4PJAF

Structure of human mr1-5-op-ru in complex with human mait b-b10 tcr
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
235
structure length
235
Chain Sequence
GVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASTLGQEGQPQHFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I-related gene protei
publication title A molecular basis underpinning the T cell receptor heterogeneity of mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 57
structure length 235
sequence length 235
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjaF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjaF02
1AD0B 4JJ5B 3BGFC 5DWUH 5GRUH 3TA3B 3W81A 4ZUUA 1WISA 4FQXA 1QPXA 4J7RA 4UDUA 5DJ6A 5IVNA 3T3PF 1W0WB 3VXSE 2FEEI 4OLEA 1HQRA 2J8OA 3NGBB 4E42A 2YD6A 1NFIB 1URLA 2GY7B 35C8L 4MD4B 2BNUB 4U6TA 4WWKC 3RFZC 5ESVA 1CTOA 3HC0A 1YEHH 4G3YL 5B8CC 1U8JB 2J12B 3Q48A 2DQHH 3MNVA 2FZ3A 5E94A 3IRPX 3BVNB 3C6SB 2XQBH 2NY4C 4M5YL 1JP5A 2F5BH 3TBYB 4MA8L 2AV7A 2DI7A 1QFUH 4P4KC 4TVPE 1WBZB 3QCTL 4KI5C 3V0VA 1LP9F 2NY6C 4TSBH 3LH2H 3MRHA 3MRQB 3L3KA 2NTFB 3HZMA 3MLPA 5EU3B 2W91A 4TUOA 1NGZB 2JJVA 3HMWH 1A14H 1J5OH 3DO7A 1F6AA 1RFDL 1PLGL 3QIBB 2Y9RT 4W6WB 4Q74A 1AGCA 4TPRL 2NR6D 1S7QA 5I8CB 5D7JA 2EIDA 3KLHD 3U7WH 1I8MA 2AQ3A 4WU7A 5D9SA 5D5MB 5I1EH 5M94B 2QQKL 1XGYL 4M3KB 4X5LA 1QACA 1JPGA 3MV9A 2NY2C 4NRXA 2NXZB 3RNQA 4G6AC 3BYTA 4JDTL 2CUMA 1EERB 1F58H 4X6DA 4QXWA 1A7QH 5E9DB 2R4RL 3KXFD 3C6LA 2DMBA 1X4ZA 4GAYB 4OV6F 3WDIA 2NZIA 3FFCD 1WZLA 2MMXA 4MDJB 4ZPVA 1TVHB 1F11B 2GJ6E 5I75C 5SWZB 2AEPH 4TN9A 3ZO0A 4NHCH 1OGAD 1N26A 4X80L 2DS4A 4EI5A 2DM2A 2R4SH 3MV8E 2EXWC 5JXEA 5MEND 1DL7L 1KF9B 2ZJSL 3FB7A 4C59B 1ZANH 5EOTB 2V5TA 4AH2B 1SVZA 3SJVB 3RGVC 4LCUB 4CBPA 3I85A 4DAGH 4V1DB 1GGCL 3TN0A 1ONQA 1NBZA 4Y4HC 2FJGB 2DN7A 2AK4D 3H9SB 2O5ZL 2F54E 1SY6A 5IVZB 3T4AB 2GY5A 4ETYA 1LDSA 2YUVA 1CK0L 2AJVL 3EYSL 3CZJA 2QQNL 1DFBL 1RUPL 3QQ9C 5EO9B 2VERN 3HB3D 4BQ8A 2IH3A 4Y7MA 1CDJA 3WN5C 1BBDL 3SDCB 3P0YH 5J12C 3E2HB 4BH8B 3MGOB 1DUZB 2RGSA 1G7PB 1KIPB 3DYPA 3INUH 4PGEA 3UZQA 2RQ8A 1IAKB 3FAXA 1FNEB 3JBG7 3ZZ1A 4F7TA 3BHBB 2QQLH 4ONFH 2VLKE 4FQIL 1S9KC 3CFKB 4P48A 1MSPA 4PRPE 4JM2B 3PGFL 1YJDH 4PJ8D 4GUPB 2JB6A 3VGBA 4NNYA 2HP4A 1T20B 4K9EC 3ZL4H 2VXSH 4YHPA 5IB5B 4P2RA 4IBLT 2ATKA 1PZ5B 3PGDB 4KY1L 2Z31A 3QCVL 2HTLD 1QBLL 1YN7A 4YEEA 43CAB 4F8QA 4IRSD 3QUKB 4IS6B 3VE0A 2Q8AL 5TF1H 2Z4QA 1IT9L 5EPMB 3S3SA 3SGJC 1HZHH 3ARBA 1HQ4A 1P7QB 4LSSL 1D5MA 3Q3GB 3PV6B 4LCCC 4LHUB 4HBCH 3U7YH 5DVNA 1MREL 4P5KB 2C3HA 2H2SD 4P57A 1ZLWH 3QCUL 3AC0A 3QO1A 2HLFC 4M1GL 4JB9H 4Y19A 3QI9D 2ENSA 3KHOA 5IMLA 4UI2A 1FFPB 1MOEA 4OF0A 3TO2B 4PJXA 2DTSA 1RURL 3MJ6A 4O5LH 4XWGH 1SQ2N 2BNQA 5D7LE 1AQDB 4UT9L 3RVWD 5EU6D 1FYTE 2NQCA 4JKMA 4NO3A 1D5ZB 3RIFK 1KB5H 5GS1B 1KCUH 3ARFB 3TIDA 1J87A 3PGCB 2UZIH 3BKMH 4HT1L 3HZVA 1C8PA 3GFUA 5IMMA 3D48R 5F9OH 3SKNA 2D31B 4OB5H 5ID1A 3TO4A 3TVMD 4DUXA 4M6NH 1R3JB 4Y89A 4WUUB 4Z7NF 2DLHA 2F8VA 1KJ2L 1N64H 3QEUB 4HAGA 2PXYC 3HKFA 2AV1B 3WHXA 1T66C 2AJ3B 3KS0J 3BPCB 4BQ6A 3GJFB 4PJIF 1DQTA 1BVLA 4LCYA 3OB0K 3MACH 1CICA 1XFPA 5C0AD 1RUQL 4YPGB 3WIHH 4EBQL 2Z8SA 1ZMYA 1FFOB 3B2UC 4XWOC 3VFOA 3KDMA 3MSPA 1C5DA 3RWJA 3SKOA 2EYSA 4G8IA 2FYYB 3KWWB 1E27A 4MX7B 3UTSB 4KMTH 1JCKA 3NACH 4QRRA 5FO9A 2X9WA 4G9FD 4HQQH 1W72B 2CUHA 1CLYL 2VDMH 4M6OL 3ULVD 5DRWB 1YMMB 4HFWB 1L4IA 4OZHF 5ESQB 2DTML 1CFTB 4WHYH 3JWNC 4YGVA 4XVTH 1UWEH 3LEYH 2YR3A 4U1LA 2E7CA 3VFVA 4F37K 1B90A 1A1MA 4MVBD 1BAFL 2CGRH 3LPGA 3A6BH 4M1CD 1X5FA 3N85L 5IV2B 3QEQB 4OQTH 4R97B 2X4TB 1FGNL 1XGQA 1G84A 4H0HB 2NY3B 4MLIA 5FV1L 4ONOA 1F4XH 5DJYA 3S34H 3VXMA 5JUEH 4OAWB 3STZB 2DWDB 3RJDA 3TJEH 3IXTA 3QDGD 4XC1L 5JO5A 5DYOB 4WJ5B 1PSKH 3QXUA 3C60B 3PNWA 1ZLVH 3HC4H 2VLRE 4GAJH 5D1QA 1WIOA 4RX4A 9CGTA 3LKRB 1FJ1A 3JTTB 3W9DB 1XEDA 1F4WL 5LXGL 2WM0A 1I7TA 1IGJB 2VXUH 4URTB 3LZFH 4BM7A 4YHIB 1GZPA 2V2WA 1YY9D 4NWTL 3OF6D 4ONGL 1T6WA 4QT5A 4ETQB 1RJYB 5CGMA 3G9AB 3PQYE 2E6QA 1UJ3B 1YPZA 2EO1A 4NJAH 1BEYL 4R2GD 4RGNE 3AREA 5GRVL 4OV5A 1K2DB 3GEWB 3HZYB 3DVGA 1FL6B 2P5EA 1RZIA 1YNKH 2XRAH 1MJJA 1AGBA 3UTZA 2NW3A 5I66B 5I1JL 1U8KA 3SDAB 1CXLA 2F19L 2FHCA 1HKLL 1RZ8A 1VADA 1RZJH 5HVFB 3BZEB 4DTGH 4OLUL 4Z7UF 1YN6A 4OSUH 3PWPA 2IADB 3AAZB 5B21A 2A74A 1WWCA 1GGIL 1S7SA 5EOCH 2WAHA 4EDWH 1FO0H 1QRKA 2A0LC 1R3HB 5DD6B 2OL3H 4QXTB 2H9GB 4H1LB 4NZTL 5ICYA 3WS3A 4MJ2A 5JHDE 1VFBA 3OZ9L 5CUSL 4U49A 1NGPH 4G6FD 2QSQA 1HHGB 3BGFB 1FDLH 4PRBB 4PR5B 4FQHA 2ITCB 2FECL 5IK3A 2VN7A 3T65A 2Z92A 4C4KO 1T5WA 3BE1L 5KS9A 4CVWA 1J0HA 2P24A 3P9LA 4NGHH 5HHQB 5IW6B 5GGTL 5EUKA 5JZ7D 2OR8A 5DMGC 2OXHA 2OSLB 3K74B 3FT3A 4W4OC 3LD8C 1DQJA 1KNOB 4NYLA 5LJYH 1RIHH 1V7NL 3R06B 1A9BA 1FVEA 2X9YA 3UMTA 1JGUH 5C0ND 4DK6A 5KSBA 1F4YL 4FQ2H 3RA7L 2Q3AA 2YXMA 1RVFH 1LDPL 2VQUA 5FO7B 3LSOA 1PYWA 3VA6A 5LAXA 3IDGA 2R2BA 1SHMA 5HY9A 2O61A 3EOYG 2Y4SA 4H20H 4XVSH 2X1OA 4XCYB 1YEIH 5BQ7A 4HH9B 1ZHLB 4DGYL 1XF3B 5AUMA 4R90L 1JGVL 2A83A 4XBGB 4GT7A 1FAKT 4OIIH 1NUNB 2JJTA 2NY2B 5HHPB 1HIML 2QBWA 1JZ3A 2H26B 3MRDA 3RWHB 1KOAA 5L2KB 2RCSH 1QHOA 4XMLL 2YK1L 5GHWH 1G6RA 5TGBB 4HIJB 2ZG3A 1AY1H 1BQLL 1M7IB 2P8LA 3ARDB 4KTYA 3VGEA 2QKIB 3QUZA 5J06A 1N7ML 1MHPH 4OF7A 3BN9D 3R1GH 1DQQA 3VRLF 3OAYH 32C2A 4HUWB 5I75B 1ITCA 4HV8B 5DMIL 1NGWA 3DETC 4APQB 5C8JB 5HJ3A 2YOCA 5E8OA 4EVNA 4EOWL 4OUUA 3MLUL 2NPLX 3GNML 5H94A 3A67L 2CKBB 2MPAL 3IAPA 1OVZA 3AM8C 4UTBL 4TOYH 4ODWA 3EFFA 2Y36H 5KOMC 1T2QH 3GSXA 1BX2B 3RVTD 5EO0A 3P4MA 3VRIA 4HIXH 4QEGA 4LL9A 1BJ1H 4UBDC 1NL0L 3F5WA 1QR1B 3DUUB 3U6RA 3GB7A 5DJAA 4BQBA 3L7FA 4UUJB 5EBMA 3OXRB 4RA0C 5J12B 5D7IE 1MCFA 1QFOA 4LOUD 1BZQK 2EYTB 5AAWA 5CBAA 2X41A 4R96A 1MCQA 5BS0D 4KJPD 1OW0A 4U1SA 3VFSB 4JRYE 5ISZA 5LCVH 3QJFB 3IVKA 3B9KC 2IQAB 2OZ4A 5E99H 4IMLB 2OQJB 2P5WD 2CDEB 4RNRA 4YDVA 3WEXB 1A1NA 4LLYA 4J8RA 2NX5E 4PJGE 4GS7C 4ZUVB 2X4UA 2ED8A 4D0DA 3V2AR 1TZHA 1UB5B 4MNQD 2F53A 2I60H 2EYRB 4UV4H 4ZODA 4N9GB 5JHLH 1Q94B 4FTVD 5F1KC 3TLRA 1JMZA 1BM3H 4JANA 1OD9A 4RAVA 4WI3A 1Z5LB 3ETBF 3D25A 1C7TA 4MD5A 3PHQA 3MRMB 2OJZH 4HS3A 2VABB 1WC7A 3UO1L 3D85D 4QO1A 2R1XB 3MLSH 2HFFA 4PRDA 5FYKD 4NM4L 1BIIA 2Z35B 4HHAA 4TNWF 4S1DD 1ZA6B 1C5BL 4LCCB 4QHUB 4ORGB 3PWVA 4LCWA 5GGRA 1CD0A 1ZAGA 3NCCB 1WSST 1I9JH 4L4TA 5D2NC 2DQIL 1HXMA 3IDIA 1K8DB 4QRPA 3CU1A 3BIAX 3WFHA 4MJIB 3SGEI 1Q0XL 3LMJH 4GRMB 5E2UH 2VITB 5DLMH 4CVZA 1YJDC 1WFUA 1RSFA 1HOCA 4L3EE 1TTFA 5TQ0H 5IVXF 1QUNA 3UTTD 5FKAB 4PRHE 1VSCA 3H3BC 5K9KA 3GKZA 1P6FA 4RFOH 4PRNB 3CMOH 3CLEL 1CFVL 4GMTL 3VFWB 3SKJL 4O2CB 4AIZA 4HG4K 3PABA 1CDBA 1IAII 2PXYB 4YBQC 1INQB 3HS0A 4F33A 4P9MH 2IMNA 1JI1A 4EN3A 1NUDA 4M7ZC 4WI4A 5JW4N 4N5EC 1CL7I 4J3VA 4GRWB 4AMKL 5DVOA 4EUPH 4UV7H 3RNKB 1LEGB 2BNRA 5CZXC 1BGXL 3O4OC 3RWIB 5I30H 4NWUL 3T1WA 3ROLB 1NAMA 3RX8A 4YDIH 5DVLA 3MXVH 3TBTB 1OAUH 3IJYB 2HT2C 1D5XB 4XPAL 4FN0A 3TBVA 5F7DB 5HYSA 5JXAL 3QO0B 5HDBF 5JOPD 4Y4FA 1J0JA 4X6BA 2R2EA 3QB7C 5DF0A 4B0MM 4GG8A 5IFHH 4U1IA 3T0AA 1QPPA 4JHWH 3A0OA 5I1LB 3HE7D 1SVCP 2BY3A 4E41E 1LE5A 1NCBH 1MUJB 3U36A 5EU4A 2FX7H 3PWJB 4F7PB 4GBXD 1MHHB 4LHUG 4R4FL 4N8VA 4UDTA 5BJTA 3C9NB 4RSVA 1U3JA 1GPOL 2BCKA 2XA3A 2VDOL 1ZT7B 2I9TB 3KPQB 5HYJB 4JRXD 4X7SL 3X13B 1D9KA 1FNGA 4KKLD 1FZOB 1S7UB 3D3VE 1B88A 3UJJL 1MI5E 3P9MB 4TULH 4N0CD 3X11B 5E8PB 2Z8RA 4PV8B 1OAZH 4KUCF 3BP4A 4LIQH 4DW2L 4MYWB 4I3SH 3MLTA 4D3CL 3PWNA 1NUGA 3EW3B 4R3SA 1MJ7H 4UOJA 3MROB 4NRZA 3HNTH 1YYLH 3QNZB 2WWMD 3D39D 2PF6A 4YFDB 1P4IL 3O3UN 4HD9A 1EXUB 4RBPH 1RMFH 4CN6A 4AM0A 4M8VA 3GSWB 2VDRH 2FDBP 1NBVH 1F00I 3O2DA 1QFWL 1KPUA 4X9FA 4ZFOL 2EO9A 4X4ME 2VXQH 4CNIB 1FBIH 3WUWB 1NFDF 4FRWA 4S10A 3MFFB 3MV7D 5DD5L 3K2MC 2BHZA 2XTJC 1IEAB 3V6FB 3PE9A 5KSAC 2HFTA 3VFMA 4GAGL 5C09B 1ZHKA 1CU4H 1TQBC 3D1MC 2HWZH 3SY0B 2J88H 4DCQB 4XP6L 3VXSD 3DOSA 3MJ7B 1NGYA 3A6CL 1FFNA 1N3NB 1M71B 3R4DA 2E9JA 5BVPL 4X9IA 3BEWB 4GMSL 3G6JF 3SDXE 1EV2E 2AI0L 2ESVE 2YPKB 4U7MA 4XP4H 5BZDB 4R6UA 2OK0H 4L9LC 4Z7VA 4ENED 4U7KA 3N9GH 1MFNA 3GKWL 3H42L 4XGZB 5EIQA 4QOKE 2AGJL 5HI5D 3LEXB 5FHBL 3PL6D 4E5XA 2GI7A 3LQAC 1A2YB 4TVPD 1U3HD 5DC0A 4MSWB 1F8TH 4YXKL 1NQBA 5L6YH 3LD8B 3OKNB 2VL5B 3H3PL 3MO1B 1E4KC 3MRKB 1NBQA 3MJ9A 1BD2B 5AYUL 1V8HA 1KPRA 1XR8B 5C6TH 3VFUA 4OZFH 3LAFA 3SEPA 4OCYH 1FVCB 5CJOL 5DJ2B 5TE6L 1LVEA 3O8XB 1UQSA 3DX6A 5B39A 3VD7A 3VXTA 2IQ9H 2NR6C 3FO1A 2IALB 3GMNA 1DEEB 2YRPA 3KLHC 4IIQC 5H35A 4J1UB 4XNMB 3SHSA 3ARQA 3LIZH 1NCWH 3DHJA 3NCFB 4OGXH 3KG5A 2IPKA 4LKCA 4K7FA 2VN4A 4HWZA 4NOFA 3IU3A 1A7RL 3NCYP 2LVCA 2QEJA 4LBEA 3PP3K 1OP5H 3C5ZB 3K2UH 5ETUB 2GJ6D 4Z6AT 4L4VA 3V5HB 5LGJA 3OJVC 3CFCL 4M4RA 3UYPA 4RFNC 3FQWB 1MFEL 4M02A 2DOCA 3S4SB 3S7GA 4KHXL 3B4NA 3MV8D 1IE5A 5TDOA 1CFQA 1CT8B 4JFXB 3KPSE 3DGGB 2AJSL 4LEXL 5HGBA 1NC4A 1L6XA 4OD2A 5ECJE 4XNUH 3TYGL 3IJSB 4PJCE 1OQOA 2BVEA 2G9HB 3FTGA 2F54D 1SY6L 3ZSSA 4D9LL 4Q9RH 3MRFA 5FCUL 1TVBB 3C5JB 5DUML 1EBPA 1N59B 3IF1B 1A0QH 1OQXA 4XP5L 5EC2B 1KBGH 1QSFB 5LGHH 4HF5L 1UM4H 3UTQB 5FYKH 3HB3C 3WXWL 1P84J 4IMKC 4N8CH 4Y4KA 3IDNB 1WCBB 3KPOB 3P11H 5EORL 3HE6D 1ES0B 1L7IL 4I9WE 5CZKA 3PHOB 3MRGA 4FA8A 1ERNA 3FT4A 1AKJA 2VLKD 1NMBL 1YMHB 5C2UB 3KPRE 3DJ9A 5ILTL 1JWSB 3WD5L 3QQ4B 4PRPD 4NNXA 5I8KL 2YD7A 4LLUA 5B3NA 5F6IC 4WI9A 3WIIH 4PJ8C 2GTZB 3CFJB 1CF8L 1IFHH 1W72L 3BQUA 3P77B 5MEPB 3B9KB 3ZE0F 2RBLA 3V0WL 3Q6FA 4M5ZL 1C08A 4GKZA 2FX8H 4Q9QL 1T83C 1RZFL 3L5JA 3VI3F 1S9VB 1IM9D 4GS7B 2X89D 3CLFL 2R0ZL 1N6QH 4NSKA 4P99A 1MCOH 3BD4A 3MBEB 3VXNB 1SEQH 3O81A 3WE6A 4F2MB 1JPTH 4JQIL 3QFDA 4IRSC 3VGFA 1HHKB 3S36L 2AJYL 3S35H 3REWB 3FQXA 2N4IA 5DS8A 4ZTPH 3MPCA 1AGEA 4NC2B 3G5YA 5DJXA 4IOIA 1CN4A 1KJ3H 4ZFGH 4KZDL 1DQLH 1BECA 2OJEB 4JO1H 4W4NA 2H2SC 2XWJA 4MAYC 3K4DA 3MRLA 1KELH 4HDIA 3EO1B 3QI9C 4YHZL 1AGFA 2V17L 1A6UL 2E6PA 5D7LD 5ESAA 5D2NB 5CKGA 1M4KA 5HYEA 1FYTD 5H2BB 2Y23A 4BZ2L 1PEZA 1FV1B 3RVWC 1VGEH 1AD0A 4JO4L 5E2VH 3LS5H 3I2CH 1NFKA 1NCCL 2F5AH 3BESR 3TA3A 3DVNA 4CADB 1Q1JL 2BRQA 4PS4L 3I75B 3CDGA 2FHFA 1W0WA 4P2OC 5GS0D 5IJVB 3FO2B 1NFIA 4K3DH 4MQTB 1G7QB 4LF3A 4HJJL 1DSFH 1CCZA 1XIWD 5E6ID 1C16A 2Q3ZA 2JIXB 5GZNC 2R69L 1U8JA 2WP3O 5LQBL 2EKSB 5EUOF 4F37F 2CMRL 5KVEH 3C6SA 4AQOA 4PJDF 2XY2A 4JKWA 5FXCH 4MCZA 3KR3L 1RUAL 2ZNWA 3P30L 3G5VB 1LP9A 5FB8A 5F7UA 1A1OB 5C0GB 3CH1B 3O3DB 3MRQA 4M7ZB 4WTZA 4YE4L 3G6DL 4ISVB 2NTFA 3BUYA 4HK3N 5EU3A 2Z91B 1LK2B 5SWSB 2DIJA 2P47B 3O4OB 1S9XB 4EIZC 3ULVC 3QIBA 5A2LH 1I7ZB 5IQ7H 1P1ZA 4AEIL 4PB9L 5I8CA 3UBXB 1IKFH 1JV5A 1QBMH 1G7JA 1LEKA 5HHVH 1I8LA 4CDHA 2GK2A 4PD4K 2KDGA 3S88L 2HH0L 3AMLA 4WW2F 1OTSC 4C54A 4YO0A 5DA4A 2R0LH 4MVBC 4NQEA 4M1CC 4DUVA 4ELME 1KB5B 4YPJA 4BKLB 4R7DB 2VDPL 3GSNH 2YPVH 4Y8DC 4QHKJ 1A6ZA 4H5SB 1IBGH 5E2TL 4JKLA 5E8EA 4NQCE 3MV9E 3HI6H 4GAYA 3VRJB 3WSQL 1F3RB 3MNWA 4NFCA 1FYHB 2VLRD 4TQEH 4GG6F 4DFIA 5KVFL 1CGSL 4LQFL 3SBWC 3QA3A 4YBLC 4MDJA 3VG9B 3WS6A 1TVHA 2BSSB 4P2QB 4KRPD 4HWBA 4JVWA 4XPTL 4DN3L 5SWZA 4MD0B 5I1KL 4JG1L 4Z18A 5MP6H 1CFNB 3PQYD 1K6QL 5I1GL 2EDQA 5INCB 3MLWH 2YN5A 3WLWD 4OJFH 4KTDL 5F70A 4RGND 4AH2A 3SJVA 4LCUA 3RRQA 4EKXA 1HILA 3FB5A 2I26N 2XXMB 1PQZB 1RU9H 2FJGA 3RVVD 3VJ6B 3FN0L 3H9SA 4K2UL 3DBXA 3T4AA 1FAIL 1JGDB 4JY5L 1JNLH 1VCAA 3GBNH 5D2LE 3TPUB 4FQCH 2ENYA 5HHNB 1KLFA 3C09C 4PRAB 3LY6A 1MWAL 4UU9B 1E4WH 4XBEL 3CXDL 2AW2A 4G6MH 5EWIH 5IBLD 4JFFE 1OSPH 1DUZA 1QNZH 1ZT4A 4ODSL 4KK8D 1Q0YL 3S35X 4AYFA 5JHDD 1FNEA 1S3KL 4OLXH 4ODUB 5KSAB 3IYLW 1QBAA 2CKBL 3SGKA 1TQBB 3O6ML 4JM2A 4LCIH 3L95B 4OZIB 3EJZD 4GUPA 1JFQL 4RISH 4HUUB 2DQDH 4F58H 1T20A 3EIFA 1YA5A 2YXFA 2DKUA 1W8NA 4XAWH 3PGDA 3NZ8B 3CVIH 2DQGH 2YA1A 4FS0A 4J3OC 1MFBH 5KSVA 5HYFA 2BX5A 4OLZL 5DDHB 4ZFZB 1F6LL 1JTPA 2NYYD 43CAA 4ZO8A 3SDDD 2G60L 1JJUA 4IS6A 5E1AB 5T1DH 2ADJA 4N1CA 1C12B 3L5WA 2L7JA 4HLJA 1A02N 3HCVB 1WWBX 4RWYL 2P8PB 4AG4L 2R8SL 1KTRL 3W11D 3Q3GA 5IJKA 2GK0B 3IFNL 4X5XA 4AEHH 5I15H 3EZ8A 2P46B 4P5KA 4QCIB 2QSCL 4RAHA 3T0XA 3C08L 3M45A 4MA7L 4R8WH 4F57H 2JJWA 1RIUL 1GXEA 1EFQA 1FFPA 3HR5A 3TO2A 2AJZB 2OR9L 3HTLX 1A6VH 5KANG 1X5XA 2OL3B 1FL3A 3B2VH 3OJDB 3LDBB 1MCNA 1EO8L 5GS1A 1D5ZA 5IIEA 3EYVB 4U33A 5C0IA 5L9DL 2A1WH 1G6RL 1T0NB 5EU7E 6FABH 3WIFA 2EXYD 1UM6L 5FA4A 4HWEH 1A7NH 2HG5B 3TCXA 3KXFB 1AQKH 2HRPL 1OARH 2ORBH 1KXQE 1R3JA 4AEFA 4MXQC 2EIZA 3GSVB 3FFCB 3QEUA 3BN9C 4GO6B 2AV1A 3OB0H 4HC1A 1HKFA 1ZEAH 2AJ3A 5ACMA 3BPCA 1K5NB 4OKDA 3H7BB 1OGAB 1NJ9B 3MLRH 4R7NB 4WO4C 1FG2A 4YPGA 1FFOA 5MENB 2H32A 5CD5D 4MAUH 3U4BL 5IMOB 1NEZB 2IPUG 4LASL 3WHE1 4MX7A 3F7VB 3MCLH 4LLDA 4WU5B 3HPJA 4OZHA 3LRGA 2VXTH 4M7KL 2X05A 5GS3A 4G7YL 1CE6B 1YMMA 1CZ8L 5ESQA 1MRDH 1X4XA 5F89B 5HGHB 5F1IA 5A1AA 1MHCB 4QRRE 3QNYB 4DGIH 2H1PH 3WNOA 5EN2B 1BPVA 4FQJH 5IESL 4RRPG 3TT3H 4YHLL 4LOUC 4PG9A 3VWJC 1ADQH 4JRYD 4X7EC 2X1WL 5CJBA 5FO8A 2VDQH 4OZGB 2X4TA 3GI8L 4KPHH 4BJLA 4OAWA 5J11C 2CRYA 3BW9A 3DPBA 4DVRH 3OR7A 2NX5D 2YPLE 3VXPB 4WJ5A 4XCFL 1IC1A 4PJ8B 4U1NA 1CGXA 4DN4H 5T3XL 3T2OA 3V4PL 4LDLB 3VXME 3GZKA 5GS0H 3BX7C 3E6FA 1RQ5A 1IGJA 3SCMD 5CEXB 1HYSD 4M8QB 1RJYA 2FGZA 4FXKB 3UPRA 1GGUA 4W81A 4JPKL 1LO2H 1FFQA 1TNNA 1K2DA 2JTDA 1O7SA 4HMCA 4K55A 4PGDA 3F62A 3HZYA 4IRSB 2YMXL 4RA3A 4G3YH 4NKIL 4YHML 3ZMRA 5I66A 1YEEL 1ZVSB 1L7TL 3SDAA 2FCBA 1X4YA 3OG6B 4M5YH 3MRBB 3RZWA 1BZ9A 1MHEA 2Q86B 3V7AG 5CEZL 1N5AA 3B43A 4MNGB 5BV7L 4LSRL 3KJ4B 4K07A 2IG2L 3AAZA 1SMAA 4OCWL 3QI9B 4TSAL 4K7PY 4TSCL 4U1GC 2VZOA 1R3HA 1HHJB 1MCEA 3OG4B 4L3ED 2X42A 3PWPE 4OCLC 5HGAB 2H9GA 4H1LA 4PJHB 4A6YH 4PRHD 5BZWA 5EU6B 3VXQB 4EXPX 4X6CB 3EYUL 1S8DB 2V5YA 1GGTA 4X7FC 2NY5L 4PRBA 4PR5A 3QZWB 2YD1A 5FHAH 1X5AA 4IDJL 5IHBA 2ITCA 1M7XA 4L1DA 1XGYH 2A6DB 3TVMB 4ZYKB 5IBUB 1KYOJ 4PJAE 4WWKA 1SYSA 4WGVB 1BJ8A 3TT1L 5HHQA 3QRFM 1KG0A 1PD6A 5B8CA 5IW6A 3IFLL 5HDOA 2R4RH 1B0RA 4D9RE 2OSLA 5F3BB 1ACYL 3P0GB 2EECA 3BP7A 3QDJA 5C0AB 3R06A 2Q6WB 4P4KA 1EGJL 4YDKL 3UJTL 2V5MA 2O5XL 1L0XA 3EO9H 4H8WC 1UZ6F 4HKZB 5FO7A 1Y0LB 2V7NB 2KQMA 3UXFA 1DR9A 2WBKA 5I1HL 1DL7H 1A3RL 1MCWM 4G9FB 4Z7WF 1OGTA 5KSBE 1KJVA 1ZLUK 1YNLH 3R8QA 4HH9A 1MIML 4LU5L 4E41D 1T1ZA 4WEUD 1XF3A 4MB5A 3GM0A 4XBGA 3HE7C 5AZEL 3EYSH 3LKSB 2FO4B 1OPGL 5HHPA 2QQNH 3A6OA 1DFBH 1RUPH 2EIBA 1YQVL 2E3VA 2H26A 2NNAB 4FP8L 3VU2A 4GBXC 4H88L 3NH7L 1BBDH 1KFAL 4HIJA 1AJ7L 5JW3L 4OT1L 3V52L 5IVOA 4D0CB 4JLRA 3QDGB 3BUTA 3D3VD 1GRWA 1MI5D 3L9RB 4YBLB 1OCWL 3EUUA 2EEBA 1VFAB 3VWKD 2X10A 2YZ8A 2B2XL 4HV8A 1G7HB 3O6FD 4N0CC 4KZEH 4G8FB 4U6HB 5DQDL 1ZGLB 3FMGL 5C8JA 2A77H 5GRUL 5KG9A 3RGVA 4EUPB 1BVKA 3MRNB 4R2GB 3T08A 2WWMC 4Y4HA 4XMKH 4K8RL 3TIEB 4LLQB 4GW4A 4KY1H 3RWDB 1XAUA 1JN6A 1YEHL 3B3IB 4ODBD 3QCVH 3BZFB 3ZE1E 3UZVB 4JR9H 4ZUTA 3UP1A 1QR1A 3DUUA 1FZMB 2Q8AH 4CMMB 3C09B 4O2EB 4D0BB 3CUPB 1NAKL 1IT9H 3CD4A 4KDVA 4UTAH 1F90L 1J8HA 4UUJA 3WN5A 4OCRL 3OXRA 1JZ6A 3NCMA 4WFGE 1QFUL 4QHMB 2EYTA 4MXVE 5C70A 4Y0GA 1U2CA 1B0GB 4KJWD 1R3KB 2RAMA 4L8BB 3QCUH 4ONHB 4JEGB 1QLRB 4R9HA 4M1GH 4JFYB 3I3DA 4N0UB 2ESVD 4IMLA 2OQJA 4IRJD 2CDEA 3QSKB 2IWGA 5DK2B 3D18B 3UBXG 1RURH 4L8DB 3BH8B 2X1QA 2XKSA 3P2TA 4UT9H 4FHBD 4QOKD 2XKNB 2DLFL 5DJDA 4XCEA 4NBXB 3QXAA 5HI5C 4N9GA 3PL6C 1Q94A 3FOLB 3QP3A 1F58L 1U3HC 2CLVB 3DMMD 4LLWB 5T3XE 2F8OA 1A7QL 1VENA 5DMYA 1KJ2H 1P53A 3MRMA 5FUOL 5TFSL 2DM7A 5HPMA 2VABA 2GJJA 3F7RA 3MREA 2R1XA 3BZDA 3SGJA 2Z35A 1U8MA 4LP5A 5ERWB 2AEPL 1F3DH 1HYRC 4LCCA 1RUQH 4OGAC 5EDXA 4EBQH 3L3JB 4JJHA 2R2HB 1MCSA 5TQ2H 3ARRA 3B8SA 4TNVF 3D69A 5TH2B 1XGRB 1ZANL 5DUBB 2GUOB 1S5HA 2YWYA 2X4OA 3RI5K 4N0RA 1OWRM 5HYJE 1CG9B 4MJIA 3QFJE 1HDMA 4GRMA 5CEZE 3RJQB 5J7CC 3LS4H 1K4CA 2DTMH 1CDHA 1D5BA 5ELIA 4KV5F 2DJUA 4KGJA 1J11A 4ZMAT 5FKAA 4I0KA 3UJIH 3MGTA 4G80A 1TNMA 3BT2L 1ZT1A 1S78D 4PRNA 3VFWA 1BAFH 1P7KB 2DF3A 5C0FB 1DVFD 5CJXC 2YN3A 4O2CA 1XZ0B 3KPSD 1WBYA 1FGNH 2PXYA 4PJEF 2MHAA 3QHZL 1XCQB 4S0TD 3ZLQC 2FGWH 4POZC 3VMNA 3RQ3A 5E1HB 2W0KA 4WFHE 1KENH 2HJLB 3LHPL 4WDIB 4HS6A 3T09A 1U6AL 2PCPA 3PHSA 5LXGH 3RNKA 4UQ2A 1FG9C 4OZFB 3WXVH 1UCTA 3JVGC 2SEBB 5E2JA 2JCCE 4DKAA 1ZWIB 4QHNB 3ZL4L 4ONGH 3IJYA 3VD5A 3KYKH 2BNRE 1BEYH 3IJHA 5F7DA 4Y5VC 3QO0A 3B9EA 4I9WD 4I2XB 2BSRA 3RUGE 2H2PD 1E28B 2A9ML 1C7SA 2AEWA 3HE6C 3G04B 3NPSC 3KPRD 4P9HC 2F19H 5EC1B 2WBJD 4FFZL 3OKEB 3T3MF 2H41A 3MA7A 1MUJA 3SE3C 2IPTH 4OLUH 1Y6NR 3RBGA 5FIEA 3ARPA 4F7PA 4X99B 5BS0B 1CDGA 1MHHA 3U7YL 4HBCL 3C9NA 3FB8A 5D6CB 4BK4A 1ZT7A 1GGIH 5J11B 1SJXA 1WCQA 2I9TA 3N50A 3KPQA 2DIAA 2P5WB 3X13A 1T7ZA 1CFSB 4N1EA 1FZOA 4OD1L 3VFTB 1S7UA 4NJ9H 3WNKA 3OZ9H 3P9MA 4K94L 5CUSH 4XWGL 4NKOB 1MNUH 3BJ91 3NIGE 4PV8A 1TQCC 4MNQB 1DQDH 3V6ZB 1ZGLP 4QTIH 4MB3A 1EO5A 3BKML 4FTVB 3MROA 1T21A 4WTWA 4OB5L 3L5IA 1VEPA 3GSUB 4MQ7B 2DMKA 4CU8A 2Q76B 3MGAA 3D85B 4ZS7L 2R56H 4U6XB 2Q7NA 3IS0X 1U92A 4PJBB 4M7LL 3BEVB 1RJLA 1B2WH 1SM3L 2OX5A 5F7YC 1V7NH 1M7DB 3MNZA 3O6LH 3WIHL 4CNIA 3WUWA 3O0RH 3ZYJA 4DJMA 1F4YH 3RA7H 3JTSB 4PV9B 5CGTA 3HZKB 4PJFB 1B6DA 4MGXA 4U6YB 3V6FA 1LDPH 1NEZG 3BIKB 5I17A 1MCJA 5FDYA 1F97A 4EI6B 5BW7C 3UYRL 4U1GB 4O02H 1CGVA 5GGRY 3SY0A 1GC1C 3V7AE 1U8IB 2IANE 1FSKC 4DCQA 3NACL 3QRGH 5EB9A 2C1OB 3MUGB 1N3NA 1M71A 1Z9MA 4O9HL 4F9PC 4HQQL 3N1FC 3G6JA 4I4WB 2YC1A 1I7UB 1IKNC 2YUZA 4DZBB 3BEWA 4OZ4B 4M7LT 3UTTB 3DGCR 4JREC 2I25N 4DGYH 5D6DC 4XVTL 2YPKA 1JGVH 5BZDA 1XIWC 2L7UA 1FC2D 1WUNT 5DZNA 3ZDXE 1HIMH 1HNGA 4YHOH 5AD0B 4KK5D 3MV11 4P0DA 4XGZA 4Z95L 4EZMA 4YXHL 3K8LA 2E8ZA 2FO1A 3O4LA 3V5DB 2G5BB 1BQLH 3KPPB 2XG4A 1F4XL 4W4OA 5HHOA 1LK3L 2VL5A 3MO1A 1T3FB 3TCLA 1BD2A 4LLVA 4U4BA 3HC4L 2LU3A 1FVCA 1SJEA 5DJ2A 4LPWA 3EDEA 1AE6H 1P2CA 2BVQA 3GO1L 5GSRB 4CN1A 4EOWH 3MLUH 1CVRA 1YEFL 2C4FU 5ANMB 2IALA 3A67H 1EZVY 2MPAH 2VXVH 3ALXA 1IGYB 5DK0B 4NJAL 4UTBH 4U6VL 1N8ZA 3B5TA 3CJJA 1OB1B 3QUXD 4XBPB 3CCHA 1YNKL 1MQ8A 3FONA 4O00A 1ZVHA 4IJ3C 1NL0H 4NQCD 3HE7B 3MV9D 3PP3H 2DWEB 2LAGB 3GJEB 4HWUA 1A4KA 1T2JA 3BI9X 1RZJL 1NANH 3Q5TA 4GBXB 4OF5A 4DTGL 3V5HA 2PR4L 4Z9KB 2UWEB 2LQRA 3LRHA 2D7PA 3UPCA 4ZPTB 4LKXB 1P7QD 2B1HH 3S4SA 3WFZA 3B5HA 2VMFA 2J6EA 1CDYA 5JPMB 1FO0L 4JFXA 3D6GA 5MEQB 3DGGA 3IGAA 2AJUL 5J6HA 3WLWC 1XR9A 1OM3L 3IJSA 4AENB 4EI5D 4QNPF 2CRZA 1NGPL 3EJJX 4Y16B 5F93C 1YEDB 2ZPKL 1K8IA 3QZWG 3RVVC 3RY6C 1ZHNB 3T0WA 5B3JF 5DO2D 4OFYA 2PTVA 3IXAA 4NP4H 3AM8A 1U8HB 3D39B 4AL8H 5EC2A 4DKDC 3OKMA 1U91B 4KAQH 5IQ9B 1V3MA 2QSTA 4GKNB 4JFFD 1X5JA 1WCBA 4X6DF 5IBLC 3UO1H 1NUFA 1R5WB 2MCPH 3RL2B 4NM4H 3PHOA 3U83A 4KK8C 3GSNB 3TWCL 2L0DA 3MV7B 3OB8A 1YMHA 3GUTB 1KCRL 5ICXB 2F8XC 1C5BH 1JWSA 4J23A 4OM0L 3QQ4A 3QUMH 1NMAL 2ITDB 4KTEH 3DV6A 2O5YL 5FEBA 1U8PB 3VXSB 3S96B 2DQIH 3CFJA 4JZJC 3P77A 3VFNB 1ULVA 3EJZC 2B7DT 3B9KA 5MEPA 5I2IB 1KIUA 2JJSC 3NVQA 2OMBA 1E4XL 4XVSL 1Q0XH 3LV3B 2A38A 1S9VA 1UXWB 1JRHH 4LVHC 2X4SA 4PLKD 1G7MB 1V7MH 4P23C 4NUGL 4F2MA 1YEGH 5GGVH 1KTLB 3SDDC 1H8SA 3SO5A 3BD5A 3PL6B 2Z31D 3CLEH 1CFVH 3S98A 1AP2B 3BOVA 3MYJB 1U3HB 4GMTH 4YEFA 2W65A 5DHVH 3SKJH 5SX4H 1AY1L 3C5SB 5DURD 2P45B 8FABB 2FECI 3W11C 1G1CA 3FQTB 2O93L 5C0DA 5KAQF 3KPMB 2P42B 2PUQT 2WUBH 4Z77B 2ADGA 1UADC 2Y72A 1I75A 2AJXH 1T6VN 5EIIB 1H5BB 3EO1A 1I1FB 3V9FA 4LEOA 1U36A 3C60D 4AMKH 3MLYL 3CNKA 1BGXH 5MERB 4NWUH 5D2NA 1WGOA 4NQSB 4EUPG 1CTNA 1P6AB 2IGFH 3BPOC 5EZOL 3RX7A 1V05A 5IOPB 5DRNB 4XCNB 4XPAH 4QHLB 2DI9A 1UA6L 4CADA 1NLBH 3I75A 3V8CA 5JXAH 5IJVA 3FO2A 2EXYC 5GJTH 1DANT 3T3PE 3MYZA 5B38G 5EZJB 2GJ6B 4HC1L 1EFXD 1QFPA 3MXWL 1TZIB 2VB5A 2EKSA 4BFGA 3K8KA 5F8RC 1FZJB 3MV8B 2X4RB 2X4NB 1AH1A 2R15A 5GXBB 2DYPB 3T2PA 3OKOB 3KPTA 1T1YB 1JWMB 2VDOH 3ORJA 3G5VA 5LCVL 1A1OA 4QRUB 4UOW1 4X7SH 1T04B 4Y2OA 5E99L 3CH1A 3O3DA 4XRCB 5C0GA 2F54B 1NMCC 3QXWA 4ISVA 1H3GA 1MFCH 2Z91A 1LK2A 1R3IL 1ZXQA 1XGTB 1LP9E 1S9XA 2ATPA 3S9DB 5JNYA 1I7RA 4PJXF 4QRRD 1I7ZA 1TTUA 1HCFX 4D3CH 4HWNA 4I0PC 4UV4L 1QTYT 4YH6A 1MAKA 2YBRB 1BM3L 4GRLD 1P4IH 3W2DL 3D9AL 2MKLC 1YECL 3CH8A 2OJZL 4PB0H 3HE6B 3NPSB 4QYOA 1X3DA 4R7DA 2CLRB 4JY4A 1T5XB 2VLKB 5LKNA 2YPLD 4PRPB 2QHLA 4NQEE 2FR4B 2V5RA 2CR3A 1OL0A 5DD5H 2VAJA 3KVQA 3T0BA 3VXMD 3FQRB 3X12B 2AXGB 4P2QA 1FNAA 5IHZB 4MD0A 4GAGH 3IRZA 5FYLL 2AQ1A 5DD0H 1NGXA 1ZSDA 3SCMC 5L8JB 5D1QD 1WWWX 2GKIA 5D71H 5INCA 1IM9B 1YZZA 1HYSC 5BVPH 4JFHE 4GMSH 2HFEA 1TQCB 2XWBA 5HHME 1PQZA 2AI0H 5TQ0L 1N4XL 5C0CB 5GISH 2VUOA 3VJ6A 2HFGH 5EBGA 2FATH 5GGUB 2PW1B 1JGDA 3H42H 2AGJH 5DD1L 3TPUA 4C4KT 2AAVA 4P2CG 3T04D 5HHNA 4PRAA 4XI5D 3OKKB 5ACZB 3HRZB 5DVMA 4UU9A 1LQSR 4YXKH 2P8MB 4P9ML 1WZMA 2WIMA 4JFDE 1DBML 1NDGB 5FGBC 2X7LB 4JHAL 3OTTA 5EOCJ 5AYUH 3WYRA 3PWPD 5DSCB 4OQTA 2ILLA 4DQOH 4PP1D 4GSDL 4JY6B 5D7LB 2VKWA 3KNBB 4ODUA 1FYTB 5KSAA 4F7MB 2E7MA 4CAGA 2ZSVB 1KACB 5I30L 3M17B 3VMOA 3ZSTA 3ES6B 5HHXL 1UWXK 1J9CT 1OAUL 4QRSA 3L95A 4OZIA 2J8UF 4G43B 5DI8B 2OM5A 2VAAB 1WIUA 3H9HB 1YPZF 4JREB 5IFHL 3ULSB 1XIWB 4D9RD 5E6IB 1NCTA 1A7BA 4L9LA 4JHWL 3NZ8A 4CKVX 1A7RH 1FZKB 1TXKA 4XNZB 1AR1D 5DDHA 4ZFZA 2BDNL 1NCBL 4CVXB 3KLAA 5IF0A 3LKNB 5E1AA 1PG7H 3DIFA 1C12A 4Q6IC 3CFCH 3EYOB 4X98B 4RMVA 3E3QE 2D0FA 4XX1E 3UX9B 4MJ5B 3S6CA 1MFEH 4GG6B 3FKUS 3HCVA 3DX8A 4KHXH 1NGQL 2P8PA 3ALWA 4N0FB 1E4KA 4PGBB 4S1RL 3GRWA 2AJSH 4LEXH 4WVRA 4ZXBD 3TYGH 4QCIA 4HUNB 4KJYA 2C4FT 2CIIA 2CIKB 2EEAA 1SY6H 4HUMB 2FIRT 4LIQL 5FCUH 4ZDHB 2YEZB 4I3SL 4WI7A 1YC7A 3CFDA 2WNGA 4IIQA 5DUMH 2NXYB 2OL3A 1MJ7L 2BP3A 4XP5H 3OJDA 5D1ZD 2EDLA 3HNTL 1YYLL 3EYVA 3ARTA 3WBDA 5KS9F 4L8CA 4IJ3B 1T0NA 1PFCA 2LTQC 4PJ5E 1F2XK 2FEDD 2VDRL 3FT2A 5EORH 2HG5A 3BJLA 3KXFA 1L7IH 2CO6B 3BPNC 3NAAL 1KSRA 2VLRB 3MOBL 2APWA 1BMGA 1FBIL 5ILTH 3EZJB 4KRPB 3WD5H 4Z7NE 3THMH 3QUZD 4JGMA 3VWKC 1OGAA 2VQTA 2QTEA 1BOGB 2ZOKA 4LPUA 4R7NA 5GGSB 3OWEA 3PQYB 2HWZL 3TBWB 4PJIE 1CF8H 3TM6A 5MENA 4YHNA 3V0WH 4RGNB 5IMOA 2F9BT 4Q9QH 1RZFH 4LMQE 2J1KA 2PYEB 4WU5A 1EH9A 3CLFH 2AK4A 4XP4L 1T0MB 4Y5XC 1MCWW 1N6VA 4O51B 1BJ1J 1ZA3A 5F89A 4AIOA 3NIDF 3ET9F 1QVOB 3S36H 4OZHE 4IMKA 3DX9B 3CX5J 4WFGD 2DQJH 3FRUB 5EN2A 2O26U 5C71A 3ZTNH 4KRLB 1OWWA 1F8TL 5L6YL 1T1XA 2DM4A 3CPLB 1L0YA 4GFTB 1FLRL 4WRLA 5JHDB 2MFNA 1NDMB 4IM8A 5C6TL 4HH8A 2DD8L 5HVWA 4YHZH 2V17H 2R1WB 1A6UH 3K4AA 3VXPA 3IKCB 5EFIA 2IQ9L 4PJ8A 4QTHB 4JZJB 5T1LB 3BZ4B 1QFWI 3ZT6A 3RDTD 4XPFL 5IB2A 3HAEA 1Q8MA 4HX1B 4JO4H 3IU4H 1T83A 1H8OA 1ORQB 3N0PB 4Z78B 4PS4H 3RI5F 1NCWL 4LVHB 2AABH 4M8QA 5T3XD 1JUFA 4OGXL 3GIVB 2FL5B 5T1MB 3DMMC 2DQEH 1JYVA 2FIKB 1JHTB 4XPGH 5FYLE 3SDDB 2DQUL 4IRSA 4BFEA 1Q9OB 4RMTA 3K3QA 1T03H 2R69H 5C0BB 3VFPB 4LP4A 5CIPA 1H9VA 2IFGA 5IG7A 3G5XA 3MRBA 4GLRI 2EC9T 2XZAL 2EH7L 3KR3H 1KEML 1VFUA 3LKPA 4X6FB 2FEEL 2BK8A 4Z7UE 4MAYA 1UH4A 5HYJD 2AXJA 1LEIB 3QI9A 4YE4H 3G6DH 1KULA 2B20A 1PG7X 3QFJD 5CEZD 3LQZB 5F1NA 1HHJA 5KSUB 3U30C 2VZTA 3VGAC 1X5LA 4PJHA 5K9JH 5EU6A 4HIEA 3VXQA 4EJ1C 4X6CA 3RWEB 2X4PB 4AEIH 4PB9H 2PO6C 4U0RC 5LGHL 2OTUB 1UM4L 3QZWA 1MCLA 5D7KE 4C56A 5CJ5A 5CEYA 3S88H 2HH0H 2ZOLA 1S78C 4P2OA 5T33L 2HVKA 3V6BR 1W0VB 2B4CH 2A6DA 1DVFC 2UUDH 3CXHJ 1MCIA 3ZKMD 1GHFL 1CFBA 2GW5A 2OXGA 5E4EB 4WFHD 3HUJF 5F3BA 3ZKSD 3E8UL 5JOFB 4F7CB 1Q9KB 3WSQH 3L3HA 3FB6B 5GQBA 1KJ2B 5KVFH 3U7AA 1CGSH 1IAMA 2VC2H 2R29L 4LQFH 3BWAB 4DN3H 4XPTH 3H0TB 4EN3D 3WIIL 1BWWA 1IFHL 4EQ2A 1P4LB 4H25A 1J10A 4MJ4A 1I9EA 2ARJB 1EMTL 2V7NA 5I1GH 2GSGB 4Z7WA 3QDJE 2EDFA 2BNRD 3NABH 4G9DB 4QLRA 4DEPC 4JFEE 4G9FA 2FD6L 5D70H 3MFGB 1MY7A 3WKNA 1LO3L 1MJ8L 5LBSH 3FN0H 2GT9B 3NMEA 4ERSL 5IFJB 5D7IB 1FAIH 1QSEA 3K46A 1ZLSL 2CO7B 3ARYA 4ZTOH 2WBJC 5C9KA 5EH1A 3DARA 3O3EB 1KJ3L 2EDRA 3W39B 2NNAA 1MWAH 1A47A 1D3CA 4JRYB 3CC5B 4LIQE 3CXDH 5ADOL 5ID0B 2VR9A 4LVNC 5I18H 4LK4A 15C8L 1X6NA 1U42A 4ODSH 1VKXB 1Z6JT 2OI9C 1S9WB 3MLZL 2PW2B 3QDGA 2NX5B 4PJGB 1Q0YH 5C0EB 3SBWA 3L9RA 1S3KH 3FO0H 4WI6A 1UKTA 5IB3A 1LNUB 1INEL 5I0DA 4X9BA 4K7PX 3VRLE 1D9KD 1IC4L 3SCMB 3RPIB 3MCKB 4G8FA 1ZGLA 5E2VL 3LS5L 3I2CL 3PG2A 4DVBA 1VPOH 3VXOA 4IEFB 3TNNB 4IOSD 4D94A 3MRNA 5J0BA 2ZUXA 3KYMB 1JZ4A 4MQXD 4LLQA 1QRNA 4UIMA 2I07A 3BZFA 2V2XA 4OLZH 4QKXB 1E4JA 2G60H 1U2HA 4CMMA 1QBBA 4K8RD 4O2EA 5I9QC 1EJOH 1DBJH 2C3XA 2DQFA 2Y5TB 2XNAA 4OFIA 4LSUL 4P46D 4XP9L 1N0XL 4RWYH 3BAEL 3FOMB 1T4KB 2G2RA 3WJJC 4QHMA 3IDYC 3ULUF 3ZHDA 2IAND 3R8BB 2HRLA 3IFNH 4Z8FL 2YHGA 1J8HE 1B0GA 2X2YA 1EAPB 2QSCH 1XT5A 3C08H 4L3EB 4L8BA 4ONHA 1QLRA 2B1AH 2LU4A 3RY4A 4MA7H 5DJ0A 2GHWB 4J6RL 4PRHB 5DEFB 1BFOB 3L3IB 1X5HA 5EOQL 1JGEB 4WV1C 3D18A 1DQML 2OR9H 4PJ7B 5K59F 4QRQB 2XKNA 3HMXL 3LOWA 3M8OL 4KRNA 1G6RH 4ZUSB 2DLEA 4HJGA 3FZUD 5FGRA 3TH3T 1FL5B 4ODTH 4HGWA 1UM6H 5HD8C 2CLVA 4LLWA 2HRPH 3SDCC 4NRYB 5DJZB 4M48H 1Q9LA 4L8SC 4NZJA 3HI6L 5E70A 4BSJA 5CS7A 1M6OB 2VISB 4G42B 4JM4H 3OJMB 4YDJB 3EOAA 1I9RH 3Q2CA 4KMQA 5BVJB 4PP2B 3RTQD 1MVUB 3L3JA 4TVSa 2R2HA 3ARGD 4QRTB 3U4BH 1MCHA 1S5IL 3ECBB 5TH2A 1XGRA 1P9MC 5DUBA 1KC5H 1AIFB 4FNLH 3X3GL 5DFVC 2W38A 4C58B 1G9ML 1TJIH 3TEUA 2ZSWB 3QUXC 5E2WL 4E41B 3L7EB 4G7YH 4HKJB 4AZ8A 1CZ8H 1DLHA 1JNLL 1F42A 2HJKB 3PJSB 4ODHH 4LRNL 4Z7VF 4G8GB 2J5LC 2LTQB 2W0FB 5K93A 3QPXH 5SV3A 5IVXE 5IESH 3JZ7A 3CFBA 1E4WL 3W9EB 1P7KA 4YHLH 5C0FA 1XZ0A 4PJEA 5JQ6H 5C0JB 1QNZL 1X5YA 3D3VB 1MI5B 4ZS6D 3GI8H 3OKLB 2OZ4H 1XCQA 4OLXL 3VWKB 1UKSA 3O6FB 4QY8B 4WO4A 4X9HA 5FA3B 2HJLA 4XCFH 1NC4D 4WDIA 5J3HC 2D03L 5T3XH 3V4PH 3ESVF 4LCIL 2UVFA 3T2QA 4MWFB 5DO2C 4OZFA 3B8YA 1IC7L 1ZWIA 3O45B 3V6OE 3EOBB 4NO2A 3ARFC 3CIQA 2X09A 3QDMA 3CVHA 1G7LB 1KN4L 1KXVC 3IFPB 4JPKH 4Y5XB 5F6HI 2VDNH 1OHQA 4BH7B 1WBXB 3RKDC 2WIIB 2DQGL 2YUXA 3CVIL 1MFBL 2AXFB 3K8MA 4P5MA 2YMXH 4RMSA 3RAJL 1G9NH 1E28A 1INDL 5T1DL 5L2JB 3ZT7A 2JIXD 1UH3A 4Y4KD 5HDBE 1KCSL 1YEEH 3DROA 5TDNB 3I6KB 5EC1A 3OKEA 1JBJA 4LAJH 3JWDL 1CI5A 1R24B 1I8KB 3QIUD 3VWJA 1AKJD 1I8IB 1T0PB 3UDWC 4X99A 4EDXB 1UVQB 5BV7H 4AEHL 5I15L 4XB8A 2WMPA 3DUSB 2IG2H 1MCBA 4OCWH 3SDXB 4TSCH 2L4OA 2ESVB 4NDMA 4R8WL 2P5WA 4IRJB 3F6IA 3P4OA 5DQ9B 1A6VL 1ORSB 2A73B 2G75B 1U58B 3O41A 2IH1A 4QOKB 4U1JB 5GRYA 4NKOA 3B2VL 1KIQB 2VLJA 2NY5H 1CE1H 1MQKL 5M95B 4IDJH 2ZZUT 4QWWD 4JFQB 1LO4L 3QEGL 5IW1A 3ALPA 3DMMB 6FABL 1EEYB 1JF1B 3L3DA 1U8NA 3EO0B 1F13A 4M93B 4MQ7A 1UH2A 1AQKL 2Q76A 1JIBA 3TT1H 3JV4B 4CDGC 3D85A 3IFLH 4RZCB 3RY5A 5IMKB 2NY3C 2NTSP 1ACYH 1ZEAL 4MJ6A 1I1YB 2WP3T 4UT6H 1M7DA 4FABL 2FJHB 4XT1C 3U9PL 1WK0A 3C60C 5K9OB 1PKQE 1NAMH 4YDKH 2DBJA 3JTSA 3UJTH 4PV9A 2X70B 3Q1SL 3BIKA 1F45A 1TCRB 2QJDA 1I1AD 2ZP0T 1NFDE 2P1YA 4WIQA 1FPTL 1RJZB 1U8IA 4YIQB 2A6KB 5EU7C 1A3RH 3U30B 3LCYA 5KN5B 2C1OA 3AB0B 3N06B 3VGAB 1J18A 3MUGA 1FLTX 4AY0A 1UJ3C 2E27H 1QG3A 3KYNB 1I7UA 1S7TA 1MCCA 1OAXH 3D0LA 1MRDL 3UTTA 3TFKD 3ILQC 4PPTA 1XF4B 1MIMH 4KMLB 4U0RB 1K85A 2DLGA 1SYVA 4HS8H 4DGIL 1QFHA 3G6JE 4KQ3L 1DVFB 3KHQA 1A4JA 1YQVH 1U9KA 3HPLB 3KPSB 2XOTA 4H88H 4DK3A 1ADQL 2KKQA 1JF5A 3KYOB 1KFAH 2VDQL 4PJCB 4KK6D 4YNYB 3V5DA 4CL7A 3BO8A 2G5BA 1AJ7H 5DHVB 4XVUD 3KPPA 2AVGA 4RGMC 4KPHL 3V52H 1H15B 3ILPB 4P2YA 3RWGB 1FN4B 1T3FA 2QL1A 4DVRL 4F7EB 3O4LE 3CSGA 4P3WA 4C83A 2B2XH 2YKLL 5C2BL 1MH5A 5F1OB 3T1FB 5HHOE 5DQDH 2A6IA 1RHHB 3FMGH 4BUGA 2GAZB 3LPWA 1KCLA 3MJGX 4DEPB 5A16B 1VACB 4JO2H 3RVUD 2MKWA 1IGCL 1XCTB 3CZFB 1LO2L 4TRPH 5DK0A 1JNHB 3VGDA 4GRLC 1HEZA 4W6XB 4K8RH 1Q9WA 1UYWH 4KXZH 5CMAB 3I84A 3KPRB 3O2DH 3ESUF 3HE7A 3GJEA 4HKBB 2WBJB 3BH9B 4NQED 1Y18B 2ZUQC 4OCXH 2BVPB 1EEQA 1NAKH 3QG6B 4LSDA 3UYOD 1F90H 4PY8J 4NO5B 4GBXA 3EYQD 1JNNH 4OCRH 2HN7A 2UWEA 4LVNB 4U1MB 1FVDB 4UB0H 5JW4R 2OI9B 5DZOA 3W0WE 3MRRB 4JRXA 3KPNA 5JPMA 5MEQA 4JFHD 1SEBA 3T0EE 4L3CB 5HHMD 5I1IH 1W8OA 4YAQB 4A6YL 4CU7A 1MLCA 3RWFB 3LVEA 4XMPL 2BSED 2VE6B 1OP3K 3QPQC 5FHAL 1IL1B 3RWCA 2DLFH 2NLJB 1VERA 4WW1A 5TF0A 1U8HA 3D39A 2LAAA 5D5MF 5T5NG 4LNVA 5IP4A 4XI5C 2DKSA 4JFDD 5IQ9A 2KPNA 3IAQA 3MJ9H 5FUOH 2FWOB 5TFSH 4H0GA 1DDHB 5I9QB 1JZ7A 3ARDC 5E5MB 3GSQA 4NT6B 4HZLB 3RL2A 1YUHB 3QXVA 1OF2A 3GSNA 3QQ3B 4WEMB 3O3BB 1EEZB 3MV7A 4WTXA 2WQRA 2GITB 1GOGA 2XYCA 3IDYB 2ITDA 3EO9L 1EX0A 4O2FB 3LN9A 2YZ1A 4ZFOB 4APQC 3P0VL 1U3YA 3ZKXC 3VFNA 4R4BB 1Q72L 5A3ID 5I2IA 1OOAA 1EA9C 4WV1B 1YNLL 1SJVA 4UDUB 3ZE0E 2EDYA 1UXWA 3B83A 1HQRB 1WFTA 4E42B 3WO4B 2EE3A 4J4PC 1G7MA 3CSBA 3VI3E 5DTFB 4JAMA 5ESVB 3HC0B 1AR1C 5JORB 5KANI 1WV7T 3BT2H 3PL6A 5E6ZA 1G9EA 1AP2A 3MNVB 1U3HA 4LNRB 5E94B 1FHGA 1JMXA 2XA8L 2VDLH 5CFHA 5EZIH 1IGIH 4WGWB 4MNHB 4HXBH 4L8SB 3BIBX 1J86A 3FRPG 4I5BB 8FABA 4OIBA 3FQTA 2AV7B 5DRXB 1IC5H 3QHZH 1UKQA 4ZXBC 4UNVA 5MEOB 3I50H 3V0VB 2BRRL 3EJYC 4MS8C 2XN9E 1R3LB 1BLNB 2ERJB 3LHPH 1SBSH 1EHNA 5EIIA 4KZEL 4LHQB 5C3TA 1I1FA 1U6AH 4JPWH 1FE8H 2A77L 2R1YB 3DO7B 4R4NC 4Y1AA 5INDB 4JM2F 4NQSA 5J13C 1AGCB 1QLFB 1ZV5A 5CP3H 1S7QB 3LEVL 5D1ZC 4ELMB 3BFOA 3QUXB 1I8MB 5IOPA 4PJ5D 4XMKL 5DRNA 1HCVA 4QHLA 1IAIL 4NQCB 1JPGB 3MV9B 5J89A 4PUBH 3KLDA 1EHLH 2FEDC 5BRZE 2YSSB 3PP4L 3I6LE 4JR9L 2A9MH 2J5LB 1Z2KA 3TNMB 5EZJA 3MODL 3NFPA 2EKJA 4LLMB 4UTAL 4KK9C 5C0CE 4FFZH 4M1DH 1CL7L 4ZSOE 2XZQH 1HE7A 4RCAA 5CJXA 3QXDA 1TZIA 1BQHG 1FZJA 3MV8A 2X4NA 3BP5A 5EUOE 1JWMA 1DUYA 1LO0L 4PJDE 3V95A 4QRUA 4EI5B 3TZVD 4XRCA 4OD1H 2F54A 3C8KA 4K94H 4RMWA 1XGTA 1AD9B 2ADFL 3JVGA 5D2LB 4YUEL 3WL9A 1C5CL 3GSOB 4BFIB 3GMOB 5ABDE 3FO9B 3V4UL 1RUML 4Y5VA 2YBRA 4JFFB 1WFNA 1D7FA 3P73A 2IH3B 4ZS7H 3HE6A 2CLRA 4POUB 4NO0A 3C8DA 3DUHA 2VLKA 4M7LH 3R0MA 2W60A 4ZNCD 4HIIB 1SM3H 3SE3A 1H3VA 2QHRH 4PGEB 2FR4A 4L9DA 1RD6A 1G0DA 4F7TB 2VQ1A 1AO7A 1GGYA 2CRIA 3FQRA 5TQ2L 2AS5M 2AXGA 3S3JA 5IHZA 1H3TA 3WCYA 5CSBA 4GG6E 3UYRH 3RDTC 2D2OA 2QADB 2JB6B 1C1EL 4NNYB 4O9HH 2X89A 3GM8A 1F3JB 2VJXA 5F9DC 4YHPB 3LS4L 4Z0XA 5C1MB 5FYLD 5L88L 4X8JB 5EBWA 5FYJL 3P4NA 2XQYK 4Z5RA 3FCTB 2ATKB 2Z31B 3UJIL 5GGUA 3EHBD 5I1DA 4Z95H 3VE0B 4YXHH 4X9GA 1DBBH 5DURB 4NQDE 3MJ8B 5J56B 3OKKA 5ACZA 3HRZA 5I71B 4X83A 2CJUL 1UG9A 3N1MC 1D5MB 2P8MA 1LK3H 1NDGA 2FGWL 3GBML 2X7LA 5HPOA 1JWUA 4ZD3L 3NFSL 1KENL 4OKVB 3BD3A 5DSCA 4MCYA 1TENA 1JI2A 3QO1B 1HXYA 4JRWA 5D7LA 2MCG1 4ZNEA 5AWNH 2E9WA 1FYTA 4F7MA 5IMLB 1OSZB 2ZSVA 3GO1H 2D9QB 3WXVL 5BW7A 1MVFA 5T1KA 2J8UA 5D7KD 3ES6A 4PJXB 3S97C 1YEFH 2DJSA 4XZUB 2HA1A 5I76B 4F9PA 5DI8A 2XTJE 4NZUL 2VAAA 3KYKL 2YD9A 4U6VH 1IKNA 3H9HA 1JHKH 3HZVB 3Q6GH 5D6DA 2PYEE 1XIWA 1TMCB 1EFXB 3SKNB 4HCRA 3NFNA 4LFHG 5F96H 4WWKD 5FGCE 1QOKA 4WNQA 4UZGA 3WHXB 2IPTL 4GKSB 4HWBH 3U4EA 2PR4H 1KPVB 3EYOA 4X98A 2GYSA 3VD9A 2JB5L 3LN4A 4RGMB 1TJGH 2VIRA 5J8OA 1U8OA 3QDJD 4PGBA 2KUTA 4L29A 4JFED 4P4KD 2AJUH 1BF2A 1C5DB 4XXDB 2XWTB 4Z7OF 1OM3H 2VYRE 3DRQB 5IROC 4NJ9L 2NY6D 4JVUA 5FK9B 1GH7A 2APVA 3LN5A 4QRRB 4XB7A 1UACH 2IJ0C 1MNUL 5CGYC 5FO9B 2ZPKH 4ZOBA 1DQDL 4BZ1L 1AXTH 4ZDHA 4M4PA 1QFWM 4QTIL 4BYHA 3V79C 3QULB 4YWGH 5HYQB 1CD1A 4GRLB 1VA9A 3QJHB 4WHTB 1FGVL 5E7FA 3VFVB 2PTUA 1QO3A 1A3QA 1A1MB 2EDTA 2R56L 5F7EL 2GIYA 2ZUQB 3IDJB 2Q87A 2YPLB 1JK8A 2BVUA 1PJ9A 1B2WL 3TWCH 2GCYA 3O6LL 5DJYB 2EDXA 3VXMB 5C0BE 1KCRH 3O0RL 1RHFA 4OM0H 3STBA 5JO5B 2DL9A 1NMAH 4JN2B 4BK5A 1XH3B 3O8XC 3EYFB 1JTOA 4YC2C 4KI5F 2O5YH 3E0GA 4O02L 5CHNB 5D1QB 3PQYA 3TBWA 3QRGL 4PTUB 1ZLVK 2YD3A 2DJ4A 2V2WB 1E4XH 4QT5B 3ISWA 2I24N 4NFDA 4Z76A 3RY6A 3RGVD 4YLQT 1M05B 1T0MA 3LKQA 4NUGH 3WLBA 4Y4HD 3DVGB 4O51A 1RZIB 1MJJB 4YHOL 5DR5L 3UBXI 1AGBB 3F58H 3UTZB 5DHYB 2NW3B 4UNTA 1Y6MR 3C5ZC 1IEBA 5A2IH 1U8KB 1RZ8B 4P46C 3GMLB 1VADB 4J2XA 1X44A 3DWTA 2AXHA 2Y1VA 1J8HD 3SGDH 3MUHL 3CPLA 3PWPB 5EU5B 1MWAB 5JHDA 3FFDB 1NDMA 1S7SB 1MCRA 5FM5O 5EZLA 3ARSA 3L5HA 5TPWL 1ROWA 4WCYH 1AE6L 5EULV 1ED3A 3EBAA 1QD0A 3MRJB 2R1WA 2IC2A 3ZKXB 3MLYH 4QTHA 4JZJA 5K9QG 3BZ4A 5EZOH 3MMEA 2VXVL 3GIZL 2JJSA 4PJAB 4HX1A 5IHLB 2MSPA 1ORQA 3VXRA 4MDIB 1UA6H 5IK3B 1BOYA 2WQ8A 4BSVB 5F7MC 2Z92B 4S1SH 2K3TA 1X7QA 3FZUC 1T5WB 4P23A 5T1MA 1U95B 3WDHA 3P9LB 2FIKA 1JHTA 2VH5H 3RU8L 4BA8A 2AKRA 4HC1H 1WAAF 4OGYH 1Q9OA 4I77L 1MAML 3VFPA 2DQTL 2RHEA 1F2QA 1K4DA 3MXWH 4KU1A 4O58H 3FN9A 3BKYL 2B1HL 4NHUB 1A9BB 3MLXH 1FVEB 5FYJE 2H32H 1F3DJ 3V0AC 1CD9B 3RTQC 3QNXA 4ZXBB 1AHWC 3ARGC 5KSBB 3VXUE 3J8F7 1B3JA 1I4FB 1KTDB 3LSOB 5C86A 1PYWB 1MFDL 3IDGB 2R2BB 5HY9B 1RZKL 1CVSC 3LQZA 1R3IH 1IM3B 5KSUA 1E6JL 2E7LC 5J13B 3MBEC 5D1ZB 1QA9A 4NP4L 5BQ7B 3RWEA 2X4PA 4AL8L 4XHJD 2C4XA 4TUJA 1QQDA 3E6HA 3S5LG 3UC0H 5EIVA 4KAQL 4HG4J 3W2DH 3D9AH 2OR7A 4F80A 1W0VA 4G6JH 1YECH 4JPIB 3TYFB 3GK8L 1G6RB 2MCPL 4C56E 3HUJA 4ZS6C 5DQJB 3BKCH 3QUZB 2F58H 5JOFA 4F7CA 4HFUL 3QUML 1T66D 1KJ2A 32C2B 3CFIC 4GW1A 3B9VA 4KTEL 3JWOH 3VG0H 3BWAA 4M9PA 4PGCA 5I73B 1MFAH 3TF7C 3DURB 5FYLH 1IGFL 3B2UD 2ARJA 4OUUB 3G08A 5ALCH 1ND0B 4GQ9H 3L1OH 4G9DA 1JRHL 1UZ6E 3V7MA 2CDFB 1FP5A 5IEKA 3AS0A 3ZE1F 1V7ML 4ODWB 5ENWB 4Q58C 1CR9L 1YEGL 1N4XH 3GSXB 4PGZA 4Z7WE 4CU6A 5GGVL 4I0PA 4MA1C 1T22B 3F5WB 4PJ7E 4ZFFB 2BSTB 5DD1H 3GB7B 4K3GA 2ADIA 2JK5A 1S7XA 3QIUC 1HH9B 43C9B 4JRYA 3MA9L 4KI1A 1QSEE 5AG8A 5J57B 1DBMH 5ID0A 2WUBL 1BIHA 1RUKH 3DV4A 1IAOA 4JHAH 2QLVB 5AAMA 2AJXL 3NCEB 1S9WA 1VGKB 3OJ2C 5DT1L 2NX5A 3H2WA 2N7AA 7FABH 4GSDH 2APFA 3IVKB 2XIDA 5D96B 4N9OB 2NY7L 1FIEA 1LNUA 3RDTB 4M61B 4GRWF 2IGFL 3X14A 2D4FA 3SCMA 4J8RB 3RPIA 2UY6A 5HHXH 5T3ZL 1JTTA 4K3JL 4KUCD 2X4UB 1IGTA 4D0DB 2UY7A 5JW4Q 1NLBL 2DKMA 1VHPA 3X3FL 1P7HL 2CKNA 4OF6A 1R6VA 2HVJB 5IB4A 5GJTL 1TLKA 2BHYA 2FX9H 3OXSA 1IILE 5A2JH 1H0DA 3HC3H 5FV2A 4LSQL 4HS3B 2P43B 2BDNH 5KVGH 1WC7B 1TZGL 4HW6A 2HFFB 4X6EA 3BPLC 1BIIB 3AU1A 2Y5TA 1QRNE 4G8GE 2XICA 4HHAB 1NCAL 5HGDA 4I13B 2LABA 3VG9C 4CW1A 4N8PA 1NGQH 1D6EB 5FGBA 1T4KA 4S1RH 1YNTB 3PWVB 4NCC2 1I1AC 3QFJB 4FZ8L 3ZDYF 3TESA 1CIDA 3QWOA 3S8WA 1MFCL 5BV7B 1HXMB 3IDIB 4L3EA 3DXAE 4AK1A 2DBLL 2EC8A 4PRHA 3WFHB 2BOBB 4Y16D 1JGEA 5CCKL 5JIPA 3TFKC 4UINL 1S7RB 5B22A 1MPAH 2VTFA 1A7OL 4QRQA 4JDZA 2EE2A 4X7TB 1B6UA 4XPHL 2K7QA 3IS1X 4PRIE 3WFBL 4ZUSA 3FQNB 5EO1A 4PB0L 4LPCA 4RMQA 2YWZA 3F65A 1I85C 4KK6C 4J3UA 4XVUC 4NRYA 4K23L 3PDOB 3NAAH 5CSZB 3O4LD 3MOBH 3O11B 4Q6IA 3FAWA 4F33B 5GGTA 4I8DA 2VISA 2RJMA 4EN3B 5HHOD 2JCCB 2NY0B 4X4XB 5JIHA 4FXGA 2QQQA 1GZQB 1RZ7L 4F3FB 4NNPL 5DD0L 4P3DB 2BNRB 3F12B 4QRTA 4NN7B 5D71L 4YDLB 3ECBA 1NAMB 1A6TB 3BKJL 1AIFA 3RUGB 3QH3B 4Q0XH 5E00B 4ZUWB 5DFTA 4KQ4L 1GCFA 1RZGB 2ZSWA 4QXUH 5HYSB 5GISL 2HFGL 4E41A 2FATL 4X4ZA 4I3RH 3QWRD 3PJSA 5E8DH 4U1IB 4YBHA 5F9AC 5C08A 1LE5B 2W0FA 1LGVA 3EYQC 5C07E 1TITA 4KV5E 4RFEA 3W9EA 1DBKL 5EU4B 3W0WD 4JHZA 3KAAA 4MMXC 4N8VB 4UDTB 4Z7QF 3VDCA 1RZJC 2P7TA 5C0JA 1FLRH 2AK1L 2BCKB 5L7XH 4P4RB 3T0ED 3OKLA 4DQOL 3C2AH 3ABZA 3VWKA 25C8L 2DD8H 5FFLA 1D9KB 4YC2B 5FA3A 5IUSA 4JG0L 1M1SA 2R39A 4XPBL 4JQVC 2BOCB 1BBJB 4R26H 1IQDA 3HG1E 4LSTL 4XPFH 4MWFA 1KJMB 4L5FL 5DMKA 2Y06L 3LDBC 3MLTB 2ICWI 3EOBA 4JFPA 4R3SB 4OBRA 4OBSA 1JZ5A 4NRZB 3IFPA 4XNYL 5JTWA 4Y5XA 3MR9A 4BH7A 3NTCH 2WIIA 1MAJA 1CGUA 4GXUM 1HH6A 2AXFA 2DQUH 2F74A 5DRZB 3QDME 4UBDD 1PG7L 4S2SA 1EO7A 2BXYA 4P46B 5TDNA 2P48B 1YYMH 1KPUB 2XZAH 5ITBH 4KWUA 1OLZA 2EH7H 2IANB 4M43H 1I8KA 2MJWA 1I8IA 4TNVK 4JFOB 2DYPD 4QF1B 3VCLA 1KEMH 2GFBA 3VFMB 3EGSA 3SQOL 2XFXA 5A3IC 5ALBH 1NGYB 4PBWD 2E8YA 2A2QT 4WY7L 2W1NA 5SX5K 2A73A 2EDOA 4HKXB 3JV6B 2CDGB 3HN3A 3VI4F 4YZFF 2HLAA 4C57C 3E3QC 1B4JL 2KL6A 2OTWA 4OI9A 5T33H 2P49B 4BSWA 2ZG2A 2HJFB 3DMMA 1EEYA 4GJTB 2VLJE 4E5XB 5I16A 1GHFH 3WO3B 2C5DC 5T3ZE 4E9LA 2XN9D 3BYYA 1G7IA 4X4YA 3ZTJG 3E8UH 1I1YA 3THML 3ZT5A 1IRAY 1UM5L 5F3HB 5CBEB 4X5WB 2R29H 5FOBA 4MZ3A 1KPRB 1V3KA 3RTQB 2FJHA 1AHWB 3ARGB 5I1CL 4NM8L 1QR4A 2X70A 4HK0B 1DE4B 4ORZC 1EMTH 3G5ZB 3J7HA 3FO1B 1GAFH 5DGRA 5KVDL 4QXGL 1RJZA 1AXIB 5A2KH 5KN5A 2FD6H 5IEHB 3GMMB 1XGUB 4WUKH 5BRZD 3I6LD 3KYNA 2HTLC 3VH8B 2R23B 4LGRB 4OFDA 1LO3H 1MJ8H 2PO6A 4ERSH 1XF4A 4LKCB 4K7FB 5C0CD 1HNFA 4HWZB 3BRFA 1ZLSH 1A6AA 5JA9A 3O6KL 3IU3B 1B0WA 2DQJL 4LBEB 2EDEA 1DVFA 1WJ3A 3ZTNL 1YDPA 3KPSA 3HPLA 5JR1L 4K7PL 1HHIB 3U0PA 2VZ3A 2E6JA 4X7CC 5ITFB 1OP5K 4RDQF 5ADOH 4PJCA 4YNYA 1CLZH 15C8H 5D72L 3KJ4C 5TDOB 1CFQB 3C8HA 2UYLB 3MLZH 3RWGA 1FN4A 2RIKA 4NN5C 4KVNL 5HGGS 1NC4B 5HGBB 3TZVC 4EXKA 7CGTA 2NW2B 2M8XA 2B0SL 1A6WL 1INEH 1YEKH 3QWQB 1IC4H 5TJWK 1IJ9A 3T1FA 4N5ED 1RHHA 5GZOD 3IU4L 4JJ5A 4PD4J 4LHJB 5A16A 1VACA 2AABL 3ZE2F 3NIFF 2DLIA 1WFOA 1XCTA 3CZFA 3TVMC 1MF2H 2DQEL 2V6HA 4MD4A 4XPGL 2BNUA 3MBXL 3OGOE 3BDYH 4MA1B 4Y4KB 1T03L 3KPRA 3WMSA 4HKBA 2WBJA 3BH9A 4X0KB 5J9PB 1GOFA 3EFDH 3BVNA 5SV4A 2PETA 2EDWA 2BVPA 3MRGB 3QG6A 3QIUB 1AKJB 4LSUH 4NO5A 4DUWA 4XP9H 1N0XH 3TBYA 3BAEH 4NNXB 3QDAA 3M1BB 4WI2A 4LLUB 1FVDA 4U1MA 1WBZA 2IFFH 3V5KB 1KEGH 4XAKE 2XG5A 4Z8FH 3WDJA 5L8KB 3WUZA 1NGZA 1F5WA 3OAUH 4J6RH 4GKZB 4L3CA 3QISA 1OP3H 2YD2A 5EOQH 5K9JL 1DQMH 3OX8B 4PYGA 1A9EB 3RKPA 3BMVA 4NSKB 4NUJB 3AS3A 3TV3L 1FRGH 5DEZA 2NXYD 1IL1A 2BJML 2J4WH 3QXTA 4QNPE 3HMXH 1J1PL 5D5MA 5IT2H 3M8OH 2NLJA 1T1WB 1I9IH 2B4CL 4NQDD 4YFLI 5B3JE 1A5FL 1FIGH 3ARZA 5E03A 2EDJA 5DS8B 2Z0BA 1AGEB 3K80A 1SJHB 3PXHA 1AGDB 2C26A 5E9DA 1DBAL 1A64A 4CN4A 1H3PH 3IDXH 2FWOA 3BPLB 2E7HA 3BMWA 4HZLA 2VC2L 3DX7B 3QQ3A 4X6DE 1F11A 1WQVT 3O3BA 2GITA 2XWJB 3MOAL 3WJJA 4HDIB 4RIRB 1GC1L 4R0LC 2FH6A 1AGFB 1I1AB 1BP3B 4ZFOA 5ESAB 1YY9C 2XTJD 3VD3A 1S5IH 1PW3A 3NABL 2DQCL 5EOTA 3D0VB 3X3GH 5D70L 3MCG1 1G9MH 4V1DA 3X17A 4JKPH 4R2GC 3DVNB 4S11A 3HI1B 2PYED 4NQVB 3NPZB 4WV1A 4HCRL 5E2WH 2F15A 5LBSL 3CDGB 5IVZA 3EDDA 2YD5A 1GGBL 4LRNH 4ZTOL 4LF3B 5DTFA 3NA9L 5JORA 4UAOC 1C16B 5EO9A 4LPXA 3ARXA 5IM7B 4XVJH 4LNRA 3SE9L 3K1DA 3SDCA 2J6EH 3CFEB 3TH2T 5BO1L 4BH8A 4MNHA 3U0WL 5I18L 1JHLH 1AFVL 3MGOA 4L8SA 1CGWA 4MCZB 4I5BA 1G7PA 3QEHB 1QYGL 1KIPA 5DRXA 2PKDA 3RZCD 1LP9B 5FB8B 2IAMD 1IAKA 5LVEA 3FO0L 3BHBA 4N1HB 5MEOA 1R3LA 1LD9B 1BLNA 3CFKA 3BUYB 1BHGA 1HSBB 2D03H 2IMMA 1U93B 2R1YA 1U8QB 5T1LD 4KKNA 5INDA 1P9MA 4FQ1L 1VPOL 5E0QA 3OL2A 1IC7H 3AROA 4OZIF 1Z9OA 1P1ZB 1QLFA 4ZOCA 4ELMA 5IB5A 1JV5B 1KN4H 3NZHL 1G7JB 1LEKB 3QUXA 2YRZA 4XHQA 5GRJL 3NOIA 1PZ5A 4Y1AE 5LWYL 4YO0B 5JZ7C 4NQCA 4NQEB 3RAJH 4A2LA 2VNCA 4I3GA 4P2RE 2YSSA 4DKFH 4KUZL 1INDH 3QUKA 4K3EH 3TNMA 4DOHE 1A6ZB 5C0BD 1KCSH 3H9ZA 1EJOL 1DBJL 4LLMA 5EPMA 5E8EB 2BVOB 5ADPH 3AY4C 1FCGA 5C0NC 3JWDH 4MHHG 1P7QA 3MNWB 4JDVB 1AI1L 3F7YB 3PV6A 4MXWL 3QA3B 5HI4D 4LHUA 2KQNA 5D1XD 2C1PB 1FH5L 3WHE0 4EQ3A 2B1AL 2A9NL 4UIKH 5HHMB 2FSEB 5DC4B 4JZNB 2YUWA 5J4MA 1FO0B 3P3YA 1A22B 1G0YR 1HILB 3OHXB 3FB5B 4PJ9D 4JPVL 3S37L 1AD9A 5D2LA 1AQDA 3I9GH 4Y19E 1MQKH 4BFIA 3GSOA 3KYAA 4GW5B 3GMOA 3ARFA 4UILH 3DBXB 2ICES 3FO9A 3PGCA 4ALAH 1XF5B 4XNXL 1LO4H 1ZE3C 3DSFH 4RAUB 3QEGH 4PJXE 3BP6B 4JFDB 4PBVC 5F8QC 4ODTL 2BNQE 1HINL 1YY8B 2D31A 5IHUL 4JFFA 2YD4A 4UQ3B 4WUUA 2Y07L 4M48L 4AT6B 4JM4L 1WTLA 2D7OA 3GJFA 1ZT4B 4HIIA 4Y8AA 1I9RL 4I18C 4OLYH 4FABH 5KZCD 1RULH 2MWCA 3UDWA 3U9PH 2C3VB 4PLJD 3Q1SH 1KC5L 2FYYA 3KWWA 4FNLL 3UTSA 1FPTH 4QGTA 1KIRB 1TJIL 4DGVL 1AO7E 3CK0L 4NC0B 5HYSG 3H9YA 4J3WA 3RVTC 1W72A 5DZLA 1F3JA 1FQ9C 5DRWA 4YXLL 4HFWA 1CFTA 2MTPA 4X8JA 5DFWH 2R0WL 4ODHL 3FCTA 2V7HB 5KSVB 4KQ3H 3QPXL 2ZG1A 5FYJD 2ADJB 4ZG1A 3L5WB 2Q1EA 4LPVA 5HDQH 5IV2A 1MRFL 4N8VG 3QEQA 5JQ6L 3MJ8A 4KJPC 2UV3A 3VXUD 2PTTB 4KROD 3TBSB 2OZ4L 2LVEA 3KLSA 4OZGF 1JGLL 3STZA 2DWDA 2ICCA 1KCKA 4X5XB 1VDGA 5DYOA 5E8NB 4JGJA 4OKVA 1U8LB 3AS2A 3CDFA 3C60A 4Q2ZB 1IVLA 2YKLH 4MAYD 5C2BH 4WI5A 3LKRA 1OP9A 3JTTA 3W9DA 5IGXH 4PY8I 1OSZA 5F9JB 3HR5B 4YHIA 5J6GB 4ETQA 4XHJC 4PJ5B 4XZUA 3QUYD 3NCYS 4OTXH 1FL3B 5I76A 4G5ZH 4ZNEE 1IGCH 1UJ3A 3SPVB 2VDNL 4S1QH 5IIEB 1HK6A 1PG7W 5C0IB 1HWHB 2J8UE 3IB4A 1FL6A 1KUMA 4C56D 1G9NL 4P2OD 3WIFB 2V9RA 1EFXA 1DJSA 5CJQH 1YPZE 5FA4B 4S1DC 1OTUD 2EIZB 2P5EE 5GZND 3BZEA 4WFEE 4PJIB 4GKSA 1KPVA 1BWMA 2EH8H 2IADA 2V2TB 1KCVL 3V6OC 3HNVL 5F6HJ 1FG2B 1LO5B 4NN5B 3TZVB 4HXAH 2H32B 1GYAA 3GMRB 5DD6A 4XXDA 2XWTA 4QXTA 3DRQA 2EZ0D 4KDTC 1TJHH 4LLDB 5FK9A 1JYNA 1HHGA 3HPJB 4OZHB 4XMPH 4PJHF 1CE1L 3DRTB 4X6CF 2EICA 1J7VR 1QSZA 5F1IB 3QULA 5HYQA 2DLTA 4GRLA 3QJHA 4WHTA 3VW3L 4KHTL 2APTA 4YX2H 1QSED 2CUIA 1OTSD 3U48A 4G8EB 5JPNB 1WZKA 3IDJA 1OAQL 1KB9J 1PX4A 5KS9E 1UT9A 4PG9B 1VB9A 1XMWA 2YPLA 1KNOA 3L6FB 5FO8B 4LGPB 4UT6L 2DB8A 4PG2C 3BW9B 1P4BL 1NAML 3OR7B 5DK3A 1NCDL 2WLZA 4JN2A 5B39G 3UZEA 2FJFB 1XH3A 2WZPD 3EYFA 3P0VH 4U1NB 5D93C 5CHNA 2W9LA 2FBOJ 5C9JB 2ICWB 4P5TD 3CDCA 3E6FB 1EPFA 1YEJL 2AERT 4PTUA 1Q72H 2E27L 3VH8G 2GTWB 1OAXL 3ULVF 4XCYA 2WUCH 2XTLA 3UPRB 5JLZB 1ZHLA 2JKXA 1NBYB 1ZTXH 1M05A 4HS8L 4PGDB 3AXLB 3LQAH 3RVXD 2Z9TA 1QRND 4G8GD 3GHBH 1I3RB 5DHYA 3RWHA 4ZQKB 3PXJA 5L2KA 3ULUL 2XA8H 2Q8BL 4Z7UB 3NIDE 4KH2A 5TGBA 3GMLA 3GRWH 1BZ9B 1MHEB 4JZOB 1M7IA 5BOZG 1BVZA 3ARDA 2QKIA 2ZWLT 1N5AB 2ZUVA 2WINB 3DYOA 3SGEH 3DXAD 5EU5A 1MWAA 4KKLC 4HUWA 3FFDA 2BRRH 5E08L 4R0LB 5DA0B 4OLVH 4APQA 3MRJA 1T7YA 4Y16C 1RPQA 2BY1A 5I1AB 1Z9LA 5DC9B 5BZWB 3MX0A 2VWEE 4PRID 4JO2L 3DO3A 2CKBA 3LEVH 4PJAA 4TRPL 1P5UA 1B4RA 3IDUA 4MDIA 1UYWL 4Y2DD 1IAIH 4M62L 4BSVA 1BX2A 5DJCB 5KW9L 4J4PA 4Y88A 5E24E 3O9WD 3O2DL 4X7DC 3PP4H 1U95A 3QIWD 4N5UA 1SYSB 1WAAA 4WWKB 3P4LA 5FCSH 3T4YB 3U79A 4UAOB 4U1KB 1KG0B 4OCXL 5B8CB 3VXRE 5B38B 2OP4H 3MODH 1E6OL 1B0RB 1CL7H 1JNNL 4LFHD 2NY4B 1NEUA 3OR6B 4DZ8B 2XACC 3BP7B 3QDJB 4UB0L 4NHUA 2W07A 2YA2A 5IB1B 2PN5A 4YR6B 4JFEB 4P4KB 5I74C 1FNSH 1NC2D 5DUPH 4ZXBA 3VFSA 1LO0H 2NY6B 3QJFA 1I4FA 1KTDA 2IQAA 5JMRA 2XZCL 5I1IL 3U9UB 3WEXA 1OGTB 1IM3A 5ISZE 2ADFH 3O3AB 1KJVB 4ZUVA 1XGPB 4I48B 4YUEH 1C5CH 3QT2A 5D1ZA 4ENEC <