFA 2CKBL 3GMOB 1L6ZA 3D2UA 4BFIB 3A6CL 2NZ9D 3JV0A 3JV4B 5D1ZB 1AH1A 3LN4B 4TYUA 2IG2L 3CFJA 3EOTL 1X5LA 3WUWG 1U3HB 1JN6A 2NW2B 4HJGB 4PJFF 4OFVA 5KSVA 1K4CB 3VDAA 1S78C 3MFGB 3SQOH 1ZTXL 1BJMA 2IH1A 5D1QA 3MUY1 1FJ1B 1NGPL 4HV8B 3HE6C 4G7YH 5EUOB 1KN4H 4FQXA 1BBJB 3ARSA 4WI4A 1ORQB 1AQDA 3DUUB 3GSXB 3TH2T 1MQKL 5GRUH 1PAMA 5JXAL 4NKMA 5B3JF 1KTRL 5C3TA 1D9KD 4NQSB 4B41A 5DC0A 3T1FA 3LOWA 1G9ML 1MRCH 2YUWA 3NZ8A 1JGEA 5I1CH 5CFHA 3MUHL 4HLZG 4PRDA 5IMOA 4GLRI 1EO8H 2F5AL 3I2CH 1VEMA 2YC1A 2R0LH 4P23C 5ICXA 4Z7VF 5HJ3B 1IJ9A 2HRLA 3DMMD 4HWBH 4FTVA 5DZNA 3WXVL 1BFVL 1OAZL 4CKVX 4OCYH 1YEJL 1JTPA 3FL7A 1M7XA 1FNSH 2OL3A 1D5IH 1FNGA 4POUB 3F7YA 5CJ5A 2A6JA 5ICZB 4KMQA 4PB9H 3WS3A 5FYJD 4KHTL 5DJXA 3FOMB 4L8DB 2NPLX 1PBYA 4Y16B 3AB0C 4JPKL 3S5LA 5IB2B 3MJ9A 3MUGB 2IPTH 1FFQA 4KWUA 4XP5H 4CJ0A 3HB3D 2NZ9C 4G8FB 1QFUH 2FYYA 5CKAA 2NY2D 1RJZA 3TIDA 3WD5L 3QA3B 4X98A 1U95A 2CGRL 2APTA 4J12A 4JFPB 1G0XA 4ZXBA 3GBMH 4N9OB 3K4AA 3SDCD 1LO0H 4XRCB 2R1YB 2M2DA 4M03A 1OAYH 4U1JB 3DX8B 5KSUB 1U8OA 4NN6C 3DRQA 1KPUB 4BH8B 3HG1E 2XWTA 4IOSD 3SOBH 4NO0A 2B1HH 3EOYG 4MDIB 3TF7C 4TNVF 4WIQA 5DJAB 1OSZB 4K3GA 1C5CH 1NGXA 3G6DL 2CRZA 3V2AR 3VFWB 3IVKB 3O2VL 4GO6B 1AHWA 1MFBL 2DWEA 4ZPTA 4FQJH 1D9KC 2AJUH 1MVUB 3L3JA 5D6DA 5TPWH 1CFTA 1V05A 1MWAH 2FHCA 5IK3B 4GW1B 4KUCF 4M7LH 4KJYA 2C1OA 3WIFA 1LP9B 5ESAA 3FCTB 1DUYB 5J6GB 3DMMC 4P9MH 4RAVA 1YNTA 3AAZA 4S1SH 4JLRB 5GRXG 4YGVB 2R15A 4XXCC 3IJHB 3U9PH 4Y1AA 2EDFA 4XCCL 2EDLA 5IB1A 2GSGA 3S96B 1WQVT 2ADIA 3UTSE 5AWNL 5C2BL 4YDIL 3V0WL 4EN3D 3MRPB 1KXQE 3F58H 2ADGB 4N90D 5C07B 3MRRA 2W0LA 3FT2A 3HB3C 4J4PD 3ARGD 4P9HL 4KK9D 1ZLUK 4YR6A 2JB5L 3RWJA 1OY3B 2NY2C 4JPIB 4OZ4B 4WI8A 1CD1B 1HHJA 4P59L 3NCBB 4NZTH 3O6FD 4KJPD 1RURH 3SDCC 1EFXB 3NGBB 1SYVB 3UPCA 2A73A 1S9XA 4CVWA 5FM4A 5CD3B 5DMJB 4UOW0 1DE4B 2GJ6D 4GH7B 2ZCHL 4ZNEE 3IDYB 1LO5A 4YPJA 5GISL 3IDMA 4R90H 1XGUA 3CAFA 1FORH 1L0XA 2DTMH 5DJ0A 4IS6A 1SQ2N 4OZFB 2LV4A 1F8TL 5EIVA 3BKJH 3EO1B 4JFOA 4JHAL 4KQ3L 2XA3A 5BMFL 2GJZB 4J3OC 35C8H 4RX4D 5CWSB 3QUMH 4CJ1A 3U36B 1H5BC 5GGTA 1KLUA 3MTRA 4XC1L 5DUML 1YPZB 1FGNL 4BQBA 3B5TA 2K3TA 3MREB 4IRZH 3UYPA 2QEJA 1WIPA 3FB6A 4XCFL 1UH3A 4APQB 2NY6D 1XCTB 3LH2L 2RR3A 3SDXF 3OKLB 3VG9C 3ZDZF 1L7TL 4LDLB 3BHBB 3G5XB 1TVBA 2AJXL 4JZOB 4GBXA 1DL7H 1BM3L 1QSFD 3IKCB 1U3ZA 3LMJH 1T03L 5C6WH 2J6EL 1YEGH 5DVNA 3VG0L 1UM6H 3BN3B 2APBA 2EC9T 1BVLA 3IT8D 3SDAB 1A7OL 2O5XL 1NMCB 4EN3C 4QY8B 4G9DB 3MROB 4DKEL 5E2VL 3GO1H 5HDBF 3MR9B 5FUOH 2B4CH 5MI0C 1JUFA 5GRWA 4ETQA 4J4PC 3ARGC 4ZFOA 4JJHA 4KK9C 4PJ5A 4LPTA 5T5FH 3V4PL 2WAHA 3RX5A 2VQ1B 3AGVA 4WENB 3D6GA 5IHZB 2HWZL 3OAYH 5HVFB 4GKZB 4HCRL 4PS4L 3O6FC 4PJEA 4KJPC 3WUZA 3FQWA 5ADPL 5GGRA 3KWWB 2AVGA 3QP3A 1LHZA 2X9YA 2UY7A 1WSST 3BP5B 4BJLA 1QQDB 4LVNB 3C08L 4RZCB 3QDMB 1UA6H 3WV0A 3V4VL 3VFVB 3EYFB 3HC4L 5E9DB 1IQDB 3NIFF 1TCRA 2ZOLA 3PHSA 1B0RB 4S11A 5DHYA 3C2AL 5JPNA 3NACH 2V2WA 5HHMD 4JM2B 1EGJL 4MA3B 2UZXB 2C4FT 1M4KA 3CFEB 5DJYB 3ULUE 1JK8B 3V0VA 1B6UA 2XZQH 4KDTC 1I1FA 3KPLB 2DMCA 4FMFA 4NRZB 3NH7L 4WWID 2NY6C 2GY7B 4NQCB 3QAZC 2DLGA 2IPUG 3MACL 3WE6B 4HFUL 2ESVB 2X6MA 4P2OB 3ARBA 3LKSB 4PGDB 4X5WB 5IWLA 3BO8A 4HC1H 2HH0L 4MNHA 3MLUH 1Z9SA 5DD6A 1SYSA 1UWXH 3U46B 1IGIH 4NT6B 4Z7WF 1FZOA 1Q9KA 1S9YA 4XNMB 3N50A 5FEBA 3O41B 1DBAL 2RQ8A 3RBSA 4U1MA 2A83B 4FN0A 1T1XB 1ZHKA 1UKTA 4HH9A 3DUSB 4RWHA 4NO3B 1QEWA 3SCMB 1MRDL 2NY4B 4OI7A 4N1EA 1U93A 4FFWC 3UTSA 5FB8A 3BSZH 5EO9B 1PG7W 4JO3H 4OFYA 4RISL 4TSAL 3OJMB 4UI2A 4MNQE 2DLIA 1YMME 2BXZA 2HKHH 2DLHA 5FCSH 1A1OB 4LSVH 1NUGA 4JGUA 2Q8AL 2E27H 2VRAA 4AEIL 2IWGA 1F4YH 1F58L 3KXFB 1G6RA 1K2DA 3TJEH 1RUPH 3T0EE 5FOJA 2BMKA 1G0YR 5MEQB 4QHNA 1MJUL 2H8PB 2UWEE 3IFOA 4XCEB 3KYAA 2E5EA 2HG5B 4EI5D 3TFKD 4LSQL 4Q0XH 4MAYA 2CLRA 2LABA 4QRUA 4M7ZB 2G5BB 2EDYA 3S5LG 1KN2L 3BIKA 1F3JA 1SY6A 4PRNA 2NY0B 3KPRD 4MA8H 5FM8A 2VL5B 3PWPB 4X6CA 5A43C 2ARJB 2B5IB 1T5XB 4HX1B 3HZMA 1ZEAL 1IC5L 1II4E 5E0QA 4Z0BH 1J9CT 3IDGB 4P5TB 3DIFB 5ID1A 1HWGB 3D2UD 4KHXH 3TNMB 1A14H 1MWAB 2DRUA 2FJGA 2X4PA 4FQHB 3RNQA 3IAQA 1V7NL 5E8OA 4NUGH 2YN5A 3OKDA 1WBYA 1AQKL 3HLAB 1KCUH 1KCRH 2HAZA 2VNCA 4PJFB 4XCYB 3S34H 2BOCB 4K7PY 3WJJA 2HFFA 4H0HB 2BVPA 4QXGH 4LSSL 3DBXB 5HYJE 5CBAB 2WUCL 4HBCL 4CADB 1F6FB 2DQTH 1F4XL 3B9DA 1KC5L 3JTSA 3JVGA 5DLMH 1PQZA 2Q1EA 2PTVA 2WIIA 1OP5H 4RGNE 1TJHL 2X4NB 3QWRD 4HPYH 1DLFH 4HWEL 5JW4N 2HFEA 1MI5D 3CSYA 3REVA 1K8IA 5D7SL 4Z7NF 4NWTH 3EBAA 1DQDH 3SDDA 3OB0K 1JMXA 3TVMD 3TFKC 4EI5C 2HJKA 4DEPB 2HLAB 4WJ5B 1TPXB 2X4RA 3BD3A 3RVTD 1A6ZA 4LEOA 4Z7VB 4RFNB 3L5WB 4L29A 2FD6H 3H3KA 3LDBB 7FABL 1IGYA 2VIRB 4UINH 1YN6A 3VXUE 3MRIB 3KLDA 5FO9A 5DHVA 3LKPA 4R96A 4V2BA 4OZHA 3LEYH 4YXHL 3QIBB 4OSUH 5A40E 1P5UA 5FM5M 1MJ8H 5I8KH 3MLSH 1KGCD 3GEWB 1T7WA 3ZTNH 3LRHA 3C2SA 3GKWL 4J3TA 1LE5B 4MHHG 4DTGH 1YEIH 3U9UA 1FGVH 3MXWH 5DJ6A 5KN5A 4XTRD 3VFPA 2BSSA 5KVFH 4U6XA 1NCCH 4WUUB 4U1IB 1D5XB 2JB6A 4HIEB 5BO1L 3L3DA 1P69B 2C7UA 1NBVL 5IVNA 4S0TD 4G6MH 4G6JH 1WZKA 3VFNA 2X4UB 4YHYB 2ICWA 1FFOA 5FA3A 4RNRA 1HH9A 1BEYH 5T3ZD 5AYUL 3W39B 1YMMA 3AFLA 4DN4H 2R2EA 3FQRB 3CDGB 2DYPD 4R0LA 5IFAH 1B6DA 4G9FA 2BVTA 4UQ3B 3F5WA 3TVMC 4ODXB 5IB4B 3HMXL 1T7VA 3OKMA 3RVTC 4GAGH 4Y4HB 5JQ6L 3K2MC 1IBGH 3QFJA 4MD4B 4NZRL 2UWEA 43C9B 5C09B 3ZYZA 3X3GL 4QRRB 5EU5B 1U3JA 2EYRA 1OM3L 4YHKH 5DQDH 3GMRA 3GSUA 3QUZD 4NCC1 5F1IA 5IFJA 2RCSL 1AD9A 2P1YA 2CKBA 3VGAB 1NMAL 5F7KC 2VXQH 1ES0B 2AW2A 4XNUH 3BDYL 3BZ4A 4LSDA 2WV3A 3UZQA 1HNFA 1I3VA 5TE7H 3TO2B 4XPTH 3KPPA 4XTRC 2QKIB 4OD3L 3PXHA 5JR1L 1C08B 3U7AA 4LGPB 4NHUA 3DECA 3R06A 4BK4A 3CSGA 1QBLH 5T1DL 4X9FA 1KENL 1AXTL 1Q9WB 2YS4A 1HSBA 1CK0H 5MENA 1U8PA 1QPPA 4I0PC 4NO5A 1R5IB 4PGBA 3LS4L 5HYJA 3HNSL 5GRYA 1JPTH 4PRPB 1S7SA 3LEVH 1XIWB 1NCWH 2ADFL 4YHIB 3GUTA 5GJSL 1DEDA 5IMKA 3RDTB 3FRUA 4OUUA 2IANE 2FZ3A 1TVHB 1ZWIB 1CFQB 3BT2H 5EN2A 2R0WL 2R0KL 4OQTH 4JZJC 3T8XB 5KVEL 4DCQB 5DI8B 3SDXB 3SY0B 2DQHL 1DN2A 5FHBL 3PWVA 4KDVA 4ONFL 2YK1L 4P99A 3QDGD 4HK0B 1EAPA 1C12A 4GBXD 1AP2B 3DX6A 4PJBF 4Q97A 5JHDE 1TDQA 3SDYL 3GGWA 4JE4B 3QUZC 2MFNA 3FKUS 4GQ9L 25C8L 1JF6A 2EYTA 3EO0B 3VMPA 4LEXL 4MJ4A 1I1CA 2WLYA 2VE6A 2OZ4L 3JWDC 1MCCA 1EDQA 1T22B 3BVNA 1MCNA 1W72L 2XZAH 1IT9L 1FCCA 4RA3A 12E8H 5ICYB 5E5UB 5JA9A 4JFDE 5D7IE 5BXFB 4Y2DB 1IM3A 4HMEA 2EXYC 2VDLL 1MIML 1A1MA 5CD5D 2VDRL 3W0WD 1XR9B 3IJYB 4PG9A 1Z0MA 4JQIH 4P2RB 4CMHB 4KROD 4AG4H 5CUSL 1CFSA 4HBQA 4D0CA 5E1HB 3U1SL 5TE6H 3O3EB 3WFEL 2VXTH 5AZ2H 3EHBD 3V6OE 3VMOA 2PYEA 3CH8A 1MHHA 1P4BL 2QHRH 1I1YA 4YIQB 3PJSB 3VFTB 2J8UB 1BQUA 5DMIH 3VI3E 4F58L 2XWJA 3STLA 2Q7NA 3HG1D 5F96L 4C59B 3TT1L 2OI9C 4IRSA 5K9QI 2WBJB 4WI5A 2A77H 1IVLA 3G9AB 3MV9E 1PKQE 4LASH 5F1OB 1INEL 4KV5E 1PLGL 4M43L 2JLLA 5D2NB 4JPWH 1NCAL 4WWKD 2J88H 3QUYB 3WNOA 5D96C 1H3PH 5HI4D 4JFFD 3KYNA 5IBUG 2BC4A 4XMKH 3QJFB 1X5AA 4I8DA 2ICWI 5DMKB 1A0QH 1X5GA 3RA7L 5C0AE 5DQJB 4IRJB 1SEQH 5I17A 3O4OB 1GGCL 2BNQE 3QIUB 5JHLL 5HHXH 4FQ2H 3D0VA 4Y5XB 1NC2A 4JN2B 4HKBB 5DK3A 1B2WL 2FL5A 2G60H