5E1AB

Structure of kcsa with l24c/r117c mutations
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title Conformational heterogeneity in closed and open states of the KcsA potassium channel in lipid bicelles.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Metal transport
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2015-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e1aB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e1aB01
3LAFA 3QPXH 4ACPA 2ZG1A 4BM7A 2WLYA 3QXAB 4KK9C 2H2SD 4Y1AE 5MEPA 2R1XB 1EZVY 5FHAH 5IFHH 3BP5B 2NX5E 3O6FB 4YHIB 4UT7L 4O2CB 3IS1X 3GIZH 1R5VB 2QQKL 4HBQA 4G7YL 4WW1A 2XZQH 4OZGB 3AB0B 2F74A 3DXAE 5DMYA 3LRGA 4PP2B 2AJ3A 1A5FL 2F5AL 3TH3T 2ICWB 1Q9OB 1IGML 5CGTA 3HR6A 8FABA 3H9HB 4TNVK 4Y7MA 3S35L 4KI5E 5FCUL 1XF5A 1TMCB 4NN5C 5HD8C 1S3KL 1A9EB 2C1PA 2I9LB 3DVNA 1CTNA 4PUBH 2M2DA 3S96B 2FO4B 1S9XB 2YRPA 3P9MB 3UAJC 1VEPA 4AL8H 5C0EA 4KTYA 5GS1C 3U0PB 4MB5A 1VB9A 4RFEB 3UJJH 1MAJA 1YN6A 1JTPA 3C60B 5IUSA 4NRXA 5EFIB 1Q38A 5DZNA 3L5XL 2Z4QA 3KAAA 1U3JA 4XP4H 3NGBC 3Q3GA 5D7JC 2R0WH 3DYOA 1JFQH 3OAUH 1I9JL 5F1NB 3QB7C 2ED8A 5JDJA 1E6JL 4G6JH 2CR6A 4RA3A 1JWMB 3O6FD 4XCYB 5F1OB 5I19L 1IGIH 1X5XA 3MROB 1VFOA 3OHXB 3RX8A 5C70A 1CGXA 2VJXA 5BJTB 1U8MB 2OL3B 4CJ0A 4ZNEE 4XX1G 3ARUA 1NFDE 1FNEA 2GYSA 4WVRA 4HXAL 1EH9A 3MRPB 3CPLB 1NGPH 3UPRB 2AEQL 5CJXC 1IL1B 5EIVA 2YD9A 2I25N 3HE6B 4M43H 3H3PL 1HIMH 3WJJC 2GY5A 3GBML 2ZOKA 3QPXL 5HPMB 1BQSA 1TTGA 5J1AA 4FFWC 3G5XA 5J9PB 1YNLH 4K9EH 2RBLA 2GCYB 5FHAL 1T22B 5IFHL 1SJHB 1L0YA 3C5SB 5DA4A 5KG9A 1IAOB 3GIZL 1QFWH 3C60D 3WO4B 4BYHA 2XZQL 4FG6D 4QHUB 5BS0A 4ZDHA 4LLYA 4LPVA 4PJ9A 3GBNH 2YPLB 3L7FB 1K3ZA 4XNMB 4PUBL 1CICB 4U1KA 2X89D 1O5DT 3SGJC 4P0DA 3KHQA 4Q2ZB 4H1LA 1FFQA 4WHCA 2YMXH 3MYJB 3DX8A 5F6HI 4HEME 3FQRB 4BUHA 2C3XA 3GMLB 1ITCA 4QRQA 3RGHA 1KEMH 1MY5A 4WNQA 2P45B 3CNKA 2UWEB 1DBMH 3M17B 3PWJB 5L6YH 1AGEB 1N2RB 4XP4L 4MXQD 1A14H 5D1ZB 5CZXC 3HE6D 1NUDA 2K1MA 4ZPTB 2R0WL 2ZUUA 2DL9A 1JFQL 3HZYA 3OAUL 1J7VR 3OKEB 4ORGA 2OTWB 3DX6A 3RDTB 4OD1H 5EU6E 4G6JL 3WS3A 3C5ZC 4TVPD 5C8JA 4X7EC 2YN5A 1R3JA 1F4HA 3B83A 1IGIL 1B0RA 2AQ2A 3QULA 4HULB 3HMXH 1MPAH 5EIQA 4X7CC 4ELMA 4R3SB 1R3HB 4BZ2H 4HUKB 3F7VA 1NGPL 2YPLD 1WEJH 2FNBA 3TF7C 2JJTA 1XR8A 1HH6A 3EGSA 4X7DC 3MA7A 3W0WB 4ZUTA 1CICD 3R1GH 4AENA 4M43L 4LARH 1HIML 2N7BA 1VGKB 3FQNB 5EUOB 4PRHB 1OB1B 1CR9H 4D8PB 5EN2B 3VFVA 1NBZA 1GZQA 3RWIA 1YNLL 3GZKA 2AJSH 4K9EL 4FMKA 4XH2A 3VDBA 1TZIA 2GITA 1T0PB 1EFXA 4HKZA 1MVUA 3HPLA 2UZYB 4C57C 1QFWL 2IPUG 3MRLA 1I8KA 2XACC 3QP3A 4UQ3B 5HVHB 1MCNA 4NM4H 3X14A 1ZT7A 3H0TB 2PCPB 4G8IB 5I8KH 5E4EC 3CC5B 1URLA 4M61B 1S7RA 5D1ZD 1AQDA 3GBNL 3CX2A 3GO1H 3B9AA 3ZYZA 4EKXA 5D7IA 2EIZA 4YFLF 5MP6L 1XGTA 3RDTD 2VQUA 4OM1H 4E5XA 5C0IA 1FLRH 1ROWA 2FB4H 1I7UA 4OZGE 4P3WA 2YMXL 1ZTXH 3I6GB 3GMOA 4GRLA 3QPQC 3U46B 1KEML 5LQBH 1FFOA 3S4SG 1U8NB 2F54A 3ZYIA 4KUZH 4E42B 5EG6C 3UZVB 4CMHC 3FB6B 5L6YL 1DBML 4X6FA 4OGZA 2OLDA 3NIGE 4CW1B 2IALB 5HI4D 5DFVD 5HVFB 2AJUH 5C08A 3W0WD 1A14L 1OTSD 3BD5A 4C56B 5K33A 2NY2C 4PRHD 4PRBA 3L3KB 4JZNA 4U4BA 3OX8B 4NO3B 4OD1L 2FJGB 4HQQH 3DURA 4NUJB 3T1FB 4UIMA 3U1SL 4RGOH 5DRZB 1FFNA 3DSFH 1KJMB 3HMXL 1MPAL 5IOPB 5I1AA 1MWAA 4BZ2L 1EHAA 2P24A 1WEJL 1EERB 3QIUC 3MCLH 1QSFA 3L95A 1DDHB 1CT8B 3R1GL 1J05A 4LARL 4R26H 1A7QH 3LS5H 4U1HB 2FJHB 1CR9L 43C9B 3I2CH 4X6DB 5FFLA 2PUQT 2AJSL 5C9JB 3L7EB 2AK4B 2W9LA 4XCCH 5A2LH 3VFSB 3DO7B 2Z0BA 3QISA 2YSSA 1DP0A 1KG0B 3CFBB 3MLSH 4PB0H 1MCHA 2OI9B 1Z9OA 1P1ZB 1VKXA 4NM4L 4JKWA 1HH9A 3EDEA 5I8KL 3RRQA 5IV2A 4WHDA 3OKNA 4ZTOH 5TE6H 1T6VN 1RI8A 5CD5D 4C56D 4TVPE 5KANG 3GO1L 1T1YA 4BELD 3P3YA 1RK1B 4PJHF 3F6LA 1RZJC 1RUAH 4OM1L 1FLRL 3MRNB 2IBGA 5EBLA 3OKMB 5AWNL 2FB4L 4ALAH 2WWKT 1IRAY 1TZHB 3SE3C 4J3SA 1ZTXL 1LE5A 3AXLA 4D0DA 3P4MB 5HDLA 2NLJA 3WNOA 2YPLE 5IBTH 5LQBL 4HX1A 4L29B 5TF0A 4KUZL 5DEFA 3AS0A 4Y0GA 3E8UH 2CDEA 1GC1H 4Q58C 1P6FA 5E8PA 2AJUL 3MFGB 4HWZB 1QTYT 5IB5A 5CUSH 1YYMH 2A83B 3QXVA 1G7JA 1A7NH 2V7NB 1A6TA 4HQQL 4RCAA 2AK4D 3KLAB 3RIFK 2UWEE 5KSAB 2M8XA 4RGOL 4JM2F 1HKFA 3HFMH 1CG9B 4I0CC 3DSFL 4I2XB 2P42B 2DDQH 3LRSB 3X3FH 5GISH 4BKLA 1A3RH 3PL6B 4LMQI 1DANU 4U1SB 3MCLL 4JGUA 1IQDB 3JSSA 1JBJA 4O58H 1SJEB 3T4AB 4HJGA 5C0BB 1QLFA 4R26L 5ID0A 1A7QL 3EO1A 3LS5L 5CEXA 2GIYA 3VWJC 2VQ1B 3I2CL 4JDVA 5HHPB 5J13B 3SOBH 3EBAA 1NL0H 4GXUM 1PZUB 4XCCL 1OQOA 2PETA 1XAUA 2W0FB 3ULUD 3W0WE 3MLSL 2OMNA 4QYOB 4PB0L 3REWB 1HE7A 3KVQA 3S5LG 1KIRA 4OGAD 5EUOE 4PRHE 2C1OA 3X13A 4ZYKB 5I0ZA 4CVUA 4ZTOL 1FO0B 5TE6L 3KYAA 3KYMA 3NZ8A 3OWEA 3LKRA 4NN6C 3G04B 1RUAL 1NMAH 4KI5C 1HNFA 2AP2A 5DD3H 4POZD 3GSNB 2F9BT 5KSAD 1NCDH 4XCEB 1GGUA 5C0AA 4ALAL 2C5DC 4KJWD 5FOBB 3HI5H 4MD0B 3T2QA 1BIHA 1YPZF 5IBTL 5HXMA 4ONHA 4PJCB 1G9MC 3B3IA 2BY0A 3MLTB 3TA3B 3E8UL 3BZFA 3PL6D 4XNZB 4CMMA 1GC1L 1R3LB 1PEWA 3AROA 1Q9WB 1TQBC 3IKCA 5BV7H 3EYOB 5C0BD 5CUSL 1YYML 5JOPD 4DEPB 4AIZA 4WHYH 3MRFB 4X4MA 3BEVA 5LXGH 1A3LH 4MZ2A 2IAMB 5D5MF 3MRRA 4B41A 1BEYH 2KKQA 5T1MA 1F02I 2N4IA 2ILLA 3HFML 2AXGA 4Z7VB 2NCMA 3BRDA 2B20A 1LD9A 4PP1C 3KG5A 4JY4B 2DDQL 4P2OC 3L5JA 4PTTA 4IRJB 3X3FL 5GISL 1A3RL 4JQXA 1S9YA 3FQWA 3MV7B 4S0TD 5DRWA 1JF1A 2ADIB 4Q6IA 3GJEB 4O58L 4WUUE 4QF1A 1ZT1B 4NSKA 1HEZB 1Y0LA 3DYMA 3NCBB 4GH7B 3TH2T 3QJFB 3SOBL 4PJGB 1NL0L 2XN9A 4JR9H 3MODH 4U2ZA 1YJDH 3LHPH 2HVJA 4MNHA 2DN7A 4J3VA 1S9WB 3WNNA 3TA3D 1LDSA 1TVBA 3WLWC 5DO2C 3HKFA 1RZ8B 5DJAB 2MFNA 2BVTA 2WNGA 1XGQB 4X6DE 5TFSH 4P5TB 4XGZB 3MRHA 5D70H 4YDLC 2AS5M 2VLLA 3TBWA 2AK4E 5HI5C 3LV3A 1MRCH 3MJ7B 2V9TA 4P4RB 1NMAL 5ADPH 2IAMD 1FV1B 5DD3L 1NCDL 2P8LA 1YEHH 2DWEB 3LKPB 1JTTA 3HI5L 2N7AA 3QIWA 4NQSB 4HV8A 3OXRB 4GKSB 5JPNB 5JO5A 4R97C 5GRJL 5FDWB 3UYOD 4IRJD 4HK0B 4LVOB 3SE4A 3ARBC 3MV7D 1SY6A 3ZT6A 4P2QB 5BV7L 1KNOA 3RIAF 1QSEA 1W0WA 3DBXA 32C2B 2KZWA 3O9WA 2H2SC 3ULVF 1MCPH 5F93C 4QHKI 4LCUA 3ULUE 1OCWH 2DLIA 5LXGL 1A3LL 2EIEA 4BFIB 1BEYL 1JF6A 5KS9F 4U6XA 2QV2A 5LBSH 4UILH 4XAKE 1F6AA 3JBG7 4LOUD 4OD2A 5I18H 5TDPB 4P5TD 2B0SH 3T3MF 3TBYB 1BJ1H 5HYQB 2AXHA 3WUZA 3FOMA 5HGDA 3G5ZB 4YAQA 4PJHA 2EE2A 3FO9B 3STZB 4PGDB 3O4OC 1MJ7H 2QQNH 2KUTA 4JR9L 3MODL 3TN0A 1YJDL 3GMNB 3ARFD 3LHPL 4ZSOE 5JZ7D 3NFPA 1ZA3B 1VACB 3WN5B 5C0BE 5JOPE 4UI2A 5K9JH 2HWZH 2YK1H 1WBZA 1I9IH 3IDJB 3QDGA 4ZUSA 3QNYA 1KLFA 5DJ2A 5TFSL 4P2QD 2Q3AA 5EZIH 5D70L 3BGMB 1JYXA 3FN0H 4HIIA 5IQ9A 4PGJA 1MRCL 2NTFB 5F70A 3KJ6H 1FBIH 5BCAA 3WXVH 3O6FC 4LRIC 5ADPL 5FYLD 3KPNB 2WM0A 1N6VA 1ZHLA 4Q9CA 2BOCB 1YEHL 3KXFA 4LCWA 4F7EA 1WIPA 3AB0C 2XKSA 3FB8A 4AMKH 2EYSA 3KPOB 1ZE3C 4JM2A 2D9CA 3BH9A 1NPUA 1UEYA 5CJBA 4RZCA 2QR0B 2GSGA 5C2UB 1VSCA 3C09B 4F3FA 5CLWA 3HTLX 1K6QH 4JZJB 5L2JB 4UINH 3P40A 3V6FB 1DCLA 4IBLT 4MAYB 4QRSB 3U4EB 3DROB 2KDGA 3QHTC 4TSBH 4PJCE 1OCWL 3V5DA 2WUCH 4JG0H 5BO1H 2BNQA 3BYYA 4LNRB 4RNRA 4Z7WB 4K7FA 3BW9A 5E03A 3C60C 1XF3A 3UZQA 1QVOB 5LBSL 4UILL 4P9MH 3RY6A 4R0LA 4FG6C 1RK0A 1A1OA 3PXHA 1D6VH 4MQSB 4L4VB 2MPAH 1PVHA 4UV7H 5I18L 4LVNB 4NO0A 2B0SL 3L6FA 3VGBA 2HG5A 5F88A 4ZOCA 2X40A 1X6LA 5A2JH 4Z7VE 1P5VA 1S5HB 2DJSA 5C0GA 2WQ8A 1MJ7L 2QQNL 1DQDH 3S36X 3NIFF 1J1PH 3MV7E 1FGNH 3H3KA 2XA8H 2RHEA 1NANI 1YPZA 5K9JL 2HWZL 2YK1L 4MXQC 3NTCH 1OSZA 5J1SC 3HE6C 1X4YA 5EZIL 1EK3A 2F5BH 1D6EB 3K74B 4PJGE 1GXEA 4EZMA 5TGBB 2GJZA 2QTEA 4MAYD 4ODXA 2F58H 5KVMC 2PF6A 2PW1A 3F12A 1FBIL 2VDMH 5HYSG 2X4QB 3WXVL 4HUNB 5B8CA 2JK5B 4XWGH 3BP7B 1NMCB 4IS6A 4U1JB 4CVWA 2HMID 3WO4C 3UZEA 2XXMB 2AXFB 5D5MA 3AS1A 4L4VD 4AMKL 1QO3B 5IVOA 4N0UB 2Y7QB 1IM3B 2HFEA 5L7XH 3FB7A 4KJYA 4X6CB 1CICC 1TCRB 1K6QL 3D39B 4KKCD 4UINL 4NCC1 4RX4A 1NC4A 1K8DB 4TSBL 2HFTA 4NCDA 2WUCL 5BOPA 4MDIB 4RGMC 5BO1L 1WQVT 5GGVY 3A67H 4OIAA 1N3NB 5HGHA 4URTB 3THMH 3VGHA 4P9ML 1MUJA 4P2QE 2FGWH 2WQRA 2LE9A 1LP9B 3NVQA 1D6VL 3QUXA 4AK1A 2MPAL 1NFKA 4UV7L 2MQ0A 4U6YA 5D1ZC 2X4UB 2O5YH 4X4XA 5FYLE 5H94B 2CXKA 3RDTC 2MOVA 4K8RD 2N1KA 5FO7A 1YEJH 4MNGE 2A38A 3GSUB 2Q76B 5EO9B 3GMPA 4V1DA 5F8QC 2X1OA 4DCQA 3CVIH 5EU7E 3RWCB 1KCKA 4QCIA 1DQDL 4NO2A 5FYKH 1J1PL 2B8OT 1FGNL 1QUNA 2XA8L 4JLRA 3TVMA 5DJYB 4NM8L 5HI4C 1LEGB 3BRGC 4LEOB 3NTCL 1OTSC 4WDIA 3D39D 5IW1A 5I1IL 3ZT5A 2F5BL 2W9DH 2EDEA 3QO0B 2H9GB 1CBVH 3DHJA 1S7WA 2F58L 4FP8H 2IJ0C 2VDML 4WIQA 3S37H 4XWGL 3SDCA 4RMVA 2F8XC 2DB8A 5KN5B 1BIIA 5HVHC 2VXSH 1U3HA 3MLRH 4L9LB 5KS9A 3CDGA 1R0AH 3FFCB 5E2JA 5L7XL 2VZTA 4WO4B 4L3AA 3QG6B 3U7WH 1NCUA 3VE0A 3ARZA 1DQQA 4YIQA 4LQFH 1CK0H 1QHPA 2EYRA 5EOCH 3NACL 2BZDA 5IB2A 4Y4HB 4HUVA 4YBQD 1FL6B 3LSOA 4PJ7F 4GFTB 1MHHB 4Y19B 2H45A 1K85A 1U8HB 3A67L 1OT1A 4RMWA 4WFGD 4D0BA 5CLTA 5IW3A 2YD1A 5DYOB 2FGWL 3GIVA 5EZLB 2QQQA 4N5UA 2DLEA 5CD5C 2O5YL 1MCQA 1GZPB 2NY4B 3IGAB 4L8BB 1J1XH 4Z7WE 2R1WB 2XWTA 2X4OA 2H3NA 1YMMA 3UTZB 3VMOA 4U2YA 1YEJL 2BNRB 2X42A 3BXNA 1PYWB 5JIIA 3VW3H 1JNHA 1OQXA 1XGUB 2EDTA 4X98A 4L4VE 4YHYB 5HYJB 1J1OH 3CVIL 3OSKA 4WI3A 4WU5B 1FC2D 4W6XB 1PQZB 1QFWM 3AMLA 4I4WA 4QHNA 4ZO6A 4LEXH 2VXTL 5FYKL 2CR3A 4F7PB 4I18B 4NT6B 1OP3H 3FFCD 3VRIB 2Z92B 5LVEA 4WO4D 1CE6A 5E6IA 4KDVA 4JFEE 4N9GA 1PSKH 4PGZA 3EKCA 3SY0B 5J4MA 3DUSB 2W9DL 4Y4HD 5FGRA 2NY6C 1U8OB 1CBVL 5I1CH 4PBVC 3RWEB 3S37L 4TNWK 3I3EA 3O45B 3O6MH 1FN4A 3CFEA 3CGTA 4ZQKB 5BMFH 1SY6L 2XWBA 2V2TA 2Q6WA 2OI9C 4XNYH 2GQHA 2PTVA 2VXSL 2XZZA 1TPXB 3MLRL 4R96A 3RZCA 1R0AL 3T3PE 4U1GB 4MMXC 2NY4D 1NGQH 1WJ3A 1M71A 2DQCH 4LQFL 1CK0L 3SGKC 4P59H 5EOCL 5I8OH 1D5XA 2BNRD 3NFNB 4OJFH 3F8UB 1MI5B 4PLOB 3VI4F 2P44B 1UJ3B 3S36H 1N8ZA 4LSPL 1KJVA 5HYJD 4N0UE 4QXTA 3QRGH 2FO1A 4N0CD 4PJFB 1MNUH 2BHYA 4X6CE 2VR4A 1GIGH 3ULUC 3DWTA 3D39E 4RDQF 3WHXA 1QPPA 2YPKA 4OGAC 2GTZA 3LKSA 4JVPA 5I76B 5GGVH 3RWFA 5I17A 4Z7QF 4HKXA 1J1XL 5C0FB 3H9SB 5E8DH 4POZC 2DBJA 1OP3K 4DFIA 5KSAC 3VW3L 1MCSA 1U8QA 4KJWC 4QTHB 1TETH 1TLKA 3T0VA 4X8JA 1J1OL 1N59B 1UADC 3REVB 3Q48A 4O2EA 4Y2DB 4YHOH 4LEXL 3ORJA 3OR7A 1WC7A 3PL6C 3IT8D 4XVUD 4CN6A 3VH8G 4GKZB 2FJFB 3NMEA 1PSKL 1SYSB 5AUMA 2DQUH 2G5RA 4BJLA 2H26A 2A74B 1G9NC 3TFKD 3MUHL 1MI5D 5I1CL 5J13C 1F00I 4AH2A 5F3BA 2X7LA 1ZHBB 4BFGA 5HHOB 2ADJA 1RZIA 5BMFL 3MRDA 1JNNH 3F5WA 1ZXQA 4RMUA 3ELAT 1BHGA 4MB3A 4MWFA 4XNYL 1WFTA 4ZUVA 3WFHB 3DV6A 3IRZA 3MJ6A 1WTGT 1FCGA 1HHIB 3HRZB 2A73B 3DECA 4S1SH 1D9KA 1MIMH 1NGQL 4NQEB 5FECA 2DQCL 5ACLA 4TUOB 5ESVA 4OCLC 4P59L 3H9SD 5I8OL 2BVYA 4LU5H 3DX9A 3PIQA 4OJFL 4LSQH 3RVUD 3DYPA 3H8NA 5IG7A 3S36L 1TJHH 3FFCE 3QRGL 4DZBB 1D5MA 2VH5H 4M9OA 3KPPA 3BJ91 1X5KA 1MNUL 4S1DD 4Y2DD 1GIGL 1CFTB 3P2TA 3TA3C 3BO8A 4QY8A 4XNZC 3OZ9H 1JNLH 2DWDB 3EYFA 4U6HA 3WS6C 2GTWA 1FLTX 4Y19E 5GGVL 4DEPC 4HD9A 3HG1B 5IFAH 1CDUA 4XXDA 4GG6B 4JM4H 1RJZB 2IAMC 5E8DL 5DLMH 3L3IA 1U92B 4PG9A 5JORA 4XMPL 5HHOD 1TETL 1QP1A 5IB1B 1NFIB 1S9KC 1FFRA 5H2BA 1AO7B 3FHQA 3MLUH 1UACH 4YHOL 2A1WH 4O9HH 1MCLA 1LMKA 2AEIT 4HBCH 4OUUA 2IQ9H 4IRJC 3MGTA 2BNRE 4N1HB 2YD3A 1BWMA 3O11B 1OL0A 3GMMA 4NQED 2DQUL 5C0ND 3IJSA 1DZBA 1JK8B 1R5IB 1Q9KB 4FXGA 5AAWA 1F4XH 3MZTA 4U0RB 3ZYJA 4OI9A 2D7OA 3C5JB 5TDNA 4UB0H 4N1CA 4G9DB 5CCKH 2DQTH 4PJ7A 2KBGA 4YHZH 3IDNA 4HK3J 1JNNL 4LOUC 1I4FA 1RIHH 2BC4B 4M7LH 2BY3A 3SKJL 3DVIA 5GGRA 4Z9KB 4JKMA 4P5TC 4S1SL 1MIML 2E8YA 4LHJB 4U7SA 3QIBB 3O3DA 3HG1D 2Q87A 2Z9TA 2DTMH 3DSNA 4H25A 3VJ6A 1QR1B 3EO0B 4LU5L 4GRWF 4LSQL 3RHWF 3P77B 2ZOLB 1TJHL 1AFVH 3UTSE 5IHZB 2VH5L 4D0CA 3ARFC 1AO7D 3GSOA 1JRHI 5DGRA 3V6ZB 4LVHB 4OCSH 3WFEH 2ZUXA 4UNVA 5JZ7C 2AV7A 4LKCA 3PGCA 3OZ9L 4LVOC 2ARJA 1JNLL 5CEYB 1M7DB 1MI5E 4QT5B 1IBGH 2DYPB 5FK9B 1Q9LA 3DIFA 4OKVB 3C9NA 5DS8B 3VFOB 4PJFE 5IFAL 1BJMA 4JM4L 3X3GH 3SPVB 2VDLH 1W8OA 4PTUB 5DLML 3RGVA 3RIAK 3CXHJ 3TC9A 1KN2H 5IBUB 2J1KA 3S88H 3OKOB 2R1YB 3RL1A 1OD9A 3KNBA 2ESVA 3MLUL 1UACL 4FFYH 3KPQA 2A1WL 4O9HL 5FM8A 3RVTD 1WT5A 4HBCL 2IQ9L 5EU7C 3VFUA 1KIPB 1NMBH 1GYAA 4QRUB 3QIBD 4K3EH 1OSPH 1CD1B 5I1HH 1MRDH 3MTRA 3D25A 2D0HA 1M7IB 5DJXA 1I7TB 4QHMB 3JWDC 3WJLC 1F4XL 1UQSB 3G6JF 1L7IH 4UB0L 5GRZA 4OFKA 2BSSA 5CCKL 2DQTL 3KYOA 1MSPA 4YHZL 5SWSA 5ANMA 3NPZB 3R0NA 5GS0H 2XPGA 2X6MA 3WN5C 1RIHL 1JHTA 5DZLA 4M7LL 1G7IB 3G6DH 2YUXA 4CAGA 2FSEA 2DYPD 3EOTH 3VRJA 4MCYB 4Z95H 4PJ8A 1SJVA 2XTJB 2DTML 1VGEH 3FB5B 5HHOE 1FP5A 4PRDB 1JIBA 4MA3B 4PS4H 4DAGH 3JWNC 3W9EA 1OF2A 2O26U 5IJKC 4IOSD 2A77H 1AFVL 3GB7B 3ES6A 2DQIH 1YEGH 5FF6B 3X11B 4L8DB 4YO0A 3LVEA 1B0WA 4NQEE 4OCSL 1RVFH 3I3BA 3OF6D 1REIA 5DMIH 3O2DA 2A2QT 4AIXA 4BFBD 4RQQA 3C09C 1XH3A 3AREA 4GW5A 4JZJC 1SYVA 3K2MC 1IBGL 4I0PC 3KDMA 1KTDA 1CGYA 3FMGH 4MAYC 4N90E 2EKJA 3FQTA 4YZFF 3X3GL 1DN0A 2VDLL 1KN2L 2VAAA 1WWAX 3S88L 2KQNA 4QNPF 2HJFB 3V0AC 3CH1A 4FQXA 2HT4D 4OF3A 3HG1E 2FH6A 4FFYL 4D9QD 4X8XA 1T5XA 4LVNC 1SVCP 2CJUH 1AXSA 4GG6E 2K3TA 1NMBL 1INQB 2IEPA 4U1NB 2EDBA 3UTTA 4KKCC 2X10A 4K3EL 1OSPL 3HCVB 1T7XA 2CRZA 1MRDL 2XTJD 5H8DA 1AGBA 5I1HL 5KZCB 1FPTH 3BZ4B 4P46B 1K5NA 4QHLB 5J11C 5JLZA 4NQUA 1AO7E 1Q94B 5IVZA 5K93A 3KS0H 4YQXH 3SDXF 3N1GC 2C3HA 2FZ3A 1CVRA 1L7IL 3IXAB 4N0RA 4Y89A 5GS0L 3MRMA 4HUWA 4FQHB 2V7HA 1NGYB 3HRPA 3W2DH 5GS2H 4FABH 2ATPA 3G6DL 4X99B 3JVGA 3EOTL 1OGTB 2HYMA 3I6LD 3UJIH 4Z95L 3QCUH 4K8RC 1VGEL 1CDHA 3JZ7A 2Z8VC 3MR9B 5I1DB 4DAGL 4PS4L 2EDWA 3C6SA 4M8QB 1MY7A 1KENH 1NMCC 3OJVC 2A77L 2DAVA 3TBTB 4APQA 1YEGL 4N8VG 2WSKA 1A21A 2ICEA 5C07B 1RVFL 2BHZA 4H5SB 5DMIL 2ATKB 1OW0C 4UOW1 1W0YT 3OKLA 3QUKB 4JVUA 2X9WA 4ZAKB 5KZCD 4YHPB 2FR4B 3OAYH 4P46D 3T1WA 4JFFA 3FMGL 3TNNA 3IFOA 2VZ3A 2NPLX 5C09B 4EN3A 1PW3A 4EIGB 4YEFA 3QA3B 4TTDD 1SJXA 4HKBA 1WISA 4C4KO 1IAKB 4JO1H 3LB6D 4MGXA 2MNUA 3EUUA 1R5WA 3KHOA 2CJUL 1JWUA 4LHUA 2BMKA 2YD7A 3QWRD 4GXVH 4DZ8B 2OJEB 4NNXB 4HIXH 4ISVB 3JTSB 1FPTL 4JHAH 4YBQC 1RUKH 2AXJA 2MJWA 5CEZD 1HZHH 4RAVB 1RJLA 4N8PA 4YQXL 3IXTA 3CIQA 4U3XA 4OZHF 2FD6H 3EOAA 4MDJA 1HHKB 3QWOA 1ZVYA 5C07D 5DJ0B 2QSQA 3E3QE 4NJ9H 3W2DL 5KAQG 3IU3B 5HGBB 4EI5B 3RTQA 2X4NA 4ZAKD 2ITCA 1I85A 5GGSY 2G75A 3NIDE 3BMWA 3UJIL 5L8JB 5F9JA 1MCEA 3HMWH 3BP4A 3QCUL 5C09D 4HKJA 3T65B 3B8SA 4N8CH 1CDBA 3MV9E 1ZHKA 3R0MA 1OP9A 3C8DA 1KENL 3BIKB 4D9QE 1CD9B 1XGRB 1FZOB 5CP7A 5FYKU 1QG3A 4ZFOA 3OAYK 5TQ0H 4DK6A 3TYGH 5EO1A 4L9LC 1DLHA 3UX9B 4CU7A 2XTJE 2JE8A 4PJBB 1BVKB 3WLBB 1I8MB 1HSAA 4B0MM 4WO4C 1VFAB 1UZ6F 3TCLA 2IPUK 5F3HA 4KZDH 2P8PB 4Y4HC 3OV6A 2W0KA 5L0QB 4LLWA 4JPIB 3BEWA 5K9OB 4FRWA 5DMKB 4NHUA 1T2QH 5IJVA 4XNUH 1G7LA 3K8LA 1INDH 1HOCB 2DM3A 5B39B 3GDBA 1IC5H 4FQCH 3MXWH 1YDPB 4M6OH 5E5MB 3G6JA 4LP4A 3I6LE 1Z6JT 1AIFA 4JO1L 3V2AR 4EI5D 2I60H 3IAGC 2NY4C 2IH1B 4K94H 3L3OA 5FB8A 2YBRB 3SKMB 4GXVL 3TO4A 4JN1H 4YK4B 4HIXL 3PWNA 5HDBF 5AYQA 4JHAL 1RUKL 4ODWA 4M4RA 5KSUA 4MMZC 4UDUA 4YJZL 1HZHL 1FGVH 4WGWB 4YHYC 4NC1E 1RZFH 3BKMH 3ME0A 5MERB 4N0CC 2E7BA 2FD6L 5T5NG 3LKQA 4I18C 3UDWA 3RJQB 3SE9H 3QEQA 4P23A 4KROB 4NJ9L 4PGBA 5EC2A 4RMTA 3TEUA 1TIUA 2HRPH 3ZHKA 3PGDA 2VLJA 3HMWL 1C5CH 4LLAA 3TPUA 4YR6A 1LEKA 3O2DH 4N8CL 4L8SB 3K7UA 5LWYH 2JJWA 4NBZB 3MNZA 3J7HA 2SEBB 1T5WA 3BHBA 4I13B 4Z76B 3CVHA 4DN4H 3OXSA 4JQIH 5TQ0L 5I1JH 1TPXC 3AU1B 3TYGL 1ZA6A 2QL1A 2C4FU 4KRMB 4U1GC 4C55A 4XVUC 5IWLC 4JCLA 3C2AH 2XICA 2YD8A 4BH8B 5B38G 3VXRB 4MQ7A 1A1NA 3O4LB 3MLYH 5CEZE 3O3EA 3LN4A 4RA0C 4KZDL 3TFKC 1T03L 4F33A 1DTUA 1UJ3C 3MRQB 4FFZH 2YS4A 2R2EA 1HILA 1T2QL 5C07E 4WWKB 5ETUA 4HGWA 4XNUL 5JNYB 1CGVA 5ABDE 5BVPH 1J86A 1INDL 5JMOC 5DK3A 2WW8A 1UXWA 1IC5L 3TZVB 4XMLH 1FZKA 3NA9H 4NOFA 3SDXA 4FQCL 4M6OL 1BREA 2L0DA 5F72S 2FWOB 4KROD 1UH3A 1KT2B 5C09E 2I60L 2CLRA 2C3VB 4HFUH 3RWGA 3LEXA 1TNNA 2WINB 2VZ1A 3QXWA 4JN1L 5ACMA 3RUGF 3I84A 1IAII 1C12B 2E3VA 3FN9A 5DD5H 3RVUC 1VEMA 3O8XB 1FGVL 3MFFA 3VFTA 3VCLB 1QZ1A 1RZFL 1V7NH 3BKML 4Y5VB 1TVHA 4TYUA 4NQXB 1NGWA 3FFDA 2APFA 3HNSL 5FOJA 2FLBT 5D2LB 4S1DC 2EDQA 4Y2DC 5HYSA 1J8HE 3BKCH 1JPTH 2BY2A 4YLQT 2O61B 3OGCB 2ZP0T 4PRNB 3SE9L 1EAPA 1OLZA 5E94A 3UROR 3VXRD 3O4LD 2BJMH 2VLKA 4M62H 4OTXH 4TUKH 3PDOA 2HRPL 1IQWH 3G5VB 3W9DB 2ZCKH 3VFPA 1C5CL 2X41A 3Q6FA 1XZ0B 4P3DB 4LSVL 3F6IA 1FL3B 4WWKD 1WZLA 4CADA 4X80L 3O2DL 5LWYL 2DLTA 3FTGB 5GRWA 1K4CA 1TITA 3TZVD 3S9DB 1JV5A 4F9LA 2VABB 3P73B 1H8OA 4Z5RB 2BRRH 3SBWC 1TFHA 2ZUQB 4JQIL 4DN4L 5EWIH 5I1JL 1IARB 5SX5K 3BAEL 2CLZB 1ZK9A 2F74B 5D2NB 5KVFH 1I1YA 2VL5A 3KR3H 4HUXB 1S7UB 3HZMA 5C6WH 3U6RB 3C2AL 1B2WH 1UKTA 3MLYL 1JI1A 3TGXA 5FA4B 5C0NC 1NCBH 1YQVH 1CFNA 4KKAD 5I16B 3MRGA 3KPRB 1LK3H 4JFHD 4Z8FH 4U33A 3O8XD 4FFZL 1NJ9B 3HPJA 1JGLH 4PJBE 4XPBL 5BVPL 5B3JE 2AJZA 1H3XA 2EDRA 4XMLL 3NA9L 4M93B 5DHYA 4OZHA 3GUTA 3JV6B 5I2IB 5LAXB 2YRZA 4HFUL 5EIIA 4BQ8A 3Q3GB 1IEBA 4GRWH 4CJ1A 4R4BB 2WBKA 3UTOA 3N0PB 5J3HD 5MEQA 2VN4A 4OQ1A 2EZ0D 5DD5L 1ORSA 1BZQK 4WRLA 2R2HA 1KOAA 3IF1A 5J89A 2VERN 1V7NL 4JRXB 5DJZB 3V0VA 3KWWB 3HAEA 3MCKB 3BKCL 1JPTL 4KDTC 3DVGA 4OLZH 4N1EA 4NFDA 1W72A 1Z3GH 5CJXA 4AEIH 2BJML 4JFXA 2IADA 5AZ2H 1FC1A 3I9GH 4M62L 4OTXL 4TUKL 3WJJA 5IMOA 1IQWL 3KPRD 5BXFB 2ZCKL 3SHSA 3A6CH 5F7EH 4U0RC 5JOEA 2VDRH 5F7KC 2RJMA 5HY9B 2WBJB 3C8HA 2W92A 4UBDD 4ODBD 2AABH 2ICWJ 2BRRL 4DKDC 5EWIL 3CFIC 1L9NA 3DRTA 4ZDHB 5KVFL 4U1IA 3RVTC 4MD4B 3KR3L 3G6AA 4NRZB 3QIBC 1I3RB 1B2WL 3OR6A 4YFLI 3VXPA 4U1KB 2V9RA 1NCBL 1YQVL 3SGJA 3MJ9A 4LBEB 3GMRB 4PBWD 1LK3L 5K9KB 4OFYD 4H1LB 5DZOA 4Z8FL 1RZGA 4JRXD 1FNLA 1E6OH 1JGLL 3QDJE 4L5FH 1GGBH 3ARDB 1HXMB 3VXRE 3HC3H 3IFPB 3O4LE 4LVHC 2OM5A 4MD5B 4Y8AA 1U8PA 3IDXL 4PRAB 5KSBB 1UEMA 5LGHH 4K71B 4Z7OF 3EDDA 3WIIH 5EZOH 2E5EA 4KI5F 2IH3B 1YY9D 1JZ7A 2ZSWB 4E0RB 4ERSH 1DJSA 3OJDA 3OJ2C 4BQ6A 2EIDA 2DQDH 3C5ZA 2EDDA 5DRXA 1QA9A 3FQXA 3JV4B 3DRQA 2FEEL 5GQBA 2AEPH 2WBJD 3QULB 4RSVA 4X9HA 4KAQH 1Y18A 1U91A 4ZTPH 4KRPB 4OLZL 2WIMA 2XZCH 4MLIA 5EU5A 3DARA 1MRFH 1Z3GL 4J1UB 5CIPA 4JFHE 1I9EA 3AUVA 3W39A 3EGSB 4Z0XB 4AEIL 3A6BH 4OLYH 4TSCH 3GSVB 4WUKH 3OG4B 4NKMB 5AZ2L 3E3QC 3I9GL 4XRCA 4ZFOL 3CVHH 4JFQA 3IVKA 1F13A 3A6CL 5F7EL 3RWIB 3SDDB 4NNYA 3KLDA 5E4IA 5E9DB 3DUHA 2E9IA 3ARDD 3HUJB 2VL4A 5F21B 2OYPA 1T2JA 3MO1A 3RNKA 2R23A 2HT4C 1NFDF 2AABL 2ORBH 4OSUH 4JN2B 3X14B 2KH2B 1WFNA 3MNVA 5F9DC 3QEUA 3Q6GH 1ZS8B 4WV1B 3S3JA 2FATH 5DUBA 1AGCA 4JFDB 2RFXA 2XTJC 2R0LL 4NIKB 5DHVB 4E5XB 5C0IB 4X4YA 3TT1H 2CK0H 1T04B 3DTXB 5DDHA 4ZO8A 3CFJA 3RUGA 4LIQH 3CCHA 4V2BA 4L5FL 2V2XA 1GGBL 3SKOB 4KRPD 3HC3L 3BGAA 3C8KA 5JPMB 1KGCD 4XNXL 5LGHL 3KPRE 2A6JB 2E9JA 3WIIL 5EZOL 1V3LA 4E41B 3S3PA 3SKNB 4KC3B 2XA3A 4ERSL 2C3WA 3VH8A 1X5ZA 3ALXA 1U3YA 2DQDL 3DGCR 1K8IB 5GGSB 2NTSP 3SDDD 4I3SH 5E9DD 1A6UH 2AEPL 2R8SL 1FFNB 4C83A 1ACYH 4ZTPL 1JUFB 3FT2A 4HZLA 2XZCL 5I1AB 2QADB 1MWAB 1MRFL 4EOWL 3HC4H 3EJYD 3B9DA 4TULH 1T66D 3QIUA 4JFDD 1QSFB 3A6BL 1BD2B 4WUKL 4P46C 4JRXE 5A16B 1F3DJ 5LGJB 3CVHL 3BPNB 4XWOD 4OGXH 3T0XA 1AI1H 4B53A 5EU3A 3P4NB 1Q1JH 4TTDC 1U95B 4IRZH 2YSSB 1CFBA 3ARTA 3H6JA 1FVDA 2ORBL 3LB6C 4OSUL 2W60A 2VZSA 5JHDA 1MCJA 1PAMA 1ZEAH 3QDMA 4PIRF 3Q6GL 5GGUA 3OKNB 4E41D 2M26A 2P47B 4FXLA 2FATL 2NQCA 1F3JB 1N26A 4GAFB 4WCYH 4IMLA 1IGTA 4JPVH 1B4RA 3TT1L 2CK0L 5ICXB 4NWUH 4YE4H 3SE3A 2Q8AH 4LIQL 4D0DB 3KLSA 1MFAH 1J0HA 4NO5B 1H8SA 4YXHH 1X4ZA 4R4ND 1RZKC 4KPHL 2QADD 5I1LA 4NRYA 5DJCA 1QSFD 4NBYB 1BD2D 1KV3A 5F7DA 4M00A 5DEZA 1VFBB 4N0FB 4UNUA 4WEUD 5KW9H 5BW7C 4TUJB 1INEH 4X5WA 5JW5A 1FZMB 2FIRT 1X5IA 4GW4B 2Q86A 4RAHA 1W72H 1IGFH 4OZGF 3G5YB 4X0KA 2CRYA 4OZFB 3RP1A 3ROLB 1ZGLB 5KSBE 4FA8A 4GOSA 4I3SL 4ZS7H 5I66A 1A6UL 2W07A 5IMMB 3ECBA 1HI6B 5SX4H 3KYKH 2DIJA 1ACYL 2A6IA 4GKNB 3L3HA 2AW2A 3BGFB 1DE4A 1JPST 2WWKO 5F7LB 3DHMA 3NIGF 3HC4L 1K4DA 4TULL 3ARRA 1C5DB 1A6ZA 4P2RB 4OZIB 4PY8I 1IKNC 5FO9A 2HKHH 3VWJA 3GKZA 5C0JA 2HJKA 2X9YA 1LILA 1AI1L 1XEDA 1F97A 1Q1JL 4Y1AA 4IRZL 3E6FB 1BX2A 4JDTH 2NX5A 2DIBA 5D7SH 1WBXA 2HJLB 1R3IH 1A1MB 4EI5C 5CAYB 1ZEAL 5KAQF 3D2UA 3X12B 3QFJA 1UG9A 3DXAA 3T09A 1H8NA 3D0VB 1S7QB 3LKRB 5E9DE 1PKQA 4WCYL 3HUJE 4JPVL 2W65A 4NBXB 1D5BA 3I02A 3IU4H 4P4KA 5T5FH 4QRTB 3VDAA 4DKFH 4NWUL 5C0AB 2CKBA 4YE4L 3EZJB 2Q8AL 1NDGA 2GAZA 3VFRB 5IB4B 2OXGA 1MFAL 3CXHK 3MRJA 3GSQA 1OAZH 4I8DA 4LSSH 4JFDE 4YXHL 3LCYA 3VFMB 4WY7H 1GHFH 3UBXI 4WHTA 3P0VH 4CMMB 3DJ9A 3IETA 4L1HA 1N5YH 5FO8A 4JDZA 43CAB 2G5BA 3IKCB 4P2RD 1Q8MA 2WK2A 1QOKA 1R24B 3MYZA 2WMPA 5L0QC 5M94B 1U8KA 4AIZB 2GK0A 1MREL 1INEL 2PW2B 1W72L 1YUHB 3QT2A 1I7RA 1IGFL 3TYFB 4P3CH 5EORL 5EO0B 4ZS7L 3HN3A 4HFWB 2YN3A 3U4AA 4GW1B 4E41E 2FECL 1FL5B 3KYKL 1LD9B 3D69A 4DK3A 4P2OA 4MCZB 4ZNEA 1NFDA 1M6OB 3QUMA 1MHCA 4K3HA 3T0EB 1R3KA 2BVPA 1L6ZA 4YK4C 5JW3H 5CD3B 3D1MC 1YN7B 4OGYL 5IMKA 2HKHL 4JFOB 1Y0LB 2MWCA 1JGEB 5C0AD 5ICZA 4POYA 3IJHA 2UWEF 2X70B 1FNGA 5C0CB 4H0IA 4JAMA 1LVEA 5EC1A 1CXLA 4CU8A 1QSFE 4JDTL 5T5NF 1Z2KA 5D7SL 1R3IL 3BDYH 1T20A 5KVEH 2G9HB 2DD8H 2VMFA 5EBWB 3BN3B 3LPFA 4LVEA 3VA2C 5A43C 1H3UA 5KTEH 4QTIH 2BRQA 3B4NA 2P8MB 4X6BA 3DVFA 4WFEE 4M9PA 4L8SC 3D3VA 5IVXB 5T5FL 3ZE2F 4DKFL 3RY5A 4ELKA 4ORZC 4ODTH 4XPTH 1XF4A 3KLHD 1BVLA 2VXQL 5T3XH 4HV8B 2RB8A 2LTQB 1ES0A 4Z0BH 3PWVA 1OAZL 2J5LC 5EOQH 2W0PA 1A3QA 3X17A 4HPYH 1CXFA 3MNWA 5FGCB 3FHAA 5T1LA 2AV1B 1SM3H 5EUOF 4WY7L 1GHFL 3ZDZE 3P0VL 1JGVH 3ARBA 5ID1A 1AR2A 3T0ED 3I3DA 5IEKA 1N5YL 2ZUYA 2EDHA 2OMBA 5IB3B 2ICCA 1A8JH 5FXCH 2R69H 5EOTB 3T0BA 3I50H 3PHOB 4WWKC 5DXWA 5C0CD 4P3CL 4WI4A 1CU4H 1HHHB 4PREB 2DJ4A 3TBSA 4B5EA 5INDB 4EDWH 1U8IA 3TZVC 4YGVB 4XZUB 3ARVA 1F4YH 2VB5A 1A9BA 2MKWA 3N06B 2R4RH 5CWSB 2EYTA 4LAJH 5T3ZD 4EI6A 4WW2C 5T33H 2WAHA 1MFEH 1A7OH 4JY6A 3E6HB 2HA1A 2QSVA 3QZWB 5JW3L 4KKAC 1NBQA 1XGPA 2OZ4H 1T1WA 3ETBF 3WFDH 3O8XC 2FYYB 1PEZA 1QRNB 5IQ7H 4Y5VC 3EYVB 2W91A 1T7VA 5DQDH 4W6WB 4I48A 5F6HJ 3HI1B 3GJFA 1RZJH 4P2RE 4OZIE 1WAAF 5E0QA 1ETZA 2D03H 4ZNCD 2ARWA 5KVEL 2DD8L 4ZUSB 3DUUA 4KGLA 5DJ2B 5L2KB 1EIBA 4N8VA 3GSXA 2GUOB 5DD0H 1FZJA 2P49B 3D18A 4P5MB 4UDTB 5KTEL 4QTIL 5J3HC 2B1HH 3QXAA 1X5HA 1BZ9B 1ED3A 4KVNH 3WFCH 2EZ0C 3RZCD 3BP5A 3O6FA 3HZKB 4LRIA 4YHIA 4O2CA 3SO3B 5E5UB 2JCCF 1R5VA 3BD4A 4ODTL 4XPTL 5TDOB 2VRAA 3HS0B 3RKPA 3RNQB 5ALCH 4OZGA 2OTUB 5T3XL 2ZUQC 1VENA 5D2NC 3V5HA 4PP2A 2EYSB 5EOQL 4HPYL 2ICWA 1Q9OA 4JKKA 5B3NA 4PJIF 5C86A 3H9HA 3WNPA 4RZCB 1SM3L 4NHCL 1BPVA 2GSGB 4X7SH 5D9SB 3T77B 5B21A 1JGVL 5KVGH 2I9LA 4X6DF 2VN7A 2VITB 1EHNA 3S96A 5C0AE 2FO4A 1S9XA 3QG7H 3QO1B 3P9MA 2HP4A 1PY4A 2R69L 1JMXA 4ZXBB 3I50L 3WCYA 4PG2C 3MLXH 3UEZA 3GFUA 1QRND 3WO3B 3U0PA 4RFEA 2HN7B 5C2BH 5SWQA 4ZUWB 1LO5B 1CU4L 4YPGB 5CJ8A 5JA9A 4K7FB 3C60A 4EDWL 4CRPA 2GKIA 2ZNWA 4UBDC 5EFIA 4M93C 1F4YL 1GPOH 4AZ8A 1DQTA 2R4RL 2CPCA 1NGZB 5F7MC 3B8YA 4OF5A 5L2KD 4XC3H 4J23A 5T33L 1MFEL 4WI7A 1A7OL 2ZPKH 5EBMA 4F7MB 5F1NA 4K7PY 2X89A 1RSFA 2EO1A 6CGTA 4G3YH 1JWMA 2OZ4L 4XCYA 3WFDL 2VXVH 1OT2A 5JQ6H 3ULUF 3MROA 3OHXA 5IQ7L 2XQBH 5BJTA 2FLRT 1U8MA 2OL3A 3TIDB 4BA8A 5DQDL 2UUDK 1UJTA 2LVCA 4M1DH 3T0EE 3MRPA 1BF8A 3CPLA 4GQ9H 1RZJL 2CMRL 3UPRA 2VDQH 2D03L 1IL1A 1YPZB 2CKBH 3HE6A 5DD0L 1YY9C 2PTTB 3P0YH 5F9WB 5C0CE 5DVLA 5HPMA 4ZXBD 2GJZB 4ODXB 3Q5TA 2B1HL 1WLHA 4LGSB 5EPMA 1U9KA 5J9PA 1G9MH 2PW1B 2GCYA 4WI6A 4KVNL 3QQNA 3VDCA 3WFCL 1IKFH 3C5SA 4G6FB 1BOYA 2WBJC 3KJ4B 5T3ZE 3U48A 4LK4A 4DOHB 5ALCL 4QHUA 5DEGA 5J12B 1I3GH 3B5HA 4K94C 3QNZA 2HFEB 2YPLA 3FB7B 3L7FA 4XNMA 3VI3F 4X7SL 5KVGL 3PHQA 4Q2ZA 1MLBB 3QG7L 3MUJA 1C08B 4WI2A 3ZHDA 4FQQB 4LLQB 3MLXL 5F7FA 5FGCE 4HIEB 1JE6A 3FQRA 3GMLA 2YA2A 3QUMH 3ARDC 1CDYA 2I27N 3RPIB 1MUJB 5A3ID 5I8CB 2UWEA 3M17A 3PWJA 5JXED 1GPOL 2D0GA 4K71C 1AGEA 3QUXB 3ZT7A 3DGGB 1N2RA 2V5SA 5D1ZA 5CBEB 1FORH 4KQ3H 4XC3L 4ZPTA 1ZLSH 4MJ5B 4U7MA 1UWXH 1NCTA 2ZPKL 1G9EA 3OKEA 4LLVB 2I07B 2OTWA 3RDTA 3PV6B 2XI9A 4G3YL 4PJCF 1J0JA 2VXVL 4G6FD 3ZKSD 5JQ6L 1CE1H 1F3RB 2XQBL 1YEEH 2J8HA 4ODSH 1KACB 4KRPC 4M1DL 5FKPA 2EC8A 3FRPG 2ZCLH 1R3HA 4GQ9L 3RA7H 2NNAB 4GAGH 4J3TA 2VDQL 1DUZB 4ZMAT 2DI9A 2BSRB 2E9WA 3L3DB 2CKBL 4WDIB 2MCPH 1QRNE 3FN3A 1NEZB 1VGKA 3P0YL 4H0HB 4PRHA 5EUOA 5D72H 4D8PA 5EN2A 3UBXB 1G9ML 2EE9A 3SDDC 4Z7VF 1IKFL 4RBPH 2UZIH 3SDCB 5L2KE 1MOEA 1D3CA 1FNSH 2VYRE 4UQ3A 4G8IA 3H0TA 2PCPA 4F15B 1I3GL 3BESR 3QUXD 5FUCE 3CC5A 3IDIB 3T8XB 5KS9B 4M61A 2Y1VA 4WV1C 3EJYC 4OIIH 1DBBH 1T66C 5DQJB 3VE0B 4OZ4B 5HI3D 1DQQB 2AJXH 2H6PB 3CFCH 2EYRB 1U58B 4LCWE 4XWOC 2D0FA 3I6GA 4WI9A 3FRUB 2YRLA 3CSPA 2IMMA 3U46A 4IRSC 3QUML 3BPLB 2ENYA 1U8NA 1UWXK 1OAUH 4E42A 2NY5C 4EQ2A 4CW1A 4YFDB 2IALA 3AS2A 5E8NB 3WEXB 2VO5A 4C56A 1P7KB 1WAAA 1FORL 4KQ3L 1Z0NA 3L3KA 1BOGA 4H26B 3OX8A 4NO3A 3GJFH 1H3WM 2FJGA 3S7GA 4NUJA 1R6VA 3T1FA 1A6VH 1UYWL 3BYTA 3SDCD 3RIFF 2DKMA 1CE1L 3O41A 3ULVD 2J7LA 1YEEL 2MMXA 4ODSL 5HJ3A 4ZFFB 4K7PH 4EDXB 1Q0YH 1KJMA 2JCCA 3PJSB 3TNMA 5IOPA 4R4NC 2ZCLL 2QADC 3KYNB 3RA7L 4KMTH 3TV3H 2KL6A 4GAGL 5E08H 1LO4H 1VEOA 4OQTA 3HZVB 2I5YH 1CE6B 4RBPK 1CIUA 3CSGA 1DDHA 1CT8A 2MCPL 4PJIA 5IBUG 1QR4A 4O00A 4U1HA 1H3PH 1ONQB 4Z78B 2FJHA 5D72L 3BPNC 43C9A 2OR9H 4X6DA 2F53B 5C9JA 2Y5TB 3L7EA 1WWCA 2AK4A 4XBPB 1VPOH 3GI8H 4F9PC 2GFBB 3VFSA 3DO7A 2DQHH 2UZIL 3M8OH 1KG0A 1HINH 1YPZE 3CFBA 1OTUD 2V2TB 1FNSL 3BWAB 1P1ZA 3B6SB 4LCCB 2R15A 2ERJB 4G6AD 1T0MB 2LU7A 3K8MA 3QFDB 4OIIL 3IKKA 1DBBL 3S6CA 3UYRL 3VXTB 2UYLB 2Q20A 3FKUS 1GGCH 2ITDB 2AJXL 3SGKA 3CFCL 3MRNA 4IMKC 1IFHH 1X5JA 4DOHE 3OKMA 4HG4J 2EH7H 4LFHD 1KB9K 1TZHA 3P4MA 3GSWB 5CZVH 1FRGL 3ARGB 1N0XH 3ALPA 4IDLA 4L29A 1OAUL 1SMAA 4NZTH 2VWEE 3D0LB 3GJFK 3C08H 3WDHA 2GTZB 1MEXH 1AR1D 1I1RA 4HWZA 4XBEH 3CSYB 4XCFH 4PBXA 4PYHA 2CGRH 2A83A 4HKXB 2HKFL 1Z5LB 5CILH 1KTLB 4UIKH 2V7NA 2F53D 4R4FH 5D71H 2F19H 5KSAA 1A6VL 5GRVK 1G0YR 1KJ2B 1S8DB 1TJGH 4X8JB 5MEOB 5CSZA 4S10A 2LFGA 1CG9A 1FNAA 1M7XA 1PG7X 4K7PL 4I2XA 1I1FB 1Q0YL 5CZKA 1CLZH 3LRSA 3BGFC 4KMTL 4TVPH 3PL6A 3PWLB 5GRVL 3RWDB 5E08L 1LO4L 4L1DA 4U1SA 3HC0B 5F97E 1BFOB 1SJEA 5ADOH 2PXYB 3T4AA 5C0BA 1V7MH 2JIXA 1LEIB 1H3PL 4Z7WF 1F4WL 2OR9L 2VQ1A 5HHPA 1P4BH 1U8LA 4AH2B 1HXYB 1VPOL 3GI8L 5E7FA 1L0QA 1Y6NR 1UWEH 2NW3B 4QHKJ 3ARGD 2W0FA 3M8OL 4KZEH 1HINL 5MHSD 4QYOA 1EO8H 3ULSB 3REWA 3MRDB 2FRGP 1ZWIB 4ZUVB 2FIKB 3DV6B 4U6TA 4ZYKA 1FO0A 4HH8A 3BH8A 5H37G 2A9MH 2J8UB 1NAMB 3ULVE 2NY7H 1GGCL 4G8GB 4XVTH 1IFHL 3GSNA 4JQVC 4GG8B 4XCEA 2EH7L 5F7NC 3VXSB 5FOBA 1WCBB 5KS9E 4KXZI 3L3JB 3QI9C 3PNWB 5CZVL 4MD0A 5HDOA 4DFHA 5T1KB 2Q7NA 5IMLB 4PJCA 1N0XL 3O2VH 2JLLA 1MCKA 2O5XH 3MLTA 2KQMA 4NZTL 3VG9B 3TA3A 3BZEB 1S7XB 3UYPA 1BFSA 1R3LA 3NFSH 3OG6B 1MEXL 3T3ME 3EYFB 3T3PF 4ZO9A 4XBEL 3EYOA 4XCFL 1JPFA 2PXYD 4GMSL 3UJTH 2CGRL 4O4YH 3EYUH 3MRFA 5CILL 5HSFA 4UIKL 1AGDB 3VXNB 3WE6B 2IAMA 4R4FL 5D71L 3KPMB 3SE8L 2F19L 4HDIB 5E8EB 1MFDH 1TJGL 2XG5A 1E28B 3ABZA 3KLHC 3LQZB 1KLGA 3O3AB 4Z7VA 4X6CF 5H2BB 1V3KA 2HRLA 3BVNA 3N1PC 1CLZL 2XNAA 2L4OA 3U79A 1J0KA 4IRJA 4OUUB 4TVPL 5EA0H 4EUPB 3O81A 4JQXC 1EJ6A 3MV7A 4LSTH 3T0EC 5EU6B 1CL7I 5SWZB 3GJEA 5ADOL 5KSVA 4L8CB 4G8GD 1ZT1A 4HS6B 4XBGB 3IDGB 1JPGB 4MSWB 1V7ML 2NR6D 3JTTB 4JRYB 2UZXB 1HEZA 4P5KA 5E7BA 1NCAH 3NN8B 3A0OA 3VXSD 5ISZB 1P4BL 3QJFA 1NKRA 5D6CB 4JO2H 5FCSH 3FONB 3P9LB 3TP4A 1LP9F 5TDNB 1DLFH 1JGUH 1UWEL 5LCVH 5T1KD 4KZEL 1E27B 4IOFD 4HAFA 4JG1H 1EO8L 1S9WA 2ZKHH 3MUGB 2YC1A 3QUZB 1RZ8A 5DJAA 1XGQA 5GGRB 1CD8A 1LGVA 3MLPA 4P5TA 4CN4A 1MHEB 2J12B 4QO1A 3TCXA 5ACZB 4MHHI 3MJ7A 4P4RA 3U36B 1K3IA 2NY7L 2RQ8A 4UU9B 2CDFB 5FV2A 1FV1A 4XVTL 4JPWH 5HGAB 3G9AB 4LCYA 1G7QB 3NCJH 3LKPA 4CDHA 5I6XB 2PNDA 4NQSA 4X7TB 3UTQB 2LTQC 3RX7A 3ARFA 1MCRA 4ESKA 5JPNA 3JUYA 3O2VL 1X44A 4K55A 2O5XL 5FDWA 3UPAA 5C1MB 3NFSL 5IKCA 3BDXA 5EU6D 5SWZD 4P2QA 4QRRB 2D7TH 3UJTL 2EE3A 1UM6H 4DWHA 2GK2A 32C2A 4O4YL 4JRYD 3EYUL 3VXQB 2YZ8A 4LSDA 5MHSE 5ISZD 1BBJB 4K3JH 4BFIA 4NQTA 3HE7B 3PWUB 4M03A 1JN6A 1BQHB 4OQTH 4HJ0D 1MFDL 1XCQB 2GT9A 4RAUB 3KNBB 3QUZD 1GRWA 5TDPA 4JY5H 4PPTA 4W68A 3VFUB 5EA0L 1MFNA 3TBYA 5HYQA 4LSTL 1FE8L 4M3KB 2H8PB 1HQRB 5B39G 1E4XH 3D25B 4GO6B 4HHAB 3BIAX 5DJXB 2CK2A 3G5ZA 1NCAL 2CUMA 3FO9A 3WJLA 3STZA 4KH2A 4MXVE 2PN5A 4JO2L 3HR5B 4PGDA 3Q0HA 4U49A 1DLFL 1JGUL 3GMNA 4Y88A 5LCVL 3BKJH 5IFJB 5E2VH 2D4FA 4JG1L 4RMRA 1AD9B 2ZKHL 1ZA3A 1VACA 3WN5A 1X7QB 4AQ1B 2X2YA 4G42B 3IDJA 5E1AA 4I3GA 2WBWB 4QRRD 5FAAA 3BGMA 2IPKB 4Y5YB 5FUCC 4LSUL 3WDJA 2MHAB 3ULUH 2NTFA 3WSQH 1A4JB 4CGTA 4JPWL 3HE7D 3KPNA 3M07A 3SO3C 1PG7H 2PYEB 4DGIH 2BOCA 5IJKA 3WUWB 1OF2B 3NCJL 5LG1A 2Z91B 5IIEB 2DS4A 4X7FC 1JNJA 2DRUA 1P7QB 3KPOA 2XOTA 4LLDB 2J8UE 3OMZA 1A7RH 2FCBA 1G7MB 2ADGB 2QR0A 4G8GE 3DMMB 3AREB 5DMGD 1H3TA 3VXSE 5L2JA 5D7LB 1H3GA 4I0PA 2YXFA 2D7TL 3KDMB 3V6FA 4DQOH 1KPRA 1UM6L 1QFHA 4ZXBC 4MAYA 4QRSA 3DROA 5DVKA 3HLAB 3K46A 3FQTB 4K3JL 4LNRA 1DN0B 2D31B 4Z7WA 3PP4H 4OQTL 4NFCA 1QVOA 4JFYA 4MJ6A 5ILTH 1JHLH 5HYEA 2NXZB 4LLMB 4BH7B 4AL8L 5B22A 1G9NH 4L4VA 3TBVB 4JY5L 1G1YA 4B7IA 3UJJL 4XCNB 1B0GB 2EDLA 2NXYB 4U3CA 4MQXD 3LKNB 1E4XL 4AM0B 2APVA 4IIQB 1UB5B 2I9TB 1IE5A 3ZDXE 5E8OB 4XP5H 1SMOA 1I7ZB 2PYED 1HKLH 3BQUB 4AT6B 1SVZA 1FO0H 5E24E 4H20H 3RI5F 4C58B 5EUKB 3VXUA 3BKJL 1P7QD 4OCXH 5SWZE 5E70A 5E2VL 5A3IC 5JXEC 3FQUA 4UZGA 4KRLB 5H35B 3DMMD 3GSNH 4JRYE 3T0AA 3ARED 4KQ4H 4HXBH 4OV5B 5D7LD 5ISZE 3JV5A 3MRIB 3PABB 1D6EA 5F9WC 4M5YH 3BT2H 1TTFA 1UH2A 2CO6B 3ULUL 3WSQL 3RVXD 5IK3B 4Q9QH 1J0ZA 2LU3A 1N4XH 3KJ4C 1PG7L 3FT4B 4U1JA 4NKOA 4DGIL 1NUFA 4LL9A 2NXZD 5J12C 3OB0H 1QO3A 5B38B 1IM9A 4N0UA 1J11A 2Y7QA 1IM3A 1A7RL 2ZSVB 3B2UD 3BSZH 1YY8B 2HT3C 1OW0A 4X6CA 3NAAH 2NXYD 1S7TB 1TCRA 3D39A 1J18A 3BUTA 1VFUA 4DQOL 3BOVA 3K1DA 4JFFB 1K8DA 1QEWB 4FHBD 4C59B 1CFVH 2VTFA 3BQUD 5EZJB 4LF3A 4MDIA 1KLUB 3R06B 3PP4L 4UT9H 1KCSH 2VKWA 1SHMA 1TENA 4E9LA 4D9LH 1CGTA 5DD6B 1BZ7B 5ILTL 1JHLL 4QRRE 4BSWB 1LP9A 3HB3D 1G9NL 3RAJH 3QUXC 4IDJH 2UVFA 1V05A 2HT2D 2X4UA 4POUB 4LHUB 1JZ8A 5DJDB 2L7UA 2EEAA 1MJUH 5HI3C 4N0YH 4NOBA 4YXKH 3TIEB 4M02A 4UAOB 3GSUA 2Q76A 4PJEB 4XP5L 4UV4H 2HLAB 1HKLL 1AQKH 1FO0L 2APXA 4H20L 5L9DH 4YFEA 2OR8A 3QHFH 4F7CB 4OCXL 4CVXB 1CFQB 2BXZA 1OAKH 3MRCA 2NMSA 5EU4B 4WU7B 3QQ9D 4WUUB 1LEGA 3GSNL 1OM3H 4LEOA 4GG6F 4HXBL 5GJSH 4RFNB 1H0DB 4M5YL 3BT2L 3GM8A 3QO0A 2H9GA 4JFFD 4KV5F 4G80B 4CUCA 3T0DA 1YQ2A 5SWSE 4Q9QL 4PRPB 1SEQH 1ULVA 3SDCC 4BFEA 5FV1L 1N4XL 4TNWF 5KN5A 3ZKQD 5IHBA 4F15C 5J8OA 3S34H 2CDGB 1MQKH 3FFCA 4GBXB 1HSAB 4WO4A 3BSZL 1K9TA 5FYLH 4LHUD 4YBHA 3U7YH 3QG6A 3NAAL 2A6DB 4Z7QE 2RCSH 2PYEE 2DOCA 1CZ8H 4Y4HA 5ESAB 2Z35B 1FL6A 4LLWB 1XF2B 1YA5A 2YD4A 5DK2B 4JGMA 1MHHA 1YC8A 1CFVL 5CJOH 5DWUH 1U8HA 3BPLC 1WIOA 4UT9L 1KCSL 1OTUC 1V8HA 4MJIB 4D9LL 4MYWB 5D7LE 2XXCB 5DYOA 2DMKA 5EZLA 3ZTJG 2CRIA 1A2YB 3RAJL 4WUUD 1B6UA 4IDJL 3JWDH 7CGTA 5AAMA 4H1LG 1RFDH 4G6AC 3SGEH 1GZPA 3IGAA 4G43A 4L8BA 4JZOB 2CIIB 1JZ2A 1MJUL 1YYLH 4N0YL 4RFOH 4Y4KB 5D93B 4YXKL 3UTZA 4UMGA 4HT1H 2BNRA 4PRPD 1DUYA 5KOVC 4Q7DA 5F1IB 4UV4L 5HYJA 1CLYH 1AQKL 1CXIA 2Q8BH 5IHLB 5L9DL 2NY1B 4WU5A 1E4WH 1PQZA 3B5TA 3CXDH 3QHFL 4LPYA 3UTTE 5FKAB 4F7PA 4I18A 4NT6A 4P2CG 4M3JA 3VRIA 4GBXD 1OAKL 2Z92A 2R29H 5CGYD 2A6KA 2W38A 1AR1C 5DRNB 2BNUB 4JEGB 1OM3L 3V7AE 2AQ1A 3SY0A 5GJSL 3DUSA 3FO1B 1FHGA 3ARXA 3CH8A 1U8OA 4JFZH 2X4PB 4ZSOB 1LEKB 3AMKA 1SEQL 3O45A 2IC2A 5JA8B 3CDFA 2D2OA 1ZV5A 3S98A 3FL7A 4MJID 1AD0B 4CNIB 2FDBP 3HA0A 4J2XA 3S34L 3LIZH 4LCCC 4CVZB 2JF1A 5F89B 5IVNA 2ERJC 4HF5H 5IWLA 5FYLL 3U7YL 2RCSL 4Y4KD 1EBAA 3NIDF 1CZ8L 2VIRB 4PJDB 1Y6KR 3NFNA 4HGKC 4XAKD 1UJ3A 4F33B 1YNTB 5CJOL 5DWUL 2B39A 5ETUB 1FYTA 4QGTA 5GZOD 3GEWB 4PJFA 3ARGC 2NY1D 2X4SB 1FG9C 5AG8A 4GMTH 4KKLD 2DLFH 1EV2E 3T0WA 4FFVD 3LD8B 2BVUA 3PF2A 3JWDL 4JFFE 4D94A 1S5IH 5I76A 1NGXB 1RFDL 2FGZA 1I75A 5F1SA 4HIHA 4DKAA 3EYSH 5C0FA 1YYLL 4H0GA 4RFOL 3H9SA 5D7KD 4PV8A 4HT1L 4KY1H 4NKDB 1PX3A 4J12A 4NQVB 3ZE1E 4QTHA 3BFOA 1X5YA 2JELH 4MB4A 1CLYL 2QKIB 4L3EB 1TVHB 1N59A 2Q8BL 1JYNA 3REVA 1S7SB 1E4WL 3MGAA 4Y2DA 3CXDL 1A7NL 1BFTA 4PY7A 4K8RH 4A6YB 2R29L 3LH2H 4PJEE 2FJFA 1SYSA 2PXYC 1N7MH 3K2UH 3FCTB 1DEEB 2A74A 5FUOH 5C7XH 1RHFA 3PDOB 4JVWA 4JFZL 3VFPB 3Q6FB 3L1OH 4LHQB 3GSRB 4CADB 5HHOA 1ZHNA 3STLB 1EEUA 4HLJA 4IJ3C 3SBWA 5IBLD 3UXFA 3WFHA 3LIZL 5FGBC 4QKXB 1HHIA 3MMEB 5HPOA 2DKUA 1QNZH 2A73A 4HF5L 3BP6B 4PRPE 1YMHB 1MHPH 4NQEA 2GEEA 1FH5H 2H32B 2HFGH 3QSKB 2D7MA 3ZHLA 4TUOA 2CD0A 2NR6C 3OL2A 3MRGB 3E0GA 3BX7C 5ICYB 1FYHB 4ZUUB 3VFWB 4BQ9A 5TE7H 1C8PA 1JGDB 4L3ED 4DZBA 1AHWB 4MNQB 2YUVA 4MA1B 4GMTL 2DLFL 4IOFC 1CFTA 5GS3A 1JCKA 1DR9A 1EX0A 2DWDA 4OZHB 3VWKB 5JUEH 1S5IL 1GGYA 1BECA 3FRPA 5HHNA 1IEBB 3EYSL 1IMHC 3STBA 6FABH 5E6ZA 1GL4B 4GG6A 3PG2A 4MJIE 3CU7A 1RJZA 5GXBB 4U31A 4KY1L 1W0VA 1U92A 1JWSB 1DQJA 4OKDA 2JELL 3IF1B 5IB1A 3ZKXB 1NFIA 2PYFB 1MELA 4HCRA 3HAEB 2B1AH 2YD6A 3P11H 2DQEH 1EEZB 4KDTA 4NPYB 4K8RL 4CDGC 2AJYH 4N68A 2CO7B 1U8JB 4MA8H 4TOYH 3H7BA 1F6LL 3O11A 1F4AA 4BSVB 4MNGB 2BCKA 1D5ZB 4OZFG 1N7ML 3K2UL 3WL9A 5FUOL 5C7XL 3CMGA 1JK8A 1R5IA 3V5KB 1Q9KA 3FOLB 3WHE1 3EOYG 4NDMB 3EOBB 3CJJA 3L1OL 3C5JA 2YEZA 3P0GB 4XXCC 3QEQE 4G9DA 4MNQD 2GJ6A 4HJ0C 5C92A 4KRNA 3PHSA 3JXAA 1TXKA 2EE6A 1Z9MA 3QUZC 2BC4A 1S9VB 3VWKD 5D7KE 1QNZL 4PV9A 1ADQH 3QIBA 2RAMA 5BVJB 1MHPL 3ISWA 1FH5L 2HFGL 1H15B 1QR1A 5FM4A 1IGJB 3O3BA 4NKQB 3L5IA 3QHZH 2OBGA 3P77A 5BZDB 2KZ1B 2ZOLA 5I6XC 4KKNA 5IHZA 3TO2B 4KK8D 4H8WC 1OWRM 2X05A 2E6JA 4HUMB 4JFPB 5KJRH 3QNXB 2EKSB 4PLKD 3V6ZA 4XTRD 4DUWA 4NQDB 4PJDE 5FA3B 1QFUH 4QT5A 5JUEL 2DYPA 3DX7B 1BLNB 4OKVA 4AQOA 4FZ8H 5DS8A 2R56H 4OCNC 4WFHE 1FQ9C 3VFOA 6FABL 1LK2A 3BRFA 4X9GA 1UCBH 3ZL4H 1C1EH 3SPVA 4BZYA 1FVCB 2XKNB 3HE7C 4PTUA 1UGNA 4NQCA 3VRLF 1ZLVH 1U93B 4PJBF 1XGYH 3OKOA 3V4VH 2R1YA 2DMCA 5B3JF 1MCPL 2B1AL 3P11L 4R7NB 2DQEL 4ZO7A 3WNMA 3OF6A 1WT5C 5EU5B 1KIPA 2AJYL 3NCYP 4XPHH 4PGCB 4MA8L 4NJAH 2XWJA 1RQ5A 4TOYL 2EDOA 1MF2H 1S7VB 5CIPB 1CD1A 1T4KB 5DMGC 2FX8H 4X83A 4B7LA 1I1AB 4L3EE 1M7IA 1JJUA 1I7TA 2XTLA 4KKBD 1P53A 3DPBA 4QOKB 1JTOA 1UQSA 3O6LH 4NNYB 1EDQA 3LQAH 1WBYA 4PYGA 1UA6H 2Z8SA 4S1RH 1XT5A 4JFEB 4NQDD 5GSVB 1G7IA 4OF0A 3H9ZA 3QEUB 4O2FA 4YNYA 3QQ4B 4MCYA 1G0XA 4Y5YC 4LDLB 3M1BB 1RMFH 3GRWA 4MQXC 3FB5A 3CZFB 4OD3H 5DQ9B 4PRDA 3DI3B 4MA3A 1DFBH 3QHZL 1I9IL 4OLWH 3BIBX 5HHVH 2WV3A 5JTWA 4M6AA 1BAFH 3GB7A 3FN0L 5AYUH 3LN9A 4V2CB 5FF6A 1Q0XH 4MZ3A 4L8DA 3X11A 5KJRL 3KJ6L 4ZS6D 2BVOB 3DMMC 4CMHB 2IF7A 1UXSB 3AREC 1QFUL 3UTPD 1ZLVK 1I1AD 4FZ8L 2R56L 1FAIH 4MNQE 1ND0B 1WIUA 5GRUH 3RVXC 4QOKD 1UCBL 4J3UA 3ZL4L 1C1EL 3CX5J 4O02H 2D7QA 4ONFH 1KELH 3QXTA 1MLCA 4HW6A 1C7SA 1C16B 4OZHE 1ZANH 1XGYL 5FYJD 2YXMA 3G08B 9CGTA 2NXZC 4JFED 4DTGH 4HUUB 3DV4B 1TVDA 5F1KC 4JHWH 4JG0L 3QXDB 3B2UC 5CKGA 3ARWA 1INQA 4XPHL 5IEHB 2NXYC 4NJAL 3V9FA 1FFPB 1MF2L 3HCVA 5DURB 2FX8L 3S35X 3BZ4A 4P46A 1WSST 3QH3B 4IIQC 4G8FB 1YEFH 3FO2B 4QHLA 5F7UA 1H5BB 5CSBA 1Q94A 1F90H 3LKOB 1G7HB 4DGVH 3BQUC 1LE9B 4HIJB 4WWID 3O6LL 3IXAA 1ZSDB 3KPTA 3QAZB 2OQJA 1IC4H 4I5BB 1B6DA 1UA6L 3B9EA 4WW2F 4ODHH 3QZWG 4S1RL 3HB3C 4FQHA 5E00A 4ZFZB 3RI5K 2ZCHH 2HT2C 5JHDB 5DMJB 5DJ8B 5GGUB 3JVGC 1OGTA 2DQFB 3QWRA 1IEAB 4Y16B 1HHGB 3V4UH 3MR9A 2A9NH 5I1DA 3I75B 5DFVC 2C4XA 5D2LF 1DFBL 4M8QA 1CDCA 1KB5B 4OLWL 3VFNB 5HHVL 4KK6D 2ZNXA 1BAFL 4Y4FB 5AYUL 4OLUH 1NANH 1OWWA 1Q0XL 5C07A 4L4TA 2ATKA 2X44D 3QQ9C 3QUKA 1N64H 4RIRB 5DURD 4YHPA 2FR4A 1RAMA 4Z77A 3OKKB 3RX5A 4HCRH 1CLOH 1FAIL 5BW7A 5C09A 1MH5A 3F62A 3LY6A 5GRUL 3AAZB 3BUYB 5GRYA 4O02L 4NQDE 4S11A 4ONFL 2EC9U 3ZLQC 1KELL 3QA3A 4P57B 4M48H 3RY4A 3OB8A 5DHXB 1ZANL 1P4LB 5DC4B 1SEBB 1CGSH 1IAKA 3V6OE 5DT1H 4DTGL 4MAUH 5E95B 5DSCB 1G6RB 4JHWL 5JHDD 1T7ZA 2M1KA 3L3HB 2E7MA 4GUPB 2JJUA 3WFBH 3THML 4DZ8A 2OJEA 1KCUH 3UP1A 2R2BA 4NNXA 4Y16D 3INUH 2AQ3A 3JTSA 4ZFGH 4W81A 3OGOE 4UAOC 1YEFL 5FO9B 2DQGH 4ETQB 4RAVA 1F90L 3CFDB 4RRPG 3VWJB 5E2UH 4DGVL 2COQA 1NH6A 4Y4FD 4XI5D 4YDKH 1IC4L 3QUYB 1HHKA 3UTPE 5DJ0A 1BX2B 1CF8H 4ODHL 3MRKB 3KPSB 3IU3A 2ZG3A 5HGBA 4EI5A 4G8EB 2ZCHL 5M95B 3CDYA 4QOKE 3D2UB 4RFNC 3LEYH 3QFJB 1UENA 1YNKH 4XVJH 3T65A 3V4UL 5FYJE 2A9NL 2J3SA 1D5BB 4P4KB 1ACZA 1QQDB 3BIKA 1WFUA 4GXUN 1XGRA 1FZOA 1QBAA 2QHRH 3MRBA 2Z31B 4OLUL 1EMTH 3AM8C 3VFGH 4FP8L 4Y19D 3MUY1 1I8MA 4PJBA 1BVKA 4GBXC 5CGYC 2I24N 2B4CC 1N64L 1VFAA 4ZOBA 1BQLH 3GHEH 2P8PA 3RUGE 1M05B 2LU4A 1A4KB 4HCRL 4JPIA 1U8KB 1CLOL 3UTSB 1C5BH 3U7WL 1P69B 2Y6SD 5A1AA 1HOCA 3NZHH 5B39A 4M48L 1FG2B 3QUYD 1CGSL 5E5MA 1YDPA 5DT1L 5GSRB 4MAUL 4KGJA 1AJ7H 3KPSD 2JJSC 5GIRB 3B9KB 5JR1H 2V5YA 3RWHB 2IH1A 3WFBL 3U0WH 1A6AB 1EUUA 3QFJD 5ECJE 2YBRA 3SKMA 1MHCB 1R3KB 1KCUL 1T3FA 4Y4KC 5D93C 4EXPX 1H3VA 1IILE 3DI2B 3INUL 4ZFGL 5E2WH 2EDNA 2DF3A 4LMQE 2DQGL 1LO2H 4P4KD 3JWOC 3EFFB 3QJHB 5E2UL 5MERA 5ICZB 1GH7A 3LN5B 4OAWB 5GZOC 3V52H 5KSBF 2Y23A 4AG4H 4EVNB 1G84A 2NY1C 1I8IA 2Z31D 4KKLC 4YDKL 4C54A 3GRWH 4M8VA 1CF8L 1RHHB 3UDWC 3ROOB 4FFVC 3SJVB 1CVSC 4WGVB 1T20B 1S78D 4UUJB 4YH6A 3TJHD 3I6KB 1EBPA 2LVEA 3LEYL 1BBDH 2H1PH 3NCMA 2Y4SA 4GRMB 1L9MA 1XIWB 1DEDA 5ESQB 3UTSD 3WD5H 1YNKL 4XVJL 3VGGA 1ITBB 2QEJA 3HHRB 5IGXH 4L8SA 4F37F 3R4DA 4MVBD 2AI0H 4LLUB 5JHDE 4Z76A 3V7MA 5I0DA 4G7YH 4HH9B 2QHRL 5ELIA 2OSLB 4W4OC 3V0WH 1BVLB 5D1QB 3GGWB 2EEBA 3AU1A 4X5LA 1EMTL 5A2FA 3VFGL 25C8H 1NEZG 3B9KD 1IGMH 2QBWA 3MNWB 5TF1H 4HLZH 3UBXG 3O6ML 4LQ1A 5CFHA 2NW2B 4M6NH 4BH8A 3SDAB 3VXRA 4Q74A 3O4LA 5ID1B 4OF6A 1BQLL 4X5XA 2QQLH 3GHEL 5DTFB 1J5OH 3MRQA 1UZ8B 3HUJF 4FXKB 2NY3B 2C7UB 1C5BL 3CSBA 4WWKA 5JNYA 3OAZH 3NZHL 4OBRA 3E1F1 3IAPA 3TZVA 3ZO0A 1FCCA 2YPVH 4O51B 2OK0H 5IBLC 3LD8C 2FWOA 1HSBB 4UQ2B 3SJVD 3WLWD 1AJ7L 1P2CB 3VXOA 1ZVHA 1KT2A 4PRIB 2EYTB 2C3VA 1QPXA 4WW2A 4EI6B 5H37H 1YEDA 3T4YB 3U0WL 2DIAA 1MFBH 2NYYD 3PE9A 1XIWD 4J3OC 5E2WL 1C12A 4FN0A 5I8EB 2H2PD 4XP9H 5B4MD 3U30B 3O8XA 1LO2L 2Y25A 3VCLA 1P84J 2P7TA 4Y5VA 4NQXA 2P46B 4AG4L 5D2LA 1MCIA 5D1QD 3SQBA 1PJ9A 5FYJU 4NFBA 3ZE0E 2O61A 3GRWL 3OGCA 4IHOB 5J0BA 1O7VA 4PRNA 1T1ZB 5CEZH 2P48B 3SDAD 1NBVH 2OJZH 4LFHG 4LPUA 1BBDL 3D18B 1QFWI 3G5VA 3W9DA 3ALWA 3WD5L 1LNUA 1XZ0A 4P3DA 1QRKA 2NY3D 1FL3A 1ED3B 1RZKH 5IGXL 2Z93B 2OXHA 3FTGA 3KPSE 2AI0L 1J0YA 2VABA 3P73A 4Z5RA 4F9LC 5E5RB 4PJXB 3V0WL 2EXWD 3W5NA 4J4PD 2BK8A 3QFJE 1MCWM 2BOBB 1O7SA 3EO9H 2CLZA 5D2NA 1JYWA 25C8L 4JO3H 3V5HB 4Z7OE 4HUXA 4PRID 1S7UA 3K4ZA 5TF1L 1PKQE 3U6RA 2Q1EA 4M6NL 5J6HA 1EO5A 5BQ7B 1T0NB 4N90D 3OAZK 3U0TB 1HK6A 2E7CA 2K7PA 5E2TH 5FA4A 1IC7H 3SGDH 5J7CC 2QQLL 5I16A 3LZFH 3KPRA 4P9HC 1J5OL 4CKVX 5D8JH 5F7YC 4PG2A 1NJ9A 3S4SA 4FTVB 3WYRA 2YWYA 5SWQB 2XT1B 1AHWC 5EOCJ 4MA1C 3RWJB 2VQTA 1TNMA 2BSTB 5IW6B 2YPVL 2AK1H 2OK0L 5BZWA 3PWPA 3JV6A 4YDVB 3VWKC 5I2IA 1IGYB 4UTAH 1AE6H 5LAXA 2VNCA 3D6GA 3ZDZF 1G6VK 1Z9LA 1MFBL 5FM5M 2L7JA 3TM6A 4R4BA 5ITBH 5EBMB 4Y2OA 1YECH 4OFYA 5CMAB 4XP9L 1AKJB 4JRXA 1P9MA 5DJZA 3ZKXC 4KK8C 5E99H 1ORQB 4ZODA 1KJ3H 3KWWA 3MBEB 3MCKA 1V3MA 2X4TB 4PLKC 4XTRC 5J6GB 2EH8H 4JE4B 4BK5A 5FIEA 1N6QH 2QSCH 2EDXA 3F7YB 3IDMB 1KYOJ 5CEZL 5L8KB 5JDSB 3CFKB 1NBVL 2OJZL 4YHKH 2EDYA 2WP3T 2F8VA 1G7PB 1EHXA 1K2DB 4YDJB 5BXFA 3P4OB 5EPMB 2IWGA 4FTVD 1RZKL 3L5WB 3WNKA 3O6KH 3QEHB 2Y36H 3SJVE 5HY9A 2WBJA 2HVKB 4R7DB 2HTLD 2Y72A 5DEGB 3EO9L 4JO3L 4OZIF 4MD4A 5J06A 3IJYB 3QNZB 4NRZA 4UNTA 1I3RA 5DVOA 3D3VE 5E2TL 3MV9B 1VFMA 5MP6H 1IC7L 3PHQB 4LBEA 2HFFB 3GMRA 3LZFL 1U2HA 3DETD 5K9KA 4JANB 4KKBC 5D8JL 4HMCA 1AKJD 3WBDA 1KF9B 4K07A 4F2MB 1NQBA 4RGMB 3MBED 3ARDA 1HXMA 3IFPA 1UKQA 1AP2B 4MD5A 4F57H 3PQYB 2AK1L 4PRAA 5KSBA 1CD0A 4UTAL 1AE6L 3GM0A 2IH3A 3V6OC 2GY7B 2E6QA 3WFEL 2ZSWA 1CQKA 4E0RA 5ITBL 2IFGA 4HJJH 1YECL 2W59A 3JV4A 3U1SH 2WLZA 1T21B 4YWGH 1JRHH 2CIKB 4PRIE 5E99L 3KPLB 3ZDYE 3ILPB 1KJ3L 1F2QA 3DNKA 4EEEA 4HS3B 2WIIB 1T83C 4G9FB 5FKPB 2EH8L 4ZS6C 1T1XB 4BUGA 1N6QL 2QSCL 5I1GH 2HMIC 4J1UA 4WEBH 2BXYA 4OFVA 4Z0XA 1UVQA 1I1AC 4YHKL 3GSVA 3MV9D 4NKMA 1KSRA 5JOFB 3MV01 1GJIA 3CLEH 1FJ1B 3SDDA 4J6RH 3O6KL 3S5LA 3WFZA 2Y36L 5I1EH 3CUPB 5E9DA 4EUPG 3U2SB 3GMQB 3HUJA 3KGRA 2CLVA 2UVEA 4ODUA 3PQYD 2XFXB 4JN2A 3ESVF 3L9RB 1ZS8A 5IR1B 4G7VH 4WV1A 1CQYA 3BKYH 4JFDA 5DHVA 3SGEI 1EGJA 1HHJA 4PJXE 5HHQA 5CHNB 5AWNH 4HWBA 4QRPB 1NKOA 1T04A 3DTXA 4LGPB 2EICA 4PY8J 4HC1A 4OUOA 4IRSA 3SKOA 1I3VA 4G9FD 4F57L 2VXUH 5JPMA 5C0DB 2A6JA 5J1TC 1OTTD 4E41A 1UFUA 2DQIL 2CXGA 4FTVE 5IVXF 3SKNA 5HHMB 1TQCB 1BOGB 3MOBH 4HJJL 4PJ5B 2MSPA 3MGOA 1K8IA 5GGSA 4AEHH 4FQIH 3TJEH 1BFVH 4S2SB 4KK6C 2ZZUT 3MV8B 5DGQA 4YWGL 5AEAA 1DBJH 3O41B 1JRHL 3BPCB 2CQVA 5HJ3B 1NAKH 4EJ1C 1DANT 4K3DH 3K0WA 4JJ5B 1JUFA 2JCCB 3TNMB 1ZVSB 5I1GL 4RGNB 4WEBL 2IBBA 1BD2A 1BQHG 2XQYG 1GGIH 5A16A 4PJIB 5LGJA 4U1MB 3NBNA 4X6EB 3MBXH 4HMEA 1H5BC 4J8RB 3LDBB 4KDWA 2NY6B 4QRPD 4KTEH 1NDMB 1J8HB 3CLEL 3WXWH 5ENWB 4J6RL 4F9PA 3QAZC 3P4NA 5I1EL 1U95A 1V3JA 3ZMRA 3SCMB 4TPRH 5IF0B 1E4KC 3MPCA 4WTZG 2P5WB 2X09A 5FUZH 5JW4Q 4TVSa 3RVVD 2ARJQ 3QQ3A 4G7VL 1F45A 4BQBA 1F3JA 4F80A 3BKYL 3O0RH 4XNQA 4Y16C 5FDYA 5HHMD 4AY0A 4PR5B 1HQ4B 4YDIH 3MOAH 4PJ5D 5DK0B 2V2WB 2VE6A 3MREB 4IMKA 4FABL 2YOCA 5ICXA 3GHBH 4YHMH 3MV8D 4Y4FC 4G6KH 2AKRA 4XI5C 4RDQG 4NO5A 1L6XA 2R2CA 5AD0B 1PGRB 4A2MA 2VXUL 1F11A 4MX7B 4RGND 5C9KA 1X5LA 1VFBA 4N0FA 3LMJH 3WUWG 4TUJA 2NY6D 1FZMA 3MOBL 4GW4A 3DLQR 1MAMH 2OS7A 1J8HD 3PQYE 3G5YA 3NCYS 4OZFA 4AEHL 3Q1SH 4FQIL 3ROLA 3TJEL 3W11D 1BFVL 3MOQA 1ZGLA 3WIFB 3VXMB 5IMMA 5DUMH 1DBJL 1DVFB 1VERA 3SCMD 1HI6A 1ZT4B 5CSZB 3UPCA 1HDMB 1JPSH 2VLRB