1DQDL

Crystal structure of fab hgr-2 f6, a competitive antagonist of the glucagon receptor
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
214
structure length
214
Chain Sequence
b'DIVLSQSPAIMSASPGEKVTITCSASSSVSYMHWFQQKPGTSPKLCIYTTSNLASGVPARFSGSGSGTSYSLTISRMEAEDAATYYCQQRSTYPPTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPRDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNECA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB HGR-2 F6
molecule tags Immune system
publication title Structure of Fab hGR-2 F6, a competitive antagonist of the glucagon receptor.
pubmed doi rcsb
total genus 48
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2000-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dqdL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dqdL01
3CPLA 3VFMB 4KMTH 4GAYB 1UZ6F 4JRXA 4CDGC 3FMGH 5FGRA 4Q9QH 4LBEA 5HYJA 3D0LA 5JORB 3O9WD 2IQ9H 5E2WH 2VC2H 4M9PA 4G8IB 1JWMB 3JTSB 2H45A 3CDCA 5FGSA 1EUUA 2AXGA 3BZFB 1AD9B 5IVXF 3FCTB 5E8OB 5GQBA 3CCHA 4OUUB 1AQKL 4MB4A 1F4YH 2AGJH 4Y0GA 3J8F7 4TYUA 3F65A 3EJJX 4G6JL 4PB9L 4QXGH 2YSSB 4JRYB 3QIUC 3UTQB 5H37H 4QRRB 3IAGC 1DQJA 1SBBA 2RHEA 1A6UH 5L6YH 5DF0A 3H7BA 5AD0A 3BAEH 3MUGB 3TJHC 3O2DA 2ADGA 3RGVA 3O0RL 4BKLA 4JM2B 2KUTA 4Y5YB 3FB8A 8FABB 2DRUA 5T3XE 2ZUTA 2CMRL 1JHLL 5JR1H 2LQRA 4P23B 3WL9B 4H88H 4A6YB 3SHSA 4KJPD 4I77L 2HVJA 3GNMH 5AYUH 2VAJA 5BV7C 3RWEA 2OMNA 2IF7A 1EEZB 1BQLH 3STZB 3BP5B 3EYQC 3MSPA 3UTOA 1VEMA 3MV9E 5KTEH 2FWOB 2G60L 2N4IA 3H9HA 5ITFB 1KN2H 3SDDA 4O2EA 4PRIE 3C8DA 1GOHA 5DWUL 4JFEE 1VADA 2J6EH 3PHSA 1BVKA 1V7ML 1E4JA 2BVTA 3VXSA 1UJ3A 4PRPB 2YHGA 2WMPA 2YD5A 5FM4A 3QNXA 3U7YH 5TDNA 3EYOB 5JPNA 3TP4A 5C0JA 4XNYH 3P77A 2YSSA 3QDJE 2I5YL 4WIQA 3NZHL 1JGUL 3UTPE 5JW4R 4XXDB 3T2PA 1EK3A 5ICYB 5I30L 5MI0B 4WU7B 4XVJL 1BX2A 4XMPL 4K3GA 5TE7H 4TTDC 4CGTA 4FHBD 1A5FL 5C3LD 1ZKAA 5ISZD 3TO2B 5JNYB 1UA6L 3O6MH 3Q2CA 5DHXB 3TA3A 4PJIE 4RGOL 2XKNB 4JR9H 4NJAL 1Q9KA 4M6OL 2RR3A 3C08H 3KXFA 4J4PC 1CFTB 2P43B 3JSSA 1OAKL 5DRWA 3F7QA 3KJ4B 3V6FA 1YNKL 4YHZL 1EXUB 4KU1A 1A14H 5AZEL 3QXDA 1KPRA 3F12A 1HH6B 4DJMA 3T0BA 2AK4E 2HVKA 4JFFE 1EHLL 2APTA 1OT2A 1G7MB 5DQJB 2VLJB 5SV4A 2DLFL 1QHPA 4XWOC 3KYNA 2OZ4H 4MAUH 4NJ9H 1ZLVH 4NM4L 3V5DB 2ZJSH 3OZ9L 4Y88A 3L3JA 3O8XA 3X17A 3PQYA 3TF7C 1A6PA 2XZCH 3BKMH 3QXAA 4R7DA 4WDIA 4G9FE 4E41B 1QO3A 1QFWH 3UBXB 5D9SA 5E08H 5JDSA 4U6XA 4X5WA 4BH8A 1QSVA 5FO9B 3WS3B 4Y4KA 4MAYD 4ELMF 5DJ2B 4I5BA 1FO0A 2YD1A 3JWOH 1Q94B 4PJHE 3CFDB 5AAMA 2W07A 3LQAC 5MHSD 1ZSDA 1IGIL 1YQVH 1ZVSB 4M8QB 4ZUUA 2NY7H 3JBG7 2AXFA 1YYLL 4PJ9C 3HE7A 3M17A 5BO1L 4MJIE 4N68A 4QRRA 1NSNL 3EDJA 1I8IA 5MP6L 5FUOL 1K8IA 1XAUA 1RJZB 3UTZB 1BFVL 2X6MA 4MYWB 3GHEL 4KJQC 4LFHG 5CJ5A 4FFVD 3ALWA 5KVEL 4WO4A 2Q7NA 3NAAL 2UZXB 3GK8L 4EUPA 2VLJA 2I07A 1JNHA 1S5HA 3PWNA 4WGVB 1AFVH 3LDBC 1AQDB 5EZOL 1MLBB 3VGBA 1HI6A 1X3DA 4GT7A 3IJYB 1TVBB 5KSUA 3QUXA 2YPKB 3FTGB 4ODVH 5EZJA 1QSEE 2DIJA 3SJVA 1T7VA 2MPAL 5EBMB 1K8IB 1HZHL 2R2BA 4MHHI 1GGCH 4U7SA 3STBA 1BF8A 2GK0B 4S1DC 3NBNA 3LQZB 1A4KB 5DD3H 1MJ8H 5J3HC 2R9HD 3MRDB 2WQ8A 2RGSA 5TDPB 4OZIF 2ZCKL 1HK6A 4P5MA 2IPTL 3P9LB 3WHXB 4ISVB 2XXCB 3BN9C 3D85A 5C0IB 4QHUA 3HS0A 4P2QA 4O9HH 5IBLC 4K3EH 1FYHB 1N7MH 4GH7B 1EVUA 4PJAE 3L3DA 5LQBL 3FONA 1DQLL 3ZKSD 1Z2KA 2X5PA 2ZSVA 3UZEA 4NO3A 2QQKH 2BOCB 3GSNA 4UINH 5BZWA 1A7BA 1GGIL 2AGJL 1UT9A 1P5VA 4OZFH 3V4PH 2WBJC 2SEBA 1MQ8A 3CLEH 1UACL 5SWSB 12E8L 3OKNA 2WBJA 3IDXL 4POZD 5D5ME 3TH4T 2YXFA 1U6AH 2VH5H 1CGVA 4M4RA 1MCQA 3T8XA 3QUML 4DKEH 1EX0A 3M45A 3THMH 3DSFH 3MCLH 2V2WA 4C59B 3O0RH 1BFTA 5JMOC 3UC0L 2XZAL 2X4SB 1TTFA 3I75A 4ZQKB 3ULVE 3OR6B 4OT1H 2FECI 2XTJB 1RURH 1YMME 1VDGA 3I50L 4WWKB 4U3XA 2FX7H 2Y07L 3GSVA 1T20B 3MRHB 4G42B 1A22B 5IB3B 4GG6E 5BS0A 1VGKB 2FJFB 4X6DB 1MIEH 1A7PH 4O51A 4ZFFA 1YNTA 2VLRE 5JDSB 3IU3A 1QSFB 1UM5L 5CINH 1UFUA 4OCNC 4F7MA 4YHNA 1F8TL 2FGWH 1VCAA 4MA8L 4DTGL 5I1DA 1UADC 5EC1B 4PP1C 2NYYD 5TGBB 4UB0L 5E99H 4OZIB 1BWMA 5EOQL 3IDGB 1AD0A 3BIKB 1BVZA 3D69B 2H1PL 4GRLA 5EOTB 5CGMA 3RZCC 4L4VE 1LMKA 3P0YH 3HRZB 4Y2DB 5JIPA 4XWOD 1T1WA 1VFMA 2GUOB 5F7EH 3VA6A 1EEYA 2B2XH 1RJZA 5CKGA 3UTZA 4U1LB 4C83B 5JZ7D 3UPCA 32C2A 4WW1A 4YDJB 1S5IH 3ZE2E 4OLWL 1GGYA 1QBLL 2NMSA 3PG2A 3BKCL 4XRCA 2IG2L 9CGTA 2NYYC 5ISZB 4TUJA 3ARVA 2VISA 3WLBB 2BC4B 4G42A 4L3CB 4D9LH 1IM9B 3GKWL 3O6LH 1F90H 1A21A 5CSZB 3MRCB 3IRZA 1YEGH 4Z7VB 1DJSA 1XFPA 3X11A 4NZUH 3NCFB 5D1ZA 5FOJA 3RKDC 4Y1AB 5CEYB 2X10A 4NQCA 2RCSH 4DUWA 4RWHA 1S7RA 3U0PB 4K8RC 4NCC2 5DMJB 2IBBA 4IIQB 1LEKB 5FYJE 3QUKB 2F74B 2CLRA 2FHCA 5EFIA 4YR6A 4ONHB 5DJ0A 5GSVA 4H26A 2FO4A 2ADFH 3S88H 4E0RB 3HC0B 2R2HA 1U8JB 1QHOA 3FO2A 1FYTB 1PKOA 35C8H 4KQ4L 1W0VB 5D5MB 2WLYA 3GKZA 4HC1L 3UJJL 4JDVA 4XCCH 3T3ME 2W38A 4I3RH 4X5XA 4DN3H 1T66D 3L1OL 3BO8B 4YE4H 1BZ7B 3PGCA 3WMSA 4NQXB 3B2UC 1IAIL 3FQWB 3GHEH 1BQHG 1JFQH 3ECBA 4CNIB 2CJUH 5HHPA 3P4LA 5ETUA 1RULL 2B1AL 3U6RA 4QT5B 4F3FA 1UG9A 1E6JH 1JHTB 4HXBL 4BZ1L 1T6VN 5FA4B 3O41B 4RRPA 5E2VH 2HP4A 4DGVH 4S1QL 5C92A 3DPBA 4GRWE 1CBVH 5F97E 1FZOB 4XVUD 1I1AB 4GAFB 5LXGL 3IXTA 1U42A 4K3DL 2HT2C 1P84K 2VTFA 5FF6B 3BPOC 2EXWD 3LEVL 1P9MC 3MBEB 2CK2A 5IMLB 3VRIA 1MWAL 1ZANL 4Q6YA 5FM8A 3U4EA 1PAMA 3VJ6A 4ZODA 4JB9H 3DMMA 1LVEA 1OTTD 3C2SA 5DEGB 4Y1AD 3MV7D 4N1EA 3H9SA 3MUY1 2LTQC 2VDNL 2QKIB 2BVQA 3WLWC 4XBPA 4ZPTA 5KZCD 3FN3A 4HZLA 2R1XB 3TPUA 3MJ9A 5HYSB 5FF6A 2B5IB 3KPSA 1TZHB 3SE8H 3RUGA 3RVVD 5KS9F 2DM7A 2A73B 2KL6A 3HAEH 5C86A 5ID0A 3VH8A 1Z3GL 3KHOA 2P48B 4ZNCD 4F8QA 2K7QA 4UINL 2EO9A 5FV2A 5EOCH 1VPOH 3TO4B 3F58L 3RVUC 1Y18A 5CIPA 5FUZH 2AKRA 1GXEA 3V0VA 4L8CB 2GCYB 3FQNA 4JGJA 3TBTA 2GSGB 2XZQL 1AD9A 1KB9K 3MRCA 4WI3A 3QFJB 4ZS6C 1OP9A 3FQRA 4Q97A 4K7FB 1BPVA 1N8ZB 5K9QG 1MHCA 4UIKH 1KB5B 4NRYA 4G9DA 3QEHA 4ELKB 4IOFD 2D31A 2VO5A 5E8DH 4JJ5B 1IAIM 5T3XL 5KS9B 4KZDL 1IE5A 2BOBB 1A6ZB 4RGNE 4HUWB 5E9DD 1FC1A 4LKXA 1FFOB 4UILL 1OL0A 1B0GB 4V2BA 1UWEL 3KJ6L 1FPTL 1MLCA 1YMMD 4EOWH 4V1DA 2PXYB 1RZKL 1EAJA 5D1ZC 3HI5H 1N6VA 4Q0XH 1E27B 5AYUL 5HHOE 5EORL 1G7PA 5EUOA 4IIQA 3LRSA 1JPGA 3E8UL 1KXVC 1PLGH 5C9JA 4XNUL 2OYPA 1JF1B 2GJZB 2RB8A 2QV2A 5I1CH 3DGGB 4QTIH 1OPGH 3C09C 3BYYA 4X7CC 5ALCH 1U8NA 5IROC 1IMHC 3AC0A 2Z8WC 5I74C 1YY8A 2JB5H 1JTTA 2YA2A 5EU3A 1UGNA 1I9RL 2NLJA 5HGGS 3UYPA 1CFVH 1WTGT 1UJ3B 3UJTL 4M6NH 5IK3A 5ICZA 4PBWD 1MLBA 1S8DA 2W9EH 2VC2L 3CUPB 1SY6H 4G6ML 4OLYH 1NQBA 3VH8G 2X4UA 4YIQB 3S7GA 4RZCB 1EXUA 5D96C 4MNQA 1S7QA 4MJ5B 4WV1A 3GMMB 4MDIB 4RQQA 5CBEB 4YHIB 3SPVB 2EYSB 2NX5D 3S37X 3LMJH 1ES0A 4LSVL 3WJJA 3RVTC 4N8CH 4Y4FD 2F58H 1UVQB 2OP4L 1MFNA 3GEWB 1R5IA 3NCCB 4IM8A 5DJ8A 1U8IB 5DS8A 3O9WA 4M7LT 1ZWIB 1ZS8A 4HWBL 1WZMA 4PJFE 1KGCE 2ZUQB 3BPLB 4HFWB 1H3PL 4OFKA 3HZYB 3OX8A 2P8PB 2P5EB 3V6OA 1XGTB 1F13A 4H88L 1L9MA 1U8QB 3KYKL 2O61B 3ZDYE 4NBXB 2I9TA 4O58H 4KQ3H 3G9AB 5EG6C 3LOWA 5CP3H 3EO9L 3VXUE 1A7RH 3C5JA 1W72H 3ROOB 1W0WB 2V5YA 3DBXB 4PJBA 3S88L 4WUUB 4LIQE 3B8YA 1TJGL 1RD6A 4JO2L 1W8NA 4PGJA 4KV5E 4AM0A 4GG8A 4WFFE 4ZUVB 2X1QA 1A6TA 3E0GA 4M7LH 1AKJD 4U6XB 4X5WB 4BH8B 5GS0D 1I3RA 3V6ZB 5CBEA 2GSIA 1YYLH 3QDHA 1GYAA 4ODWB 3EIFA 2WW8A 1X5KA 1JGUH 1FJ1B 2XTJC 1CI5A 3QCUH 2CKBA 1X5AA 4JZNA 3QIBA 1E6OH 5I30H 3O4LE 3G5XA 3P3YA 4I2XE 4EIGB 1ZWIA 5I1IL 1HE7A 3LKSA 3K2UL 2DQUH 2FEDD 1U8KB 4JG1L 4KRPC 1FNAA 1NBZB 5T5NG 4YNYB 1RFDL 2EKSB 4PB9H 5ICYA 1E27A 3LHPL 4F7MB 1EGJH 4F7TA 4X4ZA 1LE9A 3L3IB 5E5MA 1WBXB 5KVFL 2FD6H 4IOFC 3M1BB 5D2LF 5D4QA 1LILA 4RA0C 3FB6B 4E9LA 2D7MA 3VFOA 1FVCA 4O2CA 2XN9A 3QDMD 1BAFL 1BM3H 4I4WA 3ULUF 4N1HB 3WKNA 2VLMD 4MVBC 3BD4A 4YEFA 4OGYH 1Z9MA 1FO0H 4IHOB 2W60B 1KEGH 4FS0A 1RK0A 1UCBL 3ABZA 5DD1H 1T89C 4HAFA 4Z78A 4JLRB 4M61A 3AGVA 1JYVA 2YPLD 3L3IA 1JWSA 4FP8L 3B9VA 5C0AB 5DMGC 1NGQL 4A2MA 4S1DD 1EHXA 1FL5A 1QFWL 4XTRD 4A6YA 4F2MB 3MLRH 1GZPA 1GC1H 3SOBH 4UU9A 1ORSA 1W72A 3HMWL 3QFDB 3OAUH 3VXRB 1AR1C 2KQNA 2EDFA 1FDLH 5C08E 3U46B 1LK2A 2FWOA 1ACZA 5TH2A 3SPVA 4P46B 1GOFA 5D1ZB 2QR0B 4N0RA 3MJ6A 3C8KB 3U36A 2I9LB 1M71B 1KG0B 1QZ1A 4G5ZL 4PJIF 5CD3A 4KI5C 3P2TA 4ZUTA 1I3GH 3A6CL 4NO5A 1NJ9A 3DSFL 1MJJB 4JDZB 4XMKH 5D7KD 5SWSA 3T0XA 1HQ4B 3G5ZA 1LP9F 5J0BA 1FPTH 3ARTA 2K3TA 4MWFA 2VN4A 4Y19B 5EO1A 3HI5L 3ALPA 4FG6D 3DXAE 4POZC 1BX2B 1I7TA 2R4RL 4WY7L 5A43C 1FBIL 3DTXB 3P30L 2ICWJ 1NFIA 3GIVA 1D6VH 3AXLB 3EDKA 4MJ2A 1MFDL 1T21A 2A1WL 4HIEA 4TNVK 2HT2D 3MLUH 2J8OA 1T1YA 1QQDA 3NGBB 5CEXA 1PYWB 1G9MC 5GHWL 4AEEA 1RZ7H 3RU8H 2HYMA 4WW2C 3JWOC 2FATL 3OR7B 1VFBA 4J1UA 4M7KH 4NJ9L 4BSVB 4OZHF 2IPTH 4DOHE 3UP1A 4U1NA 3IFOB 1ED3A 2AAVA 2BXZA 1VKXA 1IAOA 4FFYL 5I76A 3WSQH 2COQA 3LKQB 3V5DA 3HG1A 1S5IL 1U8HB 3WHXA 5KSBA 1RIUL 4YHOL 3N0PB 2XZCL 3BKML 3DYOA 1QPPA 3Q3GA 5D7IB 4JM2F 2FSEB 1JUFB 1OF2B 4OFVA 3KPQA 4OGAD 4YBQC 5DMGD 1J18A 2YD9A 1FVDA 4MXVE 3GMNA 3TBWB 3VG9C 4XB8A 5DEFB 1RZJC 1G7JB 4P4RA 1WWAX 2W9LA 3PDOA 5CJQH 4NUGH 1IAOB 4HMDA 3D39B 2P1YA 2Q20A 3VFVA 3G5VA 5BO1H 1WAAA 1R3JB 2VUYA 2C7UA 1CIDA 3KPMB 4IMKC 1OAQL 1K2DB 4Y16B 1Q72H 4KRMB 4P59L 3KPQB 1D5IL 1OTUD 2D9CA 2FX7L 2Y07H 4R3SA 5F1SA 1CG9A 2F53E 4AT6B 2B7DT 2NY3C 3BGFB 5JO5B 3T09A 4Y1AA 5CEYA 4YDVA 4NQCB 2ADJB 2CLZB 2W65A 3GSXB 1JZ5A 1DN0B 4F7EA 4OI9A 4JO3L 4L1HA 3O45A 1LEKA 1WF5A 2C1OB 1MHCB 1U9KA 1REIA 4V1DE 4JG0L 4LPTA 2R56L 3GO1L 5DHVA 3SDXE 1CFSB 3QJFA 1HKFA 1BHGA 2L0DA 5F3BA 1DQLH 1MI5B 3K80A 1H3VA 1DUYA 4D0DA 2OL3A 2E3VA 5HHOD 1N0XL 4KAQL 3CDYA 3UTSD 5D2NB 1G7LB 1P53A 3ESUF 3T0EC 3LN9A 3QBTB 1BZ7A 3PGCB 2L7JA 5HVHC 1J0HA 4O4YL 3D3VB 3SE3A 4PGZA 1FLTX 1FSKC 4UDUB 3K74B 5C07A 2DLHA 1OCWL 5DTFB 3F7YA 3H2WA 4J4PD 3MJ7B 2HLAA 5DFWH 4U2YA 3WNMA 4DN4L 5IW1A 2VDML 3THML 4EDXA 4QYOB 2P24A 4WVRA 1JGVH 1IQDA 2C9AA 2IJ0C 4JQIL 3AU1A 5EBWA 1JGEA 1XGRB 1J0ZA 4XX1E 4LGRB 4LCCC 1MFAL 1I9IH 4LVNC 3V7AG 2VITB 4M93C 3MROB 1Z0NA 4JFYB 3MRIA 4Y2DC 4WV1C 3KS0J 1NCCH 1MFEL 3VXME 1XF3A 2BJMH 2CIKB 4PIRF 1SYVA 1NLDH 1B90A 4PJDF 3L5XL 3DHMA 1JNNL 1RUKH 1UM6H 1OAYH 5C0FA 1DUYB 1R3IL 1JJUA 2XTLA 4OLZH 1RZJH 3MJGX 2VDQH 3WDHA 4NQDD 2WBWB 5F70A 3VXSB 2HKHH 2H1PH 3S36H 1A6AB 2QL1A 4HK0A 5D93C 2BERA 1F8TH 2QQQA 3LKPB 1QSFE 5FGBA 1MUJB 4GW5B 4UT7H 4NKOB 1TENA 3CVHL 1AY1H 5DRNB 4MXVF 4HKBB 4D9RE 1OGAD 2NX5A 4NOBA 1N64L 1NLBH 5D7KE 4HULB 2RBLA 3BJLA 5BVPH 1Y6NR 5CJXA 1HKLL 4X9FA 1XF2A 3IFLH 2B1HH 5D1QD 4QGYA 2HFGH 3QDGE 4NRZB 5EIVA 2ZKHH 5TQ0L 4OF6A 5B38B 2PTUA 2O26U 5DVNA 3X13A 2W0FA 3VXRD 1KULA 5I73B 4JY4A 5BRZE 4D9LL 5BXFB 4QTIL 3D2UB 2DTMH 4X4XB 4BYHA 1MRCL 1U92B 1HCFX 3WLWD 4XCFH 4GW4B 2OR9H 5F7UA 3OKMA 1WFTA 3U9UB 5D1QC 1KACB 3D0VA 3RWIA 1OQOA 4GW5A 4L8SC 1J5OL 5BZDA 4MCYA 3MFGB 3ARUA 4KDVA 2CDFB 1E4XI 1IGJA 4JKLA 3T0WA 3VI4F 3H9HB 3QWRD 3ARSA 5FO9A 2P8MB 3RTQD 5I18L 1MFCH 4LSUL 3WS6A 3WO4C 4R7NB 1A4JA 1AGBA 1CK0H 4XCYA 5LG1A 5GZND 2YWYA 1NCNA 2FX8H 4NIKB 5C0BE 1OD9A 2X4NB 3EYOA 4ZUUB 1AXSA 3MV7A 4XHJC 3VH8B 1J0JA 4X6DE 4F15B 3DGCR 4XPAL 3X13B 3WXWH 4EBQL 4KY1H 4BFIA 3DMMC 1CF8H 1D5BB 4RGNC 5HYQA 2NXZD 4NSKA 1KCVL 3MR9A 2H32A 5DUML 1W2KT 4X8XA 1U95B 1OOAA 2AV7B 2I9TB 2Y36H 3K1KC 4DK6A 1JV5A 43CAB 2YD3A 5HI3D 5IKCB 3S35L 2FZ3B 2HLFD 4V2CB 5FOBB 3ECBB 1DDHB 4LEXH 3M8OH 2NY0B 3HUJA 2PN5A 2ZZUT 3GB7A 4K3DH 5HD8C 4AG4L 4GS7C 5EORH 5JXEC 4FQHB 2CMRH 3D0LB 5JORA 1JTOA 1URLA 1I9JL 2IAMC 3F12B 1OY3B 4Y89A 4RMWA 4JO3H 1JIBA 3DLQR 1NGZB 5GZOD 2ICCA 5ALCL 4K8RD 5I8KL 1XF5B 1R24B 4HS3B 1HHHB 4WEBH 1RHFA 3GGWA 4V1DD 4BH7B 1XZ0A 1CFTA 5FB8A 5IIEB 5IGXH 1ERNA 3NIFF 1N5AA 1JMZA 3V4UH 3MUHL 5CCKL 5E9DB 5HXMA 4FQLH 1P69B 4OI8A 4FABL 3R06B 4Y8DC 4OLVH 5B39A 4EN3D 5DURB 2P8LB 4N5EC 1EZVY 4I48B 3NZHH 3DO7A 2FZ3A 4EQ3A 4QXWA 1PGRB 2PYED 3ROLB 1ZLSH 5GRUL 1OCWH 2CR6A 4G8GD 1CXKA 1F6AB 3CX5J 2X40A 1NCUA 3LMJL 1C1EL 3EW3B 1RK0B 3NA4A 4JREC 4N8CL 4JFZH 1BVLB 5EU5A 3DX6B 2MKWA 4RSVA 3ZDXE 4Z7QE 3W0WB 4ESKA 4HQQH 4I2XB 1RUQH 3AMKA 1FE8L 4N8PA 1PZUB 1MCHA 3D9AL 4QHNA 4MQXC 1AC0A 3ZHDA 5DD1L 3FB6A 5DI8B 3QUMA 1ZV5A 3LEYL 4JFFA 2AJVL 2AW2A 4PD4K 3RA7H 5T1LA 1CN4A 3QUXB 1WWWX 5EU4A 3EKCA 3L5XH 2VDOL 1YJDH 3DX6A 1S3KL 1KJ2B 5MERB 3HLAB 3QA3B 1U58B 3OAUL 3P4NA 4S0SD 1G7QB 1FDLL 3S35X 2WUCL 3UAJD 2IANA 1RZIA 1SQ2N 4FQJH 4NUJA 4ONGL 5JOFB 5I1CL 5F7WC 4OGXH 4WI4A 5EH1A 3GBMH 2PCPB 4XX1G 3ME0A 1CFQB 3O9WC 3ES6A 1CLYH 1HOCB 2HTLC 2UZIL 1F5WA 5TDOA 4G6FB 1FNEB 5DRZA 5GZOC 4OBSA 5MERA 1ZEAH 3VXTB 5E4EC 3VD4A 5HHXL 3ZZ1A 5I73C 5GRZA 4Z95H 3EUUA 3UTTE 4KKLD 1KIRB 2Y7QB 1JYXA 4M6NL 4RX4A 3T1WA 4OKVA 3VFUA 1BBDH 5C08B 4L3AA 3MLZH 1D5ZB 4G6MH 4NBZB 5E6IB 4TVPH 2ARWA 4K7PL 4LASH 3TIEA 5C6TH 1QEWA 4PRHA 1S78D 5DO2C 2FH8A 1AO7E 4I18A 2UVEA 1EO8L 1RIVL 1K9TA 3QA3A 4BZ2L 1J8HD 3QEQB 2OP4H 4X6CB 2R8SH 1DP0A 3QQNA 2GT9B 3GMOA 3MZGB 4LFHD 4NNYB 5F7DA 1QLFB 4KVCL 4N0FB 1OSPH 1WICA 2B4CL 2OMBA 1X5JA 1QFWM 1O5DT 3RJQB 3WJLA 2MJWA 3PABB 2VXVL 3VXUA 1OAZL 3ZSSA 3QJHA 4OUOA 3SO3B 1ZT1A 1KLUB 1GC1L 4G8FB 4ZAKC 3SOBL 1K5NA 2RFXB 4PRDA 4J3SA 2MFNA 1SM3H 2XIDA 4K3JL 4U33A 3E1F1 2NY1C 3WCYA 3DROB 4F37F 2QQNL 4X6BB 5HYSG 4FA8A 5GGVH 2Y1VA 3I6KA 5IEKB 4G8EB 4XP6L 3DX9A 5E8NA 2Z91B 3MLXL 1GSMA 4HWBA 5JXEA 3A67H 3HB3C 2YD6A 1J12A 1JYWA 4NN6B 1LK3L 4AEFA 5DR5H 4PY7B 1MNUH 1HHIB 3DUHA 3SO3C 3WO4B 5GPRA 2APBA 1JZ6A 4OCSL 3FHAA 4Z7QF 2AV1B 2E6QA 2AJUH 1E6OL 5C09D 3QUMH 4JKKA 1OM3H 1SMOA 3SGJA 5T1LB 3L3OB 3PWUA 3MCLL 1AI1L 3IDJA 4CVZA 4KZEL 1MF2H 5HYJD 3B8SA 4JG1H 2AK1L 1JPTL 4IMLA 5DLMH 4RCAA 5C0AD 1LNUA 4K55A 3SDCC 4NKQB 3CNKA 4JFOA 1CG9B 3DXAB 5T1KB 5I9QC 2NX5E 3TNMA 3FL7A 1CGTA 3IXAA 3QNYB 4U1KB 3FFCE 2PW2A 3G08B 43C9B 4TPRL 4YDIL 1H5BC 5GISL 1J05A 2FLBT 5I1HL 2J88L 4LNRB 5GGUA 4PG9B 4KMLB 2FLRT 4PJFB 2X4RB 3VFWA 3RIFK 3HN3A 2DQFA 3CSYA 4POYA 4MNGA 4NZJA 2OTWA 4LEOB 5I66A 1HHJB 4YR6B 5EFIB 1NUNB 3PL6D 3WSQL 1LO4L 1N5YH 5C0CA 4HBCH 4H1LG 1DL7H 3S34L 1D7FA 1CFSA 1KB5H 4KJPC 4UZGA 1GPOL 1ODAA 3QNYA 3GI8H 4HHAB 4JDVB 5DMIL 3RY6C 4EJ1C 1K6QH 3KPNB 3MRKA 4IIQC 3UTTA 4H20H 3WNLA 1JZ2A 3BT2L 2IBGA 1J1PH 4OCMC 5CJXC 3P4MA 5D1QA 2IH3B 3MBEC 4TUOA 3SDDD 4BSWB 3RGHA 5JQ6L 4GOSA 5KS9A 3I6GA 4EEEA 3A6OA 2MQCA 2JE8A 3K0WA 2FO1A 5BZDB 4UDTA 4G5ZH 4TN9A 1XR8A 3RGVC 1V3MA 4MMZC 1G6RB 5CWSB 1PVHA 4WCYL 5I1KH 1FZOA 4KTEL 3SGDI 3DV6A 1Y6KR 1TIUA 3BZ4B 1ND0B 5GS1B 4JZOB 3VWKD 1CLOH 1T0NA 2V5TA 2NXZC 1LO3L 1Q38A 1J1OL 4R7NA 3WNOA 4YGVB 4FQXD 1YN6B 3LEXA 4ZFOL 4NRXA 1ZTXL 1EO5A 4OD1H 5CJBA 4WRLA 4PJEE 2G9HA 1S7SB 3MTRA 1RZJL 3TA3D 4Z7UB 5E4EB 4P5TC 2Z4QB 3GHBH 4D9QD 2CLVB 5I71B 3EHBC 3ARFB 4KKBD 5J56B 5IG7A 1U8OA 4XP5H 3TESA 3GUTA 3FKUS 4PRID 1F3DJ 2M26A 4P9ML 4F7EB 1KFAH 3G6DH 1T5WB 1XEDA 4M62L 2NQCA 4RAVB 4XCCL 4LSQL 3QZWA 4YHOH 1CICC 3JUYA 4PR5A 5MEPB 3QPXH 5C6WH 5DJXA 2X4UB 4AEIL 5J6GA 1G9NC 3GSWA 2ESVD 4TNWF 4AEHL 2B1HL 4FQHA 3AY4A 3KYMA 3HMXH 1R5VA 2VZVA 2XA8L 2H6PA 4GMSL 3SDDB 3RUGF 4YXLL 1KV3A 3GZKA 1EFXA 4PJGE 1YN7A 2YA0A 5L6YL 3IAQA 1YN6A 3LEXB 5D7SL 1UJ3C 4K23H 2CIIB 2CSPA 3T2OA 3KR3H 4XAWL 4DGVL 5HTSA 1VACB 2BY2A 1K3IA 2BVPA 5F6IC 5IFAL 1CBVL 1CE6B 1IEHA 5HHOA 4K07A 5D70H 4XNQB 1MREL 5A16B 2DQTL 3MREB 2VZTA 5EBGA 5LWYL 4I0PD 4XC3L 2CPCA 3ARFA 3TT1H 2VDKH 3GSOB 3R8QA 5FYLE 2VOTA 3HE7D 5KG9A 3D25A 2XPGA 1PX3A 3D6GA 3QXWA 1L0QA 5D7IF 2AK4D 3RVUD 2GSGA 3CDGA 3VMPA 4HF5L 4JFFD 4F57L 2QSVA 1RPQA 3D2UD 4PJGA 3RZCD 2VXVH 2OTWB 4LEOA 5E7FA 5A3ID 1UYWH 5IVXA 1Q0YH 4KDWA 2BNRB 2QQLH 4UV4L 4FTVE 2Q8BL 3PXJA 2VLJD 7CGTA 3QRGL 3LY6A 3OV6A 3LQMA 1IC5L 3SE4C 5MHSE 3OPZL 1DVFA 4X8JA 4OGZA 1VERA 5IHZB 2FJHB 4QWWD 5HDBE 4CVXA 1JPSH 4W68A 1G7PB 5EUOB 3TJEH 4KXZH 1AIFA 2VLKA 3EGSB 3IU4H 1KCVH 5IVXB 4ZXBA 1OARL 3RDTD 1U93B 5I19L 2DJ4A 2HMIC 4JRYA 3QP3A 3ARGC 1UXSB 4NQEB 4NGHH 2WNGA 1NL0H 3GIZL 4KUCF 1MVFA 4PFEA 5DK2B 4F8TA 5F3BB 2IH1B 4OCYH 1OAUL 1OP3H 1MWAA 3CC5B 1Z9LA 4ODUA 1S7TA 5CS7A 3HLAA 4H8WC 5H37G 2A9NL 4YHML 1YNKH 4LLQB 2Y4SA 4APQC 1FFNB 1XR9B 1TPXB 4TRPL 4OQTL 3NN8B 4NBYB 3MUZ1 4QTHB 3BQUD 5T3ZD 3BRDA 4PJ9A 2DJUA 2OXHA 3UYRH 2DTML 3RY4A 5J4MA 4LGPB 4ZSOA 1P7HL 2PXYD 1Q9LA 4TPRH 3DX8A 4RGNB 1B0RB 3LAFA 4YDKL 4YPGB 2J88H 5IG7B 2IFFH 4QXUL 4U1SA 2R1YB 4YJZL 2P49B 4Q6IB 5E08L 4N9GB 2DQJH 4F2MA 1T03L 4HLJA 3BDYH 4BH7A 5L88L 4PJEB 1ZOXA 1T2XA 5IW6A 2BJML 1FFOA 1KN4L 5DQDH 1XIWD 1IGFH 3UZQA 4GQPH 1I9RH 2YD4A 4OCLC 3MYJA 2ADIA 3HC3H 4G6AD 1N4XL 1FQ9C 3VFGH 4OF7A 3LIZL 4I2XA 3EOTH 2N7BA 3VXQA 4ZO9A 4PJBF 1PSKH 1NAML 4NYLB 5K33A 4AY0A 1IL1B 4DW2L 4MHHG 4MA1C 2Y5TA 1YYMH 4MJIA 2Q76B 3MBXH 1A7OL 4PJIB 3VFSB 3S3SA 3U9PH 5IW6B 3V6FB 3W2DL 4A2LA 2VIRB 3MOBH 4XXCA 5DRNA 3IKCB 1F45A 3MCG1 4BELD 1K5NB 2OJEB 5JZ7C 3DRTB 5IMKA 3O6FA 4LVHB 5F7MC 3SDXF 1UH2A 3QIUD 3V7AE 3D3VE 1QYGL 2DOCA 1GGCL 1IEBA 2LAGB 1XH3B 1B88A 2IMNA 3RWGB 4WUKL 4KHTH 3RWEB 2Z91A 4P49A 4HS8H 4OF8A 4MNQB 3QIUB 5AAWA 4JLRA 1NGWB 4M61B 5L8KB 1T4KB 2X9YA 2NPLX 1C5CH 4OM0H 4Z6AT 5BJTA 1C16A 2DMCA 1ZVHA 2E9IA 2OTUB 4KTYA 5C09E 2PYFA 4PJXB 2DI9A 3FRUB 1R3HA 4PJCF 7FABL 3HG1B 2DDQH 4ZTOH 1G9MH 1NFDF 2OLDA 3TIEB 4C56D 4ZFZA 4PJ7A 2P8PA 2XA8H 3IU3B 5E2TH 5CAYB 5TH2B 1IGTA 4QRRE 3MFFA 2OI9C 4YWGH 3WIHL 3FFCD 1CF8L 3W9EB 4PJAB 5TDPA 1OHQA 3LS5H 3HI1B 5DUMH 1W0WA 3DBXA 3TH3T 4HT1H 5K9OA 1F6AA 1EGJL 4OCRH 3MRFB 2YPLB 3OAYK 5HDQH 5LBSH 4WI8A 5KAQG 2R23B 4JFPB 3UZVB 2AJZB 5LGJB 1AP2A 4D9RD 4HUXA 3V6ZA 3OAZH 2BSSB 1U95A 1YMHA 1MAML 2PYEA 4LQFH 1DANT 4XNXH 4JQXA 1A7PL 4Z8FH 4NCC1 3MLVH 3F5WA 3RL1A 1C16B 3LQAL 5MI0C 2GTZB 4ZMAT 2C1PB 2F5AH 3FT4A 1UH4A 1DE4A 3G5XB 1D5XA 3PWPA 3QB7C 4S1RL 2DIBA 3ZDZE 1M7DA 2E27H 3HUJB 5CSBA 5DD5L 1A6VL 1QA9B 5TF0A 5IB4A 3VXRE 1TQCB 3EYSL 2G5BA 2P46B 5FYJD 3L3DB 2XNAA 5C0CD 5CP7A 5D7JA 3O8XC 3KHQA 5IROA 1D9KA 2X4TB 4PV9B 5I8CB 2EO1A 2Q8AH 2GTZA 3MGAA 2D4DA 3RPKA 4U1MB 1PYWA 1A7NL 3O11A 2I27N 1ZT7B 5JTWA 1XGPB 1A9BA 1C7TA 1OAUH 2XKUA 4JFPA 4FQPA 3L7EB 4HUMB 3CFCH 3HFMH 4ZOBA 4ZS6D 2MHAA 3STLA 4WHDA 3GKWH 3NTCH 4UNVA 1MFBH 1KYOJ 2QHRL 3CH1A 1JPFB 4RNRB 4JFZL 3ARGD 2VE6B 3K8KA 3G08A 1MCFA 3WJJC 5AWNH 4GKZB 3MMEA 3ET9F 1W72B 1CT8A 2NY4D 4JAMA 5MENB 1C1EH 1RY7B 4Y16A 1CE1L 1L7IL 2ZPKL 1TETL 3LEYH 4LDOB 5DT1L 4LCYB 4IMLB 2Z93A 1HHJA 1VB9A 3MLUL 3QDMB 4YDJA 4KRNA 5E8EA 1XGUA 1RUQL 3D9AH 3W5NA 2DQHL 3HZMB 1I1YA 2GW5A 4KI5F 3MV9A 1EEQA 4HHAA 2D0GA 5E00A 2XTJD 5D6DA 2J8UF 4LAQH 1GC1C 5LGKA 2IBZX 3L7FB 1N26A 4HKZA 1BEYH 4HGWA 3VXSE 5DZOA 3GI8L 3V5HA 1T2QH 2EC9T 4GRWB 4JJHA 3RPIA 3JVGC 3OHXB 5I66B 4CMHC 1A6WL 2CIIA 2EH8L 2LVEA 1CTNA 2JJTC 32C2B 4WW1B 3BT2H 1DLFH 1MY7A 5IFHL 5MP6H 2ESVA 1K4DA 1G7QA 5GRWA 4X7DC 1OLZA 3ZYIA 4P2CG 1MEXH 3RL2A 1DBML 3GJFB 4UQ2B 4X6FA 3E3QC 4YHLH 5FYLD 5FYKE 3K4DA 1M7XA 3EO0A 4Z0XA 3UEZA 3MMEB 1L9NA 4CBPA 3PNWB 1K3ZA 3O3AB 5L9DH 1MNUL 3QPQD 3QWOA 3O45B 4G80B 3KYOA 3K81A 1ZEAL 2X2YA 1XGUB 3MRGA 4DUVA 3KLAA 4JFEB 4ODXA 5KVMC 3MPCA 1N59A 3RWHA 1W0YT 5D71L 1AGEA 3ARFD 4QNPF 1IAKA 1LO0H 4QOKE 1MOEA 1TVHB 2ZG1A 1G6RA 3C6SB 1T20A 3IVKB 4M7ZB 3O6FC 5JIHA 2XA3A 4H8WL 4WI2A 3EZJB 2HTKD 5SX4H 2IPUG 3QFJA 4P4KC 4YHPB 3BXNA 4I18B 5B4MD 1R3KB 2XWBB 3BAEL 4WGWB 5MEOB 3MNWA 5F7HA 1LQSR 1ONQB 1N6UA 4YHNB 4ZO8A 1V7NH 4JPIB 4KROB 4U7KA 1ETZB 3SE4A 1DVFD 5T1MA 3ZYZA 4KKCC 5IW1B 4U0QB 1CGWA 1V7MH 2EC9U 4LL9A 3NFNA 2Y9RT 4QOKA 2H9GA 4KJYB 4Y4KC 1U8OB 2DYPB 3VGAC 2AXGB 3HE6D 4K7PY 1NPUA 2B4CH 1GPOH 1FNSH 2MQ3A 4Z77A 3MLPA 1PZ5A 2A83B 3VXUB 2ZNWA 1UACH 1KN2L 4HPYL 4JRYD 4MD5B 4FQIH 4JPVL 4H20L 2YUWA 2HJFB 3W9DA 5I6XC 3VFRA 4HK3J 4OD3H 3WFEH 3KR3L 4XAWH 4Y4HB 4PTTA 3L5WA 3HAEB 4H1LA 1WIPA 1IEAA 3MV01 1UZ6E 5E6ZA 8FABA 3MV11 3TPUB 3VA2C 4GKSB 5HYSA 3BQUC 3KPSB 3SGEI 3B9EA 4YUEH 5GJTL 2BFVH 4GAGL 4LSSH 3O3BA 3I3DA 1QFUL 5BRZA 3IFPB 1MI5D 2BVPB 3CFBB 4OAWB 4KTEH 1IC7H 4LHUA 3UTTD 1EEZA 2CXGA 3O8XB 5DUPH 1TITA 4XNUH 4M6OH 2BZDA 5DJZA 3QHZH 4YHKH 2HAZA 5H35A 5ALBL 1GAFH 4N0YL 4D8PA 1CQYA 3L7FA 1G6RH 4N8VA 4KI5E 3FB8B 5D2NE 2QHLA 1AHWC 3C6LB 3G04B 3HNTH 4DZBB 4KK9D 4QRUA 3AB0C 4UAOC 4M1CD 4JY6A 4C57C 3CIQA 3AROA 5FCUH 3PHQA 3CVIH 3O4LD 1U8LA 3S36L 4WU5A 4MJ4A 3QT2A 4GXUN 3BO8A 2XKNA 4JPKH 4J8RA 5B21A 4OCYL 4K7FA 3QEUA 2DWEB 4HFUL 3RX7A 1NCBH 4QCIA 2QSQA 3NTCL 5C0BB 2Y06L 3VFMA 4MXQD 1JHTA 3ARYA 5EBMA 5EB9A 3IJSA 4L3EA 2ICWB 1CU4L 2H32B 3H9SE 2JK5A 3OKYA 5C0GA 4Y5XC 5DJYB 4NKDA 4YHPA 1G7MA 3C6LA 5ICXB 5E7BA 4OM1L 3VFNB 2VL5A 2KZ1B 4NWTL 5T1DL 2F15A 3PP3H 1C08A 3O4OC 3ZSTA 3DRQB 1KNOA 1YUHB 3E3QE 3RX8A 2DQHH 2VWEC 1I1AD 3DHJA 4ZSOB 3V9FA 4E41A 1EFXD 4FZEH 4I3SH 1JBJA 5ELIA 5J3HD 2VL4A 4L1DA 2VZSA 3ZTJG 4OJFH 4QRRD 2DM3A 4Z7NF 2AEIT 2AV7A 3ARDC 2YZ1A 1KN4H 5DQDL 3P4NB 5C08D 1HZHH 3MYZA 5IT2H 3TWCH 1ZSDB 3SY0A 3BIBX 2NY0D 4KKAC 3RIAK 5EWIH 3WXVL 3QDGB 4XGZB 5KVGL 1YNLH 2HFTA 4MLSA 4PY8J 3GB7B 2IMMA 1SBSL 1HIML 1Y18B 3OJMB 5D7JD 3B9KB 1NC2D 3VFRB 5LGJA 1BIHA 5HDLA 3Q6FB 1YEKL 5H94B 2O61A 3D39D 5CJ8A 2VUOA 2ICES 1XCQB 3W2DH 2X7LB 4WJ5A 1BVKB 4UTBH 3TA3C 4EIZC 1U6AL 3REVA 3SY0B 3VFNA 3W5MA 4LF3A 4LMQI 4DKEL 3GSVB 5DS8B 2V2XB 1DTUA 1I9EA 5EA0H 2Z31C 3MNVA 3QFDA 1NBYA 3KLHD 1NEUA 4RAUB 3OXSA 2NY2C 5JQHC 1I7RA 5M7QA 5C0CE 2K7PA 4WTWA 1IFHH 2DJSA 3BISA 4LCWA 4NO0B 1FO0L 1U8QA 1NBVL 4ZXBD 1HWGB 1NH6A 2P8LA 1QPXA 3RFZC 1IM3B 3OAZK 4OUUA 3UJIH 3TCXA 4L4TA 4LLUB 4XVUC 3R0NA 4PLKC 5F88A 4ZFGH 2QADC 4MXQC 4TOYL 1HI6B 2HG5A 4OZ4A 5IFAH 5FAAA 4X9HA 1HQ4A 1F4AA 4B50A 4XNQA 1NFKA 5F9WC 3ZYJA 4XVSL 2E8ZA 1T0MA 4F7CA 5L2KA 3DX8B 5CZXD 3RKPA 1RZGB 5HHNA 2DQJL 1T03H 3STLB 1H3XA 5JMRA 5I8EB 3QRGH 1P7KA 4JM2C 1ZGLM 4C54A 3DVIA 4R0LC 1UM4L 3QUXC 4BZYA 3OF6A 3OKLA 5I8OL 3GFUA 3HC3L 1JVKA 1ITCA 2BC4A 3LIZH 1JNJA 4L9LC 4YWGL 3WIHH 1SJHA 2HKFH 3VMOA 5CZVL 1BFOA 4JCLA 2YRPA 4L9LA 3CDFA 1B3JA 3B4NA 2ICWA 4LK4A 4LCWB 2V2WB 4RWYL 3NIFE 1A7OH 5GRUH 2UWEA 3IDUA 3ARZA 3NZ8A 3QDJB 5DVMA 1AIFB 4YUEL 5GJTH 3U4BL 3P4OA 1NGYB 4Y5XA 3PWPB 2GITA 2HT4D 1MAMH 3R1GH 2R69H 4ERSH 2AABH 2V17H 4OZHA 4X98B 5JPMB 4IRJB 1IGML 2GJ6B 4CUCA 1IC4L 2EH7L 2IH1A 4UQ3B 3MJ8B 2DIAA 3PGFH 1Y0LA 4NFDA 3MCKB 4ODSL 3UTSA 1AH1A 4D0CB 1A3LH 4PLJC 2NY6C 4JQVC 3P0VH 1NKRA 4KJWD 2PW1B 4JFDA 1W8OA 1PY9A 1MCKA 3QULB 4JCMA 2Y7QA 1XR9A 1EAPB 3FO9B 3BRGC 3VFUB 1FL6A 3DETC 5J6HB 4HCRA 1YJDL 3P9LA 1M7DB 4DOHB 3MRHA 4Z7OF 2VR9A 4LPCA 5JPMA 3FFDB 3RVWD 2DM4A 1WJ3A 2XYCA 4DUXA 2EEAA 5FGCB 3QIUA 4LVOC 4X4YA 5FO8A 1KPRB 1KSRA 4FQJL 3UTSE 4ONGH 1ZMYA 4ODXB 2UWEB 1X4ZA 1EJOL 5DDHB 4AYFA 4WEMB 2CK0H 1LO2H 4X6CA 3WS6C 2ADJA 2DQIL 4Q9QL 4J6RH 4LDEB 3F6LA 2GT9A 1QKZL 1C8PA 3FO1A 4FTVD 3BD3A 3QCVH 4U1MA 4LPYA 4JAMB 1IM9A 1PSKL 1NAMH 2OQJA 3DUUB 4OZHB 4X98A 5CJQL 2EXYD 1SY6A 3PL6B 2BNUB 3QUYC 2VLRD 1N4XH 3K3QA 4LCCB 4LGSB 4ZAKA 1DLHB 3QO0A 1GOGA 4UV7L 4TVPL 4AJ0A 1HHKA 2BVEA 2LTQB 2P5WE 4M5ZL 1T0PB 3INUL 5EC2A 4JN2B 4LDLB 4X6CE 5CMAB 5IV2B 2B1AH 1BP3B 1MCNA 5ERWB 3Q5TA 1KJVB 1QBML 4Z8FL 3FFDA 3B6SB 4ZXBC 4I3SL 1UEYA 1TZHA 5TDOB 5J89A 1JUFA 3NFPA 1MVUA 3D3VA 2A38A 5DRZB 4HJJL 4JFOB 1FGNH 1S7SA 2DQGL 2X05A 5I1DB 1S9VA 2K1MA 4LSTL 1U8JA 1INDL 3D5OF 4TULL 5DDHA 4NKIH 4X9BA 4HIXH 4D3CH 4HEPG 1S9KC 1I8LA 1D5ZA 1GL4B 3EYUL 4MA1B 1F4XL 4P0DA 3G5YB 4PRHE 4NHCL 4NM8H 5IFHH 3LPGA 5H8DA 5BS0B 4AL8H 3B3IB 5FKAA 5ACZB 1FP5A 3VXRA 5KVDL 3EYFB 1GGIH 4NQDE 5GS2H 1OGAE 1ACYH 3BZDA 3KS0H 4PBXA 3KPPA 3VI3E 5GGVL 1G9ML 3DXAA 5L8JB 4PR5B 1N6QL 4XP6H 1MQKH 3PWPD 3NZ8B 5EC1A 2HFEA 2XZQH 3O4LA 4O4YH 1DBBH 4PJCE 3RNQA 3WDIA 2B5IC 4U6TA 3LKRB 4PPTA 3KPNA 4I0PC 4M4PA 4M48H 2DD8H 4QEGA 5CSZA 2WUBH 5EOCL 5HJ3B 3VGHA 4XTRC 3F6IA 4D0BB 3B6SA 3BXNB 3TC9A 2O5YL 4CRPA 4NN5C 1JN6A 4CAGA 3NFPB 5C9JB 1BF2A 5BRZD 1JGVL 4JGMA 4HT1L 1HYSD 2DBJA 2EDYA 1DANU 3B2UD 5C70A 1CXEA 3F7VA 4M43L 4FXGA 5LBSL 1HSAA 1BD2B 1WCQA 3KPOB 1WQVT 1MF2L 1KCRH 1ZA3A 1AGEB 3BYTA 1T21B 2W65B 4J3UA 1U8NB 4WTZA 2VWEE 4Z7OE 5M94B 4FQCH 4UILH 3GMPA 2AVGA 5ADOL 3C6LD 2R2CA 2VNCA 3HI6H 2DWEA 3MLRL 3ARGA 4NRZA 3AM8C 4Q9CA 4AQOA 3NH7L 2OXGA 4Z7UA 5TQ2L 4HWNA 2EZ0C 4RMTA 3FRPG 1IBGH 4EXPX 4HPYH 5I8OH 4L3EB 1YPZE 5C2BL 1FCCA 1A6WH 1IQDB 3RZWA 1X44A 2ATPA 1A6VH 3T3PF 4E42A 4QRSB 1KJ3L 4ELME 1KB5L 3U83A 1X4YA 3UPRA 4YFLI 5FO7A 3VWKC 6CGTA 5C0BD 3MV9D 5DJ8B 5ANMB 5DUBA 1A7NH 4OV5B 1UXWB 1YEDB 4NC2B 2D7QA 5F9JB 3D0VB 5JHDD 3CVHB 3PIQA 3QCTL 5IVZA 5DK2A 2DKSA 5CIPB 5CMAA 4Z76A 3D39A 4XBGA 2F54D 1WFOA 4GXUM 5J12B 2O93L 4LPUA 4K2UH 4JHAL 1Z5LB 2EICA 4OD2B 5KSBE 1OAXL 4C56B 4Z7WB 4PGBB 4G80A 4P2RB 3A6BH 2X4PB 3TM6A 1NUGA 2GJZA 4G9DB 4DGIH 2VITA 2CGRL 1D5MA 5F3HB 2YMXH 2JCCE 4R96A 5ISZE 2A6IA 1CE1H 5DJXB 2V6HA 3E6HB 2RAMA 1IAKB 1B0RA 3O41A 4LPXA 4HS6A 5IQ7H 1ZTXH 3MACH 4ODWA 3PJSA 3LZFH 5AUMB 2WIIB 4JO2H 2XG5A 2ZCLL 4FFYH 4ETQA 2XY2A 3CVIL 3FB7B 3VDAA 1WT5C 1MJ7L 2OM5A 3S37H 1INEL 5DUBB 3V79C 1UZ8B 3QH3A 3MA9H 4FQQA 5TPWH 1MUJA 3PWJA 2EEBA 1NGXB 3T0AA 2F53A 1I1YB 1NC2A 1A7QL 1B6UA 3EAKA 4X7FC 3MREA 3MV9B 3TFKC 3NFNB 3ILQD 4JM4H 2MTPA 3AAZB 5EO0B 4NO0A 2V7NA 3PHOA 1G7HB 5JA9A 3WXWL 1WBXA 3CFJB 2DS4A 5DJAA 1NC4A 2VLRB 5D7LB 4BQ8A 4LCIL 3RPIB 4LSPH 5I16A 2Y5TB 2A73A 2EH8H 4LCUA 1KTRL 5B3JE 3CFEA 5AYQA 5B38A 4JY5H 2J6EA 12E8H 4OZGA 4CU7A 3QXTA 4QHKJ 2NY3D 1ZLVK 1ZA6A 1MHPH 1EEUA 3B9AA 5ESQA 3MRNB 4RIRB 2BNQD 1ZANH 2HT3D 4FQ2H 2XZAH 3TVMA 2VZ3A 1ORQB 3NACH 4DAGH 3SO5A 1EMTH 4PJ7E 1ZS8B 1QNZL 3L5IA 1BAFH 1RURL 4MA7L 5HY9B 3H3KA 4PRHD 3PHOB 3HC4L 4IJ3C 4YXHH 4L9DA 4R0LA 1QSED 5HBBA 5IKCA 1YA5A 5DHYB 5IR1B 3WHE0 1F58L 5FA3B 3OPZH 4N9GA 1R3KA 2XWBA 3FRUA 3ZL4L 2YD2A 3QDGA 1YEDA 2NY5L 2NR6C 1EVTC 1CDYA 4Y4FB 4NC1C 4IRJA 4ONFL 1DBJH 1YDPB 4JQVA 2VKXA 2H9GB 1JRHI 5FGBC 3OGCA 3A6CH 5K59E 4DK3A 2ZG2A 3TVMB 3QUZB 4NGHL 1T3FB 2I60H 3GIZH 4WW2A 5CLWA 4HEME 1BWWA 1U2CA 3ARED 2A74A 2J8UE 1E4KC 1NBYB 1G6VK 3VGFA 4P46C 4OB5H 2FHFA 5LCVH 1S7WB 2ADIB 3KLHC 5T1DH 3L5WB 2GCYA 3NPSC 4FMKA 3OGOE 3EO1B 5I1JL 2X44D 2EIBA 1CFBA 4LHJB 3T4YB 4BJLA 4DWHA 1KTDA 5HSFA 5EN2A 5K59F 4AH2B 1N3NA 1F90L 1GIGH 2VDOH 2NZIA 5IR1A 4YHKL 4LARH 2IFGA 4FZEL 4JRXD 2N7AA 3MRQB 3QNXB 4MJIB 4RMQA 3DYPA 4NQCE 1TVBA 1IC7L 5KSUB 3FTGA 4WUUD 3QI9D 4Q74A 4U6VL 1VGKA 2FJFA 4X6DA 3RDTC 4IHOA 5A2LH 1UM4H 1YDPA 2EE9A 3Q3GB 3G6AB 3FQTA 3GJEA 5MEND 1NGWA 3WIIH 1Q9WB 5GJSL 1HSBA 3N1QC 4PV9A 4OIIL 1KIQB 1BGXL 4KKNA 5C0AA 3QDJA 4NQUA 1T3FA 2R0KH 4QRPD 4Y4HD 2Q86A 5IQ9A 3MV8A 4HH8A 2EDBA 1XH3A 3C6LC 1BFSA 4Y16C 1MELA 15C8L 3CAFA 4JY6B 1F02I 2YPKA 1LE5B 3AB0B 4PY8I 1HEZB 4UI2A 2GJ6A 5FGCE 4EKXA 1ZA6B 4KMQA 1NDMB 4HFUH 1FRGH 3QXUA 4KQ4H 3NCYP 4DW2H 3SDAB 5DA0B 1JFQL 3MUGA 4KRPD 5C6TL 4HGKC 1I8LC 1KT2B 2GK0A 3MFFB 5EU3B 3BJ91 2NY1B 2YA1A 3C8KA 3GJFK 4YE4L 3LH2L 1ZK9A 4HW6A 4R9HA 1CQKA 2JJUA 5FXCH 5GGRA 3OKEA 4MQ7B 2YMXL 2GK2A 2DAVA 4Q9RL 4QHUB 2FEEL 4MVBD 4RAUA 5J9PB 4PUBH 3N06B 3G6AA 4FZ8L 1I7ZB 1P6FA 3Q5OA 3PWPE 3WIHA 2WWMD 3BWAA 4JB9L 3BH9B 4FFWC 4YDLB 2WANA 1D5IH 1RSFA 3LV3A 1R24A 5ESVB 3RNQB 3G6JF 3QISA 4GRMA 5F96H 5E6IA 4FOMA 3TYGH 5TPWL 1G84A 5F7KC 3M17B 1I8MA 4HFWA 2JCCF 4HGWB 4QY8A 1Q8MA 4IS6B 3RAJH 2MSPA 3VXTA 2YBRA 5JXAL 3IETA 3BP4B 4K8RL 1B4JH 4R4NC 3CX2A 3GSRA 3UDWA 3TJHD 3LPWA 4MJ6A 3VU2A 3MLSH 2R56H 1CIUA 1LEGB 2UY7A 3DO3A 3CLFL 3SKNB 4YH6A 3RNKB 3LHPH 3RVTD 2YC1B 3HS0B 1SYSA 4R26H 4FXKA 2IADB 2KQMA 2X4QA 5KVFH 5TE4H 4YBHA 4QXTA 2ZSWA 5IB2B 1YNTB 5I1AB 4GFTB 4LVOB 5AG8A 4WI7A 3MROA 5EA0L 5IHBA 1U3HC 1CXHA 2J8UB 2BOCA 4YPJA 2R0LH 4WHYG 2NTFA 4R6UA 3FRPA 1F3DH 2MCPL 5E94A 4TSBL 2VMFA 2FBJH 3IS1X 5TFSH 5BOZG 4Z9KB 4U6HB 5F7DB 3L3JB 4NOFA 4Y4KD 3L95A 1KJMA 3PL6C 3DI2B 3ARBA 4ODBD 1PG7W 2ZCHL 3RHWF 3D18B 3KJ6H 3HRPA 1JNNH 1RUKL 4OV5A 1U58A 3VI3F 1NAMA 4F80A 2E27L 1FO0B 1MPAL 3CH1B 1CDHA 5F9OL 1FN4A 2WK2A 4G6KH 3KG5A 1K4CB 2OI9B 1R0AL 4QOKB 2YK1H 4XCEA 1O7VA 4IOSD 3S34H 1MQKL 1HWHB 5ILTL 4HV8B 4ZOAA 3IDJB 4XC1H 5KSVB 5HGBB 4UT7L 1SVCP 4OQ1A 3ZKXC 5L2KB 5IF0B 3OHXA 1QFWI 1AO7A 3SBWA 3UYOD 2YS4A 4UDUA 4IRJC 1RJYB 2LU3A 2HRLA 2F53D 2BXYA 2CD0A 1UQSB 2NY3B 5CZVH 2YEZB 4OLUL 4CN4A 4RFEB 4WWKA 1SEBB 4KGLA 5JHLH 1EO7A 3B9KD 3OKEB 1SJEA 4MQ7A 3VFVB 4R8WL 4M43H 4I8DA 2C3XA 4HK3N 3FN0L 1X5FA 1FAKT 4LIQH 3GRWL 1HINH 4L9LB 2GFBA 1RMFL 5F44A 4CNIA 2F5BL 4GKOA 1IRAY 4ZAKB 3RHWK 1R3LA 4PS4H 3MRIB 2E9JA 3C60A 5IB5B 5BCAA 5D96B 1MRDL 2VLKD 4J3TA 1QRND 4LSVH 4EI5C 3TH2T 3IDNB 3GJFA 1JK8B 3U30B 3VXPB 1FYTD 3ZTNH 3X3FL 1A3QA 3BIKA 1I1RA 3VG0L 3OJVC 4HC1A 5ITBH 1YPZF 3KDMB 4N0FA 3RZCB 1ZLUK 4RGND 1MAJA 4XP9L 1UWXK 5FK9A 1G7IB 4S0TD 5JW3L 4WI9A 4XP5L 2Y6SD 5MEOA 1D3CA 4Y8AA 1HNFA 3Q6GH 4KK5C 5DGRA 1KELL 4PRDB 1UQSA 1EPFA 4P23D 5B8CA 1MH5B 3TBVB 1WCBA 1KTLB 4JZJC 1FL6B 5J6HA 3FOLA 1YJDC 3IDIA 2A77H 4KJYA 4JPWH 1U8LB 2AJSH 1RVFL 4M1DH 4TTGA 2BMKB 5KSAB 1QR1B 4WFGE 3T77B 3QSKB 4GJTB 3QCUL 4GUPB 4U0RB 5F21B 2R2EB 3LD8B 4YC2B 4BA8A 4P5TD 1NEZG 5IMLA 1GVIA 4LASL 4DEPC 4M02A 3U0WL 4PV8A 3L5JA 4LLDB 4ONOA 5HVGB 3REWB 2VXSH 1UKQA 5A1AA 5JHDB 1ZHBA 5H2BA 2NXYC 1QKZH 5E00B 2NY2D 4AMKL 4CADB 4AZ8A 4MD4A 2DYPA 4PLNC 5KSBB 4HIHB 4PJXE 2EE3A 4XH2B 5D7LE 1FFPB 1VSCA 4YGVA 2HN7A 4Y2DD 3SDCA 5DMYA 4YGAB 4EQ2A 4ONHA 1EH9A 2H2PD 2BX5A 3ZKND 3GSNH 3DRQA 3GMNB 4DVRH 1L6XA 4MMXC 3ZE0F 4CMHB 2FB4H 4JKPL 5ADOH 1TJIH 3WV0A 3SGKC 1FGNL 1JP5A 3D69A 5F96L 3EO0B 1KCKA 2V7HA 1EERB 2NXYB 4RDQG 1V8HA 3TBTB 1QBMH 3BOVA 4JO1L 5AUMA 1OW0A 1KGCD 2NY0C 5D7LA 1AGBB 4D94A 4MNGB 3VFPA 3TCLA 3U4AA 4HWZA 4DKAA 3CFBA 4OLXH 3DGGA 3K8LA 5C7XH 1SYVB 1RZ8B 1PFCA 1YPZA 2CRYA 1CVRA 5ISZA 3LN4B 4MAYA 2QKIA 2R29L 1IGYB 5JLZB 4UNUA 1F6FB 2JELL 4LVEA 3KYAA 5FKPA 1FJ1A 4HUVA 1A3RL 3BSZH 1FFPA 2FYYB 1H15B 4LLVA 4DN4H 2OSLB 5IOPA 3TEUA 2YUVA 1LHZA 2HVJB 4WUUE 2FIKB 5DGQA 4HQQL 1WC7A 4G3YH 1G9NH 1CVSC 4ZOCA 5T3XD 3MLWL 3BPCB 5KW9H 4K9EL 1XR8B 3FQTB 3LN4A 4MAYB 3TO4C 2AQ3A 4WY7H 1I3GL 4KJWC 5E2UL 4YHYC 5E6YA 1QNZH 5E03A 3X3GL 5J8OA 3VGAB 4NRXB 1HHHA 5JIIA 4QXUH 4KTDL 3B2VL 5CKAA 3LRHA 4E0RA 3SJVD 2IALA 3CSGA 2FJGA 4FXGB 1FBIH 4LKXB 2FR4A 2PR4L 3QUYA 4JFED 5KS9E 1PJ9A 5FEBA 3TBVA 1LDSA 1MFDH 2A0LD 2NW2A 3H9ZA 2UWEE 3SDYH 1S7TB 2BRQA 2Z8SA 2G75B 1RJLB 3AS1A 5D8JL 5B8CC 5JNYA 3D1MC 3DVNB 3QDJD 5DC0A 3CU7A 4Z7UE 1JPGB 3TZVA 4XNMB 2NZ9D 4GW4A 1CLYL 2UZIH 1IILE 4IOIB 1K6QL 1WGOA 2JCCB 4XMPH 3ZHLA 4QO1A 5IMMB 3D85D 4PD4J 4QRQB 5DRWB 1HILB 4NQTA 1VEOA 1KLGB 1BFOB 1MCIA 2DLIA 4FQ1L 1S7WA 1R5VB 3MBXL 4W70A 1MSPA 4U1SB 1WBYB 2R0ZL 1X9QA 4RGMB 3IXTB 1I4FA 3LRSB 3HE6B 2NLJB 3MOAL 2AEQH 2BRRH 3GBNH 4ORGA 1KG0A 5HYIA 4PGDB 4PG2C 2AERT 5IMMA 3NN8A 1X5IA 3Q1SL 1CGSH 1QLFA 1T2JA 4YO0A 4G7YH 1I3VA 1MRDH 4RZCA 2VSCA 4JN1H 1U8KA 3AREC 1RUML 1U0QA 4Y19A 3GJEB 4QHLB 1WBYA 2C4FT 5HYFA 2ADGB 1S9XB 3IKKA 3WFHB 1RZFL 1JGDA 1T22B 2D7NA 4Y7MA 1J5OH 1A9EB 4RFOL 3T0VA 3W81A 4PGBA 3GI9H 3U1SH 2OX5A 4KKLC 2AS5M 3OJDA 2HRPH 3CSBA 1BQSA 3LS4H 4GMTH 3T0EA 1UEMA 2CO7B 4OJFL 5I18H 2VAAB 3VW3H 5IVNA 4HAGA 2QSTA 5I17A 1MJ7H 3JZ7A 5HVWA 3EJZC 1VENA 1CK0L 2BVOA 1KYOK 1VA9A 1P4LB 5A3IC 4QKXB 3J7HA 3H0TA 4NZTL 5FDYA 5J1AA 3VXQB 1HN1A 4PY7A 4KHXH 3O6FB 2W0LA 5DFVD 4U6YB 2PF6A 5DJDB 1JCKA 1ZT4A 4MCZB 3ULUE 1FL5B 3OKMB 2Q7YA 2D3VA 4JFXB 1INEH 2X89D 3BPNB 1DUZA 3LKQA 4I13B 5D5MF 4FFZH 3GO1H 5KN5A 2VXSL 4LRIA 2Y36L 3ULSA 5C0ND 2QQNH 3FQXB 1KCUH 4ZFFB 2DMKA 1IGJB 2WWKO 3ISWA 5GRXG 2AEPL 4Z78B 1P4IH 2HJLA 3EJZD 4HJGB 3C8HA 3T3MF 1IZKA 3NA9H 4HDIB 5BJTB 5KSAC 1JL8A 1M6OA 4PYGA 4ZUTB 3ROLA 4OZIE 2W92A 4J3VA 5KN5B 4LAJH 5IJKC 4PJ9B 3ARBC 1S7XA 2IPKB 5EPMA 2ARJQ 1A6UL 1UYWL 4P9HL 2EIEA 3IF1B 1NBZA 3G6JE 3G9VA 3O3DA 2XG4A 2OZ4L 1T1ZB 4UT9L 5GZNC 4J3XA 4AT6A 1C7SA 1V5JA 2BY3A 2XQBH 5I15L 3NACL 1J8HB 5CCKH 3FAXA 3VE0A 2UYLB 3G5YA 1YMMB 3S5LB 1FIGH 2YC1A 4L5FL 3QXAB 4PJ7B 1F58H 2IQAA 3O2VL 5C09A 4LCYA 1I85C 3TBYA 2G60H 5DZNA 2XI9A 1YY9D 2J4WH 1NL0L 1J1PL 5EZIL 1JRHH 1JPST 2XT1B 3DVGB 1C5BL 4OZFB 2CO6B 3GMQA 5C0EB 1FZMA 4XVTL 3DUSB 2MNUA 1DL7L 2C4FU 1F4HA 4PTUB 2BP3A 1G7LA 4X9GA 2PCPA 4OZFG 2IQAB 4QOKD 5FHAL 2MCPH 1IKNC 4OZHE 4OQTH 1R5WA 4R4FH 3C60D 4H26B 2PTTB 3RX5A 1E28B 2J8UA 1JGDB 5B8CB 4GQ9H 4FXLA 1OLLA 3CMOH 3S96A 3SKUD 3RIFF 3KPRA 4Z7VE 4MS8C 3SJVE 1PKQB 3GMPB 1NEZB 4J12A 4K71C 4R4BB 3K7UA 1M7IB 1MCEA 4NQVA 3AMLA 4TTDD 2G5BB 1EIBA 5B3JF 1LDPH 3BDYL 5IEHA 3ESVF 2YK1L 1U3HB 1WEJL 1T5XA 2AK4B 4CU6A 4MXWH 3DTXA 1Z9OA 3TBWA 1MCCA 5HHQB 4NN6C 5HI5C 2DLFH 3CJJA 4N5UA 2B2XL 3DVGA 4FFWD 3BHBB 1LP9B 2APFA 4M62H 1R6VA 4XPHL 1NDGA 1U3YA 3IFNH 1ZHLA 4LSUH 5EO9B 4WI6A 1DQQB 2AJXL 3FONB 3PWVA 4HLZG 2VXUL 4J6RL 3QDMA 4G6JH 3HMXL 4C83A 4G43B 4Z7WE 3V2AR 1CZ8H 3BKJL 3ARFC 1BD2E 2R9HC 5E6ID 4K7PH 3WFZA 2YPVH 1EV2E 3BW9A 3P9MB 1KIUA 4LLWA 4FQXA 4XPAH 4Z7UF 1KPUB 4GKZA 2NNAA 1YQVL 5DK0A 3GSOA 4TQEL 4X4MA 5SWZB 2BVQB 4PJDB 2PTVA 3ALXA 3B3IA 4FN0A 1CFQA 4HIJB 1U8PB 3LH2H 3RJDA 4IRZL 4XZUB 3ULVL 4BUGA 4TSBH 3KPSE 5F9DC 4PRIB 2RQ8A 3IFOA 2XWJB 2AJ3B 1BD2A 2W1NA 4KVCH 4AG4H 1S7VA 3GI9L 4CW1A 4XHJD 3MXVH 1H3GA 1YPZB 4XHQA 3MA7B 3CFIC 5IHZA 4ODHH 4MQSB 4NZDA 4LEXL 2DQGH 1T1XA 3F8UB 3W11D 2J6EL 2Q8BH 5EU6A 5DVKA 4N0UE 1G7IA 3SE3C 2A77L 1YECL 1U93A 4ZO7A 3LKNA 5C9KA 4JFEA 2H26B 1DSFL 4TNWK 3W0WD 4KRPB 1HSAB 2OL3L 4LRNL 3L1OH 5JO5A 1SJXA 1FNHA 2JJWA 2CIKA 4X80L 3KPLB 4KK5D 4JRXE 1PQZA 3ULUD 2CDFA 3ARBD 4YLQT 1B4JL 4IRSD 1I1AA 3GSQA 5FYJL 5F1NA 4O9HL 1QLEL 5ID1B 1N7ML 1J9CT 1IJ9A 4QRTB 3GM0A 2EDOA 3AS0A 3GM8A 1R5WB 4PJDE 4BQBA 1A0QL 4RAVA 1RZKC 4UAOB 2UY6A 3LKNB 2VXTH 4OQTA 3KLAB 5CHNA 3L6FB 3JXAA 3GIVB 4O2FA 3MC0A 1J86A 3FN0H 3I02A 4YHMH 3U79A 4KZEH 1OB1A 5IVZB 1F4YL 3LEVH 4U1HA 1HH9A 5HYQB 5CWSA 5KG9B 2G75A 1ZLSL 5GRVK 4JM2A 2R0LL 4R26L 4FRWA 3RY5A 3DARA 1OSZA 2WM0A 2ZSWB 5IB2A 2F5AL 2C4XA 4UT6L 5JDJA 3MV7E 4WWKD 1BJ8A 1CD1B 1G6RL 1V05A 3QUYD 3UC0H 2RJMA 4JPIA 3L6FA 2H26A 3X11B 1FHGA 5BS0E 1FVEB 5GGSA 4DKDC 3QQ4A 5GGQL 1P7QD 3U2SB 4U49A 3BRFA 4XMLL 2OS7A 3D25B 3HB3D 1LO4H 5L88H 4PG2A 5BW7C 1U3ZA 1MPAH 5F9OH 3HZKA 1XCTA 3FQRB 1U2HA 3HCVA 3WFCL 3D18A 3FO0H 5DJCA 5LGHL 4R97C 1RUPL 4XPTH 2DQCH 4I0CC 2G9HB 1S9WB 4PLOB 3MNZB 5CHNB 4YO0B 5GGTL 4JPKL 2EDRA 2Z31B 3JVGA 1U8MB 3T2NH 1NCDH 4GKNA 3WN5C 1J05B 3C5ZB 5D1XC 2H6PB 3TYFA 1IGYA 4PJDA 2ZUYA 5F6HJ 5HDOA 3WKMH 5HHXH 3D39E 2OJEA 3B5HA 2NW3B 5JHLL 2P44B 2N56A 2Z92B 4R4FL 5SX4I 2IQ9L 5E2WL 3T3PE 3BZEB 1F3RB 3QZWB 2IALB 2XWJA 4GRWF 4QTHA 3FQUB 4C55A 1TETH 3U0TB 4U7MA 2VLJE 3JV4A 5IM7B 2QTEA 1HDMA 3OF6D 4KRLB 1G1YA 2D0HA 5C0FB 2VR5A 1HXMA 1SJEB 2VYRE 1BBDL 3U9PL 1LO5B 5C3TA 3NIDE 3DVNA 4KHTL 5HVHB 5IJVA 3P11L 3X3FH 1T04A 4LAQL 2DLTA 1A6AA 1P2CB 2ZCKH 3ZKMD 2ZUSA 3QIBC 2FJGB 4N0UA 2WBKA 2Z31A 5DVOA 1OSPL 4YBQD 3ULSB 3TWCL 1JHLH 5JR1L 5BMFL 3SE8L 1I7RB 1X5ZA 2W9EL 4JY4B 2OBGA 4CL7A 4RIRA 3K1DA 2V7HB 3BESR 4CVXB 5INDB 3ULVF 5F1NB 4NYLA 4J4PA 2FCBA 3QEUB 3QIBD 5HPOA 4MNGE 4QNPE 2VXUH 4DKFH 5BV7B 2ATKA 3OKDB 4W4OA 2D2OA 1GHFH 1XZ0B 3ELAT 4LPWA 3SCMB 4ZUWA 2NZ9C 1KC5H 4LRIC 4ODTH 3HE7C 3ZKMC 2PO6C 4XXDA 3C09B 2F58L 2VIRA 5HPMB 2G5RA 2AQ2A 2R15A 4YXKL 4L8SB 1AC6A 1XGTA 3FHQA 2IPUK 4LCIH 4QYOA 5CIPH 4JPWL 3OGCB 5HY9A 2P42B 2C5DC 4KH2A 4X7TB 3BEWB 4GBXA 4Y5VB 5JLZA 3X12B 3WFHA 3RTQB 5I74B 1AHWB 3DETD 4KK6D 4ACPA 2DM2A 1JNHB 1S5HB 4L3EE 4LSDA 4YEEA 1R5IB 5GRJL 4GSDH 1RUAL 4IEFB 4MQXD 3OKLB 3WD5H 4IRSB 4QF1B 3V0WL 3TT1L 3DOSA 4PV8B 1RULH 2VABB 5SX5K 4YC2C 1F11A 4Z7WF 1UXSA 4OFYD 2VR4A 1P6AB 4PRHB 1TVDA 3MXVL 3SGEH 4NQDA 5CINL 3B2VH 3KWWA 4ALAL 1TJGH 3DIFA 4S1RH 3L3HB 3AVEA 2H3NA 5B39B 1TJIL 1EFXB 3FCTA 5E8OA 1OPGL 5DQJA 2OK0H 3IDYC 5EOQH 1JF1A 4N5ED 1K8DA 4U31A 3WFDH 3ROOA 4EN3C 5HGAB 1AXSB 3MV7B 4GLRH 4KDTA 4YK4C 5B4MC 4DVRL 2Q3AA 4CKVX 5EIIB 3T65B 1I8MB 1QLRB 4X80H 1MJ8L 3CXHJ 3AREB 4N9OB 1J1XL 3UBXA 5F7EL 4XAKD 3L7EA 3WHE1 5GGVY 3VRLE 3WNPA 1MIML 1FZKA 1H8NA 2WQRA 2OJZL 5K93A 3V6OC 1IARB 2ZJSL 2UUDH 2HKFL 2GHWB 2BSRA 1LEIB 5F6HI 2HJKA 1IL1A 2APWA 5DJDA 2OTUA 2A6DA 1QFOA 4PJCB 4H5SA 4Y5YC 2AEPH 4LF3B 2FX9L 1JZ7A 4NQSB 3UBXI 4CVUA 4S2SA 4HG4J 3S36X 3BMVA 4QXTB 5IM7A 5DRXA 1UWGL 1QO3B 3C87A 3IF1A 2C3GA 4NQDB 4APQD 5HHNB 3BEVA 5LAXA 2FIRT 2R69L 4HMCA 4HX1B 5E8EB 4ERSL 3NCJH 5A2KH 4NZRL 2H2PC 4X9IA 2JELH 1KEGL 1ED3B 3ORJA 4NCDA 4I48A 4LOUC 4ZG1A 5T3ZL 2C1PA 3ZT7A 3MLYL 1MCBA 4K94H 1WK0A 4YDKH 4PJ5A 5ADPL 4PYHA 1JYNA 4TUKH 2OQJB 3DUUA 1G9NL 1N5AB 1TNNA 3ES6B 4KWUA 4RFOH 3SKMB 3TBYB 4X7SH 5E95B 2EDNA 3SN6N 2VDRL 5IESH 3V52H 1BD2D 4GW1A 4X4ME 5J13B 3WN5B 4WCYH 5I1KL 4IDJH 3FT3A 1RJCA 4ODVL 4JHZA 2AJYH 2PW2B 4FFVC 43C9A 5FYKU 3VE0B 1TPXC 5DK0B 1CDJA 2J4WL 2FGWL 5E2JA 1EJOH 3KNBB 1JRHL 4JO4L 1K2DA 4XP4L 4KHXL 3BX7C 1FFRA 5J9PA 4BM7A 1XMWA 2IAMB 2NTSP 2XNAB 4EI6B 3W11C 4HX1A 4KV5F 3T4YA 15C8H 2QR0A 4F37K 3SGKA 3P0YL 3G6JA 1JV5B 3HNSH 3JV6B 5FYLH 4AH2A 3K2UH 4CVWA 4P9MH 3T04D 3QEQA 1TQBB 4O02L 5LJYH 1SEBA 3BH8B 1NMCC 2Q7YB 3GMQB 1UENA 1IT9H 4IRSA 4QF1A 3VXOA 1TNMA 4PJ5B 3QZWG 1WTLA 5C1MB 2FD6L 2WSKA 3WJLC 4CMMA 2V5SA 4KPHH 5EU4B 4WHTB 4BK4A 2ARJA 3PABA 4YHLL 5I1AA 3HA0A 5D7SH 2IEPA 5CD5D 2Q6WB 5E5MB 1A8JH 1QFHA 1NCTA 1CD8A 4HPOL 3MRPB 3ZMRA 4YFDB 2R1WB 3WIFA 3GSRB 4ORGB 3VXPA 4HKXB 1CLZL 3BMWA 5DD0L 5K9OB 5A2IH 4G7YL 4GLRI 3OL2A 5T5NF 4NKIL 1H3PH 3ULVD 3ARXA 4D0BA 4EN3A 4D3CL 3WUWB 1MREH 1T83C 2CKBL 3FB5A 4XC3H 1U3HA 2D7OA 4ZO6A 3VD3A 4TSCL 1SBSH 2R2HB 2HJFA 2XRAL 2PNDA 3HE6C 2NTFB 1DR9A 2B8OT 3FOLB 2PETA 1LP9A 1FG2B 2N1KA 4NZTH 1KIPA 4FQIL 5IB3A 3PNWA 2QQLL 1X7QA 2DBLL 3S5LG 3VRLF 1QD0A 1OQXA 5GS0L 4K3HA 1QRKA 4MB3A 3RQ3A 3SQOL 4PRNB 1LNUB 5I0ZA 4OD3L 3WFEL 3MLSL 4P3DA 2EXWC 2VXQL 4OF3A 4PJAF 2YOCA 1FL3B 4WEUD 1FNSL 1Q72L 1JPSL 5JHDE 4UBDD 4YDVB 1DBAH 5IVOA 2ID5A 1UWEH 1P4IL 3MODL 2FEEI 3V0WH 4XP1L 3K4AA 3L9RB 1FLRH 1S9YB 1LP9E 4PJ8C 1MCPH 3EYQD 2R39A 3P0GB 3HZKB 1ADQH 3DV4B 3T2QA 1IAMA 2ESVE 3BKCH 1IAII 4OF0A 3LKOA 4HK0B 5FUCC 4FQCL 4URTB 3TN0C 1GAFL 2C26A 3UTQA 2AJ3A 1ETZA 2PW1A 4JFDB 2YN3A 3S8WA 2IANB 4NO2A 5CGYC 5FIEA 4Z76B 5CBAB 4ZSOE 5FYKD 3I6KB 5IEKA 2ITDB 5T33L 1IQWH 3MRKB 3DV6B 2XPGB 2WBJB 2R1XA 4M6ML 5AZ2L 3SKJH 3DV4A 3QHZL 4HMEA 4P2QD 5DZLA 3RUGB 4F33B 4BQCA 2VDNH 4MQTB 1T1ZA 4XPBH 3MO1A 1XGQB 1M05A 3KXFE 5T1KA 3I6GB 3DURA 5FYJH 5ENWA 5I15H 3FO2B 3WO3B 3JV6A 2QADD 3EFFB 1VKXB 4ZTPL 2E8YA 3QWRA 3S97C 1MI5A 3CFKA 2P24B 2ZOKA 3CFCL 3HFML 5JW5B 5IBUB 3L3OA 4WFED 1MFBL 4GKSA 4PJBE 1C5BH 4P4KB 1NGPL 2FL5A 1F3JB 3N85L 4LLDA 1D9KB 2X4TA 1WC7B 5I8CA 2ESVB 3BW9B 3N1GC 4NQEA 5E1AA 1FVEA 3I02B 5GGSB 2VQUA 3MRPA 3PQYE 2A9MH 2DI8A 2HT4C 3BVNA 4V1DB 2HTKC 2YUZA 25C8H 3EOAA 5EO0A 4ZS7H 4PJFA 2CJUL 3I9GH 3WBDA 3O11B 1M4KA 1XCTB 3CCHB 5EUOE 5ACMA 1QFPA 4FNLL 1CU4H 1ZVYA 4ZOEA 5DYOB 3MRMB 5IBLD 1EFQA 2VDRH 4Q0XL 5ANMA 4UNTA 4YAQA 1CICA 2MKLC 3CFEB 2DI7A 1JZ8A 5C0CB 3HPJA 3QUYB 5IWLC 3PHQB 2A1WH 5FA4A 2XXMB 3WEXB 2J2ZA 2EDJA 3LN5A 4P3WA 5GGRY 4WUKH 1NEZA 5CEZE 2W0PA 3TVMC 1PZ5B 2A83A 2X42A 4B0MM 2EDXA 3GMLB 3CXDH 3K4ZA 5CZXC 2NY2B 1MI5E 1TCMA 3C60B 5I1IH 5DHVH 2EIZB 2ED9A 5HHOB 1HILA 2Z35B 1F00I 3CZFA 3I84A 3OKKA 1T7XA 5FFLA 3BP5A 1HDMB 3PP3K 1KEMH 1J88A 5D9SB 3C2AH 5EWIL 3PGDB 3WXVH 4MJ5A 4GBXD 5E2TL 4D0DB 2NX5B 2B39A 5IHLB 5BXFA 4ETYA 3KDMA 3CDGB 1E4XH 4KI5D 4PJGB 4I1NB 3RI5F 4XWGH 4PJ8A 4Z18A 3RKDD 2GY5A 3QH3B 4FQQB 4EVNB 4JQIH 2FEDC 4MX7B 4KVNL 3VRJA 3MV8D 3EOYG 2C3HA 4XAKE 5I71C 4NQCD 1NMCB 1FZKB 2PUQT 1QVOA 2VZUA 1GGBL 3HG1E 4OCRL 1OSZB 4ELMA 3VGGA 4N0CC 2AI0H 2EDDA 1Q9KB 5M95B 5I2IB 4UOJA 4DZBA 2ATKB 2XFXB 3OKDA 3U7WL 3ZDYF 4WO4D 3H3PH 4TSCH 2CQVA 2XRAH 2R0WL 3JTTA 4ZYKA 1CGXA 4XPFH 1U36A 2GSIB 3H9SD 1X6LA 2JIXB 3CMGA 4OLXL 3LSOB 1DBJL 3HZVA 3M07A 1Z0MA 4DGYH 2G2RA 5CGYD 5E56A 3QUMB 5HHMD 2Q8AL 1CD0A 4LCWD 4QRPE 3Q0HA 2PYFB 3MGTA 4P5MB 3NGBC 2DF3A 1P7QA 4M48L 1A2YA 5GS3A 2UZYB 3V5KA 2GEEA 2VLLB 5IHUH 1OWRM 2WP3T 1A1MA 3CXHK 5I1GL 3Q6FA 1ZXQA 1MCPL 4F7TB 2X4OB 5L2KD 1PG7L 1CLCA 3EOBA 4QRTA 3MRJB 4PRPA 3MJ9L 4PGDA 3N1FC 4KK6C 1ULVA 4UBDC 3SKOA 3O9WB 4OZ4B 2B20A 1D5MB 3NOIA 5F3HA 3KVQA 3OKNB 3IGAB 3TBSB 4OFPA 3P0VL 1J87A 5E9DA 1NDMA 1CR9L 3P11H 4XCFL 1DVFB 5FM5O 3O3DB 5T33H 1HXMB 2VB5A 3OMZA 2W9DH 3KWWB 4YHIA 4C4KO 3LN5B 2JIXA 1IGMH 1RK1A 1ITBB 1UCBH 1SHMA 4NDMA 3QUZA 3H7LA 2CR3A 5HI4C 3VXMA 3DO7B 5E6IC 2Q3ZA 1H15A 5F1IA 4A6YH 3EGSA 4GO6B 4OIAA 3WE6B 3KPSD 4RBPK 3O3BB 1MIMH 1FC2D 4YQXH 2D31B 1C08B 4OFIA 4XGZA 4OLVL 4BFBD 3CX5K 3P9WB 5GS0C 3TBSA 1BEYL 1H0DB 1Q0XL 4JFHD 1MWAB 3CC5A 1U91B 3U2SA 3IKCA 4B53A 4JREB 2BDNL 1YEIL 4HIIB 4N1CA 1X5HA 3QCVL 1T7ZA 4D2NA 3QCTH 1P7KB 2VDQL 3HPLB 4ODTL 2WAHA 4YDLC 1CFNB 3FO0L 1NGPH 3LV3B 2DQCL 2FNBA 1R3HB 4AIXA 4QRUB 4I0PA 5SV3A 4ISVA 3ZKNC 3PV6A 1CGUA 3O6KL 2Z0BA 2AJVH 3BGMA 4GRLD 1DBMH 2NW2B 1JI2A 4IS6A 4DGIL 2BVOB 4KUZL 1QBBA 1JGLL 3F7PC 1UH3A 1FIEA 4X7TA 4X83A 2ITCA 3QULA 5FUCE 3EFDL 1MCRA 5J57B 3BPNC 2I24N 4ENED 1FCGA 4MJ6B 2JCCA 3MACL 1RFDH 1I9JH 4M8QA 3BZEA 3HUJE 3QEGL 4XI5D 1TCRA 3KNBA 2DICA 5D1XD 1DBKL 4DEPB 1INDH 3TV3H 3QDME 1JE6A 2AP2A 3RWCA 1CD9B 4H0IA 3S37L 4GG6A 2CKNA 2JK5B 1SEQH 1LO5A 3K46A 5I75B 4Q2ZA 1RIHL 1ES0B 3I75B 3N50A 4AL8L 1HIMH 2Q86B 5IQ9B 1FNLA 5D2LB 2EEDA 2Q76A 1BOGA 2YPLE 4G7VH 5EIIA 1N0XH 4KAQH 4B7IA 4HKZB 4HKJB 3ZKQD 3PL6A 1ZLWK 3QO1B 2ZUQC 2EZ0D 5CILL 2X70B 5KANI 2K9UA 4Z5RA 4L8DA 2V9RA 4WWKC 2X4SA 4OBRA 1J11A 2JB6A 1UWGH 1I1CA 5BQ7A 3I6LE 1XIWB 1CXFA 4NNYA 3SCMA 4ZUWB 3RDTB 3D85B 4HWEL 4JPVH 2Y6SC 3SCMC 4KY1L 4EN3B 1FYTE 4MWFB 3RWCB 5DD0H 3TIDA 4QHMA 1I9IL 2P7TA 3HAEG 1QR4A 5I1LA 4WJ5B 4P3CL 2GTWB 2R4SL 3OJ2C 4XVSH 3T4AB 1O0VA 1XIWA 1UM6L 4ZUSA 2BFVL 4GAGH 4LSSL 4RA3A 1B6DA 5DWUH 3VWKA 1OP3K 4P2QB 1KCRL 3JWDL 4M9OA 5TQ2H 3TT3L 1D6VL 2XQBL 4KUCD 5JOEA 1R0AH 1CICD 1VFUA 5T1KD 5FO7B 4OLEA 4QHMB 1QBAA 3P73A 3QJHB 5SWQB 2VDLL 1AKJA 1T7YA 4MJID 1ZT1B<