4PJAF

Structure of human mr1-5-op-ru in complex with human mait b-b10 tcr
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
235
structure length
235
Chain Sequence
b'GVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASTLGQEGQPQHFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I-related gene protei
publication title A molecular basis underpinning the T cell receptor heterogeneity of mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 57
structure length 235
sequence length 235
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjaF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjaF02
4U1SB 4HBCL 4KROC 2XNAB 3E1F1 1QFWH 1ZXQA 1E27A 2VQTA 1CXLA 2HT2C 2EIDA 1CE1L 1G9MH 2VUOA 4MQTB 4AL8L 4HIXH 4LSQL 1E4WH 1CBVH 4JQVC 1GGBL 4RFOH 1UCTA 1VACA 2H32H 4P46C 2GTWB 2NY7L 3GMLB 4DK6A 1NDGA 3TESA 3QEQD 3BYTA 1J8KA 4JCLA 2C1OA 4R0LA 4DZBA 5D6CA 4ZO8A 4RCAA 4I18A 3EUUA 4HCRL 2ZSWB 4YHLL 4NOFA 3FB5A 3I6KB 4R2GD 2NNAA 2O5ZH 4X4ZA 5JXED 5KSAC 3QEUA 1CDYA 3QDMA 4P3CL 2VDLH 4G6JL 1BZ9A 4UNTA 2VLJB 5D7LA 1Z5LB 2DQHL 3VXME 1WTLA 3BZEB 4YX2L 4OSUH 4XBEH 3OXSB 5INCA 3DBXA 1R0AH 1E6OL 4NN6B 2FHFA 3QUKA 4NZJA 2X89D 3MV8D 4NQCB 1WJ3A 1UZ8A 2QADC 2CUHA 4P2QD 1QG3A 3AS3A 2H26A 1KOAA 2BSTB 2GJ6E 4P5TA 5E2VH 4OZGF 1MRFH 1T1ZB 3RX5A 1MCDA 1AFVH 3WIIH 1GC1L 4L3AA 1SVZA 3BYYA 3T2QA 5EU5A 5FO7B 3TF7C 5F7MC 4LHUD 1GZQA 3GSWA 3RVVC 4Y1AD 4ZPVA 4GW1B 2YPLE 1T21A 3VJ6B 4QRPB 4CDHA 1KSRA 4YXHH 5SWQA 1I85A 3DX7A 3ZYZA 4I13B 4BKLB 3QEQE 5L6YL 5M7QA 1G6RL 1O0VA 4U6VH 2AEQL 3HC3H 4XTRD 4O2FB 1J8HB 4X4XA 4IRJD 2XFXA 1ACZA 1D6EA 2AK4D 3TO4B 4OZHF 3HZMA 4LKCA 1XCQA 1FG9C 3RPIA 4KC3B 2Z31B 1JHTB 2BNQA 1P5UA 4PJIE 4CGTA 2MCPL 1I1YA 3MV7B 1JWSA 4NUJB 3WIFA 2R2EA 3WS3A 3HG1D 3OAZK 2EC9T 1NCDL 3QAZC 2F5BH 4BZ2L 5I1JH 2VR4A 4NT6B 5ICZB 1MH5B 5F7FA 3HE7C 2J8UE 1OPGL 4K07A 2RHEA 2OR9L 1P1ZA 1M7IB 5T3XH 3AREB 2R1WA 4RGMC 2VITB 4QTIH 2CK0H 3NN8B 3WCYA 1MREH 5SX5H 4M8QA 4PJ8C 2CLZB 4P2QE 1UA6L 2KKQA 5HGAA 4M7JH 4ZUVB 35C8L 1S7TA 1HSAA 1CZ8L 3O4LB 4HHAB 4UUJA 5IWLA 5AAWA 4OCWL 5HYJD 3NZ8B 3IFOB 2XPGA 3AXLB 4ZSOB 2KZWA 4Y1AE 1J1PL 3TBWA 4RNRA 3BX7C 5GRYA 3GFUA 3IDIA 1N6VA 1JV5A 4UQ3B 4OJFH 2D7TH 1U92A 1G9EA 4QNPE 1LK3L 2BXYA 1RUAH 4QRTB 4XP1H 3JUZA 2DQEL 1EBAA 3IB4A 5BJTB 3H7BB 5ANME 5DFVD 4GAJH 3TO2B 4CVXA 2AK4E 3IDNB 2J6EH 4F7CA 4TSBH 1UXWA 3MODL 4J3VA 3QG7L 3WMSA 1J5OH 1BWWA 3IF1A 5I8EB 5CGYD 1WF5A 4WWKB 4CVZB 1NCAL 1XGPB 1JYXA 4D94A 1QHOA 4PJXF 4HSQA 5E8EA 5DJAB 2CRMA 1JTTA 4XCEA 3T2NH 1B4RA 4Z95L 3U0PA 1HIMH 2M26A 4PJ7E 1MAJA 1FV1B 1TZIA 2WK2A 3UTPD 3WLBA 4TPRL 4UT9H 3BH9A 4LPYA 1HKFA 2YUZA 4LSRL 3MRDA 4MWFB 2VYRE 1G7JA 2P5EA 1SMOA 4KJYA 5GGSY 4IRSD 2F5AH 3H9YA 1R5VA 2FJHA 3U36A 1U8OB 1GGIH 1QRNB 5HYJE 2D03L 4JHZA 5IJVA 3MLUH 1PQZB 3O9WA 3T0EC 5TE7H 1AD0B 5GS1B 3VD5A 4WW1A 5FYJU 4MMXC 1A6AB 2DF3A 3VCLB 5A2FA 4LLUB 4ODUA 4O9HH 4LVOC 4X99B 4XPBL 4KK8C 4YK4B 5FOJA 3NCMA 3GSNH 1A6TB 4D9LL 4JQXA 3AROA 1EEZA 2IH1A 4DKFH 1D6VH 3N1MC 3HC0A 5D7KD 1FYTE 5HHOA 4XVJL 1IT9H 3N06B 2HLAB 2GEEA 3UJTL 4NFCA 1JWMA 3UBXI 3P11H 4CMMB 5FYLE 4G80A 3THML 1GL4B 3E6HB 4C56B 3NCJL 3MLYL 1T4KA 1JHKH 3GSQA 4X7TA 5C0CD 3LS4L 2RCSL 4PBVC 5IB1B 4HZAA 4L5FL 1U36A 5CBAB 4NO5B 1Q9LB 2X4QA 4EIZC 3HUJA 3UTPE 4PYGA 5HDQH 4NNXA 1BFOA 1LWRA 3OQ3B 1IC4H 3L9RA 4KHTH 5CCKL 4ZFOA 1LNUA 4JN2A 3HZYA 4XVUC 2V5TA 5FHBL 4K7FA 1IM9D 3MOQA 1CIDA 5K93A 4FABH 4FG6D 4CL7A 4P2OD 2DYPA 5I6XB 3U0TB 5EZLA 4XHJD 3MRMA 4OCYL 5DQJB 4OZIA 3ZKQD 1JZ4A 1F58L 3S34L 3PL6B 1FJ1A 3EOAB 3EO9L 4I77L 3WFDH 5F7KC 5SX4H 3RTQA 1N0LA 1V7MH 1A2YA 3HNSH 2A38A 5IB2B 1YJDL 1T04A 1U3HC 4ELKA 4MVBD 3KPPB 4Z7WE 1YY9D 5FOBB 5AG8A 2W9DH 2C1PB 4GLRI 1D9KD 5TF1L 2XT1B 4G42B 4RISL 2NW3A 1FORH 3BPNB 5IBTH 5D7KE 3CNKA 3O8XC 1KCKA 3DSFL 1IGIL 1P9MC 1OP3K 1GGCL 4Z78A 5EC2A 3D2UB 1DN2A 1JRHL 3TPUB 5EU6A 1I8LC 4LRIA 1NGXA 3MRPB 2FZ3A 2R0LH 1JNLH 3NIFF 3EYFB 2H3NA 2C4FU 1U8HB 5DJ0B 3G5ZB 4PLKC 1NUDA 1N5YL 1ZHBA 3GIZL 3ES6B 3LH2L 4U0RB 3HZKA 5FKPB 2AQ1A 5EIIB 1C5CH 4KHXL 1PG7L 1F8TH 4F80A 3MRFB 5FCUH 2IQAB 1BX2B 1CLYL 5A3ID 1R3IL 1GIGL 4JDTL 1EJOL 4AENA 3V7MA 4Y4HD 3GRWL 4I8DA 4LP4A 4F58H 2ZPKL 5CD3A 3KLHD 4JG0H 3CFKB 3O6KL 5IFAH 4LCCA 2UZIL 3OJMB 1EXUB 2VXVH 4DVBB 1VADB 3D87B 3EJJX 1N0XH 4Z5RB 2HJLA 3V5DB 2NW2B 3GSNB 4GUPA 1AHWB 3T8XA 1EFXA 1URLA 1NGYB 1T1YB 5JQHC 5T1MA 4X5XA 4TULH 1AQKH 1Q0YH 1UCBH 5JW5A 4F37K 1DBKH 4L4TA 4NN6C 5CEYA 5J3HD 2DQTL 3BT2L 3RWDB 5BCAA 3RZCA 1CLOL 1FFPB 5IV2B 3K3QA 4G5ZL 5C0JA 3MLWL 5FM5O 5KJRL 1JF5A 1U0QA 3OZ9H 5FGCE 1PX3A 2P45B 3NOIA 4HFUH 3IU3A 3MUHL 4DCQA 3KAAA 1BGXH 2JJSC 5I1HL 1LE9B 1T1WB 2ZUQB 4Z7QF 1N8ZA 3S4SB 5M94B 1D5XA 3MRLB 5IFJB 3F7VA 3F12B 4NZUH 4Y0GA 1ZTXH 5ID0A 4JM2D 5DEZA 2AV1A 2AQ2A 4LASL 4K8RH 1AO7E 4K7PH 5BRZA 1T20A 4F7MB 1QSEA 5E5MB 4MNGA 3LRSA 4OZ4B 4OV5B 4U1IA 3LMJL 5I9QB 4EKXA 3S96B 1Y18A 5HD8C 1DBAH 1OP9A 1T83C 4I0PA 4P9MH 3KG5A 3OB0K 3BDYH 1KELH 3KPTA 1P2CB 1X4XA 4R4BA 3IJYA 5JDSB 4E41E 4JZOA 4R9HA 4ZUUB 2Z31C 4N0FA 2KBGA 4PJDE 3MNZA 4XHQA 2XRAL 5DQDH 1CGYA 3KPOA 1T5WA 3GGWB 1L7IL 3U7AA 3MRQB 2IBGA 2O5YL 2VQ1A 3GMOA 4HK0B 3RIFF 4CW1B 1JL8A 5DK0A 5GS0C 3T77A 3T3PF 1WGOA 3W9EA 1QP1A 4OCXL 3C8KB 4DFIA 2DQCL 1BFVH 1WIOA 5CSZB 3QA3A 5D70H 1R5IB 1MCOH 1NLBH 1F02I 4HIIB 1I8KB 3G9AB 1U8QB 1BVKA 3AREC 3GJEA 1WZ1H 2IALB 4YHZH 1FGVL 5I8KH 5D5ME 3ZLQC 2X4PB 4JRYE 3RAJH 4L3EB 2XN9D 5ITBL 3EDFA 3LN5B 2GW5A 2Y06L 3O2DL 1G9MC 1FFOA 1HI6A 1IGFH 4OLVH 2FR4A 1ZVHA 2XTJE 3R8QA 4I3SL 4JO4H 2HG5A 1FCGA 1KN4H 5JPNA 4ODVL 1NAMA 1QR1A 1RZJH 1TZHB 2VDPH 3GMQA 3ZHKA 5IG7B 4AMKH 3C87A 2VN4A 3GMRA 4M6NL 4Q2ZB 2DQUL 4WU5B 3ZO0A 3KPRD 1A3LH 2VDOL 3ULVH 3V0VB 4NZTL 2MHAA 1XF4A 3QPXL 4JAMA 3GMMA 4Y2OA 1IILE 3QI9A 1HHIB 4LCUA 4XNZB 2OTPA 5HPMB 3X11A 4XPGL 1YPZA 5HHNB 3LKOB 1LGVA 4XCFH 3KLDA 1XIWD 4Q6IB 3O41A 3CFDB 1AP2B 5SWZB 2NXYD 3MRIA 4RA0C 5TFSH 4WWKC 1ZLUH 1CGWA 1YEHH 2WIIB 1KF9B 4XZUA 1I3RA 3BISA 5ALCH 4PUBL 1FBIL 4BQ9A 2PO6B 3HMWL 2ID5A 3ARGA 4IMLA 1U6AH 4Z77B 2EEDA 4FQLL 2GYSA 3BP6B 4PJBE 1KULA 3MC0A 3PDDA 1ZHKB 1MHEB 2ITDA 4WEBH 3D18A 4ZFFB 1XF1A 3BKML 4HDIB 4ONOA 2G9HB 3REVA 3RIAF 2FCBA 3NCBB 2XN9E 3QIUA 3TNMB 1U9KA 2VSDA 1QO3A 3T0BA 4LARL 2YD7A 3G5YB 5TDNB 5EU3B 4ODSH 2UY7A 1QFUL 4G8IA 4YQXL 1Z6JT 3FO2B 4POYA 4NJ9L 3BKCL 1IZJA 2KQNA 5GS1C 5L8LB 2OK0L 3CXDH 2UZYB 4Z7OE 1MI5A 3QWOA 2V7HA 3ZDXF 1BZ7B 2JIXB 4TTDD 1T89A 4YK4C 1JNNH 1NDGB 4PRPB 4XCCH 1B0GA 2FSEA 2Z92A 3S7GA 2C1OB 1FZKB 5D6CB 3QDJD 4FXLA 4Y4KA 5HPOA 2XWTB 4ERSH 2DQIL 4YUEH 4I18B 5FUZL 4FQHA 4XNUL 5DHYA 1KPVA 3FB5B 1G9NH 3PQYA 4Y2DB 3EIFA 4AT6A 3NFPB 2BHUA 5CEZD 4FNLL 3QDMB 1BZ9B 2ADGA 2DB8A 4HKJB 4TVPL 2FATL 1A7PH 2E7LA 5INCB 4KTEL 2DICA 3UTTA 4XB8A 5FB8B 3VXRB 4ONFL 3QUKB 3NACL 3NPSB 2E9WA 3CJJA 3AAZA 4UDTA 3UO1L 3CXHJ 3R1GH 3VD7A 1UZ8B 3DRTA 5DWUL 1L0XA 2H26B 4ALAH 1CF8H 3VRLF 3C6LA 3MMEA 4L4VE 4OKVA 2BHYA 1ZS8A 4M02A 2AGJH 5FDYA 5I6XC 1D5MA 3HMXA 1R24B 4BZ1H 5ISZA 2HYMA 3FB6A 1GZQB 1S3KL 3CUPB 4WO4C 3PL6C 2WUCH 4HIEA 2DQDH 4YHPA 1T21B 4HS6B 1RHHB 4MD0A 2Z4QA 1JI1A 4UMGA 1NMAL 5SWQB 5KVFL 5FO9B 1JPFB 1EPFA 2C4XA 3O3UN 3DX7B 1V05A 1YNKL 5BMFL 4M7LT 1UACL 3QRFM 4PY8I 2P4AB 3BPNC 4X4XB 4HT1L 3SBWC 2CXGA 1A7NL 4JRXE 4LKCB 1XCQB 3RPIB 4R3SA 3MACL 2DI7A 4HLJA 4S1SH 1KACB 3MLPA 1H3PH 4UB0L 1YN7B 2BNQB 5IKCB 1I1YB 2EZ0D 1JWSB 5FGBC 3W11C 4P0DA 2R2EB 3VGBA 5CEZE 1EBPA 3V0WL 5DJ6B 5E6ID 4CMHB 4FTVA 5C0IA 3CLFH 1TTUA 3V6OA 4NO0D 4OB5H 5C07D 3ARRA 1BLNA 3WDJA 5HYEA 3NCCB 3QXUA 4MB4A 3VG9B 5EOTB 1A14H 3QUML 2X4SA 3L95B 5E00A 3SDXF 1MFAL 1EDQA 3QH3A 4KGJA 5I1KL 4O4YH 2VXQH 1KEGL 4WNQB 2R1WB 4KV5E 1GPOH 1AI1H 3RFZC 5DYOB 1QRKA 2X4TA 3IT8D 5SV3A 3QR2A 4GO6B 3D5OF 4MQXD 2XZCL 3U7YL 2EDDA 4XP9L 1Z0NA 3QIBD 1Q9OB 3OMZA 1S7TB 4H25B 1HSAB 3NIGF 1HINL 4UUJB 5FXCH 2QHRH 1TVBB 3RVUC 1QSVA 2X1WL 2XPGB 2DL2A 5EBWA 2BCKA 1AHWC 3TBWB 4RNRB 4HZLA 1HH6A 1CU4H 1S7WA 2DTMH 4YPGB 3IDIB 2HJFB 3QWQB 5EZIL 1A6VL 1JRHI 2VSCA 4YIQA 3TVMA 4PJCF 1JHLH 1FLRH 3QQ3B 4P23C 2Y36H 5EUOE 2WBJB 2X42A 4JQIH 5CJOH 1YY8A 5L2JB 2K7PA 4MS8D 1FPTH 5FA3A 3B8YA 1UM6L 1AY1L 5BS0D 1QKZL 4JM2F 2ZUQC 2ICEB 3D3VA 3VA6A 3P77B 4W68A 4HEME 1T0PB 1PVHA 4P9HL 4XC3H 3C5ZA 3M8OL 1LD9B 3MJ6A 5C07E 1WAAA 4YWGH 3U0PB 5FYJH 2GSGA 1OARL 2CRIA 1TTFA 1CICB 1KNOA 1T2QH 3TCXA 5GGTL 5A2JH 5I9QC 2A77H 4RGOH 2NR6D 3VW3L 3WLBB 5L9DH 1CDUA 3VRJB 3F7QA 4M62L 4WIQA 1ZSDA 2QQNH 4HV8A 3MRDB 4OLWL 3LCYA 5DRWA 5GRJH 5ICYA 1G7JB 1C5BH 2P5EB 4M1GL 5E2WH 1R3JA 4PJGE 5INDA 4DAGL 1DLFL 1GHFH 1WZMA 1A1OA 3WLWC 3QEGL 2ADFL 2XOTA 4KI5E 4KTDL 5IB3B 5HGGS 4QRSB 5IJVB 1UJTA 3B9KA 3G08A 3VXOA 4FA8A 3O9WB 4D8PA 1IEBB 2ZZUT 4JVPA 5TDPA 4NKQB 4NZRL 4WW1B 1N64H 4NQUA 5D2NE 2VC2L 4M7LL 4XX1E 3QHTC 3G6AA 2FWOB 3BWAA 5JIKA 4KZDL 5ILTL 2EE3A 1L7TL 2BNUB 1EEZB 4KROD 4XP5H 5D93B 3B2UC 3WFHB 3H42L 5D7JA 2C9AA 2HT2D 3FFCE 1JWMB 2P5WB 4UIKH 2QQLL 4OLXH 3GM0A 4G80B 3QUZB 1TIUA 1PDKA 3RWGB 4P46D 3VXMA 4CUCA 1KN2L 1TETL 3J7HA 3ZDZF 3MCLL 1UGNA 1T4KB 1FN4A 3GSQB 4X7TB 4RX4D 4AEFA 4N8PA 3MXVL 1LE5A 2FBOJ 2XG5A 5CHNB 1QUNA 5KZCD 5HSFA 4ODXA 5DHVA 3SKJH 2X4QB 2EC8A 4FZ8L 4B50A 5DEFA 5I19L 5KSAD 5F3HA 1PYWA 2GJ6A 4LLWA 4NNXB 4XNZC 4LCWE 1PEZA 1LDPL 2FX8L 3L9RB 4P49A 5DK2B 2HP4A 1OF2B 3QCTH 1LNUB 3SKNA 1L4IA 5ALBH 4K7FB 1F6FB 1NGZA 1ZVSA 4KMTL 3MCG1 4Q6IC 1NAKL 1CWVA 4JFFB 2FIRT 4JEGB 5TH2A 2IBZY 1N6UA 2DYPB 2L7UA 2AW2A 5EZLB 1VB9A 4HWUA 5K59F 4OZIB 3TYFB 4AEIL 2IJ0C 3W2DL 4QKXB 2PO6C 3S9DB 3GMNA 1INEL 3KLSA 5C71A 1KLUA 2QADD 3UTQA 3O3BA 4APQD 3QEQA 1FNSL 4LVHB 2C26A 4HUUA 1FAKT 1RK1A 1T04B 4ZOBA 2W0PA 3E8UH 4FQJH 5CZVL 4YDKH 4LAQH 4MDJA 3P9MB 4I0CC 4JFHD 3RNQB 1KTKE 3RVVD 1WICA 3RWIA 4PJIA 1OGTB 1JUFA 1J05B 5JXEA 3BO8A 4Q0XL 3B5HA 3PGCA 5AWNL 1NQBA 4K8RC 3WD5L 3QCVH 5EC2B 4X7SL 1QLRA 3CZJA 4P99A 4KZEL 5EU6B 2VE6A 3OAUH 3W5NA 2H3NB 1W0WA 5LQBH 2X1OA 3WFBH 2DKUA 3LB6C 3HZKB 1NH6A 2X89A 2BNRD 2UYLA 5T3ZH 2XXCB 3B5GA 2DMBA 1GOGA 3P0VH 3S35H 1NAMH 4P2QA 3T0WA 3U4BH 1JPST 3MCKA 1FDLH 2P24B 2GCYA 3DJ9A 3FO0H 3AUVA 4F57L 5E2UH 4NC1C 4I18C 4URTB 2DQGL 5CD3B 4NCC1 2XKSA 5C1MB 3HE7D 3NFNB 4LHUA 4Y2DC 4LCCB 4M6AA 4Y1AA 1EMTL 3V9FA 3HNVH 1HQ4A 2R69L 2NX5D 4J3UA 5C0EA 2RFXA 3ROOA 5E8OA 1MCSA 2HJLB 3KPMA 4ELMF 2AXGA 3MROA 2WP3T 4PJ8D 3HTLX 3ARQA 4X5XB 2CDGA 1YECL 2UV3A 1MAML 5JW5B 4L4TB 32C2A 4PG2A 3EFDL 4C55A 3NPSC 4IRJA 5ANMA 1BAFL 3O81A 4G6KL 2YMXL 3RZCB 2AK4A 4JY4B 5C0JB 4JFHE 2FDBP 2H2PC 4HH8A 4A2LA 2A6IB 5GS3A 3F8UB 3IU3B 3PWUA 3ETBF 2ITCB 1ZANH 4LLQA 4QYOB 4DCQB 2Y25A 2JLLA 4OCNC 1BVLA 2ICCA 1JNHA 2A73B 2V2XB 3U6RB 2ZOLB 1L9MA 4YFDB 5DEGB 2NY1C 2LE9A 3LQAH 1N4XL 3F7VB 3R06B 3C9NA 4GAYA 4PJ7A 5ID0B 3IXTB 1EO8H 3DUHA 2GT9A 4DFHA 3VD3A 5CZXC 5BRZB 3MOBL 4YHYB 5C0RH 1N2RA 4W6YB 3LRSB 1DBML 3QUYB 4U1IB 2BNRE 1VKXB 3VGAB 5JHDE 4MDIA 4R7DB 3GO1H 4JZOB 4M48H 2ENSA 2CKBL 2FEEL 3IFLH 4H5SA 3RUGE 2XQBH 4N0FB 5IW6A 3MNZB 5C3LD 1SJVA 3O2WH 5HYJA 1OGAD 3KPOB 3RQ3A 5CAYB 1OCWL 3WO3B 2MTPA 2CPCA 3CDGA 3G6JE 4CMHC 4P59L 1H8SA 4KQ3H 4PYHA 3T77B 2A1WL 3PHQA 5J9PB 5FM5M 5IR1B 4GRWF 4DGVH 2OMNA 3VG9C 5DMGD 4P57A 1QFHA 5E9DE 3QA3B 1S5IH 4WW2F 1BVKB 1FYTA 3GJEB 4G7YL 2W0LA 1Q38A 2QQKH 4PJHE 1MJ7H 1P4BL 1KCRH 1RZ7H 1N7MH 1I7RA 5DA4A 4XB7A 3RJDA 3T0ED 5DS8A 4R4FH 1FFOB 1HI6B 4X6DE 1A5FH 2P8MA 5DA0B 1FHGA 4XXDA 3Q6GH 1S8DB 3DGCR 5D8JL 5EDXA 4FQIL 2E7HA 4KK8D 1BQLL 1MIEH 3ARXA 5JPNB 1NAMB 5HVFB 1MCBA 3GMQB 3B8SA 2HVJA 1RIHH 2GQHA 3GMRB 4NO2B 4JPIB 1N3NA 1LEIA 1RQ5A 1NCBH 5BVPL 3KLAB 4TQEL 1XF4B 4JAMB 3GMMB 1G9NC 3FB7A 2WBJC 5FGRA 3C5SA 1LP9E 1TQCC 1KCSL 3QI9B 4G6MH 4MNQB 4LCUB 1OSZA 4JFZL 4IRSA 3O45A 3HZVA 2FYYA 3S5LB 1YPZB 1X5YA 1NFDB 4PS4L 1AXTL 1K6QL 4XMPH 2YA0A 3SE9L 1J18A 3MRBA 4YO0A 4OFKA 2APBA 4M03A 4X4ME 2J4WL 2O61B 1OGAE 2G75A 4XZUB 3F6IA 3UTSE 1B4JL 4U1HB 5JUEH 5SWSD 2FX7L 2YZ8A 3WE6A 2RJMA 3N1PC 4B41A 4Z7WA 3ARGB 1JP5A 4IMLB 3WN5B 4PY8J 5AYUH 4BQ6A 1CICC 1RUMH 4XVUD 3QXAA 1FYHB 2IANE 2ITDB 3D18B 1RMFL 2E27H 3FRPA 4AZ8A 4PGEB 3FCTA 3REVB 1FVCA 1KJMB 4LSPH 4NIKB 1KFAL 2E9BA 4UINL 1T0MA 3T0EE 3KHOA 3VXUD 5ETUA 1QO3B 3REWB 1RURL 5C0CA 3QDGD 4YXLL 5IB5A 3SE3C 1U3HD 2EDEA 1VA9A 3WXVH 4QOKD 5B8CA 3JVGC 5D4QA 3O9WC 1MEXL 4F2MB 5HDBF 5LWYH 3ULUH 3O8XD 4ODWA 5FA4A 2XZQL 2IPTL 4JB9L 3RL2B 1LMKA 5EFIB 4LK4A 1B0GB 1DQMH 1L0YA 5D93C 5DDHA 5EWIL 2FJGA 2VXUH 4KDWA 1UT9A 3SY0A 4P2OA 4PLKD 4DQOL 4FQHB 4G8FB 3H3KA 4KPHH 3I9GL 1CVSC 1KPVB 3PQYB 3QUZC 4U6TA 2NY5H 2R4RL 1I9EA 1T7YA 3X3GL 4RFNB 2ATPA 4X5WA 2AERT 5ERWB 1ZA6A 2ADGB 5IIEA 5SWSE 2AP2A 4U6XA 2R9HC 3DUSA 3O6MH 4PB9H 1D9KA 1LO2H 3UTTB 4K3DL 5J6GB 1BQUA 1I9RL 1UYWL 4PJFF 4X80H 4BK4A 4XNXH 3AAZB 4UDTB 4KJPC 1KJ3L 2Z8RA 5IESL 3FT4A 2VLJD 1XGYH 3C6LB 4OKVB 4WUKL 5KOVC 1AGBB 3P4NB 3S97C 3OKNA 1KPUA 1RZIB 4PB0L 3VFNA 1JFQL 1AO7A 5C0FA 4HIEB 3HAEA 3SGJA 1CK0L 2F19H 4NQCD 5A40E 4MD0B 5E99H 3CVIH 5JXAL 4R8WL 4OCSL 1MHPH 4LVHC 1UADC 3NFSL 2X4NA 2WP3O 4ZD3L 4Y4HA 1FIGH 4E41A 3GBNH 4PRDB 2OL3A 5DR5L 1FFNA 3V7AG 4PJDA 1CDIA 1U41A 4K3JL 3LN4B 3DYMA 3T08A 1QBMH 4WHYH 3CX5J 3OPZH 4YHOH 2F53B 3X13B 4LRNH 4QRPD 5I17A 5EPMA 5FGSA 2AXFA 3B4NA 3V5HB 1BJMA 2J2ZA 2Y6SC 4Y5XA 4E0RA 5HD8D 1OAXH 2Y4SA 5GGRA 2OM5A 4GXUM 5C0IB 5IMOB 4NNPH 1J8HD 1BLNB 5KAQG 4PRHB 3VFWA 2DLHA 1C7TA 3DUUA 2XI9A 4XBPB 1KPRB 2EEBA 2X4SB 2Z31D 1UZ6F 5D5MA 3H2WA 1H5BA 2OQJA 4JRYA 3QH3B 4BJLA 2CMRL 4QXGL 2Z8VC 3MV7D 4FZEH 3E0GA 1UJ3A 1T66C 3QHZL 1JGDA 2A9NH 2X4TB 3BRDA 3TN0B 5GS0D 3AMLA 2P43B 3V6FB 2YEZA 5F7DA 3IETA 3QIWA 2AK1H 2J1KA 3IYLW 4LCCC 5IMMA 3KXFE 3LZFH 4HEPG 3GMPA 4JM2A 1JF6A 5EBWB 3ARED 2Y7QA 1A1NA 1AGEA 1BBDL 1IQDB 2PTTB 1T03L 4AG4L 1HH6B 4NQCE 1S7WB 3TVMB 4R26H 1H3WM 2YPKA 2AKRA 1RVFH 4HLZH 4KI1A 3O4LD 4HK3N 3RZCC 1YUHA 2XG4A 2HA1A 4WJ5A 2VZVA 1DN0B 1X5HA 4ZDHB 3FQWB 5FA3B 5E7FA 2G2RB 4QRPE 5FUCC 1KENL 4J23A 4OTXH 2IG2H 5ENWB 4MNHA 5C0GB 3MGOB 2B7DT 4PJBA 4WEMB 2JK5B 4JPVH 2WWMC 4Q9QH 4YGVA 1J86A 2I5YH 2GSGB 3DTXA 2E8YA 4YHYC 1MCLA 4HGKC 4DGIL 3QUYC 3LSOA 2P8LB 4MX7A 4AM0A 3EYVA 3EKCA 3F58L 3VGAC 3BP5B 1BOYA 2X9YA 2XN9A 1DLHB 2ZKHL 2MQ3A 4WWKD 1UM5L 1YEDB 1ZSDB 4JANA 4HUXA 5HGBA 4WHCA 5ICYB 3UZQA 1JYVA 1R3JB 3VFUB 4TVPE 1U2HA 5INDB 1EGJL 1HH9A 1TENA 5B3JE 5ADPL 1A1OB 5C6TL 4A6YL 5F3BA 4G43A 4M43H 1RU9H 2W92A 3G08B 1DQLL 4D8PB 3KPRA 3KPLA 3WKNA 2IQ9H 3X14A 1KIQA 1I3GL 5TDPB 1HOCA 4QEGA 3D9AL 2QTEA 1RZKL 4KXZI 2BVOA 1VEPA 3RDTB 3G6AB 5AZ2L 3BWAB 5MENB 3O4LE 1ZT7A 1WT5C 3OJDB 2YRPA 4PRIB 3VGFA 2Q20A 1IGMH 1DUZA 2VAAB 1QRND 4TYUA 3NZHL 2HT4C 1E4KC 2EKJA 5TE4L 1OSPL 3T0XA 5JORA 4MZ2A 4HQQL 1B6UA 3UBXA 4RFEB 2KDGA 1BVZA 3VXMB 1EERB 1MJUH 2A6KA 2EECA 2FEEI 3TT3H 43C9A 3LQMA 1LE5B 1NBZB 4RRPA 4U1LA 4IMKA 1X6NA 4HMCA 4UTBH 3BJLA 3MREA 1DR9A 4OD3L 3BE1L 4ODXB 3O3EA 5F44A 4YDVB 1INQA 4HUWA 2PW1B 5LXGL 5HI5C 4RDQG 5DI8B 5F3HB 1PYWB 4BSWA 4C56D 3QI9C 4L4VA 4G9DB 4M93B 3VGDA 3CH8A 3NABH 3SKNB 1IC5H 1SYSA 1KIRA 5F7EL 2VRAA 3DECA 2ZSVA 3VFTA 4JPWL 5TH2B 4IRZH 3W5MA 3L5XL 4JFPA 1YEEH 4K3EH 2YPLB 1F2QA 4NDMA 3MLXL 4PJAF 4M1CC 4XCNA 4HGWA 4GG6E 3ARGC 1WEJL 3WN5C 1HEZA 1BFSA 1KLUB 3O3BB 2C3VA 1JGLL 3O0RL 4CAGA 4MDJB 1Q9KA 4LLAA 4JRXA 1A7RH 1LO0H 3OXRB 5HHQA 5DD0L 2X9WA 2CJUH 2QR0B 1SYVA 4WO4D 3PL6D 3RWIB 4PJIB 4NRXA 4KDVA 4S1QL 5IM7B 4NFBA 3FN0H 4NP4H 4JHWH 4RWHA 1RIVH 5EIVA 5HYSA 2R2BA 5FYKL 2VLKB 1B9ZA 1QLRB 5TDOB 3P4MB 4W4OC 5EUKA 5KS9F 5FYLH 5J11B 2J8UB 4HS3A 1JTPA 1VGEL 1W0WB 3LKPB 4R96A 4H8WL 4Y5YB 1FO0A 4APQC 1YN6A 2R23A 4DKDC 4HUVB 6FABL 4F9PC 5D1QA 5H2BA 4DKEL 5A2KH 1LEGB 1NC2B 2UYLB 1T89C 5HHPB 3D2UD 1RFDH 4P2QB 3BKYL 4DVRH 3A6BH 3HRZB 2WINB 3MCKB 3W11D 4EDWL 5J06A 2GCYB 1FL6B 4NQXA 1VESA 4QHMA 5AG9A 5IEHB 2BOBA 3AFLA 2B4CH 4F7TA 2EDOA 4JR9H 4YPJA 7FABL 1GGUA 1A8JH 4LHUB 2HJKA 3BMWA 2H41A 3LKSB 3LEVL 5MHSD 1HQ4B 1XZ0B 2E9JA 2D31B 1U8NB 4RFNC 2B0SL 2RFXB 2DQJL 4DTGH 3EYUH 1S9VB 3T1FA 3MNVA 1RV6X 3MYJB 5DD1L 4IS6A 1CR9L 3PXHA 2YSSB 4GH7B 2CDGB 2V9RA 3RU8H 1J1XH 5C2UB 1KTDA 1LK2B 1CI5A 5D7IB 1JPGB 5CP7A 1K4CA 2AK4B 3PWJA 3RVUD 2F74A 3GK8L 3GNML 4F37F 1YEKH 3KYMA 3U0WL 4JJ5B 4M6ML 1ITCA 5DZNA 1AXSB 1RUQL 3C6LC 4QT5A 3PWUB 4M5ZH 5ELIA 3JV6A 5EORH 2FRGP 2B1AL 1ZEAH 5DMIL 1UG9A 12E8L 1JNHB 1G7HB 4XNQB 1E4XL 1MJJA 1NCCL 1OAUH 4FFVC 4NO0A 4P23D 1MLBB 5C07A 3VG0L 4R90H 5KTEL 3C9NB 4GAYB 4Q7DA 3CK0L 3MO1B 5F1NB 4QRUA 3V4PL 3DROA 1UB5A 3G04A 1YNTA 1C8PA 4DK3A 2BRRH 5I1DA 3QEHA 3DYOA 5D1ZB 4HBQA 3BQUA 5DVMA 3T09A 4HKXA 3BXNA 4U1MB 2JB5L 4U1JB 4MDIB 3O3AA 4D0DA 5D2LF 2BRQA 2WNGA 4ZYKA 5DUBB 3U1SL 1F4WL 1CL7L 1KJ2L 1BD2B 4UTAH 5E0QA 2DD8H 1ETZA 5GSVA 1AE6H 1MFDL 4YHKL 1EJ6A 3ESUF 3B6SA 1ZAGA 3RI5K 4LPTA 1HQRA 1Z0MA 5D2NA 1X9QA 3W9DB 3HI5H 3SDDB 3EYOA 3F7RA 1ZLVK 5E8PA 4NPYA 3WFEL 5I1GL 4RGNE 4P57B 3WEXA 2VXTH 1NEZB 4MQSB 3TA3B 1RD6A 3RX8A 1QBLH 1FYTB 3WLWD 1T7WA 3V2AR 3OGCB 2R0WH 3CFIC 1FGNL 4E42A 2NCMA 3FFCA 5IBUG 2ZG1A 5EOQH 3MLVL 3CSBA 1KCVL 2XZAL 5DF0A 4S1RL 3TN0C 5DS8B 2GKIA 3QFJE 4X6BB 3HI1A 4QHNA 2UWEF 4XC1L 1FVDB 2AJVH 2CLVA 4NCDA 2YD5A 4XBGB 2VH5H 2H8PA 1U95A 2P42B 1GRWA 2GUOB 1QHPA 3VXPA 4Z7UB 2J3SA 3B2UD 2HVJB 4ZFGH 4L3ED 3DVGA 3WJJC 1N3NB 1EVUA 4E5XA 1DEEB 5FF6A 3DIFA 2YXMA 2SEBA 1MIMH 3TV3H 2B1HL 3FB7B 2NY5C 3HAEH 3A0OA 4MJ2A 2YD9A 3S88H 2GSIA 4LEXH 3HZVB 3SO5A 4LCYA 1CBVL 5EZJB 3QPQC 5AD0B 1S7SA 2X09A 4JZNA 2QSCL 4NHCH 5J6HA 1H0DA 3VI4F 2G75B 2OL3H 3GJFA 5E03A 4U1KA 3ZL4L 1OAYH 1XT5A 3ARBB 1IAII 2DLGA 2FD6L 3PDOA 4AEHH 4Z7WB 1DVFA 3EJZC 4QTHA 3IDXH 2AJZA 3KNBA 4JGMA 5F97E 2O5XH 3TBYA 2X4OA 2VABA 5KSUA 4UV7L 1ONQB 5I0DA 5SWZD 4DGYH 1Z3GL 1KCLA 3LPGA 2R39A 5F9AC 1HNGA 3ORJA 3ESVF 3C2AH 4JQVA 1FVCB 3OKLA 5EIQA 3H3PL 2P47B 4EBQH 2PO6D 5E6ZA 1T0MB 2EC9U 4P46A 4V1DD 5IT2L 5ETUB 4OSUL 3CPLB 3CLEH 2IBZX 4RX4A 2NTFA 5IB5B 3OF6D 5BOPA 3TIEB 4F33B 1T7XA 4LLDA 4DN4H 5B8CB 1FZMB 4XMKH 3MUJA 1U8KA 1AKJB 4N8VB 5I8CA 3WYRA 4L3EE 2GHWB 4POUB 4PRNB 5KSAA 2V17H 3K8LA 3RDTC 3L7EB 4ODWB 3IKCB 2BDNH 4XVSH 1SBSL 3FJTA 4K8RD 4PGDA 1P4IL 2IH3A 1PW3A 2BK8A 1MPAH 5CILL 2HFEA 5DDHB 5EULV 2FJGB 1ZA3A 1PKOA 1G0DA 2LU3A 3SY0B 5IGXH 4GT7A 3K81A 1A6ZB 1I1FB 1YYLL 5T1DL 5JPMB 3LB6D 2RGSA 1HYRC 4S1DC 1R3HA 2DM4A 2JIXD 1MRDH 2V2WA 5TE6H 3ILPA 4PRPD 4APQA 4X5WB 3HC3L 1F3RB 3F7YB 5F6IB 1IQWH 4U6XB 1FNEB 3GKWL 3C6SB 2LFGA 3HI6L 5CJ5A 1BHGA 3DUSB 4YDIH 3RY5A 3VFVA 4X83A 1HXMB 4Y2DD 4K9EH 2GJJA 5EU4B 5FGCB 1IEHA 5LVEA 4KQ4L 4KJWC 3OG6B 4OI9A 2ORBH 3GI8H 5KVDL 2ADJB 4M93C 4I2XB 1S5HB 4QLRA 1OAZL 3FT4B 3V52H 3HA0A 3MFGB 3I75B 4V1DE 1AD9A 2KUTA 4J3XA 2Z8WC 3IFNL 3QCUL 1WCQA 3FT3A 3VXRD 3A67L 3WFCL 1FZJA 2WBKA 3VFNB 1AO7B 4HF5H 5C0FB 2CK0L 3HAEB 5ADOH 1RAMA 1MREL 2BNRA 2XQYK 4BH7B 5F1IA 5CWSA 5DRZA 3WNNA 1FSKC 2H2PD 2YC1A 3GEWB 4OIAA 5GRUH 2EYTA 4NWTH 1B90A 3D85B 4Y4HB 4E41B 3R0NA 2OL3B 3RUGA 2CH8A 3MRKB 4PJDB 2NY1D 1JF1A 3QHFH 3HE7A 1WZKA 3C60A 3GM8A 3MUY1 3ZMRA 1CXEA 3DX8A 4LEOA 4PTUA 2GK0A 2NX5A 3KPNA 5CZXD 5EPMB 3G6JA 4WHTA 3SCMB 1DZBA 2AXFB 3LS5H 5A43C 5BW7C 4Y5XB 1IKFH 3F7PC 3FHAA 4M3KB 1IGTA 4E0RB 2P48B 4G3YH 4PJ8A 4FQ1H 4GQPH 5FEBA 5C2BL 4Y5YC 3QNZB 3VFWB 3P9LA 1YQVL 3DUUB 4NC1E 4LL9A 3SQOH 2E9IA 2ICWI 4PJHA 1TZGH 2OQJB 4JRYB 1J5OL 4ZPTB 4XPFL 1DSFH 5F88A 3S4SG 4X6DA 2ZG2A 1OM3L 4X6CE 4H0GA 5B38A 2XTJB 4JKLA 2YEZB 1YEFL 4JO2L 1HIML 3QIWB 3VXSB 5IMMB 3O6LH 3VXRE 2JB6A 3S3JA 2V5SA 2EEAA 2YD4A 3GMPB 5E2TH 3SGDH 5FIEA 1I9JL 1A1NB 2Q86A 1W72H 4WDIA 3PWVB 4C83B 2VDKH 3ARWA 2BJMH 1I9IL 2OP4L 5I15L 5KSBE 1LP9A 2AKRB 3B3IA 4KKNA 5FECA 4LQFH 4MJIB 3QJFA 1K5NA 4HXBH 4HG4K 1YNLH 5KANI 1YUHB 4WY7L 4OFYD 2BY2A 4X4MA 1OGAA 2LAGB 3I3DA 2W38A 2DM3A 3DXAD 3P40A 1NBVL 4GXVH 4GKSA 3QYCA 3UTSA 1BBJB 1YA5A 1HHJB 4GLRH 1KLGA 4MNHB 3GRWA 4NN7B 2WBJD 3ARPA 2CIKA 3FQNA 4TNVK 1KYOK 1DL7L 2IANA 5HDOA 3OG4B 1MWAA 4H0IA 3DTXB 4NQEB 4P2CG 3GSOA 1PG7W 5CJQH 1BOGA 3EYVB 1JN6B 1C08B 3WUZA 1F6AA 5D1ZC 2R0ZH 5L7XL 3T0EA 3GHBH 1FO0H 3QB7C 3ULSA 1PZ5B 5HGBB 3V79C 3ZE1E 4U2ZA 1YZZA 1HH9B 1OAKH 1CICD 1A7QH 1J0ZA 1CD1A 2W0FB 3QNYA 3CMOL 3ARDB 4JPKH 3N85H 5CLWA 2O93L 5KN5A 4G43B 5HDQL 4OD1L 3SDDC 1IKNC 4MCYA 3KPLB 1TNNA 1KIQB 1UM4L 1TJIH 1VFBA 2Z91A 1E4XI 1CXIA 1HOCB 1YYML 5LGHH 3RP1A 4ISVA 1SEQL 2P5ED 3MJ7A 4TUKL 4LDEB 2BVOB 3TA3C 1KTLB 1CGTA 1IAKA 4YDLB 2X1XR 1Q72H 4I48B 4OF3A 1QLEH 4N0RA 1DUZB 4QXUH 3LKQA 5DRXA 4NWUH 4HUMB 3KPQB 5D1XA 4TTGA 3O9WD 5DJ2B 4OLZL 3RWHA 2HFGH 3DXAE 4HBCH 2NXYB 2FBJL 4L1HA 2GI7A 4QCIA 5SWSA 1CE1H 4AL8H 4LSQH 4UV4L 3ZE0F 3WO4B 1FNGB 43C9B 1CL7I 2R56L 4EQ2A 4KUZH 2NY7H 4HPOL 1WISA 4NOBA 4OF0A 4X98B 3RWCB 4M7ZB 1UC6A 1RI8A 1T6VN 1INQB 4UIMA 2P5WD 3PP3H 2J5LB 3MRJA 3QUZD 1N6QL 1X5AA 4NJAH 5ABDE 4BSWB 1I75A 5IMLA 4HCRH 1SMAA 4L4VB 4YHLH 1ND0A 1T2XA 4H26A 2Y5TB 4B7LA 5IB4B 1W72B 5I1AA 1U3HA 4NBZB 3BP7A 4PJEF 1TVDA 2ZSVB 3RIAK 3VFTB 4KKBC 4G6JH 1C5CL 2R9HD 5MP6L 4JFPB 2FL5A 1F8TL 2DQHH 4ZG1A 3ARTA 2DMKA 4B53A 4YX2H 3ARYA 4JJHA 5D72L 3O8XA 1EIBA 3O2DA 4XCNB 3ARBC 4HGWB 2B2XL 1P9MA 4KJPD 5GRZA 1HEZB 3ELAT 3Q1SL 4JG0L 3X12A 3ZTNH 1G0XA 1K3ZA 2XNAA 4JFFD 3Q5OA 4ZTOL 4M9OA 2DYPD 3E6FB 1Q9KB 2EDWA 4UBDC 5FKAB 4JRXB 2FHBA 5KBNC 2JCCF 1N0XL 3D0VB 4QHUA 1GC1H 1IAIM 3FHQA 2R1YA 3GMLA 1LHZA 3AS1A 1J0KA 4I1NB 4GSDH 5B8CC 1RSFA 5EUKB 2CIIB 4HS3B 4N1CA 1MRCL 2X4RA 3DSNA 4R96B 4EDXB 2ZSWA 2NXZB 4LNRB 4DZ8B 1FO0B 1X7QA 2OJZH 5DZOA 5I1CL 5L6YH 5D1QB 2AEQH 1W8OA 3Q6FA 2P5WE 4HKBA 5FYJD 2PN5A 2Y6SD 3V7AE 5EU6D 1Z5LA 1B3JA 3FMGL 4LLMA 4LPUA 4NQXB 3R8BB 3PABB 3BZEA 1EUUA 1XGUA 5E1HB 1D5IL 2MCPH 4F7TB 2G5RA 3KXFA 3O3DB 2UUDK 2VZSA 3TYGL 4XWOC 1G7PA 1NCDH 4BZ2H 1PD6A 2Q8AL 5J1SC 5KVEH 3NA9L 2FH8A 4NQCA 1OPGH 3EDEA 3BDYL 4H88L 2OR9H 3SE8L 3T1FB 1T66D 5F6IC 5GXBB 3RX7A 1T1ZA 3WSQL 5HGHA 2JJSA 4K94C 4IS6B 5EUOB 4ZO7A 4MHHI 1AC6A 2PR4H 4FQ2L 3GJFH 3JTSB 5DQDL 5CP7B 4ZO6A 4EUPA 2A6DB 4JY5L 5MEPA 1UA6H 2CUMA 1F3JA 3PWJB 1ADQL 3WUWB 35C8H 3KYMB 3NAAL 3RY6C 2QLVB 4QRPA 1CZ8H 2BXZA 4JFDB 4OCWH 2EIZA 3IJSA 2YA2A 1OAQL 1F11A 1BFVL 4BH8A 4BKLA 1T83A 1J1PH 1MJJB 5D70L 4L4TD 1NLBL 4NO0B 1J8HA 3BH8B 5C07B 4EN3A 3U83A 4U33A 3RZCD 2AEPL 2I9LA 2VZUA 1X5XA 4YXKL 1LK3H 3ULVF 5LCVL 4CVWA 1UB5B 3LEYL 3G04B 1YNTB 2DQEH 5H35B 3MV7A 1KC5L 5GPRA 2J88L 5I1DB 1AC0A 2OX5A 1EFQA 3BQUB 3C5JB 5K9OA 5GS2H 4PJGB 4D0DB 2G5BA 5HTSA 3MODH 5T1LA 4L8CB 4PV9B 1XFPA 3QG7H 4YFLI 4C54A 3MOAL 2WWMD 1NCAH 2IAMA 5BRZD 3SCMC 2F8XC 3AREA 3WIHA 3QUYD 1KB9K 3B6SB 3D25B 3ZZ1A 4J4PA 4JGJA 4Z95H 4OM0L 4KUCF 2CLZA 5D2NB 3CZFB 3EYOB 4ZUVA 5E8PB 4NPYB 5I8OH 4JDZA 1MQ8A 3O4LA 2ESVE 3WEXB 2AJSL 4OBRA 4LSRH 3NZ8A 4XNYL 3IFOA 1IRAY 1YEHL 3DO7B 3FFCB 2A9ML 8FABB 2C3XA 5DD6B 3IRZA 5ALCL 1PSKL 2ZNWA 2XTJC 4M7KH 2EKSB 5IP4A 3QIWC 3QJHA 1DQJB 2D03H 3HI1B 3LHPH 2CLVB 1G6RB 1IJ9A 2H8PB 1W0VB 4EOWH 1ZGLB 3MV9D 5BJTA 4QRQB 3TO2A 2D4FA 3VXPB 4LMQI 2JELL 4XPBH 3DVGB 2IF7A 4UT7L 1LQSR 2HT4D 4D9LH 5I8EA 3RKDC 2SEBB 4AY0A 4WWKA 4LCWB 3L3JA 3MA7A 5FYKE 5FUCE 1XGPA 4XVJH 3UJTH 5DJAA 4C58B 5T3ZD 3EFFB 4ODSL 3TM6A 1GSMA 2GSIB 3THMH 1BQHA 3VDAA 3STZB 2VWEC 4HAFA 3NCJH 3RGVA 4OZHB 1FV1A 1J0YA 2CKNA 2RCSH 1AR1C 2XKNB 4JZNB 1CFQB 4NHUB 1B2WL 1A9BB 4KRPB 4GG6A 3GJFB 2EE2A 1T3FB 4U1KB 2DI9A 4K9EC 4NN7C 5HI5D 4NKDB 3QI9D 4MNQD 3V4VH 1F13A 1DVFB 4K94L 2WANA 4QTHB 1G7LA 4NKMB 3U46A 1M7DB 2NQCA 2X4OB 5KSUB 4FFWC 1QRNA 2CO6B 4MCZA 5CCKH 1X5LA 5E5UB 3K4AA 1BZQK 1AD0A 5GS1A 4N9GA 2NYYC 3OKLB 1A6AA 4M1CD 3ARGD 4LLUA 4UU9B 4OCYH 2X5PA 3ZT6A 1F58H 3FO9B 1A6TA 3VE0A 3ARDC 3DV6B 3PWPE 3EO9H 1Y6NR 1VGKA 4I77H 4LLDB 2ICWJ 3MV9E 5C0NC 3IDMA 1M05A 2HLAA 5CMAA 1YJDH 5FO8A 1NUGA 2VLME 4D9RD 2QHLA 4B7IA 3E6HA 5TF1H 4RISH 4PGDB 4ZOAA 4YDLC 2OJEA 3V4UL 2X70B 3DSFH 1IGIH 4LAJH 2HFEB 3ARUA 1GGCH 1GJIA 5E8DL 2C5DC 3K1DA 4NO5A 3B83A 1Q9LA 1JRHH 3FTGB 5GGTA 1RIUH 5DURB 4H1LA 4ODTL 4Y4FB 4KJQC 3MRHB 3J8F7 3I2CH 1T0NB 1N5YH 4OZFG 1NC4B 5IQ7L 3GIZH 5T5NF 1L6ZA 1S9XA 4RMUA 3LH2H 4APQB 4PGCA 4KHXH 1PG7H 4MNQE 4IMKC 3MBEB 1CFTA 2E7CA 4M7ZC 3K46A 1CLYH 1NFDE 1R3IH 3A6CL 1F90H 3U0TA 1GIGH 5DD3L 4JDTH 1EJOH 4S1SL 4X8JB 3VFVB 2J5LC 3PQYD 4KFZC 3GRWH 1GZPA 4WO4A 4YFEA 3OAYH 3PL6A 4NM8L 5T1KB 2NTSP 3EOAA 3X17A 3O6KH 1MWAH 3K4ZA 4XPHH 1TVHB 4LSUL 4W6WB 1JYNA 3WXWL 4NQSB 5IB2A 1PKQE 3VFSA 3BGFC 5IVOA 2HVKA 1AD9B 4O51A 5CZKA 5FOBA 1DE4A 4OF5A 1XF3B 1DQDL 5D2LE 5IVZB 3UTTD 3FT3B 4AQ1B 4G42A 5B21A 3I85A 2VXQL 3SBWA 5JA9A 1M71B 1XMWA 4YBLB 2DQTH 3BT2H 2BNRB 2D9QB 3CFBA 3MV01 4D9RE 4QRRB 4JZJB 2YC1B 1CLOH 1FZOB 4OZIF 1DUYA 3C6LD 4OLUH 4G5ZH 2EYTB 3MLWH 5FGBA 5JHDB 5KJRH 3BZ4A 4S2SB 4FFVD 3RA7H 4WENB 3G5ZA 1M1SA 1JIBA 2EICA 5DJXB 1EHAA 4ZFOL 5I1HH 4YR6A 3WL9B 3HE7B 3C60B 3ES6A 3MZGB 3DX8B 5EIIA 4LEOB 5HYQA 4PTUB 4N0UE 3KPNB 4HXAL 3MRFA 3N9GL 3G6JB 1F4XL 1JMXA 2IQAA 1BX2A 4WHTB 1F5WA 1MLCB 2Y36L 4WFGE 5IQ9A 4X9IA 5E9DB 3VFOA 4JQIL 3LMJH 2NXZC 3SOBL 3BP4B 1XR8A 5J13B 2DIJA 1MELA 4CDGC 1LDSA 1ZV5A 5D1QC 1FPTL 4Z7VE 2F53D 4P5MA 1S9KC 2WUBL 3CX2A 3JWOL 3SGEH 4Z5RA 3V5DA 5J57B 1KUMA 3GSNA 1AHWA 3NH7L 3LOWA 3FQRA 1NGYA 3D69B 4X6DB 2XRAH 1D5BA 5A1AA 5F1SA 1L7IH 1JI2A 2O5YH 4P23A 4PRHD 2B8OT 4OGXH 1FFPA 1YDPB 1S9YA 1MOEA 4OCXH 5L9DL 5DJZB 3DLQR 1Q94B 2DQCH 3GBML 3CFCL 3OR7A 2Q86B 4WDIB 1A4JB 2VDML 2GJZB 4GG8B 4OAWB 3EYQC 1LE9A 3TN0D 1J88A 2YBRA 1UWXH 1FGVH 2ZUUA 4HUKB 4BA8A 1O7VA 3MRLA 3QJFB 4BFEA 1BJ1J 4PFEA 1K5NB 5ITBH 3F12A 2Y06H 4N9OB 1XCTB 3SDAA 3O2DH 2W60B 3AU1B 2DLFH 4F7MA 5E5MA 5E8NB 1UWEL 4OV5A 4OZ4A 1A7OL 4I3SH 4GKSB 1N64L 3S96A 4PGZA 3UTSB 4ODVH 3K8KA 1KLGB 1ZT4A 4M6NH 5JDSA 2DQUH 1I7UA 2FB4H 2CIKB 3FQNB 5C0BE 4NZTH 2VISA 1SY6A 2IANB 3SGKC 3QPXH 2DJUA 1DQQA 1TQBC 2LAAA 1HHHB 3GSOB 3GGWA 3MRQA 3TT1L 3QPQD 4UAOB 1XAUA 4CW1A 4XPGH 5EOCL 1G7IB 3BQUC 3B9EA 1DBBH 3CH1B 5F8RC 3C8KA 1HSBB 1IAOB 1OL0A 1JZ8A 3L1OL 4KI5C 1R5IA 4PRHE 3EJZD 4HIIA 1I8KA 4PUBH 1FBIH 3TBVA 2NMSA 3QNYB 5E95B 5AYQA 2X4PA 5KN5B 4L3EA 5MEOA 2A83B 3V5KB 3LN5A 1HDMB 4MCYB 3ZT7A 5F72S 3QCTL 4PTTB 3DX6B 1MFCL 4ETYA 1GC1C 3MJ7B 3T65B 3HR5B 4JLRA 1SVCP 2GK2A 3DHJA 3U7WL 1FE8H 1NMBL 2GFBB 1EZVY 1TZHA 3K4DA 1U8MA 5DRXB 3LKQB 3QG6A 3MYZA 3HR6A 1GXEA 4LARH 2ZG3A 3KDMB 3Q0HA 1Y0LA 4Q2ZA 5D1XB 3HB3C 3RWHB 3V0VA 3BIAX 5GJSL 4EUPH 4YQXH 2VNCA 4QCIB 3BKCH 3RDTD 4WFFD 5MEND 2K7QA 2OZ4L 5GHWL 2OK0H 3ZE2F 4PRID 2QL1A 3L3KB 2CKBA 5HHNA 1VFAB 3D48R 2I24N 3AGVA 3QRGL 4OQTA 5IMKA 1QD0A 4PD4K 2WIIA 1F4AA 4K2UL 4LMQE 4X8XA 2DQIH 4M5YL 5FUZH 4S1DD 3VXMD 4XNUH 2EDYA 2PO6A 4ZAKB 1OP5H 5IMLB 4Z7NE 2W9LA 4V1DA 1XH3B 4WGVB 4Z77A 4H26B 3VWKB 3UYRL 1WWAX 2AABL 5LQBL 3OF6A 4FNLH 1ZHKA 2APWA 4ZFFA 2PYEE 4HDIA 4MA8L 1YPZF 4KRPC 3CC5A 2G9HA 4TVPH 2FATH 3GJFK 3U4BL 4U7SA 4WUUB 4KJWD 4KTEH 4OUUA 1NKOA 4Y16B 4ZTPL 2WW8A 4ONFH 1DVFC 3NACH 2VZ1A 5JW3L 2NY0B 2DAVA 2VZTA 4EIGB 4EZMA 5DHXB 3X12B 2OTUB 4X9GA 5BZDA 5EU3A 1Q1JL 3QXDB 3PUCA 5DWUH 3FO2A 4WI4A 2YPLD 4Y19B 4QHUB 3IJHB 3SPVA 3OWEA 5M95B 2IMNA 1KXQE 15C8L 1BZ7A 5ACLA 2JIXA 1OTSD 3QXVA 1S3KH 2R1YB 1XGRB 4PRPA 5I0ZA 1KJVB 1FZKA 4JRWA 4WFFE 5MENE 4XMLL 1HCFX 2XWTA 5K33A 4PP2B 4PRIE 3U4EA 4ETQB 1CVRA 1NMAH 5JR1H 4P48A 5KVFH 2X4RB 3DETC 3MLRL 4OGYL 4UOW1 1X7QB 4PLJC 1YNKH 1UACH 2DN7A 4Y2DA 1PZUB 1QLFA 2APTA 5JMOC 3Q6FB 3DRQB 1KT2B 3NFPA 1T5XA 4HKBB 4HT1H 4FXKA 2VLKD 1A7NH 4X6CA 4EI5A 3JV4B 1UEYA 3MACH 4D3CL 4LLMB 4HKJA 1OB1A 4UB0H 4YC2C 1PAMA 4YJZL 1XGUB 2HKFL 5HI4C 4JHAL 3ZYIA 4G8GE 5FB8A 3VXRA 3KXFB 1HN1A 4Y4FC 2AXHA 1G7PB 1NC2D 5F70A 2NY2B 4K23L 3QUMH 3QO0A 1MFBL 5KSBA 1K4DA 3IS1X 1MFAH 3MBEC 3LV3A 5HGHB 2I60L 3PHSA 3IFLL 1HXYA 1F4YL 1R24A 1V7NL 4EUPB 3CUPA 1S7QB 25C8L 5MEPB 1F3JB 3OKDA 2ZUTA 3H7LA 1ES0B 3U7YH 4HS6A 1RHHA 5EO9B 1HINH 5F93C 4V2BA 2VLRE 2EIZB 3IJSB 5FO9A 1JPFA 3ABZA 4OGAC 1U8JB 1OOAA 2Q8BH 1ORQA 1F11B 1RZGB 4BH8B 4KWUA 5DSCB 5EZIH 1A6VH 4EN3B 5IHBA 1HCVA 4X9FA 2QQKL 2I9LB 3H9HA 4YBLC 2YKLH 1J12A 3G6DL 4JZJC 1YN7A 5IKCA 2Q7YA 4WTXA 4JFXA 4ZS6C 2BVUA 3NGBB 2XWBB 2X2YA 5DJ6A 2NY3B 2VLKE 4AYFA 1PGRB 5E24E 5K9OB 2KL6A 2X1QA 4L9LA 2G5BB 5T1LB 1UM6H 1AY1H 1WLHA 1QKZH 3C60C 3B9DA 5EOTA 3L95A 2IAMB 3HMXL 3NCFB 4P9HH 4XH2B 3M8OH 4WNQA 4GRMA 3FZUC 3MA9L 4N68A 4YE4L 1KCUL 2DMCA 5DYOA 1QSZA 1OARH 5D1ZD 1ZHLB 2CD0A 1I1AB 4G6ML 4ACPA 3T0VA 5GGTH 4H1LH 4GMTL 5J13C 3RI5F 2VO5A 3VW3H 1Q9OA 4H25A 1WBZB 4JDZB 2I07A 3UTZA 5GGQL 1TVBA 4M62H 1BD2D 4WTZG 1FRGL 4OFYA 5I16B 3MLZL 3I50L 4CU8A 3W39B 4M1GH 3DXAA 1OQXA 5JOPD 4YPGA 2HJFA 1CDBA 2VR5A 4DAGH 1IVLA 1DLFH 1A6WL 2W0KA 3SDDD 1YJDC 3QEGH 2ADFH 3WV0A 4KTDH 3QJHB 3QQ3A 4OIIL 1BEYL 4M6OL 2QJDA 2WBJA 4DUWA 1PEWA 3TA3D 5D7IE 2W9EL 4NZRH 3WS6C 1FYTD 1RPQA 1JGVL 2VC2H 3ULUF 4RZCA 5L2JA 4M7LH 3ALPA 4KKLC 1WCBA 5FYLD 3FOMB 4KZDH 5ILTH 1L7TH 1WFTA 2ICEA 3P77A 3L3JB 5KVMC 3MA7B 5JLZB 3H42H 5FHAL 5AUMA 4FQXC 3SDYL 5D9SA 1LD9A 5DLML 3EOTL 4MQ7A 1BQHB 2AI0L 4NBYB 1TNMA 1CICA 3QUMB 1TJHL 5DGQA 1C5DB 1KN2H 3RGVB 1R3KB 3MCLH 3ULUL 1YEIL 1JBJA 3GI9L 4KU1A 4Y8DC 4WHYG 4IOSD 3VRJA 5IVXE 4GG6B 3NIDF 1DQML 5DMGC 3OAYK 4FZ8H 4DN3L 3RZWA 4YAQB 1ZE3C 4HWEL 2BX5A 5I19H 2IFFH 1G7LB 3BW9B 3U46B 5ESVB 3SE3A 1BD2E 5IB3A 3MQIA 1LDPH 4UAOC 4KKBD 4QRSA 4MCZB 5AZEL 3SDXB 3JVGA 3MZTA 1WAAF 1BIIA 3FL7A 2DJSA 1IEBA 4KMTH 1NAKH 5JOPE 4N9GB 1RJLB 1G7MB 5LGJB 5K9QI 4FP8L 3ARBD 4I3GA 4BFBD 4G7VL 2FWOA 3KS0H 4X6EB 4AEIH 3W2DH 3VE0B 3HS0B 2WSKA 2BNUA 2VERN 1CCZA 4EEEA 1TPXB 1H3UA 3DI3B 1VGKB 3VU2A 3IDMB 3WFHA 4XNXL 2QEJA 1DANT 1M05B 3JTTA 4UBDD 5CMAB 5FO8B 5DJCA 2P5WA 5TF0A 1HKLH 4U0QB 3QUZA 3QZWG 3RWGA 4Y8AA 4PREB 4HX1A 1MCEA 2OJEB 4PP1C 4Q0XH 5AWNH 4HLZG 5CHNA 3WD5H 4X7SH 5D1XC 5GSRB 4KZEH 1AKJD 3HPJA 2XQYG 4Z7UE 1WQVT 4WV1B 4H1LB 1MHPL 2NPLX 3P3YA 2X1PA 1IGCL 2JKXA 1OD7A 3ARSA 3MGAA 3SGDI 2JJWA 1FIGL 3F62A 5DK2A 1S9XB 1OF2A 3O6FB 4PGCB 1WTGT 4JFFA 1EGJA 1CFTB 3CU1A 1OY3B 4JCMA 3FFDA 2PW2B 4LRNL 4A6YA 5C7XL 4Z18A 4F57H 2IPKB 4XWOD 1Z9LA 1GZPB 3TYFA 4WO4B 1WK0A 4QGTA 3T1WA 2DQGH 4ZAKC 4L8SB 1SY6H 5FYKU 3VWKC 3M17A 4BFGA 1EMTH 5JIHA 3P0GB 4GXUN 3VFSB 2R69H 2VB5A 2HVKB 4O51B 2Q3AA 1DE4B 4HC1L 3P9MA 4XPTL 3RNQA 5GZOC 3VWJB 2RBLA 5C09B 4FZEL 3MBXL 1NCWL 1OGTA 1J05A 1MAMH 4NC2B 3BPOB 1O7SA 2DLIA 4Y16C 2A9NL 3K2UL 3ECBB 2DLTA 3EFDH 3CFBB 1BAFH 2NY0C 2YMXH 3UP1A 1DUYB 5A16B 1IAMA 3BZ4B 2EDFA 4LHUG 4LKXB 3TZVB 3W0WE 3LZFL 2OYPA 3FT2A 4Y7MA 3ISWA 5BZWA 5I30L 2WQ8A 1AO7D 3SKOB 5ID1A 4YR6B 1CXKA 3UPAA 4FQQA 3BRGC 4XAKD 3WNLA 4KXZH 5HYQB 4L8DA 2LV4A 4NKIL 4HWNA 2P24A 3KYNB 4PJIF 3LPFA 4Q58C 2M1KA 3D85D 1HYSC 5IQ9B 4RGNB 3MOBH 4E41D 2HH0L 2ESVA 4YHML 3EYSL 1DBMH 3VFOB 4U3XA 1TCRB 1WBXB 1XR8B 5TQ0L 1NPUA 3ZDYE 4DEPB 3NFNA 2HTLC 1K9TA 2J8UF 4P5MB 2ICWA 3SCMD 4ONGL 2CKBH 3FQRB 3QFJB 1D5BB 5GGRY 1OCWH 4OQTH 1EVTC 1C16A 5KW9H 4P23B 4P59H 2A1WH 3OSKA 3DI2B 1S9YB 3IDGB 2NY2C 3FQXA 4JY4A 4JRYD 1JCKA 3LD8B 2XY1A 5D6DA 4KK9C 2F54D 3OR7B 2A6IA 4WU7B 4I2XE 2ITCA 4QYOA 2ENYA 3TH4T 4LFHD 2I9TA 2A6JB 2A73A 2V2XA 2XTJD 3U6RA 2YBRB 2ZOLA 3QIWD 3VXSD 4EJ1C 1P4BH 5IF0A 5DEGA 4JKMA 1XR9B 4QNPF 2LU4A 2W91A 3OKYA 1P6AB 3R06A 5JW4M 4FQCL 3SDAB 4W70A 3WBDA 4KVCL 5L8JB 3IXTA 4OFDA 1JWUB 2CR3A 3HE6A 2RQ8A 1QFOA 1SQ2N 5D8JH 5L88L 1A9EB 2VDNH 2RIKA 3QUYA 4XAKE 3U9PL 1BM3L 1VKXA 4TRPL 1BQLH 1SBBA 3TJHC 5DT1H 5IUSA 3RKDD 1CQKA 2MOVA 4MJID 1ZT4B 4R7DA 5F7UA 4EN3C 3MRGB 1I7UB 1IGML 3V8CA 4YEEA 5BVPH 2VISB 4TQEH 1HNFA 1JPSH 3MNWB 1DQQB 5KSVA 1KCSH 3NGBC 4PJ7F 4TNVF 2Z35B 2NY3C 2WMPA 1AR1D 4ZXBC 1S78C 4PS4H 5JQ6L 1AXTH 3VI3E 2E6QA 1K6QH 5J9PA 5IR1A 1MAKA 2J4WH 4PGBB 4BQBA 3S35X 4IIQB 3I84A 4XAWL 2EO1A 2AJXH 3PWPA 2H45A 4DOHE 2IAMC 3MV9A 4NQED 4MD4A 1WT5A 3TBVB 3T3ME 1F2XK 4J4PC 4FFWD 5MEOB 1I1AC 4O2EB 2F54E 1E4KA 5CGTA 3CVHL 1IC5L 2NYYD 1RMFH 1S8DA 1MY5A 5BXFB 5HHVL 4JLRB 3VXSE 3K80A 2CO7B 1KFAH 4UINH 1U8MB 3ARDD 2E3VA 3QG6B 5H8DA 5C0ND 1RZFL 1RURH 1Y0LB 5CINL 4NO2A 2CGRL 3IFPA 4JPIA 3MUZ1 2FNBA 2EH8L 1I8MA 3KLAA 2GY7B 1NCTA 4JVWA 1MFNA 1MEXH 4MNQA 3HUJE 4MJIE 3LDBB 2IC2A 1YEGL 3S5LA 1A7RL 1LO0L 1NFDA 2CKBB 2ERJB 3EO1B 2KZ1B 3CFEA 2ED8A 3FRPG 4RWYL 2XZQH 3N0PB 5DQ9B 1MVFA 4JB9H 4RQQB 2O61A 1IM3A 2V7NB 3S37L 2VWEE 5IMKB 2ZCKL 1BF2A 4F8TA 5EWIH 4KJQD 1PLGL 2V5MA 5ESQA 2YRZA 3CDCA 3RKPA 4DQOH 4U1HA 5BQ7A 1PKQA 3ZKXB 4NM4L 3I9GH 2YS4A 2P8PB 4V1DB 3WN5A 5KVGL 3HPLB 3OKMB 1KB5L 3RGVC 4M9PA 1HILA 4PBWD 5C6PB 4XRCB 1ZK9A 4NQEE 1MNUH 3VDCA 4L8BB 4CU6A 3CC5B 4PGEA 2BVQB 1KJMA 4HJJH 4OM1L 1HZHL 2XIDA 4K3DH 1J11A 4L4VD 4OUUB 5TJWK 5B39G 1RJZA 2VR9A 3REWA 3IDJA 4PG9B 4FRWA 1UYWH 4JO3H 2B4CL 4KAQH 1P7QB 3IU4H 3PWLA 4JR9L 4J2XA 5BZDB 3DGGA 5C6WH 5JW4R 3UJIH 4W4OA 4OT1L 5CUSH 1P5VA 2PKDA 5GRWA 4Z7WF 4MJ4A 3PV6A 1NGPH 3NMEA 4F2MA 2AJ3B 2C7UB 4WUKH 2R8SL 3CGTA 4NUGL 3SPVB 5F96H 3VFPA 4WI5A 4P4RA 1SHMA 1W0YT 4F9PA 4PB0H 1JFQH 1FIEA 3RL2A 5LJYH 1MUJA 5EFIA 1CK0H 3GSUA 1TPXC 4M00A 5JXAH 3F65A 5BV7C 4R8WH 1K8DB 1KXTB 3U4EB 4JRXD 4G8FA 4Z7VA 2BSRB 1IL1A 4ZD3H 2CR6A 2CDFB 3TJEL 1QLFB 4LP5A 5GISL 1T5XB 4LVNB 1O5DT 4FXKB 4K3JH 5DVOA 1U8PA 4ZS7L 4QY8A 1OAUL 4P9HC 4X6CB 5ERWA 4HWZB 4EI5B 5EZOL 2FIKB 3S36L 1I7ZB 1OB1B 5FFLA 5SX5K 1HHKB 3HNTL 2NXZD 4WV1C 5DFWH 5J6GA 4BYHA 2Q7NA 5ITFA 5D1QD 2KQMA 3KGRA 4MAYD 2ARJB 3UDWA 1YEJL 3O6FC 3QO0B 4JG1L 5KSBB 1K4DB 4PJ5B 3LV3B 1AGBA 1HXYB 2CMRH 3RWJA 4QXGH 3W81A 3P4NA 3QHZH 2DD8L 1J0HA 4IOFC 4CN1A 1B6DA 1RZIA 2NY1B 2VJXA 4JDVA 4L8SC 4MB3A 1X5GA 3OKDB 3WDIA 5IHLB 3DARA 1IAIH 5CJ8A 4OF6A 3WHE0 3BDBA 1ORQB 3EYQD 4KDTC 4MNGE 2VXTL 4PRDA 5C0BA 4AG4H 3IGAB 3VWJC 1EAPB 3LN4A 2R0WL 5CIPA 3BPOC 4UNVA 3H9HB 3FN3A 2F53A 2IPUK 3X13A 2F9BT 4M61A 3FONA 1E28B 4LIQE 5AEAA 3V5HA 2Q7YB 4JFDD 5DJYB 4JFXB 2E6PA 3TZVC 4D2NA 3SJVD 5F21B 5IMOA 5D96C 1E6JH 3PE9A 4ODHL 5DJDB 4L9LB 4PRHA 1CFNB 4MMZC 1KENH 4MXVE 1TCMA 4BK5A 4XBPA 1KPRA 4ZFGL 5F9WB 3GDBA 4NCC2 3T2OA 4LHQB 4PJDF 1IGJB 3L5WB 3ZSTA 5HY9B 5DJ8B 4GRMB 3MGTA 3AC0A 4RGNC 3TN0A 3BQUD 4DGIH 4U7MA 1Q0XL 3V6FA 1JZ7A 3S88L 1AQDB 2OR8A 4DEPC 1QVOA 2I07B 3OJ2C 5DVKA 3UTZB 1UM5H 4KI5D 5MERA 4NHCL 2IGFH 5EOCJ 1LO5A 3KYKL 1IQDA 4GQ9H 2VTFA 2PTTA 3RL1B 2W07A 3DXAB 2YD1A 1EGJH 1KG0B 3L3DB 3UMTA 5D5MF 3WJJA 5JHLL 1QNZL 5IHUL 2XACC 5C6TH 4A6YH 5GGUA 1QEWA 3IDXL 2O5XL 1DQLH 3Q3GA 3CCHB 3OV6A 1TQCB 1I3GH 2PETA 5B4MC 3T04D 3LD8C 5BV7L 1RZKH 4IDJL 4RZCB 3FFCD 1DN0A 4ZDHA 3FQWA 1VPOH 1WCBB 2G2RA 3JWDL 3HB3D 2R29L 4HK3J 3IXAB 4JFDE 1WC7B 1DFBL 5ENWA 5C0GA 3NZHH 1M6OA 5AUMB 3SJVE 3MGOA 3SDAC 1EZVX 3MRRB 5D9SB 5TE4H 2JK5A 1CGUA 3OHXA 4MQ7B 4HFWA 2PYEA 3FB8B 2P8LA 3PGFL 4U49A 3BP5A 1DLHA 5C08E 4K71C 4LLYB 4LCWD 4Y88A 1YEDA 1ZHNB 1QFPA 3OKOB 1EEYA 5IK3B 5CGMA 3VFUA 4XPAL 4J1UB 5J8OA 5IGXL 3DOSA 3BVNB 4FFYL 5FK9A 5GRVK 4YNYB 1U8LA 3TNNB 4RIRA 5HHXH 4PJBF 5F7WC 2FECL 3UBXG 1REIA 1BIIB 5F7EH 3IAPA 4KRPD 4JPWH 3L5XH 4IIQC 2MQCA 2QKIB 3RWFA 3RDTA 4GFTB 3T4YA 5MENA 1DVFD 4YDIL 2A0LC 4N0YH 4CN4A 4PRIA 3OJDA 5HHME 2HRLA 2BY3A 2HWZH 2IBBA 2X4UB 3MJ9L 3MXWL 2VAAA 4I4WB 2D7PA 4PV8A 4QWWC 3GI8L 3JTTB 1YC8A 5BO1L 4GBXB 1JGLH 5DJCB 1RUPH 1VERA 4YHNA 3VXTB 3VH8A 3TWCL 1N5AB 3O0RH 4RFEA 4NSKA 4AQOA 1SJEB 1KEML 3F5WB 2M8XA 4FOMA 2XZZA 1MSPA 3BN9C 4OZGE 5DD0H 3SGEI 4HX1B 1YMHA 3BESR 4S1QH 4LSTL 1N59A 5E2JA 4G8GA 3K7UA 4UZGA 1NBZA 3OX8B 3WNKA 4OI7A 5FYKH 1FNFA 3P0YH 5H37G 1L6XA 3UPRA 3DETD 3HPJB 4YDVA 5GS2D 4WFHD 2PW1A 2VOTA 4PLJD 2BERA 1ZGLM 4RMVA 2R0KL 1VGEH 5DI8A 2Q76B 1INDL 4GW4B 4G9DA 4FMKA 3LDBC 4BFIA 2ERJC 4J12A 4TVSa 2VKXA 4DKEH 4U1NA 3QFDB 3QHFL 5CKAA 1A64A 3WNPA 3FFDB 3BKYH 4OLYL 5HI4D 4EDWH 2HN7B 2EYSA 2DL9A 2YPLA 4OZHE 4Y4FD 5DURD 4A6YB 3MSPA 5HYSG 3HC4L 3ZKXC 1NC4D 2L7JA 3SO3B 4MB5A 7FABH 3ARFB 4KVNH 2GY5A 3M17B 5GJTH 3RWEA 1MFEL 3LEVH 5J4MA 1QR4A 2D3VA 3MBED 2B0SH 1PY9A 3SQOL 4NBXB 3MFFA 2OS7A 1U42A 4HJ0C 1TZGL 3OXRA 3ILQC 3RHWK 2QR0A 1CR9H 1CFBA 5EA0L 5IM7A 5T1KD 3E3QC 3PF2A 1AJ7L 4WCYL 3G9VA 2VLKA 2OCFD 1WBYB 5BW7A 3GK8H 3GNMH 4OGAD 5TDOA 4MXWL 3P4MA 2J8UA 3LVEA 4ORGB 1RUQH 3LKPA 3FT2B 5E2TL 2X9XA 5BZWB 1WVZA 4Y5YA 1EX0A 5DMIH 2B1AH 5ID1B 12E8H 5E94A 4FQQB 3CMGA 4Z0BL 1E4XH 4HUVA 5IFHL 1LEGA 1NC2A 4HGMA 4WFHE 4QRRD 5HHPA 4U1GB 4L8DB 3KYOA 3CK0H 3HRZA 4LQFL 2E5EA 2WINA 2YPVH 4ZS6D 5JHDD 1CFVL 1FL6A 1WWWX 1I3UA 2VL5A 2ESVB 3AVEA 4PY7A 5IEHA 4UILL 3V6ZA 3VD4A 2E7MA 3KJ6L 3C60D 3OR6A 3LKSA 4GXVL 1XZ0A 2JB5H 2IMMA 2D31A 4LVNC 1U8NA 3VMNA 2DRUA 2ICWB 5KOMC 1IFHL 3CIQA 4JFOA 3U1SH 1F4WH 4EI5C 1GAFL 1S9VA 4C4KT 1CL7H 3B43A 1BJ8A 1KJ2H 5JDJA 2P7TB 3FZUD 2BC4B 2CQVA 3MYJA 4KV5F 2VN7A 3ZKNC 5IW1A 1MFDH 2YSSA 4YHKH 1JZ5A 5E9DD 4PJXE 5CEZL 1C16B 2X7LB 1LK2A 2FGWH 5D7IA 1JPGA 2VQUA 3SE4C 2WZPD 3KPSD 2VIRA 3FQXB 2BVPB 3WFEH 3BGMB 2R0ZL 4JJ5A 3RVWC 1AXSA 4PJAB 1I7TB 4PR5B 2I9TB 1BJ1H 1G7HA 1A3RH 4XNQA 3PHOB 1FGNH 5IF0B 5I2IA 1MLBA 3MLVH 2ZUSA 1A7QL 2WLZA 3P73A 4UT6L 3D3VE 1NEUA 3N85L 3MO1A 5F1NA 5HDLA 1SJHA 2BOCA 1SEBB 1QYGH 3HE6B 4XC1H 4LPWA 4U2YA 4XX1G 4KKLD 4ZOCA 5CFHA 5IVXA 2EIEA 3ME0A 5IHZB 4QRRE 5EBMA 5D1ZA 2XA8H 1MCHA 3S37X 1TLKA 4U1MA 1OT1A 4U1JA 4G6FB 1ZLUK 1QLEL 4L29B 4IJ3B 4KTYA 4XP6L 5DUBA 5KS9B 4FQXD 2EH7L 4NWUL 5MEQB 2B1HH 4HS8L 1BD2A 1H9VA 4R4NC 2PXYB 4I3RH 1VFMA 2HFGL 4AK1A 5EU7C 4EI6A 5KSVB 1IBGL 2AV7B 4HPYH 2N7AA 4CADB 5I73B 3GSVB 1NSNH 3D39D 3UTSD 1MF2H 3BAEL 1QPPA 2XWJB 1MY7A 3W9DA 4JO1L 3SDDA 1IKNA 1P53A 4RAUB 1HHGB 4L9LC 3VD9A 4F7PA 5DRNA 2QSCH 3L7FA 4KUZL 1CT8A 4PIRF 5CSGA 5A2IH 1NEZA 2EXWC 3BPLB 5F9WC 2IAND 3PWPB 2VDQL 4PRBB 3TA3A 3MV9B 5DUML 4GAFB 3ZL4H 4A2MA 1EHLL 4MD4B 1L0QA 4PJGF 3KPSE 1G0YR 1ADQA 4JGUA 4Y5VB 3OGCA 2FD6H 4NJAL 2OI9C 1DJSA 4KI5F 2RB8A 1GYAA 5IBLC 4UV7H 4X6BA 4DUXA 3LIZH 1FVDA 4KRMB 2EDTA 4XBGA 5E1AA 3ALWA 3VFGL 1Z3GH 4F3FA 3EGSA 2H6PB 4DWHA 3H3PH 1F97A 2GUOA 2ZJSL 3C08L 4Z7UA 4AIZB 3C8DA 5IT2H 5CP3A 1AGDB 2J7LA 5HJ3A 3IFPB 3WKML 1DEEA 3EJYC 3MLSL 3BKJL 4EXKA 1VCAA 3DMMB 1I8MB 2VL4A 2NZ9C 2H1PH 2D7OA 3ZTNL 5I74B 5D7SL 2P1YA 4PP1D 3CFEB 1KJ2B 5EZJA 1SBSH 1P4IH 5AD0A 1IM3B 5D1XD 3S36X 2FO1A 2JJTC 1KIPB 5CILH 5HYIA 2Y72A 5ESQB 3D39E 2OR7A 5CIPH 3L5HA 4GSDL 5BQ7B 1PKQB 1YYLH 5T1DH 3ARBA 3B9AA 4N8CL 1CFSA 2K1MA 1WSST 2AEWA 5D2LB 4LU5L 3NIFE 2VUYA 1HILB 2OJZL 2IADB 3L6FB 3DYPA 1ONQA 3T4AA 1U93B 3B2VL 3CFJB 3I6LD 3GKWH 4W6XB 1C1EL 3I02A 1MCRA 3HI6H 3D0LA 1WZLA 5F7LB 4XVTH 4HH9B 4ZAKD 4HMEA 6CGTA 1RJZB 4POZC 3IDJB 3VWKD 3CPLA 1FH5L 2DI8A 4KQ4H 4RAVA 4G8EA 3SHSA 2DDQH 3PWLB 3W0WA 5KVDH 3TIEA 4F33A 2BMKB 3DGGB 2GITB 4YBHA 1OAZH 1X3DA 2DM2A 1FZMA 1CGVA 4HAGA 3PV6B 1EAJA 3MJGX 5GZOD 5KG9B 1JVKA 5KVEL 1AKJA 5FDWA 3BSZL 4N0UB 4N8VA 3IFNH 3DO3A 4WUUD 3QCUH 3ZKMC 4PRNA 2UY6A 1JMZA 4Y16D 3VFPB 3L7EA 4P4RB 3A67H 3IKCA 4MYWB 3WFCH 1MHHA 5FUOL 4HIHB 1PY4A 1MUJB 3QWRA 1NL0L 2NY0D 5HVGB 2PR4L 1X4YA 3MV8E 1ZKAA 2UWEB 4X0KB 5FM4A 1UH4A 1NBYB 3GSUB 1MHCB 3PG2A 4O5LL 5DFTA 4CBPA 4BZYA 1U58B 2ED9A 1FVEB 4GBXC 4Z7VB 1A6ZA 1I1FA 4HW6A 1IL1B 4Y19D 5JPMA 3GUTB 1D5ZB 2H32B 2FX9L 5CJBA 3V8OA 1ZLSL 1K8IA 1U8PB 4QY8B 1U8IB 3P4OA 4KH2A 3JSSA 3F7YA 3FQUA 4I0KA 4Z7QE 1FNEA 3H9SB 3INUL 1HYSD 3C6SA 1PX4A 1IARB 2G60L 2FECI 1JGUL 1HXMA 2P44B 2HTLD 4TUOA 5EU4A 5C0AB 3BD4A 5ITFB 4IEFB 4L1DA 2R4SL 2ADJA 1QSFB 5C2BH 4I2XA 1S5HA 3I6LE 2CSPA 3RY6A 1YQVH 1J0JA 2BVTA 4G9FB 2VXSL 5I1IH 3CDFA 3I75A 3ZTJH 3C2SA 4CRPA 2Z93B 5J1TC 3RWJB 2N56A 4XPFH 5JW4Q 3KXFD 5IBUB 3ROLB 3ZYJA 3HG1E 2A2QT 4WI2A 1OM3H 5I1EH 4JDVB 1T22B 2NY2D 1YEFH 5T5FL 3SO3C 4JO2H 4F15B 1C7SA 3ARFC 4BH7A 8CGTA 4WUUE 1UKSA 1RZKC 4KK9D 4C4KO 1FNLA 5I8OL 2Y9RT 2ZOKB 3T3PE 3D85A 1I9JH 1QA9B 5C0BB 1R3LA 3MRKA 3WFZA 1A1MA 1JPTL 5CIPB 4NNYB 5I15H 1I9IH 2OP4H 3FRUB 2EO9A 4Y19E 4M61B 3FONB 4M7KL 3FOLA 3SCMA 5B38G 1B0RB 1NMCC 2Y23A 4WY7H 4Z76B 3LHPL 2MMXA 4MA1B 1QZ1A 1R5WB 1T6WA 1YMMD 3TJHD 3UJJL 4EOWL 1NBVH 3VXQB 3QNZA 4KK5C 4XWGL 4EN3D 4S11A 2ILLA 3SDCA 3RUGF 4O02L 1XGQB 4U1GC 4ZPTA 1ZLWH 5K9JL 5DD5L 2F54A 3P30L 1DL7H 3MGTB 2NY3D 2HTKC 4ZXBD 1S78D 3G6JF 2DKSA 1ZT1A 3P2TA 4TVPD 1VEOA 3VXSA 5T1LD 1QVOB 4HKZA 1OTUC 4FXGB 5L7XH 3DVNB 1T1XB 4KKCC 1TJGH 5DMJB 2IAMD 5MERB 4HG4J 4QF1B 3A6OA 5IVNA 1LO5B 2MPAL 4YDJB 2NY6B 1I8IB 2AJUL 3PWVA 4J4PD 4C83A 4YH6A 4PJHF 1I1AD 2GTZA 3V4VL 3CMOH 1RJCA 1CGSL 1UH3A 4MJIA 5GGUB 1AGCB 4AJ0A 1QEWB 4OD1H 1NFIB 4X6DF 3Q3GB 4XGZA 1BP3B 1NJ9B 1UM4H 2XY2A 1YYMH 1KYOJ 4KY1H 1SEQH 5D6DC 4TUKH 1CLZH 3KWWA 1A6PA 1OTTC 3TIDA 1OWWA 4NQDD 3UC0L 5T33H 1BBJA 1HHJA 4CU7A 2D7QA 2DM7A 5J0BA 1M6OB 1MCQA 1YMME 4OLZH 3U48A 2LABA 2JTDA 4XT1C 1G84A 4H8WC 2FBJH 2H9GB 5I18L 3OHXB 1LP9F 3HE6C 4HFWB 4NQEA 2XKUA 2D4DA 2PYEB 4OZFA 4MA7H 1LEKA 4UV4H 3RNKA 1JN6A 1C08A 3QQ4B 3L5JA 1F4HA 2I26N 1UXSB 2R56H 3S3PA 2EDRA 3MUGB 4M4PA 3M07A 1EEUA 4HPOH 3ZDXE 1PZ5A 2F58L 3X3FL 4IJ3C 3H8NA 1EEYB 2BY0A 1SM3H 1LILA 1ED3B 1JYWA 1N6QH 2PXYC 2JJVA 4JN1L 5JOFB 4GRLB 5FK9B 1RIUL 1U8LB 2W0FA 4RIRB 3RGVD 3ARDA 2FLRT 5I73C 5C0CE 2VLLA 4LSVL 3I2CL 3BI9X 1CQYA 1A6UL 1S9WB 3U2SB 4AIOA 1MQKH 4P3DB 2FJFA 5MP6H 3RWFB 1FNHA 3BPLC 1KTLA 3T4YB 1CGXA 2YOCA 1A0QL 2CLRB 3BHBB 1F90L 5D72H 4I48A 5DC9B 4Y5VC 2CK2A 2B2XH 4N90D 1J1OL 1H3VA 4TOYH 2YUVA 3CSYB 3KPQA 4PV8B 3Q1SH 4G6AC 5DJ2A 3LAFA 4RSVA 1MWAL 4ONHB 4XPHL 4XXCC 1IC7L 4ZTOH 3CU7A 4NQDE 2J12B 3VH8B 5DMKB 4YHNB 4NSKB 4R6UA 3VRLE 4P4KB 2HRPL 1FNGA 1YMHB 5I66A 1N59B 2APXA 4G8GB 4NKOB 4QXTA 2UVFA 2WV3A 4X98A 3RWCA 1MCPH 3M45A 1ERNA 3UPRB 3DMMC 3GB7B 4RBPH 1RJYB 5I1LA 1VSCA 4OLUL 1AGFA 1MRCH 5I74C 2FEDC 3N1QC 4RMQA</