3WTXA

Crystal structure of the complex comprised of ets1(y329a), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
118
structure length
118
Chain Sequence
b'GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 18
structure length 118
sequence length 118
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3wtxA00
2IOMA 4L0YA 3IGKA 2J1WA 1TUPA 4LOFA 2J20A 4AGQA 1TSRA 4G82A 2BIMA 2ATAA 5BUAA 1HJBC 2MEJB 3ZMEA 1EANA 4IJTA 2J1YA 1E50A 3WTTA 2IOOA 4LOEA 3TS8A 1KZYA 1YCSA 2BIOA 2BIPA 4LO9A 3WTUA 2BINA 2X0WA 1EAOA 3WTWA 5AOKA 1T4WA 5AB9A 2J6WA 2J21A 4G83A 4GUQA 5AOLA 3KMDA 2VUKA 3US0A 3D08A 5ABAA 2XWCA 2IOIA 2OCJA 5AOJA 3KZ8A 4AGOA 4L0ZA 2PCXA 5AOIA 5G4MA 4IBWA 3EXJA 3D0AA 5G4NA 1H9DA 4AGNA 4A63A 3US1A 4QO1B 1LJMA 4MZIA 2J1ZA 1HJCA 3WTSA 4IBYA 4IBQA 5ECGA 2FEJA 4HJEA 5G4OA 3VD2A 4IBSA 4KVPA 2ADYA 4MZRA 3IGLA 1CMOA 4IBVA 2YBGA 1GZHA 4AGMA 4AGLA 5AOMA 5KBDA 4IBTA 5A7BA 3WTYA 3Q05A 1CO1A 2RMNA 3WTXA 2H1LM 4GUOA 3WTVA 3D07A 3VD0A 5LGYA 2AC0A 1GZHC 4IBZA 4IBUA 2BIQA 3WU1A 1UOLA 4XR8C 3D06A 2AHIA 4AGPA 3Q01A 1EAQA 2XWRA 2P52A 2X0UA 5LAPA 2GEQA 3EXLA 3QYMA 4L18A 2X0VA 2WGXA 3D09A 3VD1A 1IO4C 2J1XA 3QYNA 3D05A 3Q06A 1HU8A
chains in the Genus database with same CATH superfamily
1I8IA 2KLTA 1J0IA 3H2PA 3BN9D 3KLAA 3QIUB 3TIDA 2IANE 3ILPA 5IQNA 1BXUA 1F45A 3T0ED 2XYBA 1T83C 1FUNA 1TTGA 4ETQA 3ZIYA 4AKOA 1FVDB 1JNHB 5I1AA 2ZOWA 2CBTA 3MCYA 3ARVA 3BIKB 3ME0A 3S8FB 2CBMA 5KYUB 2J55A 2VLRD 3S37H 4CMHB 4LARL 2CHNA 4J3BA 4UIMA 1JZ3A 5ITFB 4GMTL 3GSVA 2EH8H 4A2MA 4R0LB 3V0VB 1CBJA 1D7FA 3QUYD 4F2EA 1UWEL 2ZKHH 3DBXB 4OGQC 2JCCF 4ZO9A 4GY4A 2FX7H 5JPMC 4F8NA 5ETUA 2VXQA 3EH5B 3DX4A 1CL7L 3ABZA 3STZB 2I9TA 2BMKA 2H8PB 2VW4A 2WP3O 3PGCB 4XCNA 4F91B 4KPHH 1ZS8B 3K2MC 4LMQI 3LQZB 4MXQD 1HSAA 1FV1B 2GKIA 2WMPB 5EFIB 4Y16D 3MLWH 4FQ1L 4NRXB 2Z91B 2ENYA 3EYVB 4MVBC 4W9JC 1BZ9B 1B0GA 3TBWA 3ZE0B 4E5XB 4HOZA 1DBBH 2CIKB 4CL7A 3V9EA 3T0BA 4U4BA 1CTOA 1YQ2A 1FL6A 3GK8H 3KWUA 4AGNA 2LW3A 2FBJL 2Q9OA 2AJVH 5D1XA 1C16B 2XPZA 4NNYA 3W57A 1QLEL 3BJ91 3QORB 1G43A 5C0AE 3DX7B 4X9BA 3HTLX 4ZOEA 43CAA 3WFHB 4X7DC 3AU1B 3HN3A 3QQ3A 3AXLB 1XV8A 2X1XR 1LO0L 2EIMB 3UDWC 2GSGB 4B5EA 3DHJA 2I9LA 3QQ4A 5D55A 1IUZA 5KBLA 4J1UB 1NSNH 2VXQH 4IBTA 5ILTH 1QSEE 3Q5TA 3B2PA 3BWSA 1H5BA 3IDYC 4WDIA 3CZFB 2R56L 1W0VA 3C8KA 2EDYA 1SY6L 2H0FA 4JFQA 4XE0A 3WXWL 3QQ9D 5GGRY 1C5CH 4OF3A 5GGTH 5CBEA 4HUUB 4OUUA 2HFEA 4FJZA 1EIBA 2A5UA 3FUDA 3PV6B 4WWOA 1JPSL 4GXVH 4NQDA 4PRAA 4FADA 3CDFA 3IFLH 3Q3GA 1QBAA 1TQUA 3ARQA 1IAOA 4AV5A 5DTFB 5PAZA 3RX7A 3IRPX 5I8EB 1UHVA 3MCKB 3QJUB 1TZ8A 2Z8WC 2WXIA 4FFZL 4PD4J 4BQBA 4TRPL 4A2FA 3CU1A 5IF0A 3PWPB 4AGQA 1RXLA 3ES6B 4JJHA 5E6SB 3WDHA 2WXNA 1CGXA 4TS6A 3VH8B 4NBZB 1P6FA 1S78D 3NEEA 4XBMA 4DHLA 5HGHA 2WHVA 3SE4A 1T7YA 2AJZB 4W93A 1JAEA 1KFAH 4O02A 4X6CA 3W9EB 4TLTA 3UZVA 1I9JH 2PPAA 2DBLL 1HOCB 1TVBA 2MCPL 5D9SA 4MXVE 4NPKA 5F7MC 1ECYA 2VDRL 4NQEB 5B22A 2NY5H 3ZW3A 5FGBA 2ADFH 3J07A 5ICZB 4U1NA 3RPKA 3CFMA 4YNYA 1E40A 1EERB 3OGCA 2F53D 3NSCA 5EU4A 2OSXA 3VI3F 1QHPA 2NYZA 2O6CA 3BEWA 1CQKA 1SLWA 3TT3L 1LMKA 5F7WC 2N7BA 4DKTA 2E9JA 3Q8CA 5ACZB 3O0RL 3VFGL 4EI6A 2BP5M 3RVWD 2A9CA 2AEIT 1UENA 1AZVA 3O8XC 4NQVA 1JWSA 1N0LB 1BF5A 3DDFA 3C6SA 5ICXB 2IG2L 4G71B 5E2VL 4W81A 1AS7A 5ALCH 4IU2A 1AY1L 5B1CA 4YE4L 4MZIA 3ESVF 1MELA 3V10A 2C9XA 2DQJL 4PJBB 3T65B 4NO0B 4LSSL 4LL1A 3SPCA 3FQ2A 4O02H 3DO3A 4PCSA 3K4ZA 1KELL 3EH3B 4NZRH 2K6ZA 2IQ9L 3H4HA 1AS6A 5IB2B 3ESOA 2D4FA 2K8MA 1ZMYA 3SDXF 3FO1A 3FMGL 1NFDF 2EKSA 2JKNA 3KYKH 1TFPA 2MQGA 5BXFB 3QEUB 3AWEA 3GUTA 3E6FA 4JQIA 1B9KA 1U8PA 1NGPH 4HKXB 4G8FB 2ATKA 3QXAB 1KCSH 1M9SA 2H1LM 2K6YA 2X42A 3HNVH 4N5UA 1YMHB 5D93B 1PY9A 1M9WA 1WC7B 4GEJA 3APMA 4QRPD 4Y4KA 3PREA 1K85A 4L29A 5C3IA 3P3SA 2WVTA 3RL1A 5GXBB 3U0TB 4MA8H 3FU3A 4HCIA 4I48A 3S5LB 5HHNA 2B1OA 2BCKA 3OG4B 2FWOA 2F0CA 4C55A 2LVEA 3MLXH 4DK6A 4RBPK 2H2SD 3H9HB 3C6EA 3IXTB 2OMUB 4J2QA 3UPAA 3HIZA 4Y4FC 4ALAH 3D6GA 4FG4A 2FX9H 1P7QA 2NSMA 1NFDE 1YN6B 4UNVA 4AK2A 4LEOA 1F3RB 3G5YB 2Q5BA 3OXRB 5CLYA 2B3RA 3D09A 3INUL 1BWWA 3SKOB 1SFHA 5MEOB 3IDXH 3W3BA 1NLBL 1MCIA 2FCBA 1DEEB 4I89A 4UAOB 2EIZA 3BCDA 1JPFA 1UCBH 3FO0L 3G5ZB 4Z77A 1EZUA 4LCWD 1TNMA 3HG0A 1S5IH 3HRZA 4XO9A 3UADA 2Q76A 3DIDA 5GZOA 1KLFB 3FL7A 1Z9PA 4XBGA 5DYOA 4E9YA 4YSEA 3L3HA 4KAQL 2PP7A 4R4FH 1S5HA 4HCRH 3S96B 3UYPA 2AEPL 4LLQA 1G7JA 4LPVA 5IW1B 2BRRH 1A6WL 1P1ZB 4X4YA 1JZHA 3L5JA 2XKSA 2TRHA 5DWUH 3IJEA 4A6YL 2ZX8A 2P1YA 3QFJE 1LD9A 4AYDC 2DJ4A 4M1DL 2FR4B 4PJ9C 4Y5VC 1I1AD 4LE8A 2F5BH 1S6NA 2O5ZH 2YPKB 3D87B 1E28B 2CIIB 5EU7E 1TZHB 2NY6C 4KO5A 4QRRD 4NAJA 3ZT6A 4DVRL 4FA6A 3RGVB 5MEQB 3KPMB 3MRJB 3IMWA 3Q1SH 2VXUL 3BP5A 1K8IB 4FQLH 1JGDA 7TAAA 4KMTL 4PJXE 1LEKB 4JDTL 4FFYL 3C87A 3DYPA 2B2XH 3GXMA 1INDH 2J1ZA 2ZUQB 3B83A 3FUFA 3VCLB 1XF3A 2CHZA 4ZMNA 1EDYA 4KOBA 3EBAA 1COBA 3M1CA 4WKZB 1GGCL 2J3SA 1IAIH 3L3OA 1NINA 3H42H 5J13C 5JHBA 4FQXC 4HX1B 5I6PA 3SOBL 1BBDH 2YK1H 1Z9SA 4IBSA 3O6MH 1WWCA 4IDJH 2PP9A 3TV3H 4N8PA 1KDJA 4K94C 4J3WA 1Q1PA 2CO7A 3VXPB 5EUKB 3WS6C 3WFBH 2DI9A 1DJIA 4WTZG 1BZQK 5GRUH 1Q90A 2G3MA 2VXTH 4JRXA 2Q7AA 2Z1PA 3ROLB 4F15C 3WY4A 5C0EA 2B39A 3MUY1 1BGXL 1E4XL 2F5AL 4RGNE 5ICYB 1X9RA 4HK0B 3QNYB 3OAUH 4KHXL 1MQKL 5E94A 2YSSB 3R1GL 3MCLL 4BUQA 1PJ9A 3PABB 4AJVA 7PAZA 2Y4SA 3L4VA 4MD5A 1NKRA 4JFUA 5IHWA 5IGXL 1LWHA 2VM3A 1SMOA 4NQCD 2ESVA 3FQRB 3MYZA 4FNLH 5HJGA 5TF1L 4LESA 2P8PB 2OSLA 1H0DB 2HLFD 3T2NL 5E8EB 2QV4A 1N9PA 2QTVA 3UTZA 4N4YB 2YMXL 1P84J 2VR4A 4RAUA 3OC8A 1OP5K 1NC2A 3ZE2E 4O9HL 2EDKA 2FIKB 3E80A 2Y36H 3CHPA 3LD8B 3L3IA 2R1WA 2VKXA 2E7LA 2K7PA 4XP5H 5EDXA 2F08A 2NRDA 5D7KD 2XY2A 2FJGA 5L7XL 4RSYA 2EYTA 3GMMB 1IX2A 2Q6WB 5BRZE 2Z31D 4MMXA 5FFOA 1W0YT 4I88A 4YSQA 4JO8A 3WOVA 3QDGA 1Y18A 2PXYA 2AK4B 4QRTB 3NRFA 1CT8B 4H4NA 4JJ5B 4OGAC 4P59L 4RMVA 3F12B 3M17A 2J21A 4P5SA 5TH2A 2C4FU 3MGOB 4ZO7A 4A67A 4EKJA 5DJAB 1YMMB 4CADA 1JGEB 4NC0B 4DIXA 2VR8A 4KDTA 3ZSTA 2FWUA 4NCC2 1JZJA 3CFBB 2K4WA 3QJQB 2IPUG 4WU7B 1TZAA 4NAQA 1SBSH 5AEAA 3ZDWA 3TEXA 5F0MB 3MOAL 1L6XA 5HI3C 4JFFE 5LBSA 2KBGA 4DN4H 3TPUA 2UY6A 5F9DC 5MERB 3V5KB 4NO2B 3OKKA 4A04A 5F8QC 2AEWA 3T2LA 3KYNA 5H8DA 2E47A 5BQDA 1ZVHA 3Q5YA 1MOEA 1ZWIA 2BVOA 3Q0HA 2ZXCA 1A7PH 2VM9A 4FFWD 5D1ZC 4FZ8H 1KY6A 1HINH 3O41B 3SEPA 2IQAA 2NDGA 2Y1VA 3H0TA 3QBTB 5C0JA 1IC4L 2BP0A 4GNKB 1CDGA 3PHOA 4BDVA 5LCVA 2BJML 2VZ3A 5AD0B 3BVXA 5BS0B 2VMCA 5DVMA 4MB4A 4Y19E 3BFQG 2A9NL 2B16A 3LV3B 4G7YL 2D4DA 2QQLH 3MMEB 3O3UN 1BHGA 4QAMB 2HT2D 3C60A 4PTUA 3LHPL 2K0RA 3V7MA 2BY1A 3QUZB 4W6YB 5LBSH 1XZ0A 3GZPA 4G70B 2VABB 2HX8A 2HJLB 3ZE0F 4JPWL 1MI5D 2AJUL 3IF1A 1E8YA 4IMKC 4YHNA 4JG1L 4FI7A 1ASOA 3EGDB 1A4AA 3WFZA 1ZGLB 3WFEH 2NUPB 2W38A 3ZKQD 2BSCA 4GAFB 3P11H 2NY2B 3BKJL 3BX7C 2RD0A 4LCIH 5I6KA 4X8CA 4KY2A 1T7WA 4JY5L 1II4E 4PVNA 4Z8FH 4XNAA 3N1PC 4QWWC 4LSTH 3QPQC 4Y1AE 1QZ1A 1BVOA 2X09A 3NAAH 1DBKL 1L9OA 3WDJA 3VYOA 3ZKXC 5T3XD 4MX7B 4NYLB 1W2KT 4LSPL 4WW1A 4WI3A 4PBDA 4XOAA 3NIFB 1QMUA 1S9XB 3AXHA 1VSCA 1JK9B 1G7IA 1Q9LB 2L3BA 3DVFA 1G4RA 4HWEL 2JKSA 4ZFQA 2AEQH 3L2MA 1F90L 2X70B 2R23B 5KJRH 5E03A 5JA8B 2RFXA 4HLZH 5F7FA 5J6GA 1M71A 4PJCA 3V6ZB 3T0EA 1WCBB 3NCMA 4CVZA 1FGNL 5FUCC 5AOKA 3BZEA 3TIEB 4P3WA 2X4RA 1MN4A 2D7TL 1H3XA 3JWOL 3QQDA 4N0YL 4CA4A 4DFHA 5EIIA 3HZYB 4X4ME 4X83A 1A3QA 1EDHA 1YPZB 2VLRA 4YEFA 3UYOD 2NTSP 4PJIF 5JOFA 1LXMA 1ODAA 4LLYB 4LPTA 2QMJA 5KSBF 1WWWX 4C47A 4ATTA 2J88H 2XIDA 3QUYA 2WNXA 1GHFH 1ZPLA 3UXFA 1AQKH 3QXVA 3NH7H 3BSHA 4MKTA 4KK9D 3D0AA 2BHUA 3COOA 2IDQA 5IFJA 2HWZH 1UXWA 5EBLA 2NXYC 1QR1B 4G59C 4N2FA 5I9QC 4R7DB 4HBQA 5I16A 4Y16A 1RK0B 3STBA 3N3EA 3VFRB 4FYQA 5EU5A 2HLAA 1QTYT 5EO0B 1RUAL 5D7HA 3CFNA 3L3DB 3LY6A 3LEXA 4HC1A 2JXMA 1M05B 2ZOKB 2E74C 1MW3A 2LAAA 4NWUL 5DSCA 4PGCA 2YKKA 4GXUN 1U91B 4KZEL 1A7QH 3RZCC 3GXPA 3GBML 4RFOL 5C9JB 2DQTH 4JPIA 4LLAA 4NUJB 3AT0A 5FYLH 5KVFL 4XC1H 1ZVSB 1IAIM 1PVHA 4UQ9A 4XVUC 5DJDA 3W5MA 4GRLB 3ZTNL 4PGBB 3FQNB 3I50H 4YPJA 5F1IB 3LN5B 3Q2VA 4C56B 4NRZB 5IV2B 5LG6A 3MKKA 4BFKA 5D4JA 3RWGA 2HN7B 5I1KL 3Q8FA 4JZJB 4X8GA 1UACL 1BYPA 1B4JH 5JDJA 2QLYA 1U30A 4NUGH 3VFVB 4D0DA 3FUHA 3RG1C 2Y3NA 2RQ8A 3LN9A 4POZC 3QG6B 1GTNA 4FKHA 4J4PC 3V6OE 3O81A 1SXZA 5FOBA 1K5NB 3UEZA 4HC1H 4GRWH 4WUUD 3D7PA 4JHWL 4N90D 4Y0GA 2DQCH 2C3WA 2Y6SD 3FB6B 3UPCA 1U33A 3E1ZA 2YIHA 5JZ7C 3NBNA 2OMWA 3KPLB 3ZMRA 3PP3K 4U1KB 1A21A 1E6JL 2DIAA 3JVFC 1U8JB 5L8JB 3HE7C 4LBEB 4NENA 5I8KH 2R4RH 4XCYB 1PMYA 5A6IA 3MLVH 4BQ9A 1QW9A 5ADPH 5I5IA 1AIFA 1JHKL 1R3LB 1CFSB 4NKIL 4WVRA 1H6EA 5IWLA 5FXCH 1FAIH 3G04B 4XAKE 5T1LD 3OKEB 2J8UB 4PMEA 3A67L 4YXLH 4WNJA 5D1QB 4MNQD 1CIDA 4ES8A 5AVVB 2I69A 5IIEA 2FGWH 4PJBE 2DTSA 3VMNA 3W11C 4H0GA 2A83A 3V8CA 4KKAD 5E9DD 3O4LE 1PAZA 3OZ9H 1UD8A 4XP1H 1TPXB 3NCYS 3ECVA 1MFVA 4WU5B 4I18B 3BWZA 3O2DH 4P2AA 1JPGA 1ND0A 5DD3L 1TTFA 4M4PA 3HKZA 4U2ZA 5C07B 2ZCHH 3VVWA 4MHHI 5F93C 4KI5C 4L5FH 1XO8A 5G55A 1QSFA 1SF5A 2F53A 3D85B 1MIMH 3BXNA 1SM3L 1JG9A 3PWUA 1L0PA 1MFDH 1XGRA 4HEPA 4J3UA 5JIPA 4DO6A 1TQCC 3AAZB 3VRLF 2KPWA 1Z32X 2JSFA 4IIQA 1AXTH 2UUDH 2PWGA 3ZDYF 35C8L 3OR7A 4I3GA 2APBA 4U49A 2H9GB 1AZNA 4AIEA 5EU6D 3DPBA 4PUBL 3LXBA 3T8XA 3GTVA 5FWQA 3S4SB 2C1OB 1IM9B 4YL9A 3KLSA 4PS4H 3EYSH 5GGVY 3FHAA 4N8CH 3SOTA 3QCUL 3CDGA 1I8KA 3NIGB 5T1KB 3IJ7A 2WB7A 1AGEB 2X4UB 4QNPF 4ZX4A 2CXKA 1LDPH 2N1TE 1NDMA 3OJDA 3SPVA 1OANA 4PLJC 4UQ3B 1PKQA 2P42B 3QJRB 4GLRI 3K8MA 4K3GA 3C5XA 4QRPA 1Q0YL 4ZQKA 3INOA 4PJFA 1Q94A 4JFPA 2AHIA 1RAMA 4MNHB 4E41D 5J11C 4IW4C 5DFVD 1MF2L 3BLKA 3X1FA 5JW4Q 2KHAA 4I0PB 1I8IB 3ZKMC 4XI5D 1NIEA 3N43F 4YJZL 3WLBA 3KCPB 3KLAB 3L5XH 3TIDB 3X13A 4KHTL 1N19A 3Q06A 4FG2A 3ILPB 1SFDA 1EJOH 5KVFE 3CLFH 4WKXA 4FTDA 4QXGH 3JQOB 4R4ND 5ENWA 5EUOE 1MCWW 3GSXA 4ETQB 5I1AB 4NAMA 2X9YA 3ME0B 2WXKA 1XCQA 2J5WA 1TO5A 1W91A 4I85A 1L0YA 4N22A 2ITEA 1I7RA 4UIMB 4H8WC 4U6VH 2X12A 2IIJA 1YCSA 4LCWA 5C0CD 2WQSA 1NCIA 4LSQL 1KXQE 1KN2H 3BE1H 5ETUB 3WUZA 1WD8A 5F9JA 3MV7E 2I9TB 1XX9C 2BMKB 2IMNA 5K9JH 3WN5A 4XCNB 3ARFC 5TGBA 3BUTA 1B6UA 1Q1JL 4MFHA 2DEXX 2WZ0A 3BT2H 4M6NH 1HSAB 4WO0A 1CE6A 1QAWA 4F7TA 5L8LB 4FQQA 1B0GB 2PWHA 3TBWB 5GS0C 1KXVC 1N68A 4MWFA 4EUPA 5PCYA 2X1WL 3QDHA 1CURA 4A2HA 1FL6B 4KXCA 4Z7OB 2DM7A 1QFOA 2VGLM 5D1XB 4NNYB 1I1AA 1GMIA 5IVZA 2Y5QA 2W8CA 1FZMA 4QRRA 43CAB 3PUCA 1OTUC 5DZOA 1KN4L 4L1TA 3BUBA 3QQ3B 3FQTA 4FC3E 3TA3B 5F8RC 3CFDA 4WI9A 2RB8A 3DGGA 2I9LB 3QQ4B 3RUGF 1OVZA 3NK4A 3T08A 1QI4A 4MYPA 2VZ1A 4N2OA 4AEFA 5IVXA 2PKDA 3KPNA 4WHTA 1BF8A 4KRNA 3S3PA 1OP3H 1H5BB 4WDIB 2HVBA 4CGTA 1QZNA 4PYGA 1W0VB 1DL7H 3LHAA 3KLHD 3C8KB 4JFQB 4PV9B 2BSDA 4I87A 4LCUA 4PLNC 1J8KA 3SQBA 3CIQA 4YHZH 3KGTA 2E86A 3ETTA 2F58L 3S36H 4FA8A 1NUGA 4XP4L 4EUPH 3D9AH 1AGCA 4OUUB 4RMSA 2HFEB 5CBEB 3GF8A 2CO3A 4WSJA 1UA6H 1P4UA 4Z7QE 4NQDB 3NZUA 3VX1A 3ULSA 4PRAB 3MBXL 3Q3GB 5EHFA 2BDNH 4N6RA 1C1EH 2AXFA 3S37X 3BUIA 1IAOB 4PGJA 1CICC 1DLFH 2ZPKL 3NVQA 3QCVL 4FERA 3RX9A 4JO3H 4OVVA 1M7DB 4NP4L 1WG3A 4Z95H 2A9BA 2Y7SA 4G80A 1NCTA 1CU4H 3I9GH 1WAAF 1N3NA 4PJAF 2BNUA 2ZX7A 5C0RL 2PPDA 4NO3A 1TYEB 3QIBD 5IF0B 1NPJA 4M8QA 4Z23A 1YMME 3IPFA 2F15A 2CCWA 2VR7A 1KYOK 4NQCA 3K8LA 5HGHB 2IFFL 5D4IA 2Z8VC 4O02B 4X6CB 3UZVB 3W0WD 1O7DC 5DGRA 3AU0A 4JFED 4G6AC 1TVBB 1AE6L 2OMZA 5D9SB 3WTTA 3QRFM 4JL1A 3FCGA 4MCMA 1AHWC 3O2VH 3WXVH 2XN9D 4U1NB 3MGTA 4YNYB 1BWMA 5EU4B 5TE7H 3F5WA 3TEYA 3BEWB 3GXTA 4XWOC 5CR1A 1L7IL 1QR4A 4HF5H 4EBQL 2Z31A 4EI6B 1FBIL 4B97A 5ELIA 2BFGA 3DTXA 4NQVB 1JWSB 4JFHE 1VPOH 2NXZB 2EDTA 3C6SB 1DQTA 4AC4A 5B39B 5JIHA 1NC4D 4IU2B 4DKFH 1FORH 5FYJE 2RR3A 4NGHL 3NIFF 3LXAA 3MODH 5CINL 5GZNC 5EIQA 2EVHA 4UDUA 4ZMQA 1RJLA 3FO1B 3TXAA 2EKSB 4LVHC 3GUTB 1MREH 1NMBL 4NQQA 3FT2A 4PU2A 3ZTJH 2X6AA 5HDLA 2IADA 2ATKB 2V9UA 2YOAA 4P2OC 4KXZI 1CO1A 3QJFB 2ZAGA 3V4PH 3ABMB 4DEPC 4Y4KB 3VXMD 4L29B 3RL1B 2GI0A 2ZWNA 1JCVA 3SYQA 1OPGL 3F7YA 4FQPA 4PS7A 4WV1C 4CNIA 4I48B 5F7AA 5HHNB 2F1BA 2BCKB 2E4TA 4TUJA 2FWOB 1VF5C 3BVTA 5I0XA 4KZDH 1GYAA 2Q8BH 3S3BB 1XGUA 3LPPA 1FDLH 3GFUA 5K9QG 2CUHA 5H4ZA 1EA9C 3ZLQC 5BZZA 1HS6A 1NBVH 7FABH 4YSSA 2YQ2A 1MI5A 2JMRA 1LMIA 3FULA 4E9SA 2GPZA 2EIZB 1JPFB 1WYJA 4FQIH 4Z77B 1S3RA 3ZL4L 4V33A 3LQMA 3HRZB 1UKTA 3QG7L 4M1CD 1G7QA 3LIZH 2Q76B 3NZSA 3H56A 4XBGB 1YPZE 5DYOB 1U3YA 4MB5A 1OM3H 2XZAH 3L3HB 1I9IL 1EHXA 1KIPA 3MLSH 1S5HB 3UYPB 4LLQB 1G7JB 5BUAA 5LNGA 1E4WH 3S37L 4X4YB 3IRZA 3TYGL 1MY7A 3IJEB 2EH8L 4ONGH 4N86A 1N70A 1XXDC 1LD9B 4G8IA 3TTYA 4WFHE 3CWGA 4RFEA 5D1ZI 15C8L 2YD9A 3GIZH 1AKJD 4P46C 2BOBA 3KPQA 1A3RH 2YWYA 2VC2H 1GGYA 4W4OA 4XNUH 3BYYA 3BP5B 4XNMA 4FN0A 5CKGA 5DO8A 2ENPA 2NY3C 5DQJA 5KJ7E 3V0IA 3QEHA 4BSVA 1B3IA 3NGBB 4WWNA 5EN3A 5G4MA 3RJQB 2YSTA 2AJVL 2AJ3A 3S8WA 2AXJA 4ZPVA 1GA2A 1XF3B 5J1AA 1N64H 1ZTXH 4GQ9H 1KNOA 4HJ1A 4C56E 2JK5A 2QL1A 5DUPH 3L3OB 2Y69B 3MA7A 2QGEA 1J5CA 5T33H 3KCWA 2WP3T 3PQYB 1Z9SB 5GRJL 1QRKA 1DUZA 4PRDA 5J3HC 2R15A 2C9VA 2ODIA 3CK0H 4HUVA 4V2BA 1RERA 4ZS7H 2B77A 2J8UF 3KEHA 4GOSA 5T3XH 4PGEA 1CLOL 1CN4A 1HHKA 2CO7B 2ICEC 4L9DA 3IGLA 2VXQL 5FFGA 1KWKA 4MRCA 5EF3A 3PP4L 1FNLA 2OLDA 3O6KL 2JIXD 4JM4L 4Z7NE 3T0DA 1WUZA 2H5UA 1ZTMA 1F4XL 1THCA 1C5CL 2KYIA 1X5IA 3FKUS 3MUHL 5E94B 1OARH 2D0FA 2AC0A 5CEXA 1DANU 1L7TL 2HTKC 1D6EA 3KE0A 5DK3A 4HT1L 5CD5D 4U3CA 4J28A 2ED8A 4KO9A 2EEFA 3MVSA 4MD5B 1AKPA 1J8RA 1IRAY 2OQJA 5FYKU 1KBBA 5KAQG 2V5TA 3D4GA 2R4SH 3VTAA 1WEJH 3BWAA 4UU9A 2ESVB 3CXDL 3VE0A 1RKRA 1UFUA 4X50A 2WKOF 2OSLB 5DDHA 1WHOA 2DQUH 4N0RA 4P4RA 3GJFA 3UTZB 3CC1A 3S2AA 1EO8L 1GZQA 4RWYL 1OW0A 3ZTDC 4HJUA 4HA1A 1G9HA 2AQSA 4RAUB 1NC2B 4PI2A 3ZHLA 2N0KA 1MWAL 1ZHNA 3QGVA 3L3IB 2R1WB 3B2VH 3HW7A 2G5BA 4XMVA 5DVNA 5IFAH 3N1QC 4WUUA 4DETA 5DJYA 2FJGB 4JAMA 2EYTB 2LLGA 3CVIL 2MNWA 4Q0XL 1OM9A 4PVLA 2OFQA 4MMXB 5F7YC 1GGIH 1U41A 3DOIA 4NLHA 2HPTA 1NMCB 3VXQA 1I9JL 4ZUWA 3L4UA 1E50A 3QDGB 1Y18B 3U25A 2DLTA 2PXYB 1IE5A 4UOW0 4JW3A 4ISVA 3M17B 3FPYA 5TH2B 4FHKA 4NPYA 4YHOH 1T1XA 2Q3ZA 2YXMA 5CGYD 5T1LA 4CADB 3M7FB 1MHPL 1YY9D 2J6WA 3BQVA 3BVWA 3UIYA 5FA4A 4DWHA 3K6NA 3GJFH 4MNQA 1LTXA 5I6NA 3TPUB 2UY6B 4AI7A 4XVJH 4IRJB 4LHUD 1P1VA 3T6WA 5LXGH 2JELL 1GAFH 5E6IC 3OKKB 4YWGL 5E9DA 1EO5A 1AMXA 3KYNB 3P40A 2DL2A 2O5YL 2FH6A 4B9GA 1ILUA 1XL4A 1ZWIB 1I7UB 2BVOB 4K9EC 4DCQA 4OLYL 1CDUA 1TR7A 3B7TA 1UH4A 4O02L 4X5QA 4OJEH 1XR8A 4OAWB 3EBHA 3GNML 3NSDA 1IEBA 2IQAB 3H0TB 3CAFA 3NIGE 1V7MH 3HB3B 3OBAA 1WSST 2BP0B 4NDMA 3KNBA 1O7SA 3PHOB 4RISL 4XPTL 4BDVB 1MFBH 3KYKL 5EB9A 3HG2A 1AANA 1KCKA 3WHXA 4IDLA 2NY0C 2EO9A 2IWKA 2YBGA 3B9KD 3GDCA 3MFGB 1NGPL 5E2TH 2WZAA 1KC5H 3FCSA 4YZFF 3C60B 4PTUB 3HZVA 1R3KB 1TITA 4Q6YA 2F7OA 1I7TA 3H7BA 3B9DA 3UGXA 1A14L 43C9A 3SDAD 1XZ0B 2A73A 3DGDA 2ZYHA 3QEQD 3OZLA 3PCYA 5CO1A 1MRFH 3W9DA 5L4FA 4HISA 4WWID 4AM0Q 4BE6A 1JDCA 3IF1B 5JYLA 1J9QA 2YPVA 4YHNB 1XBRA 2NNAB 3MLXL 1OAZL 4G6KH 4L8SA 5EU6A 3DVNA 3QUKA 5FWRA 4Q9RL 4Z7OF 3QDME 2HKAA 4GMSL 4MB3A 4C58B 3DRQA 3UERA 4F7PA 1N4XL 3WFCH 1FI8C 1A6PA 1SJXA 1VFAA 1M2OA 1RVFH 5G5DA 3FUKA 3HAEG 3IYLW 4NXKA 5I1CL 1I31A 4JQIL 4A7QA 4PJ8D 1WZ1H 4R9HA 1UCBL 4LASH 3GLZA 2EQDA 2WINA 3IDNA 4ADIA 3ZDZE 4LAQH 4WW1B 4ZPTA 3ULUD 2NY4C 1DSFH 4E41A 1ULVA 3D33A 3LQAH 1YJDH 4ZOCA 2R0WH 3A6BL 1PDKA 1G7IB 4L4JA 1Q9WA 3UTSD 1AQDB 1AOHA 4JRWA 4Z7OE 5AAPA 1KTBA 3D50A 1IFGA 2RFXB 4OZIA 5D1XE 5IK3A 1ZOXA 4ZW7A 1M71B 4PJCB 5J6GB 4MJID 1GS8A 1S7SA 1WQVT 3QRGH 4KKLC 3T0EB 4CVZB 3HI6H 1HSBA 2BIPA 2EKJA 3BZEB 1G1KA 1N8OE 3BYTA 5LBVA 2X4RB 5E4IA 3ULVD 1JRHH 2Y2WA 3QQDB 4DGUA 1CDHA 5EIIB 3H53A 5KYYB 1IQDA 3TESA 1JI1A 2F5BL 2B8OT 4JDZA 5F6HJ 4P4KC 2VLRB 4N2BA 5ACLA 5MEND 5JOFB 3B1TA 3QFDA 4BV1A 1T4KA 4CN1A 5C0CA 3QUYB 2HRLA 1VKXA 3BZ5A 3PY9A 3HS8A 2G75A 1PZUB 1YG9A 4XCCH 5IFJB 1UXWB 5EBLB 2AZAA 1N0XL 2WTOA 3CVHH 4J2XA 1KF9B 2C3HA 5JPNC 4UQEA 4GP8B 5I16B 4LCCA 2WAHA 4Y16B 3RI5F 3LMJL 2N7SA 4NJAL 5EU5B 2HLAB 5FC9A 2VLKD 3RNQA 4D7BA 3LEXB 2JXMB 4G1EA 3IXAA 4GRWB 4LGRB 4LVOC 3PGDA 1OT1A 4NQDE 2FEJA 3AWFA 4NNXA 4NZTL 3RIAK 5DSCB 4PGCB 4PCKA 1KGIA 4FQJL 3UC0L 4JPIB 2HTLC 3VD7A 2V2XA 3PDOA 2J4WH 1WIPA 2WLMA 3N9GH 2AJSH 5DJDB 4H13C 5K59E 3SGJA 4B9YA 2W5PA 3I3EA 3KGUA 1E90A 4CUCA 3PAZA 2IEPA 5K9QI 3RWGB 1NANI 2MOGA 3ARGD 1QLFA 4OB5H 4H88H 3UJJH 2PO6D 1PLGH 1IVTA 3ILEA 4D0DB 3H55A 1FCCA 5BV7B 3CHOA 3AY4C 3K6DA 3IU4H 3BPLB 3OV6A 1NIFA 3WSQH 2XC8A 3NSYA 5FOBB 4X6CE 3D25A 3KLQA 1OCWL 4MJ5A 3F58H 1IBGL 2GITA 4FNLL 4FZEL 4KY1H 1TOXA 3WNKA 1O5PA 3V4VL 2EP6A 2OMWB 1LL1A 4G9DA 2IDUA 3VWKD 1R3HA 4NENB 4GIOA 4N3UA 4CVUA 4BM7A 4TNWF 1QABA 2OX5A 1AIFB 2XWJA 4N2AA 2L8AA 1BQLH 4MDJA 2YXWA 1I8LC 1M3JA 2PYFA 1ZV2A 1KB3A 3RAJH 5LNEA 4DPRA 3GKZA 2MEJB 1Z5HA 3QIBA 1CF8H 2OR8A 4F33A 2WO4A 3AQYA 1WZAA 4KTEH 1WHPA 5IIEB 4N1CA 4P9HH 1J05A 5B21A 2Y1AA 3FO9A 2A83B 3BZFA 2CA4A 3WNLA 5JIQA 4NIYE 4M6MH 3WKMH 1YEJL 5K1NA 2EDQA 2R0ZH 4Q8BA 5KG9A 2WJ7A 1JPGB 1ND0B 4M43H 2W0LA 4X6BA 4XMKL 5C3TA 3BD3A 3W0WA 3QARA 4JFEA 3KG5A 3JZYA 3LYRA 4PSPA 2N4IA 2R69A 1R19A 2IOIA 3G6AA 1R34A 3RKDC 1YYLL 1FSKB 5HPOA 5TE6H 2XN9A 1QSFB 3Q2NA 5IKCA 1N5YH 2F53B 3KGSA 4L4TD 4Q97A 3EHBD 5FCUL 2YZ1A 3BXNB 3PNRB 3BUPA 3WENA 2Z4TA 3PWUB 2CZNA 4HG4K 1XGRB 4ENZA 3AW5A 4Y2DC 1BFSA 3ZRSA 1ACYL 3QUMH 1UA7A 3IFPA 3NFPA 4FZ8L 2VO8A 4IIQB 3BPCA 1QRNE 1NGXA 4RMRA 1KLUA 2DBJA 1NC4A 3OR7B 4HJ0D 3NPZB 5JOPE 1XGTA 1JXKA 2RJMA 3VXNA 3DPBB 1N67A 3T8XB 4KGLA 5CFHA 1SZNA 4JHVA 2C4FT 5HYJE 2QPDB 3U1SH 5LBSL 2VZUA 1T66D 2R69H 3D39D 3TYFA 3CDGB 1I8KB 3NJJA 1JYWA 3AGVA 3WTVA 1UC6A 4HPYH 1RULH 1KTRL 1NDMB 3OJDB 4YGAB 1QA9A 4PW4A 3SPVB 3CLEH 1PKQB 1CXFA 2DYSB 4KKBD 2ZXEB 4XB8A 2JKTM 4YDIL 3WFEL 5HI5C 4QRPB 4R2GC 3VXMA 3P11L 1SN0A 3FT1A 1AD0A 1Q94B 4JFPB 1RUKL 4PJFB 4ZQKB 3I75A 1JF6A 3B3BA 5BO0D 3BPNC 1UJ3C 5LCVL 2WO3B 5JA9A 25C8H 5EBGA 2R7EA 3QZWG 3WLBB 5F7LB 5A2JH 3X13B 4TSCH 1GOHA 3NJNA 5TDNA 5ID1A 3BQUC 5A6LA 3NAAL 5D6DC 4P8QA 4Z7UF 2IGFL 1CDBA 1GOGA 5ENWB 4RESB 1JXGA 3GSXB 5FLVA 4FQHA 3R18A 5EU7C 4AX3A 3QWNA 2WCGA 1XCQB 1I9RL 4G82A 1BD2D 1QO3A 1OKEA 3BESR 4OD1H 2AEQL 1FC2D 3CMOH 2X4PA 4IGBD 4LCWB 1G0YR 3T71A 4F7EA 1XSJA 4NOBA 1MCOL 1XCWA 5F9JB 2AXHA 4OF7A 3V0JA 1GYCA 5TGBB 3K3QA 1A0QL 1CYXA 1NKOA 1UB6A 2YJLA 1YNTF 5IB4A 5L88L 1CE6B 3L8QA 3LNIA 1YYML 4F7TB 3GRWA 3FTYA 4RFNC 5EDSA 4FQQB 4FF9A 3QZOA 2H2PC 1Q9OA 4LSUH 4MWFB 4EUPB 5I1EL 5ITBL 1MJUL 3VNZA 4CVWA 2CJSA 3VDAA 1E5BA 3QI9C 4P48A 3ARBD 2WXOA 4JRXE 5F6HI 3KBFA 4XO4A 5KVEL 1I1AB 3V79C 4B41A 1LK2A 2J73A 5IVZB 2FO4A 1FZMB 2NY1D 2XTJC 3F62A 4QRRB 3SE3A 2NX5D 3U0WL 1OZTG 5FUZH 3AREC 1AKJA 4K8RD 1OL0A 2E7MA 2ZUTA 3FQTB 4PBVC 1RUMH 5H4YA 3CFDB 4Z0BH 4PB0L 3DGGB 4KVCH 4MCYA 4I0KA 5JOEA 4IM8A 4IKNA 3SCMD 5IVXB 5IJKC 3KPNB 5INDA 4WHTB 4OZFG 3QRBA 1AJ7H 5HXMA 3F6JA 1U0QA 4LBAA 1INQA 3UP1A 2LFEA 4AGMA 2ESVE 4LCUB 4UBDD 3SQBB 3GRWH 1H3GA 3C75A 2X6MA 4WENB 2DWYA 2NR6D 3QR2A 4AZ8A 1AGCB 3ZHFA 1NQBA 3NACL 1P6WA 4JCMA 3CV5A 3ARDC 5E9NA 2WBJD 2AEOA 4LEBA 3FHEA 3VD5A 3LZRA 3SGDI 3ULSB 1CTNA 2ITFA 1DE4A 4F1ZA 1QFWH 4GUPB 2JIXA 4EF3A 1F6LL 2FH8A 1E3FA 1NCAL 4N6RB 2AXFB 3HG1B 4ZAKD 3B37A 3JBG7 2KLRA 3NABL 5GISH 3W1ZA 1LWRA 2XVKA 3BMWA 2O5XH 1OAQH 1I85C 2DWEA 1FVEA 2XWTA 4M9OA 4G80B 3QDGE 4OD3L 4GAYA 1K6QH 1N3NB 2BNUB 4XBEH 3X3GL 4UOZA 2Z7YA 1JIBA 4NO3B 1UYWH 2MH4A 2CJUH 5HYSG 4R5XA 3JWNH 1G9MH 1ZANL 3HFML 4NQXA 2EE9A 4X80L 3MLVL 5AWNH 1ORSA 1USZA 4NQCB 1MVFA 1PX4A 4M61A 4PB9H 5IBTH 4CN6A 5I1LA 1W16A 1KGUA 4KXAA 1OE1A 5FW8A 1TQVA 4F3FA 2YXFA 4MAYD 1JERA 5HYIA 2DDQH 2Y7MA 3VGBA 2OMZB 2ZOOA 3FDWA 1CGTA 3B5GA 3AROA 2QELA 3L4YA 3LS5L 4S1RL 3ZMNA 5BV7L 3K6SA 3LX9A 5SX4H 3MGTB 5TDOA 1U6AL 3OMAB 3F5WB 4NKOA 3OZ9L 4L1LA 5DMIL 2XXCB 2VDMB 2EXWD 2Z31B 3SQRA 4AIOA 4F9LC 3OKMA 2CBQA 4TUKL 5E1AA 3ZSSA 4ODHL 5B3NA 4WY7L 3D08A 4KH2A 2GEEA 4BXSV 5F3HA 3BT0A 5DJZA 1M7IB 1DCEA 1TQSA 2B59A 4DAGH 3MRNA 1NM4A 4Z76A 2GHWB 3S36X 4IBWA 1IT9H 3D3VE 3DWTA 5C0AD 3BDBA 1ZDSA 3VGGA 5FEBA 3QZBA 4EOWH 3DPDA 2ZXGA 2HB0A 4I3RH 3EO9L 1R5WA 1RZ8A 4ZFGH 4UDUB 1RJLB 4LHUA 3S3CB 1CYWA 1MFAH 4R4BA 3IK2A 2LTQB 3EW3B 1BJ1H 4XMXA 2OTWA 3S5ZA 5LN4A 3FT2B 2FUTA 3DSFH 2IADB 1N6QL 5IROC 4K7PH 5I1IL 5FK9A 1DFBL 1JFQH 1RUQH 4J12A 4CMHC 3F7YB 2GIMA 1E2WA 3EYSL 3GS0A 4R0LC 4AH2A 4CNIB 5DQDL 3L1FA 4TUJB 4TULH 5KVEE 3B9KA 1XGUB 1BAFH 1GTFA 1JYXA 3IEAA 5SWQA 3KYOA 3IFNH 1LLAA 4L0PB 2X2HA 3M1OA 4H0LC 5GHWL 1UVQA 1LGVA 2OXGB 4ZX5A 5EG6C 3U46A 2K78A 4LT7A 4HKZA 3SDAA 1LO4L 4S10A 3QEQA 3U30B 4PIRF 4G6JL 5I5MA 2QADC 1MI5B 4M7JH 4OW6A 4F7MA 2EECA 2VC2B 3HPLA 4PJCE 4MB1A 2OR7A 4GRWF 4WTWA 3LEVH 1A64A 4DUWA 2G3ZA 4RNRA 5FOJA 2DW5A 1G7QB 1T0PB 4RRPM 2R1YA 5T3ZD 3LS4L 3VJ6A 1BEYH 2VLRE 1ZD6A 3BWUC 1KIPB 3HA0A 4N24A 1AO7D 1CLVA 3ABLB 4FNPA 1W6LA 1M1SA 4MVBD 1XH0A 4PJ8A 3NCJH 5CSGA 4WNSA 5I0YA 3O11A 4HXBL 3T2QA 3H8NA 4KXDA 4K23L 2XQYA 1SDAB 4G8IB 4ANKA 2BWDA 1IFRA 3LKOA 1KN2L 4UDTA 4GKLA 4DGIH 5I6XB 1BZEA 4PWFA 5I1DA 1L6PA 2EE3A 2YZ8A 4HFUL 4RFEB 1CDYA 2GAZA 2V37A 3H3PL 1S46A 2VZTA 3BT2L 1AZRA 4ZW8A 4D3CL 3SO5A 2BOBB 3U1QA 2X6BA 3KPQB 3D30A 3O3AA 3T3PF 4W9IC 3UTSA 1EAPA 2DH3A 2DB8A 4XNMB 2C1PB 3ATFA 5F0LB 4B9IA 2DTMH 4MJIA 2OS7A 3BOVA 1QKZL 1FNAA 3QEHB 4BSVB 1BBJA 4OV6F 4JQVC 2E7HA 1T7ZA 2AJ3B 1TG8A 4AQ8A 4ZPVB 5J1AB 3I6LD 8CGTA 1KNOB 5KS9E 3EJZC 2VR5A 1YO4A 1OEZW 1GJWA 1J18A 2JK5B 4M56A 5MENA 3MA7B 1SEBA 2FNWA 1DUZB 2X9ZA 3FQ1A 1SVBA 4QXVA 4HUVB 5DFAA 1Z2KA 3LZPA 4L3AA 4PGEB 4LGPB 5IBLC 3IGFA 1HHKB 5CJ5A 4ZNEA 5INCA 1RZKL 4DQOL 5BZDA 2VXVL 4TV3A 1T1WA 3UGUA 3FXIC 4XHJC 3HRPA 2CWRA 1H8OA 2CO2A 2FJHA 2E9IA 3B9AA 2VLKA 3LH2L 4PP1C 3V0WL 4FE9A 5IJCC 3UOAB 2AMGA 3B7UX 1CK0L 1VZIA 2QR0A 3S36L 1AG0A 3MUZ1 1FFQA 1UA6L 5CEXB 1BM7A 4Z7IA 5HHPA 3ULVH 1U3JA 1D6EB 2NDFA 3D07A 4ZUVA 3SDYL 4ZMTA 5CUSH 1EAJA 4JHAH 4JO4H 3SE9H 2OQJB 4FGMA 5KSAD 2NTFA 3U6RA 4PGZA 1D2OA 3EZJB 3BWAB 4UU9B 3G6DH 1DLFL 2DIBA 3VE0B 1LO3H 1KYOJ 3UJTH 5E0FA 3ARGA 5JHLL 5DDHB 4P4RB 4Z95L 1TVHA 1FPTH 5BO1L 2PO6A 3GJFB 4ZX6A 1GZQB 1QFWM 4R26L 4N0UA 4XVTL 3WY1A 1PZDA 1KSRA 1BFTA 2GVYA 5B3JF 4Q9QH 1RL1A 3JWDH 4DKAA 1IAMA 3BAKA 3NZ8A 4Q6IA 1ZHNB 4BK8A 1E9QA 2AVGA 2G5BB 4WUUB 5DJYB 2VDNB 1GIGL 1F0LA 1FHGA 3SODB 2I25N 3MNZA 4MS8C 3VXQB 4ZUWB 3VWKA 4OLWH 4NIKB 2F53E 3SKMA 5EZIL 4ISVB 3FNKA 2CRMA 3NSFA 4LOEA 5D93C 1WS8A 5JW5A 4NPYB 4CBZA 1P4IL 4HQQL 1T1XB 5T1LB 4JK0D 1Z9LA 4BH7A 2CPUA 3GBNH 1EAOA 1A3LH 1DQMH 2WZ6A 1HH9A 2BSBA 2GK0A 3HG3A 4LRIA 4UQIM 5FA4B 5E5RB 4MNQB 5B3JE 1IJ9A 3NEOA 4C8XA 3TWYA 1NCWH 5BMFL 1JHLL 5JHDD 2P5WD 4PVMA 2OW6A 5E9DB 3EDFA 5AOJA 3P4NA 4L37B 4L0ZA 1NCGA 4DCQB 2AI0L 1MDTA 3MJ9A 5B8CA 3VGDA 3RI5K 3BAEH 4P0DA 3GZKA 5AAWC 3GMRA 2BFVH 3HHSA 1XR8B 4FCHA 4IJ3C 3RWIA 4AYFA 1IEBB 2MQCA 2Y07H 2ZZUT 4NDMB 4TSAH 1LJMA 5CILH 3RWDA 3T3MB 3VUAA 3KNBB 4UAOC 3W39A 2EIKB 1XGPA 3E7JA 2NNFA 3RNKA 5D5MB 3H85A 1PKQE 4L48A 4L4TA 3WHXB 3ZT7A 1VGEL 4QRPE 4PJFE 3WE6A 3TV8A 4OCWH 3FCSB 2WZPD 2IDTA 4Y4FD 2RAMA 2DN7A 4UTBA 2XRAH 3WLWC 4Y9EA 2VDML 1I7TB 3H7BB 5AOMA 43C9B 4UMGA 4ZTOH 2A73B 4ONOA 4RGND 3W9DB 5FO9A 4F9PC 2AK1H 1A7OH 4M7KH 3U7AA 2HZHA 5I17A 3QNXA 1JNNH 1SF3A 4WEEA 3I3BA 4L8SB 4YPGA 3DVNB 3QUKB 3QW9A 5HVHB 3MCG1 3MJ9H 1FDLL 4DUXA 1EH9A 1RZIA 4H8VA 4GG8A 4RAVA 3BEVA 3DRQB 2AFNA 2W0PA 4AKPA 4F7PB 1K4DA 1XWVA 2HP4A 2XFGB 4V1DE 5DT1H 2EYRA 3RGVC 4GB9A 5IESL 2HLEB 1BPVA 3D39A 4TXVB 4OBRA 1VFAB 4LCWE 5G5DB 2OJEA 1MZZA 2GTZA 6PAZA 2XPGA 4HFWA 2IBZY 1TIUA 1MWOA 2WINB 2EDOA 4TNWK 3IDNB 5IVXF 1DN2A 4AOFA 4P57A 4JCLA 4ZPTB 4UTBH 3IU3A 4PJ9D 3OMIB 3RTLA 2F54B 3K72A 4OD2A 4E41B 4CC1A 2XZAL 2NY6D 1PDKB 2E27H 2I60H 1ZLVH 4D94A 4I9WE 1NCCH 4HBCH 1Q9WB 3MRRA 5AVZB 2C9PA 4JE0A 4OZIB 5FKPA 5IK3B 4X7TA 1RI8A 4KUCD 1OP9A 1S7SB 4RMWA 1EVUA 1HSBB 1A6UL 1EEYA 4Y8DC 5T1JA 2Q3AA 1KXTA 2AZUA 4IK7A 1IQDB 2VDKH 1CR9H 1NBYA 3QE5A 4JDZB 1O9VA 2H7WA 1BD2A 4L1BA 2RBLA 4M7LH 1XF2A 2AQ1A 3QFDB 1ZLEA 1T4KB 4JKMA 2YLKA 3S3DB 4IGBA 5C0CB 4PJ7A 4PRBA 1VKXB 4XNUL 4JFFD 3CFUA 5E95B 1KBKA 2G75B 1MDAA 2FJSA 4PRPE 4XMPH 2YAQA 5E24E 3G08A 1JN6A 4TSBH 5F7DA 4POUB 3FAXA 5EF1A 1N64L 4LCCB 4XMTA 4EZKA 1C5DA 3B9VA 4G1EB 3IXAB 3PGDB 4FNQA 4NNXB 2P45B 1DVZA 3CK0L 4OQTA 3ARBA 4IBQA 3E2HB 5T3XL 4H5SA 3ZBMA 3MUJA 5I5JA 2V2XB 3PDOB 3LD8C 4MA3A 2E6JA 2NX5A 4XCEA 2KKQA 3II3A 2XBDA 7CGTA 1OAUH 3P3RA 5FYKD 5D7IF 3U9UA 5DMJB 1PYWA 1J1XH 3UBXG 4IRZA 4LPYA 4PJGA 2Y1ZA 1G6RH 3SCMA 4BFRA 1XIWC 1QLFB 3ALPA 1DBAL 4X7CC 2NSXA 5K9OA 1UB5B 3VMOA 3B43A 4AMKH 3BVVA 1MHEA 2YA1A 1J86A 1MFEH 1SHXA 1XTMA 1HI6A 3QNFA 3DO7A 3E9TA 4IYKA 2QTEA 3WCYA 1DQDH 3BVNA 4R5TA 4KH9A 4RZCA 2WOYA 1NEZA 3D25B 4GG6E 2NR6A 3EUUA 1DZBA 5CJXC 4MJ5B 4KTDL 2TSBA 2ZXQA 4X98A 3ZK0A 4NM4H 2GITB 1SLUA 2WBJA 4KJYA 5C6TL 3Q8AA 2DQUL 2XZCL 4GSXA 3FJTA 3ILQC 3NJLA 4Y1AD 4G9DB 4J5VA 4K5PA 1R3HB 2WSPA 3OX8A 4Q14A 1FFOA 4FRWA 3U7WH 5D7KE 1QASA 5DVOA 2JJTA 2OX5B 3LB6D 4ZAKA 2XWJB 3AC0A 4KRPD 3B2VL 1IO4C 4MDJB 4NQUA 4P5KB 4CSPA 1ONQA 4IRZH 2PYFB 4HUXA 1SBBA 3P9LA 4X9FA 2OL3A 1S9VA 3NA9L 3QIBB 1GGIL 4IMLA 4WW2A 4F33B 5IJDC 2AGJL 1HHJA 1J05B 3BUQA 1GS7A 2GIYA 3QXUA 1FNEA 1DANT 3FO9B 3BZFB 2GY7B 4FG0A 4D9QD 2BVTA 3IPBA 3ZE1E 5KG9B 4NCDA 5D1ZD 3W0WB 1EZVY 4X6BB 3CN0A 3O2WL 4XPGL 5AVSB 1ZLSH 3WELA 1CZ8L 3X1GA 4MAYA 4JFEB 3VA2C 2R29A 1KPVA 3GXDA 1XL6A 5JW4M 3E8UH 3G6AB 3I9PA 1BOGA 2DQDH 2XN9B 3F2LA 1OF2A 5IKCB 3HNTH 2NY2C 3P30L 4RDQF 2P7TA 3VD3A 4MRBA 3FPXA 2VDNL 3I6SA 1YQVL 4QTIH 2APSA 2HT4D 3OWEA 2OL3H 3IFPB 3LKRA 3NFPB 5L9DH 2VQ4A 3ESPA 3BPCB 5GJSL 4GO8A 3NSXA 1NGXB 2P44B 1KLUB 4U1JA 4TKWA 1NC4B 3MJ7A 4IBLT 4JO2L 1E8XA 2AABL 1FQ9C 1KPUA 4MQXD 1XGTB 3RTQD 3F7QA 3EDEA 3VXNB 4MDIA 4QD2E 1Q9KA 4QRFA 5C0AA 5TQ0L 3H3BC 4LLVA 1X7TA 3W81A 3EO1A 1OALA 5DUMH 3MLYH 2B08A 5I0WA 4XMZA 3EO0A 2VN7A 4NNPH 3TYFB 5JTWA 1MRFL 1WA2X 3QPQD 3KW8A 4QR7A 5KVMC 3CDYA 5C0ND 4M5ZL 1AS8A 3JV5A 5CZXC 1QA9B 4G7VH 3WKYA 1NEUA 4YX2H 3OKDA 5CCJA 4H8UA 3VXMB 3MRHA 1AD0B 3RVTD 3NJGA 3I75B 2F7IA 2BNRE 4I1NB 2CUAA 4JEGB 3ZO0A 5C0FA 4N2GA 1K72A 3WFCL 1U3ZA 4BZ1L 4X7SH 1T03H 1RVFL 1XD0A 5T3XE 3GDBA 1RLWA 4P2YA 2R7EB 4P99A 3QULA 2B7DT 4KV5E 5E8DL 5TDNB 5ID1B 3QJZA 3AT9A 1WZ1L 2R2CA 3MNDA 4Q6KA 4JR9H 3EXLA 1MCCA 1T83A 3HE6D 1A9BA 1I53A 2HVJA 3NN8A 4XN4A 4L18A 4FQHB 3U7YL 3DKHA 4PG2C 3RVUC 3LQAL 1EUTA 1YJDL 3LSOA 3CNKA 5E2WL 3MBED 4XAKD 2IOMA 1QO3B 2UWEA 1G6VK 4HJJH 3T77A 1TUPA 2YPLD 2WCSA 4EE2A 1R1CA 3UAEA 4UWQB 2ATAA 1D5XA 2YPVL 3SQOH 4F7EB 2JFCA 2YFNA 5JPMA 5HYFA 4YOKA 1VAHA 3Q6FA 4PRNA 1CE1H 3CBJB 3QRGL 4XNYL 1NUDA 3JYCA 2CGRH 2NXYD 4K3DL 4YEEA 1JRHL 1A9EA 1EFQA 1AO7A 3GSNA 1UB6B 5ID0A 5IB4B 5IR1A 3WTUA 2V3EA 2V9QA 1H8LA 4W68A 5FHAL 2YD3A 1Q9OB 4IOFC 4K3EH 3SD2A 1H3UA 1TEGA 1A9VA 2P24A 3RZCD 4XN7A 1LK2B 1I3UA 5DJCA 2FO4B 1RIVL 4WSGA 5KBPA 3ZGHA 3GMLA 1AKJB 3GZQA 4XN2A 5I1HH 2N7AA 1FH2A 4MZ3A 2QSCH 4G8EA 3TVMD 5E08L 3H1ZA 3KGRA 4MCYB 1F2QA 5BJTA 4MAUL 1HC1A 2N3JA 5T3ZH 5INDB 1QVOA 3L95A 1QWUA 1ZCRA 4AM0A 1INQB 1BCIA 1J1OL 2AJSL 4J4PD 3MDJA 2F61A 2ZNXA 4JPVH 1ZDQA 3I74A 5DI8A 1BQSA 3G7TA 3TBVA 4WUKL 3A4FA 4AZ8B 2UZIH 4X4KA 5D1QC 2H3XC 4XPAH 3RY6A 4AQOA 5CJQH 1V5JA 4JKKA 2ZTBA 4LOUC 4X4XA 3WI9A 1DE4B 1PLGL 2EYSA 4I0CC 2JIXB 3HE7D 3TF7C 2XXGA 1ZE3C 1TPXC 4UV7H 3MLUH 4I18C 4OCYL 2EEXA 2E5EA 5DR5H 1OQOA 2AJXL 5EOCJ 3NTCL 5CP3A 3F58L 4M8RA 2XWTB 2DWEB 1FVEB 2XG5A 4KGJA 4GAYB 3ZZLA 4MS6A 1T2XA 3MNVA 3KHOA 2IALA 2ZWZA 3MX0A 2FBOJ 2GSIB 2FSEA 3H2QA 4CC4C 3W11D 5D5MF 4ELKA 1URZA 5E2JA 5KSAA 3HUJE 4NQXB 1BAWA 4RMQA 2IPTL 1ORSB 4M61B 4LARH 5I1LB 4GMTH 4MNQE 3T4YA 3E3QC 3FSVA 3HEIB 3NPSB 4LCVA 1ACCA 5JW3L 3KL3A 3HN5A 2ZX6A 1UWEH 3PHQA 4HAKA 4F3FB 4HAFA 5J6SA 1ACZA 1CL7H 1F4WL 4KTEL 2XHNA 3K6SB 4TNGA 3KLLA 4TLUA 5TDOB 4MJ2A 4NKOB 4M6ML 3WKML 4FQ1H 1VFBA 4S1DC 4O51A 4UB0H 5CP3H 5IQOA 3DROA 3T3ME 5JHMA 5DFWH 3OKMB 4HG4J 3ZX1A 5F1KC 5E1AB 4HWNA 2LT9A 2FBJH 2YUXA 3RWHA 5IJVA 1OZUA 4XGZA 4DJMA 1KTCA 1QLEH 1ET5A 1S9WA 1T5WA 5DEJA 5F3HB 5DJZB 2ED9A 3EH2A 2B59B 2WWOA 1BVKA 1VZGA 3MRNB 4Z76B 4KTYA 1SLVA 4B3VA 1O5DT 4Q74A 1X5MA 1LO0H 1WF5A 4C59B 4K7FA 1Z3RA 5EPMA 2HG0A 1DBML 3NCXA 4M1GL 3VQMA 1R5WB 1RZ8B 1K4CA 1FHNA 3KVDD 4FFZA 4I0PC 4Z7AA 4LHUB 5DHVA 5GS1C 5JHDA 1MCPL 4R4BB 1BMZA 2H4EA 2P5WA 5EU6E 5HGDA 3UBHA 3WTSA 3VD4A 2OTWB 2R56H 3OJ2C 3UBXI 2WUCL 2WK2A 4EN3D 5AVTB 2C9SA 3ZDXB 4GT7A 5ALBH 3R7RA 4GP4B 5EEVA 5HI4D 3QJOA 3NCFB 2FQDA 2YKLL 1WPCA 5FK9B 5LAXB 1TKWA 5H37G 3SZKC 3ARWA 4XXWC 3FU0A 1JPSH 3AUWB 2FT6A 5EOTA 2H6UA 2EVGA 1BECA 4HIHA 5L8KB 4NFDA 4ZMLA 4HDIA 4PEEA 3O3BA 1HXYA 3B9KB 4HPYL 5C6PB 4E41E 2W81C 3PFQA 2WZPA 5SWQB 4Y4FA 3KYOB 2YUVA 4B5ZA 1F6AA 1UVQB 4YDJA 1KJ3L 1NGZA 3DDGA 1XH3A 4HKZB 3BH8A 3UL4A 3SDAB 5F96L 3QEQB 4FFZH 1MZYA 4TRPH 2X88A 1HESA 3WEXA 1HEJC 3UACA 4H1LG 4OZIE 4F7MB 3NJKA 3NP3A 3HPLB 4LKCB 2X2UA 4NUPA 1XMWA 1SXCA 3BGFB 3D06A 4U7MA 3RB5A 4RNRB 4TSCL 1FNGA 1GY1A 2R1YB 5FAAA 1KFGA 1A65A 1YC8A 3BN3B 4QHUA 4YH6A 4FNRA 3ARFD 4OF6A 2GTQA 5J89A 1FN4A 3D69A 2DBLH 2TSAA 2MCPH 3CZGA 5C0CE 3TA3C 4Z9KB 3A0OA 2ZP8A 3PL6D 4N20A 5GS0D 4PJ8B 2KQMA 3IS1X 3O11B 1WGVA 4FP8L 3UC2A 4R83A 4YXHL 3SGEI 3TT3H 4N8VG 2WXQA 2Q3XA 4UDTB 3LKOB 4PJ9A 2C9AA 4P04A 3O0RH 2D0HA 1I1FA 4Y5VA 5I1DB 4FEMA 2GAZB 4HHAA 4I9XA 3GZOA 1OTUD 3O3AB 2QGBA 4OZ4A 3UTSB 1EAPB 4MJJA 2YRBA 2IG2H 5E2VH 3G5VA 4DP2X 1AY1H 4B27A 4MJIB 2BZCA 4YE4H 4L8BA 4F27A 5IFHH 4EDWL 2DQJH 5DZAA 4JFHD 1BBJB 3DTUB 4LCYA 2XZQL 3PNWA 1AQHA 4LSSH 1HZHL 4LDEB 5T1DL 2NY5C 2DLFL 5CS7A 1KELH 3CTTA 3VM5A 2Z64C 1MY5A 2IQ9H 4CKVX 1ADQA 5MENB 1SEBB 3FMGH 3QZNA 4WTQA 1PF3A 5GGSY 2AXWA 3P1VA 1RUML 3VQ1C 1VADA 4JFFA 4JN1L 1MCHA 4Z0BL 3U2JA 4KVCL 3O0LA 4EZJA 4F57L 1BREA 3HLAA 4DN3L 4W9LC 3SPGA 5INCB 1E5YA 1JTPA 3O6FC 4ZS6D 4D0CA 5BZDB 1R3JA 3LEYL 3V4LA 2OZ4L 4YAQB 3SE4C 1OP3K 1KCVL 2FJHB 3WAJA 3DC0A 1S7XA 3V2AR 3BGMA 2YAMA 2CPCA 2QR0B 3K2IA 1UZ8A 5DUBA 4AGLA 4KZCA 1E0OB 1RJYA 3EYQC 5E1GA 5HHPB 4YMPA 1A6AA 4QY8A 4DK3A 1NIBA 2G2RA 4ZUVB 3TL5A 4M5YL 4GYBA 1MCSA 2CO1A 4QPEA 5E00A 2MKWA 2NTFB 1RJZA 2YGNA 3U6RB 3INUH 2CSPA 4P5TD 3BUDA 2P49B 1TZIA 1NLBH 4MQSB 5KBKA 3EJSA 4HLJA 4HOWA 3ARGB 3FO0H 3N85L 3CSPA 4K94H 1KUMA 1TVHB 4FFYA 1ZXKA 2NXZC 2X41A 4WEBL 4XBEL 2G9KA 2NYYC 1A4CA 4N0UB 3ULAB 2YR3A 1OSEA 1TLKA 4P9ML 2A6DA 2ZF8A 4QJ4B 4UNTA 5FM8A 2VDPL 3SJVD 3U36A 3ZZQA 4KAQH 3NZ8B 4Q6IB 2FVNA 1E9QB 2AEPH 4M3KB 5HD8D 3W0WE 4ALAC 3BUYA 5J12C 1A6WH 3B5TA 2VNCA 3N0PB 2LU3A 3MRGA 5CNHA 2ZSWA 3MNZB 3VFMA 4A6YH 2PMZA 3LKSA 3UMTA 3ESNA 5KZCD 2JLPA 2RH0A 2KZWA 4Y1AA 4B95C 2XN9E 3QT2A 3VWKB 4M1DH 2DDQL 4TQPA 4U1SA 3SKMB 1WZMA 5F89A 3WGUB 1IGFL 2YRLA 4GQZA 4Q89A 4YL4A 5J0BA 5LGHL 4DVRH 3FONA 5I6LA 1CDCA 5JW5B 1OB0A 5DMKA 1AFVL 1D9KC 2ZKXA 1KEGL 4Y4KC 4BH7B 5EA0L 4W9EC 4P05A 1HH9B 2I07A 1X7QA 4KMTH 5DRNA 4JDTH 4FFYH 5GZND 1WT5C 2X44D 1IC7L 1H15A 1BVNP 5AW1B 4DERA 3WL9A 1J7VR 4DGVL 2FECL 3ZTCC 4NJ9L 2K6WA 5K1VA 5IBUB 3GD1C 2ICES 3P4NB 1CVRA 1GGCH 3EYUL 2YD0A 1I1CA 1MLCA 2VDOB 2XY1A 1TLMA 4LSDA 1JYVA 5B8CB 3SOBH 3EIFA 4X4MA 4P2OD 5D1ZA 3GMRB 3HHSB 2MRYA 4ICWA 3RWIB 4AYFB 3RWDB 4YHYC 3OGOE 3ZYOA 1WLHA 2LOEA 3W39B 4NN5B 1XGPB 3Q6GL 4M93B 3RNKB 1JMXA 4JRYD 1HJCA 4L4TB 5EMYA 4XP6L 3EHBB 3VXME 5GZOC 1BGXH 3WE6B 1O9ZA 1E4XH 3P0VH 4R5VA 2F5AH 4KDVA 3AS0A 5E5MA 4KHXH 1MQKH 2HKHL 3GB7A 4R97B 1H9VA 4XTRC 3MCLH 2BSTA 4ZTEA 5F44A 3QDJE 1FYHB 5DHYA 1PLCA 2F19L 5I17B 4IMKA 1KCRH 3QNXB 2A6KA 2DEWX 2N59A 3RTQA 4YPGB 1GL4B 2RTTA 3QRLA 4ABQA 5IGXH 1OGAE 1BAFL 3FU5A 1RZIB 4RAVB 4GG8B 3BEVB 5TF1H 3IFNL 2YAPA 1K4DB 3G6JA 3MC0A 3RDTD 1RPKA 2VDKB 3N41B 4MD0A 2EYRB 3T2NH 2YMXH 3OMZA 3D39B 5I23A 3IPEA 2BZDA 2OJEB 1YYCA 5I0DA 2ARJQ 2EDBA 2ZT9C 4O9HH 2ZCKL 4KVNL 2GTZB 2XFXA 2XPGB 3IT8D 4HFWB 4PV1C 3LEVL 4DO5A 4OF0A 3EJYC 4ORGA 2WCPA 4K15A 2UXFA 5E8PA 2E8ZA 3WD5L 4DTGL 4P57B 4IK6A 4A2EA 3L3JA 4QF1A 1WITA 3K72B 4OD2B 5KSVA 3BRGC 3B2XA 5ABZA 3L3OC 4OZGA 1FFTB 4G7QB 3O4OB 1E2ZA 5E2UL 3GJEA 4F37F 4P46D 5C7ZA 5D2LF 3UTPD 1OE2A 3MRRB 8PAZA 3IGKA 3SBRA 5FKPB 2BK8A 3NCJL 2NY3D 4OY9A 4X7TB 3FUIA 3HE6A 1EEYB 2R0KL 1NPNA 4DGIL 1KXTB 5B7FA 1NBYB 3DV6A 1UOVA 3MOAH 1W0WA 4ELMA 3MBEA 4Y1TA 5HDQL 1BD2B 1BZOA 1MFUA 2Z1KA 4OCMC 4BH8A 2G3NA 2YPLA 5D7EA 1XGZA 4UUJA 3VWJC 5CAYB 1XF2B 4DK5A 1CFNA 5J3HD 4IGBB 4EIUA 4PJ7B 5I75B 4PRBB 3H6JA 1YEHL 2LFGA 2DTML 4HMCA 4RQQA 4UM9D 1G94A 3JTBA 1ROCA 1GC1L 1Z3GH 2XETA 1GW6A 3WNNA 4OI8A 3G08B 4H44C 4IU3A 1JN6B 5F7DB 4U33A 4APQD 1F1AA 5B4MC 5DK0A 3GSQA 1MEXH 2VSDA 1IC4H 2ZYSA 1HX0A 4OKVA 1C5DB 3TASA 2BJMH 4O2CA 1Z5YD 1PCSA 2WBWB 4TTDC 4AL8H 3IDMB 5LNDA 1G7LA 1X5AA 5FV1L 2A9NH 2E9BA 3ARBB 4G7YH 4LSRL 3RZCA 3S5YA 3MRIA 3HNSL 4H5SB 1TTAA 3ULUL 2ZG1A 2HTKD 5D8JL 4F8PA 4MA3B 2NY1B 2CD0A 4IIZA 1RLBA 4XCEB 5AAMA 2E7LC 5F3FA 2MTPA 4W9CC 2R0LH 3TVMA 4L05A 4JPWH 5B3SB 3U9UB 4GQQA 1PYWB 2AJUH 3PAVA 1RU9L 2ZKWA 4JG1H 4PJGB 3TZVB 1NMCC 3SCMB 3W82A 5K9OB 1KZQA 5K33A 4FL4B 1PZ2A 3P4LA 3VXRE 3CD4A 1T2JA 3ULVL 4TQEL 3BKJH 5JUEH 3GO1H 3QHFL 1HI6B 3DO7B 4JY5H 4J4PA 5CUSL 3QDMD 1IC0A 2VRKA 4KDTC 4RZCB 1NEZB 1JV2A 5E4EC 1DJSA 5B39G 1N8ZA 4OZHE 4W9GC 1CB4A 3QA3A 4X98B 2K70A 1PFOA 1S7VA 2V17H 5F7KC 3FN3A 1LO3L 5FM4A 2WBJB 4KJYB 3UJTL 1MXDA 1DBKH 3ALWA 4IBUA 4IRJC 2Y5TA 5DHMC 3B3IA 4M7LT 1TJGL 4LSPH 5A3ID 1FYTD 3HE7A 3LVTA 4GAJL 3OX8B 1W8OA 4XR8C 4OJFL 2P4AB 2BY0A 3FTVA 1AR1C 1QLRA 3GSOA 3LZFL 4FKEA 4ZAKB 1CI3M 4HWEH 5MHSD 5KVDL 1F90H 3CZJA 3SDCD 4B7IA 5IQ7H 1WJ3A 1YECL 1ONQB 3FZUC 4HUXB 1UCTA 2Q87A 3P9LB 2OPCA 2VUOA 3LN4A 4ZDHA 2OL3B 1S9VB 4JPKL 4IMLB 1FGNH 4WW2B 1A1OA 2FEDC 3BH9A 1HHJB 3BSZL 1J9SA 2WXMA 3CSBA 3JWOH 2D7TH 2IANB 3HMWL 4XN5A 4N0YH 1RV6X 3KPOA 1FNEB 5FYJU 4BCYA 1FNHA 1U95A 4LMQE 5EUOA 1PJWA 3SN6N 2QHRL 1TU2A 2CBPA 3KHQA 4CSSA 2WNWA 1YZZA 1ZJBA 4YS4A 1J0YA 3GBNL 2XQ0A 5IOKA 4MAYB 4OBSA 1PAMA 1KPVB 5EOQL 5AENA 2BINA 3C9NA 4U6HA 1LHZA 3GJFK 4R8WH 2EUVA 2Y7NA 2KH2B 4K07A 2EIJB 3ZDXE 1BOGB 2H41A 4IEFA 1OF2B 4YDKL 2NY0D 5I73C 3L4ZA 4FYSA 3OB0H 1UH3A 1RUAH 5ABAA 2P7TB 3U48A 4O5LL 1A4JA 5EORH 4KKCC 4QHPA 3KLDA 2G9HA 3O9WC 4JFYB 2BFVL 5F9WB 3LKRB 1IIIA 3DSNB 3FQXA 4U1HA 4KZEH 1JGVL 5CILL 3GBMH 4RFOH 1S9YA 2DM3A 1CLZL 4U1JB 1AMYA 2WANA 3DOSA 5EIVA 1ZLWK 5KVFH 3MJ7B 5LBGA 4B6ZA 1R47A 2J6EA 4WHDA 2X05A 3FS9A 1KPUB 5C9KA 2CNYA 2MOQA 1AC6A 4QHLA 3MR9A 2BY2A 2QV2A 4MDIB 3KL0A 1W9XA 1Q9KB 5C0AB 4LLVB 3QEQE 1L9SA 1T7VA 3EO1B 4BQCA 1U8MA 5I1KH 4BRJA 1UACH 4FXKA 3CHXA 3C5ZC 3EO0B 2AQRA 1U8NA 1Z9OA 3E6HA 2OYKA 1DVTA 3T0EC 5A2FA 3AM8A 5AW4B 1WWAX 1VA9A 3N5AA 4EN3A 4S0HA 2OJZL 2VDOL 2XVLA 1IBDA 2V3DA 3OKDB 1UT2A 4XB3A 4YUEL 5GQBA 5IMKA 4JHWH 2C7FA 3MRHB 4XNZB 3JV6A 3K1KC 5C0FB 2PP8A 1JE6A 2YRPA 4YSTA 5DT1L 1O9WA 2DYRB 3VSVA 1E6JH 4XMLH 1KMGA 3GTTA 4W6WB 3IMUA 4RH4A 3HC2A 3ASWA 3ENEA 2VRAA 2LU5A 2WIIA 3QULB 1INEL 4Z7WA 5HVFB 1JHKH 3ULUE 1M1XA 4JO1L 4S1SL 2PW2A 5D6CA 4NKIH 4BFIA 1A9BB 1AC0A 1EJ6A 3NN8B 4MXQC 5DS2A 1B0WA 2COVD 1PQZA 1LEIA 5ECJE 3C6LB 4Y16C 3VG0L 4YQXL 3UTSE 3A67H 2ITCA 3LSOB 3LNFA 5K93A 2ORBL 4P4KD 3AS2A 2UWEB 5IB3A 3D5OF 4MJIE 3T77B 1PX3A 1NCCL 4W9HC 4PYHA 3OD3A 1R5VA 1D5XB 4GH7B 3ULVE 2HAZA 5JPMB 3Q6FB 4PRNB 1D7BA 2GCYB 5CLXA 2IC2A 1ITBB 3ARFA 1FO0A 5I18H 2J25A 5DD3H 1A9EB 1AO7B 4PJEF 4YGVB 3GSNB 1UWXH 5F1SA 5ID0B 5IR1B 1FA4A 3PL6A 2DQ6A 2B14A 1VEMA 3MJWA 1R6VA 1E9OA 4QXTA 1IAKA 3VNYA 4D9RE 4ZNEE 4XRCB 1XF1A 2CALA 5IB5A 4D7PA 3TO4D 3EDDA 2P24B 3L4WA 5KSUA 1SM3H 4XMPL 5CSZA 2FB4L 5DJCB 3DBSA 3BPLC 2CRZA 2ENSA 3D52A 5KVDE 2VLKE 2NCMA 1BLNA 3CX2A 3GMLB 1GCYA 1MW2A 4C4BA 4G8EB 2GJZA 3E8VA 2Z93A 5FX3A 35C8H 5TE4L 2P5ED 3HG5A 3LZOA 4GQRA 2CH8A 5BJTB 1QRND 2ICWA 4PUBH 1QVOB 3L95B 3CZUB 3SE8L 3CGTA 1TCMA 3SBWA 2R39A 4L23A 4AM0B 2EVFA 5IWLC 3UTTD 3V95A 1HHHA 4CILA 2H26A 3MREA 4N68A 2DRUA 3QCUH 4QXUH 4W70A 5DI8B 5HYJD 3TBVB 2F68X 3VRJA 4WI8A 4HWUA 1SUJA 3DMMC 4N0UE 1ZY9A 3R8QA 3H9ZA 4I7ZC 5L6YL 3HI5L 3JV0A 4NM8L 1F97A 4X4XB 5GRVL 3QS3A 5JXED 1Q0YH 2EYSB 5ESAA 1LP9A 1S78C 2WNKA 1MFEL 4PWKA 3MU3A 3OAZH 5E7FA 1MF2H 2ZJSL 1ASPA 2W65A 4K4KA 3SO3C 3TCLA 2EDXA 5DHEA 3BVDB 2Z0BA 4IS6A 4PWIA 2XG5B 5GGVL 1SYSA 1QHQA 2ZOUA 4OQTL 4ABVA 3K7UA 3MNVB 1FSKC 3TJHD 2IALB 4FKKA 3MX0B 1QLEB 4PGDA 3ZPDA 3AZUA 2FSEB 1MIEL 4ELKB 5KSAB 1FNFA 3U7WL 3QIWD 2OMXB 1Z9MA 3P3TA 1C8QA 1M6OA 3NCYP 4WWKC 4P5TA 4K8RL 3M07A 4Z3IA 4E2OA 5KWYC 1WFMA 3DIVA 4UTAA 3T4YB 2NSQA 5M94B 4F58L 1AD9A 4DEUA 4ZT1A 4IRZL 5E70A 3PHQB 3RJOA 4N87A 4LSQH 4YDMA 2NZ9C 2DJMA 3EG9A 3V6FA 3Q8BA 1JPEA 2Z65C 3SJVA 1AHWA 3VYNA 2K9UA 3KL5A 3VGFA 4FA7B 4NI6A 1Q1JH 1KB5A 2VMJA 4X6EA 2UX6A 1VFBB 1A7RL 5DMYA 2WTPA 4BFBD 4CU6A 5D4HA 1XZWA 3DROB 4HLZG 3MV9E 5DVPA 4Y2DD 3N41F 3RWHB 4OCSH 4URKA 5IJVB 4DF9A 5DJXA 2BXZA 2H6PA 4XGZB 4DUVA 4L4TE 3D1MC 2IXQA 2GK2A 3E8UL 1S9WB 1P9MA 1T5WB 5TJWK 2V5MA 1I8MA 2FUQA 3K71A 2ZQKA 5KEZA 1BVKB 3P3YA 1KN4H 1NL0L 4CU7A 1OCRB 1OLZA 1R3IH 4K7FB 4X7FC 5EPMB 5CLWA 4XWGH 5GZNA 2CCLA 4DT2A 3C12A 3V7AE 3W56A 1A1MB 4XVOA 3DX9A 1K4CB 4FLQA 4RX4D 4ZG1A 1HTYA 5DHVB 5JHDB 5IT2H 2H2SC 1HE8A 2P5WB 4Y89A 5HGDB 4W6XB 5A40E 1JZIA 2UVFA 1ZLUH 2DM4A 2ZWKA 3K8KA 3L2LA 4P2OA 2F9BT 4XP4H 1ECZA 3GRGA 1TKWB 4WI2A 3D39E 3GMPA 5EOTB 1IJNA 2XNAA 2R29L 5DUML 4OJDH 4WV1A 1WBXA 5EIIG 3MBXH 1EEUA 2QQKL 2J12B 3GI9L 4HIHB 4JRYA 3X2QB 5IUCA 2BX5A 4HDIB 2LE9A 2G60L 5ISZD 3O3BB 1HXYB 3QAZB 1BFOA 2YQGA 2DM2A 3WTYA 1JPTL 1ET8A 4Z0XA 2ZPKH 3QCVH 3UX9B 4Y4FB 4KFZC 1F6AB 2IO5A 4H2CA 4NP4H 1ZS2A 4YDJB 1NGZB 3SGKA 1XH3B 2EDLA 3BH8B 4EJ1C 2J43A 4RGNB 3T1FA 5C0RH 1GZHC 3WEXB 1FL3A 1E7VA 5JIKA 1AHMA 1BG1A 2JB5L 1BM3L 1UZ6E 2RCSH 4PV8A 1FNGB 1KTJA 3S2CA 5EC1A 1ID5I 2IFFH 2BO0A 4Q52A 4UQAA 2RALA 3HAEA 3TO2A 4I2XA 3RDTA 3SBQA 3E0GA 4QHUB 1WIOA 3QYCA 2BHZA 1FN4B 3D69B 3REWA 5DR5L 1AE6H 4FULA 4PJ7E 4L2LA 1ZV5A 2JLLA 5FIEA 1H6UA 3IS0X 4HJJL 3IJ9A 3QNZA 5AB0A 4TL4A 2H2PD 5IB1A 4PJGF 4M48H 5I1GL 4YSOA 3A21A 3BKMH 4LOFA 4PJ9B 3WIAA 1M53A 4Y5VB 1I1FB 1L7IH 4ODTL 4EBQH 4ZFOA 1FBIH 4MKMA 2NY6B 2CGRL 2XTJD 4HHAB 1AIZA 4P46A 3RWEA 5CD3A 3VO0A 1BLIA 4OZ4B 3TH4T 1BP3B 3GHBL 4HIJA 3G5VB 1AYOA 1JD9A 2GBAA 1EZLA 3GXFA 4L8BB 2EDJA 4LCYB 2F8OA 1W80A 3PNWB 2NX5E 3BD4A 4HZ1A 2PN5A 4NGHH 5E7BA 2Y6TE 4YFLF 4OI7A 2ZUSA 2ZYIA 1QACA 1ZT7A 4YO0A 2W92A 3N44B 2HG5A 1DVFD 3D3VD 4U6XA 1IAII 5TF0A 5J13B 4PVBA 4POYA 2QSCL 2YGOA 3RX5A 1VADB 1OCCB 4JFFB 5KANI 4KNQA 4UM9A 1NDTA 2KZ1B 3ARDD 1VDGA 1DBJL 4C57C 2XVBA 3HLAB 2ICEA 1WBZA 4WW2F 1OV8A 5T3ZL 4D0CB 1HCFX 4APQA 1R3JB 5F7NC 1F42A 5E51A 5I19L 3DURA 3T6QC 1ML0A 1OPGH 1CGYA 3GSNL 4TL5A 3AT8A 4JKLA 1S7XB 4KJPC 2RHEA 3BGMB 1DQVA 4GEIA 4A6YB 5DUBB 1IARB 1P7KA 2CG9X 4Y7MA 4R7VA 1RJYB 2HJKA 1A6AB 2K9FB 4ZD3L 4QY8B 4OGXH 3REVA 5CN3A 1MCFA 3GI8L 1FG9C 5E00B 4GI8A 1RJZB 4ZQTA 3D48R 4HK3N 4Q56A 4UV7L 4PY8J 2Z31C 1TZIB 4AT6A 1YLBB 3V0DA 3HBGA 5G2NA 2ICCA 2EIDA 1DVUA 1XH2A 3ZL4H 4KRMB 3H9YA 3QG7H 1YEEL 2J44A 3FRUA 4PS8A 3ZR6A 1MXGA 3TPKA 2A6DB 4OJAA 5ANME 3VI4E 3U36B 4RMBA 4GIAA 1I9IH 3QDMA 4BQ8A 1E27A 1QPKA 5J5EA 1AAJA 3I2CH 1UJTA 2MTAA 4PLKD 3BUYB 4B9PA 1AOZA 4F37K 1CS6A 2GEQA 4NOFA 3TYGH 1HILA 2WYTA 3MRGB 2ZSWB 1VCAA 4YFDB 3VFMB 5DJ6A 2W95A 3AMLA 3LKSB 5IQLA 2GBUA 2MHAB 1Q8MA 4Y1AB 1FYTA 2LTQC 1YNLL 3PHAA 4DGWC 1AZBA 2PWEA 5JLZA 4U1SB 5F89B 1BVLA 1E65A 3FONB 15C8H 4KRPB 1WE5A 2EADA 1T0MA 3SDCA 4NFBA 2VLJE 4UYQA 1S7TA 5DMKB 4N9GA 4BUHA 3D4YA 1BXVA 4LF3A 1P6AB 1MCNA 2GJ6D 4UB0L 2I07B 1X7QB 5DRNB 2P26A 5F7UA 1REIA 1ZGLM 4AUUA 2J1YA 4HS3A 4K5MA 1H15B 3LKNA 4LVEA 3WL9B 4QRAA 2QVKA 2B1AH 5SX5H 4NKMA 3DX6A 2WLKA 3FTZA 1R17A 1OHZA 2C3GA 2WQ8A 4WGKA 3NJMA 4GW4A 3OTTA 3CSGA 3PAYA 5JYMA 1MLCB 2QEJA 1SOSA 2FT7A 2O1AA 5AB9A 5KYNA 1HWWA 4EXKA 5IROD 5GRJH 5IMOA 5D1ZB 3KM1A 2HH0L 2VXSL 4FHBD 1QI3A 2L7EA 3ARTA 4J23A 4RGOL 1CLOH 4K73A 5AW2B 3X3FH 2GIXA 4GAGL 1ZJAA 1CI5A 3PP4H 1XH1A 1RSYA 3O6KH 3EXJA 3K0YA 4JM4H 1MRCL 2VSMB 1MWAA 5C08E 1QEWA 2X28A 5ALBL 1F4XH 4AYMC 5E5MB 3JT0A 5DS8A 4UINH 3GB7B 4WHYH 1MQ8A 2BSTB 3ATBA 5IMLA 3N40F 3P9MA 1L7TH 4A2GA 2K3HA 3TGXA 5DHYB 4HT1H 2QADD 3OVUB 2D3LA 3FUJA 1DDHA 1HH6A 2YS4A 2A6KB 4YXKL 3CVDA 4MXVF 3RTQB 3BRDA 3JZ7A 2ITDA 2WWMC 4ODWA 1WTLA 4UQ2A 2EXYD 3CXDH 1Z5LA 4GW5A 4JQXC 4MZ2A 2L04A 4EUPG 2UWEE 1D5IL 3WNPA 4MD0B 4LPXA 1EO8H 4Y2NA 4RWYH 1QBBA 3KXFE 4W4OC 2Y7LA 4OI9A 3ZRFC 2XJLA 2FO1A 5E1QA 5H35A 2Q20A 2XFXB 1ZAGA 2WXPA 1MWAH 2XYCA 3PJLA 2I27N 5T3ZE 2H47C 4ORGB 5E8PB 3TU6A 1JMZA 4OIAA 3U1PA 1AO7E 5E23A 3L3JB 4QF1B 4QRSA 3CVIH 1B0IA 4Q0XH 5KSVB 2CHWA 1PFCA 1QFHA 1XEUA 4OZGB 1AACA 3GJEB 1A4KA 1Q0XL 2NOYA 4B9ZA 4R84A 3VW3L 5DHDA 3N1MC 4KK9C 2FBRA 4J3OD 1V54B 3OJVC 4U7SA 3K4AA 2E46A 3N2JA 1U8LA 1Z0MA 1M2VA 3MTRA 3HE6B 1XMEB 3WEMA 2Z7WA 3OF6D 4N2NA 1PZBA 1MHPH 3VAEA 1S2EA 3KBPA 3H9SE 3BP7A 5FO7A 3FSAA 4YBQC 3DV6B 1W0WB 4P4KA 3EJZD 3MBEB 4ELMB 4BH8B 3CMGA 1IEAA 4ZW3A 2YPLB 4UUJB 1CFNB 2JELH 5DU7A 2BHYA 4YWGH 3PE9A 2O5YH 3O6LL 2C8NA 4RQQB 5IBLD 5IFHL 3I6LE 4OLYH 3GPSA 2D3VA 2GSMB 3ATEA 4KK6D 4IU3B 1JZ6A 2NXYB 3RVVD 5I9QB 3Q7JA 3WFDH 3O4LB 5JPNA 2OTPA 5DK0B 1NFKA 3GNMH 3GSQB 5I28A 5AOLA 5B7EA