4PJAF

Structure of human mr1-5-op-ru in complex with human mait b-b10 tcr
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
235
structure length
235
Chain Sequence
GVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASTLGQEGQPQHFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A molecular basis underpinning the T cell receptor heterogeneity of mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
total genus 57
structure length 235
sequence length 235
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjaF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjaF02
1Y0LA 2PTUA 1WK0A 4LLWB 3NOIA 2R1YB 1ZHBA 1EMTL 1T2QL 4X83A 2C3VA 5T33H 1PW3A 1KCVL 3PABB 5HHQA 1I8MA 1QSEB 3TJEL 2KH2B 1DBML 1FYTB 2GSGB 1H3WM 2QTEA 4GQ9L 3VW3L 4P2QE 5J6GB 4XXDA 3L7EB 1ZMYA 1BQLL 3FB6A 4ZXBB 1OM3H 5ILTH 3FT3B 4NYLA 4XPGL 5BRZD 3BWAA 4K3EH 3ILQC 3O3DA 3QDME 2X7LB 4NGHH 5TE4H 1QA9A 5EU7E 3WUWA 2D7TH 3OHXA 4XNYL 4GBXB 1QRKA 5E00B 2XTJD 4PRHE 1INQB 5JXED 1UH4A 4Z78B 4HLJA 4DKEL 1N5AB 3JTTA 5DURB 3VGGA 5JOPE 3LZFL 3O3BB 4D0CB 3U7YH 4F9PC 2R2HA 4PS4H 4OCWL 1HYSD 5DUPH 2WINB 4FTVB 2DL2A 3OV6A 2W9EH 4HPYL 2B4CH 5E9DD 4OCNC 1PKQB 1QLEH 1YPZE 1SJEB 2J8OA 5A1AA 4FFWD 2ZOKB 4IRSD 3GJFK 4NO0D 4I3RH 1F02I 4UT6H 5E2VL 3F12B 3PQYE 4JN2B 1RI8A 2K3TA 3CDCA 3MRBA 1RFDH 4X7FC 4ZODA 2LTQB 5DVNA 5GRXG 2F54E 3MJ8A 2A6KA 1MNUL 4H0HB 4JFHD 3DURA 4G9DA 4ZD3L 5BW7A 3Q1SL 4O51B 3JV4A 5AEAA 3PQYD 3VJ6A 2YKLH 4OGAD 4MX7B 4O5LH 4Y4HB 4G6ML 3FFCD 4QYOB 2IANB 2E6PA 1ZEAL 3BHBA 5AAMA 2VQUA 4GG6B 1UXWB 1F6FB 1BBJB 4WHCA 4M7LT 4LAJH 3MRIA 4HKBB 2HRPL 3K1DA 3QIUC 4AT6B 2COQA 3VXUB 4Z7WE 1KELH 2HTKC 5ADPH 2ZSVB 3QIWB 2DQGH 3MBXH 4Z7QE 3EJJX 4DAGL 3QCVH 3QUYC 1MOEA 3O2DL 3ARDC 3DVGB 1UJ3C 2VDNL 1OWWA 4ZS6D 5HXMA 3BGAA 3OKLB 3KPRD 3W2DH 2D9CA 4Z7UF 1HKLH 4PP1C 4YHLL 2ADJB 1A4JA 2CRZA 2EH8L 3VDCA 3QDGE 1S7TA 3ZKMD 3LDBC 3UTSB 2KZWA 4H20L 4WVRA 3KG5A 4MCYA 4NQCD 4EI5A 2VABB 1IGMH 4JR9L 4LCUA 1Q9KA 2XRAH 4FZEH 4YX2H 5A2FA 5DJ0B 4KQ3H 3QBTB 1UB6A 2VO5A 4NJAH 4YUEH 1OOAA 2VXUH 1FN4B 4XX1E 1YC8A 5J11C 5EU3A 4CRPA 4U1KA 5TE7L 3BN3B 3O2VH 1KCKA 3MLUL 3GBNH 2BNQA 4GRMA 2GKIA 2X4RA 4Y5XA 4HDIA 1VGEH 5LG1A 3SY0A 1MFAL 2IANE 2O5ZH 5TQ2L 4EI5B 1S7SB 4HUUA 5EPMB 3ARQA 5DTFB 4ZUUB 3KWWB 5D4QA 2AK4D 2HFTA 2VMFA 4HZLA 5CD5D 1VPOL 3PWLA 1IQDA 1MH5B 4OZFB 2AV1A 5DT1H 4Z0BH 4OLWH 1FRGH 5D1XB 4EUPH 4KTEH 4JFOB 4LIQL 3GRWH 1URLA 2YD2A 2X9XA 5I74C 4UTBH 1SJHB 1IZKA 3VW3H 2P5ED 4ZMAT 2Q3ZA 4C58B 1NCWL 2X4PB 15C8H 4J3UA 2CPCA 4HKJB 3QQNA 3RZCA 1P4LA 3OB0H 4M48H 3FOLB 4RFNB 1YYLH 1TVHA 4OLXH 5JA9A 1M71B 1UJ3A 3QZWG 4NBZB 1EUTA 3VXNA 5EBMA 4BFIB 4P23C 1A1OB 3SDCC 3VH8G 2R0WH 3IS0X 4BQ9A 1KB9K 3UEZA 5I9QC 1WJ3A 5L7XL 3C5JB 1G7HA 2Z31C 2AI0H 1G6RH 1O0VA 5I1EL 4G8GE 1J8KA 1H15A 1T1WB 3GMRA 5F7WC 1AQDA 3MOQA 5F8RC 4NN5B 1RZIA 4XCYA 2GAZA 3QG7H 3CSYB 3IJYB 1J5OH 3ULVF 3GI9L 1CXHA 5IEHB 3C5JA 1MHPH 3Q6GL 5FGRA 2OS7A 1UXWA 4PPTA 1A6AA 4O2FB 1FAKT 4EEEA 1RZGB 1XGUA 1I7TA 2JKXA 4FABL 1YN7A 2ERJB 5JORB 4ODWB 1L7IL 1AGFB 4LSVH 1U2CA 1YMMD 4PB9H 4YR6A 5A2KH 3CLEH 2VZ3A 1KT2B 1P53A 4OGZA 4FP8H 1CLCA 5DVLA 1QFWI 5HYSB 2DQGL 4LVOC 1BOGA 2XN9D 3TGXA 2DWEB 1OAKH 1VADB 1XIWC 3VXTB 1M6OA 1KN2L 1S9KC 3A67H 4W81A 3TNNB 4MAYC 3WEXA 1MCSA 4M8VA 2ATPB 2XA8L 5FK9B 4PJ7B 5IT2H 1R0AL 1TLKA 2BHZA 3TPUA 3ILPB 4PJIA 3SPVA 3D3VB 5KN5B 3JV0A 4R0LC 1CFQA 2EE3A 1RIHH 4HJGB 1LE9A 2XKSA 5AZ2L 3VG0H 1N0LA 3AUVA 1ZGLA 4HS6A 1NLBL 4NO0B 4Y5YB 3WIHA 4P9HC 3AB0C 3ARDD 1FZJA 1UM4H 4HBCH 5GJSH 4U1KB 4XCFL 4NKOB 2DL9A 1EGJL 3PWVA 4LLYA 5E2VH 3VXSE 1J0KA 4WO4B 1SVZA 5IJVA 4Y4KA 3BOVA 3PHQB 1CLOL 3ALPA 2CDFA 4O58H 3BKJL 4G3YL 4JM4H 4QHKI 5C0BA 4OLZH 2UY7A 2J2ZA 2ERJC 1TNMA 5DD5L 2EXYC 2PCPB 3DGCR 3FQNA 2XTJE 1EZVX 1JWSA 2R8SL 1KPVA 5CGTA 3B5HA 1WBYB 2QADB 2NY6B 1A6PA 1G9EA 1VFMA 1BD2D 2W65B 5HDBE 4DK3A 4S1SL 1CIDA 5B8CB 2YMXH 2YXFA 4I77L 5TPWL 2PYEA 4OTXH 3FQXB 4J1UA 2H2SC 1W0WA 5KVDH 3UPRA 1HQ4A 2NCMA 4HIJA 2K1MA 2VUOA 5DYOA 1OLZA 5DEGB 3SGDI 4Z77B 2P5EB 5T3XH 4QO1A 3CLFL 3QDMA 1NGYA 3RTQD 1QSZA 5TPWH 3IDJA 4HFWA 1XGTA 4XNXL 2V5TA 4BUHA 3KLAA 2JJUA 4M62L 2XPGB 1NGPH 2Z31B 3C5ZA 4GBXD 2NLJB 5DI8B 4Q7DA 5IQ9A 3OB0K 4G7YH 2MQ3A 1D7FA 1PJ9A 1WISA 4KROD 2Y5EA 2DYPB 2D0HA 4FMFA 2G5BA 3S88L 3SDAC 4LGRB 4X4XA 3R1GL 3RL2B 4FXGB 4E42B 2FRGP 4JN2A 2GQHA 4QHMA 2ZSWA 4XPFL 3N1PC 1JHKL 4HWBL 2VIRB 4ZFFB 2NY5C 1JK8A 5IW3A 3L1OL 3ZTNH 4KJWD 1FIGL 4RWYH 1Q9LA 3MJ8B 5GJTH 2F19H 3DARA 3QEUB 4LCCC 4XWGL 4Q6YA 4Y1AE 1A4KA 2FX9H 1O7VA 5DQ9B 1NGQH 2CIKB 3SKJH 2GK2A 32C2B 2MCPL 3D69A 4RMTA 5B8CC 4G8IB 5CUSL 5HHOB 5D1XD 4PG9A 2HG5B 4EN3D 2ICWI 4MCZA 3O3EA 3STLA 5K9JH 5GISL 5MI0B 1KJMA 4N1HB 1X5GA 1NBZA 4JFEB 2EDJA 4N90E 5GGTL 2AK4A 5DQDL 3ULSA 3DRQB 4WUUE 4P99A 5L9DL 2CIKA 3NPSC 4FG6D 4CKVX 1CGUA 1S8DA 3RVUD 1YZZA 3RNKB 1MQ8A 3OAZH 1E4WL 5L2JA 5CJ8A 1RVFH 3QIWD 4MYWB 4AENB 5F9DC 2HN7B 3F58L 5J1TC 2CK2A 4OZHF 1NMAH 4HEME 5CGYD 2ZPKL 3DRTB 3WKML 4ELMA 4XNQA 2JB5H 1DSFL 5A2JH 3BQUB 3Q5OA 5JW3L 1KJ2A 4LGPB 5EUOA 2Z35B 2V5RA 4RAVB 4AG4H 3MFFB 3HHRB 4WFGE 3HNTH 3TYFA 1S8DB 5K9JL 3EHBD 4UQ2A 1PVHA 3HNSH 4Z76B 2GTZB 4OI7A 2H41A 3U4EB 4PJFF 3UAJC 3OQ3B 3HNVL 1T3FA 3ZDXF 1BBJA 1MFCH 1T1YA 1RIVH 3MRGB 3HR6A 1RV6X 1KPVB 4NC1E 4DW2L 4ODXA 4JAMB 4APQB 3ZDZE 1EEZA 3RY5A 5AG9A 4Y4KD 3RU8L 5IB2B 1I3RA 3TV3H 2VLJD 4GRWE 1CGVA 3VRJB 3ZKND 3S6CA 5IMOB 1KJ3L 5DHXB 2HYMA 4LP4A 4QOKA 1B88A 5D2NE 4M1CD 1BZ9B 4PD4J 5DZOA 1UGNA 2KQMA 3WLBA 3MXVL 2YN5A 1KLFA 5IG7B 5IB1A 1ND0B 3MR9A 5EOQL 2PO6C 2CLRA 4XVUD 3B2UC 1A1NB 3SE8H 3ZTJG 1CFSA 3JWDH 4OSUH 4UDTA 3QIBA 5TDNB 1Q0XH 3QA3A 1HILA 5J1AA 1UZ8B 2IGFL 2X7LA 1WLHA 4TVSa 2VAAA 4ZXBC 3WDHA 2H2SD 4WWKA 1BQHA 3V4VL 3SDDB 4TUOA 3H9HB 4OTXL 1JRHL 5F96L 4Y19B 1U3JA 5EFIA 4PRPE 4GW4A 4G43B 4JQIL 3L3GB 5MENB 4JRWA 1MFAH 5GS0D 1MCFA 3G5XA 1MAJA 4YPGB 3MLXH 3T4AA 4OQTA 2P44B 4FQIH 2WBJD 5A2LH 2NXYD 3LIZH 5TDNA 3OF6A 3SO3B 3C2AH 1IJ9A 3LPFA 2XG4A 2IAMC 4IRJD 2YBRB 2WV3A 3MNVB 4G6FD 4KROC 4ODUB 3ZYZA 1MCBA 3QHZL 4HK3N 1CLOH 4JFDE 1I8LA 4NZRL 1XFPA 1OPGL 5AWNL 1IGFL 5F7YC 1ZLUH 3FQTB 4JQIH 1EFXD 3GMLA 1N6VA 1QBLH 2K7QA 3SDAA 1PBYA 1QRND 3CX2A 3GHEH 5I19H 4OT1H 5C08A 4EVNA 4JJHA 3RA7H 2A74A 1UH2A 2LABA 4IDJL 3QXWA 5F6HI 1UB5A 2WK2A 1RY7B 1GPOH 3H7BB 1MJJB 3B3IA 3D2UD 3M17A 5TGBA 4GMTL 1ITCA 1FJ1A 4P3WA 2PW2B 4ONGL 5F3BA 3SPVB 1HYSC 2P8PA 3HA0A 4TVPD 3MJ9A 5GHWH 5HYIA 4O9HL 2BP3A 1MAML 2EEDA 1UA6H 2IFFH 2OL3L 2XN9A 3OKMB 4Y5YA 4AK1A 4HWEL 3Q5TA 4QRSB 4J23A 4LLQB 4I3SL 3CUPA 4BYHA 4CU7A 3BIKA 2RAMA 2CDGA 5FB8B 2R0ZH 2R69H 2IAMB 3UTSE 2F74A 3QDHA 4CJ1A 3GHEL 1UWGL 3GMNB 3OPZL 4G6KH 4DCQB 3VGHA 3S97C 5HHQB 1S9XA 4OCSL 4X0KB 3O6LL 4JKLA 5DD0H 5JORA 5AWNH 5ICXA 2A73A 5EO0A 1KXVC 3DOSA 4WO4D 3WMSA 4EDXA 3TVMA 3UDWA 4F2MB 4HCRH 5D5MA 3BESR 2WBJA 1WBYA 3X13A 3MRCA 1JGDA 3QUZB 4EKXA 5IW6B 5JOFB 5F70A 3BIKB 1MRCH 3P0YH 3VXRA 2C4FT 2V5YA 5ICZA 1G6RL 2X1QA 3PWNA 5MERB 1K8DA 4ZUSA 3SJVA 5F1KC 1OB1B 5KSBA 4B0MM 5BOPA 2VWEE 2CXGA 5DYOB 2ZCKL 2ZG2A 1IKNA 4UUJA 5IEKA 1O5DT 5IQ7H 1LVEA 1A0QL 5ADOL 1U8PB 3JVGC 2H2PC 3SDCA 3VFSB 1T7WA 1K8DB 4ZUSB 3U30B 3SKMB 3UBXB 3PQYB 1NC2B 2R4RL 3P0GB 3L7FB 2HLAA 1ETZB 5GGTA 4KXZI 5TE6L 2V2WB 3UP1A 4HKJA 2P8MB 3V8CA 1HSAA 2KKQA 1NJ9B 5DD6B 1XGQB 2X4NA 2PCPA 1ACZA 3V0VB 4P5MA 2P5WA 4JFFB 2VLKA 4WU7A 2W38A 5MEOB 2OTWB 4KROB 4MQXC 4ZYKB 3DROB 3Q3GB 1QBAA 4ZOBA 3GM8A 5F93C 1NBVL 4K3DL 3QG6B 4MNGA 5L6YH 5L0QB 5GPRA 2EDEA 5IWLC 3FT4A 3FN0H 5HPMB 4M7ZC 4MB3A 4I2XB 4CJ0A 3CIQA 3JZ7A 2IH1A 3EO1A 2UV3A 3BKCH 2E27L 4NM4H 4JO4H 5D9SB 1G6VK 1LNUB 3FO2B 1MEXH 4TSCL 1C08A 5HHMD 2WBJC 5HHOD 5GRWA 5GS1A 5CMAA 1HH9A 3HMXL 4JFZH 4YFLI 3MGOB 3TBSA 2QQLL 1KEMH 2EDRA 4NQDE 2BC4B 4YH6A 3WN5C 2CXKA 2VC2H 3KPSE 2ADJA 1D5ZA 2JJSA 5I1CL 1G9MH 3MBEB 3UYOD 4KMTL 3GSNL 5CCKL 2VZUA 1F3JA 3LRSA 1U95A 4D9LH 3WKMH 4LCWA 3AS1A 4ELME 4PJAE 2P8LA 5JTWA 4MXVF 2F58H 3DX8A 4M1DL 5F89B 1DBKH 2VR4A 5L9DH 3I6LD 3P9LB 2VB5A 4KWUA 3DVIA 1JPTL 1YEHH 4DZBB 3KJ6L 4OIIL 5HI3D 5T1KB 4M93C 4ODHH 5KVGL 4GG6E 4FFYH 1SHMA 4P9ML 1CN4A 3QFJB 3BH9A 3UZQA 4YXKL 2MPAL 4LSUL 4JFDD 4LPVA 5C0JA 1YJDC 1BVKB 3B8YA 4UILL 4L5FH 1NDMB 5C07B 1KTLB 4RRPA 5EBGA 4XWGH 4F7CA 1XGRA 1HNGA 3MRRA 3BKMH 3OKNB 2Q76B 3IKKA 2ZCLL 5IBUB 1T4KA 4XPFH 3CGTA 3MNWA 3O4OC 2XKNA 4HF5L 2EEBA 4ODHL 1BGXH 5CS7A 2ITCA 1N5YH 2W9LA 4G80A 4FQJH 3MRPA 4JY5L 1EVUA 4OCWH 5CBEA 3HE7D 4LSQL 5I1AB 1TQCC 4MAUL 4O2EA 2HFEA 4GBXC 3TVMC 3ZE0F 1KBGH 5AUMA 5C0AB 3IFPB 1DBKL 1KENL 3QXDA 2X4UB 5E5UB 1E6OL 1MFBH 1MCIA 1VEPA 1G7HB 1AO7D 1MF2H 3DUUA 4OF7A 1DLFL 4N0YH 2CK0H 1FV1B 5ALCH 1CTNA 4H0IA 4K3EL 3PL6B 4L9LC 1HSBB 3D87B 3P9WB 1EPFA 5DO2D 5FAAA 2XN9E 4YBQD 1NMBL 2UWEA 4MQ7A 2BSTA 4LCCA 2Z4QA 4XCYB 3HS0A 4FA8A 1UKTA 3LD8C 1BJ8A 1OPGH 2YD3A 4RX4D 4JY6A 1UJTA 1FL6A 2WANA 4R0LB 2M8XA 1QKZH 1LD9B 2DQDH 5CJBA 2FEEL 3G5YA 1KT2A 4YHOH 3BKCL 4P5KA 1SYVB 4U1IA 2APVA 5SX4H 4FOMA 3QPXH 4JFDA 3TBWB 2CLRB 4IIQC 1TQCB 3BEVB 4IJ3C 3I3DA 1JYVA 4TUJB 4YHNA 5GS2D 1KTKE 1JHLH 5F97E 4HV8A 1PG7W 3LVEA 1NKOA 4F3FA 2YOCA 1U3YA 3ZHDA 2RFXB 1G9NH 4G8EA 5EFIB 5EULV 1Z6JT 3SDAD 2P8PB 4OSUL 4NQDB 1R0AH 3IDYB 2Z91B 4LPUA 5HGDB 3ZTJH 2GFBB 4OD2B 2FECI 4JRXB 4I18B 5DQJB 3RVVD 5C09B 5CKAA 4JFFD 3SCMD 2V9QA 3DX6B 2DLTA 4YGVA 5JLZA 3T0VA 4QLRA 4X9FA 3V6FA 1U58B 1HXMA 4ODUA 4KJPC 2YK1L 3C09C 1P6AB 1GOHA 4LSVL 4PB9L 4EN3C 2P5WE 1GVIA 1ACYH 4W4OA 5HGDA 4EI6A 2ZSVA 3NTCH 4UINH 1F4WH 4XBEH 4NQEB 1JGDB 4MDIA 4PJ5E 1M05A 1GHFL 1OP9A 3TYFB 5I1GL 2R29H 5ETUB 4OUUA 3P0YL 2CRYA 4NRZB 5FA4A 2Y36L 1WBXB 3QDAA 4IMLB 3BZ4A 4J3TA 4X6CA 2NY0D 4P2YA 5C0GB 1TQBC 1KIUA 3L5WA 4PV8A 5IR1A 4YHMH 3OKKB 1EFQA 1T1YB 3IDNA 4OCSH 1NGYB 5E6IC 1NFIB 4R8WL 4K7PH 3BPNB 4JREC 3RPIA 2I07B 3MJ9H 4N8CH 4P4KA 4NO3A 5IM7A 3GNMH 4FQPA 1X9QA 5JHDE 1QSFB 4QRSA 3ZKXB 3KPSA 3PL6C 4L9LB 4GAGL 2WM0A 4LF3B 3MGAA 1CS6A 3HMXA 3BKYL 1WFOA 3DSFL 1ETZA 1N2RB 2R1XA 3QEGH 1FG9C 2BZDA 3EOBB 4N68A 2R56H 1S7WA 3I6LE 4C56A 5CBAB 1CL7H 1CFSB 2NXYC 3QUML 5B39G 1DQMH 3MR9B 1KJVB 3DYOA 3RIAF 3ARUA 3WS6A 1CXEA 4PJ5D 4BH7A 3MOAL 4YIQA 1Y6KR 2CH8A 1PQZB 4FTVD 4HZAA 4NN5C 4YHKL 4J6RL 3HI5L 3DHMA 3MRKB 4ZUTB 3IS1X 1I1AC 5EZOH 3SKJL 5CWSB 4C57C 2R0KH 1AXTL 5AG8A 4YPGA 4GS7B 3BGFC 4XC3L 2F19L 4NKMA 3RVTD 1T04B 1P5UA 4RX4A 2ZUTA 3ARZA 4M5YH 4IOFC 5DJDA 4RMRA 2MTPA 4KJYB 4WEBL 1DQLH 3KPPA 2ZCHH 1JTPA 4DZ8A 4MX7A 2F53A 5EU4B 5SWSD 4LARH 4X4ZA 1VACA 3IAQA 3MLXL 3B9DA 2P8MA 5E0QA 4ERSH 4GAJL 1XGQA 5AYUH 1MHCA 4YHLH 4Y4FC 2XZAL 4BZ2L 1LDSA 3WD5L 1NGWB 3I2CH 1IBGH 2NY2D 3O4LE 5GSVB 4OZ4A 1AR1D 3MOAH 3P40A 1XF1A 3IJYA 4P2OA 1VA9A 4UT9H 3ZMRA 4WEUD 5KVEH 1R5IA 3MBXL 3EFFA 4U6TA 3UTZB 1BZ7B 3H7BA 1NFDB 5I73B 3G6DL 5SWZE 2Y5TB 3U36A 5DMIL 2GJJA 2VLLB 4BM7A 1T0MA 5CD5C 1N5YL 3RZWA 3L95A 2J7LA 3O2DA 2YRLA 3T0EA 1TJHH 3BZEB 1XR9B 4J8RA 3BE1H 3LN5A 3QCUH 3JWNC 1J88A 3MJ9L 4N8CL 1TFHA 4LVNC 4XCEA 2IMNA 3M8OL 4MXQC 1JL8A 3SDDD 3UYRH 2OL3A 4FRWA 4I3RL 4UT6L 1QRNA 3RGHA 3P77A 1NLBH 1FFNB 1QLEL 4ZUVB 4JDVB 3W5MA 4KPHL 5C9JA 5SV3A 4J3VA 4JVWA 4MD5A 4POUB 1SMOA 1KYOK 3UPCA 3E6FA 2VNCA 4JRXD 2DLEA 4P23D 3GSQA 4ZPVA 5F72S 3HKFA 1RAMA 4U1SA 3T4YA 1CD1A 1FSKB 4QRRE 2VZSA 4UTAL 1TVHB 3ZL4H 4HIXL 5DJ0A 1KNOA 2R2BA 4PIRF 4WW2F 5CFHA 5EIIB 4MB5A 3D18A 4LCCB 5I1HH 4PTTB 2GJ6B 1DUZA 4XWOC 1CF8L 3VD3A 1FG2B 1MQKL 2GUOA 3F7YA 3WEXB 2UWEE 5I1CH 3RGVA 4NO2B 3UBXA 1SBSH 4OIAA 4R4FH 5GGVH 1RZJH 4M8QB 1HQRB 3MRMA 3L3JB 1KCVH 4JPKH 5DK2A 1JGEA 1WWWX 3FMGH 2HJKB 1QNZL 4JPVH 4CMMA 1FL3B 1B0RA 4Q97A 4HFWB 3U0TA 3U9UA 4O2EB 3U4AA 4FMKA 4W6YB 3WN5A 3S37H 1NCAH 1X6NA 4HUNB 4NDMB 1G7LB 5HVFB 3WS6C 5L7XH 1N4XL 2FLRT 3MOBL 1IILE 5DD3H 1JNNH 1RK0A 3CSPA 4YFLF 1LNUA 3FO2A 2XTJC 1GGUA 2UWEF 1UKQA 3QI9D 1QTYT 3PL6A 5E5MA 4P2RB 5KAQG 1A7PH 2NW3B 2ADFH 5JHDA 1AGBB 5EUKA 4BFIA 3O3AA 4NHCL 4PRIA 4NQDD 1JV5B 3BEWB 3EAKA 2FEEI 4OQTH 4LNRB 3QCTL 3PP3H 1T5WA 4YHPB 2CMRH 1OW0A 5HYQA 3QDJE 2A6JA 4C56E 1G7IA 4Z7VF 3PIQB 4Z18A 3QH3A 1PKQE 5ALCL 3WJJA 3NFNB 3S8WA 1EBPA 1T0MB 4YFEA 3N85L 4JFEA 4M4PA 3CX5J 5F1NB 5I15H 4LVNB 4TTGA 4M7KL 5ELIA 1C1EL 2J5LC 3PWPB 4WTXA 4CN4A 5LQBH 4N9OB 3CAFA 3DUSA 4J8RB 3RWHB 3T0DA 1RZGA 5CZVH 1OB1A 1ZAGA 4K8RC 4U1JA 4RGMC 2YPKB 4MA3A 5I2IA 3DRTA 4MS8C 4ELMB 1J11A 4UQ3B 1I8IB 3UTTA 1V7ML 2B5IC 3ZDZF 5B38G 1UEMA 4LU5L 1IQWH 2BFVL 1YY9C 3TBVA 5HYSG 4O58L 1JYXA 3LKRB 4HUKB 5C9JB 3K4AA 5C0CB 2HRLA 5D1ZC 5IM7B 2J8UB 2F53E 5CEZE 1IFHH 2HLFC 3P4NA 4IIQB 5T1MB 1G7MA 4UILH 1SY6A 2C7UB 3BP6B 3QCUL 1E0OB 4AIZA 1UCTA 4DTGH 4D9QD 3TEUA 5FKPB 1OAZL 5FV2A 5IVXB 3HUJB 3WNLA 5DMJB 2R0ZL 2R69L 4NO5B 3HMWL 1EDQA 2VKWA 3QI9A 4KGLA 1T89C 4M5ZH 3DV6A 5E7BA 1OGAD 1FYTA 3BJ91 3D9AH 4HLZH 4GOSA 5E94B 4A2LA 2XNAB 3ETBF 1X5HA 3L3DA 2L4OA 3RUGB 4XI5C 4DQOL 1FL5B 5T1MA 3ARGB 4JGUA 5IJVB 1XIWB 3R8BB 1H3VA 1IAKA 2FO4B 1ADQH 4LLUB 4WTWA 3P4OA 1LE5B 4X4XB 1A7NL 3HZMA 35C8L 4QRUA 3VA2C 4MLIA 2ICWB 1JNLL 1S7RA 3NGBB 5EZJB 4AEIL 2DYPD 1IBGL 4MQ7B 1L7IH 4KKBD 3SE4A 2CKBL 5IHBA 1NAKH 2ARJB 4Y1AB 1D9KB 3ARBA 2QKIB 4Z7UE 3CFEB 4D9RD 5C0EA 3EOYG 3VD9A 3U9PL 1KJ2L 3T0EE 2I27N 1B6UA 4WTZG 1H9VA 2NY4B 3REVB 3OKDB 2O5XH 3GSWB 1LE5A 3GMOA 4K3JH 1JYWA 2HVKB 4PJCA 5K33A 3K8KA 3BYTA 3P73B 3WE6A 2QSQA 4TSCH 2VN4A 4IRZL 5E8DL 3UTTD 4WHTA 5JPNA 3R4DA 4TQEH 1W72L 4P46B 5FYKL 1I75A 1M7DA 4HKXA 2NY5H 3NAAH 5CBAA 5HYJA 3BPCB 4DKEH 1N4XH 4F9LA 2GTWB 3LKOB 1CDBA 4NC0B 1V7NH 3ELAT 4PRIB 1DUYA 3BD4A 3ARVA 2AKRB 2BNQE 4X8XA 5F7HA 2ILLA 4GSDH 4YO0B 4YDLC 5FYKE 4F37K 2H32A 1G0YR 4KJPD 4QHLA 3ZZ1A 2OJZL 3GSNB 2IANA 3MRDA 5IVOA 2H26B 5FUOH 1YYLL 3O4LA 4NIKB 5DJZA 5I18L 5KS9B 5DHVB 4E41D 4GW1B 3VRLF 1N59B 2EYSB 1ZANL 1RMFH 2BHUA 2GSIA 3MXVH 4PJDB 1WCQA 4MJ4A 4OZHB 4FQQA 4LIQH 1BF8A 3V7AG 3QEHB 3S3JA 3R0NA 4U1JB 2X4OA 4OZIF 4Q9CA 1HHIB 4GAFB 2AS5M 2EKJA 4X7EC 1F11A 5E2UL 3TV3L 3FFDB 4OZIB 5I6XB 1J86A 5TQ2H 1DN2A 5LBSH 3C60C 4I5BB 3WFBL 4I0CC 2PNDA 1A8JH 1YQVL 3LD8B 3LKRA 3WNMA 5EORH 1IKNC 1JTOA 3PGDB 1FVEA 5IV2B 4KC3B 3S4SA 1J05B 2VXUL 4KKAD 4K8RD 5JO5A 1H3PL 2X6MA 3TN0D 3E6HB 4K3JL 5IFAL 1FNGB 4XMKL 2Y36H 4L4TA 1QD0A 4NO5A 4C83B 1CT8A 1S9XB 1NEZA 5GSRB 2X70A 3GFUA 3I02A 4XPTH 3L5HA 3X3FH 1TCRA 1OWRM 4WRLA 3P30H 5HHVH 3BE1L 3N50A 4X6CF 3S36X 4WUUD 2CSPA 2RGSA 4AEIH 2FH6A 3IU4H 1ZWIB 3CFDA 3OAYK 5DUBA 1LP9B 2VR5A 1T7XA 5H2BA 4AQ1B 5HHPB 12E8H 5C3LD 4JM2A 3T0XA 1HNFA 1NEZB 4LCIL 1B6DA 4MGXA 1PG7X 2GSGA 4I8DA 4MJ6A 5GZOC 5JXAH 3MUGB 2X9WA 4O02H 1S9WA 1EEZB 1AE6L 2QKIA 4XXDB 4GKZB 1JFQH 2F8XC 1AH1A 3BAEL 1CLZH 4PJ9C 3CVHA 1DQJB 4RQQA 2G60L 2YZ8A 5HI4D 4WI5A 2X4SA 3MV7D 3ARXA 3PHSA 1ZLVH 2OR7A 4ZUTA 4K2UL 1WWCA 5C0CD 1GC1C 2AW2A 4LKCA 1FE8L 1T0PB 2KQNA 1UQSA 3U0PB 3U48A 1JVKA 5IESL 4YGAB 4LGSB 1C5CL 4PJEB 5EIIA 4HK0B 2WQRA 4M6ML 1DUYB 3O3BA 4B7IA 4ZTPH 4FQXA 1YDPA 1UH3A 2X9YA 4TUKL 25C8H 3WIHH 5DJDB 3RTQC 4MNGB 3MLWL 4XNMB 3WIIL 4ZO6A 5E1AB 1H3UA 4G7YL 5T3ZD 4ZAKA 1I1FB 3L3KB 3DHJA 4PRIE 3ARTA 4TRPH 2N56A 1SYSA 4GLRH 4LEXL 3CFIC 4NHUB 1UXSA 5FM4A 5J11B 3LH2L 3MXWH 4DKFL 3HI1A 3V4VH 4L29A 3FB7B 5EOCJ 1EBAA 2XKUA 4U0QB 5TDOA 5F7MC 4JZNB 4U1GB 1JNLH 4PRNB 1Q0XL 5D7SL 1XR8B 1QSFD 1WITA 3QWOB 5E1AA 1JBJA 1S9VA 2Z92B 5CZXD 2AXFB 1JJUA 2X4OB 2ESVA 5DJCB 3SEPA 4U31A 5EOQH 4IRSB 4QYOA 4MA8H 4MA3B 4U7MA 4XNQB 3KHOA 3VFPB 2PYED 4TRPL 2VLLA 4GXVH 4NHCH 4Z7UA 3D0VA 2HFGL 5GGQH 5C7XH 4M1GL 1KJ3H 1ZT4B 3FO9B 2DQEH 3UTTE 4PJEE 1QO3B 3O6FA 1DQQA 1U6AH 4QXUH 2VRAA 5D5MF 3LEXB 4IRSA 3BKML 2DTMH 4PJ8A 5ERWA 2D7PA 1H5BC 5I8KH 2X70B 4LCUB 1K8IB 4K94H 1CXKA 5FECA 2BOBA 4QHUA 1DVFB 4YXKH 4KZDL 5CGYC 4K2UH 3TN0A 3TPKA 2VTFA 1KACB 2NTFB 3VG0L 1JPFA 3T0BA 4M93B 2IBZX 3SKNB 3HI6H 4U6VH 1FYTE 1XIWA 5IK3B 2X4RB 3TH3T 2AJXL 4PG2C 1AE6H 4PB0H 4XRCB 2IC2A 3LHPL 3DMMB 3GSRB 4NNYB 5I2IB 4UIKH 1LP9E 5FECB 3SKOB 2R2BB 3PWLB 1T7YA 1JUFA 3FO1A 3RWEB 1CD1B 1JZ5A 4EI5C 2P5WB 1V5JA 1OAQL 5DRWB 3WL9B 3OGCB 3TIDA 4L8SA 5JIKA 4OZFH 3NVQA 1UWEL 3P4NB 4UIMA 4XAKE 2I9LA 3MLZL 4PG2A 4PRBA 5GZOD 2EDQA 1T20A 5KSAD 1UWXK 4GUPB 3LQAC 3RL2A 5DHVH 1CI5A 3MMEA 3T1FB 2GW5A 3OGCA 1S5IH 1NMCC 4YNYA 2LV4A 4NM4L 1CK0H 1A14H 1J8HE 1EEYA 2I9LB 3ARBC 5J0BA 4LDOB 2N7BA 4LLUA 3WFBH 5KSVA 4YDIH 5FUZL 4HWUA 4TNWF 4X9BA 5LXGL 4K3DH 2J4WL 3WJJC 5D7JD 1LEIA 5ITBL 4OZGF 4X9GA 3S88H 3CCHA 3X14A 4N9GA 5EZLA 3O6MH 2UZIH 5FV1L 4OB5H 1LDPL 1Z3GH 4M1GH 4QTIH 1YEFL 4PRDA 4JM2C 4C55A 2JIXA 3EYSL 1QLRB 3O11B 4KUZH 4U6XB 4PJBE 4PJDA 1CCZA 4U49A 3S35X 1FORL 3QWOA 2EXWD 2CDEB 5GGVL 3ECBB 2FJHA 2AK4E 4F15B 1G9MC 1T22A 2IAMD 2CRIA 2NY6C 3CCHB 3HE6C 3FRPG 4XP6H 4BH8B 3O8XC 4ZNEE 2EEAA 1M7DB 4J3WA 3NFNA 3LH2H 4G5ZH 1F3DH 3BH9B 3CPLB 2IPUG 2DWEA 3ZO0A 3RX7A 1FN4A 4OCXL 5FYLH 2CLZB 4V2BA 4WFGD 1T03L 1B4JL 4FNLH 4YE4L 5C07D 3S4SB 3LCYA 4YAQB 4R90L 5E7FA 2ED8A 5GXBB 1J8HD 4M7ZB 4P3DA 2NYYD 2HTLD 4D2NA 4JZOB 3ZE2E 3LKSA 2H8PA 5FOBB 4M5YL 4Z9KB 2YRPA 1GOFA 3PWVB 2R2EB 4XC3H 3DX9A 3UXFA 5C0RH 3ULUC 1ZHLB 4HGKC 5EUOE 1FE8H 3HN3A 5C0AD 1A9EB 1BAFH 4L8SC 4U0RC 1RZKC 2CKBH 1MSPA 1WBZA 3L5WB 2EO1A 5JR1H 2OXHA 4DK6A 5IWLA 5C08E 3JSSA 3QI9B 1HSBA 4YK4C 3DMMD 4DAGH 1T0NB 3DV6B 4P3CL 1MVUB 4QNPF 4R7DB 1B0GB 4GS7C 5J3HD 1AC6A 1H5BB 4HCRA 3ULUL 1XGRB 5B8CA 4FQCH 4GMTH 4M1DH 5LJYH 5HTSA 3TZVC 2HLAB 5GRVL 1W0WB 5DK3A 3PWPE 2DQJL 1T1ZB 3H0TB 4L3ED 1HSAB 5H94B 3IXAA 1VHPA 4PREB 4JO3L 3IDIB 3CFEA 5C0EB 3GRWA 4E41A 2J88L 2FZ3A 4PJEA 3ARBB 2EDXA 1IAII 3NIDE 3VRIB 3OKOA 1HHGA 4HPOH 1CD9B 1JMZA 1NH6A 4OKVA 1XGUB 2DF3A 3RL1A 2LAGB 1A1MA 2RFXA 2GJZA 4ISVA 4XP9H 5CJXA 3OHXB 5CJOH 3AVEA 4XI5D 1AXSA 4LQFL 5E9DA 1F4XL 3NCJH 1LO4H 3QSKB 4XNUL 1UT9A 3U7YL 4D0DB 2JB6A 4GRWB 4P46C 3FN0L 4PRPA 5H8DA 3VXRE 3ZSSA 3QZWA 1C1EH 3F7VA 3QNXB 4UOJA 4YO0A 3Q0HA 2WINA 3N1GC 4PR5A 5SWQB 3V95A 1YEKH 2R9HC 5DSCB 2YPLD 3HLAB 3F6IA 4GH7B 4TSBL 3HCVA 1AGCA 3RWCA 1M1SA 2C1OA 3RNQA 3MGTA 4UDUB 2DJUA 1G9NC 2BVEA 1XGPA 4L8BA 1FO0A 5F9OL 3CZJA 1PZ5A 2OP4H 2QQQA 2DD8L 3KPRB 1QYGL 4B50A 1QACA 5DRNA 2BNRB 3TH2T 4WNQA 4PJXA 2FO1A 2R0LL 4PR5B 4EOWH 3D39A 3DIFA 5F88B 3MPCA 1FFRA 1EH9A 4NZJA 5FA4B 3ZHKA 1KEGH 5IVXA 1F11B 5E99L 4L4VD 4ZFZB 2IADB 2V7HB 4OD3H 2Q87A 5MEND 4JZOA 3WHE0 1MI5E 2GFBA 4OD2A 5M7QA 4CVXB 3GO1H 1DVFA 2IQ9H 2ZOLB 1NCNA 1JWUA 3J8F7 3NFSH 1DL7H 1OGAE 2DBLH 6FABH 3NIGF 4QEGA 3V9FA 3IDXL 1QEWB 2D7QA 4NJAL 4Z0XB 1RD6A 3GGWB 1YPZF 5D6DC 4KK5C 1C16A 5BMFH 4U2ZA 2H6PA 2EZ0C 1J9CT 5D2LE 3SJVE 2DQIL 5B22A 1W0VB 3VRJA 2C1PA 4D0BB 3MJ6A 1ZWIA 3Q2CA 1CFTA 5I17B 1WCBA 3BX7C 3NH7H 3C60D 5LCVL 3TO2A 1QVOB 4KRNA 3VH8B 4HQQH 4HUMB 3WE6B 2NR6C 3KYOB 4N90D 3RY4A 1A6UL 4GKNB 1OTUC 4ZAKD 1NFIA 3QR2A 3HC4L 1NCDH 3FB8A 1GGCH 3V0VA 5I1IH 1UZ6E 2AJXH 3E3QE 5J3HC 3EFDH 4HAGA 4LHQB 4U4BA 3GMQB 1FSKC 3ARFA 1MWAH 1CFTB 4WI2A 3VFTA 2IBGA 4X8JA 1FL6B 3QJFB 3AFLA 2QHRL 3GSUA 5DJ6A 3FZUC 4RA0C 4PJAF 3TVMD 3OZ9H 4R4BA 4WCYL 4NNXA 3MRBB 4LLMA 1HH6B 5BJTA 3FQUA 4HMDA 4KH2A 1WZLA 4GMSL 4OM1H 3C08H 3DI3B 3QHTC 3UJIL 1FL3A 2D0GA 4P2OB 2EDWA 2W59A 1F58H 4S2SA 3QEHA 2AJSH 2NXZD 4KVNH 3EFFB 4Z7WB 2ITDA 4X7SL 2L7JA 1AGCB 3LZFH 3KJ6H 2FBOJ 4Y0GA 5LQBL 1IVLA 3WUZA 4NQDA 1I7ZA 2VERN 1VEOA 3QWRA 1Z9OA 4POZC 1ED3A 4OFYD 3VI3E 1XR8A 4L8DB 4JKPL 2D31A 4Z8FH 1UACL 5DXWA 2V9RA 3RGVD 4XCEB 2M2DA 3B5TA 5E1HB 4NRYB 4EZMA 1KN4L 3QNYA 3QDGD 4HWZB 4OFIA 1SVCP 3HAEG 1I85A 3P77B 1JZ4A 2VZOA 4J3OC 4R7NB 1AI1H 1Q1JL 1PLGH 1QRNB 2QADC 3OKMA 4K3HA 2XY1A 3FTGB 2ADFL 4MDIB 4ZS7H 3WIHL 3G04B 2O61B 4XP5L 1NCBL 3N1FC 3O0RH 5CP7B 2FYYB 3LEXA 3MBEC 3RKDC 4LKXB 2V7NB 4XWOD 3NZHL 3O6FB 5GQBA 3RU8H 5CZXC 4OD1L 5DDHB 4QF1B 4KI5F 4EUPG 2FEDD 1ONQB 5HVGB 3KPNB 1TXKA 3IDNB 1MRDH 1NCAL 3BP4A 4V1DE 5IB1B 3W9DB 1EO5A 3O6KH 3V52H 1KTRL 1HIMH 3QIUA 1IM3B 1Q9WA 2DICA 4K55A 3T2QA 4EBQL 4NO0A 4QWWD 2W1NA 2FDBP 3ORJA 2FYYA 4HLZG 1QSFA 5ICZB 5IW6A 1CYGA 1YEGL 3OR7B 3QXDB 2IF7A 3O2WH 2XZQL 5BS0B 1P7KA 1L0QA 1BPVA 1CZ8H 2BCKB 3KPTA 2DRUA 2VXTL 1CDIA 5B4MC 1G6RB 4PJ5B 5ITFB 1XCQB 1N0XL 4HUXB 1UQSB 2R1WB 5H94A 1S7WB 4JZJA 1IMHC 1MCWM 4LHUG 3TA3D 2ZPKH 2BSTB 4DGIL 5I1HL 5J6GA 4PJXE 4OZIE 1FFQA 3MA9H 4IHOA 2F8VA 4P59L 3W39B 3QEQE 3E6FB 3U83A 1NAMB 4HIHA 2YEZB 2QJDA 4XNZC 4JHAL 4XVTL 3RIFF 1SJVA 4ZFGH 1A1OA 1II4E 1MHPL 3Q6GH 4R8WH 1L0XA 4WW2A 3CDYA 1S5HB 3UCRA 5HJ3A 3S5LB 4DVRH 3ZT7A 1RJZB 3TIEA 4YHYB 1S7UB 4WU7B 2SEBB 3SDXB 5JW5B 1AQKH 1KPRA 5DC9B 5DC0A 3FB7A 4B53A 1Y6MR 1X5KA 3JXAA 1OP3K 1JNJA 2A74B 4Z7NE 2EDYA 3BEVA 1NGQL 1DL7L 4P4RB 3MFGB 1IEBB 4L3EE 4TOYH 5BVJA 2VR9A 2R23A 2HKHL 3OG6B 2B0SL 1PZUB 1HDMA 5I66B 3R0MA 2FGWL 1YN7B 1F42A 4TTDD 3GIZH 1HZHL 2JIXB 3GSVB 3PWUA 1I1AD 4M03A 2EDFA 2Z0BA 1P4IL 2DKUA 2PF6A 4CW1A 3KXFB 5F88A 5DQ9A 4H25B 3LS5L 1K6QH 1A3RH 4D9QE 5DJ2A 1I3GH 4M7JL 2P45B 1JPST 3MUZ1 5L8LB 1ZHNA 2GJZB 4S1RH 2V7HA 5BRZE 1EHLL 3TVMB 2I9TB 5J9PA 3MRCB 4Q58C 1UENA 3B9KD 4LCWB 3MLYL 3MV7A 3W11D 2XACC 1P2CB 1P7QA 3VGEA 3F7QA 4NNPH 2AAVA 3DVNA 2HWZL 5CIPA 3VWJB 3X17A 3OXRA 3RVWD 4YAQA 2YHGA 1MI5A 4OUUB 5TFSH 5L2JB 1A3QA 2Q86B 4WGVB 5SWQA 5J6HA 2VLRD 4K8RH 4LPCA 4X7SH 2NY2C 2PTVA 1F4XH 4JY4A 4APQD 1T66C 4XBPA 3WDIA 3VWKD 3MGTB 4UDUA 5GIRA 1A7BA 2QADD 2NY6D 2VLJE 5K59E 4P23B 1IGIH 2X41A 3I50L 5KG9B 1JYNA 2WZPD 1SM3L 4G3YH 2R2EA 4OM1L 4JEGB 1KTLA 2HH0L 3AC0A 4DOHE 1RJCA 4Q9QL 1BVKA 3KPRE 1LEGA 4XCFH 2HWZH 3IVKA 5I8OL 5FO8A 5CD3A 2R0KL 1KC5H 4HS3A 4CN6A 2XOTA 1MLCA 1DANU 1KIQA 4KRLB 4WUKH 4CVZB 1TZIB 1YNKH 2P5EA 4JDZB 4DFIA 4KTDL 3GJFH 3MNWB 4ZQKB 3V5KA 5I8CB 2XKNB 4Z77A 4JN1L 2OL3H 3OKEB 3DXAA 3JWDL 4YFDB 4TULL 3D25A 4UNVA 1KULA 4N8VB 3BRGC 3KNBB 4KDWA 2VDKL 4KAQH 1NC4A 2DQUH 4PGBB 3IFOB 5I8EA 5FO8B 5J13C 1XZ0A 4X5XB 4DQOH 1KN2H 1NAMA 5AUMB 4CN1A 4UOW1 3BP6A 4LSQH 4AIZB 1SJHA 4PGZA 3GSUB 5KTEH 1IM9D 3HB3D 2P47B 5T5FL 4OAWB 3U46A 1WT5A 3CH1A 3GKZA 4JFPA 5SWZA 2FSEA 4HKXB 3MUGA 1I4FA 4OGXL 5JPNB 1HCVA 1T7VA 1ZLSL 2DQTL 4WY7L 1T04A 2BY0A 1MHEA 1XH3A 3HFML 1A1NA 3ARGA 3MRNB 4MDJA 4JFYA 5C0FA 4K23L 4Q9QH 5D1ZB 5F7EH 3MCKA 5FF6A 3JWOL 1R3HA 5DJXA 3VU2A 2K7PA 5I17A 2JCCB 1BQHB 3KLDA 4Y5YC 3STLB 3IDGB 4OLYL 1MCJA 5HI3C 5C6WH 1BIIB 1DQTA 3V8OA 4IS6B 3BD5A 3NFSL 4R97B 4H88L 1RUPH 2KDGA 2I25N 1GZQB 4UV4H 4BQ8A 4D0DA 2GITA 3IXTB 4FNLL 4NWTH 2WIIB 1FC1A 1R3IL 4OI9A 2HN7A 1TQBB 2FIKA 2AEPH 1I1YA 3ARDB 4LDEB 1S3KL 4GG6F 1TJIH 3RVXD 3EHBC 4DGIH 3ARED 1AP2B 3JTSB 1WEJL 1OF2B 1KIPB 1R24A 3WFCL 4QRQB 2XZZA 1D5IL 4HD9A 4HMCA 4ODTH 4Y5XC 3FFDA 4OZIA 3GDBA 4XPBL 5F7UA 1RMFL 1ZE3C 4WFFD 3QEQA 1A7OL 1FFOB 1JPSL 2VZ1A 4AIXA 1EHNA 3QP3A 2EO9A 3MFFA 3G5ZA 2YWZA 3QUXD 2YZ1A 1YA5A 4KY1H 5GISH 5ANME 2JTDA 4PRNA 1T6VN 4LKXA 3DIFB 4QTIL 3K0WA 1LDPH 1T3FB 5IOPB 3QUKB 5T5NF 1VPOH 3VFVA 4AH2A 4PRHD 5IB5A 1MEXL 3WXWL 3G08A 4PJ7E 4PJ8D 2FX9L 3EIFA 2FBJL 2O5ZL 3H9SD 4MJIB 3TBVB 2B8OT 3VFUA 3ZTNL 3T0EC 3LRHA 3MLUH 3OF6D 3VD5A 3RVWC 4ZXBA 2H1PL 3NCYP 3U4BL 1H0DA 2D7NA 2JLLA 2NY1C 1I1AB 4ZO8A 4HK3J 3SBWC 2ICES 4QRPA 3BT2L 3G6AB 5DUBB 1QSFE 4J4PD 4JDZA 3MA7A 4HPOL 1EAPB 5JNYB 1XIWD 4X0KA 3HC3H 4X6EB 3DBXB 5DFVC 1KF9B 2AK1L 3MUJA 1A7RL 3QJHB 5BS0D 5F1OB 1N5AA 3VMPA 4M6OL 3MJ7A 3V0WH 4QXTB 4XVTH 4K9EH 1ODAA 3QRFM 4POYA 2QR0B 1CICD 4W70A 3BPNC 1A7QL 5MI0C 1TZGL 3AXLA 2Q1EA 4MMXC 4TUOB 1ORQB 2E9JA 2NY0B 2VAAB 3MA7B 1KFAH 1C5BH 5IMKB 3FCTB 5ACZA 2EE2A 4FFZL 2QBWA 2OJEB 4JHWL 3EZ8A 4H5SA 1QHPA 2R1XB 1N0XH 3BP4B 5CILL 3WFDL 1UM5H 5E6IA 4NOBA 4JO2L 3O2WL 4PRPB 1T83A 5FCUL 1NL0H 1CXIA 1DN0A 3TIDB 2NXZC 4JFED 3AROA 4RGOH 3AY4A 1D3CA 1E4XH 3ZE2F 4ZD3H 1QA9B 2JCCA 2CKBB 5CUSH 1OP5H 3MUHL 4UBDD 1KCRL 1RFDL 3L3KA 4HT1H 2E7CA 1N3NA 4KI5D 1UM4L 4QXWA 1CTOA 2BJML 5EB9A 2VLMD 2NW3A 3UTQB 2OTWA 3H9ZA 4JZNA 3RWIB 1QHOA 4HXBL 2GJ6E 4LBEA 1X6LA 2NX5A 4I3SH 4YNYB 5JLZB 3O8XB 4XHQA 3SOBH 1OTSD 2XFXB 3ZDYE 2JIXD 3VI4E 5C7XL 2YD6A 1DQDH 4DN4H 3OX8A 5MEPA 1KIPA 4LSTL 2XA8H 2F5AH 5MEQB 3QXVA 5T5NG 2PKDA 3QQ3B 4GW5B 2YD5A 1QFWH 3L5XH 1A6WL 2D7TL 5T1LB 4G5ZL 1M7XA 4C59B 3LQZA 4XHJC 4Y19E 2YXMA 3TYGH 2OQJB 4MHHI 1A7QH 3BP5A 1C5DA 5GSVA 2YPVH 4BZ2H 3VJ6B 2ZJSL 5HSFA 1YMHB 2YMXL 4X9IA 4ODVL 4LLDA 2ARWA 3VG9B 1DBMH 3TCLA 1SYSB 5DA0B 3QG7L 1OGTB 1QQDA 5D1XC 5KSAA 5IFJB 1HYRC 4PV9B 1Z3GL 4N1CA 1IGIL 2RCSH 4F2MA 1I8KB 4Y4FA 5EUOF 3BJLA 1GCFA 3RDTD 4XH2A 1DTUA 2PXYA 5E4IA 2PUQT 1S9VB 1FDLL 3EYUH 5JUEH 1R5VA 1WQVT 1FNAA 3E6HA 2BSRB 1Q94B 4R6UA 4L4TB 1A9BB 4RFNC 3C6SA 1B3JA 3W9DA 1IC4H 1DEDA 3DPBA 1Q8MA 5I1LB 3SGEH 2ICEB 4JCLA 4WCYH 4NUGH 3T0AA 3IAGC 3ZE0E 5E99H 4F7PB 4BSVB 2I9TA 5TQ0L 5E94A 2DM2A 2VSCA 3FMGL 4N0CC 4Q74A 4AIOA 4XT1C 4NYLB 4P2OD 3DX9B 1Z9LA 3CVHL 3MBED 4U6HA 3VFSA 4ONHB 4JB9L 2B5IB 3EGSB 1AKJB 4J4PC 1K6QL 3LS5H 1QFOA 4QXGL 3B9KA 2AJVH 5F9OH 2D4FA 3IFNH 3JBG7 3NCMA 1A3LL 1SQ2N 2BK8A 5DTFA 4ZUUA 4D0CA 3CFJA 1U8JB 5IQ7L 2FX8L 1KNOB 2ZG3A 2W91A 4U7KA 1TJIL 2CKNA 4GAGH 1QR1A 4I2XE 4ZYKA 1EIBA 3ZL4L 2X4SB 4MJID 3PXHA 1FG2A 2GUOB 3F7YB 3H7LA 2Q20A 4FQLL 3SDDA 1Y18A 1SEQL 4PB0L 1EEYB 5LAXB 2OZ4H 4H88H 1A2YB 2DYPA 3S37X 5C71A 3FT2B 2VDLH 4G7VH 5E4EC 3LQAH 4KKLD 2PYEE 5B39A 3CMOH 4TSAL 1KB5A 5JW5A 3M1BB 4X6BB 2R29L 1YDPB 3PJSB 1WT5C 5ESQA 3FQRA 3K4ZA 3QHFL 1P7QD 4NKDA 1AHWA 1M6OB 2B7DT 2PO6D 3M8OH 4JANB 4NRYA 1I1FA 1FYTD 1UWGH 5JXEC 4JPWH 3FQWA 3BUYB 1ZLSH 1PEZA 5D93C 1J12A 5DJZB 4KI5C 2CUMA 3C5ZC 3P4MB 2BHYA 1Z0MA 3S7GA 2BY1A 5SWSE 3SCMB 1U95B 1Z9SA 1R3JB 3QCVL 3VXPA 4FQHA 1JF6A 5JHLL 1KELL 3H42H 1IAIH 4U1GC 1AO7B 1UB5B 4Z7VE 4CADA 4LPWA 2VDKH 4KAQL 1CFNB 1EJOH 3WNPA 4DVBB 2X1PA 3W9EA 1JN6A 1BBDH 4W6XB 4HIIB 4XBGA 5EA0H 1T89A 5GS0L 3DTXA 2YUVA 4J12A 5FOBA 1ZS8B 4Z7UB 1VFOA 5I75B 3PGFH 1JGLH 1G1YA 1MCPL 4EBQH 4WUKL 1RJYA 1UB6B 4OT1L 1NDMA 5C07A 4GSDL 3QWQB 3IDUA 2GITB 3IXTA 1E28A 3WFEL 1NCTA 1VGEL 4OD1H 3ARYA 3OAUH 4F57H 5F7DB 5JO5B 1QSVA 3D3VA 5KN5A 4PJBB 3C87A 3GSOB 1NGXB 1WF5A 1FNHA 5D93B 4Z5RA 2OR9L 3HG1B 2JJSC 4MVBD 3HR5B 4ZTPL 4KXZH 4YUEL 5HDLA 5GIRB 4ZS6C 3OGOE 2GJ6A 4IHOB 4D8PA 1KPUA 4FZ8H 5F9WC 5TFSL 4PRID 1Y6NR 1GIGL 1TCMA 4XNXH 1RZ8B 1AD0A 4K71B 2X1XR 1TZIA 1S7QB 2QSVA 4Q2ZB 3WNKA 5C0CE 5ACZB 4PFEA 3V5KB 5FKPA 4IMKC 1AKJD 1SJXA 4MD0B 4HGMA 4KI5E 4E41B 35C8H 4ONOA 3ARRA 5IG7A 1K9TA 3U82B 1U9KA 2X05A 3V7AE 3SBWA 1MFBL 3GKWH 4PREA 3WS3A 4V1DB 1JK8B 4YXLH 4JPIB 4OZGB 4N8VA 2W0FB 1FYHB 1IEHA 1K5NB 2P24B 4NM8H 4S10A 2Q3AA 2IJ0C 3FFCE 1HHGB 1BFTA 4N0UA 4OKVB 3RL1B 1R3LB 3NIGE 4PJAB 1D9KA 2J4WH 3P11H 1HKFA 2AERT 3MMEB 1T0NA 4ORGA 1HINH 4PJHA 4K3GA 1XGTB 3EBAA 3EYOA 1PYWB 2IQAA 1GH7A 5D8JL 1QFWM 4HK0A 3CSYA 4TOYL 2GIYA 1IGTB 5C0RL 1A21A 1AHWB 1U0QA 2W0KA 5E8PB 4PLJC 5D72L 2VITB 4PLNC 5FF6B 5DJ6B 3V79C 4DGVH 1E4XL 1F8TL 4RGNE 3H6JA 2HMID 4MJ2A 3EO1B 1MWAB 1QG3A 4MA7L 3RWCB 1QZ1A 1NL0L 4G7VL 4KFZC 1PYWA 2IQAB 4DKAA 5MP6L 4LHUB 2V2TB 1YEHL 3VXMA 5EUOB 3SDCD 1CWVA 3HI1B 3LQZB 1MLBB 3A0OA 2OQJA 1TJGL 3UJTL 1XF2A 3T3MF 1CBVL 1JZ6A 4ZSOB 5E2UH 5D7JA 2UYLA 2YK1H 4KHTL 1TVBA 3QXAA 1E6JH 3LS4L 4MAYB 1F13A 2F54D 3UTTB 1ZS8A 1BJMA 1BP3B 1WWBX 1R24B 1H3GA 5IVXF 4ZO7A 2IBZY 2J8UE 2GEEA 3W0WB 2VC2L 4JB9H 3HC3L 2X89A 3UTQA 1E27A 2DQFB 4LBEB 4M9PA 2RR3A 3ZKSD 3AM8C 5DEFB 4ETQB 4PV8B 5IR1B 5F21B 1WC7A 2Y06L 4P2QA 4DCQA 1BEYH 3WSQL 3O6KL 2PO6B 3CXDL 2DOCA 3FRPA 1U36A 5HYJD 5E5RB 1V7NL 3GUTB 3SDYH 1RZ7L 5DMKB 1KPUB 1FLTX 1A14L 3QPXL 3O41A 3S37L 5HGAA 3FOMB 4OLVH 4D94A 3K46A 4IOIA 4HX1B 2DQEL 1HILB 1T80A 4CGTA 4OLXL 2DJ4A 1KEGL 3LN5B 3SE9L 1FNLA 3B2VH 2NYYC 4LK4A 3NA9H 3RJDA 4EOWL 4C83A 1A7OH 1JPSH 3T65B 2H3NA 3IDJB 2DI8A 4JM2F 3GM0A 3C6LA 3GMPA 3O41B 3TJHC 3NBNA 1FLRH 4Z7QF 4DUWA 1YPZA 3GRWL 1K5NA 1MQKH 5IIEA 4KVCL 5DLMH 3ES6B 5EU3B 1IAMA 3GMOB 5KVDL 1H8OA 2P43B 1RHFA 2YUXA 4Y8AA 3LSOA 1C16B 1AJ7H 2OMBA 3L5IA 5EDXA 4YQXH 3WLBB 1Q94A 1UEYA 3X11B 2F54A 3KDMA 1BZ9A 2O26U 4NKMB 3T4YB 4H5SB 1XCTA 2FJFB 4MJ6B 2PR4H 2BSED 4Y8DC 4N8PA 5EBWA 5MP6H 4NQSA 2GTWA 3T08A 4FTVA 4CAGA 3TN0C 1NPUA 1IKFL 3C09B 3C8HA 3L3OB 3GJFA 2X2YA 4QRPD 4KDVA 1F58L 3DMMC 3QUXB 2Y07L 1OAZH 3IU3A 4Q6IB 2NXZB 4P2RD 3F8UB 3UTPE 3SDXF 4WW2B 4EDWH 1TTUA 2NY3B 4KK9C 5CAYB 2ZOKA 2HT3D 1BD2B 2RBLA 1P4LB 3QIWC 1MELA 1U8IA 3QXTA 4DUVA 1HXYA 2GSIB 5GS3A 1VFAB 1HH9B 2I5YH 2Q7YB 3TBSB 1MLBA 5CP3H 3ULUF 2UUDH 3O11A 4RCAA 5AZ2H 2J5LB 4LRNH 1LEKB 1OAUH 2Y1VA 4L8DA 4H8WH 2OSLA 3MRJA 4WDIA 4X99B 2BNRD 1MJ8L 2C1OB 5ESAA 5ID1A 4XBGB 1DBAL 3VXUA 1RK0B 1NDGA 3CK0H 1G1CA 43C9B 1F3JB 3LRSB 4PBXA 1J8HA 5C08B 4BZ1H 3G5VB 2NZ9C 5CSBA 4L4VB 3VDAA 3UAJD 4G9FB 3M1BA 3IU4L 1C5DB 5FXCH 4G8FA 1NCCH 4YGVB 3SO5A 4WFEE 2ESVB 3AS3A 5IGXL 4KMLB 5FHBH 5C07E 1XR9A 1BAFL 3PWNB 2WLZA 3VFNA 1A7RH 2VXQL 4BFEA 3X3FL 5KSAB 3L9RA 4LDLB 4EI6B 1DLHB 2W60A 2APBA 2LU3A 1PEWA 4GXUM 3D5OF 1RUKL 3D3VE 3FO9A 2EDOA 5C0JB 2X09A 4L1DA 5HI4C 4CNIA 5D2NB 5ACMA 4S1QL 4RAUA 2C4FU 2DBLL 5CIPB 1CGYA 1TITA 4ZNEA 2GCYB 2G2RB 3GMNA 2CDGB 1X5ZA 5FB8A 5C3TA 4X6CB 3C6SB 3MOBH 3OAUL 4XVUC 4YE4H 2B1AH 2BSRA 2ZUQB 3WLWC 1K8IA 4NFBA 5CHNA 1JNHB 2C5DC 4HZLB 1ADQA 1S9WB 3SGEI 1T21A 3V6BR 1JRHH 1S7SA 4HUUB 3QUZA 2WAHA 3VMNA 4JFFA 1GZPB 2IGFH 1RUAH 3HUJE 4BKLB 4DEPB 2NTFA 2BY3A 4JPKL 3E0GA 1N6QH 4GJTB 3S4SG 5EA0L 4FQ2H 1JI2A 3EO0B 3SE8L 2IWGA 1N64H 5I9QB 1U3HB 4KK5D 5CHNB 2MQ0A 2OP4L 4QRTB 4GW4B 3WNNA 3O9WB 1BWWA 3VMOA 5J06A 5K9KA 12E8L 3L3JA 5CEYB 1PGRB 4KDTA 4F7TB 1S7XA 3REWA 3SQOH 2OXGA 1JGUH 3MGOA 1FFPA 4GRLC 3M07A 1XZ0B 2EH7H 2CGRH 4HIEA 1D5BA 5CIPH 2CUIA 3P30L 4JFXA 3H3PH 1KCLA 4UIMB 2NNAA 2VISA 3VXSD 2XA3A 3ME0A 3V4UL 4TQEL 5FYKH 1ZT7A 1MCHA 4Z78A 2ENYA 5EC1A 5B39B 4XGZB 2CLVA 5IFAH 1IEAB 2NY3D 1IT9H 1FNSL 1DP0A 3Q3GA 1RUKH 3T1FA 4F80A 3WXVH 1U8QA 4RBPH 4XTRC 2ZUVA 4HIHB 4NQVA 3RDTB 3O3AB 3TESA 3RBGA 2OZ4L 4HJ0D 1G7JA 5HI5C 4G6KL 1YQVH 1AC0A 2A6JB 1CG9B 1ZHNB 3EOAA 2IH1B 4JO1L 2ZNXA 2HVKA 4PJCB 4UT7L 4Y89A 5HPMA 2DMCA 5BV7L 5EN2A 4FFVC 2DS4A 3J7HA 1AGFA 1RUQH 5KJRL 4PJHB 4Y16C 1I7RA 3LRGA 2UVFA 1YY9D 2BNRA 1AO7A 4LL9A 3LKOA 3SGKA 2D31B 4MSWA 4HUWA 3N1MC 1I1CA 3E2HB 3BIAX 2DQFA 3MREA 3G6DH 4I3GA 3LHPH 4WO4C 1CG9A 1F5WA 1G0XA 3D69B 4XAWL 4BUGA 2XZQH 4OI8A 2A9NL 5ACLA 4YZFE 3JTSA 4FQXC 3RX8A 5SWZD 4FS0A 5HGBB 4F15C 3DTXB 2NZ9D 5DA4A 1YEJL 2HKFH 5TQ0H 1RPQA 1LO2H 3PHOB 2PW1B 3MRPB 5JOFA 5HHME 3ARBD 3MRLA 4KK6D 1T5XA 4K94L 3IAPA 3RX5A 4CDHA 1TTGA 1IFHL 4U1LA 3S96A 3LN4A 4XPHH 2HJFB 4OCYL 4ACPA 3BZ4B 3PNWA 4RISL 4NZUH 4PY7A 2LFGA 1HHIA 4RFEA 4QXUL 3MNZB 3EYUL 4X6DE 5HGBA 4FQ1H 1FGNL 3OKKA 3LKSB 4XP5H 3C5SA 3BI9X 3NZ8B 3BQUA 4XC1L 4OLUL 3D0LB 5D6CA 5ISZD 3T65A 1IL1B 4Q9RL 2Z35A 3UJJL 4K8RL 4P9HH 1FL5A 3VFUB 3Q5YA 5I30H 4GXVL 3F65A 3VXNB 1MHHB 3RKDD 3IETB 2J12B 1AGDA 1HEZA 3EUUA 4DN3L 3TA3B 5D2LA 5JHDD 5IF0B 1FHGA 3KS0J 1WBZB 3CH1B 1G6RA 1WFNA 2FEDC 4PJ5A 1WC7B 4YHKH 5ITFA 3G6AA 1Q72L 1IM9B 1JGLL 1MCPH 2P46B 3F6LA 5ILTL 4HIJB 1OM3L 1FO0L 4DKFH 3TT1L 2Y9RT 3IJSA 5CLTA 4IBLT 4C54A 1I3GL 3DECA 1H5BA 4UAOB 5H35A 5IBLC 3SN6N 1MIEH 4NT6B 3CXHK 3GSWA 2XPGA 4RIRA 5GGRB 1QBBA 1W8NA 1WICA 3LEYH 4MAUH 5D1ZA 3AXLB 3LDBB 4RAHA 3EYSH 2V17H 3ISWA 5FGCE 3FQWB 3VFRA 1R3LA 2D7OA 3C9NA 4H8WL 2DLHA 5L0QC 1YUHB 1FGNH 2XICA 4ORGB 4A6YH 1ZA6A 5DK2B 3FFCB 5CLWA 4NJ9H 3PF2A 5FUZH 1JWMA 3DJ9A 3N9GH 4YDIL 3OTTA 5B4MD 4AEEA 2VIRA 2AKRA 3FO0L 4LFHD 4ZOCA 1HCFX 5CEZL 1RIVL 4UNTA 2JK5B 5E6YA 4LSPH 2ITDB 1B2WL 2Y07H 3PWPD 3T1WA 5DHVA 4G8IA 3CFCH 3H9HA 1IC1A 1CE6A 2JELL 5BVPL 4WJ5A 2VE6A 1DFBL 4WEMB 1ZHKA 4X4YA 5IKCB 4XMLL 4KUCD 1JFQL 3G5VA 1I7RB 1FZOA 6CGTA 4HGWB 1A6VH 3HC4H 5I74B 1J87A 2G75B 2Z93B 1A02N 5IMMA 4AMKH 3P9LA 4FQXB 3G5ZB 4G6AC 4X6DF 3UTPD 1BMGA 3NA4A 3S35H 4WI7A 3DVFA 3HCVB 5DR5L 3DYMA 3QQ9C 5ID0A 1A47A 4I5BA 5H37H 2XWTB 4OQTL 5F7FA 1HI6A 3K81A 1E4KC 2HMIC 1IAIM 5D2NA 5BVPH 3DUSB 3RWHA 3OJ2C 3PGDA 3DLQR 4HHAB 5KSBF 2E8ZA 1FNGA 2I24N 3BT2H 4O2CA 1FP5A 4JKKA 4Q2ZA 4UZGA 3U0WL 1N2RA 3S98A 1ZSDB 3RI5K 2DTSA 3T3PF 3NFPA 4X7CC 4M43L 5J89A 4JDTL 1CDYA 2HJLA 2YC1B 3QIUB 3V2AR 2QR0A 4PV9A 1FIGH 2J6EH 4YC2B 5C6PB 1U6AL 1KCSH 4PLKD 2EIZB 3SGDH 3HE6A 4ENEC 1NCUA 3FONB 1NCBH 1WZKA 4HWNA 4BZYA 4J3XA 4OZHE 4HX1A 1X5FA 1DJSA 1KIQB 1S78C 2FL5B 4CVZA 5DMIH 4F58L 3IXAB 3TZVB 5FEBA 3I6GA 3TBYB 3VXRD 4TN9A 1DZBA 1RZJL 1W72B 3RAJH 5DK0A 4KZEL 3K80A 2WMPA 4JFHE 1X3DA 2C1PB 2Z9TA 2Q6WA 3QA3B 4K9EC 2VYRE 3RPIB 2AV7B 4X5XA 5IROA 4Y4HD 3V5HB 1GGYA 2ARJQ 4JRYE 1CF8H 2BNUB 4OFDA 3SKNA 2CKBA 1PG7H 3EDFA 3RGVB 2PYEB 5T3ZE 1HN1A 2I60H 5SV4A 1RK1A 1S3KH 4KU1A 3G9VA 2WBWB 4NC1C 1I7UA 4HIXH 5HVHC 5BRZA 2IALA 1AY1L 3PGCB 1F4AA 1FNEA 1EJ6A 4LLVB 3VGBA 2E9WA 4HH9B 3MV8B 3FHQA 1UVQA 3D48R 1CD8A 3FB5A 2DLIA 2NPLX 2VL5A 2XWJA 2E7LA 5JZ7C 3OXSA 4TUKH 4JG1L 5E95B 2FWOA 3OX8B 2XY2A 3THML 3O6FD 4X6DA 3ZDXE 4QCIB 2O5XL 3FRUA 5EU6A 2DDQL 5DC4B 1KJ2H 1LWRA 5FDWB 5D8JH 1MFEH 2VLKB 2C4XA 1FZMA 2R2CA 1UFUA 3NACH 3KPSD 5HVWA 3P11L 5EUKB 1ES0B 1P4BL 5LKNA 3TFKD 5INCB 4NKQB 3GK8L 5JIPA 3RIFK 1RZKL 4KMQA 3WHXA 3IKCA 1ITBB 2NY0C 4NN7B 1ZVYA 1YEDB 2YA0A 3TCLB 4YXLL 1MFDL 4PRHB 1ORSB 1OAYH 2EXYD 4RGNB 4UT9L 3ROOB 5KJRH 5KVEL 5KVMC 4JDVA 4HXAH 3VGAC 1ED3B 3MSPA 3BN9D 5SX5K 1P4BH 3RA7L 4D9LL 3SQBA 5A16A 4UT7H 1FGVL 2DIJA 1DQQB 3AREC 1BHGA 2V6HA 4OCLC 3F62A 4GAJH 5FM5M 4KJQC 1GIGH 1OTUD 1BQUA 3QHFH 4MZ2A 2Y5TA 3U36B 3FTGA 1KJ2B 4YK4B 5KG9A 4RMUA 1IQWL 5D7KD 1J0ZA 3UPAA 4MJ5B 3WV0A 3LY6A 3DXAD 3C2AL 5DRXA 4U1HB 2MSPA 4PS4L 3MREB 4WW2C 4PY8I 3S36H 5EOCH 1T83C 4QF1A 4DZBA 5DMGD 2WP3T 4POZD 1EXUB 5I71B 3OB8A 4X7TB 3JV6B 3QWRD 1MY7A 3K8MA 1B9ZA 4MNGE 1D9KC 4GXUN 2CUHA 4GRLD 1XMWA 4D8PB 2AV7A 2CR6A 5HDQH 2Z8RA 3SKMA 4RGMB 1V8HA 3JUZA 5BXFB 5I8EB 3BWAB 5GGUB 4MHHG 1BIHA 3UC0L 1BBDL 3MLSH 3OJDA 8FABA 1RZ8A 3RVTC 1MJ7L 1ZANH 2R1WA 4JQXA 1QLFB 4PY7B 4RFEB 4Z7WF 2LTQC 3KWWA 4NQED 5DFVD 4X98A 2QQKL 1TPXB 4Y5VC 1H3XA 1N26A 2AXHA 3B2VL 1FRGL 3WFZA 3D0LA 5D6CB 1JF5A 1BVZA 3WIFA 2P5EE 3PJSA 4XTRD 3P9MB 4Y4HC 4NUJA 5ANMA 1LK2B 4PJ9B 4X6BA 1KXTB 3I6KA 3MO1B 4G9FE 4ONHA 4ZFOA 3DXAE 1JNNL 1F6LL 3I75B 4U1MA 4Y4FD 5ISZA 1V3KA 1AIFA 3EDJA 4LCWE 1RUPL 4MA1B 2NY5L 3NAAL 5EC1B 4YHOL 4PJAA 3ZKQD 1IEAA 4P46A 4X4YB 4TSAH 2IG2H 1UJ3B 3X14B 3RWIA 5FM5O 4HCRL 3KS0H 1LMKA 5DVKA 4FQHB 5I1GH 1IC5L 2VLKE 4MNHA 3QUYA 3O6LH 5GZND 4XNMA 2OMNA 2DLFH 1AIFB 3WUWG 5E8OB 5DVOA 3V4PH 4WI4A 1KLGA 5CKGA 1J7VR 3MA9L 1P7HL 3DV4B 2LE9A 4PJCE 1MF2L 2DQJH 5EO1A 3MTRA 3VXMB 4JRYA 4UTAH 2BXZA 4MXQD 1CFVL 4CW1B 2AEQL 4GFTB 3TF7C 2GCYA 5F7DA 1UYWL 5J1SC 2C9AA 2DQUL 2VXTH 3ULUD 4MJIE 4NN6C 4H1LB 1E4JA 1MCRA 1I9IH 1NFDF 4XMLH 5KSBB 3EYFB 3LKPB 1K4CB 3HR5A 2AJUL 3IFLH 1V3MA 4F8QA 2QQNH 1OTSC 5J9PB 3MJGX 3HPLB 2CRMA 4L4TD 4ZUVA 3LKQB 3GZKA 1BX2B 2ZCLH 1YNLL 4R26H 4JE4B 2MCPH 1XAUA 4U1LB 3S96B 4JRXE 3BGMA 5DRXB 1RZFH 1X4YA 3QFDA 2E6QA 4MD4B 3KLHC 3QIUD 1U8HA 4I9WD 4LSUH 5TH2B 1I3UA 3SGJC 4Y16D 2BFVH 3LKNB 5KSUA 1HHHA 2B4CL 2V9TA 2PO6A 2Q7NA 2NY2B 3HPLA 2X4TB 4C4KT 1RSFA 4M61A 2A2QT 5GGQL 3RDTC 4ELKB 5C0AA 3IT8D 3WS3B 3QFDB 4V1DD 4Z95L 1MVFA 3VXRB 3S34H 3A6BH 4M62H 2NLJA 4ZUWB 3WJLC 4N0UB 1BFOB 4Q6IC 4HHAA 1XF5B 1V3LA 4WW1A 5IQ9B 4FHBD 4PLJD 1I7UB 3NABH 3RTQA 4JM2B 3H0TA 4WWID 1WAAF 5DLML 3TIEB 4LVEA 2G5BB 4AM0A 1QR4A 1GYAA 2ATKA 4E42A 3V7MA 2XZAH 3T8XB 1KLUB 4L4TE 4YHIA 1OARL 4NUJB 3BW9B 5ANMB 3T77B 4S1SH 3ZHLA 2XNAA 4DWHA 4APQC 2D0FA 4D0BA 4PJHF 1NC4B 4PGBA 4F58H 3LMJH 4WFHD 1LO3L 1S7QA 1OQXA 1EMTH 3MRFB 3MLWH 2EDDA 5DEGA 1XF3B 3GIZL 2OR9H 5IVNA 2FHBA 4HXBH 5E4EB 3U0PA 5LGHL 5SWZB 4PGJA 1L4IA 4NZUL 3UJIH 4KRPC 3GSVA 4K7PY 1X7QA 5I1DB 2QEJA 4HSQA 4JPIA 4OZGA 5B3NA 3CVIL 3GBLA 4CDGC 4URTB 3ULSB 4L5FL 3KGRA 5IBLD 5AYQA 2BNUA 1ZLWH 1JCKA 1MFCL 3QJFA 1U2HA 3FKUS 3IDGA 1TZHA 5L8KB 2H9GB 4FXGA 4MS8D 1YECH 1K3IA 2ED7A 5D1QB 3VWKC 4CL7A 2QSCH 1X7QB 2WW8A 2A9NH 4P0DA 3NIFF 4D3CH 1SBSL 4R4FL 1E27B 2RB8A 3CFBB 1CLYH 3AS2A 5D2NC 2R2HB 3A67L 5GS2H 5D1ZD 3O4OB 2R56L 4X6CE 3OXRB 3EJZD 2Z31D 4WNQB 2A1WH 2ID5A 4HULB 2FJGA 3CZFA 2H26A 3L3HB 3PP4H 1YC7A 2OSLB 2XXMB 2DWDA 3QO1B 1S9YB 2V5SA 2ZUQC 1L9MA 1TETL 1SJEA 4XBPB 5F7NC 1T22B 2DKSA 2E3VA 1R5WB 3DX7B 4R2GB 4OF6A 1RQ5A 3GSNH 4M6AA 4UIKL 1LO0H 1YEEH 5HHVL 1CD0A 1JIBA 1OGTA 1QQDB 3G6JE 1TCRB 3QYCA 5FOJA 2F53D 1VKXA 3HRZB 3IJHA 3GI9H 4OBSA 4G9FA 1MCOH 3C5ZD 4XPTL 4APQA 2EYTA 2X4QB 2YA1A 4HJJL 1YEGH 4AENA 1KEML 1NSNL 4WHDA 2IAMA 2ORBL 3PDGA 3H9YA 4CVWA 4IOIB 2FATH 2WSKA 3E8UL 1P69B 1U91B 5FGBA 3HTLX 4HDIB 4N0FB 4HMEA 3CNKA 3VRLE 2C3HA 4XZUA 1NQBA 3W82A 5KOVC 3HUJF 2Z4QB 5IIEB 2HJLB 1YY8B 2ZZUT 5LBSL 2ZUUA 1NBYA 2FBJH 2EH7L 4L9LA 4YHZH 3VE0B 4MQXD 3VG9C 3LSOB 2A77H 3BZFA 4PP2B 4OF5A 3U2SA 3QQ9D 3X11A 3EOBA 1KG0A 2DIAA 3TZVA 2NMSA 4NFDA 2HFGH 4XRCA 5GHWL 5IBUG 1A4JB 2R0LH 4GKNA 2AJVL 3SGJA 3K2UH 1J0YA 5DWUL 4G43A 1PX4A 1J0IA 2DD8H 4YHIB 5IB2A 1H8SA 4G6JL 3QT2A 3UC0H 3FT3A 3U7WL 4BKLA 5T3XL 3L7EA 5F8QC 2PYFA 5ADOH 2B4CC 5HHMB 5JW4N 5F1IB 5FUOL 1YYML 3PQYA 4X8JB 3V5DB 4R96A 5DJ8A 1D5XA 4LMQI 5F3HA 2AEPL 5LVEA 2H2PD 1MCLA 5D6DA 2VE6B 5GGSB 1ND0A 4ERSL 3JTTB 4JZJB 1DBBH 5EPMA 4XP1H 1WWAX 2X4NB 4LSRL 4UMGA 3VFMB 1IGJB 3KPQB 3VWKA 1BM3H 5JOPD 4P9HL 3TM6A 3TO4D 4K7FA 3KVQA 1N8ZB 4NQCE 1IGYA 1FBIH 3E1F1 4KKCC 1PY9A 3HC0A 4LHUD 2VITA 3AB0B 3C08L 4Z7WA 5KSVB 3QNZA 4J4PA 1C5CH 4N5UA 2AXGA 5FDWA 2A83A 3EO9H 2X10A 3M17B 1KLGB 4WV1A 2P42B 1LGVA 2V2XB 4XGZA 2JB6B 1JGEB 1HKLL 1U8MA 3MLYH 1BQSA 3GBMH 4O51A 2D7MA 3CX5K 1GGIL 2VDNH 3D2UA 3RY6C 3TNMB 4WTZA 2CK0L 4LMQE 1MWAL 3CFKB 4OZ4B 3IU3B 5CEZD 2G60H 3QUMH 4F3FB 3AU1A 1RIUH 3G08B 5C6TH 1BZ7A 2YD8A 2HRPH 5FYKU 4Z7VA 5IB4A 4MJIA 2YRZA 5ICXB 2B39A 1KIRB 1ZEAH 3BDXA 4JY5H 3BKYH 1V05A 2XWBB 2EYTB 2WBJB 4NBXB 1U8OA 2OLDA 4HEPG 5SWSA 4MQTB 1NC2D 3KAAA 1MJJA 3B3IB 3NACL 5T3XD 3LB6D 3T0EB 4P46D 2B0SH 5IP4A 4LLDB 2DQIH 2C3VB 2BXYA 1QBLL 4PJDE 4PJBA 1YMHA 3O3UN 4LPXA 4R3SA 4RNRA 3R06B 5GGVY 4OFPA 2X89D 4CU6A 4NZRH 2XN9B 1BREA 2H8PB 1X4ZA 5F1SA 5B3JF 4UAOC 3RHWF 2UVEA 1YN6B 4MWFB 5EO1B 1IAOB 1AGEB 1TTFA 2VXVL 5D71H 1HHJB 4R2GC 1P7KB 3LIZL 5ERWB 5DJAA 4ZUWA 4OCRH 3HNTL 4MD5B 4Z0XA 5CZVL 1J1OL 1BM3L 2R4SL 5IMKA 2ATPA 1MCDA 4HUXA 2BNQB 3GO1L 1U3HA 4HH8A 2PN5A 2IALB 5ESVB 4WWKC 4X7TA 2C3GA 4Y5XB 1DLHA 2W60B 3MV9B 5IMLB 4ZTOH 4OIBA 1EXUA 1UM6L 3BDBA 4OD3L 1LQSR 3B9EA 1I85C 3N85H 1YYMH 4KKAC 3LKQA 1PG7L 5I1AA 2F5BH 3REWB 2IPTL 1RVFL 1HHJA 4QOKD 5C0DA 1E4WH 4QHKJ 2AABL 3KPSB 4IOSD 2HAZA 2F53B 1TVDA 2D3VA 4NN7C 1CU4L 1OLLA 3X3GL 4DOHB 5DQDH 2YSSA 3GIVA 2ZWLT 1MCCA 1AKJA 3B6SA 4JHZA 1P4IH 4O4YL 3NA9L 2IEPA 4QHMB 1JZ7A 1ZOXA 2WNGA 3P9MA 3MRHB 4L8SB 2DM3A 2BVQB 3U4BH 3K74B 3GJFB 3P4LA 4NDMA 5EO9B 2P7TB 2WWMC 4OQ1A 5HHNA 1MRDL 4M00A 5TF1L 4OZGE 3RVVC 3SKUD 1G7QA 1JZ2A 3FT2A 4L3CA 5C09D 3RTQB 3PWJB 5D1QA 1W72H 3C6LC 4JFPB 5CEYA 4S1QH 5CJOL 2DQDL 3BMVA 3FFCA 5IJKA 3FL7A 4MSWB 1JZ3A 3OKLA 5CEXB 5C0NC 2A6DA 5E24E 3ABZA 4NP4H 3UROR 3CDGA 1I1RA 2JK5A 1F00I 4ODVH 4NKDB 4PUBL 3RP1A 4AG4L 4EN3A 5HVHB 1BD2E 3Q6FA 1WV7T 5FHBL 3VFPA 5EZIH 1FGVH 3GSXA 2YPVL 2HT3C 3BUYA 3O45A 2AJYL 1XF3A 3LS4H 4G8EB 4JKPH 4B7LA 5HYFA 2B1HH 1KIRA 4H26B 3I9GL 4N0YL 5FO7A 1HOCA 4U3XA 4G6FB 1QFPA 3U1SL 3BPCA 4YXHL 5FCSH 4YBLC 2G75A 2Z93A 4U0RB 2PTTB 4UV7H 1P2CA 1P7QB 4ORZC 3D39B 4U05A 5CP3A 5E9DE 5C0BE 1A4KB 4UQ2B 4OM0L 1VADA 1FVDA 3G6JA 5DZNA 4UV4L 4LSTH 2KBGA 3LKPA 1ZXQA 3V6ZA 3PL6D 4R3SB 2JELH 3EYFA 1IL1A 4LRNL 2CO7B 3Q1SH 2FH8A 2GT9A 3C5SB 1KV3A 2M1KA 3X13B 3L3IA 4DTGL 2A9ML 4UU9B 1SEBB 3BO8B 4QT5A 5D1XA 4R4ND 3IDYC 3VD7A 1BX2A 4NPYA 4QHNA 5HGHB 5IHUL 1EGJH 3B8SA 2OK0L 1FPTL 2F8OA 3RNKA 2J8UA 1EHAA 4RWYL 1X5AA 2DQTH 2AQ1A 5D2LB 5K9QG 2CQVA 1BQHG 5F6IC 2BVOB 2WWKT 3GGWA 1YMMA 1YEIH 3N06B 3DGGB 3HAEA 4QTHB 1OTTD 1R5WA 3DX7A 4LHJB 5D2LF 2D2OA 1RIHL 3LKNA 4KKLC 3RGVC 4JVUA 3CFJB 4DGYH 1MAMH 4LRIC 5JDSA 4U2YA 4MXVE 1C12A 5IT2L 4KI1A 4S11A 3OL2A 3EJYC 1RIUL 3HE7A 1OAKL 1XF5A 4WW1B 3I75A 1WIPA 4ALAL 4TULH 1KFAL 5DJ8B 1ERNA 5LCVH 2BVYA 5KW9L 1CE1H 1J0HA 1D5MA 2VZVA 3HG1D 3P4OB 4U1SB 2ITCB 2F54B 4LCYA 1T1WA 2ICWA 3ET9F 2AJZA 3NABL 3KPMB 4KK8C 1NEUA 3B5GA 5CJ5A 3MXWL 4I77H 4KRMB 4LLAA 4G8GD 5C0FB 4U6YA 3MJ7B 4GQ9H 4JFDB 3VFVB 4JKMA 1N8ZA 3H9SE 4PJGB 2B20A 1JV5A 3MRNA 4MDJB 5D7JC 5IBTH 4FZ8L 5GGSY 3EYQD 1NAMH 4KUZL 5DI8A 4Y16A 1FAIL 2DLGA 5HY9A 4Q9RH 1IARB 4FTVE 5F44A 1A7PL 1FVCB 1DVFD 4NNXB 4JVPA 4V2CB 4FQ1L 1BIIA 2CLVB 3ILQD 3RIAK 3MLRL 3WYRA 5HYJB 1EERB 3O8XD 5IW1B 1FO0B 5D7IF 4OCYH 3HS0B 2NTSP 3MV9D 2OCFD 3SDYL 3WFEH 1CGSH 5E8PA 4HBCL 4NNPL 5GJSL 5IMMB 4DFHA 1C8PA 3WSQH 3CH8A 1TZHB 3QUYD 2DMBA 2OI9C 1NLDH 1I1YB 3ARDA 2ADIB 5EU4A 3UBXG 1NUFA 2DI9A 1AHWC 3MBEA 4M3KB 1QNZH 3O3EB 4JPVL 3G6JF 3C6LD 5ESAB 1DCLA 2L0DA 3JVGA 2QQKH 3ARWA 3MROB 3MZTA 15C8L 2KUTA 3U7WH 1JWMB 1INEL 3BAEH 3MLZH 3SDDC 2IFGA 3S3SA 1GGCL 1DBJH 1B0WA 4OZFG 2EICA 4FQQB 5JXAL 5BZDA 1UWEH 4IIQA 1HI6B 5HYJE 4X7DC 5INCA 3GI8L 3BH8A 2CDFB 1MPAL 1EO8L 5DHYB 1RUQL 1KGCE 1WFUA 3S35L 3L3HA 1VEMA 1KSRA 2WWKO 4O2CB 1YEKL 3T2NL 1QOKA 2ZCKH 3PIQA 4OGAC 4JM2D 4NZTH 2BSSA 4RAVA 4R7NA 4L8BB 3MCG1 4HGWA 3IJHB 3FAXA 4HS8H 1U8MB 4RMVA 1ORSA 3ZSTA 3GBNL 4XP4L 3X12B 3EDDA 3VGFA 4HG4K 4Z76A 4Y7MA 1DEEA 4QRPB 1IAKB 2FO4A 1CDHA 3STBA 2VXVH 2FL5A 1P9MC 1H3PH 3HE7C 2GJ6D 1B2WH 5KAQF 5IJKC 2CO6B 1NBQA 5FO9B 2XRAL 4XZUB 1QSEA 1ZHBB 3LQAL 4TNVK 5E2WH 1EA9C 3V4UH 3TZVD 2EDKA 5JDSB 1SEQH 4X6EA 3W0WD 3FB8B 2UY6A 3N9GL 1LO0L 1YEEL 3DETD 1Z5LA 5FIEA 4PJFE