5E1AB

Structure of kcsa with l24c/r117c mutations
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords antibody Fab fragment heavy chain
publication title Conformational heterogeneity in closed and open states of the KcsA potassium channel in lipid bicelles.
pubmed doi rcsb
source organism Streptomyces lividans
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2015-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e1aB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e1aB01
3CSYB 1PKQE 3D69B 5CEZL 2ZCLH 5EPMB 5DQJA 5F3HB 1HYRC 4X4YA 2A6JB 4HWEL 3ULVC 5DUBA 2CUHA 1CLYH 3OKDB 3FQWB 4LAJH 4ERSH 1S5IL 3RY5A 4F80A 5LG1A 4XMPL 3PL6C 5I30H 3TVMA 5MENB 1MQKL 1OSPL 3VXQA 5MHSE 5SWZA 1QHOA 2P8MB 4FQ1L 4PV9A 3TZVB 4DZ8A 1DANU 5T1DL 4EI6B 4AEIL 4N8CH 3VFVA 4XPGH 1J5OL 3BKJH 4X6CE 1YA5A 3QQ9C 3O2VH 3O6LL 2NY2B 1MAJA 3M8OH 5EU4B 3LRHA 1ZVSA 2EDTA 1NFDF 1KLFA 4HMCA 2VLJB 4M9OA 2VDNH 3IT8D 5FO7B 4NO2A 4K7PL 4RA3A 3WO4C 5DD0H 1VKXB 5J6GA 3BSZH 3HMXH 2P24B 8CGTA 5J57B 4MD5A 1TZGH 2HVKB 3BP7A 3BKMH 4GMTH 4CKVX 2UZXB 5DD3H 2CK0L 1FG2A 2FSEB 1V3JA 3E2HC 4GSDL 1X5FA 3EHBC 5FDWA 5HVWA 1XFPA 4Q74A 4PG2A 1K4CB 5EN2B 3MV8A 2FX8H 2OTWA 1JWSB 2LAAA 1OW0C 2A73B 1DLFH 1PZ5B 1QSEB 5T1KD 1PX3A 1CXIA 3OBAA 3ZYOA 5C09B 1Z3GH 2YKLH 4CVXA 5D5MF 2NY0C 4U3HA 5C0ND 4XC3L 2QADC 4XI5D 1BPVA 2NNAB 2DTML 3H7BB 3B6SB 4P2RE 3IF1B 2BCKA 4Y4FD 1MWAA 5L0QC 3ULUF 2DM2A 4Q6IC 4GO6B 4S10A 2P5WE 1BD2E 2V5TA 4HSQA 4NJ9H 4QO1A 2FO1A 4GFTB 5D2LB 4XB8A 4KY1L 3ELAT 4Y1AD 5L6YH 3C8DA 4IRJB 1JN6A 5HHPA 2B5IC 2WBJA 1SYVA 5DS8A 5TQ0L 3ZT5A 5T5FL 1GGCH 5DQJB 3EUUA 4X4YB 1MCIA 3QDAA 5K93A 2V7HA 1SHMA 3ZTJH 4G6MH 1XIWC 2EDNA 3I6LD 2ORBL 4PB9L 3MLYH 4KK6D 1SJEA 3VGDA 1E4XI 3TVMB 1EHAA 3L3GB 4HUWA 1JZ3A 1HK6A 1EBAA 1I7ZB 3NFSH 1FGNH 1UM5L 4WEBL 5MI0C 4LPWA 2H9GA 4HBCH 4PY7A 3TO4B 3GIVA 2X9XA 4U6HA 5FA3B 2J1KA 1ZVSB 1N8ZA 5FYJE 3CMOL 4LSRH 3PL6D 2FHFA 4JM2C 3THML 3JWDL 3MTRA 4WW2B 2MQ0A 4GW5A 3HR6A 3UTSB 4NO2B 4LSTL 5DJCB 5ICXA 1CLOH 4DAGH 4X7TA 5J6GB 2HT4D 4P46C 3BJ91 3S37L 5HPMB 2AJUL 3BYTA 4Z7VB 1CXFA 2VO5A 1EDQA 3SKMB 3DLQR 2BVOB 4U1JB 1JZ2A 1WAAF 4XNXH 2ENYA 3AFLA 3P9LA 2EDQA 4KMTL 4LRIA 4NNPL 4V2BA 4KK5C 1RIHH 5D7IE 5JW3L 2HG5B 4LSQH 4OCRH 2OTWB 3BIKA 5J8OA 1X4ZA 1CLZH 4NM8L 5C07D 1G7JB 1R24A 4YJZL 5DT1H 4PJIF 1NCBH 4L3CA 2FX9L 5GJSL 5F9AC 3ARWA 3WL9B 4CGTA 3O8XD 2ICCA 4LGPB 2W9EH 2A9ML 5D1QA 3RVUC 1C16B 2A6KB 3VW3H 3O3AB 1CGXA 3VD5A 1LK3L 4YBHA 3S3PA 3KJ6H 3CJJA 1JN6B 5HHPB 2M8XA 5IOPB 1W72A 3BISA 2WBKA 3LKOA 1BAFH 5DS8B 1XZ0B 1Q1JH 1YMME 5F96L 4A6YA 1UXWA 5BO1L 2V7HB 3OMZA 5BRZE 4LQ1A 2VDLL 5MEOA 4Y16A 5ID1B 5EC2A 3GJEA 4PLNC 1SJEB 2NX5D 5ACZA 4KWUA 2AK4B 1CDYA 1YEKL 1MI5A 3QT2A 2PXYA 5C7XL 3S7GA 5CGYD 1JPST 3QDGD 3DSFH 4HDIA 1II4E 4Y89A 1YJDL 4JO4L 2Z8SA 5C8JB 5J11B 1QUNA 4ODTL 3GIVB 5GS1A 2MJWA 4LEXH 2X5PA 1XGPA 4KQ3L 5KANI 1MUJB 1PKQA 2VZVA 2Z93A 2VITA 3EO1A 3ZE0F 1UCBL 4JEGB 5FKAB 2R29L 4Z9KB 3RWCA 5ICXB 1KPUA 5EZJA 2VDKH 3PWPD 4P9HH 4X7TB 5JPNA 4P2YA 4L8CA 1DL7L 1N6UA 1MHEA 2R0LL 3DUUA 4UB0L 1IGTB 1QSZA 3GI9H 5IB5B 4OIBA 4E42B 3I2CL 5FYKH 4NN7B 2DYPD 3RHWK 3Q2CA 2ZUVA 3ZDYE 5HHXH 2XZAH 1UT9A 1VEOA 2QQNH 4X6CA 4NQVA 5EORL 5CCKL 4WV1B 5BVPL 4JZNB 3RGVB 3HAEH 3D18B 4GKSA 4NUJB 1JPGA 1HSBB 4U4BA 1XR9B 4OCYH 5I17A 4I3SL 3D0LA 1UJ3C 3ROOA 3WXVH 4RAVB 1EHXA 1KUMA 2V2WA 4L3CB 3F7VA 5FUCC 5E56A 5BMFL 1M05B 3BGAA 3LB6D 3HN3A 3ULUL 4BFIA 3TLRA 4LSUH 1X9QA 3BD3A 5J13C 3BZFA 2IPUK 4CN1A 1C08A 5D1QB 3UTPD 3C5ZD 1KG0A 1AD0A 3RIAF 1AQDB 4AIZB 3ZKXB 4Z5RB 2AV1A 4HUUB 4WI8A 3WKML 5D72H 2MCPL 2QV2A 5I1LA 5I74B 1K6QH 1MHCB 5ENWB 1OGAB 1KGCD 1QLFB 1QO3A 4YHZL 4OQTL 1BQLL 2X40A 1G9NC 3EYSH 2C4FU 4WHYG 1SEQH 5ESVB 3S96A 1UXWB 4KKCC 5LWYL 2V5SA 3VFNB 1RUAH 2IALA 4TSCH 5BVJA 5MEOB 4Y16B 5DFWH 3L5WA 3A6CH 3GJEB 2ZUXA 4P2RA 4IRZH 5L8LB 5IM7B 1H5BB 4MNGE 2PXYB 4NHUB 4UBDD 4YGVB 3OR7B 1G9ML 1YYLH 3OF6D 1ONQA 4XWGL 3VG9B 2P5WA 1BD2A 4JFXA 1BJ1J 1CQYA 2XYCA 1S7RA 1EV2E 4DCQA 5GS1B 1JTTA 1JPSL 5GS0C 1PKQB 4W4NA 3TH2T 3DVIA 3QG7H 3RWCB 1S8DB 3MCKB 3DO7A 2D31A 1A4KA 2OJZL 4JFDB 4KMQA 3BE1H 4K9EC 1ZA6A 3PWLB 1YEGH 3DUUB 4OFDA 1FCCA 2J8UB 5B38A 1KJ2A 5ITFB 1IM9D 4G3YH 4JO2H 3ESVF 1KTDB 4NQVB 3GBNL 1RUPH 5EU6D 3ES6B 4F9PA 4YHML 1H15A 3G6JE 1YECL 1JPGB 1UKSA 5TH2A 2HVJB 5JNYA 3D0LB 1INDH 2DQDH 3HNTL 4U1NB 4FZ8L 4Y1AE 1YN7A 4KQ4L 2V2WB 4V2CB 5ETUA 3BZEA 3F7VB 1RI8A 3BVNA 4BFIB 2LTQC 1KF9B 5LCVL 4C4KO 4M5YL 1FG9C 1C08B 5TE6L 4LP5A 4OZFA 1HEZB 1TVHA 3I6LE 4EUPG 5TQ2L 2X1WL 4EUPB 5L88L 2XI9A 3I02A 5D7IA 3RU8L 4ZUWA 4OIIH 2DM3A 3IVKB 4F9LC 5D4QA 1E4WH 2BJMH 2COQA 5A3ID 3NABL 3AY4C 4OF5A 2E9WA 4PJ8A 4G6JH 1FL6B 3ECBB 4IOFD 1R3KA 4AEHL 1RIVH 4WHDA 3O2DA 2NW3B 4P2RB 2EE6A 4M8QA 3IXTA 4MMXC 5EO0B 5DD1L 3X13B 1OWRM 2YUWA 2BOBA 5HI3C 3VXTB 2AEPH 4M7LH 4HGMA 4LAQL 2P5WB 1BD2B 4LPCA 2NY3D 2VISB 2Y5TB 3MCLH 4YFDB 1URLA 3SQOH 4LVNC 5EIVA 1NCCL 4LVEA 5TF1H 4OZIA 2Y7QA 3KPLB 5T5NG 2AJVH 4MAUH 4TRPH 1JP5A 1S9KC 3JSSA 3GSWB 1YMMA 4MD4A 1QLRA 3W39B 3NTCH 2ATKA 3DO7B 2D31B 2EDBA 2IGFH 1IRAY 4FTVB 4WDIA 1U8LA 5JQ6L 5BRZA 1ZA6B 2D7QA 4TVPL 1FLRH 3EFDL 1AXTL 4KMLB 1QFWI 5MEQA 4L29A 5C0BD 4OFVA 2PUQT 5DXWA 2VLRD 5FGBC 1ZKAA 4AMKH 5KSAD 1KEML 3FB7B 4M6NL 4HXAH 4MDJB 4U33A 1H15B 2AQ3A 4UT6L 4KI1A 1RVFH 5DVMA 5F44A 3TN0A 5JNYB 4Z78A 2F58H 3UTTD 3CFEA 5I71B 5I18L 4FP8H 3UJIH 5LVEA 5D1XB 4LCUA 2EDKA 1KENL 3RBSA 3HNVL 1A7QH 4LSSH 3ARFA 5GZOD 2NLJA 3TV3L 3QPXH 1JGVH 3MGAA 2BVYA 5FYLL 2PYED 3T0BA 3KS0H 3X11A 3RY6A 2NX5E 4HHAA 2AS5M 2C26A 4XB7A 1P7KA 1S7UA 5AWNL 4G8EB 1WFNA 1N2RB 3V5HA 5F9OH 3QDGE 5C86A 2OXHA 15C8L 4PJ8B 4NZTH 4LU5H 1GGUA 3MOBH 1NUNB 3D39B 3MRRA 3LKSB 4Y4HD 2O61B 1EBPA 3MV7D 2QQLL 4BQ8A 2QHRL 4TN9A 1YEFH 4XTRC 1AGFA 5DURB 3RX8A 4MDIA 3PWPE 3LQAH 4UT7L 4HIIA 1NMAH 4PV8A 5KAQG 4G7VH 1CCZA 4WJ5B 3TNMA 1QLRB 2VH5H 4JDVA 4WWKC 2DLTA 1AC6A 5DD6B 4M93C 4M6OL 4X6CF 1WEJL 2YZ1A 4WDIB 2R69H 1I9RH 5GRXG 3K2UL 1N5AA 3IS1X 5TF0A 2VR4A 5FGCB 4LKXA 3RX5A 4Q6YA 1VB9A 4GG8B 4U0RB 4MNGA 2ITCB 2FX7L 4MQXD 2AQ1A 1E6JL 1A1MA 1T21B 4JN2A 3AS2A 3PHQA 2WWMD 4E0RA 5IEHB 4NIKB 1G7HA 2CLZA 5FYKD 3UTPE 5C6PB 2VLLB 1QRND 3TN0B 5ESAA 4CNIB 3KLDA 4GBXB 2OZ4A 1KLGA 3MROA 4JPVH 3CFEB 3NGBC 1ZLVH 2R2BA 2RIKA 1D6VH 1GGYA 1F45A 5A2FA 1CGSL 4ZPTA 2YSSB 2A83A 1KGCE 4LCUB 3W82A 4D8PA 3LS5L 3RPIB 1GSMA 2EDJA 4HH9B 4XGZA 5T1KA 5JMRA 2ZOLB 4JPKH 3ARFB 4PB0L 2NLJB 2RBLA 4XMLL 2OR8A 2YN3A 3SKNB 25C8L 2OR9H 2AV7A 5L8JB 3VGHA 1A6AB 4Y4FA 3F7PC 5J3HC 2X41A 5IW6B 2E7LA 1S7UB 3G6JA 5T3ZH 4DKDC 3UPRA 5CUSH 5I76A 4LLDB 5EU7E 4OFPA 1FPTH 2YD2A 3MGTA 2ADFL 5B3NA 1RHHB 4K8RL 3CSGA 3MO1B 5IF0A 4Y1AA 2GCYA 4NRXB 2BNRD 1E4XH 1K8IB 1GGIL 3SGJA 2EE2A 2P43B 4Q9CA 1EO7A 2H2PC 3VG0H 3RVXC 2NQCA 3ZKSD 1AGFB 1VENA 2LQRA 3A6OA 3PG2A 2LU7A 5I1AB 1F3JA 4Z7WB 3GRWH 2DLFH 4LF3A 3FQUB 1L0YA 5IT2H 4HIIB 1MFDH 4HIHA 4I8DA 4PV8B 4WU5A 4HLZH 3GSQB 3DIFA 1J1PL 3HNSH 4JFZL 1RZJC 4APQC 3U0PB 1M7XA 1P4LB 3BEVA 4ODVL 4OLWH 5J12B 3FAWA 3GJFK 2AABL 3DX7A 3PL6A 4LKXB 3TYGL 3VD7A 1V8HA 5GGVH 1CDBA 4XCYA 4MNGB 2Z35A 4D0BA 3EIFA 1E27A 2XZQH 4JB9H 1A1MB 1JMZA 4JN2B 3UTQB 1QFOA 4KTEL 3PHQB 4GW1B 3W9DB 3QA3B 4AT6A 1N6QH 2NXZC 3FMGH 4PRPD 3C2AH 3PV6A 1NGQH 4FNLH 4Q9QH 4OV5A 2KKQA 3U36B 5ESAB 3P0VH 4OCSH 3MROB 3WV0A 1XF4B 2A0LD 4JR9H 3KHQA 1W72L 5DHVA 2R2BB 5D7IF 5DFTA 2XA8H 4KK8C 1UA6L 1HHHB 3MLUL 2HLFC 4A6YL 1QFHA 2D9CA 3JWOL 2YD8A 3M1BB 4XGZB 1LO3L 3T2PA 4PJAE 3WIHA 5F1OB 4HC1A 1NLBH 5I66B 2ERJC 1WC7A 2QSTA 5E6IC 1S5HA 2E7MA 3O8XA 3EOTL 1CL7L 4U1KA 1MY7A 1NUFA 3V4UH 4HJGA 4YEEA 1RU9L 1KB9K 1NCUA 5E08H 5H37H 4HGWB 5ESQA 5I76B 1KC5L 4EI5C 2VDML 4ZTPH 5K9KA 4NC2B 5IF0B 1U93A 3IFOB 4Y1AB 1RZ7L 1PG7H 3VFPB 4OZIF 2DQJH 1TVBA 2LABA 4UV7H 2R0KL 3MOAL 4Q58C 3OGCA 4ZS6C 3JTSB 5IK3A 3J7HA 1RQ5A 2B1HL 1NCAH 2X1QA 3IJSA 4KKAC 2O5YL 1RMFL 4LF3B 2NX5A 1N7MH 5C0BE 2VLRE 2BC4A 5IMLB 2XZCL 4IRSC 3DIFB 3QDGA 5DYOA 3JV0A 1XF2B 5CSZA 1OF2A 2P47B 4JO3L 1R0AL 3ZTNH 2BSSA 4HT1H 2YA2A 2DM7A 3RQ3A 3VMPA 3WUWG 5IFJB 3VGBA 3PL6B 3EZ8A 5LQBH 2X42A 1FO0A 3WUWB 3UTTE 1OAQL 4XCYB 2Z35B 1E27B 2P8LA 5IB3A 3PWPA 4HV8A 3CDCA 4O02L 5E1AA 4NO5A 1BOGB 5F1IB 2DYPA 3MBXH 5EA0H 4KFZC 1EO5A 1K2DB 4DZBA 3ZDYF 2PYEE 1HCFX 2R9HC 4ZFGH 4IS6A 4JFFD 4NKOB 2G60L 1DDHA 3WO4B 1F6FB 5I8KL 5CJQH 3T0ED 4OSUH 3UBXA 3WKNA 3VWJD 2R2EA 3ZYIA 2Z31C 5SWSB 2PETA 1R5IB 4QRTA 5E00A 5AZ2H 5DR5L 4DGIH 2XG5A 4NKDB 2K7QA 3T2OA 4DKFH 1S7SB 3FRPG 4OZGB 1HYSD 1ZEAL 1BVKB 3F6IA 3E2HB 5TDOB 3MV7E 4G6FD 4TNWK 4M4RA 4ZO7A 4QTIL 4AEFA 3MLXL 1IKFL 4OGZA 2P42B 3K7UA 4KKLC 4NPYA 9CGTA 4MHHI 2HLFD 3C5ZA 1MRFH 2VDPL 1KIUA 4ZS7H 3V79C 3LS4L 5IMOA 2NY0B 4KPHL 3PDOA 5A1AA 1ZGLP 2QADB 5KSVA 1NAMB 1TVBB 3SCMC 4Y5VA 4PIRF 5D71H 3WJLC 4O51A 1VCAA 3MMEA 5EBGA 5TE7H 3UPCA 3EYVA 5L0QB 5IK3B 3U6RB 1FBIH 4J2XA 4MLSA 1D6EA 4JKKA 1IZJA 3IJSB 4X9BA 2JB5H 4ZODA 1RUQL 5EO9B 4N9OB 1UM4H 2VERN 3BAEL 2AI0H 1ULVA 2B5IB 3I9GH 4DQOH 2BC4B 1UXSA 3B2VH 3OF6A 1KJ2L 3QHFH 5DUML 4ZUUA 3QDGB 4HMEA 1F4YH 5DYOB 1CS6A 4R7DB 1DQTA 2NZ9D 2BSSB 1XIWB 2EC8A 3EDDA 5FYJL 4CJ0A 5FYKE 4F57H 1QRNE 5DJ6B 4S2SA 1F02I 1FO0B 2FD6H 1D5ZA 5KVEL 4O2FA 4FXLA 3BPCA 2P8LB 1EXUA 2VN7A 3DJ9A 3O2WL 2AP2A 3PWPB 4MCYA 3S34L 4NO5B 1NEUA 4JDTH 2LAGB 3OGOE 4HJJL 5LBSH 5CINL 4JM2B 4F58H 3WFBH 3IU4H 3VJ6B 1X7QA 5K33A 4IS6B 1IM9A 4Z7QF 3DBXB 5IJKA 5C0JA 3HMXA 4QY8A 2FDBP 1DDHB 3E1F1 2I9LA 4X6BB 5DZLA 1XR8B 4P46B 1GIGH 2KQMA 3G6JF 3BP5A 3MNZA 3UBXB 4XPAH 2R2EB 5T1MA 3BRDA 1TTGA 4HW6A 4P99A 4J4PD 1G6RB 1U3JA 2BNRE 4OM1H 1BGXH 3O2DL 4NWTH 3NCJH 5FDYA 1CGYA 2DOCA 5C0FA 5ABDE 1JBJA 1OTUC 1AKJB 1SBBA 4LPXA 5IB1A 4U31A 1L9MA 2Z31D 3BI9X 5J1AA 1LO4H 1ZLVK 2W92A 1Q9OB 1WF5A 3U4EB 5IMOB 3CVHB 4N0CC 4YXLH 4M61B 1G1YA 4WUKL 2KPNA 4Y5VB 5T3ZD 1I3VA 3V6OE 3MMEB 3QULA 2NTFB 4PJAA 2YXFA 4OT1H 5F7MC 3QXDA 4PRHB 4U05A 1W0WB 1JIBA 1QR1A 1CTNA 4I2XE 3T2QA 3NAAH 4M6AA 1WBXA 1I1AD 2B20A 3RNKA 1UXSB 1IAIM 3U7YH 4IHOB 4K2UH 4ZUUB 4K7FA 2AAVA 5AYUL 2V2XA 3P30L 2DQHH 1BVLA 4FQHB 1QFWH 1EA9C 2P45B 3HRZA 4PRPE 1J8HD 3DURA 5ILTL 2HFEB 5IEKA 3RZWA 4UAOC 4S2SB 2J3SA 5GPRA 12E8H 3OZ9L 3BUTA 1FHGA 1CFQA 1NBVH 1P7QD 3BPCB 3L3DA 5GGVY 2HA1A 3CVIL 1U3HD 4Y8AA 3G9AB 4MCYB 2D03H 2F53D 5C0BA 2IEPA 2AK1L 2VLRA 3VH8A 4KJQC 2VSCA 3U9UA 4XVJL 3ALPA 5KSAA 1X7QB 1N4XL 2VDQL 2DMCA 4U1IA 5C0JB 4QY8B 1BFVL 3BWUC 2YOCA 1KV3A 4YPGA 4JM4L 4PJGE 4Y5XA 2GJZA 1KEGH 5L8KB 3BP5B 2UZYB 5I1HH 2FR4A 3Q6GL 3V5DA 1T66C 3LRGA 2Q8BH 3HCVA 3UTTA 4U7MA 3TBYB 5T33H 5D7SL 1I8IA 2DJUA 4WW1A 2A6IA 1L4IA 3HZKB 5DHYB 3C60D 4YDVB 1DQMH 1MHHA 3LRSA 5IB1B 1IC4H 2IFFL 2PYEA 5INDA 1Q94A 2PTUA 4QRPE 4UT9L 3CZJA 4PJ9D 1HH6A 4Y0GA 3INUL 3QJHA 4MJ5B 2UZIL 2GSIA 2EXYD 1FGVH 2P46B 3VXOA 4NNYB 4WEMB 3TBTB 4JAMA 3TT3L 5J13B 1I1FA 1DUYA 4Y4KD 4BZ2H 4PJAB 3V0VA 3CFIC 1ITCA 4M1DL 4Y4HA 1ES0A 1GAFL 3MV7A 3BD4A 5KG9A 5ICZA 4F9LA 5E4IA 3RNKB 2A1WH 2VZ3A 4M7KL 1XF1A 1ZVHA 2CXKA 1TJGH 4K7FB 2NY3B 4MQ7A 1N5YL 1R6VA 1CXKA 3SDXE 1YYML 3E6HA 3HRZB 4M7JL 1CICC 1JRHI 3DURB 3KG5A 2N1KA 2OZ4L 2E9IA 4OGAD 1ZANL 4LVHC 4JFFE 1T04A 2UYLA 3VFTB 3L3DB 2OL3H 1S7WB 4YX2L 3T0EE 5C0BB 3W2DH 3VH8G 1ZGLM 2VLRB 3VH8B 1I9JH 2Q8AH 3STZB 1ZLSL 3WFDH 3CFCH 2WK2A 4WHCA 4DW2L 4QXUH 3TA3D 4GAJL 3QXAA 1KTRL 4YPGB 4RMUA 2GJZB 4UINH 4HIJA 3UDWA 1QRNA 2O26U 3IFNH 3GSVA 3T4YA 5CD5C 3V5DB 4P2OC 5FGBA 3HCVB 3UTTB 3L7FA 3PDDA 3VFUB 4U7KA 3LHPH 4JZJC 3HKFA 1I8IB 3LEXB 1I4FB 4HWUA 1TFHA 4PJCE 3HAEA 4HUVA 4C58B 1B9ZA 5JW4R 3GUTB 1CFTB 4KJPC 1QYGL 1GHFL 4CADB 4WFFD 4MS8D 5HD8C 1D3CA 2I24N 5GZNC 1VSCA 2OBGA 2PYEB 5E99H 2VKXA 2I27N 1HH6B 1F8TL 1W8NA 4U1SA 2FRGP 1D7FA 4DKAA 4C4KT 4M3KB 3ARTA 1GGBH 3VXOB 2LTQB 1V3KA 3G5XA 4KHTL 3PHOA 1MLCA 5DMGC 5JHDB 2R4SL 2UV3A 4YHKH 3P9MA 3U48A 4KRPD 2Z0BA 3ZHDA 3GMQA 2BNRA 4Q0XL 2EH7L 2GT9A 2NR6D 1ES0B 5JLZB 3I50H 3WLWC 4HS6A 1L7TH 2CDFA 4FS0A 5F6HI 4X5WB 1P69B 2XTJC 1I1YA 2C3VB 3IDJB 4MQ7B 3BP4A 4L8SC 2AQ2A 3EYQC 3ISWA 1T0NA 3E3QC 4M43H 3D2UD 3S36H 2G2RA 3RY4A 2PO6C 4FQJL 3V6OA 4YK4C 1P9MC 4HWBH 1T04B 5EO1A 1TZIA 5ISZB 2APBA 4G9FB 3EFFA 4WFHD 1UG9A 2QLVB 4LVNB 1MF2H 1MCDA 4I2XA 5KS9B 4EN3D 1CICD 3WIHL 1UWEH 4EDXB 3DXAB 4HC1L 1NGZA 1T1XA 4WWKA 1R3HB 3RDTD 3UYPA 2BRRL 3ZL4H 4X7FC 3LKPA 4PRPA 3MXWL 4O58L 4HIJB 4PG9B 1IGCH 1QRNB 3JV6A 4I3RH 4NQDB 3T4YB 1XF5A 5JDSA 5JOEA 4NZJA 1U42A 1K3IA 4F3FA 4X6EA 1NAML 4RBPK 1E4KA 3EYOA 1QBML 4XNYH 3TO2B 4DFIA 5T3ZE 1CFVH 4GW4A 4XVSH 1MLBB 2GQHA 2BSRA 1NLDL 3SGDI 3SBWA 4MQTB 4PJAF 4AL8H 3ARDC 4I48B 1YC8A 2DBJA 1X5GA 2PF6A 5C6WH 2R1WB 5D7LB 1AR2A 4BQBA 1ODAA 1VFOA 4PJGA 1CBVL 3VCLB 3L7EB 4GT7A 3PGCA 1MRDL 3G5XB 2KL6A 1T5XA 4GS7C 1KN2L 3D0VB 3P9MB 3OAZK 4POUB 4LVOC 3GMQB 1Q9LA 1J8HE 1FO0L 1A6PA 1MVFA 3S5LA 1QOKA 2A6DA 1WZLA 3L3IA 3U30B 2H8PA 4HS6B 1UACL 1WZ1H 2Z8WC 3GSRA 3T0AA 1KB9J 1I1YB 4Z0BH 4MX7B 3KXFD 4QRPA 1NAKL 5JIPA 2IFGA 1MCSA 4MJIB 2F53E 2P8PB 1IMHC 5DUPH 3FB8A 1T0NB 3OR6A 1ZLUK 2G2RB 4TULL 3MODH 3PWJA 2CLVB 2V2TA 5EO1B 3N06B 3QDMD 4OI8A 3FOMA 3EFFB 2DB8A 3PWUA 3QO1A 4P2QD 3R8BB 5DMIL 4I2XB 2ZUWA 1MIEL 3V4PH 2FBJH 3L9RA 3ROLB 3LKQA 1T6WA 3FONB 4H8WC 5LAXB 2UUDK 4WWKB 4M93B 2ITDB 3SDXA 3LKPB 2CRIA 4PRPB 4JN1H 1NCDL 5HHOB 1RZGA 2HH0H 5HYSG 3JV6B 1WTGT 1JGUL 3CVHL 2VAJA 5HYSB 1DJSA 5HGGS 4JFFA 2DLGA 4F3FB 4X6EB 4P4KC 1R3IH 3EYOB 4M5ZL 5B39A 5JXED 3DV6B 1PG7W 3T0EA 3VWJA 5JIKA 3IB4A 2BSRB 4KRMB 1YY8A 1Y6NR 5GISL 5I19L 2VQ1B 3NGBB 2H2SC 1FQ9C 2ZCLL 3SKJH 2C7UB 1NMBH 1DBBL 2IADA 2ZOKA 2YMXL 1CLYL 4JVPA 3ARGC 1D5XB 5CEZH 4PRNB 5E8OB 3O9WC 4WY7H 4YAQA 1G7MA 4HWEH 1LNUB 5I30L 3VXNA 5DEFB 1P4BL 3B3IA 4JJ5A 3SGKC 1MHPH 4Z8FH 1Q9LB 2JJTC 4PJCA 1MCCA 1S5IH 1W0YT 4N8CL 2A6DB 4HWZA 3L3IB 2NPLX 3O2VL 3ZKMD 4TTDC 4FQ1H 3M8OL 4YR6B 4HF5H 4OBSA 5ECJE 1OLLA 4QRPB 2ZPKH 4NYLB 5K9QG 3QNXA 1KNOB 3Q0HA 2BRQA 3RP1A 3NZHH 1N6VA 2QTEA 3KYNB 3IFPA 4NN6C 4NSKA 3BH8B 3OR6B 4X80H 3KPRD 3V95A 5DD0L 3RKPA 1F4AA 3BSZL 3HMXL 2G5BA 3PWJB 1QEWA 2V2TB 2O5ZH 4EVNA 1JNJA 1UQSB 1A1OA 1FL5A 3KS0J 2PNDA 3PWUB 3H9SB 3O81A 3BKML 3C8HA 4GMTL 3QO1B 3RL1B 5DD3L 4JDZA 5D7KD 1S7TB 1T22B 3L9RB 4HWNA 5ANME 3HR5A 2Z8RA 3LKQB 2L7JA 2NW2B 2F5AH 2A74A 4K94H 4APQB 4R26H 3ZE1E 3FZUC 1LHZA 1TJIL 2HJKA 3TESA 3QPQC 5D8JL 4UNUA 4BH7A 1JE6A 3SDXB 4XBEL 4NGHH 2I9TB 4OCMC 4YHPB 4WFFE 2FIKB 4OGXH 4R96A 1AFVH 4YH6A 1UYWL 1FVEB 1QP1A 4QRSA 2BNQB 5L2JA 1T1ZA 1I7TA 3BMWA 1NMCC 4XC3H 3MRIB 3OKLA 3T0EB 3U7AA 4NJ9L 4F37F 2NXZB 4LFHD 2DQIH 2CDEB 1XGQA 5L6YL 3QRGL 2YZ8A 2X89D 5ACMA 2G75A 4J4PA 3KLHD 4ZSOE 1IGYA 3GSNH 1MJUH 3CX2A 1A02N 2PW1B 2IBZX 3FQTA 1GGCL 4LDOB 5E9DB 1LEKA 2IADB 3RKDC 2P44B 1OB1A 1G9NL 4G9DA 4PUBL 4FXKA 1HDMB 3OPZH 2Z31A 3IDYC 5TQ0H 2DWEA 3MACH 5T5FH 3MLYL 1G7MB 4RGNC 3WN5C 3MREA 1BIIA 2CJUL 3VXNB 4JJ5B 2ERJB 4PJCB 3NFSL 4PB9H 1FGNL 2W0KA 5KW9L 4DTGL 4G8IA 4FA8A 4CU6A 4ZOCA 4XPBL 4EI5B 4WEBH 4WFHE 1T0MB 2H1PL 4LSRL 5F8RC 1JCKA 3C5SA 1WZMA 3FCTB 4NQED 4NKQB 3RTQC 1I1AA 3IFPB 3SY0A 4I18A 1IEBA 1KBGL 4ODWB 1MAML 4F2MA 3CC5A 2APFA 4ZXBC 3KYKL 3HB3C 3JWDH 1SJVA 4QCIB 4AEEA 2RB8A 1A1OB 1FL5B 2WP3O 4G5ZH 5C0IB 1J8HA 1F6AB 3IDIA 4XNXL 5HHMD 1B4RA 1D5IH 2HT2D 4JDZB 3NACH 4F15C 1QHPA 2PCPB 1B2WL 2X44D 4IRSB 1U8KB 1P7QA 1HKLL 4LSQL 2GAZB 1EHLL 1DE4A 2AJSH 1HXYA 4UV4H 1U3HA 1S7VA 3HUJE 4NNPH 5DMKA 4NZUH 4QYOB 4RFOH 5DEGA 1CLZL 2HJKB 2F53A 1BF8A 3W81A 1ORSA 3NCEB 5DFVD 2AXHA 4BH7B 2VKWA 1A9BA 1DP0A 1WSST 5DT1L 5E7BA 3WO3B 2GIYA 3F65A 4ENED 4QRSB 2P7TA 5M95B 2W9EL 5FOJA 4NUGL 5L2JB 4Q9BA 4AZ8A 1T1ZB 3VRLE 1X5KA 2FX9H 4AH2A 4PJGF 3VW3L 4GAGH 5C71A 3DETD 5IB2A 4LHUD 3ARYA 3MLRL 5FO9B 3CX5K 2D7NA 1OAYL 3UYRL 5CZXD 3KJ6L 4M03A 3BQUD 3OB8A 1INEH 1FH5H 1GCFA 1IGYB 4OD2B 1MCBA 4MWFB 3FQTB 3I6GB 2B7DT 4HAFA 1U8PA 1W8OA 2OMNA 2QBWA 3U2SA 3SE9L 3C60A 1UWXH 3VXRB 2Z31B 1MCLA 3KXFE 4PJ9A 3EYFB 3B9EA 3L6FA 1JI1A 5BO1H 4ONOA 4W4OA 2UY7A 1BIIB 1IT9H 2VDLH 4Y19D 5FM8A 1SEBB 1TIUA 4KDTA 5D6DA 4ZFOB 5DRZA 5I15L 2DIBA 4YPJA 3B9KC 2V17H 3IDGB 4Y4KA 2HTKC 5DC4B 5FGSA 2IH1A 4LEXL 3G5ZA 3N9GH 3CUPB 3W5NA 5JMOC 1AGDA 3QNYA 4P2QE 1YJDH 2BHZA 1AC0A 1JRHH 1KT2B 1T83C 3C5SB 4MAYD 4MZ3A 1ZHKB 1I1AB 3R1GL 2FLBT 3SCMB 4B53A 5I8CA 4RZCA 4XH2A 4F2MB 2VDKL 3CC5B 4P9HL 5AUMB 3TJEL 1EPFA 4B41A 4JY6B 3GI9L 1LO5A 4HX1A 1U2HA 5FKPA 5FYKL 3BKCL 1I75A 4L3AA 3SDXF 2H6PA 1J8HB 1RJLA 5HHXL 2R1YA 4XP5L 2R0LH 4UB0H 4PGEB 4MXQC 4LLUA 5GRWA 2QQNL 3VFOA 1ZHBA 3EGSB 3MGOA 4A2LA 4Y8DC 3WMSA 2ARJQ 1TMCB 2W0FA 3GSUB 3SGEI 5DMKB 5DEGB 1A21A 1QA9A 2PYFA 5CCKH 2ESVB 1ORSB 1A9BB 1KXTB 2DQUL 3WXVL 5I1GL 2QKIB 4XBPA 4M1CD 1NANI 3B83A 3C6LD 3TA3A 2P7TB 3MRHA 4OIAA 3AS1A 4AH2B 1M7IA 1DN2A 1RK0A 1TENA 3QWRD 4NOFA 5ANMA 1I8MB 3O0RH 1HQRA 2JK5A 5D72L 5HHVH 3GKZA 1K6QL 4JE4B 4PJCF 5MP6H 3WE6A 1AJ7H 2YN5A 4JREC 1KULA 3EYSL 1S9YB 4NZRH 4M7LT 3QXTA 4TSCL 1BQLH 1OD7A 3A6CL 4PJ9B 1F4WH 5LWYH 1U92B 3S3JA 3KPRE 2W38A 5DRZB 5CEZD 2GJ6B 1LWRA 4S1DC 4NQCD 3P73A 1JPFA 4N90D 3G5ZB 5HDLA 2KDGA 1YNLL 4ZSOA 3BZ4B 3GO1L 4ZO6A 3VE0A 2VXSL 1AGDB 1Z2KA 3RWIA 1XH3A 4N0UE 5DVKA 5D7KE 4KI5D 2ZJSL 3QG7L 5C3TA 1IAOB 3OXRB 1B0GA 4XH2B 3PJSA 3OKMA 4JQVA 1AGEA 1YEGL 3MLTB 5EUOE 5EBWA 3K8MA 1A5FL 1QTYT 2R1YB 3D2UA 2VABA 3VFOB 4G3YL 1ZHBB 4JO2L 5C08E 2FCBA 3MGOB 3PQYD 1K8DA 3K3QA 3QEGL 2W0FB 1VADA 2YA0A 2FEEL 4EN3A 1INDL 2DQDL 3GBNH 2YPKA 3U7WL 5BV7C 1CICA 4G42B 4BQ9A 5D7JD 1YECH 4HLJA 4FFWD 1CD1A 2ZUUA 3RDTA 4F8TA 4Z77B 3FQNA 2D0GA 3TA3B 3FRUA 3MRHB 4FZ8H 4KQ4H 4W81A 1X5XA 1PG7X 4DKEH 1I85C 2UY6A 3L3OA 1I1CA 3SGDH 1RK0B 1IGIH 5F7HA 5LCVH 5CJXC 5ANMB 3FO2B 1U95A 4M5YH 4OIIL 1HQRB 3A6BL 5TE6H 2BJML 3HUJA 3NPSC 5TQ2H 2BHUA 3GIZH 2ICWJ 5L88H 3P9WB 1T7VA 1K3ZA 3RU8H 3CK0L 5IVNA 4MZ2A 4HULB 3PWVB 1RIVL 1ND0A 2YD1A 1KTKE 4NQEE 5EOCH 4F7TA 4JZJA 4AEHH 2AEPL 3HMWL 4M7LL 5TPWL 4WFGE 1CI5A 3EJYD 4Z18A 2CXGA 3SQOL 5IESH 5FK9A 3D3VB 4D0CA 5F72S 4LAQH 2AJVL 1NUGA 1KIPA 4MCZB 5HHME 5FEBA 1F97A 4TRPL 5HJ3B 3VE0B 4OI7A 2YUXA 3H6JA 5D2NE 3RWIB 1XH3B 1NCCH 4G8GD 5GRJH 5IKCA 4XCFL 3NFNB 1ZT1A 2IGFL 4KV5E 4PJ5D 2H26A 4JPIA 1FLRL 4EIGB 3KXFA 3NIGE 3DUSA 5FA4A 3ZE2E 4JRYD 1S3KH 1VFBA 3PNWA 5EBWB 4RGOH 5JQ6H 5IVZA 2XKSA 2N7BA 4TVPH 3GK8L 3EFDH 2FJGA 4AMKL 4XHJD 3HPLA 4YHIA 3VD9A 3QIUD 3HC4L 5ID0A 3TT1H 4UILH 1K8DB 2EDFA 1YMHA 1KEMH 5KZCD 1VADB 4P2QA 4KKBD 4M6NH 3WYRA 3ALWA 4LSDA 1CICB 1I8LC 1ZTXL 2AJZA 4FP8L 3JTTA 2R0ZL 3UJIL 2NY6D 1SY6H 4LVHB 4O2CA 3V52L 5MERA 3FQNB 4OFKA 4LSSL 1YY9C 3DVNA 3ZDXE 5I1KL 3KYOB 4FQLL 1JGVL 3L3OB 1KENH 3HNVH 3GSXA 4TQEH 4XT1C 4KKNA 5H94B 2BVPA 5F89A 5FYLH 2F54B 3U9PL 1WT5C 5JXEA 2Q86B 1E4JA 5F9OL 2F19L 1KN4L 3B2UC 3O3UN 4LU5L 2UWEE 2XIDA 4R4ND 4MB4A 5AWNH 3UJTL 1MCQA 6FABL 5AZEH 3R06A 1A2YB 4BUHA 4P2OB 4Z7UE 4JZJB 3EBAA 2WINA 1YEFL 3B8SA 4RSVA 3B8YA 3LQAL 3QIWD 5FK9B 2XWTA 1NMAL 2V9QA 2QSCL 3AUVA 1KIPB 2A77H 4XNQA 4UT7H 2A9NH 2YHGA 4L4TD 1BM3H 5CD3A 3RVWD 2LV4A 1BQHA 3AAZA 4LLYB 1DVFC 5JR1H 2VRAA 1B6UA 3FHAA 2H26B 3AXLA 4JPIB 3GB7A 3DUSB 1FN4B 1ZMYA 4M6OH 4AM0A 3JVGC 3PNWB 1KJVA 5TDNA 2ATPA 1CDUA 3FAXA 4HIEB 3KPRA 3V0AC 1A47A 1KFAL 3VFMA 3HPLB 4ETYA 2VZTA 4WI6A 5ID0B 1AP2A 3GMPA 2XTJB 1U8JB 3VI3E 1O7VA 2CMRL 1E6JH 1EHNA 1WLHA 4N0UA 2GSGB 2XV6B 1F90L 5IMKA 3BH9A 4JPVL 4XCEA 2HMIC 3HE7C 5GSRB 4LCYA 5IWLC 2X05A 2PO6B 4E5XA 1YN6B 2Q3ZA 4EOWH 4YK4B 5EUOA 2Z91B 3Q3GA 4O2CB 2OL3A 2NY5C 4JZOB 5GGUA 5MERB 4ZAKC 2EH8L 4RMSA 4TSAL 3GDBA 5FXCH 4ZOAA 1XGTA 2Y07H 1CGSH 3RWEA 3DVNB 5GQBA 1JHLH 2X1PA 5CGMA 1UWGH 3DI2B 4RIRA 3LS5H 1OAKL 3DGGA 2OR9L 2Z92B 3G08B 1AE6L 2C1OA 5C08A 4PB0H 3D25A 5I6XC 4ZFOL 1E6OH 1P5VA 25C8H 5T3ZL 1JTPA 2DKUA 3HI6H 1NFIA 4O2EA 4NJAH 3OAYH 1FPTL 4XZUA 4S1SH 2IPUG 4NQCE 3QEQD 3T77A 5HYQA 4N90E 1EAPA 3C87A 5GHWH 1JGEB 3O6FD 3IYLW 5JW5B 1HILB 4KI5E 2RAMA 5EUKA 4LCCC 1NGPH 4YNYB 2X4NA 3D85D 1P4IH 2AKRB 2DLFL 4MXWH 2XWTB 3ARDB 1MFDL 3BRFA 2V9RA 4XNQB 1G7IB 1TLKA 1YEEH 2FZ3B 2ZUSA 2QEJA 5F1NB 1CK0H 5KN5B 3PQYE 2APTA 3IJYA 4LCIL 3NA9L 3H9HA 4J3VA 2ADGB 2IBGA 3O9WA 3AXLB 3GB7B 3ARUA 4GS7B 4FQPA 2FECL 5IHUL 2OSLA 4NQEA 1KJVB 1CDJA 3EJJX 4LVOB 4OFYD 5GGVL 3SGKA 1H3WM 3WD5H 1U36A 3WEXB 4PTUA 3ESUF 1NGXA 4NN5C 2AABH 4R97B 1O0VA 4JB9L 3VFMB 4UIKH 2C5DC 4ODSH 3ZO0A 3RA7H 1PGRB 5HGDA 1AP2B 3GMPB 3S4SG 3MR9A 4X6DB 4FNLL 1EK3A 1F11B 4YFEA 3S4SB 5D2NA 3P0VL 4KTEH 1LVEA 2L7UA 1FFRA 3QP3A 4UQ2B 3BH9B 4LKCB 2BOCB 4JR9L 5CP7B 5IR1A 2MCG1 2XA8L 1NQBA 4HWBA 4IMKC 1CYGA 3HUJF 2YUVA 3SE4A 3OJMB 4ELKA 2NXYC 3B5GA 1T6VN 3RWEB 4JKMA 1UA6H 4RIRB 3MLUH 2ARJB 4BSWB 3DGGB 3JWOH 3OKEB 5KVGL 1NLBL 1LO3H 1CGWA 4I0CC 4WHYH 2C1OB 5C08B 3D25B 1EZVY 4E41E 4QLRA 2VXVH 3VRLF 2YPLD 4OD3H 1NFIB 2E3VA 4O2EB 3SOBH 4LFHG 5F9JB 3VWKC 4LHUA 2F5BL 2VLMD 1I3GH 3MLZL 3MYZA 4ZTPL 1RU9H 2IQAA 4L3EB 3O3BB 3T77B 1PG7L 5HYQB 3R4DA 3BQUA 2BVEA 2DQJL 4PJ7B 1A9EA 1DLHA 4OD1L 4UV7L 1C8PA 3LKNB 1XGUA 1J88A 4G8GE 1UC6A 1RZ7H 1FRGH 3PF2A 3TZVD 3V9FA 1FYTB 4PJ5E 3JUYA 5EBLB 1RJCA 1QR4A 1N7ML 4JRYE 4NRYA 3CX5J 4Z7NE 1ETZA 2HJFA 2B1HH 5DDHA 3X3FL 2FYYA 2O5YH 2I60L 3TNNA 3RZCC 4XPFH 5ACLA 2X10A 2UWEA 3LQZA 3ZTNL 2XZCH 3ARGB 4HT1L 4K3JL 4TNVK 3FT3A 3O9WB 2WIMA 4Z7UA 5IFAH 1X4XA 5HHNB 4JO3H 4RDQF 2OSLB 4NQEB 1L0QA 4MAYA 4CAGA 2BP3A 4WTXA 4PTUB 1NGXB 2H32B 3UJJH 2NY4C 3ILQC 3NPZB 2DLHA 4HKJA 1UH2A 3QB7C 1GZPA 3SGEH 5FO8B 3TFKD 2AJYH 2H3NB 1IGJB 3MBXL 3MR9B 5EA0L 3F5WB 5HHMB 3JV4A 3FB5A 3RTQA 3TM6A 1GZQB 1JJUA 1QSED 5D2NB 4I4WA 3UBXI 5IB4B 4NN6B 1NANH 4KXZI 4KJWD 3LKRA 3KLAA 2C3GA 3QG6A 5HPOA 3RWFA 4EUPH 5CJQL 4PJHF 4ZUVA 2G60H 2XQBH 4I0PC 5AZ2L 1NKRA 4Y5YC 4ONGH 5B4MC 4QXTA 2HFTA 4DKFL 5C0DA 1IEAB 5J6HA 3RWDA 4RMRA 4JG0L 2Y6SC 3C6LA 4MLIA 1HCVA 5DR5H 1T20A 4IRJD 1C5DA 3ETBF 1ZEAH 3OB0H 5E5UB 4LHUG 5E70A 4X83A 1JFQH 1MRFL 4ZS7L 4QTIH 4LHUB 5DI8B 5DSCA 3QWRA 2V7NA 2WQRA 2IQAB 3UEZA 1Y18A 3BQUB 4H25A 3MRQB 4C56E 3N0PB 1A9EB 1DLHB 3LS4H 5FYLD 1GOHA 3P77A 3ILPB 4L4TE 1J12A 1XGUB 4KPHH 5TE7L 3TVMD 3TJHC 2DKSA 1JI2A 5IBLC 3DMMC 2Q6WA 2NYYC 2HLAA 1CXLA 2CRYA 3S36X 3VXSB 5F7KC 1MRCL 3RIAK 2JJSA 4F8QA 3WS3A 2VB5A 3TO4D 2AI0L 1A7NH 4DQOL 5J7CC 5DDHB 5E6ZA 3DHMA 3O11A 3B2VL 3QHFL 4H5SA 3DRTA 4PJFB 4RISH 3BKYH 1RUQH 1F4YL 3ARZA 1RAMA 2IMMA 3UTSD 3LQZB 2VUYA 4NQCA 1FNEA 3IDYB 4DOHB 3WN5B 4IOIA 3AM8C 3GBLA 3VXPA 2FD6L 2AXJA 3LN4A 4UDTA 5E03A 2YEZB 3HZMB 1FNGA 3QI9C 3RZCD 4QHUB 3SE3A 5EUOF 4QEGA 3VGAC 1JHKH 3O2WH 4FOMA 3JV4B 3G6AB 5MEPB 3FB5B 1T83A 3RTQB 5BW7C 3WFBL 4I4WB 3QIBC 1X5YA 4JVUA 5C3LD 3PQYA 4XVUC 5F1KC 3LKRB 4HJJH 2D3VA 2ZUQC 1ZSDB 4U6TA 4ZXBB 1GIGL 2ADJA 4YFLF 3B9AA 2WP3T 2CIKB 3T65B 4FHBD 1G7PB 3UTZA 5BCAA 2HT3C 5D7JA 4QXTB 3QEQE 5C0DB 4OM1L 1BGXL 4NWTL 3RWDB 1J86A 4RFEB 2XOTA 4F15B 3HI5L 3NCJL 3C6LB 4F7PA 1U3ZA 1T20B 3IKCA 1MH5A 1IBGH 2WV3A 5B4MD 5DSCB 1GJIA 1AY1L 3MYJA 4YXLL 1OAXH 3VRJA 2HKFH 3BGFC 1Y18B 3GMOA 2WSKA 1BBJA 3HC0A 5I9QC 4EQ3A 4QWWD 1EGJH 4X4ZA 2AK4D 5BJTB 3MBEC 1N26A 3LAFA 3BPNC 5CMAB 4WUKH 1A3RH 3GFUA 2Q6WB 2HLAB 4OT1L 2X4QB 2X7LB 2OJEA 3QQ4A 4X4ME 3V5KB 4JO1L 4ZDHA 3GSNA 3UMTA 3NAAL 1V05A 2DI8A 4XXCC 1H8SA 3U7YL 1HHKA 3M07A 4H5SB 4R6UA 1KCRL 5F9DC 4BSVA 2CKBA 1FZKA 4JHWH 4CN4A 2DQHL 1FNEB 1QFWL 2QQQA 4PLKC 3IETB 5DRXA 4POYA 3MRDA 3WNLA 3NCMA 4G8GA 3RPKA 2J4WL 4UIMA 4UDTB 5ILTH 1NGYB 4PJ5A 1FNGB 4KV5F 4ORGB 3RL2A 2GTZA 3NIGF 5EFIB 2D03L 1QVOB 4JRYA 1LK2A 3ZE2F 1SYSA 2MQ3A 5JPMA 1FAIL 3RGVD 5GS2H 1SVZA 3CFJB 1F6LL 1XCQB 1WTLA 3GJFB 5HI5C 1NC2D 3QIUA 2R56H 4IDJL 2Q20A 2ZSWA 4HKBB 2YPLE 1KEGL 4JFHD 5I1HL 5C0EA 1BFVH 2Q8BL 2VLME 1HOCA 1HHGA 5D7JB 3U46B 1OY3B 5D1QD 3C8KA 4MJ2A 1DN0A 4P57B 2K1MA 1BZ9B 3SDAC 3T8XA 2QJDA 1BZ7B 1DQML 1OGAD 3B9DA 4ZPVA 3ZDXF 4BK4A 1AIFA 3AVEA 1IC4L 4WTZG 4OGYL 3T1FA 1WFUA 3H3BC 3OJDA 1UZ8B 3AS3A 4U7SA 1GH7A 4NC1C 3VRJB 3GMOB 1S7QB 1KJ3L 1BBJB 3HC0B 4GRLD 4X9FA 5FAAA 1IQWL 3INUH 2UWEF 4BZ2L 3VA6A 2OJEB 4FQCH 2P4AB 5CGTA 3N1FC 3FQXB 4Z7UF 3TT3H 4CMMB 1DZBA 4UTBL 2NCMA 5C9JA 4E41B 1FORH 4K7PX 2A1WL 1ED3A 4JREB 3MBED 3CAFA 3OXSA 2CKBB 3QIWA 5GRUH 3DX9B 4FXGA 1IZKA 2WANA 4JFDD 1EFXD 4M7KH 2YRPA 4FFVC 4P48A 2EDLA 1ORQA 5CIPA 1IAKA 3KPMA 4C56A 3HZVA 5DRXB 8FABA 3V2AR 1PW3A 1QSEE 4L4TA 4Q7DA 5LGKA 4G8GB 5MHSD 4UIMB 1Q0YH 4F33A 1U8MA 1B0RB 4PJ5B 2FO4A 2OL3L 3T0VA 5DVOA 5JORA 1U8IA 1NDGB 2GTZB 2DQTH 4OCNC 1RJZA 3W2DL 3SDDC 1SYSB 2EC9T 5JPMB 1I9JL 3WFDL 3CFCL 3VFRA 4ZNCD 1BP3B 3CH1B 4X99A 1WBYB 4N5ED 5D2LE 4F7EB 3QIUB 4JPWH 4PGBB 2MHAB 3GMLA 4UINL 2ZSWB 3VI3F 4KTDH 1QKZH 4DW2H 3QFJB 4PREA 1Z5LB 2X4PA 4FQXC 1FNSH 2LVEA 1HOCB 5DK3A 4C83B 1HHGB 3OG6B 3LHPL 5DZOA 3C8KB 5GGRB 1WUNT 1CFBA 4TTGA 4XBGB 5FYLE 1HWHB 1OOAA 2VLKB 5DMJB 3IDNB 3GEWB 4PY8J 5FCUL 4HJ0C 1AIFB 1T1WB 1U8HA 5IV2A 2BVQA 5BV7B 1I8LA 4MD0B 1XGRA 1EUUA 1MCWM 1QYGH 3PIQB 3KPQA 1WIOA 2AJXL 5FHBH 4QRUB 1KELL 1T80A 1YNTA 5IG7A 1RUML 1B4JL 1GGBL 3AB0C 1W2KT 4P2RD 2HKHH 2X70A 3N50A 1F8TH 3DTXB 3UTSE 2EIDA 2WUCH 4YHKL 1OGTA 3EKCA 3QEQA 4OUUA 1F3DJ 2WLYA 3ULVH 4U6YA 1BD2D 2X4OB 1OP5H 3HS0B 3I3DA 3K80A 3MLSH 3O6FA 4Z7VE 1FCGA 2BX5A 4KI5F 1BJMA 3I50L 4K07A 3ZYZA 1WT5A 4Q0XH 5HGHB 2VXTL 3STLA 4WO4C 3S37X 3QCUL 2BZDA 1FFOA 2FGZA 1AXIB 4FXGB 2MTPA 4N0FA 4FTVD 5DRNA 3PP4L 5T3XH 3TCLA 4D9LL 4NNXB 4QHNB 1ORQB 5CIPB 1IAKB 3KPMB 3QWQB 4XAKE 4HXBH 4C56B 3OX8A 1QQDB 4NC0B 4HWBL 3UCRA 1JV5A 4ORZC 1U8MB 5KVMC 2FO4B 4X4MA 2BHYA 4FQJH 1SM3L 1MF2L 1GPOL 3DROA 4OFYA 3W5MA 4WUUB 4JVWA 3ARPA 3ZT7A 4CVZB 1MELA 1CG9A 5HYJB 3EJZD 3ZL4L 4U1MA 4HC1H 5D1XD 4LOUC 1V7MH 1IGCL 2B4CC 2VAAB 3QQNA 4PREB 2N7AA 3W0WB 5B8CC 2BRRH 4OLVH 4WGWB 1U8NB 1T5WA 2FEEI 4P4RB 1HIML 5F6HJ 4XNYL 2CD0A 43CAB 1CFVL 4XVSL 2AK4E 3CDGA 3MRBA 1NAMH 1IGFH 2Q7YA 4W6YB 1S78D 1NLDH 1KIQA 3D39D 1KB5B 3KPQB 1CT8A 3LV3B 3CSYA 5TE4H 1T2XA 5I1DB 2YPLA 1FNHA 4GQPH 3WNKA 5EPMA 2X70B 5DURD 2JJVA 3OKDA 1J0JA 1X6LA 2I07A 3FB6A 3E8UH 1Q38A 4HUNB 4OZHE 5C0AB 1UVQA 5K9QI 1DQJB 4K55A 4UUJB 1WZ1L 2P8MA 1LD9A 3GMMB 4Z0BL 3TCLB 1UACH 4Z7NF 2D9QB 1A64A 1CFSB 4A2MA 2XPGA 1KYOK 2IPTL 3QSKB 3MODL 3RNQB 1DUZA 4P5TC 3O4LD 5CS7A 4LCCA 4QF1A 7CGTA 4MA7L 1VKXA 3RWHA 3N85H 4JFHE 2P24A 1F2QA 1CVRA 1ZLWH 1A3LL 3TBSB 4NHCH 4TSBH 1OHQA 3MFFA 4KXZH 4ZTOL 4GBXD 2FSEA 5DMIH 1DVFB 1MIEH 1G6RH 3C9NB 4U1MB 1K4CA 2FEDC 3MRGA 2VQTA 1FP5A 1JWSA 2B1AH 4JN1L 2A73A 5FYJU 2HH0L 1PZ5A 1QSEA 4U6VL 5I8EB 4AQOA 1AR1D 3MX0A 5IVXE 3L1OH 1JZ5A 1AD9A 2DI7A 1NCDH 1UFUA 2IH3B 3HE6C 4P23C 4UOJA 4XWOC 1R3IL 2DQEH 3CVHH 3QUXC 3IF1A 3LN9A 5CSGA 3OWEA 5HDOA 5IFHH 2Q7YB 3WDHA 4M5ZH 4QRRE 5DK0B 2CQVA 3KYMA 1RZIA 2OLDA 5D2LA 3HE7B 1SY6A 3LN5B 5GISH 3VI4E 4IRJA 5I19H 1TTFA 1YNKH 3QHZL 2EDOA 5DJ8B 2YPLB 4QTHB 4ZAKB 2VDRL 3QUYC 4WY7L 3S97C 3QEHA 1DBBH 1KIRB 4NO0B 1HHIA 4KHXH 2YMXH 4JFDE 1CDCA 1MHPL 4Z8FL 4Q9RL 2ZWLT 2I07B 4XP1H 3FB6B 3ARSA 4RAUA 5E0QA 5K9OB 1UVQB 1P4BH 2EICA 3L3GA 1JUFB 2J8UE 4WRLA 1I7ZA 1LD9B 1U8QB 4HF5L 4DUWA 1WGOA 2ZPKL 5INCB 5KSUA 1DBJH 3NZHL 3TO4A 5FA3A 5CEYB 3QXUA 4LL9A 4X80L 2XPGB 3PGDA 3UROR 4RNRA 2F74B 5DA0B 3WFEL 4WW2A 1DUZB 3UTSA 3V0WH 2O5ZL 4LCCB 3SQBA 5DJCA 2M26A 4QF1B 3LEYL 3RWHB 1H3PH 4ZYKB 5HPMA 4CN6A 2DQFB 3OKYA 4Z7VA 2ZKHH 3SKMA 1TPXB 2W9LA 2BVOA 5I8OH 4IM8A 4U1JA 1I9EA 1A1NB 3RZCA 4K94L 2F5AL 3MFFB 1F3RB 1PBYA 4R26L 5JOFB 4RFNC 2VE6A 3LQMA 1UKQA 2YWYA 4IIQC 1NBZA 3MCG1 4U2YA 2HG5A 4NGHL 3MRGB 2IANE 1TVDA 1MVUB 1TJIH 4OGXL 1AFVL 1JYXA 1G7JA 3ET9F 5D8JH 3S88L 4XBEH 4NN5B 5CP3H 5BS0B 1AD9B 3RRQA 1UYWH 3WL9A 2CRZA 2RFXB 2DQIL 3HLAB 3KPPA 1C16A 2A6KA 3MNWB 3H2WA 3O3AA 1MPAH 4LEOB 3KYMB 3GSNL 1MJUL 3QO0A 1RZIB 3CSBA 1UKTA 2W60B 4L8BA 4O4YH 4NC1E 4YZFE 3QRGH 1D9KC 4P23D 3K0WA 5IOPA 3SN6N 2GI7A 3ZKND 3OPZL 3M17A 1EO8H 2CKBL 1P1ZB 1XZ0A 5DQ9A 1OT1A 3MACL 1OPGL 4G6AD 4I0PA 1VPOL 3QEHB 1A6UL 3WJJA 1VERA 1G9NH 1HHIB 4FTVE 4PUBH 2R2CA 4LPTA 3B4NA 5ID1A 4C57C 3WIFB 3SDCC 3DX6A 2EDXA 4RAUB 3K4AA 2AK4A 2D7TL 2HAZA 2CJUH 2BXZA 5C0RL 3CXDH 3VGGA 1NSNH 3QUYD 1AI1L 3QXVA 3VWKB 3KWWB 4LSVH 5KSUB 3ULVD 3HZYA 5KW9H 4B7IA 4DTGH 5C8JA 4ODUA 1ZA3A 3H9ZA 4GKZB 1LEIA 4XPBH 1WCBB 1MUJA 3JV5A 3W9EB 4AG4L 2H1PH 5IBUG 3PGDB 4N68A 5FKAA 4RNRB 2GUOB 4YIQA 5IBUB 1KBGH 2J5LC 1MAMH 1M4KA 1OP5K 1H3GA 3MUGB 4G5ZL 4PJDB 5T3XD 2DS4A 2JJUA 4G7YL 3KYKH 4W70A 1D5IL 4K9EH 3PWNB 3QQ9D 1IGTA 4OZHA 3T3PE 3CCHB 4E42A 5IB5A 1YJDC 3NACL 3V6BR 4NFCA 2FECI 4D2NA 3RZCB 1BQSA 1BLNA 2AJSL 4UV4L 3MRPB 2V9TA 2WMPA 4WWID 4NZUL 1TQBC 4RFOL 1RUKH 2BY2A 2VE6B 1B2WH 1NBZB 4WV1A 1HKLH 1UH4A 4JZNA 1EHLH 4QXWA 3RGVA 3D18A 4NUJA 5KSBF 1S9XB 1HSBA 1XR9A 4JKLA 4KUCD 5SWSD 3MJ7A 1NC2A 3D39E 4RAVA 2NY4B 1RY7B 1GYAA 5SX5H 3QUZC 1NDMA 1M05A 3EHBD 4GAGL 4C59B 2ICWB 2XTLA 4LRNH 1QSFE 2DAVA 5DC9B 4NUGH 3Q5YA 2WWKO 3KPPB 5E2TH 3EDFA 1INEL 1MSPA 1FH5L 2PR4H 4WCYH 2AW2A 3SPVA 3QO0B 3MLRH 1AQDA 4PD4K 4AIZA 4Z5RA 2NY0D 4L8BB 5I2IB 4HUUA 1OAYH 3UYRH 2Y72A 4GG6E 5JQHC 4NCC1 2QADD 1MHCA 5ENWA 1OGAA 1QLFA 1N3NB 3CLFH 3M17B 3F62A 3GGWB 5DQ9B 1KXVC 2VDOH 3ULUC 4I0PB 2AJ3B 3SE9H 5IVXA 5ESVA 4TNVF 4YHLH 3VFNA 1IT9L 3MRCB 1MFAH 4GJTB 4GRLA 4XAWL 5FGCE 1EVTC 3DX6B 1J1XH 2XWJB 4CL7A 2OXGA 5IM7A 1H5BA 2V17L 3O4LE 4NHUA 3P0GB 4YGVA 3OR7A 3ZKQD 2BSED 3WNOA 2CR6A 3N9GL 4QRRA 3TBWB 5I15H 1ACZA 4RRPA 3HZYB 1JRHL 1H3XA 4ODUB 2ZP0T 1XIWD 1ZA3B 4D9QD 2CO6B 1LEIB 2D2OA 4PJEB 2VOTA 3MBEA 2GITA 2DICA 4YIQB 1RURH 1S8DA 3DMMB 3MCKA 3R1GH 4TUJB 4JFDA 1EFXA 2QL1A 3PWLA 1G9MC 3WFZA 4NP4H 4POZC 3TJEH 4AJ0A 2HTLC 4OZHB 2LE9A 4QNPE 3BKCH 3FL7A 4BH8B 2J8UA 4JM2D 4YBQC 1RHFA 1BLNB 4XP5H 5ITFA 3GMNA 2C9AA 5HBBA 1KTDA 5FB8A 4N9GB 1AH1A 2Y5EA 5IBTL 2AVGA 3ES6A 1C7TA 4P46D 3WNMA 1H0DB 3G5VA 2HVJA 1NCWH 2RQ8A 1MY5A 3FT2A 3MJ7B 4U1NA 1NC2B 1OWWA 5I1GH 2DQUH 2XWBB 5D2LF 2XNAB 2IAMC 1C7SA 4ODXB 3C08H 3PE9A 4KK5D 3FO0L 4H1LG 1Q8MA 1NDMB 1IE5A 1KLUB 4AIXA 2EXWC 4H1LB 2I26N 1HZHH 3VGAB 1VA9A 1AKJD 3O0RL 4BELD 5HHVL 3BN9C 4R3SB 1HEZA 3QIBB 3SPVB 4H0GA 5CLWA 4Z7WE 5MP6L 4EUPA 1AJ7L 5GGQL 4Z76B 4LNVA 4X7CC 3IVKA 4NZRL 3AREC 4ODHH 3I85A 4LLWA 1FL6A 3ECBA 1F4WL 5GIRB 3RUGE 5IVXB 3RVUD 4KK9C 5FM5M 1TETH 3GI8L 4PRHD 4U1LA 1Q72H 4GRLB 2NW3A 5EO0A 5JZ7C 1C5BL 3REWB 3X13A 4WW2F 3VXTA 4MGXA 4OLXH 4RRPG 4QRRB 2VISA 5FV2A 2Y5TA 3RJDA 5IHZB 2NY2C 1KCKA 4YUEH 3KPLA 4Z7VF 5I9QB 5IHBA 1YNLH 3GO1H 2VXSH 3GSWA 1TJHL 3MBEB 2GITB 2VN4A 3W39A 3BPNB 2ZJSH 5HDBE 4PGDA 1P2CA 2APWA 4FTVA 1EFXB 2VWEC 4QGYA 5DJ0A 3IGAA 4CVUA 4RA0C 5CHNA 1JNNL 1CN4A 1A5FH 2XZZA 4LPVA 1M6OB 1TCMA 2J8OA 5IJVA 3FB7A 1R3JA 2R4RL 5E94B 5D1ZC 3GMNB 4MDJA 5FB8B 5M94B 3QEGH 3K46A 2HTLD 3G5VB 1DQLH 3I3BA 3FT2B 3U7WH 4Z0XB 2NY5L 4MA8H 4LLMA 5E4EC 4DKEL 5AG8A 5D1XA 4OKVB 2OP4H 3SDDA 1LEGA 4PP1C 5IIEA 1IGIL 4NRZB 5C6TH 3BP6A 4OF0A 3SO3C 4X98A 3L5HA 1O7SA 4JQXA 3GIZL 1GOGA 3QZWG 4YDKL 4MVBC 4CVWA 5ADOH 3QZWB 3A6BH 1U8OA 2IANB 1CQKA 4U49A 4G8EA 1N2RA 3NMEA 4UQ3A 4LLWB 4N0YH 2W59A 3ULVE 3CK0H 5EOCL 1BREA 3D39A 5E2VL 2MMXA 4OTXH 5I16B 1RZKC 3IJHB 3LKSA 2O61A 3SDAB 4OJFH 4U1LB 4JRXD 2HN7A 5IHLB 5ADPL 1QSFA 5FF6A 1O5DT 2OMBA 5IESL 3HMWH 3TIEB 5TPWH 3NCYS 5HVFB 2R39A 2IPKA 5T3XE 4PLJC 3LH2H 4AY0A 4KKCD 4FMFA 4X9GA 5GRJL 2PTVA 4OZHF 4GG6A 2CH8A 1EGJA 2CIIB 3FFDA 1OQXA 5JO5A 4WJ5A 2K7PA 3P11L 5DGQA 1CDHA 3IU3B 4XCFH 3RVVC 5DD6A 4PGDB 1P2CB 1S3KL 1MJ8H 1RZJH 5IMMB 4RGOL 1KCVH 4RX4D 5DJ0B 5EZLA 3IGAB 3RBGA 5SWSE 5CHNB 4GG8A 1U6AL 2NY7L 3O4LA 4XPHH 2ITCA 5GS0D 1ZOXA 3TT1L 2XFXA 3GK8H 4UILL 4OZGE 4JHBA 5IJVB 1T21A 2VZUA 1R3JB 1EEUA 1I3RA 4PG2C 3HC4H 5IEHA 1JGDB 3E6FB 2OR7A 5EC1A 3T09A 5EU3A 2VLLA 4CNIA 4GBXA 4O00A 1SY6L 1UB5B 1KYOJ 1CE6B 3F7RA 2ED8A 1ZTXH 1AXSB 2Z8VC 1HXMB 4MNQB 2R0ZH 4MJ4A 4LLMB 2YSSA 5GS3A 3QUKA 3V52H 3RPIA 3SDDB 1LEGB 4HH9A 4TQEL 5IIEB 1MCPL 2ZOLA 3F58H 4KAQL 3ARQA 5I1KH 5IVXF 3BP6B 4FQLH 1YZZA 3UZEA 3SKNA 1BJ1H 1BFSA 4X98B 5KVFH 1KTLA 4NKMB 1A6AA 3SDYL 2WBJC 5IW6A 1IAMA 1R5WB 1U8OB 4H26A 2OS7A 3U9PH 5AZEL 4FQXB 4LLDA 4WI7A 2F19H 4UQ3B 5JHDD 1KN4H 1RHHA 3NBNA 3MO1A 5SX5K 4WI5A 3TC9A 3UJTH 3VI4F 4NRXA 6FABH 4D9QE 3NH7L 3MFGB 1K8IA 3R0MA 2EE3A 1PQZB 1LDSA 4G8FA 3DOSA 5HI4C 2HN7B 3EO9H 1QSFB 5FF6B 1R5VB 4PGCA 4B0MM 2B0SL 5E5MB 4ELME 2IPKB 2A77L 2VXQL 5I1AA 1MFCH 4Z7WA 2A9NL 3FQUA 1BM3L 4K8RC 4GG6B 3CXHK 4F7MB 5JR1L 2QSCH 2BMKB 3AB0B 2GK0B 3FFDB 3GSQA 2J8UF 5JO5B 3U0PA 2BNUB 5HI3D 1YUHB 1P4LA 5CJOL 5ISZD 4PLJD 4G9FD 2ZG2A 5EZLB 4WU7B 1BEYL 3WHE0 3O4LB 3CLEH 5EBMA 4WO4B 3DXAD 3V7AG 2XFXB 3D6GA 4UDUA 3Q6FB 1KFAH 2CK2A 2EKSB 3UTQA 5A40E 1I3RB 1VGEH 4GW1A 3W9DA 3QA3A 5EC1B 2WIIB 2CMRH 2DQCH 1G84A 5EU3B 4XNMB 3U36A 1VHPA 4NQDD 4EOWL 2JB6B 2FWOB 1MCJA 1F90H 3VXUD 3K81A 1XF4A 4KTYA 2Y07L 3LOWA 5D6CA 1JHLL 1UWGL 3QH3B 4YFLI 3K8LA 3QUKB 1HHHA 3QCTL 4KROC 2ZNXA 3M1BA 2EH8H 1RPQA 4TSAH 2HRPH 3S3SA 4KZEL 2IG2L 1CXHA 5AAMA 2YRZA 1NL0H 3BPLC 3CFDB 1WITA 4PRHE 5D5ME 4X5XB 1E6OL 1OAKH 3HI6L 3PHSA 5I66A 5D7LD 5JTWA 4NJAL 1AE6H 1KTLB 4LCWE 1B0WA 5I74C 4S1SL 4H26B 1NFKA 1V3LA 5B8CB 4HGWA 5EZIH 5GHWL 1QFUH 5J4MA 4PJXE 2R23B 3IFOA 4YZFF 3VFPA 4R4FL 4P23A 4Y16C 1SMAA 3BN3B 4WI9A 1NGPL 3VXMB 1AO7D 4G8FB 5DJYA 5T5NF 1Z9SA 3MUZ1 4F37K 1P4IL 1FIGH 3JTSA 4MXWL 4W6WB 2M2DA 1NJ9B 4PGCB 3U4BH 4OBRA 1UM6H 3MC0A 4MJID 1YEEL 4ZG1A 5GS1C 2YC1A 4NFDA 3MLWL 1CK0L 1RZ8B 3BGMA 5IMLA 2V5RA 1A6ZB 3IS0X 3QUYA 1XF2A 3D48R 3ZT6A 4XTRD 3RUGB 4L8DB 4FG6C 4LCIH 3NA9H 5DD5H 3WD5L 4XC1H 1JNLL 1OARH 3REVA 5IFJA 3L95A 5IHUH 3W11C 1J10A 1OM3L 4UIKL 3WUWA 1UH3A 4M9PA 1OCWL 4ODSL 3RA7L 4NQSB 5EBMB 5CZVH 5E8DH 2QSVA 4UDUB 5AAWA 4WWKD 3CDFA 2WNGA 1BQUA 1MAKA 1BOGA 1ZS8B 5F1IA 3T3PF 2IF7A 5I0ZA 5HHOD 1F4XL 1K2DA 1Z9MA 4OM0H 1I3UA 5CBEB 3RWJA 4P5TB 4YHNA 2D0HA 4CBPA 1XMWA 4NKOA 5HSFA 3LVEA 4HH8A 5FUCE 1WK0A 3DECA 5D6CB 5FYKU 1HNFA 3QUMA 5SWSA 4S1RH 2BDNL 1R5IA 5DF0A 5E95B 4XRCB 3ZLQC 4NKDA 1S7SA 1ZAGA 4OZGA 1A0QH 1W0VA 5DJXB 2VXVL 4PJIE 1BVKA 3FRPA 4OD3L 5TDOA 5KVGH 4JRXE 3SOBL 2HWZL 4P0DA 4XMKH 1I3GL 2WAHA 4NOBA 1OW0A 5IQ7L 4NQXA 5D9SA 1SQ2N 2F5BH 3MLZH 2C1PB 1JVKA 2EDRA 2DJSA 3HE6B 1T03L 4P23B 4GG6F 1FRGL 1NAMA 4XP9H 4OD1H 3QUXB 5DJYB 2Q1EA 5KAQF 5J3HD 3U6RA 4Q6IA 4ZFFA 1L6ZA 2QHLA 4QRPD 4RMQA 5HDQL 3IKKA 4XPFL 5EO9A 3F7YA 4PD4J 2W65A 2YC1B 2PTTA 5F88A 3BGMB 3X3FH 2JJWA 2ID5A 5DQDH 4W6XB 2I60H 3T04D 3QUYB 4R7DA 4MA3B 2H2PD 4Y2DC 2Q87A 3RVXD 3H8NA 5IFAL 1LO0L 1GC1C 1XIWA 5DA4A 4K3JH 4LARL 4J1UA 3REVB 3H9SD 3SDCA 3UJJL 1AQKH 3L95B 3MV9B 5DJ6A 1FNLA 3X3GL 3CD4A 1C12A 1J0IA 4J3SA 2GKIA 4LGSB 2AJYL 4ELMA 1ZWIA 3WLBB 5DO2C 4APQD 1CIDA 5FUZL 2X9WA 4QXGH 1CR9H 1X5IA 2C3XA 4QHLA 1SJXA 4TUKH 1GRWA 4QNPF 5CBAB 1NEZA 3W11D 1RSFA 4JM2A 3V6FB 1EUTA 2MPAH 3VJ6A 3RWJB 4URTB 4YHNB 3DBXA 2XQBL 4X6BA 2BNQD 1XR8A 3LPGA 4P46A 4ONGL 1DBAL 3CU1A 4CJ1A 3QUMB 5JHDE 2EYSA 2NXZD 1G6RA 2JIXD 1W0VB 4RFNB 1J0ZA 4JG0H 1JFQL 4IIQB 1YEDA 1K5NB 4XP4L 3QAZC 5E9DD 4KK8D 5EWIL 1MEXL 1AKJA 4NQXB 4PJ8C 5D9SB 1U3YA 1Q9OA 3U4EA 2FJHB 4Z7WF 3CVHA 4I0KA 3QUZA 2AEQH 4JFPB 4M61A 2B39A 4KJYB 4XNUH 5E6ID 2NTFA 4JFQA 5I1EH 1IL1B 1NCNA 4Q6IB 1A7NL 5ISZE 4ZFFB 2OTUB 4ZO9A 2DDQL 4G9FE 5D5MA 4PRHA 3VFWB 4P9MH 4EI5D 4WI3A 1W0WA 1MRCH 1A7PL 4RISL 3BKYL 4LCWA 5C92A 3L3JB 5KS9E 3F7YB 2W65B 3CZFA 4PYGA 5T1LD 3CIQA 2PTTB 5F88B 4R8WL 2AXFA 3DXAE 4MNHB 4IHOA 5BOZG 3I75B 4ZS6D 4OCXH 4PJXA 5CJ5A 4FQHA 1MCHA 2YXMA 4KKAD 4J1UB 2KZ1B 3SDCB 2HFEA 4PBWD 4NQDE 3VXUE 4IRSD 5ERWA 5HDBF 1C12B 4JFOA 3BPOC 3LIZH 3MJ9A 2IBBA 1ZWIB 1JHKL 5MI0B 4ELMB 5EZOH 4LBEB 2PN5A 3MRJB 4QHLB 1NEZG 4H0HB 4FQ2H 1NEZB 3R8QA 3TN0C 3FN9A 4HCRH 5D7LE 1LE9B 3C5JA 3X12B 2J5LB 3K1KC 2F15A 5E8PB 1CU4H 5BQ7A 1Z9OA 3ARFC 4GRMA 43C9A 1OTTC 2EYSB 5DJ2A 3LEVH 3TBYA 2R9HD 4MJ6B 5F7DA 1TQBB 2BERA 2YK1L 1AO7E 3HI5H 1IBGL 1YEDB 3HZKA 2Z4QA 5DHYA 1A6TB 1OAZL 4YDVA 3VXRD 1OAXL 4ACPA 2HKFL 1ACYL 5CP3A 1BIHA 1CGUA 4C54A 2YR3A 1UJ3A 4MJIE 1EGJL 32C2A 1T4KA 1AY1H 2EECA 3QUZB 4JKPH 4MJ5A 3MRMA 1A3RL 3SKUD 4NNYA 3TBTA 4EJ1C 4KKLD 4P5KB 3ULVF 4JFQB 2Y9RT 5D5MB 4PJIA 3T2NH 4L9LC 5I75C 1UEMA 1DCLA 4JRXA 4JO1H 4LCWB 3CZFB 4JHWL 5IUSA 2CDGB 4WFEE 1D5BA 3SCMD 5C2BH 2AXFB 2DN7A 4HQQH 1KCRH 5GSVB 4PPTA 3GNML 4QT5B 4PLOB 5E5RB 5JIIA 4PJXB 1CFNB 1HH9A 1LDPL 3FN0H 1SJHB 5HHOE 3RGHA 2YPVL 4PR5A 4ZQKA 4ZUSA 3MRLB 2J4WH 5ERWB 3OKNA 4J3OC 5GGTA 3VFTA 4JFOB 3MZTA 4RX4A 1S7WA 4HK0B 3F8UB 4U1GC 4F7CB 4KUCF 2ESVD 3QCVH 1KJMA 4V1DB 3O45B 1FAIH 2R56L 3STZA 4H20H 1EX0A 4UTAL 4OZGF 5M7QA 5CJ8A 4TPRL 4QKXB 4OF7A 4Q2ZA 3C5JB 2DQGH 3OQ3B 3QEUA 4IDJH 1Q9WA 5BQ7B 4LIQH 1T7ZA 3UC0H 1CTOA 3DX8B 4GRMB 1PDKA 43C9B 4EDWH 5DJ2B 1MFEL 2YWZA 3VFUA 5LJYH 5C0NC 4QHMB 4XI5C 3LEXA 5F7DB 5KOMC 1I4FA 1DBMH 1WFOA 2R1XA 3WSQL 1ERNA 4Y4FC 2Z4QB 3GUTA 1CFTA 4I1NB 3CGTA 4CADA 3PP3H 3KNBB 5F9WC 3RJQB 3X14B 1ZT7B 3NZ8A 4DK3A 4OGYH 1UJ3B 2AXGB 32C2B 1T4KB 1MNUL 1EJ6A 3BW9A 1WVZA 3ME0A 5GJTH 3MRMB 4M62L 1KJ3H 1YEIL 2ZCKH 3SGJC 4YDLC 4FQCL 1IQWH 1HI6B 5JHDA 4ALAL 1A7RH 1OTUD 2GJ6D 5JOPD 1H8OA 1FORL 1X6NA 4MXVE 5TFSH 4HK3J 4PJIB 3H9SE 5A16B 4EIZC 3BDYL 2D4FA 2GTWB 3NCCB 1BZQK 4JRXB 5JLZA 4N0CD 4UTBH 2FNBA 5GRUL 5DTFB 3AREB 1D5BB 3AY4A 3QQ3B 4OB5H 4UNTA 2DIAA 3TP4A 4X5WA 2C3VA 4MSWB 4ELMF 3IDJA 1T2JA 1CZ8L 3WDIA 4S1QH 1IGML 1HH9B 1HSAA 1PY9A 5EG6C 1Q0YL 5GGSB 2QQKH 4JM2F 2FL5A 5HHQB 4PR5B 4ZQKB 4ZUSB 2DQTL 2HFGH 3OKNB 2BNQE 5ISZA 1MFNA 4N1CA 2HT4C 4G9FA 2EDYA 3K2MC 1UENA 4YWGL 3WHE1 5KS9A 4RWYL 1KJMB 4HFWB 3CXHJ 4FN0A 4EDXA 4JPWL 2FGWL 3DXAA 4HZLA 2KH2B 4KTDL 1QKZL 1R3HA 4GRWE 4H8WH 4WNQA 2X4TA 4Q2ZB 1F13A 3QEUB 1FNSL 5E9DE 3GKWH 1Q9WB 2FHCA 4HS3B 1ZHLB 3MLVH 3PDGA 4PG9A 2NMSA 4NQDA 4KJQD 3VXUA 5FECB 1CWVA 4JY4A 1IM3B 1FZOB 2MWCA 4CMHC 1EEZB 2R1XB 3EOBB 5D1ZB 3TO2A 3O8XC 1MLBA 1M71B 3GSOA 5E2UL 1MJJA 4R2GC 5FCUH 5IROC 1GL4B 4I48A 5FHBL 3PABB 1T66D 2R1WA 5D7LA 3NZ8B 4JFEE 1YEHL 1HKFA 2HKHL 3JZ7A 2AJXH 3BW9B 5E4EB 2WUCL 1KELH 3VCLA 3L7EA 1RUMH 1JNHB 1B4JH 3ALXA 3ULVL 1OAUH 3DSNA 3P2TA 3KPNB 3MLSL 3D3VD 3D0VA 5BZDB 3SO3B 4PJXF 4G6KH 1AO7A 5K59E 2H32H 1MJ7H 5CGYC 5T3XL 3DI3B 2VXTH 3QCUH 4MX7A 2BFVL 4HXBL 1DQDH 3CFKA 5DUBB 4MJIA 2P8PA 1LE5A 2L0DA 1HSAB 3PP4H 4D9LH 5F7EH 4OFIA 4YQXH 3I84A 5I1CL 2R8SH 2VUOA 2FL5B 4OLYH 35C8H 3T08A 2CLVA 5SWZB 3VXQB 5JA8B 4PV9B 1ZVYA 4DZ8B 3VFVB 3TEUA 3QUML 1QNZH 1SM3H 2HYMA 2IC2A 1GPOH 1G0YR 3ROLA 2E9JA 1INQA 3EYUH 3FONA 4HZLB 3BIBX 5LAXA 2MFNA 5FHAH 1V7ML 2ITDA 4WNQB 2X4TB 4OLVL 3VGFA 2EYTA 2VXUL 1UJTA 3VXRE 5HHOA 3V6ZA 3S6CA 5F7NC 2EEDA 3CMGA 1PFCA 1RULH 3ORJA 4MD5B 5HYSA 3BP7B 1LMKA 3VXUB 4JY4B 3KPTA 1PSKH 1FNFA 1IGFL 1FG2B 5GRYA 1HIMH 2F54D 4ETQA 5FDWB 3LB6C 3DV6A 2R0WH 4X7DC 3MV8B 3GSOB 3QHTC 4HPOL 5FGRA 1MJJB 3C5ZC 5BOPA 1U9KA 3SEPA 2VQ1A 4Y88A 2V6HA 4X9IA 5CD5D 3Q1SH 5TE4L 4P2OD 4CVXB 4PTTA 4O9HL 2FB4H 4NWUH 2C7UA 4RMWA 4Y5VC 2E9BA 1WISA 2BCKB 1D5XA 4Z95H 4PRNA 1MWAB 5E8OA 4KJPD 3E8UL 4R2GD 1LNUA 5HD8D 5GZND 3KLSA 4XVTH 5DEFA 4XXDA 1T89C 4OZIE 4HMDA 2B2XH 1AO7B 2WBJB 4EBQH 1SYVB 4UBDC 4O5LL 3L5XH 4HZAA 4YR6A 5EU7C 3BYYA 5DMGD 4NYLA 1KNOA 3CFKB 1LE5B 2ESVE 3KYNA 3BH8A 3G6DH 2Y25A 3SKOA 1QBBA 4BZ1L 3N85L 4D94A 1RFDH 2IPTH 4HUWB 5C9KA 3WLWD 4DGYH 4KRLB 1UQSA 1SMOA 2XTJD 1A6VL 3BESR 4MA7H 2H9GB 4NHCL 3H9SA 4PY7B 4S0TD 4TSBL 3RL1A 3EYQD 4U6HB 4NDMA 1S7TA 1T22A 1A3LH 2J88H 1N8ZB 1G6RL 1JF5A 5DLML 1INQB 4NBXB 3UO1L 2NW2A 2PO6D 1J1OL 4OF6A 4ZTOH 2B1AL 5LGHL 4GW5B 4APQA 5IJKC 1OP3H 4WVRA 1G1CA 1FSKC 2EYTB 3DVGA 2I9TA 5L7XH 4BFBD 3L1OL 4YHPA 2AGJH 3V6ZB 2FIKA 3OKOA 3NIFE 4K3EH 4U6VH 1IVLA 1F42A 5LXGH 3TYFA 4UI2A 2DQEL 4EKXA 1FVEA 3P9LB 2FJFA 1YPZE 2C3WA 2BNQA 2X4RA 2X09A 4LASH 5IFHL 4JGUA 4ETQB 3MRIA 3KVQA 3HHRB 2YD6A 3BIKB 2GJ6E 4DN3H 5JOPE 2CDEA 4M1GH 4DWHA 5EIIA 1N64H 4L9DA 1MOEA 2JIXA 1YNKL 1FIEA 1IFHH 1R24B 5E2WL 1ZV5A 4LPYA 4PTTB 2PW1A 1WQVT 5E9DA 1BJ8A 1UGNA 1ADQH 4J6RH 5FUOH 3QHZH 1FVCA 4KHXL 5A3IC 1HDMA 3GBMH 4KROB 2VDRH 4I13B 4XP1L 4IOFC 3C6SA 3BPLB 3IRPX 3ARDD 3MUJA 3U79A 4XXDB 4Q9RH 4M7ZC 5E6IA 4NM4H 3O6MH 5BXFA 1W72B 3PP3K 3LKOB 1DBJL 3MJ9L 4FFYL 4D9RD 4EI5A 2NY3C 4A6YB 4X5LA 1T0MA 4JG1H 4JFEA 4TUOA 2YD5A 3FCTA 5T1LA 2ZG1A 4JCMA 5KS9F 3U0WH 3V0WL 5EC2B 2O5XH 4ODWA 1ZGLA 3GJFH 3EW3B 5ACZB 2EDWA 2JF1A 3SKOB 1MI5B 1H3PL 3WFEH 4QCIA 3DNKA 1QFPA 2ZKHL 4HDIB 5I8OL 5C0IA 1F6AA 3LEYH 4NQUA 4HEME 2FATL 1MCOL 1XGPB 1RIUL 4NDMB 2Z93B 1PYWA 2PCPA 4IRSA 2VITB 1U8KA 3EO1B 5A2KH 1FLTX 1UEYA 2GAZA 4LDLB 5KSAC 4Y2DA 1C1EH 4QYOA 2OYPA 1N0XH 5L2KD 1KPUB 5EZJB 1CE1L 5CWSA 4L1HA 5JPNB 2ICWI 4Y5XC 3DVGB 2BK8A 4L8CB 4WEUD 1MHEB 2MSPA 3OKOB 3TYFB 1IILE 3S88H 5C08D 4NCDA 4P3CL 2FJFB 3WXWH 4BJLA 2XY2A 4Z7QE 2X4RB 4X6CB 1QSVA 5J9PA 1MPAL 5GZOC 4GKSB 4NCC2 5FO9A 4O4YL 3D3VE 3FQRA 1G6VK 5EIIB 3TBVA 4L3ED 5I17B 3KPSD 2JIXB 3RIFF 3F12A 1ROWA 1EO8L 3ROOB 2GEEA 4GRWB 4OD2A 2CKNA 4M48H 4MWFA 3I6GA 4P4KD 5FOBA 1FVCB 3VXRA 1FYTD 2FH8A 2CKBH 3BZFB 1OPGH 3C6SB 1VPOH 3EYFA 4HIXL 1CGTA 1A6UH 4WI2A 1KG0B 4GLRI 1AD0B 3KR3H 4N1EA 4Y4HC 3ULSA 2AV1B 3CXDL 2H2SD 1NSNL 1SEBA 4X4XA 2F8OA 3DWTA 5E6IB 4ZFOA 4IDLA 1QACA 4LSVL 2D7TH 5GGTL 5BXFB 3IDGA 5I1LB 1QO3B 3GHEH 3K4DA 3ARGD 5C0RH 3O9WD 1AI1H 3CUPA 3S96B 4JFEB 4TUOB 3Q5TA 4M6ML 1KT2A 3C2SA 5GS0L 2IALB 2EIBA 5BVJB 1ZHKA 5T1LB 3L5WB 3SCMA 1NCTA 1ZGLB 1H3UA 3WJLA 4AG4H 2YUZA 4WFGD 4R4BA 2J6EH 5AUMA 2BY0A 4KUZH 4K9EL 1GGTA 4JY6A 1KCUL 2XICA 4JLRA 2E27H 4TTDD 1ONQB 3RI5F 4HG4K