1DQDL

Crystal structure of fab hgr-2 f6, a competitive antagonist of the glucagon receptor
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
214
structure length
214
Chain Sequence
DIVLSQSPAIMSASPGEKVTITCSASSSVSYMHWFQQKPGTSPKLCIYTTSNLASGVPARFSGSGSGTSYSLTISRMEAEDAATYYCQQRSTYPPTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPRDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNECA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Fab hGR-2 F6, a competitive antagonist of the glucagon receptor.
pubmed doi rcsb
molecule tags Immune system
molecule keywords FAB HGR-2 F6
total genus 48
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2000-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dqdL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dqdL01
4G6KL 5CBAB 4Y2OA 3OKMA 2BSSB 4X6DF 4DOHB 3QEUB 1U8QA 5HI5D 2DM2A 3RWDB 4Y4FC 3HUJB 2NY3D 1EGJL 4RNRB 4Q6YA 2ITDB 1VADB 2NZIA 2PW2B 3WFEH 5ACMA 3KWWA 2BP3A 1UA6L 2VN7A 4KTDH 3MODH 2F5AH 1T3FA 2VXSL 3HE6D 4LARL 2CRYA 5CEXB 4HKXA 5I1EH 5HYFA 4YO0B 3BE1L 4C4KT 1KTDA 3LS4H 4YHZH 2IADA 5EC2A 1KJVB 5KN5B 2AERT 5E6IB 3WEXA 5E9DB 2ICWJ 2CMRH 2E8ZA 3K4ZA 1NMCC 3KWWB 4G5ZL 4PJCA 2EDXA 4R0LB 4R26H 1A7PH 4Z7WF 2VLJA 4M6ML 2E8YA 1CLYL 1WV7T 1F6FB 5GPRA 4GAYB 1SY6L 1ZS8B 4PLJC 4LNRA 2FB4L 4OGXH 5DVOA 5IW3A 2XWBB 1PZUB 4XWOD 2ZPKL 1YYMH 4XC3H 3QQ9D 1A7NL 3X13A 3DO7B 3C6LD 4AL8H 4HPYL 4HIHA 5EIIB 3AM8A 4YDLB 3BN9D 5FFLA 1A6TA 1FDLL 1RHHB 3TV3H 1N3NA 2XT1B 1EFXD 4M7JH 4XGZB 1CLCA 3MPCA 3K7UA 2J4WH 3NIDE 4GMSH 3X3GL 4IOIB 2CQVA 3BVNB 3SDDB 2HJKB 1EXUA 5IMMA 4Z7WE 1N8ZA 4BSWB 1A7OH 1OSZB 4BSVB 2H9GA 5MEQA 4GKNA 3WUZA 5DD3L 3GKZA 2XRAL 4HJJH 4QHUB 3KPSB 4CNIB 3CMOH 5IW6B 1K3ZA 1K4DB 4UBDD 5D7IA 2E9JA 4R8WL 2GAZA 4KJQC 3UTTB 1S7VB 2Q87A 2B7DT 4M1GH 5F1NB 1TETH 1NUDA 3A6CL 4KVCL 3WJLA 3QUML 5B38G 4Q7DA 1IAIH 8CGTA 2IANB 3BZEB 3FQRB 1U3JA 3L6FA 3MCKB 1I8KB 5F3BB 2ID5A 3D2UD 2D31B 1FL5A 4XTRD 3ZDZE 3Q48A 1HHIA 3OX8B 2X4SA 5C0RL 3MRGB 2Y1VA 1S7SB 4IRJC 5DEGB 4Z7VF 4X4YB 3IJSA 3BQUB 3HA0A 3KHOA 2NTFB 4QXWA 3QUZD 1DBAH 3QO1B 4HPOL 2AXFA 3NPSC 3LRSA 4QRUA 2C4FT 2EXWD 4CMMA 3EOAA 2BSED 4PJ9A 3LEXA 2EC9T 2XIDA 2A73A 3KNBA 3QUXC 5LGKA 3O2VL 1H8OA 4JEGB 4OUUB 5CZXC 3MBEA 4FS0A 5IG7B 5J1AB 1FYTE 2H6PB 2NNAB 3RDTB 3O45A 1NGQL 1FO0A 4PY8J 3SE3C 5T3ZD 4WFHD 4JAMA 3HS0B 3TH3T 3ELAT 2X1XR 3RVUD 1LEKB 4YDIL 2A6DA 4UV7H 3GI8L 4JR9L 1QSVA 1GGIL 1A5FL 1I1CA 2DTML 3H8NA 3H7LA 3FONB 3EOYG 2AJZB 3UJIH 3QYCA 4N90D 3MRLB 4CDHA 4XCYB 5GGSA 5I76A 3ROOA 3L5HA 2DQDH 4GBXD 5FM8A 1JF5A 4L4TA 3QEHB 4YK4C 4LHQB 3U4EB 2DQJL 4BZ2L 3ZHLA 2QHRH 5CD5D 3TM6A 3FT2B 5EWIL 1B0WA 4OD3L 3BHBA 4NQEA 4LLVA 1IGTA 3EYFB 4KKBD 4WO4A 4YZFE 2NYYC 3TYGL 2G9HB 4R7DA 3P77B 4PB0L 2Z8WC 2A83A 4IOFC 1BD2A 4U1MA 5I0DA 4PGEB 2RHEA 1RJLB 2RQ8A 5FGBC 5E03A 1XIWD 3DGCR 5CJQH 5IB5A 1Q8MA 3INUL 3UDWA 1QZ1A 3IFNH 3QG7H 5GS0C 3LZFL 1SJVA 1X3DA 3MRMB 3X12B 2X4OA 4WFEE 3CSPA 3VH8G 3QXDB 4RMVA 1FV1A 1E4XI 1WBYB 1RZFL 1QR4A 2BVTA 4ZTOH 2VAAA 2R1XB 4L8DB 5FYJE 4DFHA 3QWOB 3G5XB 3LRGA 1WVZA 4KRNA 1J8HE 4OF6A 1SVZA 3OX8A 2BHUA 1OQOA 4XNXH 3DVNB 1WLHA 3AXLB 3ZE1E 4LP5A 4XP4H 4LEXL 4LRNL 1JZ8A 2EXYC 1AR2A 2AK4E 1FNGA 3DRTA 2XOTA 4RFOH 3VXSB 4ONHB 4L4VD 3LKOB 5IHZA 3W9DB 3FAWA 1T80A 1T5WB 3GSWA 1ORQB 1HZHH 1Q72L 4YHKH 4J4PD 1MAMH 3CSGA 4GRMA 2G9HA 4R7DB 4YR6A 4KV5E 5D71H 5MHSD 5GIRA 1BZ9B 4Y4HD 4HT1H 4OFKA 4OF5A 1KN4L 3H9YA 1FO0B 1WIUA 3S88H 3HPLB 4L8SA 2CKBA 1ZLVK 2EKJA 3VFPA 4HEPG 1EZVX 3ABZA 1I4FA 5SWSE 3VFSB 3OWEA 5E56A 1IBGH 1WFNA 2YD4A 2GTWA 4X5WA 2D0HA 2PR4L 4P9HC 3LMJH 3S4SB 3M07A 1ZXQA 5CGYD 4G9DB 4PJEB 1T83C 4P5KA 3SDCC 2DTMH 1A6ZA 1FL6B 4ZO8A 2YRLA 4JFEE 4EVNB 4JM2C 1VERA 4U1IB 5E6ID 1OAQL 2CDEA 1CYGA 3EO0B 3O6KH 1N59A 3RBGA 1ZOXA 2FECL 4HWZA 6FABH 2DLHA 3D18A 4X80L 4ODTH 3MMEB 4XVSH 2NY2B 2AI0H 4NNXA 1ADQL 4PJIE 15C8L 2W07A 5I75B 5GGVY 2F54A 1JRHL 1XGUB 2VQ1A 4KJYA 4R6UA 4P5TB 1QO3B 4LHUB 5IMOB 4M48H 5DJ8B 2FATL 2YXMA 3PGDA 5I74B 4BQCA 5DRWB 5IEHA 4RA3A 4PRHE 2Z8VC 1HQRB 1MF2L 4XNZB 4NFDA 5I19L 3MMEA 3HZMA 1XGTA 1YMHB 4JO3H 2V2WA 2HKFH 1JPSH 3ARDD 2X1OA 5IKCA 5JHDD 3H6JA 3UO1L 2XN9B 1AJ7L 1J1PL 4UV4H 1B4JL 2E7CA 3QHTC 1SM3H 4RMWA 3IAQA 4JJ5A 1JZ7A 4PJEA 5MHSE 4NNYA 5KSUB 1HH9A 1I3UA 2YZ8A 4FTVE 4F7PB 2P7TB 3MRCA 3GMQA 1NBZB 4ZAKD 2ZUTA 4HEME 1G9NL 1I9JH 4HWUA 4DZ8B 3O6FC 1YECL 4RZCB 4U3CA 2XQYG 2L7JA 3I02B 3PXHA 4KAQH 4Q6IA 1QLRA 2AV1A 1ZLWK 3VFNB 1PKQB 4F15C 4FQ2H 1UJTA 2LTQB 1HYRC 3MODL 3SDYH 3JWDH 2UWEE 4KTYA 5D9SA 2ORBH 5HHMD 1C7SA 1DBML 3O8XD 1OT2A 1JYWA 1ACYH 4XPGH 4HAFA 4ODVH 2DMKA 2HFGH 1FC2D 3AVEA 3S37H 4NWTL 3BP7A 4LLWB 5INDA 3QUKA 3MRHA 4TUJB 5I17B 5FKPA 3ULUC 3MRNB 4FMFA 4QT5B 3VFSA 3O3UN 5E1AB 5TH2A 4DW2L 2NZ9D 1JL8A 3ZT6A 1N5YL 1XMWA 3QI9D 4R26L 1K8IA 1MELA 3L3DA 3V8OA 3EUUA 5J6GB 5CSGA 3N1PC 5EU3B 5DHXB 1KCKA 1S78C 1Z3GH 1T7YA 3FQTA 3F7YA 1Z5LA 2Y07L 3T0EE 4OQTA 4HJ0D 1T7XA 4DGVL 4GS7B 4PRIB 4DTGH 5D5MF 5LAXB 1RULL 2HFTA 1VFUA 4OCLC 4CN6A 4LCYB 4LF3A 5C07D 3I6LE 5IESL 3W11D 1MCPH 1KCRL 2ERJB 2HN7B 5KN5A 4IHOB 4MQ7B 4HC1H 4IM8A 4ZUTB 2J4WL 4XCNA 5E2VH 4ZFGH 1YPZB 3IFPA 3V52H 3O3DB 1EHNA 4PJHA 2QBWA 3Q3GA 3RRQA 2XXMB 3BPNC 4OZFB 5AD0A 1MJJA 5GZNC 3IJYB 5FCUL 2F54D 2BSTA 3DXAA 2ICWB 4RFEA 1CXLA 3UTQB 1M7DB 5T1MB 5IVXF 1U8QB 3RAJL 1JFQH 4N5ED 2R2BA 2KQNA 1LO5B 2EECA 5CUSL 5D1XC 1GPOL 1M05B 3PIQA 3GK8L 1XCTB 5FCSH 4MJID 3QDGD 5HYQB 4QRTA 1VENA 4PBXA 3QDJD 5J57B 2HAZA 4EI5C 5BXFB 4YWGL 3LQAL 4MAYD 4XPTH 4NC1C 4OLWH 1XF5A 1MHEA 4LSVL 1FZJA 1NL0H 1IM3B 3PHOA 5HGHA 5K9OB 3F7YB 1Q9KB 1YYLH 4LLMA 3MV8A 3QBTB 4NJ9H 4K94C 2Z9TA 2FB4H 1Z9SA 3L5IA 4F8QA 3EYQC 5GGQH 4KK5D 5C0FB 1LO3H 4BSVA 3PP3K 3ZMRA 1R6VA 5I9QB 5DR5L 5D1QC 3RVWC 1MCRA 1FDLH 2VH5L 4PJBE 3QEQD 4U1SB 4OLXH 4OZFA 2BY3A 3I84A 1FNLA 3RUGB 3H9SD 1AC0A 1GL4B 1QHPA 2FSEA 1G7IB 2PETA 1QFOA 4YIQB 3VE0A 2E3VA 1KPVB 4Y2DD 1B0RB 1MCLA 1WZ1L 2BSRB 3FRUB 3LN5B 5FM5M 4PJFA 2OQJA 2B1HL 4WGVB 3S5LG 4HIHB 3I6KB 3BAEH 4MWFA 1KT2A 1ZLVH 3RIFK 3L6FB 3E6FB 2EYSA 2ZOKB 1B6DA 4TVPE 2VABB 4JHAL 4LFHG 4WW1A 3V6OA 3F6LA 1A6WL 3AREA 3VRJB 1J8HA 2YBRB 2IGFL 3E6HB 4ZFZA 1PZ5A 3KPRD 1QRNE 3IDJB 2M8XA 1IL1A 4FQQA 4C58B 1C08B 5DRXB 5I30L 1ZHBA 4LLYB 1OAZL 5KG9B 5KAQF 2IJ0C 3ZE2E 4EN3A 4U1HA 4S2SA 3RQ3A 3X13B 2ZCHH 5A2LH 3SQOL 2DIBA 4G7YH 3MBEB 3TYGH 1KTLB 3KPLA 1Q9OA 5HD8D 4X6DA 2VSCA 5AUMB 4KK9C 2FGWH 4X7EC 1W72L 3SO3C 4KTDL 2EYTB 4LLQB 2B4CH 5EIVA 1P7KB 5DD1L 3GI9H 4IS6B 5CEYB 5ETUB 2Y6SC 1EV2E 4PJAA 3UZVB 32C2A 3IDNB 2DD8H 4W70A 5SWZB 1BAFH 3DSNA 5DQ9A 4H0IA 4NQDA 1JNJA 1OGTA 3N50A 4FQXA 2BHZA 4FFZH 3ZT5A 1MEXH 3E6FA 2LFGA 1NCAH 1IGYB 2Z4QB 1JE6A 2EEAA 1VFBA 3U7YH 3G6JB 1NEUA 2QADC 1ED3A 1D5BB 1CFSA 4JR9H 3DX8A 5FK9B 3PWPA 4WDIB 2EDYA 4RAVB 4ZXBA 4KJPD 2AK4B 3TNNA 3VXSE 5LWYH 2D7MA 2IFGA 1SMOA 1FL5B 2C7UB 5E99L 5IT2L 5AAMA 1J05B 4M43L 1AKJB 4HPYH 4X8XA 2OMBA 3A67L 3UBXG 3WSQL 1AGFB 3UTTD 2AEQL 3BPCA 5GS0H 5AYUL 4PY8I 1BQLH 4E41D 2AXJA 5KOMC 1G7IA 5CHNA 1DBKL 3MLUH 2I24N 4YHMH 2CKBL 4Y2DA 4LLQA 3SCMA 5F9JA 3MUZ1 2W65B 5D7JC 1YJDC 1CBVH 1T7ZA 4WIQA 2A6IB 4LQFL 5ESAA 2ADIB 5SWSB 3KPSA 3PQYB 1YEIL 1KFAL 2PUQT 4QRPA 1CDHA 1AP2A 2F5AL 5IK3A 2NY1C 3QH3B 1IGCL 5JHDE 2JIXD 1BVLA 3D69B 5IR1A 3ALPA 1CT8B 1RU9L 3V9FA 2CSPA 2W65A 1DEDA 5I8KL 1Z9MA 1P4IL 4EQ2A 2BVOB 2NY4C 5C7XL 4KMLB 4NRXA 3NIGE 4M9OA 4X80H 2A2QT 5ALBH 1D5XB 5BVPH 3V5KA 4FOMA 1IZKA 4TULL 4XC1H 3DI3B 1BPVA 3DYMA 1F4YL 3KXFD 4OCSL 2LE9A 1V7NH 3CU7A 2FECI 2X7LB 1AXSA 2XA3A 1FL3B 3T4YB 1I1AC 1ZT1B 4QOKB 3BW9B 3TZVC 1SJHA 4MD0A 4P59H 4Y19A 4P9HH 1M6OB 4JDVB 3HCVB 2X4QA 1UENA 4HUWA 1QOKA 1KCSH 1HKFA 5FYKD 4YC2C 4NUJA 1IZJA 2UYLB 4J1UB 1G7LB 3B9KD 5DYOB 5GJTH 3RPKA 1F45A 2I5YL 4BKLA 4ONHA 4AIOA 2X4SB 2QQKL 4LLUA 4YDVA 2MHAA 3MLZH 4N8VA 5JOPE 1DSFL 1S7XA 3QUXD 4M3KB 4OF0A 4QHMB 5EU7C 4D9QD 4N0RA 5EU5A 1U3HD 4M6MH 4AEFA 3REWA 4FTVB 2MCPL 4WDIA 1TLKA 3VRIB 2YPVH 1NGYA 2Q86A 1KENH 1O0VA 2QSQA 2R4SL 2H2SD 3RZWA 4XPFH 5CMAB 1TQBB 5DJYB 4DZBB 3QRGL 1H3VA 2NLJB 2EDKA 3SJVA 4POUB 3IVKA 3Q6GH 4GT7A 1F3RB 4GSDH 5TE6L 3MV8D 3Q5OA 5J7CC 4MAUL 5C09D 5C0CE 4LCCA 4JQVA 2P45B 4ODVL 2QHRL 4D0BB 2F74A 5ICXB 1JHLL 3FCTB 4PRPA 1BFTA 1P4LB 4U1MB 4S11A 4KK9D 4PP1C 1KXQE 1RD6A 4P3DA 1IEBB 3CVHA 3GBLA 2RJMA 4GOSA 4NJAH 1CD8A 5TGBA 5KSUA 1WT5C 3T1FB 1MH5A 3WDHA 3MRDB 5EN2B 5CJ5A 1MQKL 2Q1EA 3O9WD 4LIQE 4XCFH 1LO0L 1A7QL 3IKCB 4N8VB 3O4OC 3TT1L 2F53E 3TWCH 2EDEA 3VFMB 3EFDH 4LEOA 3G5XA 3WIIH 4NC2B 4S0SD 5E00A 4EEEA 3T1FA 2AKRA 1FZOA 3DVGA 3MRDA 1T7VA 5I2IB 4ZOAA 5TPWH 4JY4A 4KZEH 3FT3A 4A2LA 4XNQB 2J88L 3JSSA 2BOCB 3MLRH 3SE4C 1P53A 2C9AA 2DLTA 4ODUA 3CH1B 5IF0B 4YHLL 3SO3B 5C92A 4PJBA 5H35B 5E9DD 1TZHB 3NTCH 5DUPH 4P2OD 4AEEA 2B2XH 1M7IB 1SYSA 2R1XA 4LIQH 4OZHB 3FT3B 4GFTB 4LSTH 4JFOA 3F6IA 1DE4B 1RZIA 3MV7E 5JOEA 1KOAA 4XMKL 5ADPH 2GTWB 4X5WB 4UT7L 2AV1B 3VFNA 2VR9A 2PYEB 1RK1A 4M02A 3HPJA 4ZTPL 1A3LH 2CUIA 2PO6B 3OKLA 4KDVA 2UVFA 3UYRH 4DW2H 3JVGA 2M2DA 2DDQH 1LE5B 4O9HL 1QVOB 3BGFB 4WFED 5D1XD 4NO3A 4CADA 1LK3L 3IRZA 3JUYA 1KPRB 5F1IB 3VD3A 3WDJA 2XV6B 1TIUA 3T0EB 3DTXA 3MV9E 4IRZL 4TSCL 3JV6B 3CFKB 2R0ZL 4U6YA 3D2UA 3R06B 4Q6IB 4AM0B 2EEBA 4K3EH 3PIQB 1E0OB 4Y4KD 3KPMB 3NZHH 2PTVA 1CF8L 1U8PB 4D8PB 3TPKA 1V7MH 1I3RB 4DGYL 2YUXA 1RJYB 5E2WH 3H7BA 4KVNL 2HH0H 2QADB 3CZFB 3QXWA 4L9DA 4PJAE 4PB0H 2FX9H 3QHZH 1CDIA 1HCFX 4RFOL 4NQDE 3GSRB 4OZFG 2NY2C 1NMBL 1MF2H 5HHXH 4PV9B 3U4BH 3VH8A 5I71C 2R39A 2OM5A 4XCFL 3OPZL 3ROLA 4OLYH 4AQ1B 1QLEL 3LSOB 1CFNB 4L29A 1UXSA 3OKLB 4OFPA 5CUSH 3L1OL 3TT1H 4TQEL 1JNNL 3WCYA 4NM8H 4UNTA 2O5YH 4HUMB 1MFEL 4U1KA 5D5ME 3CGTA 2QJDA 1TJHH 2X1WL 3CJJA 3UTQA 3BSZL 3RNKB 5L9DH 3FB7A 1MUJB 4L3EB 4XNXL 5TE7L 3VGAB 4TUOB 4WI4A 4XAKD 5D1ZA 1OQXA 2GIYA 1E28A 2ARJA 3LDBB 3ARTA 4OSUL 3HI1B 1F42A 3L5XL 1UKQA 4JN2B 2KZWA 1OAQH 1A2YA 4GBXC 1U8PA 4WFHE 5F3HA 1MY5A 4WHYH 1QKZH 4XPBL 4A6YH 1WBZA 1JK8B 3W9EA 3U48A 3RI5K 4WVRA 5EOCJ 3OHXB 3KPRA 4XH2A 4E41E 1IC1A 3MXWH 2BY1A 5DMGD 4HJGA 2XN9E 4PJDF 4WW2C 4MLIA 4EI5A 3UYOD 3VMOA 3P73A 4OLXL 3MV9D 4KK8C 3OKNA 1S5HA 3EGSB 4L4VB 5D93B 1S9VA 2DI7A 1OARH 4NM4L 4KJWD 4QGTA 3G6JF 1F6AA 5DFWH 1Z0MA 3K2UL 5DUBB 1FNSH 3MOQA 1NLBL 5JOPD 1QPPA 2WMPA 2FO1A 3C9NB 2X4UB 3TBYA 4I2XE 3IDYC 3PP4L 3RVXD 3HNSH 4TUJA 4ODSL 4R8WH 1KB5L 3ULVC 1YC8A 3H9ZA 1CDBA 3HC4L 3FB7B 1AY1L 4FTVD 1TETL 1U8IA 4IRZH 4TSCH 5JLZB 1JZ4A 4XCNB 1F00I 4KPHL 5IIEB 1HXYB 3QUXB 5JXAL 3L3DB 5LKNA 2FX7L 3JVGC 4LCWE 1DBKH 4YJZL 4JRXA 4LBEB 1SBBA 1QLFA 4ONOA 3W39B 1HQ4B 4F15B 1KBGL 5E4EC 4LU5H 1V3JA 2HH0L 1F02I 2VZOA 3HE7C 2XTJD 1LEIB 5DRXA 4R2GC 4ONGH 3QI9A 4XNUH 4OFYA 2NY4D 3B6SB 4G43A 4P3WA 3I2CH 1P7QA 2OL3H 4CDGC 4GMTH 5T3XE 4PJHF 5T1DL 4HLZG 1RZ8B 3VXPA 4TTDC 4YUEH 1VKXB 3OXSB 1ZK9A 5DDHA 3F8UB 4YDJA 2H41A 4WW1B 5H8DA 4F37K 1CQKA 5EU6A 4YNYB 3X11B 1ZWIB 1F11A 3D0LA 2FJHB 4ZS7L 5IVXA 3BRFA 2WINA 4AG4H 2VLKD 2YN5A 1T3FB 2OK0L 1NL0L 2VL4A 2ICWA 4RFEB 1XCQA 3BPOC 4P23C 1MCNA 4U1GC 1INQA 5I1IH 1A5FH 3VCLB 1L7IL 1HWGB 4A6YB 1XGPB 1AE6H 3RZCA 1KC5L 1OLLA 2Y6SD 1N6UA 3U30C 3SCMC 4ACPA 1JF1A 4XNYL 3BJLA 4YNYA 4O02L 3PABB 2CDGB 3T4AA 3MO1B 5FM5O 5HGAA 4UI2A 1A3QA 4KTEH 1U95A 3GSQA 4XPBH 3LKPA 2HFGL 5BQ7A 4NZUH 4GAYA 3FMGH 1FIEA 3GHEL 1FAKT 1YNTA 2I5YH 5GXBB 1PG7H 3QJFB 2KH2B 2EXYD 4M1CD 3X3FH 3TEUA 4NQXB 5J11B 4LVNC 4UTBH 5JDJA 5BCAA 3AREB 4W81A 3D0VA 3GZKA 1A3RH 1BZQK 3QUMB 4RMQA 3ZYJA 4BH8B 5CJQL 1T66C 3DUUB 4U2YA 5C0NC 3D9AH 3IFNL 3QG7L 1JI2A 1H3GA 1NLBH 1BQUA 1UM5L 3C6SB 2R2EB 3GK8H 3NCYS 4KRMB 3PP4H 4X6CF 5EC1A 3WHXB 3MLWL 4JB9H 3C08L 3P4OB 4W6YB 2DLGA 3ARSA 3SKMA 1A4KA 3L3IB 4NUJB 3WXWL 1IILE 2FEEI 3S96B 4WV1A 1ULVA 5CIPH 4PJXE 3D69A 3P4MA 1G9ML 1AGFA 5F89B 2Q20A 4G6AC 1AO7E 4XAWH 2XWBA 3WFBL 4MA8L 1S7UB 3BDYL 1DLFL 3LEXB 4HIXH 1NMAL 3MRKB 3HB3C 3IDNA 1LO3L 1C16B 3BIBX 1I3GL 1YEJH 4LLYA 1P7QD 2VRAA 1NC2B 1MAKA 2C1PA 5A3IC 4OCXL 4GMTL 4EUPA 3NZ8B 2ESVE 3MRGA 5EUOF 1CIDA 5KVGH 1I7RB 4MSWA 4HCRH 4TVPD 2NPLX 1OOAA 5CFHA 1MJ8L 3TVMD 4CN1A 4Y4KA 2AXFB 2AK4A 4D9QE 3RZCB 4D9LL 3IDIB 4YQXL 1OWWA 4PV8B 5FF6A 2FZ3B 1TCRA 1NANH 1A6WH 8FABB 1FFRA 3AGVA 3L3IA 4EDWL 4X8JB 2VZSA 5EUKA 1QYGL 3MA9L 1DR9A 1HILB 2ZUUA 1FVEA 1DZBA 1P9MC 3V4UL 2B2XL 5TQ2H 5SV3A 4HKBA 3Q6GL 5DR5H 4O02H 2X7LA 4OZHF 4HIIA 2JTDA 2Z8SA 1BFVL 4MAUH 5L88L 4KTEL 3VXOB 5A2IH 1U2CA 4TVPL 4Z0BL 1OF2B 1FZMB 4HMCA 1A8JH 5L0QB 1KJMB 3ULVE 4O2CB 2DM3A 1KB9J 5F9OH 2A6JA 3HZVA 3MOBH 2MKLC 4PRHB 3CZJA 1FQ9C 5JA9A 1FH5L 4JPVH 1J0ZA 2AV7A 5J0BA 1B9ZA 2F74B 1I9RH 3BPCB 3MLSL 2BOBA 3SDCA 1LO0H 3P0GB 2XG5A 3EYSH 4MSWB 2F5BH 1Q0XL 1JMZA 3GIZL 4NUGL 3ZSTA 1MCOL 3QHFL 4LGRB 4PJ9C 4PJ9D 1RIHL 4KJPC 3MV9B 4PRDA 1S78D 2R1YA 4P57B 4PJ5D 4WRLA 5T5FL 2C4FU 2GTZB 2VISB 4TNWK 3RWEA 4DZBA 5D1ZC 1MRCL 2R1WA 1RSFA 3GNMH 4LPCA 3U7YL 5BOZG 4JANB 5JQHC 1F4YH 5DWUL 1YNKL 1T0MB 5JQ6H 1CE1L 5SX5K 4HV8A 3OKDB 4NKIL 2YPLE 4FQXC 2LAGB 4P46C 4CUCA 3NTCL 5DYOA 2ZG1A 3IDXH 3L7EB 3VD7A 3DNKA 4BKLB 1I8IA 4MB5A 3T2NL 4TUKH 2BZDA 1S9WA 4LOUD 4NSKA 2DD8L 5HYEA 2H1PH 1JWMB 2QKIA 4F57H 5ITBL 3BHBB 2CUHA 4PTUA 1T20B 3LN9A 4BH7A 2UZIH 3GMLB 3QXAA 3LKNA 4D9RE 4J4PA 1NKOA 1XH3B 3BT2L 1ZMYA 4DN4L 4ELMF 4PLJD 4JLRB 1M7IA 3BW9A 5EOQH 1RUPL 4L1HA 1PDKA 2IAMD 1OB1B 1WQVT 5MEOA 4HD9A 3KPMA 1E6OL 1T2JA 1WZLA 1BD2D 2CDEB 3OAZK 4NQCD 1RUKH 1XR9B 4RIRA 1BZ9A 1AD9A 1BJ8A 2OI9C 1OAYL 5D7IF 5F9WB 5EFIA 2EDQA 5IBUB 4CRPA 2FEDC 4PJFE 4PGDA 4WFFE 3LS5L 1LO4H 5IJVB 3RWIB 3N9GL 4P5MB 4LSDA 3M8OL 4PJ7F 3S5LB 1OLZA 4KKLD 5AYUH 3CXHJ 3BX7C 4E41B 3HE7A 4OB5H 4HUUA 4V1DA 2VDOH 3LEYH 4ELME 3T3MF 3GB7B 1U8LA 1V7NL 4DKAA 2AK1L 2CXGA 3GMRA 3K74B 2XWJB 3WNLA 1DE4A 1RZIB 4PP2B 4NQSA 5C6TH 3JWOC 2R2HB 3P11H 3FQXB 4P4RA 5AZ2H 2IPKA 4Z0XB 2J1KA 3KYMA 1KCSL 1RJYA 4D0BA 3SOBL 3B83A 3FCTA 4PRPB 3MOAL 3TT3L 1RMFL 4O2EB 3HMWL 1OB1A 1BVZA 2O26U 3WFDH 2F19H 1F8TL 4NM8L 1ZA6A 3MLZL 2DLIA 4KGJA 5C7XH 5EN2A 4I3RH 5FM4A 1C1EH 1EMTL 4PB9H 5E94A 3ZL4L 4AK1A 4NJ9L 3ESUF 1JHTB 4G9DA 5FUOH 4IBLT 3MTRA 4EXPX 1LO2L 1MCIA 3CK0H 5BS0B 5A16B 3O3AA 4WUUD 2XY2A 2PW1A 3RVVD 2EC8A 4MAYA 3I3BA 4L3AA 4P9HL 1GAFH 5TQ0H 2DQFA 3RFZC 4XBEH 1JV5A 5HDQH 3E3QC 4XMPH 3SDAB 4P23B 3O11B 2PO6D 5HHNA 1SJXA 2F53B 2VITA 1AGDB 2P8LA 4U6TA 2ZG3A 2H45A 1I7UA 1KYOK 2NW2A 4PUBL 1EHLH 2EIEA 3MJ9H 4U1JB 1YA5A 2GK0A 3ZZ1A 2HKHH 3T3PF 2IAMA 1T04A 1BWMA 1HHJB 3UYRL 3QDGA 3ZE0E 3STZB 4OD1L 3F5WB 1TVDA 3GSNL 4JRXB 4LBEA 1WZMA 1SEQL 2VXUL 2IH1A 2WBJB 3OJVC 3BN3B 3NCCB 3VA6A 4EIZC 1HNGA 3QNXA 3RWIA 4Z7UB 4ORGB 1RUML 1S9VB 1HHKB 1E27B 5E94B 2GUOB 5M7QA 1Q94A 1LO4L 5M94B 3KPQA 3VWKD 3RWCB 2HRPL 4Z7NE 5HHMB 5TDOB 3RVVC 3VDAA 4GAGL 2E9IA 3DUSB 4YAQA 4MAYB 1EGJA 4WHTB 4UDUA 3I02A 1T1YB 2EDOA 3AU1A 5B21A 3ULSA 3ZE0F 1ETZA 4HS8H 2R69L 2VR5A 1WC7A 4P4RB 5I1LB 1U92A 3BD5A 3WJJA 4P2CG 1G7HB 3FO1A 1I7UB 3CDCA 4K07A 4WI7A 1B0GA 1OL0A 2GITB 1ONQA 2A9ML 3WNOA 4R0LC 5CD3A 2W0LA 1CD0A 3O2DL 3EDKA 1NCCH 1FGVH 3WIIL 5J1TC 3VI4F 2Y5TB 3CCHA 2AGJL 4RGND 1KTDB 4U1LA 1CWVA 3G6JE 5EB9A 5L9DL 4G6FD 3VXUE 2YD7A 1FCCA 5C07B 3VH8B 2JJVA 2APWA 4FNLH 4BZ1L 3FTGA 4QYOA 5C9KA 5IQ7L 3BKMH 4HQQL 4HDIA 1CD9B 2EE6A 5BXFA 5B8CC 2HFEA 1XF5B 2WINB 3SGEI 1QLFB 5L6YH 2OYPA 3KPTA 3KYNB 1HQ4A 3DX6A 5BO1L 3L3OB 4I0CC 5CSZA 4DKFH 4K9EH 1MRFL 4JHWH 4JN1H 4MJ6A 3U79A 3VWJD 4RX4D 2YOCA 1BP3B 2P5EB 1ZLSL 3Q2CA 4QRRD 3MV7B 1MJUH 4ONFH 32C2B 5E6YA 2MMXA 5DEFB 4CJ0A 5DHVB 3LQAC 3C9NA 4ODXB 3DV4B 3MBED 4PJDA 4WI2A 5GGVL 5JPNB 4MAYC 3UEZA 4JFFD 1JK8A 1F11B 3D0LB 4OCYH 5T1KB 3WIFA 3RY5A 4PRNB 5CZXD 3TBVB 3PWUB 1RIVL 2VKXA 4PJHE 2BSSA 2NY0C 4F2MB 4NQCB 4BSWA 3JTSB 4NKDB 5IIEA 4KI5C 1UM5H 5CWSB 5JIIA 1J7VR 3SKJH 4YFLF 4GG6A 35C8L 4L4VA 5EZIL 3KLAB 2VLJB 5BV7H 1S7SA 2OR8A 1JGEB 5DQDL 1FZJB 5CEZL 1U58A 1OSPL 4GKZA 3BSZH 1MNUH 3WNMA 3B2UD 3KLHD 4OCSH 3MGAA 5HGAB 4PJXB 3PWUA 4JFHE 2QEJA 43CAA 4GKSB 2AK4D 4QOKE 2YPLD 3P30H 4NQDB 5CP7A 5JW4N 1SYVB 3C6LC 3RX8A 2VE6A 1CR9H 2NY6B 5BRZB 1MHCA 2DYPA 1B0GB 1MWAB 3H9HA 4XPAL 1JGUH 3VFRB 4NCC1 2CR6A 4Q74A 2LQRA 1I3GH 1YEJL 3BGFC 1KG0B 5DEFA 3PWLA 4U0QB 4YGVA 3KPSD 2AJXH 3QNZA 2CUMA 2PO6C 5D1QD 1EEQA 2JELH 1P84J 2DQEH 4YPGB 2FJFA 3REVB 1PY4A 3ZLQC 1K5NA 3WXVL 4JM2A 5GGUA 3E1F1 2H9GB 1P2CB 1U8MB 4NO5B 2X1PA 3I6KA 5MEQB 5GGSB 5I76B 5E8DH 4MHHG 4C83B 2EH8H 5JW5B 4V1DD 1V5JA 1IQDA 3ILQD 1FBIL 2FWOA 5E08L 3U1SL 3MACH 3T65B 4DAGL 5HVHB 3MXVH 4RGMC 5IB3A 2YBRA 3C2SA 1GGCL 5CHNB 3S34H 4ISVB 1FJ1B 4JFDB 2Z4QA 2PNDA 4WI6A 3BN9C 4P4KD 1IEHA 3TJHD 4OV5A 5I0ZA 4E0RB 5L6YL 1DVFD 3MXWL 4XCCH 2CLVB 5ITBH 4ZQKB 4G6FB 4HUXB 4NJAL 4UOW0 4MA7H 1HKLH 4OZ4A 4LSRH 1KG0A 4TPRL 3B9KA 5IROC 4LVNB 5TDPB 1FV1B 4DEPB 5KS9E 1UWXH 5F9OL 4L1DA 3T2QA 1W2KT 1DQDH 3FO9A 2VUYA 3U0PB 5EC1B 4FFWD 3WHXA 1JZ3A 4DK6A 3TWCL 4Y89A 5IG7A 3SBWA 4G6JH 1B90A 5C0CA 1S9YA 4HFWB 3IU4H 1AXTH 2FRGP 3MZGB 4S1SH 1Y6MR 4JQIH 5SWSA 3V6ZB 2VZVA 4JPIA 5F7EH 3SE8L 4OCWL 4UBDC 3VFVA 1T22A 3O41B 3U0TA 2OK0H 4JO4L 5ADOH 5GGSY 2ED9A 4MHHI 4JRXD 2G2RB 1JNHB 4U1GB 1R3IL 1YN7A 4XI5C 5CP7B 5BOPA 2AK1H 4GKNB 3JTTB 2NZ9C 4YZFF 3VWKB 2OTWA 4H20L 1CE1H 1YY9D 4K71B 1XZ0B 3DVNA 2EO9A 3ULUD 3RA7L 4OZHE 3PWPE 4NQVA 3V5KB 3ECBA 2A6JB 3EYOB 3I9GH 4Y5XB 2R0WH 3QUZB 1UJ3C 3PNWA 5F1NA 5T1DH 1EVUA 5FV1L 3MOAH 4FMKA 4Y2DB 4RGNB 3WFZA 5KVGL 3BZ4B 1G7JB 4PG9A 4Z7VA 1SJHB 4HCRL 3SEPA 1S7UA 4M8QB 2EH7L 4Q97A 1MJ8H 4E41A 5KW9H 5I1GH 2AJUH 1G0YR 1OGAE 3CVHH 3QH3A 3RI5F 1G7PA 4MA1C 4F7CA 5JOFB 5SWQB 2YXFA 4EUPG 5I1AA 3TP4A 4ISVA 1FBIH 1QUNA 1Z0NA 1H3WM 3BQUA 5EH1A 4OGXL 5F6IB 4NQSB 3JWOH 3ZTJH 2B5IC 4X6FB 4KROC 1JNLH 5CJBA 4JKWA 4DUVA 4Z6AT 1QSEA 4FTVA 5FUCE 4MS8D 2MPAL 4KKNA 4UB0H 3D85A 3VWKA 1AHWA 4FZEH 4TVPH 1TVHA 1KPUA 1F4XL 1T89A 1EHLL 1N59B 4U6HA 4MNHA 3MX0A 4R96A 4L8CA 3HZYA 2HKHL 4MA7L 1A7OL 3C2AH 4GRMB 3CAFA 5FGBA 5C1MB 5C6TL 1JYXA 2X4QB 4JRXE 5B39A 5DGQA 3MV9A 1HHGA 4M7LT 1SQ2N 3N1QC 1MCOH 3QHFH 4ZFOB 3VXUA 5IMKA 2BJML 1JNNH 1KJ2A 2ARWA 5TJWK 2J8UF 4JZNB 2O5YL 4M9PA 3RL2A 5D5MB 4G8EA 3TO4A 1S8DA 5L7XH 3CH1A 2H26A 5IF0A 2IEPA 4MDIB 4P2QB 1JZ2A 1X5KA 5E8PA 5FEBA 4UIMA 3LDBC 1P1ZB 4XB8A 1BLNA 4P5KB 3S3PA 1YMME 4Z7QE 2H32A 5DQJB 4R4FH 4PYGA 4F7EB 2VXTH 3BKCL 4NC1E 5AG9A 4JZNA 2FYYA 1S8DB 5HDLA 5KVDL 5DO2C 3R0NA 1FSKB 4Y16D 3QUYB 5E7BA 4AYFA 4HBCL 3ZDYE 2Y7QA 5GRXG 3VGHA 4UAOB 2EO1A 3SDXB 2VAAB 3VXRD 1QFWL 5CP3A 3H9SE 3DX7B 3CVIL 4NT6A 5D9SB 3BT2H 4DN4H 2DBLL 4NO3B 3NFNB 4FRWA 2MQ3A 3WS3A 5HDBE 4ZFOL 1MJ7L 1TCMA 4JZOB 2HVKA 4PP1D 4U1KB 2GFBA 25C8L 3HMXL 4G42A 3TNMB 5IUSA 4Z7QF 3DRTB 3VXSA 4HS3A 1KJ2B 1YZZA 4OD1H 4W68A 4D9LH 1R3HB 4GUPB 2HRLA 5AWNH 4R3SA 4WNQB 2HJLA 5IQ7H 3HNSL 1LP9A 4UOJA 3KYAA 2VSDA 3GHBL 4G9FE 5HHOB 4W6WB 3NPZB 4KU1A 4X7DC 2YD3A 5DUML 3GJFH 5HJ3B 1BLNB 3T0EC 2I07A 4KI5E 5GGTH 4P46D 1XGYH 3GB7A 4QHLB 4OJFL 3RL1B 4K23L 4RIRB 3MV11 4OD3H 5JZ7C 2Y23A 5IV2A 3DSFL 3BZFA 4XHQA 1HI6B 3GGWB 2XG4A 3EIFA 2HWZL 5D96B 1Y6KR 3MOBL 3T3PE 4MS8C 4EBQL 1IQWH 2PYED 5J6HA 1OTTD 1UKSA 2OL3L 3BXNB 1SMAA 3DX7A 4PJGB 4JCLA 4NHUB 3OKYA 4KHXL 3RGVA 2X4TB 3U83A 4HWBA 1PVHA 2I9TA 3N1MC 2XZCH 4KWUA 1P4BL 4R4BA 1HI6A 3KXFE 3VG0L 4JDZB 1TPXB 5GSVA 1UACL 3TA3B 3QFDA 2HTKD 4NO2B 1U6AL 3O3AB 1E6OH 1OSPH 2APVA 3PP3H 1MCCA 3F7VB 1L7IH 4ELMB 1RJCA 3VJ6B 2Y06H 4FNLL 3B9DA 3NFPB 5D72H 2R4RL 3PGFH 2DM4A 3L95B 2CK2A 3BKML 4HQQH 4NHCH 5JA8B 5C3TA 4MNQE 2YEZB 2EDNA 1PGRB 4QXUH 3RTQA 2OL3A 4WHTA 4CVXA 4L9LA 2J3SA 3QFDB 5DRZA 3VFGH 4ZPVA 5F7LB 3KJ4B 5J8OA 4C57C 1OP3K 3LQMA 4BK4A 2ZPKH 1EFQA 5DO2D 3BOVA 1X5XA 2IAMB 3IKKA 5I6XC 1E28B 2XKSA 3FFCB 3WS3B 3OBAA 3THMH 4IIQC 1HINL 2VNCA 1WWAX 4Q58C 3DRQB 5EU4B 1ZGLB 2P24A 3QR2A 5K9QG 1DVFB 2XTLA 4X7TB 5F7DA 3P0VL 4F9PC 4PJIB 3VXMD 4EI5D 1OTUC 2Y5TA 4BFEA 3TLRA 3OZ9H 1SEQH 2VXUH 2R2CA 4JDZA 4RGOH 4GKSA 3H42L 4KDTA 5E08H 1D9KA 4I9WD 1J1OH 3HC0A 3GKWH 4U33A 4LAQL 3QPXL 3VWKC 1JZ6A 4L3CB 5IFHH 4RWYL 2GK0B 4ZG1A 2V5SA 1R0AH 4KQ3H 1Q9KA 2I27N 5C2UB 1QTYT 2IH3A 1TQBC 5EO9B 1GYAA 4ZUUA 2F54E 3WL9A 3TCLB 4EDXB 1MNUL 3NGBB 5FO8A 1IKNC 3LKPB 4LSSL 4X7CC 1BGXL 4Y4FD 4NKDA 3ARBB 1JPGA 4PJBF 5HPMB 1JRHH 5C0FA 3EO1B 2IANA 3KPPA 1CICC 4AT6B 4U1HB 3PV6B 3P11L 3QUXA 1MLCB 5TE4H 5ESVB 1V3MA 4IOIA 4U1SA 5FB8B 4K3GA 4Q2ZB 1CICB 5K9KA 1ERNA 2G60L 2W9LA 3QIBB 4KROD 1GJIA 4JVUA 4XVTL 4F7MA 2PXYC 4LKCA 4GBXB 1SEBA 1T1YA 3AU1B 1B2WL 1C12A 1GZPA 4HK0B 3DO7A 1R5WA 4HBQA 5DQ9B 1JBJA 5D96C 1AI1L 1HNFA 2YC1B 3FL7A 1FPTL 1KEML 1MCFA 1ONQB 2F15A 5F6HI 1EEYA 2ZNXA 1BFOB 3DX9B 1U58B 1ZTXL 3IDJA 5TDPA 5DJ2A 3MV7D 3FOMB 1JCKA 5C0GA 2OR9H 3C5ZA 3RTQD 4NHCL 5F21B 5TQ2L 1OM3L 2IMMA 2L0DA 3MV7A 1G6RH 2VUOA 1HHHA 1GCFA 5LG1A 3CLEH 1OSZA 3UPCA 3MRLA 4NGHH 5IK3B 1KT2B 3OJDB 3GJEB 1NC4D 3HE6C 5IFJA 3SKNA 1DANT 2NY5C 4JREC 3TCXA 4HCRA 5JPNA 5IBUG 4Y1AD 3MV8B 1VACA 3FOMA 3O41A 1T22B 1EEUA 2HLAB 3DXAD 3EO9H 1EPFA 1IGTB 1IAKB 3IRPX 4KKAD 4HXBL 1CU4L 2DB8A 2D2OA 5F97E 3VXQB 5CWSA 3VXRA 1CFQB 5H2BB 1MLBA 1AGCA 4KQ4L 4ZQKA 3WEXB 1I1FA 2YHGA 1TXKA 1W72A 2NY6C 3DROB 4XNMA 2A9MH 2X4RA 3IU3B 1CLOL 5L8JB 3WLWC 1FP5A 5DS8A 4QRPB 2X40A 4LP4A 5I1JL 3MA7A 1DUZA 4JQIL 1FVEB 2HT4D 2D0GA 3ZDXE 2P1YA 4P2RD 5TF1H 1NBQA 1GOFA 1CFSB 2V5YA 3HCVA 3B8SA 1INQB 4FQ1L 2ESVD 1JPTL 1TPXC 5EU6E 1WSST 2FIKA 2DYPB 1FO0H 4WU5A 5C3LD 2CIIA 1HCVA 3OMZA 1OF2A 5IHLB 4L4TB 3JV4B 4WEBH 4OUUA 2B20A 3MR9A 4LVHB 1TZGH 4WWKB 5DJ0A 4XWGH 1LEGA 1IGMH 1NEZA 1N0LA 2ITCA 1QG3A 2G2RA 2H1PL 1GHFL 4OZGB 4PRPE 2RCSL 4F57L 4CVZA 3PWVA 2ADFL 4ONFL 1FVDB 3F12A 3RHWF 1EJOL 4L8BA 2XZAL 5IB5B 5JW4R 1W72B 3DROA 3QWQB 1HDMA 4LSVH 4YBLC 1O5DT 3RGVD 4HKJA 4NC0B 3HPLA 5CLTA 1KCUH 3I50L 4UIKH 1UKTA 5I73C 4D0CA 4EUPB 1FPTH 1T1ZA 5C0EA 5FYLD 2DF3A 3CNKA 1ORSA 1KIRB 4Y16A 4HHAA 2N1KA 3UTTA 1TNMA 1OCWL 3V4VH 1UWGL 1QSZA 1JPFB 4P2OA 1MSPA 4S1DC 3QQ3B 2YUVA 5IOPB 1MVUA 4IRJA 3SPVA 2CDFB 4KROB 5EIIA 5I9QC 1FFPA 2J8UB 5BV7L 1RZ7H 1MI5D 5IFJB 4OCRH 4EI6A 1HHIB 1U2HA 4G8FA 4XMLL 5BVJB 3P9WB 1T2QH 1UJ3A 4NGHL 4JM4H 3D18B 2WBJD 2BOBB 3SDDA 4ODTL 3MGTB 5C0DA 1IAIL 1MCEA 1XGQA 4JFDA 2OTPA 1MHPL 2R8SH 3V79C 3U2SB 1SBSH 1WBYA 3TN0C 3GIVA 3DVGB 3BISA 2YWYA 3BUTA 1FFNB 4LNVA 3VFUB 3MBXH 4M48L 1NFDE 2EDBA 1RMFH 5J1AA 1UJ3B 4ZNEE 3RDTA 2ZCLH 3WFDL 2B0SH 2JELL 4HKJB 4GW5B 4Q9RL 1H5BB 1J5OH 1DEEB 1S9XA 4TOYH 4Z7WA 5EBLB 5DJXB 1MCWW 5B39B 2WM0A 2V9TA 2V17L 3GIVB 1CGVA 4K23H 4QY8A 4MD4A 4M5YH 1BZ7B 2FZ3A 1A6AA 5DTFA 4EN3D 2P49B 3I3DA 3UJJL 1A0QL 2ILLA 3HE7D 2Z31D 5DMJB 4L8SB 5BVJA 2OJZL 5DXWA 4HKBB 3RA7H 3VXUD 4OTXH 4HIIB 1RURH 3P9MA 4B5EA 3UJIL 2IPKB 2X05A 1RFDL 3TO4C 2NX5E 3QZWA 1I8LC 3NGBC 3UAJC 1NAML 4LLDA 2X9WA 4PJ8B 2DBLH 2EH7H 3RVXC 4LSRL 4TPRH 3T3ME 4YE4L 1GC1C 4X0KA 4M6NL 3T8XA 3R1GL 4K7PY 1NPUA 3RVUC 2FR4A 2BVPB 5TH2B 3D25A 3KG5A 4I9WE 2PYEA 4GRWF 3E0GA 1DUYB 1MQ8A 4WO4D 1XH3A 1U8NB 5J1SC 1G9MC 2WQRA 4NN7B 3GMOB 5DQJA 3M1BB 1FYTA 3MLVH 1IEBA 3CVHB 2LTQC 2O5XH 3FQTB 4L3ED 2DS4A 3GSRA 4WY7L 2OSLA 4PJ5A 5HXMA 4R2GD 2NY4B 5DJDB 5DZLA 5FYLH 5GS0L 3NCBB 4OJFH 4X9FA 5CGYC 3ZDYF 5ADOL 2ZG2A 5TFSL 4OCRL 3D25B 4IRJD 1X7QB 5EU5B 1DN2A 2QR0B 3MUJA 1NFIA 3THML 4HV8B 4U6YB 5DMIL 4R90L 3A6BL 5JDSB 4QNPE 1D9KD 3D87B 2B8OT 4U1NB 2FCBA 7FABH 2X70B 2ZJSL 2FGZA 3VJ6A 4NNYB 1S7WA 3M17A 4PJHB 4XBPA 2W0FA 4WHDA 4JKPL 4Z8FH 4ZUSA 4HH9A 4P2QA 1CLZH 2UWEF 4GAJH 2UUDH 4FQHB 1KJ2H 3QA3B 4N5EC 5JO5A 4ERSH 4JRYD 4ODWA 1CZ8H 1UCBL 4OZIB 4XP9H 1F97A 3AC0A 4FG6D 4P49A 5L8KB 5I74C 1OP3H 4NHUA 1DLHA 5EBMA 2X4TA 1MCJA 4R4ND 1BQSA 3VMNA 2ZCKH 3M1BA 3AB0B 2OS7A 3BI9X 4N0YH 4XX1G 4TSBH 3W9DA 5CKAA 3O2WH 4BUHA 3U7WH 3EW3B 5IV2B 2VMFA 5BO1H 4MNQD 1KULA 1KGCE 2VLKA 3DMMC 3UZEA 5FECA 1S7QA 1ZLSH 4OTXL 4WUUA 3V7AE 1MOEA 3G5VB 4C54A 5A16A 2EYRB 2HYMA 1NDMA 4F7EA 3IJYA 3RVTD 2BOCA 3QIUA 3NACH 3HE6A 4GMSL 2NY7H 4PP2A 4XH2B 4X5XA 3L3HB 3DV6A 4HC1A 25C8H 1R3KB 1A9BA 1EGJH 3NA4A 2J2ZA 4NP4L 2RR3A 5FOBA 1EZVY 5T3XD 4L29B 5AWNL 3KR3H 2QV2A 3GBNL 3GMMA 5CJXA 2HMID 2BVQA 4K3DH 2I60L 5E2UL 5IJKA 5FA4A 2VLJE 1UQSB 1OM3H 3B8YA 4F7PA 1NANI 3L3HA 1QBLL 5FB8A 5SWZE 3QZWG 4ZO7A 2APBA 1ZHLB 4H26A 1UCTA 3PHQA 3SDXE 4L5FL 4M61B 1IEAB 3U0WH 1JHLH 3CD4A 2X10A 1XF2B 2P5EA 5E9DA 4R4FL 4ZYKB 4UT9L 2XQBH 5DJ6A 1FNFA 4DCQA 3B3IB 1FSKC 4F37F 1CLYH 4G7YL 5EO1B 1S3KH 4UINL 1S9KC 3PJSB 3V95A 2QSCL 3O3EA 1FLRL 1I85C 3AFLA 3ZKXB 2BC4A 1T21A 2ATKA 1BBJB 2W9DH 1DBBH 1INDL 1ETZB 4Z7OE 4ZUTA 1XIWB 3TO4D 3GI9L 3MCG1 2XI9A 5HVGB 1K8IB 3SGKC 3EFFA 5B38A 3N0PB 5CD3B 4YO0A 3O9WC 3MACL 1TZIB 1BEYH 2R4RH 3ILQC 4LMQI 4F33B 2YWZA 1IMHC 1X5AA 5ANMB 1UB6B 3UP1A 4XRCA 2D7PA 3T77B 2WWKO 1J8HD 2O5ZH 3ARGC 5DUMH 4WI8A 1RZKL 3U7WL 2KDGA 4PD4J 4BK5A 2AW2A 4ZS6D 4HG4J 3IF1B 4NDMA 4HBCH 3IU3A 4ZXBC 2EYSB 1VEOA 5D7SL 5DJ6B 1J05A 4Z77A 4UUJA 1ZKAA 1JP5A 4NRZA 5DHYB 3HI6H 4QT5A 3GO1L 2GJZA 4AEHH 2GAZB 1CICA 5K9KB 1DQMH 2VR4A 1MJ7H 1PZ5B 2P5WD 1MCQA 3OG4B 1R24A 2GJ6B 4J3TA 5GISH 3ZO0A 1HYSD 3Q1SL 3WS6A 2ADGB 5BRZD 4EBQH 3GSNA 4GG6B 4LAJH 3T0WA 2DLFL 2HT3D 4L3CA 4TRPL 5I16B 5F3HB 4QRTB 2AJSL 5L2KB 1I85A 5LXGL 4QOKD 1GXEA 4D3CH 3MLYH 4Y19D 1AP2B 3IXAA 2J6EH 3INUH 4HJ0C 3RAJH 5C0JA 2IMNA 4X99A 4ZUUB 1G1CA 3EOTL 4KY1L 3BIAX 5FGSA 1U8JB 3WL9B 3BZDA 2Z35B 1KPVA 4AMKL 1REIA 4N1HB 1OTTC 2R0ZH 5IM7A 5C0BB 3RJDA 4WCYL 3FZUD 4CVZB 3BO8A 3QFJA 4Q9BA 3HNVH 4UDTB 3BP5A 1MWAA 3H9HB 5HYSA 5D7LB 2X1QA 3W0WD 1QQDB 3IFPB 3RZCD 4WTZA 1UYWH 4CU6A 4NDMB 1AQKH 1JGLH 1K2DA 1CFTB 3L5WA 3VFTB 1MCDA 3P4MB 3LV3A 2KPNA 2WAHA 1II4E 1TMCB 2FSEB 2VIRB 4OZGE 1FE8L 5A1AA 2ZSWB 1F2QA 2YD5A 3AREC 3LD8B 2J8HA 4MB3A 3Q0HA 1HOCA 4P4KB 1WZKA 3LHPL 4HUWB 4PRHD 2DQJH 3QEQE 1UACH 2W0PA 5BRZA 3AAZB 3HUJA 3FB6A 4X83A 5C0CB 2FLRT 4Q0XH 3PV6A 4I0PC 3O4LB 3W39A 2NY3C 3IT8D 3RWHB 1ACZA 1LK2A 5HVFB 3CVHL 4NQUA 4LLUB 3W82A 3SDDD 3SDDC 2IBZY 5T1LA 3T4AB 3HFMH 5D72L 5JNYB 1VGEL 3STBA 4HWNA 2NY3B 3P77A 4RBPK 3JWOL 4B7IA 3PWJA 3SCMB 4H88H 3QFJB 1IC4H 1NGYB 2Q86B 1KEGL 3SGJC 2L4OA 5JXEA 2C3VB 4ORZC 5GRJL 4HAGA 4JPWL 3SKNB 1KSRA 3D85D 4PG2A 2Y9RT 5FV2A 4M7ZB 4BJLA 4DVRH 5T1LB 1LP9E 2Y5EA 2NQCA 1FL3A 5FDYA 4TNVK 3WLWD 3QDGE 4LKXA 2AI0L 3MGOB 4MCYB 5EZJA 1RK0A 2Z31C 1IM9B 1CFQA 5H2BA 4M6OL 5I18L 1JTOA 2XYCA 4ZXBB 4IDJL 4YDKL 3LRSB 4OQ1A 3G9AB 1A9EA 1CU4H 2EICA 4LCWB 4MD4B 4XNZC 1YC7A 1RIUL 1YY8B 2KZ1B 1KJMA 2WANA 3RWGA 1W72H 4PIRF 1ZGLP 2DMBA 3AY4A 3TGXA 4MJ5B 1U93A 3V7MA 2Z8RA 4RWYH 1T5XB 2ZSVA 1P69B 1Q1JL 4YHYB 5E70A 3UO1H 2WBWB 1EXUB 1XAUA 5ESAB 3FQUA 4WENB 3RUGE 5IOPA 1MEXL 4FABL 2IBBA 5KAQG 2YSSA 4CU7A 1ZVSB 2QQLL 4X8JA 4LLDB 3LY6A 1OTSC 4P57A 5FYJD 3D1MC 2GSGB 4WUUE 4P9ML 4CNIA 1NEZB 4JPKL 2BVYA 4BYHA 5AZEH 3FJTA 5E7FA 5ICXA 4FG6C 1SY6A 2IQAB 1RVFH 1PD6A 2NXZC 2P5ED 2BVUA 3BH9B 1I7TA 4OAWB 4OF3A 1B4RA 4M7LH 5GZOC 1YEGH 3S3JA 3SHSA 1DBMH 4GAJL 3S96A 3KYKL 5F7YC 3JWNC 1CG9A 4PV8A 5FF6B 3U36A 4HWEL 1S9WB 2EC9U 3BKJL 2KKQA 1T5WA 3VD5A 4GW5A 1PAMA 1NAMB 2HA1A 3EHBD 1NBVL 2EKSB 4Q9QH 1NFDF 2PO6A 1A3LL 2K3TA 4RRPG 4D2NA 1UB5B 1NQBA 1UM4L 3H3PL 5C2BL 2WZPD 4PRPD 5TGBB 1MRDH 4U6VL 2O5XL 3OKOB 4WY7H 1RZ7L 4I8DA 4HUVB 3MNWA 5I8KH 1N6QL 4MCYA 5IHZB 1X6LA 4B41A 2VERN 4D0CB 1YEDB 2DQCL 4PFEA 4O00A 1E6JH 1MCPL 2WUBH 1FHGA 4Y4FA 5IB4B 3MLXH 4OKVB 1NCDH 2XY1A 3X3FL 3S5LA 2PTTB 2N56A 4ZFOA 1IQWL 1QHOA 4C56E 3S4SG 3RU8L 4G9FA 1GGUA 5BV7C 1GZQA 2BDNL 2IQ9L 3PNWB 2JF1A 3QQ4B 5JIHA 2R1WB 1U8HA 2WLZA 3CLFL 2XWJA 2NXYC 4N90E 2P5WA 3S97C 1CLZL 1L0QA 2HJLB 1YNLL 4YFLI 3U7AA 2ICES 4Q9RH 5DSCA 5GGRB 3C09B 3IFOB 2FL5A 4XHJD 3BWAB 2UY6A 5JORB 5CP3H 2GCYB 4XP6L 2BFVL 2BNUB 4EVNA 1G84A 4ZUSB 5C6PB 3VFUA 1KCUL 5KANG 3HZVB 1MFEH 4M5YL 3E8UL 1R5IA 1A1MB 3STLB 1NC4A 2D7OA 1MI5A 4XAWL 1ORQA 3DBXA 2N7AA 4DUWA 1TZGL 4RFNB 3BDYH 3VFMA 1U3YA 1JF6A 4QEGA 5AZEL 3VXNB 1XR8A 3W0WB 1WWCA 2VYRE 4HWBH 4JN2A 1H3UA 5MENB 3DMMD 2G5BB 5MEOB 2D7TH 4TNVF 5JTWA 1F90H 2HLFD 4HXAH 1WTGT 3MSPA 4DZ8A 5F9AC 4NN6C 1NAMH 1X5LA 1QSEE 1I9EA 3IYLW 3MV01 1E27A 2IALA 4LHJB 4PGZA 1QSFE 3GMPB 4PGDB 3RDTD 1HN1A 4QTHA 3JXAA 4LPXA 1MCSA 4NP4H 2G5BA 3VFWA 4K3HA 3H3BC 5CGTA 4G3YH 2WBJC 2ICWI 3MRNA 4MX7A 5ANME 5F88A 2P7TA 3V0VB 4PJ8A 4WUKH 4Y8DC 2J5LB 5BJTA 1BWWA 2CH8A 4XNQA 3BPOB 3DXAB 2QQNL 4YGAB 4UIMB 3T0ED 1K6QL 1U92B 2AP2A 1NJ9A 3GUTB 2F54B 1TVBA 3QNXB 4MXQC 4WWID 4KJYB 1P4LA 3X14A 1N6QH 3BESR 5HYQA 1WBZB 3C8KB 5DMIH 2Q76A 3W0WA 1D3CA 3LPGA 4BFGA 4QXTA 3DO3A 4PJ7A 2IWGA 3BRGC 2HP4A 4MVBD 3SJVE 4JFYB 2DKUA 4ZAKC 1YEEH 1S3KL 4UINH 3IFLL 2Z93B 3MLSH 5IJVA 3UZQA 1S5HB 2NW2B 1CXKA 2BNRA 3BP4A 4J6RL 3I75B 3TH2T 1ZANH 2YPLB 2HVJB 4LFHD 4NPYA 2BNRD 1AR1D 3V5DA 4ERSL 1BAFL 5IFAH 2F9BT 3EDJA 3AS2A 4H8WL 5LCVL 3A6OA 5JDSA 4QXTB 4XP9L 2ZUQC 5ISZA 3NN8B 2WP3T 4JKLA 4M4PA 5I8CA 3DX6B 4LCUB 4ZD3H 4ENED 3IDUA 5FO9A 1BBJA 1ZLUH 2R2HA 2VTFA 1YNKH 2YPLA 3VFOA 4JFQA 2ADGA 4Y1AE 2CXKA 2DBJA 1LE9B 5DK0A 4LCIH 1M4KA 1CXEA 2OJZH 1P6AB 4NKMB 1NCWH 5B38B 1UZ6F 5MI0C 4DCQB 1JWSB 5JXED 3CFEB 3CX5J 2CDGA 3A67H 1RFDH 1I8MB 2Q7YA 4JRYA 5E6IC 3ARQA 3W2DH 4L8SC 2BNQD 1JYNA 3KLDA 1F3DH 1VFAB 2YK1L 1C08A 3MJ9A 1Y6NR 5E8EA 4Q0XL 3SQOH 1CFVH 5DVLA 3O4LE 3GHEH 3NCEB 4NZTH 1J0IA 1RHFA 4FZ8L 5J6HB 2W1NA 3QDMA 1QNZL 3SGKA 1DQJA 1O7SA 4LCCC 3HFML 1ZWIA 3BPLC 1H8SA 4GAFB 3QSKB 1QACA 2DWEB 4H1LA 4NN5C 3OKMB 1MFAL 3DUUA 5I1KL 1NKRA 5DC4B 4JGJA 5KSBF 3PUCA 3EGSA 4JFZH 3IS1X 5ETUA 3B6SA 3CMOL 4G43B 4NBZB 1HOCB 4FQLL 4P4KA 1HH6B 4RAHA 1QA9A 2EEDA 4MNQA 2PKDA 3CZFA 2XACC 4JG1L 4FQPA 1TJIH 3GJEA 4UT9H 5HD8C 1FC1A 2MQ0A 3MYJA 4JHBA 4DKEL 5CJOH 4TSAL 1LWRA 3CFEA 4YX2H 2OL3B 3WE6B 1J1XH 3B5TA 3TFKC 5LAXA 2YUWA 1KJ3H 1NGWB 1QBAA 5FO8B 5LWYL 4WWKC 3CC5B 2GK2A 3OQ3B 4JKPH 1EA9C 1EBPA 4M61A 5D2LF 4K8RH 2JJTC 3PWJB 1VEMA 3CSYA 3O9WB 3RWFA 1FRGL 1H3PL 4HF5H 1Q9OB 4J23A 5KS9A 4OZIE 1MLCA 4Y5VC 5AUMA 3NA9L 4YHML 5LCVH 1IAOA 2MNUA 4I3RL 3QWRD 4UDUB 4MCZA 4XP1H 3ARVA 3I50H 4UIKL 3G08B 1U8KA 3RGVC 2D7NA 1JWUB 3J8F7 4EOWL 5SWZA 1AO7B 3K81A 4YBLB 2ARJB 2X9XA 2MCPH 3B2UC 4I77H 3KLHC 2E7MA 4HIJA 4HUNB 4MMXC 4RX4A 4K3DL 4Y4HB 4NKOA 1NGZA 3BGMB 3NCJH 4H88L 1VCAA 8FABA 2ZUYA 1VFBB 2HTLC 3KPRB 1KTLA 5T33L 1EAPA 1DBJL 1K2DB 3UPAA 5D93C 1FIGL 3V4UH 4NO0A 4QRRB 1T5XA 2ZSVB 5T1KA 1I1AD 2OQJB 5ERWA 3G6AB 2DMCA 4GXVH 2HG5B 1X9QA 4CMMB 5I8OL 3TJEL 4X7FC 5CILH 4F9LC 5FKAA 4XP5H 2BRQA 4LU5L 5ESVA 5IGXH 5BZWA 1ND0A 4YBHA 1VA9A 4BFIA 3SGDH 1L9MA 3SE4A 4C55A 1AXSB 3IGAB 2R0LL 1IARB 2ZP0T 4F58H 4I1NB 5KSBB 2VXSH 1J5OL 4N0CC 3EOBA 1OGAA 3M45A 1RY7B 1U0QA 2V17H 2EXWC 3FB8B 1NFKA 4WCYH 5F7FA 4MNGA 3GSNB 1GRWA 5DFTA 3KLSA 2CDFA 3ZYIA 4B7LA 1XGPA 4RMSA 3RIAF 2QADD 2CMRL 3D3VB 4LPTA 1A0QH 1BFOA 3DX9A 4HLZH 4GG6F 2O61A 2KUTA 4YXHH 1F58L 3T0BA 1BIIA 1A7PL 2DKSA 4P9MH 1S7XB 3EJYC 3SGJA 3VXOA 4IRSA 1U95B 4LK4A 3MGOA 5EZJB 4LPUA 3SKOB 5I15L 2EKSA 2Q3AA 4YX2L 5ACZA 2R23A 5JPMA 3GM0A 1RZJC 1FFNA 3OKEB 4LRIA 3ISWA 4GSDL 5TE6H 4JO1L 4NZRH 3RIFF 3OB0H 1MY7A 1OP5K 2AEPH 2E6PA 3ARFD 3EYVB 2FEDD 2ED8A 4JFPB 4LHUG 1AH1A 1WISA 4HX1A 5CKGA 1RJZA 3G6JA 4QHKJ 4HKZA 4YE4H 1ZSDA 1ORSB 2AQ2A 2VDRH 4Y16B 5C0BE 5JNYA 4YXKL 3RX5A 1M6OA 4GQ9H 4X6DB 2XXCB 3LN4B 1H5BA 3BH9A 3S8WA 3ULVF 1C5BH 2RAMA 2CGRL 4XCYA 5D70L 1Q0YH 2ICCA 5CINH 5KTEH 2AJSH 2G75A 3VWJB 3HMXA 5IVZA 4N0UB 1A7QH 1FG2A 4AEIL 1KEGH 1UC6A 2DJSA 4WO4B 2A77L 1FNHA 2R29L 3CDFA 2QTEA 1A7RL 1OY3B 1UT9A 4HUKB 3FAXA 3MLTB 5DGRA 2LU4A 3REWB 5BQ7B 4X9IA 3T4YA 2DQUH 5EO0A 3NIFF 3DPBA 4LPVA 2DQCH 3A6CH 4XZUB 1V7ML 2H2PD 3F58L 3HE7B 1EIBA 3FHQA 1A7BA 1AQDA 2Z0BA 3IVKB 3RWGB 2W9EL 4C56B 4ETQB 3U36B 1GGTA 2C1PB 4OLVL 3IJSB 2DLFH 4MXWL 4RAUB 3QXDA 3SDAD 4W6XB 5D1QA 4H5SA 1QFWM 2BDNH 2AVGA 3VXSD 2VL5A 4QHNB 1LHZA 5ALCL 2GSIA 5DI8A 4YH6A 4YC2B 5HSFA 3FFDB 4DGIL 1TZHA 1CZ8L 1UCBH 3S3SA 2XKNA 1ZLWH 5GS2H 2VB5A 4NFCA 4IDLA 2HKFL 4FFVD 2ESVB 4U6XB 1N5AB 4NKQB 2ADIA 3SCMD 2M26A 4PJ5B 2NLJA 4H5SB 2YMXL 5IB2A 1XF3A 2V5RA 3EYOA 4K2UL 1MPAH 3MRMA 4O9HH 3VU2A 4RDQG 4YXHL 4GRWE 2CJUH 4UV7L 1C16A 3NABH 2APXA 3DYPA 2GCYA 1SY6H 2EDHA 3ALXA 1MFCL 2IAMC 3QQ9C 1P5VA 5E4EB 1KTRL 1UH2A 3BKYH 1DP0A 1YEHL 3V2AR 3QUZC 4OGYH 3LB6D 4JFDE 1WWBX 2Z92A 1B3JA 3VW3H 3T0EA 1U8HB 1QBBA 3QPQC 3BFOA 1AGDA 4P2QD 4PJIF 1JGDB 3QAZC 1T2XA 5F7HA 5EWIH 2Y7QB 3K4AA 1QFPA 1NBYA 5KSAC 1NAKH 1ZT7B 4D0DB 4LEOB 3RHWK 5J12C 3BWAA 4APQB 1WT5A 4RWHA 4M8VA 1HSAA 5M95B 3K2UH 4CU8A 5ID0A 2VLKE 4GW4A 3SQBA 3FO0L 5FYJH 5HI4D 3BEVB 4LCIL 1FORL 4BH7B 4AJ0A 3O6FB 4FXKB 1JGDA 4ODSH 1NFDA 5DZOA 1PYWB 3FZUC 5DURB 2IF7A 1XF3B 5F72S 3MFGB 1U91B 4BQ9A 3PG2A 1ZHKB 4L9LC 5HHOA 4FFVC 4UT6H 3VGBA 1G7MA 5IMLA 4LCWD 1IAIM 2DQUL 1MIEH 3G5VA 1U3HA 1AQDB 4KRLB 4ZTOL 4MX7B 5DD5L 4O58L 1S5IL 2FBOJ 2VLRA 1BOGB 3NN8A 1YPZF 4NZJA 5GJSL 4PGJA 3VXUB 2RFXA 4YAQB 5EA0H 4MQTB 4PLOB 5DWUH 5FKPB 1X4XA 3SJVB 5IVOA 4P2RA 5JQ6L 2WUCL 4ZFGL 4P5MA 5CZVH 4Q6IC 1T20A 3SY0A 2DTSA 1PG7X 4ESKA 4UU9B 3P4LA 5ITFB 2W9DL 4MQSB 3RTQC 1DBBL 4BSJA 1VESA 2VQ1B 4MXQD 4EZMA 3WO4C 1N4XL 2BNUA 1TNNA 4WJ5B 3RKDD 1U8LB 2BVQB 4N8CL 1JFQL 4NYLA 1PX3A 1R3HA 4YXLL 1ITBB 4KI5F 1YEKL 3NFSH 1HE7A 5E8OA 3S88L 4UQ3B 4JFDD 3KJ6H 4UQ2B 4AH2A 1UXWA 3QEQA 5EOQL 5FDWA 3CFKA 3WHE1 4JFEA 4E42A 3OKNB 1A1OB 2EDFA 5MERB 3GUTA 1VGKB 1NSNL 5I1IL 2MOVA 1IJ9A 4EKXA 2CO7B 4CVWA 4OZHA 1T1XA 5C08E 5FO7A 5DMKA 5F7MC 4LEXH 1PW3A 4LCUA 3U46B 1NCWL 3LS5H 5D2NA 4G8EB 1ZV5A 1Z9OA 5KZCD 1X7QA 4NIKB 3TZVD 4ALAL 4HS3B 3KYKH 3HZKB 1RK1B 2HT3C 3RTQB 3WFHA 1H3PH 1CDGA 2JLLA 4QTHB 4Z7NF 2R56H 4PV9A 3OAZH 3EYUH 1AGBB 4A2MA 2BNQB 2W92A 3I75A 2BY0A 1KNOA 1J0YA 1U8IB 3WD5L 1KN4H 5J12B 2OP4L 1Q94B 3BIKB 3K80A 1D5MA 5CJ8A 1Z5LB 5I1DB 4OIBA 1UQSA 1AD9B 5HI5C 3BH8B 2VDPH 5F88B 3QDHA 1H15A 1M71A 3V5HB 4YEFA 5L2KE 5LXGH 3OAYK 2H3NA 3WFEL 4D3CL 3EJYD 4G3YL 1T03H 4J3VA 2XWTA 2PR4H 3D9AL 3WIFB 2D0FA 2ZUSA 4MZ2A 1LQSR 1NCBL 4OM1L 3ARYA 4XRCB 1ZHKA 3GMNB 1L6XA 1DQJB 1T04B 1P7QB 3C08H 4NT6B 4OV6F 3HNVL 3ET9F 5T33H 1N64L 4JFZL 5D8JH 5I1DA 4AIZA 5MP6L 1J1PH 4JREB 2B4CC 3O6KL 1R3JB 4FQLH 1EO8H 5EU3A 4N8PA 1SM3L 2WUBL 3WNNA 2MKWA 5E5MB 1I7ZA 3MFFA 3ULUF 3DI2B 2XTJC 4U4BA 1G0DA 5CILL 4ZPVB 4NN7C 5CBAA 3CCHB 5GRZA 4TTGA 1LO5A 4BZYA 1KC5H 3UBXB 5IHUH 1IC5H 1YMMB 4XP4L 5DJAB 1IEAA 4NN5B 4PJFB 4XNYH 2P43B 4K7PL 1A7NH 1U8OB 4G6ML 5F7KC 2ZUVA 2D7TL 2HT4C 3S37X 1NGZB 3BGMA 2PW2A 1Q72H 3BP7B 4LLWA 4YHKL 5INDB 4ELMA 1D5MB 5IFAL 3O3DA 1ZA6B 5D71L 5EO1A 1GVIA 1FYHB 1LGVA 3C60D 1K8DA 3BZFB 4UQ2A 4I3SL 4AH2B 5IHBA 3BMVA 3VXMA 1WUNT 2XWTB 2PXYB 1FZKB 4L9LB 5FUZH 3H9SB 5GGUB 1WGOA 4HG4K 3KJ6L 3O4OB 5HYSB 3GSNH 1MFDH 5KS9B 1KTKE 3QDJE 1QQDA 5FYKH 4PREB 4P23D 4Z76A 5BMFL 2X89A 5FA3B 1MHEB 3P0YH 2Q7YB 3DMMA 4U1LB 3HZKA 4Y5XC 1AO7A 4M62H 4AL8L 5D2LE 4LGPB 3BDBA 3SDYL 2UWEB 1JRHI 4MWFB 4QRSA 4KVCH 3TV3L 1WBXB 1SVCP 3GJFK 2EDWA 1I1AB 3L3JB 3QO0A 3UJTH 5E95B 1G9MH 4HW6A 3HNTH 2BERA 4HC1L 4YGVB 5HPOA 3ARWA 1JMXA 4S10A 1CVSC 2V2TB 4Q2ZA 3WFBH 3E6HA 4ZFZB 5C0RH 2FIRT 1CBVL 3FN9A 3ZTNH 3ARFC 5HVHC 4IIQB 1URLA 1WBXA 1M05A 4OZGF 3MREB 5ICYA 1NGPL 5DMYA 1K4CA 3ARZA 5FYLE 1JPSL 4GRWH 2QQNH 1ZEAH 1L7TL 1S7TA 3MJ8B 3O6FD 4OM1H 4BFIB 1F4AA 3DV4A 4F80A 4LPYA 3H0TB 3FHAA 4O2FA 3EDDA 1Z6JT 4X6CB 3LQAH 4XPTL 4K71C 3KHQA 1J8HB 4XT1C 4OUOA 4YHPA 2X4UA 4HSQA 3TBYB 2BCKA 3GI8H 5ALBL 1OGAB 3L3OA 1K4CB 1GGIH 3HC0B 3ZKQD 4JRYE 4M7KL 3CX2A 1YUHB 5D4QA 1CDJA 4NO5A 1R3IH 3GRWA 3LH2L 3FQRA 5F3BA 4Y16C 3OXSA 3OR7B 1BBDH 2ZOLA 4OF7A 3LPWA 2BXZA 3U6RB 2K7PA 5CD5C 2IH3B 1ND0B 1RZKC 1MREL 1OWRM 4JHWL 3RUGA 1R5VB 3QT2A 1EEYB 5LQBH 3F62A 4DVBB 1P84K 4X4YA 1JPFA 4M00A 4Z0BH 3UCRA 4YEEA 3UX9B 3LV3B 5HYJD 3TF7C 1YQ2A 4MJIB 4JG0H 5SX4I 4BUGA 4XXCA 1BVKB 3K1KC 3H3KA 4F2MA 1QNZH 4GXUM 4AT6A 5BS0D 3RY6A 4GW1B 4XZUA 2ZOKA 2A73B 5JR1L 3ZKNC 1UADC 3IDMB 1KN2H 4ZUVA 3DIFA 3LD8C 1FH5H 4JPVL 3ARFA 3AAZA 5CINL 1RZ8A 5KTEL 3BRDA 1ZSDB 4PRAB 5IBTL 1MRDL 5FXCH 1I1YB 3NCJL 3QISA 5EOCH 3I85A 2A6DB 3ILPA 3WO4B 4PRIE 3MRKA 1E6JL 2G75B 3VWJA 3N1FC 3MR9B 4PGBA 2NY1D 4JG1H 3GNML 3ROOB 1HWHB 1KCRH 4RGMB 5CEZE 4MVBC 4DKEH 2E7HA 4MDJB 1JF1B 4IMKA 4MJ5A 5FAAA 1RZGB 4M6AA 1RJZB 4NKIH 4PG9B 1CGXA 4JFFA 2ZSWA 3H42H 4QY8B 2Q6WB 3P4OA 2HTKC 5BV7B 2H8PB 3WN5A 1FRGH 2OLDA 3BGAA 3ZTNL 5C86A 1CI5A 2D31A 2UZYB 2P5EE 4JZJC 4Y8AA 3JV4A 5E9DE 1BQHB 3GSVA 4MLSA 5KVFL 4ZODA 2V7NB 1L7TH 4QRRE 1EX0A 1J8KA 4HUVA 4X6FA 5ESQA 3VD9A 1MIEL 2YMXH 3QQ3A 4FQCL 4ODHH 3PV7A 1QRND 2ZCHL 1FN4A 2YD6A 1MHCB 1OAKL 1Q38A 1S9YB 4W4OC 3OKEA 2XA8L 1QSFD 5I15H 4DAGH 1XF4A 2CLVA 2E6QA 3TC9A 4RSVA 5GHWH 4KAQL 4YDVB 1N7MH 2V9QA 3AXLA 1HZHL 3B9AA 3HAEH 3DGGB 3M8OH 1BM3H 4HF5L 3P2TA 1WAAF 1GSMA 4XWOC 1FN4B 1KIRA 1N2RB 5LQBL 2ED7A 1VPOL 1A9EB 3C5SA 1FYTB 3BJ91 4MMZC 4XP1L 2XFXA 3MRBB 3RWJA 2V7HB 2CKBH 5IVZB 2DWDB 1BX2B 2CGRH 2D03H 4XI5D 5L2KD 2BRRL 2FBJL 3AROA 1AHWB 3D39D 1PKOA 2X41A 3B2VH 4ZTPH 1KPUB 1X4YA 3PDOA 4U7KA 4EI6B 3HMXH 5CCKL 2QR0A 2R9HD 4X0KB 1LDPL 4I0PA 3MRFA 2NTFA 4KH2A 4Y0GA 1NBYB 4U3HA 2H32B 5D1XB 1KACB 5ICZA 4Z0XA 3LPFA 4YHNB 3C5ZD 5ITFA 3ARBC 3IU4L 4ZDHB 1JGVL 1KXTB 1X5GA 5HYIA 3ARDB 1CD1B 4ZNEA 1C1EL 3TVMA 1XGYL 5GS1C 15C8H 2X89D 1Q9WB 4C59B 2VXVH 3NPSB 2DQGL 5LGJA 2B5IB 4JCMA 3U0PA 3MNWB 2ERJC 3DETD 1V05A 3MLTA 4IRJB 3NFNA 1G7JA 2YN3A 1FZOB 4KK8D 4JO1H 1WJ3A 2B4CL 5K93A 3SBWC 3VRLF 1FZMA 4JM2F 5DD1H 4KRPD 4LOUC 1HSBA 4WO4C 1I4FB 4HMDA 4PUBH 4R3SB 1HEZB 4WNQA 4RGNE 1NAMA 1W0VA 1NGQH 3IXTB 5HDBF 5HY9B 2QQKH 3NFSL 2I26N 2Q8BH 3IDGA 5D70H 3FQNB 3RZCC 1BD2B 5I1GL 1N5YH 1A6ZB 1FL6A 5C71A 1U6AH 4BZ1H 1ZVHA 4YHNA 2H2SC 4GH7B 3BIKA 2Z31B 4MB4A 2C1OA 1I8IB 5I1CH 5EBMB 1D5ZA 3HTLX 1CGSH 3A0OA 1RAMA 3PGFL 5C09B 4QGYA 2ZUQB 4UQ3A 5JIPA 2DL2A 4JFYA 4WI3A 2RFXB 3QNYB 5TDNB 2WBJA 4IJ3C 1WCQA 4QXUL 5D7KE 1A21A 4JANA 4BZ2H 3DYOA 3WV0A 1KXVC 4NPYB 3QWOA 2XFXB 3PGDB 1BQLL 5GQBA 3KDMA 1BZ7A 2E7BA 1S7WB 4KUZL 1QD0A 5KOVC 4XBPB 5FYJU 4ZAKB 1R3JA 4BM7A 3VD4A 4Y1AA 2PCPA 2Q8AH 4OLVH 2FJGB 2UY7A 5F9DC 2F53A 4LVEA 1Q9LB 1WICA 4POYA 3P0VH 1VHPA 2BRRH 1KFAH 1UM6H 5FYJL 4NCC2 4NN6B 1CTNA 4AM0A 5HGDA 5E6ZA 4G8GD 4KUCD 5ENWB 3LKNB 1G7MB 3MRPA 4KRPC 4NZDA 5HYJB 2GITA 5I2IA 4HGKC 1RU9H 3P9LB 3NCYP 4M62L 4EJ1C 2AGJH 4XMLH 1AD0B 4UT6L 5DQDH 4P2QE 1A1MA 3STLA 3ES6B 1V8HA 2YUZA 5E2TL 1OAUL 5EFIB 3QDME 4P2RB 1I8MA 1J10A 4TULH 4XC1L 4U05A 2FX7H 5E2VL 2PXYA 1UXSB 3LKSB 3VXNA 5BZDA 2WUCH 3HLAA 5F7WC 3X14B 5GGQL 4J12A 5ALCH 2P24B 1TTGA 3CUPA 3QIUB 3NFPA 3RNKA 1RQ5A 1MUJA 2VLLA 1ZA3A 3PJSA 4NQDD 4CKVX 1WFOA 2MQCA 4LASL 5EU7E 4GRLA 4PPTA 5HY9A 4XAKE 4YUEL 1H3XA 3WXVH 2UWEA 5F9WC 4MD5A 2JCCB 4DJMA 4RFNC 1KB5B 2PW1B 3CXHK 1IBGL 4JFXB 3KYMB 4K3JL 1NC2D 4L4VE 2KQMA 4KZEL 3KPQB 2FO4B 3RGVB 1OW0C 5E8NA 1NLDH 4PRIA 2VWEC 3P9LA 4ZMAT 3DRQA 5EU4A 1DQQA 1GGCH 3S34L 1VFAA 4Y5YA 3D48R 1FVCA 4KDTC 1JYVA 2XN9A 3QRGH 3ULSB 4P5TC 5E8OB 4M43H 2W91A 3KYOB 4OZIA 5T1KD 4I0PD 3JTSA 1YMMA 2X5PA 5I30H 1OVZA 3ARGB 1E4JA 1OAZH 2Q76B 3ULUE 3HI1A 4Z7OF 4ZO6A 4NKMA 3WD5H 3NZHL 5EIQA 2OJEA 5EA0L 5T1LD 3QIBA 4I4WA 4PJGA 1WZ1H 4O2FB 3DHMA 4ZFFB 2F8VA 1JI1A 2PYEE 3KVQA 1JUFA 2NX5A 1OP9A 2BNRB 4K55A 3LQZB 2NY0B 3SDAA 4G7VH 3L3KB 3FT4A 1PKQA 1JN6A 5I19H 3DURA 3L3JA 4F58L 1UH3A 4JO3L 1IAMA 1IGCH 1H8NA 3H9SA 5C08B 4DUXA 5EDXA 1LILA 3KPPB 2JCCA 1I1FB 4XNMB 1U3ZA 1NGPH 3OPZH 4JDTL 2HJFB 4N8CH 5GZND 4S1SL 3WFCL 4X7TA 5F7DB 5F8RC 4FFZL 3SE8H 4TQEH 2E7LA 4X4ZA 3BH8A 3C5ZB 2P8MB 1R5VA 5I8EB 4FQJH 1DQQB 4C4KO 4OLUH 5TF1L 2ADJB 3NCMA 4R7NB 1PSKH 3LKQA 4QRSB 1E4XH 3OJDA 4LDEB 4HK0A 5C8JA 1XCTA 4J7RA 3ZHDA 1R5WB 3RWHA 4WEBL 4Z8FL 3CPLB 2ORBL 5EZOL 2VLLB 2WIMA 4NOFA 4YHPB 3QIWD 3HI5H 1B0RA 1G6RA 5IVXE 2AEQH 1IGML 3PHQB 1ZLUK 4LLMB 1QBMH 1RPQA 2GJJA 2EYTA 1Y18B 4F3FA 3PWVB 1QLEH 1ZAGA 3TIEB 2W60A 3PWNA 5J3HC 1T83A 1YEKH 2ENSA 4OLEA 2ZOLB 5DJAA 3B3IA 5C0IB 3F7RA 1AIFA 5AEAA 1FGNH 3IXAB 4KRPB 5K33A 1UWEL 2PYFB 3QXVA 3O4LA 5KJRH 4HKXB 3AUVA 4NRYA 5TE7H 1J0JA 2DDQL 3JWDC 3OZ9L 5CLWA 3K46A 3O2WL 2A9NL 5EBGA 5KZCB 1T21B 2ATKB 3QUYD 3BO8B 1IAKA 3LKRA 1J18A 2QSTA 1ED3B 2CRZA 4LCWA 2GJ6A 5IT2H 1RULH 4NBXB 1IQDB 3AB0C 3ULUH 3RWDA 4ALAH 5EBWA 6CGTA 3DVIA 5IESH 5I71B 3OGOE 2CIKA 5C8JB 4FQIL 1BMGA 4YK4B 2Y72A 5GRWA 5L88H 3NZ8A 2XZQH 3HAEB 4IOFD 1RUAH 2FHBA 5FA3A 4MXWH 4KJWC 4DVBA 3BEWB 4PJAB 3G04B 3EBAA 1J0HA 4CBPA 2DIAA 1PG7W 1YEIH 4M4RA 2NXZB 2VKWA 4XPHH 5L8LB 3KLAA 3O45B 1KB9K 3RNQB 3QULA 4MDJA 4UUJB 4M7ZC 3I6LD 4N9GB 4DN3L 5FGCE 2VDQH 1ZEAL 5CIPB 3SGDI 4IRSB 5AAWA 2HJKA 4OCNC 1B2WH 3PDDA 1DN0B 3NIDF 4BQ6A 5DJ2B 1OAXL 1QR1A 4RA0C 1EHAA 3BD4A 5C0GB 3ZE2F 1MPAL 4HH8A 4RMUA 3LKRB 3SDAC 4ODHL 2ARJQ 1MFDL 2CJUL 4GRWB 4OLUL 2JK5A 3RIAK 3UTZA 2HT2D 3GRWL 3FQUB 3V6ZA 4UTAH 4OM0H 4DQOH 3MCLL 2R4SH 4MNGB 1ZHNB 5HHOD 1AE6L 2V7NA 5A2JH 1S7TB 3ETBF 4R2GB 3FFCD 4P59L 5C70A 1JPST 5J56B 1L6ZA 2FJFB 5ISZE 4LHUD 2EE9A 4P4KC 4MJIA 2MPAH 4ZO9A 3WHE0 4WHYG 4UDTA 4JFFB 5I1EL 4FZEL 4P2OB 2Q6WA 4WEUD 5D2NE 1BIHA 2XNAA 1V3LA 2CLRA 3RBSA 1FG2B 4QRQB 4PR5B 3VDBA 3QIWA 4I3GA 4QHKI 4K94H 3TBSA 4U2ZA 3L5WB 3QEHA 3NVQA 3HUJF 2NCMA 3T8XB 3IGAA 2F53D 1QFUL 2BVPA 4URTB 5KSBA 5FYKL 1FLTX 3O8XA 5I1CL 3DLQR 5BMFH 2A9NH 2IGFH 3I6GA 4J2XA 5FGRA 4NCDA 12E8H 3EFDL 3GMOA 5DK2B 5CGMA 3OB0K 3MLWH 1OP5H 4PRBA 1UZ8B 3E3QE 1RZGA 4H8WC 4K7FA 3VG9B 3LKOA 1LDSA 4WW2F 1J12A 2CR3A 4I0PB 1X5JA 3ARFB 4FQ1H 1OHQA 1U93B 2AXGB 1N8ZB 3Q1SH 5CBEB 4FXGB 5AYQA 3GMLA 3QXAB 1YEDA 3F7PC 3UTSE 5E5UB 2H8PA 3QHZL 4LMQE 3QO1A 2ATPA 3ILPB 2FGWL 4MGXA 1N2RA 1FVDA 3F12B 4X9BA 1NC2A 1ZT4A 3MUGA 5KVDH 5HHXL 4JPIB 3U4BL 3WO3B 1G9EA 2A0LC 4BQBA 2E9BA 1GHFH 4GW4B 4TNWF 4LARH 1K3IA 3CH8A 2X2YA 3BE1H