3WTXA

Crystal structure of the complex comprised of ets1(y329a), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
118
structure length
118
Chain Sequence
GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
total genus 18
structure length 118
sequence length 118
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3wtxA00
3WTVA 1EAOA 1GZHA 3VD1A 4LOEA 5AOKA 2XWCA 4IBYA 5AOJA 2BIPA 4AGPA 3EXLA 3D05A 3VD2A 4LOFA 4XR8C 3IGKA 2J21A 2IOOA 4AGNA 2XWRA 4IBSA 4AGQA 3Q06A 4AGOA 3Q01A 1IO4C 1EANA 1GZHC 4MZIA 4IBUA 4HJEA 5AB9A 2J1WA 3TS8A 1KZYA 5G4MA 4KVPA 3D08A 5G4NA 4AGLA 4IBWA 2ATAA 3Q05A 2MEJB 5LAPA 2VUKA 4L0ZA 4IBQA 3QYNA 1TSRA 4G83A 2J1YA 1YCSA 2X0UA 4LO9A 3KMDA 3D0AA 2X0VA 3D09A 4IBVA 2J6WA 5ABAA 3ZMEA 2WGXA 2BINA 5LGYA 5A7BA 1CMOA 1HJCA 1T4WA 5KBDA 1TUPA 1HU8A 3US1A 2AHIA 1UOLA 4IJTA 2ADYA 4IBZA 2IOIA 3EXJA 2RMNA 2FEJA 2X0WA 3WTYA 2H1LM 3WU1A 5AOIA 3WTWA 4GUOA 3D07A 3WTXA 2J1XA 3QYMA 3D06A 1HJBC 5G4OA 4A63A 2OCJA 2AC0A 1EAQA 1CO1A 3WTSA 2PCXA 4L18A 5BUAA 4GUQA 5AOLA 3WTUA 5AOMA 3IGLA 3VD0A 2J1ZA 4QO1B 2GEQA 1LJMA 1E50A 4G82A 2P52A 3WTTA 4L0YA 2YBGA 4IBTA 4MZRA 3US0A 2BIOA 2BIQA 1H9DA 2BIMA 4AGMA 5ECGA 3KZ8A 2IOMA 2J20A
chains in the Genus database with same CATH superfamily
3A67L 4FQPA 5INCA 1CDCA 4BKSC 4LSDA 1H9VA 2COVD 2ATKB 2K0RA 2J5WA 1VENA 4M56A 5E4IA 3T0EC 3MCKA 3RWJA 3ZDZF 5MHSE 2YRZA 3SJVB 4RSYA 3G5XA 1JHLH 2E0PA 4NP4L 1R3JA 3WS3A 1ZS8B 1G7PA 1NBQA 2FJHA 2NY0D 1J8KA 4XNQA 5F3FA 3UBXB 1AO7B 1DQML 3DX8B 3BUYA 2AQTA 2Y5TA 4TV3A 3GJFB 1RZFH 3NUKA 4A7QA 3O4LD 4X9BA 2FWOB 1CGSL 3NEEA 4LIQL 1ZD6A 1VA9A 3LKPA 5HHPA 2BCMA 4ZYKA 3NMEA 2V2XB 4UI2A 1DQQB 2ZX7A 1UD4A 2P48B 2P80D 2PO6B 3KYNB 4KV5F 5IMKA 3VVWA 2AEOA 2Y25A 4KJQC 1DVSA 1MSPA 1KC5H 5FYLL 3IEAA 1FZOA 2OMTA 4AVJA 3QIWA 5D72L 3PWVB 1J88A 2ZONA 4U6VL 2GI7A 4L3CA 2O30A 3EOTL 4PJ7A 2H0EA 1LDSA 4M1DH 4HWBH 4IRSC 3DX9A 5EU6D 4G7RB 5AVZB 4HFWB 4JHAL 2ZF8A 3AROA 4MAZA 4FABH 4UQIM 2BSDA 1OK0A 4R4FH 4N0YH 2YQ3A 4RGND 5J1AA 3VXRB 4D8OA 4M5ZL 1BCIA 2GK2A 4W9DC 5I2IB 4IMLA 3HZMA 3DMMB 3MR9B 5I76B 4OD3L 4CJ0A 1GY1A 2G75A 3ZE2B 5ICUA 2B1AL 2JI2A 4HEPA 2F54E 4HH8A 4ODHL 4QHKJ 2KQNA 5MP6H 3BUIA 4OCYH 1WHOA 4XCYA 1KGCE 4TRPH 3W11C 4NKQB 3LEYL 4TM9A 4E5XB 5E9AA 2FQDA 3IFOA 3QORD 3KR3H 4PBWD 3EADA 3ZDYF 3RWCB 1CD1B 4NPYA 1R5WB 5T3ZD 1T22A 1WZLA 2XIBA 2VDML 1I1YB 2BVPB 2PR4H 3DUSB 2AAVA 1ZT4B 3E3QC 2AI0L 4IRJD 4R9HA 4JO3L 1LEIB 2AQQA 7FABL 5J13C 3JT2A 3HC2A 4YBHA 4X4YB 3FSVA 4YSEA 3C5ZB 5MERA 1XGPB 5AL8A 4DGYH 3GMMB 1JRHI 2D03H 1PTZA 2F9BT 2UZPA 4CVXB 2PWGA 4CA4A 3OJVC 3VQ1C 4IGBB 4HWNA 2ENSA 3B9KC 2X44D 4MLIA 4HULB 5IROA 3G5VA 1YPZA 2A3TA 5AVQB 1CFSA 3WOVA 3OHMB 1MHCA 2F68X 2C3WA 3FRUB 1YAZA 5E08H 2AJZB 2KZWA 4KPHH 5C07B 5ADPL 3VGHA 4XC1H 1UOVA 4JFDA 5SWZA 1RZKL 2OQJB 1IQDA 5EIQA 5B3JE 1U8KB 2XA8L 4Q8BA 4Y7OC 4UM9B 2NY3B 1NA8A 3ELAT 2WBWB 2ZXEB 2HT2C 2P7TA 4NFBA 4EDXA 3ZE0F 3CN2A 3L1OL 3TBYB 3IGKA 2Y6SD 3GSNH 1Q1JL 4I77L 5DHDA 4APQD 1LO5A 1JDCA 2ADIA 4CMHB 3ZKNC 4IOFD 1SOQA 4AQAA 4HJEA 4JFXA 2V9TA 1G5GA 4M3HA 2ZYHA 4MQTB 1R46A 5I30L 5IW6B 1NH6A 2K8QA 3QEGL 2WKLA 3L4XA 3BUQA 5JOFB 4N68A 2R29L 3V10A 5TF1H 1OCWH 4MMZA 4P2QB 4MHHI 4YPGA 4BE5A 4DN4H 2Y7LA 4KHXL 4UYPA 5FIEA 3REWB 4OLUL 4A2HA 4N86A 3L7EB 4EKXA 4RDBA 1BBJA 5FKPB 4LO9A 3FU9A 1LQSR 2DWYA 1MCIA 5D1ZB 4YXHL 1U30A 3QUZB 1H6UA 2DL9A 3T77B 2Z4QA 1NL0H 4QOKD 4MQSB 1TJIH 5CS7A 5CFHA 1SHMA 4N2FA 4R84A 1AQDA 3VE0B 3VXUA 1IVTA 3AG3B 1S7SA 1UEYA 2AJUL 4H0LC 2PO6C 4PRHE 4CBPA 5GZNC 3BKCH 3GNML 1PLAA 2R23A 2ZOOA 5KYYB 4HVBA 3WE1A 4L48A 5IVXE 4BZ2L 3X12A 2A9BA 5J4MA 3FFCA 4IBZA 1M7XA 2IGFL 2OX5A 3EF7A 2RJMA 2O5XH 3FT4B 1V7NH 2YQGA 3GZQA 5I1HL 2V8MA 3QDJB 4M8UA 1XXDC 1ULVA 2FEEI 5DXWA 1EH9A 5F7DA 5HI4C 2EDHA 3GB7B 4UUJB 1UC6A 4XN1A 1Z7JA 3B9DA 4U7SA 5E8OB 1UQSA 2BNQD 1ORSB 2XWTA 3SGJC 1KTCA 4LPUA 1D9KD 5F1IA 1CL7I 2X2HA 4NCC1 2HT3D 5BS0D 1J8HD 2LE9A 2DH3A 3DMMC 3GSVA 2Q76A 4H0IA 4PRIE 4H7VA 5KSUB 3DDFA 4JDTH 2KERA 1SBBA 1JPGB 1U8QA 3CDCA 3EH1A 5FM4A 1L9NA 1T89C 5AOLA 4PWKA 1JGDA 1NDGA 2V3DA 1IL1A 4OKVA 3KG5A 4DQOH 2XA3A 2C7FA 4ZS6D 3M86A 4NQCB 4NZ8A 4G9FB 1U42A 2VDKB 3DXAE 4O58H 1YUHB 1OIOA 5FW7A 3O6MH 2W60B 3VQ2C 2ZAIA 2MPAL 4EUPH 2P42B 3I84A 4JKLA 3C6LA 1LE5A 3RGVD 4X98A 1ZJAA 2FBJL 1VB9A 2EC9T 4XNXL 4E2OA 1GIGL 5TH2A 2XN9E 4RRPG 5HDOA 1IQWL 5HJBA 1LYQA 3BGFC 3VFTB 3RFZA 3DROA 2HMIC 3TIEA 1HXKA 2X4UB 1N59B 5FM8A 1A4JA 3Q1SH 2A6KA 4IGBC 4KTDH 2K6ZA 4ZOAA 3D0LA 2X4NA 2VXVH 4WWKB 3PLYA 3QFJD 3VAEA 2YA0A 3C2AH 3CFBA 3VD9A 4ZTOH 2XWDA 3QWQB 4I3SL 2XVGA 1JVKA 3RURA 3TP4A 1PFOA 2UZYA 3KEDA 4FXLA 4JO4L 2TAAA 5FUZL 3HVNA 1E90A 3GRWA 5C3TA 4L4VD 3H4FA 4R7XA 4Z78A 4Y4FB 2NY3C 2HUHA 4LEXL 2BW4A 3SDDD 2WKOF 4OW6A 2OP4L 2R1XA 3TASA 2VISB 3IFNL 3CBRA 1IU1A 4IHOA 5C09E 4CMHC 3AG4B 3IU4L 4HW6A 4QXUL 5EO0B 4OAWB 1KCRL 2R4SH 2YUXA 3RWDB 4RISL 3CN1A 1OE2A 1C1EL 2XYBA 1JG9A 4NQEE 1G7QA 4NN7B 4O2CA 1T66C 3GXFA 1BFOB 4TNEA 1ADWA 2IIJA 3GRWL 3QUXB 4L8CA 4JFQB 5CSZA 2R56L 4LL1A 1WWBX 5B22A 4KJPC 4ABWA 4E9LA 1U4FA 4G7VL 5E00B 4IKJA 5EFIB 1UHVA 2VABA 2HRHA 3DBXA 2L7QA 5SX5K 3X13B 4U6XB 2V9QA 1JUFA 3KPSE 5D1ZC 2DV6A 5D2LE 1YEKH 3QUZC 5DTFA 3CDZB 5GHWH 1D5ZA 5CN3A 5D7LB 5CCHE 5TE6H 1NLDL 4YNYA 5C6TH 1A22B 5CJXA 4GUCA 5D4HA 1FLRL 4ZZFA 1QHOA 1YA5A 1MI5D 2JFCA 2GUOA 1LEKB 3BT2H 5AW2B 3SN6N 4LAQH 4G8EB 5CJQL 5AOMA 1H3PL 3B5TA 3ZYZA 3TJHC 5IB3B 4U1KB 2B2XL 1J9QA 5AB2A 1OZTG 5F97E 3CSGA 4EXKA 3UH8A 4AY0A 3OGCA 3UPRB 3QZLA 3L95B 4NZRL 3SQBB 1G43A 1MJUH 1XGRA 5IZ7A 2DRUA 4UQCA 4UWQB 3VFMA 4F58H 4MJ6A 3BFOA 1JN6A 1RK7A 5ESVB 4JLRB 3KZ8A 1DBJH 1YNKL 4GP5B 2CPCA 4DGVL 3HFML 4OD2A 2RH0A 3FO0H 1GZHA 1WA0X 4KH9A 4PJEB 3L4WA 4LOEA 4XVUD 3GMQA 1GGBH 3S88H 4IBYA 4ONOA 1T03L 1FO0B 4GO9A 5EBWA 3MLRH 4FYQA 1NBCA 4MYPA 2DIAA 1S78D 3UJIL 3C5JB 3BPCA 1EEZB 4EZJA 2BSBA 1CG9B 3QQ9C 4G8FB 3MUUA 4IKLA 1OGAE 1RKRA 5L88L 2F7RA 3SDCA 1HEJC 5DC4B 4F37K 1E5BA 2CLRA 4XB3A 5F96L 3BDYL 1TFHA 3RX7A 5I1AB 3ETBJ 3AM8A 4HF5H 2CDFB 3PDOA 5HGBA 5EWIL 3K1KC 1INDH 3T6VA 3KD4A 2ZOKA 3OV6A 5DJAA 3VU2A 2AQ1A 3FQYA 5F1OB 4YHIA 4OGXH 1U3NA 4XH2A 4HX1B 3OKLB 1M3IA 4LFHD 2ZNWA 3PP3K 3ZPDA 4JQVA 1A7RH 3ARGA 5DUBB 5K1JA 4D7BA 5F3HB 4JY5L 2A38A 2EDFA 3BZFB 2WNGA 4NM4L 4IK7A 1H6EA 3HC0A 4JW3A 4Y4FC 4IRZA 1T83C 4A7GF 4YL9A 3RJQB 4MNGE 4S1DC 5JHLL 4G2AA 4PJ5D 3UX9B 1F4XL 3HR5A 3LKSA 3MBXL 3RVTD 3VQLA 4YAQB 5HI3D 3WKQA 3HPJB 3QQ4A 4Y9CA 5F7LB 3L5HA 4JKMA 4JPSA 5F7AA 1ZT1B 3MV8A 4JFPB 4NJ9L 3X1NA 1USZA 3FSWA 3TF4A 1WWWX 5IR1B 1T6WA 5GJSH 1UA6H 5TF0A 5CN1A 4XMPL 4XAWH 1D5XA 4FG0A 4NN7C 3VXMA 1I8MA 3V4PA 3DWTA 3PPSA 4CSSA 3BAYA 5A2FA 3TT1H 4HPOH 4IRZL 5EG6C 4K3DL 5J56B 3IJ8A 3NZ8A 3RA7L 1LO2H 2BIIA 4MJ2A 4PJ9A 3X14A 3ZHLA 4PGJA 3Q2NA 5AVUB 3MJWA 1VGEL 1QSEB 4PLKC 2ZCLH 3SCMA 2FLBT 1TZ8A 3V6BR 1AKJD 2F8VA 3RILA 4GINA 1C08A 2XQYK 1KPVB 2X3BA 3GLAA 2ADGB 4ODSH 4RZCB 4XMXA 2HRLA 2CSPA 2OYKA 4QUOA 3IMSA 4BKLB 5K5YA 3GSNB 3L5WA 3V4PL 3HAEA 5AVTB 5T8IA 4LF3B 3WTVA 1P84J 1AGFB 3I02B 5JNYB 3KYAA 4JG1H 1N5AA 3QWRD 4QDGA 4XP5H 1VACB 1C7SA 3P73B 3B3IB 3L9RA 4HJGA 3UTSE 5CMAB 5HYQB 1O6SA 1YEFH 4U6HB 1RIUL 2ORBL 1K3ZA 1T5KA 2CHDA 5F1SA 3MA9L 3OAYK 4ZOEA 1NFDA 2C3XA 3IXAA 3CFMA 1MHEB 1B0GB 3REVA 3LS4H 3WEXA 3WJJC 3O9WA 2BK8A 3MRGB 3TBBA 1W6WA 3SOBL 1CZ8H 4XE0A 4L37A 1S7XA 5AAWA 3L1GA 2DD8L 4H1LH 5E1AB 3NG5A 1ML0A 1P9MC 1DVFA 4NKIH 4DAGL 2HG5A 4LLMA 3RGBA 3ZTNL 2GJPA 2P47B 3MRQB 1HINH 4TSCH 2X7LA 5DS8A 4QT5A 1Z5LB 1BPLB 1QHPA 2I07B 2R1WB 4MJIA 1Q72H 1GC1H 4I0PD 3RY6A 3MXVH 4NO0D 1MCCA 1P7QD 5LG6A 4JRYE 5MEND 1VFAA 2FT7A 3BP6A 1NINA 1SDDB 1LO0H 1YNLL 4FFWC 5EIIG 4JZJB 1JWSA 2QLYA 3KWWB 5C9JB 1E4XI 4MDJB 4P9HH 1ZHKA 4RIRA 3B2XA 4P3DA 5ACMA 3OKEA 3PHQA 1KEML 3L9YA 5FYKE 5JHAA 5F1NB 1QP1A 3NCEB 1D6VL 2ICEC 2QPEB 3U7YH 4ZUUB 1NM9A 4PJFA 4ANUA 1S9XA 4G42A 5D7EA 4MXQD 3BXNB 2BP5M 5LGHH 1I9RL 1ZEAL 1ZV5A 2CK2A 2YBRB 5DFVC 3O4OB 3FTGA 4M6MH 3SYPA 5JMOC 1MDTA 4CL7A 4HHAA 2YD8A 5IVZA 4JAMB 2E6PA 2C7UB 1M9SA 4TXVB 5EUOB 3MREB 2YO3A 1U8CB 4LSSH 1FIGL 4LE8A 5LAXA 4L3EA 4D0BA 4X80L 4DGWC 2JQMA 5B1KA 4EUPB 1N26A 5CIPH 1G9ML 3NCCB 4K94C 4ORGA 2EE6A 1AI1L 1MZYA 1N10A 4KHTH 1JTPA 1TNNA 1MZZA 4EQ2A 3UO8B 4F27A 4L0YA 4YFEA 3WDJA 2GIMA 4DKFL 1GKOA 2EXWD 3S37L 3ABGA 3KYOA 2UV3A 3P11H 4PMFA 3DIFB 4J6RL 2AQ3A 3KWVA 3DV4A 2DBLH 3MLWL 4MWFB 2JK5B 5AKSA 4AEHH 3EXLA 2XX1A 5IQLA 3QIBB 1N5YH 4FQCH 5CD5C 1KJ2A 4FZ8L 5SWQA 3S35X 1SXNA 3B2UD 3DOHA 4R7VA 4EAEA 4H88H 2BIPA 2VZTA 3NA4A 3NIFE 5DQJA 3N06B 1QBBA 3IMUA 3L2LA 3APDA 2XTJD 1HCYA 4F8TA 1IILE 1FYTB 5AD0B 3M17A 4CADA 2X10A 3BKMH 2VJ0A 5GGRY 3SD2A 5JQ6L 3BUBA 2YK1L 4PJ8A 4KK6C 2IH3B 3O2WL 3KGSA 1C5BH 4NRZA 5A2BA 4U1IA 3QZBA 3OPZH 2MEJB 4JO1H 5I8CA 5KVFH 2DIJA 5E6IB 3GSUB 1WH0A 1U8HA 4AYFB 3D4YA 1DVXA 4YC2B 5BRPA 5ESAB 3VFPA 2W80C 1YY8B 2V17L 4EKJA 3Q8CA 2JJTC 3FQ4A 3FUHA 2CA4A 1DSFL 2DQJL 1LP9E 1YMMB 3HUJF 3RX8A 4AK2A 5KTEH 1IKNC 2Z0BA 2PR9A 2C1PB 1U33A 3OTTA 5D1XE 4WI0B 3I6LD 4OF7A 3MV7E 3GBEA 2CGRH 4XXCC 1HU8A 1XGTB 2V33A 2FSEB 4QXGH 2AXHA 3DX3A 1WP6A 4LHUA 1I9JL 5KSBB 4PJXE 3ISWA 3DOSA 4N87A 2XWJA 3ECBB 5IBUG 1Y07A 1U91A 4PR5B 4FGMA 4AC2A 4NO3B 4JG0H 5DHYB 4D9LH 5C6PB 5DDHB 3HHSB 3KM2A 2CUHA 1D2OA 3RIAF 2ZCHL 4JZJC 3DHUA 1GOGA 4H2CA 5CCKH 1K9TA 2NCEA 2GSIB 2QVKA 3PUUA 4ZXBB 1I1FA 2F74B 1FDLH 2ADFH 5JHBA 4KO6A 3LZNA 5IJVA 2VSKB 4PJGE 1HSBB 2HPOA 4DW2H 4L4TB 1Q9WA 5DJZB 1JYVA 3PP4H 3OZLA 3VI4E 1RK0B 5ELIA 4JJHA 1DO6A 1OAQL 3O4OC 1Y18B 3EFDL 4JKWA 4JPWL 3WNPA 1YVLA 1IFHH 4OFYD 3EYQC 1MRCL 2NOYA 1I1AB 1BQLL 3BP7A 3DO3A 4QO1A 4Y1AA 4DO4A 1HEZB 4BFFA 4W1TA 5J3HD 4QCIA 4IS6A 3IRCA 3ZN6A 4OZ4A 4XNDA 5FO7A 4LT7A 1FZJA 4NZUH 4NO2A 3NIDE 2JCCF 2YPLA 1HE7A 3AG1B 1TJGL 2A0LD 3B6SA 2C3VA 4BQ8A 3QIUD 2VXTL 3KPPB 3TYFA 4ODVH 3F05A 4AGQA 2EDOA 2E7DA 1LDPL 2X5PA 2NW2A 4PVMA 5SX4I 5I73B 1GGTA 5BW7A 5DVLA 1TZHA 3U36B 3TJEH 3JVGC 5A40E 2R39A 3FZUC 3LKNA 4HS3B 3V9FA 3WUZA 4ZG1A 2QQKH 2DJSA 3QIBC 3SE8L 5IJKA 3DX0A 4I88A 3D3VD 3V52H 3W0WB 3FQRB 3AAZB 5ICXA 2OMUB 3ZYJA 1CFTB 3E6FB 1KXVA 3HN8A 4UDUB 3FB8B 4WW2A 4ZMPA 1F45A 3G5YA 3FCUB 3FF8A 3IDNB 4LLWB 2V7NB 2ZWYA 4AYBA 3BH9B 3MV9D 4MNHB 1QMUA 2VERN 3LZQA 4HUUB 1AOZA 2YKLL 1OP5K 3GHBL 5IM7B 4V11A 3TYGH 1V7MH 1RIVL 2KUTA 4RLDA 3VWKA 4ZDHA 7PAZA 3VW3H 1Z5HA 2ESVA 4QYAA 4WCYH 5E6IC 3U0PB 5B3NA 1PSKH 4ZD3L 4KI5C 4ELMF 1U8MA 4YHML 4IU2A 2JLPA 3WUWB 1OW0C 4YC2C 1QNZL 3ZTEA 5E8PA 3WU1A 2B14A 3IDGA 5IW6A 3IJSA 5EORL 5EBMB 1QYGL 4GUOA 3U2IA 5IFHL 5D5MB 3FB7B 1G87A 2HVJB 3U2SB 4BSWB 3WV0A 1TKWA 3FCTB 5I75B 4XNZB 1F41A 4O9HL 3IF1A 1RVFL 4RETB 3WFEH 5C0FB 5F72S 4QHUA 3T1FB 3Q2LA 4OLZL 1AC0A 1MY5A 5DD6B 4BDVB 1KACB 1SGKA 1CU4L 2ZWNA 1TCMA 5DD1H 4AE1A 2XWXA 4ZI8A 2BY2A 4N20A 3Q8AA 1ZCRA 1DJHA 3E6HB 3V9CA 5K69A 1U3JA 4C83A 1EAJA 2IFFH 3CSPA 3P2TA 2VRKA 3TBWB 3WHXB 3VXTA 2GCYA 2FNBA 4ZXBC 3GHEL 5D7HA 1XB8A 5DJ6B 5ERWB 3EJYD 4QTIL 4MA1B 3S3BB 1DFBH 2EDJA 4OCSL 5I1CH 1CLVA 4ODXA 4ZW3A 4UF7C 3QS3A 4GG6B 5K9JH 3US9A 4AGPA 3BD5A 3KYKL 4G5ZL 1HHKA 4LNVA 5HYEA 4UYQA 5F7EH 2IOOA 4H1LB 3WHE0 1C7TA 1IRAY 1L4IA 5JDSA 3LYRA 5LN8A 1QLRA 5AWNL 1ZY9A 1I1AC 1Q38A 1OCZB 3HLAA 1XSJA 4MZIA 3BC9A 2F5BL 2J1WA 2YD1A 2R0WH 3UTZB 1XH2A 5KZCB 2XICA 4P49A 4URTB 4ZSOE 2PPDA 3MRHA 3UC0H 2AV1B 3DURA 4K3JL 1FBIH 5FO8B 4FTVB 4YFLI 1V8HA 3VYOA 3GD1C 3RKDC 5CEZL 4KDTA 4ZW8A 1ZT7A 4LCIH 4WRLA 5TTRA 3R06B 2CGZA 3V2AR 4UTAH 5E6SB 1A3QA 3ULVF 3IBOA 2H9GA 3H42L 5B7FA 5DURD 5C97A 4ZUSB 5C07E 2UXTA 4N0CD 3QC6X 2N1KA 4S0HA 5DSCA 5I73C 3D12B 1KENL 2RR3A 2H0JA 1PZUB 4UOJA 3C60A 2A9NH 2VSDA 3B1UA 1A14L 4HXAL 5T1LB 4N6RB 3KBPA 2EZ0D 1SOKA 2DI8A 2Q20A 3FCSB 2ISDA 4WW2F 4XCCL 2ZXGA 1VZHA 1QBLH 3FUEA 3FB6A 4RA3A 1NC4A 1X6LA 1R0AH 2XTSA 1RJZA 3OG4B 2JV6A 2YN5A 1EO8L 1EFXB 4X9FA 1QI4A 2DMBA 1MCEA 1PG7W 4LEOB 2V5TA 4XXWA 3H8NA 5CIPB 3SKJL 5LWYL 5CWSB 4PVBA 3H0TA 5BRZA 2GJ6B 1PFCA 5FYJL 3VH8B 1A9EA 3PQYA 4Y19E 2H26B 4PJDF 2AVFA 2IG2L 5CBEA 4M00A 4AL8L 1DEDA 4OIIL 3ULVD 2EE0A 4GQ9L 1IMHC 3QJXA 2VZUA 5DMIH 2EAEA 3QUYA 1J9RA 1NEUA 1SF5A 2FCBA 1F4WL 1F1DA 2QJDA 3MRRB 5CILH 2ZCKL 1Z3GH 3KPRD 2CIKB 4NJAH 1QR1B 5FDWB 4XCEB 1JFQH 4H26B 4X5WB 5KSAD 3ARSA 3A22A 2QKIA 4GXVL 2ENPA 5IWLC 1MLBA 4JY6B 1BVNP 3DK2A 3DVGA 1CFQB 4KVNL 1RUAL 4M7ZB 4AQ1C 5I75C 4XNZC 1FFOA 1ZGLB 4MLSA 4DK5A 5KJ7E 1XF3B 5FGRA 1ES0B 3NP4A 2PCFB 4FKHA 1I7ZB 3TCLA 4PG9A 4K23H 1HQRA 1T2QH 2Y07L 4MA7H 4K5OA 4JKPH 5JXAH 4HKZA 5F7YC 1OPGL 3MROA 3CVHH 3FTVA 5AW5B 3B43A 3LRKA 5B4MC 4YDIL 1IO4C 5HYSA 5LNDA 5J5EA 2AVGA 2FWSA 2EE2A 3TC9A 5C0CE 2R2EB 4N1EA 1KLGA 3WL9B 1MCWW 3WEOA 4MA1C 1HAUA 2Y2TA 2OZ4A 3D6GA 4CNIB 5J9PA 2JKNA 3GZKA 2X28A 5JPMA 1KTKE 2D7QA 2FWUA 4KK9C 5SWSB 1KTBA 2BS8A 2WXRA 2CRIA 1I3GL 2OMVA 1YECL 2ZXDA 4FA6A 5C9KA 4WSKA 4JB9L 4ODTH 3NFSL 5KSVB 2G4GA 3EJCA 1HAWA 1QBAA 1Z9SA 2APBA 4H8VA 4MYWB 3IB4A 2V5MA 3WO3B 1GC1C 1ZPUA 2N01B 3D25B 3PXLA 4YBQD 2J7LA 3CZLA 2M2DA 1J0KA 2DQFB 3G6DL 3SGEI 1ETZB 25C8H 4G3YH 4HOXA 3LKQB 1UASA 1IM3A 2IC2A 3NK4A 1V54B 4P9HC 5B38A 4YQXL 3RAJL 4HS8L 4N5EC 4L8DB 2JLLA 1MCJA 4YSTA 5GS0D 3UJJH 2ED7A 3QRLA 5I82A 2K45A 2AEIT 5F7MC 1AHWB 3PG2A 3AITA 3LZLA 4PYGA 3BH8A 3TLRA 4LSVH 5IQ7L 2RA1A 4WW1A 3TA3B 4KNQA 4NUGH 1CFNA 3LNGA 4X4MA 3TU6A 1RLBA 1Q9LB 4FFVD 3MRCA 4M6OH 1FNSH 1B3IA 1JERA 1T1YB 2J57A 3OR6A 4GI8A 4IKKA 3T0VA 4C56D 4Z7VA 3IDJA 1NCJA 3PJSB 3D85D 5M94B 1WE5A 5ALCL 4PMEA 5E9DE 1O5DT 5IJBC 4P5TB 4ZW7A 2K4WA 2F61A 2EYRB 4G1MA 1CLCA 3LKRB 4AM0B 2OJZH 4BHUI 1JZ2A 3UDWA 1HQ4A 4F24A 4A7SA 3JBG7 4MX7B 3FT0A 1T4KB 1AYRA 3RL2A 3OKOB 1MCDA 1RIHH 4UINL 4TVPL 1H19A 1IAII 2FDBP 1NGYA 4WO4B 3F12A 3KPNA 4HIXL 4C54A 1W72B 1WHPA 4JR9H 5F9OL 3D69B 5EA0H 5IHHA 3BPNC 5DMGD 4F5CE 3T8VA 3GWJA 2R83A 1F1GA 3AUWB 3LNIA 4M7JL 5C0ND 4GEIA 2Q0ZX 3M6DA 4C59B 2Q8AL 1NCDL 1YEGH 3FU8A 4NFDA 1PZCA 2P5WA 1DCLA 2DWEB 3C87A 3GRGA 2GTWB 2RQ8A 1RJCA 2BVOB 4ENEC 2EEDA 3B4NA 3FS9A 2YHGA 4UQ2A 1JV5A 1L6XA 4K0OA 1AY1H 4M7ZC 1ZAGA 4RFOH 4M8QA 5C0IB 3ARFD 2YLKA 4OJYA 4TUOB 2DWSA 1ZPLA 5BV7H 4FFYA 4ONGL 3CZFA 3SDYL 4F2FA 2VZ1A 1NUGA 3MRLA 1J86A 1IAIM 2WBJC 2K70A 2PTTB 4QRRE 1BWWA 4X7SH 3MRNA 1KBKA 3RGHA 4MCMA 4TQPA 1A7PH 3KLAB 1CE6B 4FADA 3FQ1A 1KGXA 4LGRB 2LOEA 1R3HB 2P24B 2RBLA 3R4DA 2XU9A 3L3JB 2EIKB 4GW4B 3WI9A 2FTAA 3QCTL 4OV5B 4XBPA 5E5MA 3AWFA 4NWUH 1HXMA 4NHUB 2APSA 5EU3B 2MCPL 5HDBE 3B83A 3LN5A 4I2XB 1OO2A 1U3HD 3BLBA 2ZWZA 5AW0B 1DJWA 1KJ3L 4MA8L 1WZ1L 5E8EA 4G8IB 5F7KC 4LCWA 1HWGB 2EDLA 3FW6A 3TN0D 3BZDA 1GHFH 2E47A 3RTLA 2JB6A 3QUGA 4UM8B 2ZX6A 1C5CH 3QO1A 2ITCB 4Z7QE 1DDHA 2EVGA 5DJ2B 3JWNH 4C57C 3HNSH 5KANI 1KFAH 2OK0H 5CZXD 2IWEA 4LKCB 2PWDA 2DM7A 5T5FA 2HMID 5BO1L 3QEQD 5GGUA 5BVPH 3SSGA 4FRWA 2ITEA 5FFGA 3KBFA 1RZIB 2IBZY 3DJZA 3WNMA 2X4RA 5IK3B 2G2RB 4X8GA 1MHHA 4QF1A 5D7IB 5KVDH 2HFFB 5GSRB 5TJWK 2XXCB 5EO1A 3GSOB 1ZHLB 5E2UH 2WLMA 1MLCB 4WV1B 5K9KB 4OZHE 1AHWC 5I1JL 4OQTH 4DP5X 4KTEH 1DLHA 3TA3C 4P4RA 4LP5A 5T5FL 5CHNB 1B0RB 1GJIA 3N42F 3AY4A 2CBMA 1LQBC 4JFFA 1BVOA 5I5JA 4KXBA 5H37H 4CRPA 3QQ3A 4N2AA 2VR3A 1MUJA 2BNRD 3WBDA 4P5TC 1WBYA 3VD2A 3QUMA 4DO6A 2E7LC 3ARPA 4GSUA 5D1QD 1KYFA 2VXQA 3VQMA 3F5WA 4FFZA 2DYPB 1FPTH 3GUFA 4I7ZC 5LGJA 3BESR 2W0KA 1IT9L 5ETUA 2IALB 4YEEA 3UO1H 3FRPA 4EOWH 1XCTB 3NVQA 1ADQH 2HG0A 4Y4KB 4HUVA 2WTRB 2YOAA 3ROOB 3RVVC 3TPUA 4BQBA 4HK3N 3P69A 4PS4L 2ZPKL 4JX0A 3PGDA 4J2XA 4TVPD 4WEEA 5LXVA 1ZLWH 2Z91B 4ZQKA 5E1HB 5EZOL 2XYCA 4Z7OB 2VXQL 2EECA 4NAQA 3WKML 5FFLA 2N4IA 1NCOA 4ZUTA 1OF0A 1KBWA 5T3XL 4XMTA 4PJIF 4XWGL 3DI3B 1QI3A 4YS4A 2NY1D 5FB8B 2X3AA 3VD3A 5JUEH 2BDNL 2R2BA 2CKNA 2OI9B 2A6IA 4F7CB 4CGTA 2BHZA 5ISZD 3ZDXF 1QEWB 1X7SA 1YG9A 5JIQA 4R96A 5HHOE 43C9B 1TT6A 2FATL 3DHMA 2ZUTA 4EF3A 1XGQB 2ICWJ 2YZ8A 5CO1A 3TV3H 3RUGF 1MF2H 1PIGA 1R3IL 2HVBA 2IO5A 1B6UA 1FFTB 5H94B 3K2KA 5FGSA 4O2FB 4PGEB 2AXGB 5IB1B 2GPZA 3DSFL 4K3EL 5I8KH 2XDHA 1U8IA 2I26N 3GINA 5EOCL 1GYAA 2F53D 3EJUA 3HAEG 4PJHA 4XI5C 2QV4A 3PWPA 4G80A 1F6LL 2CBPA 3CHQA 4B96A 2VLJE 2GKIA 3L8QA 1AIFB 1FAIH 2XBTA 1KN2H 4KQ3L 2DY2A 5D1XC 2NZ9C 2BP0A 3BH4A 3NCFB 2WW8A 2XVKA 4RFEB 5FHAL 3HCVB 3DJSA 1T0MB 1FA4A 2NDGA 3OG6B 2D2CC 1WC7A 1E2WA 1F4YL 2NW3B 2E74C 3G6AB 2L4OA 1ETA1 3FUNA 4L5FL 2X6AA 2DQGH 4UQBA 1BA9A 3VFGH 1T1ZB 4Z1PA 3CVHB 1C9SA 4ERSL 4NQVA 4QHLB 1F0LA 5FF6B 4M4PA 3ZSTA 4WTWA 4G6KH 3HZVB 2J72A 1RPUA 2OXGB 1J8RA 3KPMB 4FQLH 1X6NA 3BLKA 5D70H 4HU8A 4UDTA 4IIQA 2WANA 1OWWA 2FEDD 3CG8A 1E27A 2Z6FA 4DUWA 3T3ME 2NZIA 4WV1C 3DGGA 4XVSH 3L3KB 4KKQA 5I0ZA 4K9JA 1VFBA 4XMKH 3VFSA 3U6RB 5G55A 3AWEA 3OZKA 4YHKH 5GISL 1WUNT 3ARED 4UT6A 3C75A 1X5AA 4OM1H 4V33A 4AEIL 2PPEA 1OM3L 3FHEA 2DWDA 4Q56A 4F7PA 2GW5A 1QAWA 2W9DH 5I1EL 4A6YH 4JBSA 1S5IH 4R0LB 3CIQA 4X0KB 4N0UE 5CGTA 3W39B 4NKMA 2V9UA 1UA3A 1Q0XL 4Y9BA 1GS7A 4W70A 2Y7MA 3O3DA 4WI2A 5HYJB 2FX9H 2EEXA 4G72B 2WNXA 2J6EL 3ETTA 4UZSA 5JW5B 1BBDL 2WWMC 3SGKC 1AJ7H 4H5SA 1QFWH 3O6FB 4R7DA 1H5BB 3CSYA 3DSNB 5HDWA 3MODL 1XTLA 1XGYL 1JPFA 3RPBA 5CINL 2XZZA 4RMRA 2VR9A 4GP8B 1Y1UA 2OTUA 4DPAX 2J2ZA 1KN4L 3ARBB 2WQVA 2ZE0A 1ZLVK 4BZ1L 2GTZB 1E5UI 1YUKB 3D18B 1OVZA 1XF4A 2YQBA 3FUIA 3QI9A 4W93A 4I5BA 3OL2A 2WVVB 3HI6L 1SN0A 4WI3A 4Y4KC 2FQEA 2MFNA 1J87A 1IM9B 5IEKA 3WIIL 4LP4A 4G6FD 2NNAB 3T8MA 1AGDA 3RZWA 2CLZA 4JL1A 2Z1KA 3X11B 5I1LA 1KIQB 5IFJA 1WG3A 4OCWH 4TQHA 2B15A 4UNVA 4C8XA 5KVGL 1E28B 4NGHL 3P4NB 1PL3A 4OF3A 4G8GA 5C0AE 1KEGH 2I27N 4LVEA 4AM0Q 3V4UH 3TBCA 1CO1A 1OLLA 1T04A 3U25A 2NYYD 2YMXH 2JB5H 1HL4A 2X89D 3BI9X 4PGCA 4PI2A 3WXVL 2OI9C 4D0DB 5KJ4A 4HCRL 5ADOL 1MW3A 3T0AA 5T3XD 3RVUC 4L2YA 2DLHA 1IGIH 2CDEA 2I7OA 5LHDA 2EINB 2NT0A 3VB8A 3JWDL 3A67H 1MKFA 5FWQA 5F6HI 3B7YA 3WS6C 1W0YT 1INEL 1D5BA 1S5HB 4TSBL 3SDAA 2Y7OA 2VZ3A 1THCA 4NP4H 3VACA 3MLUL 2CZNA 2B4CC 2VLKA 3FCBA 3LXUX 5EBLB 1DQMH 5HXMA 2OMWA 5JHDD 5I6XB 1B4TA 1GJUA 1JWUB 3FOMB 2A1WL 1CGSH 3VI3E 3QXUA 4LIQH 1Z9OA 4C4KT 3C2SA 4ZMAT 4LASL 2FL5A 1SDYA 5I19H 3O81A 2D7MA 5L4JA 4MD4A 3I9IA 4LOFA 1FZKA 3JV4A 5BV7B 4BUHA 3ARDA 3SKUD 5LUMA 4EQ3A 4KAQL 5FYLH 5ILTL 1NUDA 3MJ8A 3Q06A 1AS7A 2E8YA 5D72H 4M8RA 3KPLB 3PL6D 4U6VH 3EOTH 5TDOB 1JMZA 3KVQA 3TBVB 4Z5RB 2FGZA 5IQOA 5L7XL 1WD9A 5LQBL 5E4EC 3T0ED 3EDEA 4JHAH 3IMRA 1S9VB 2OMYA 1NKRA 3GLZA 3T6QC 3C8KB 1PZBA 4YFDB 4LHUG 5AVXB 5CKAA 1OWRM 1H8LA 3MOBL 2Z8VC 1UENA 2VQ1B 4M5ZH 3RWIB 1SVBA 3QAZB 1OGTB 3AZUA 4U2YA 1DBML 4WUUA 2B1AH 3WCYA 1IBYA 1NCUA 3NCYS 4ODHH 4R97B 4X83A 4YVNA 5K59F 1YY9D 5CD3B 2QEJA 4C4KO 4KJQD 1MCRA 3LEYH 1DQKA 3ROLA 1FL6A 4R0LC 2WSDA 2IMNA 3MLYL 4M5TA 4TVSa 2Z4TA 5HTSA 3V0VA 3VXQA 2XQYA 1M2OA 3B34A 2VDMH 3TM6A 2HLAA 1R75A 5FS5A 2YJQA 5F2FA 5HSFA 4RGOL 2AI0H 4UQ9A 4JO3H 4IRSD 4XC3L 3TBSB 4B9KC 4OLVL 4BSVB 3DYOA 7FABH 3O6FC 1XWVA 1U92B 2I7SA 3T4AB 4DKEL 3EOYG 4KRNA 3T1WA 2DQIL 1A9BB 2H45A 2ID5A 1KIRA 4RVBA 5BXFB 1EHKB 2DF3A 4Z8FL 2ZG2A 3ARBC 3VJ6A 1I3RA 2OPCA 1CGWA 5JQIB 1HYRC 2C9VA 2MNUA 5TD4A 1GMIA 3EZ8A 3N41F 3ESNA 4QYOB 5CZKA 1LD9A 3MFFA 2ITDB 1FVCA 4OZGA 2WP3T 5ADPH 1S9YB 3TEYA 2AXFA 3QUKA 5DI8B 1RZKH 2X4OA 3W11D 4JFWA 1B6DA 1NSNL 3B5HA 2XA8H 3ARXA 4NI6A 3CX5K 1GKEA 1OAZH 5EF2A 4G82A 4TF4A 3G5ZA 1ASPA 5GQBA 4QJ3B 4RAUB 3L1OH 3VXSD 2NX5E 2FYVA 5IOPB 1R9FA 4I77H 3QXTA 4Y1TA 5CLWA 3HVDA 4KDWA 2O61A 1G7MA 2BVEA 3H9SA 3LQAL 3OGOE 4KX9A 1RZGB 5JORA 1Z9PA 1CYGA 2YRLA 3N40P 1HOEA 2F18A 3N2JA 2PN5A 4MCYB 4ZFFA 3BW9B 5I30H 2UWEB 1UWXK 3NJHA 3QEGH 2DN7A 2PYEB 3B9KD 2LHAA 4XNMB 2R29H 3IU3B 3B7TA 5E0QA 3TWYA 4OQ1A 4FNLL 2CM6A 1IEAB 1ICTA 4J3VA 1E6OL 1WZKA 2FEEL 4KHXH 2Q5BA 1AD9B 4OLUH 3SKMA 4X5QA 2VITB 3Q13A 3I6KB 4JHVA 4ZAKB 2WP3O 2Y1ZA 4OZFH 3WJLA 5I6XC 2NUPB 3ASOB 4YXHH 3B8SA 2AJ3A 3D1MC 3O2DA 4L1HA 3SPVB 4E0RB 1YNTA 3PPEA 2QZ5A 2HT2D 4QRPE 5B1JC 4B53A 4O51B 1DN0A 2AJUH 2CKBH 2J5LB 2Z92A 3GNMH 4HH9B 5CF3A 3K4ZA 5BV7C 3G04A 4BZ2H 1I7UA 3ATFA 3EYOB 3DLQR 2IGFH 3QDMB 5AW7B 3S2AA 1JGLL 1T5XB 2BOLA 2NNXA 5EC1A 5E99L 2HFGL 2EO9A 2FUQA 1TTBA 4QRUA 1RJYB 2I5YL 5I15L 5DHVA 2P8MB 3O4LB 3V0WL 3O2DL 1RZJC 4R4BA 4JFOB 4Z3HA 3MGOA 4OGZA 3ZE2F 3P77B 3SJVD 5DMJB 4GQQA 4JQIA 3GSRA 2WVTA 3NEXA 2NUTA 4ODWB 4Q9QL 2DMCA 1ZANL 4E41B 3D39B 1AO7D 5F0MB 2BNUB 1IC7L 4HV8A 2XRAL 4ADJA 3QAZC 1TENA 4B9PA 3EO1A 4FTVE 4R97C 3IPFA 4BKTC 5E2VL 2D73A 4BA8A 2PO6D 4X6DA 5GZND 5J6GA 4UV7L 4FF9A 5EOTB 3IK2A 3KXFE 5JLZB 4K5LA 1XIWA 4L8SB 1A6UL 3N91A 4PP2A 1G9NL 2MPAH 1EPFA 3GMLA 4AXWA 3QXVA 4JQIL 5KAQF 1A6AB 4CGUB 2P26A 4LLYA 3NK3A 3S35L 1CT8B 5IBUB 3CXDL 4FHJA 2FBJH 1BJ8A 3GS4A 3MYJB 4XNXH 5EC2B 1BQUA 4LQFL 1GIGH 4G6AC 5HI4D 5D4IA 1IQWH 4NZTL 3T4AC 3D4CA 1SPDA 4GLRI 2EXYD 3VD4A 5KOMC 3TVMB 1HH9A 3KDMB 3LDBC 1OAXL 1ND0B 2VKWA 3ZZLA 4JFEE 3VXRD 2XN0A 4HIEB 4HUWA 3DMMD 2XZQL 2DKSA 4Q74A 1FV1A 4FQHB 4Z7UE 4WEUD 2DLTA 4JHBA 3S2CA 1SXAA 5D4JA 2ZNXA 4U31A 3RVXC 4I3SH 3PWNA 3MRFA 4HJJL 5FUZH 3A4DA 4JO4H 4ZNCD 3GUTA 3TZVA 4A6YB 3BUDA 3WHE1 5FECB 5FOBA 2X9YA 4NP9A 5F7FA 5GS1B 2VM9A 3AADB 1LGVA 4ES9A 5HI5C 1CICB 4LEXH 4P2AA 1J0IA 1P6FA 4HFUL 3FO2B 2Z31B 2OP4H 4XPTL 3IKCA 3C5ZD 3O0LA 1N64L 1UGNA 5DVKA 3IU4H 4QXUH 1PKQA 1B4LA 4P2RE 5GPRA 3RL1B 5E0FA 1Y0LA 4TVUA 3WY1A 4P23A 1KCRH 4JFHE 4RISH 3O3AA 4P46B 1C1EH 3RE0A 4IGBD 3QYNA 4DKAA 3D2UA 2AK4A 4OZIB 3GRWH 4BQ9A 5CJ5A 1A3ZA 3ZL2A 1WAAE 1QW8A 3RNKA 3IBEA 1QFHA 2R56H 5D9SB 1EGJA 1BAFL 1U8PA 4PG2C 1LM8V 4G7VH 3L3DB 3EOBB 1PG7L 4OUOA 3NJGA 4AIEA 2HJFA 1T1WB 4ZAKC 1UKTA 3SDXB 4FD0A 4UM9D 2NY3D 1O5PA 1QRND 4FCAA 3BWUC 5DO2C 1NLDH 1E5YA 3VXME 3MRPB 4G7SB 4JFTA 5C92A 1WIOA 1FLRH 3BVUA 5HHVL 2OW6A 4XOBA 2J5LC 2ZYSA 5DWPA 1JF1B 3UZEA 3V4LA 3MGAA 3EJSA 1EGJL 4XN8A 1F3DJ 5CJQH 1H3PH 3QNYA 1UVQA 2B2XH 1KT2A 1JHTB 1T66D 2K1MA 3ZKMC 1CI5A 4JG5A 4NZRH 3ZMRA 4MXVF 3HBZA 5AUMA 1LWHA 5FA4A 3Q9QA 4FERA 4KJPD 4P2QD 3BDBA 4Q6IA 2VCOA 5DGRA 3QFDB 1T7VA 1MPAL 1M3JA 1U4EA 5I17B 1AXSA 1MCSA 5IW3A 5I1GL 1YNKH 1AS6A 4GKNB 1QLEL 3GK8L 3HFMH 4DGVH 3V8OA 5D1ZD 3L6FA 5D93B 3QUZD 4Y16B 1QUNB 2LU4A 3JTTB 3SBRA 1T03H 3RDTA 2VH5L 2YAOA 5ESQB 2GG1A 1FNEA 3ZHFA 4Z3FA 2WJ7A 2BZCA 3OB0H 3IM1A 4I13B 5KYUA 5INCB 2AQRA 5I6KA 3US0A 3CVIL 3ZVVA 1B2WL 3UJIH 1TJMA 1UXSA 3U9PL 4L8SC 3MCKB 2DM4A 2YD3A 1JP5A 3RWJB 3TJHD 3G5XB 4A04A 1R3JB 3WS3B 3QDJD 5GRJL 5L88H 3MNVA 1G7PB 2FJHB 2FH6A 3LN4A 3QG6A 4BQ6A 4XNQB 1KB9K 3D34A 3DETC 3BUYB 1EEYA 2Y5TB 5F96H 3BDYH 3KHQA 5HHPB 3LKPB 4XHQA 1FO0L 4NSKA 4ZYKB 3TVMC 5I0DA 4RDQF 3SBQA 5F9WB 4ATWA 1RHFA 2GITA 5EWIH 5IMKB 1Q8MA 2JKSA 2NSMA 2V2WA 3CHRA 1QX1A 3TS8A 1J1PL 1ZA3A 5DEFB 2E75C 1FZOB 2OMTB 3QIWB 3I9PA 4PJAA 3FO1A 1FHNA 3NIGE 3RGVB 4PRNA 5I26A 4L3CB 4AUJA 1THAA 4K8RL 2H32A 3LSOA 1EZVY 4PJ7B 2Y7SA 3MGTA 2AABL 2E4TA 1IARB 4G9FD 4NQCD 4X7FC 4JY5H 3DX9B 4KMTL 3CZNA 5B38G 4NM4H 3S98A 1NEPA 1TEYA 1UUSA 5EB9A 4PJFE 3QQ9D 2O6DA 5DRZA 4BJLA 1CICC 4MNQE 4WDIA 5JHLH 1TYEB 1F4XH 5D7SL 2Z31C 3MBXH 3V5KB 4DVRL 5J1AB 1DVTA 5EOCJ 1ORQA 1SDAB 2KYIA 3DC0A 1EVTC 3HZMB 4IMLB 5D7KD 5FK9A 2G75B 3QR2A 4JG9A 2E27L 4NJ9H 3VWJA 3H55A 1CMOA 4KUZL 4IJ3B 4P46C 4XMPH 1RZQA 5GGTA 4HT1L 4XCYB 3CXHJ 2LAGB 3IGAA 2P46B 4AOFA 2RAMA 1YEHL 3W3BA 3FC8A 5ANMA 4IRZH 4PRPE 3HG3A 4K94L 4JRXA 4K3DH 4NPYB 5EEUA 1T22B 2E9WA 3RA7H 3CFEA 1YYCA 1ZSHA 5AYUL 4EEEA 1VGEH 4JQXC 1J9CT 1CFVH 5EEXA 3GFUA 2BSTA 1MW1A 3ZKQD 1NICA 2AJSL 1Q0YL 5MERB 1X5JA 4Y4FD 3ECUA 3PGFL 4PJCE 2W0FA 3AY2A 4S1DD 5GGTL 4UTBA 1A3LL 3ZYOA 1JZ6A 2VXUL 1FG2A 3V4PH 4J5VA 1FP5A 5L2KE 1YPZB 5FA3A 3WG7B 1A21A 1CFSB 2G0KA 1MHCB 4HCGA 3A4FA 3FBKA 3HG1A 2EYSA 2A74A 3QEUA 3KPQA 2BSRA 5SWZB 1IQDB 2XETA 4Y5YA 1T7WA 1T2XA 1RIUH 2BRRL 2ORBH 3UYOD 4Y5VA 2B7DT 3MA9H 4PJEF 2J20A 3U9UA 2BERA 2V3FA 4F1SA 1E4XL 1MWAA 2P7TB 4V1DE 4EDXB 3D87B 4K9EC 1ZXKA 3VRLF 4PLKD 2FRGP 4U3SA 3SOBH 1LO5B 1WAEA 1X9UA 1CD0A 2ADIB 5D93C 4Y16C 2DD8H 4AQAB 4B9ZA 2GK0A 5D7LD 4JFXB 3T0XA 3WIHA 3RI5K 5EDSA 1XF5A 4DAGH 3F7YA 4LBAA 3WNKA 3ZTNH 3QXAA 2E56A 5F7NC 4XMLL 4OSUL 4XTRC 5DC9B 3T04D 3CLFL 1RH8A 5AZ2L 4MMZB 3HRPA 4YPGB 4L9LA 1YDPB 4GS7C 3EG9A 1MWAL 1OY3B 2AQ2A 1KY7A 1YNLH 2TRYA 2PNDA 1BBJB 4M5YL 3CZJA 2P44B 2DQUL 2YC1A 1XEDA 1KEMH 1BXXA 2V4LA 2Z4QB 2A9CA 1D6VH 2VDQL 1AQDB 3VXUB 1FCGA 3LXCA 4PJAF 4CMMA 1S7SB 1KG0A 4QHPA 2JI1A 4P48A 4Q2ZA 3VFWA 1I9RH 1ZEAH 2VMEA 2R23B 5KWYC 4H0HB 4EN3A 3X12B 3CH8A 3V8CA 4FI7A 3FFCB 4HXBL 4NC0B 3QIWC 2OX5B 5H8DA 1UH4A 2H47C 2F54A 2XN1A 3WAJA 4GQPH 1CC3A 4I0CC 4PPTA 4X6EA 1FIGH 1UM5L 2Y72A 5DO8A 5F7DB 1HWHB 5CNHA 4KQ4L 1QSFD 4DNLA 3JYBA 4LAJH 4X80H 5D7JA 1UQSB 3SO3B 1WWAX 1G9MH 2XWTB 1U8JA 4B9FA 1CTMA 2A6JA 4FFWD 5F1IB 4NHCL 1AI1H 2OULB 4YDLC 2AS5M 2WJ5A 3GSVB 2Q76B 2ED8A 2JMRA 1U8QB 1INQA 2XN2A 3NH7L 1JGDB 2N1TE 4DKFH 3FU7A 1NDGB 3FFOA 4IJ3C 4NYLA 4I3GA 3S37H 1IL1B 4OKVB 4DCQA 2BFVL 1SJVA 1BYNA 1U3YA 3E9TA 4J6RH 1XD0A 2JE8A 1H15A 5DFVD 4E9TA 3MLWH 1FNHA 2P8PA 1IGYA 1WCBA 2D9CA 2Z7WA 1MFMA 1A2YA 1AR2A 4FZ8H 4KXAA 3UG4A 1UGKA 3C6LB 3Q6FA 1LE5B 3L4YA 1F86A 3O41A 4EI0A 3T3PB 2B9BA 4W9FC 4ONFL 1G7JA 5TH2B 4Z0XA 3RFZB 4DEWA 3DROB 1P5VA 3PWUA 4FI6A 1FSKB 4BZYA 3TIEB 4LRIA 5BOZG 2W59A 3FRPG 1A4JB 1JYWA 2A6KB 1O7DC 1DBBL 4MB5A 2EC9U 4KNUA 3M7OA 3D0LB 2X4NB 4TUUA 5JQ6H 2YK1H 2WXFA 3HS0A 4GBXA 4MJ4A 5IROC 3O2WH 2O4EA 1XMEB 4PAZA 3CFBB 5E6UB 4MXWH 2W07A 1C16A 4FHBD 1GL4B 2UZYB 3PAZA 5JYMA 4WNSA 3S5LB 4QY8B 1YC7A 3L1EA 4Z78B 4Z7WE 5CD5D 3APNA 2WZPA 3E7JA 2V17H 4Y89A 1PX3A 2KT6A 2HJLA 1DSFH 2DQJH 4KH2A 1ACYL 3L4ZA 4IW4C 1M2VA 1QSED 2R1XB 2X6CA 2XKNA 4GRMA 2Y69B 5AW4B 3BQVA 4EN2A 4IHOB 5D2NE 3Q8FA 1AD0B 4HYTB 4FYRA 1P4BL 5LXGL 1A4AA 1I9JH 3EJRA 2YR3A 1G7QB 1S46A 4O2CB 4PRHA 4HUNB 1KGIA 4KK6D 4AYDC 3BZEA 2OSXA 1XR8A 5HPMA 3GXTA 5IVXA 3CFJA 1JZ7A 4HJUA 2ZSVA 4K07A 4L8CB 3L3IA 5F3BA 5CSZB 4MMZC 4YGAB 1P1ZA 2FIKB 1ZLDA 3K5SA 2H3KA 2VABB 2G2NA 3DBXB 2ZCHH 2WXQA 4B41A 1B9KA 1P7BA 3BGMA 1MCNA 3GDCA 4POUB 1JUFB 3DPBA 1PY9A 5DTFB 3EYSL 1D5ZB 3B5GA 4GW1A 3E9UA 4YHPA 1BFTA 5AB0A 4NENA 5MHSD 4YNYB 3C9NA 4KJWC 2B3RA 1BMGA 1IZJA 4MB4A 2GUOB 3L1FA 5EDXA 1OAQH 1TPXB 3EFDH 3KBEA 4JPWH 4YUEL 3KWUA 2CJUL 4OTXL 2DJUA 1MRCH 1L0PA 2XSKA 3Q3GA 1BQLH 2VW6A 4FS0A 4WFHE 2GBVA 1CTNA 2O5NA 1FI8C 3OGCB 3BP4A 1M1XB 1E4KA 1HNGA 3DXAA 1IAMA 3SO3C 4BCXA 4MJ6B 4A37A 3NJJA 4C47A 2NSXA 1NWPA 1JN6B 1NOLA 1MIML 2OR7A 2CUAA 2WVUA 1TJGH 4OD2B 2IPUK 3NRQA 5BUGA 3FN9A 3RNQA 2XN9A 2PTUA 4GAGL 3GMQB 4GPVA 2YFOA 2VXTH 3FDWA 3RTQA 4Z7AA 1LDPH 4PCKA 5EBWB 4XVOA 5LDUA 4XN2A 4JHUA 3EGDB 4NCDA 5BZWA 1A6TA 3P1VA 2HKHL 3BPCB 4ZK8A 1O9ZA 3SE8H 3ULUE 1SJEA 5B3JF 1CR9L 3EYQD 2F8IA 3GS0A 2H8PA 3NCBB 4PV1C 4F2EA 3C6LC 4WU5A 4I8DA 5FLVA 4X4XA 3GO1L 5AVRB 5LBGA 3MNZA 3SDCB 4WTXA 3VDAA 3WSQL 2CLRB 5I1IL 2UX7A 5GGVL 3RFZC 5FUCE 1CXEA 1FSKC 3A6OA 4JCLA 5C08E 3VYPA 3RFRA 3PDOB 3EJTA 4XBGA 2RFXA 5HGBB 3ULVH 3GC3A 3E8UL 1KYOJ 3Q05A 4AIZA 3KPTA 1MFAH 2YKLH 4IDLA 1BZ9A 4IHBA 3GHBH 2ZOKB 2Y7QA 5DJAB 4ZQTA 3UMNA 2GAZA 5C09A 1RIVH 3BPOB 1J48A 3G6JF 3GLDA 4FJYA 4PS7A 4YHIB 4KMQA 2VLRE 3BRDA 4WK2B 2BWIA 2FGWL 4YHOL 1PEZA 4NQEA 4TLTA 3ARGB 1IAKA 3NABL 4ZD3H 4YHMH 4PSRA 1M6UA 3QG7L 2FECI 3FZUD 1QNZH 3QIBD 3HC0B 5HYIA 1JSYA 3O8XA 5EORH 5C70A 1QYGH 2J44A 5E7BA 3R7QA 3HR5B 3LKSB 4BH7A 5IFHH 1EQWA 3QQ4B 3Q5OA 3TT3L 3KPSA 1FYTD 3IE4A 3MV8B 5D2LA 4DPBX 5IUSA 4O9HH 4F15C 1RVFH 5IVXF 3RWGA 1TZOA 1UD5A 3JZ7A 1D5XB 2ZAHA 3IRZA 3U7AA 1I8MB 3V4PB 3FF7A 1J1OH 4OLZH 4UOQA 4EIBA 2IPTL 3K6DA 3SPCA 4LVNC 1CU4H 1DP0A 1QASA 2IPKA 4GUPA 5G4OA 2BSSA 3IFLL 3WLWC 4XCNA 5E6ID 3BZ4A 1GGYA 2I9LA 4FLSA 4PJ9B 3X14B 2NTSP 4KI5D 3RKPA 5BUAA 3SCMB 3OPUA 1AHKA 2XZCL 3WKNA 2I24N 1XDTT 3GHEH 5HGDA 3L16A 1C08B 4QTIH 3GTNA 4N2BA 1OSYA 1YMMD 3II2A 1VERA 4OCSH 5E5LA 3RJOA 5CJXC 2YEZA 1GW0A 3MNDA 1BAWA 3L5WB 3KW7A 3HAEB 3JWNE 5I0WA 3KYKH 1K5WA 2GFBA 1TPXC 4WKXA 1N5AB 4HALA 4YZWA 3DIDA 4OUUA 4GB9A 4IBLT 5AWNH 4GAFB 3IJ9A 3BVNA 3GS7A 5GIRA 1MCFA 3FHAA 5DFWH 4HJGB 3L9RB 2F5BH 1O6SB 3NSJA 4JVPA 1BIIA 4MQ7A 3WNNA 4K3JH 5AAMA 1NFDB 2EVHA 5HJ3A 1S7UA 2OV0A 12E8L 3MA7A 5CEZH 4R5VA 1BF8A 3IXAB 4NNYA 1NGXA 1SY6A 5DJCA 1OGAA 3REVB 3WEXB 4FMKA 3O9WB 4DKDC 3S4SA 1R5VA 3R18A 1GZHC 3L5XL 1S7XB 4L37B 4ZXBD 3LHAA 3H42H 1OEZW 2W5PA 4PRDA 2P5EE 1DVFB 1I8LA 3HB3C 2HG5B 4LLMB 4L4TD 2APTA 5DHMC 5FOJA 1VFUA 5GGSA 2AFNA 1FFRA 4D2NA 2X7LB 3OWEA 4PJBE 1KENH 4QT5B 5DS8B 3ZRCC 4MJIB 4R2GB 1RFDL 4NQUA 1A14H 1AQKL 1BD2E 1D3CA 2UXVA 2XQYG 4HXAH 2Y36L 4PRID 5KS9E 2VDNB 2G60L 1D2PA 4BWUA 4XCCH 2YGOA 4KK8C 1VFAB 4MHHG 1I1AD 3BT0A 1SY6L 4RCAA 4B9CA 3BP6B 3KM1A 1TEFA 4WSGA 1JWSB 3SDCC 3VXOA 2WYIA 3UZQA 1UCBL 3UTTE 1ZHKB 1O75A 4RIRB 4P3DB 5KG9A 2QL1A 4AW4A 1J5DA 1ILSA 1EO8H 5CJOL 3RKDD 3SKJH 2WYZA 2Z93A 3AM8C 4I9WD 4MNGA 1S9XB 4G42B 2XG5A 2IANE 4WQOA 5LWYH 2E5EA 2HA1A 3FTGB 5PAZA 3V6FA 1KTLA 5A2AA 5FYJH 3BPOC 2BM3A 1RSFA 2CGYA 4MVBC 5ABDE 4HHAB 2IG2H 2RMNA 1REIA 3HBGA 1AZNA 4L8BA 5IVZB 2BXYA 4AL8H 4F2ME 4GQ9H 5LAXB 3ARGC 3IFPA 3MV01 4X6CE 3N1QC 2EEBA 4L3EB 5D5MF 2E4FA 1F4WH 4D0BB 2P1YA 4RH4A 2ZCKH 2HFEA 3K80A 1M56B 3NGBC 1SEQL 2ZYIA 3OKKB 1MREL 4M02A 5EOQL 4QXWA 3W0WD 1W8OA 4ORGB 5TFSL 3GSWA 3HNVL 4GXVH 4A2GA 4PU2A 4K5MA 4KVNH 3RQ3A 1RUAH 2GIXA 4ZUVA 1BOGA 4PW9A 5DK2A 4AWJC 4KKZA 2WIIA 4HHWA 1CGVA 2JCCB 6PAZA 3K2UL 1XAUA 1R3KA 3KYOB 2ZZUT 4TLKA 4LBEA 3LHPL 5IOKA 1FGVH 2GQHA 3DV4B 2WLLA 1F58L 3O4LE 1AR1C 3STLA 2Y07H 3ZKXB 2PABA 1KJ2B 3W5NA 4FXKA 5SWQB 4YSAA 1VEOA 1OPGH 2G2PA 4PJ9C 4YDIH 4KOBA 2VB5A 2BOCA 1ITCA 3I9GL 5DQJB 3SCMC 3UTSA 4GG6F 4JRLA 4Y0GA 4U1NA 3UG5A 4NO5A 3NACL 4PP1C 1QWHA 5JA9A 3M17B 4P5RA 3GMOB 4CADB 1YMHA 3SGDH 3CFTA 4FL4B 4FFTA 4XPBL 5EU6E 3NZUA 3ZMNA 2I69A 4PJ8B 3F85A 2VR4A 1BF2A 4NRZB 4BHUA 2PP8A 2IBGA 3GZPA 4U1IB 1I3GH 3V4VA 1YECH 5I8CB 2NR6A 1S4IA 4RGNE 3IGUA 1AGEA 1U8HB 3NFSH 4JB9H 4XXDA 2LLNA 1M42A 4IBWA 2VT0A 1QBML 2P49B 3ZDZE 2XLLA 1PGRB 2AXWA 1KDIA 4PH8A 4MMXA 4HC1A 4KZEL 3TONA 1K8DA 3G6DH 1VZGA 4JRYA 2IH1B 2AMGA 5B4MD 3O9WC 4U3XA 2X4SA 5E6YA 3H53A 1RERA 5AAWC 3AC0A 5L2JA 4YQXH 3EDFA 3RAJH 2W9LA 2J6WA 4HS8H 5CR8A 1GXEA 5T3ZE 3V4VL 1DVFC 3UEZA 1GR7A 3QARA 3VSTA 1L7IH 3DOSB 1KWKA 2XWJB 1P6WA 5IQ7H 2AHIA 4NUPA 4R2GC 4KK9D 3RY6C 2GVYA 4PY8J 4M48L 5DVNA 2YRPA 4HC1L 1JPSL 3BYTA 3EJPA 4HZLA 3VFUA 5A7EA 2CE6A 3WTYA 5L8JB 4LSTL 5KZCD 4HLZH 3I2CL 3P3RA 5ALCH 1KJVA 2YAPA 4WGVB 1NBYA 1I1FB 1OAUL 3F8UB 3N85L 5FYKL 1DANT 4JFVA 5DQDL 3UAFA 5IJVB 1G9MC 1Q9WB 4Y5XA 2VMJA 2DMGA 3MLSL 1ECZA 5I5IA 1H8OA 4UINH 4TVPH 1FGNL 1QA9A 1ROCA 4N5ED 4QTHA 5HHMD 2HPTA 4HBCL 3W81A 5ACZB 4F92B 3BP7B 4Y1AB 4QO1B 4OBRA 5F9OH 4N0RA 1LJMA 5CZRA 4JRFA 4M7JH 1YN7A 2JKJA 4KMLB 1J1XL 1KYDA 3ZDYE 1H3XA 1WTLA 3KDPB 4IS6B 4QCIB 3DHPA 1BWMA 5T1LD 4OZ4B 4PSPA 2VXSL 1NCDH 2Q8AH 1M57B 2IEPA 5FO7B 3Q5YA 4L1BA 5KBKA 1FZJB 4LDEB 4AGMA 1A6ZA 4NO2B 3S36X 3EJJX 2YPLB 4GG8A 2H41A 2FHFA 3B6SB 4X0NA 4FG2A 2C3VB 3VFRB 4CC4A 5AENA 2A77L 1SMDA 1EFXD 1W72L 1WAPA 3TYFB 5IHBA 5JDJA 1OAKH 4LSPL 1EBAA 2NW2B 1PCSA 4NLHA 3SDYH 1TZHB 2GJ6D 1I9EA 1UATA 3Q43A 3HC4L 3LKNB 4QOKE 4I1NB 3ZKXC 5DZ9A 2WXMA 5IJCC 2OMBA 1HX0A 2FWLB 4HIHA 4PHXA 2BY3A 2D0GA 2HTLC 5ICXB 3QCTH 4B7LA 2ODHA 2D7TL 4LCVA 4A2DA 4GRLA 3ZT6A 4WW2B 3ZE0E 1TZAA 2W8CA 3NAAL 2QBWA 3VFNA 1WZMA 2MCPH 3G5YB 2WBXA 5DCCA 1K3IA 4Z76A 1KXHA 1LP9A 1CK0H 3WDHA 4ENED 1KJ3H 4MA8H 1WZ1H 5B39A 2CH8A 4PJ8C 1U95A 1E67A 5D1XA 5DS1A 3P9WB 3MV7A 3ATBA 2W65A 2BNQE 1K5NA 3VWKB 4ZDHB 3F84A 2ESVB 1UXLA 1FORH 5BS0E 1J8HE 2XPGB 1M6OA 4PJXA 1DCEA 3R4RA 5EU4A 4OLEA 2WBJD 4MB1A 5E8PB 3IDGB 4NOBA 5BO1H 2IOIA 5GRYA 2MQCA 2N0KA 3IJSB 3TNMA 2VN6A 2VERA 3HTLX 4DP7X 4TPRL 5A2CA 2LVCA 3U4AA 4QHKI 1W0WA 5AVWB 1LEGA 3ENEA 2X1PA 1KELL 4ZX6A 3KBHE 1TKWB 4W6YB 5C2UB 1UD3A 3IF1B 4QHUB 5DU7A 4DEPB 5I1JH 2YUVA 1F3DH 5IGXL 3VI4A 5SWSD 5T5FH 4M7LL 3UADA 2J4WL 1DL7L 2HYMA 4PGBA 3CN0A 2O5YL 4TL4A 5DUJA 3S34L 2NT1A 2HKFL 2Q2EB 3QFJE 4C83B 2KKQA 4XPHL 3QNXA 2Q6WA 2GJZA 2IBZX 2GCYB 3VXTB 2W91A 4FMFA 4WEBL 4JE4B 3VGFA 3VGAB 1O7SA 4N0FA 3L08A 4ODXB 1CLOL 1FLTX 3HZ3A 4L4VE 4B60A 2BXZA 3FU3A 4RRPA 4KKPA 1URZA 1HHKB 2VMDA 1I3VA 1IT9H 5IT2L 3O0RL 5JDSB 5CFAA 1OSPL 4N2CA 4W68A 1QLRB 2MSPA 1RULL 4FZEL 3HLAB 3CUPA 4GMSL 4JDEB 5MEPA 1A9VA 1BZOA 1LMKA 3TA3D 1E5ZA 4Y4HA 3U0TA 3GDBA 2X9XA 2WXJA 3MRHB 4PS4H 2AMUA 3DURB 2ZPKH 3FTUA 3A4EA 5EZOH 1YO4A 1ZT7B 1KZYA 1T21A 2VXQH 4GSQA 3WKMH 2UZXA 2OMNA 5T3XH 3A0OA 3BJLA 3STZA 4XWGH 4FNUA 4ZRGA 4P5TD 1NOFA 1EMTL 1RV6X 2G3NA 4Z18A 5JW3L 5LDSA 1PEWA 4W9HC 4NS0A 5DWUL 1ETJA 3EGSA 3AS2A 2BDNH 2ZXCA 4KY1L 1H0DA 2QQQA 3P4LA 3GM0A 3AU1A 5DSCB 3MRDA 5BW7C 5LB1A 1LWRA 2ATKA 3V5HA 3WY4A 2UVFA 5A6MA 1A25A 2XCMC 3QHFL 2PW2A 4LLUA 1CB4A 2FATH 3K5RA 5TK2A 3K7UA 4MZ2A 1MI5E 1UOKA 3QDGD 2V37A 3RVVD 1PLGL 3HRZC 3FB6B 3JTBA 5TE4L 1JMXA 1BQRA 1KXVC 1NC4B 1XV8A 1X7TA 1M71B 1OD9A 1RJZB 3DSFH 1X44A 4K3EH 4KVCL 4WW2C 4NRYA 5JXEA 5EOCH 1YEEL 2WYHA 5HYFA 3U83A 1KIUA 1ZKAA 4KKRA 3SY0A 1HESA 1ET5A 3H0TB 1M7DA 4PJXF 5BRZB 5CGMA 2K9FB 3ZRSA 1WS8A 2AGJL 3BP5A 4KQ3H 1A9EB 1KBVA 1S8DA 3PQYB 4J3SA 3VWKC 3CH1A 5CBEB 3KLQA 5FHAH 3WAKA 1NBZA 2UYLA 3BMWA 2DLGA 5TPWL 1NCIA 3PJLA 1F4YH 3KS0J 3QUYB 1VDGA 3RWFA 2DPKA 5D7IF 3AXHA 4NKOA 1A0QL 2B4CL 4L5FH 4P4KA 3P3UA 5F88A 3APFA 3EO0A 2Z8WC 1U3HB 4JDZB 5EO9A 5E70A 4ERSH 4R4NC 1EDHA 5IESL 2QKIB 4PJGF 4L23A 1MLBB 1HHGA 3DVGB 3HW7A 3L9BA 3U7WL 5DQ9A 4HDIA 1FFOB 1OKEA 3LZRA 4XI5D 3S96A 5F8RC 1BZ7A 4XP9L 2WO2B 3TCLB 4DEPC 3T6XA 4PG9B 3ZTJH 1X4XA 2ENYA 2NZ9D 3S8FB 1HQRB 5GISH 5T5NG 5CSBA 4AEIH 4HKZB 1OM3H 3S3JA 3MROB 1UG9A 5I1EH 2ETWA 1IEBA 5HYSB 4CDHA 1LEIA 1V3MA 4J23A 1Q0XH 2ZP0T 4DKTA 1R6VA 4ZSOA 3NCMA 4XP1H 3ZUNC 2J6EH 1KLGB 1BBDH 2AAAA 2F58L 4DH2A 3VGAC 5J9PB 4U05A 3RU8L 1JYXA 5JOPD 4P2OA 2EIZA 3MODH 5EEWA 1XGYH 4XAKD 5JPMB 1L5GA 5CINH 2V9RA 1NCWL 2QT6A 4JGNA 4U4BA 1ZE3H 3RY5A 1QSVA 2J88H 2OMVB 3IYLW 2A6DA 4BZ1H 1KN4H 3RB7A 5C07A 4PJ5E 2ZCZA 5SX5H 1TSRA 4YDZA 3F58L 2Y3AA 3FUJA 2OQJA 3HI6H 4LDLB 4DPCX 1Z9SB 2DEWX 1NWOA 3D0AA 2BNRB 4GXUN 3WIIH 4M4RA 4DESA 1ZVSA 4KDTC 1NIEA 4HCIA 1HH6A 5DJXA 1OAYL 1IM3B 5KVGH 4WUKL 2X41A 2ROYA 4NGHH 5B38B 4K7PY 3ALXA 4RX4D 4XN7A 2WWMD 1ACXA 2HX8A 2ROXA 5GZOA 5JOEA 1TQVA 3BH8B 2DYPD 3WXVH 4WW1B 5ADOH 4HCRH 1MIEL 1UXWA 3C60C 3ZE1B 1CFNB 1BQKA 1SYSA 3BISA 3I6GA 3Q8EA 4Y19A 3JWDH 3MRCB 3WE6A 1KIPA 2W0PA 5CP3A 3OR6B 3GI9L 3VA2C 4U1LA 4Z7VB 4CC1A 1INEH 5M7QA 4Y4KD 4TSBH 1V05A 1OP9A 3IDJB 1A3RL 4R5TA 2EDBA 1IC1A 2IBBA 1E3XA 2QGDA 1BM3L 3TO4A 3MLUH 1PPIA 2V5SA 3ATDA 3MLTA 1CLZH 1DO5A 4GKZA 4XXWC 1CVRA 3EKCA 2E59A 3VDBA 3NCJL 4DF9A 1HQ4B 4GKSA 2A1WH 3LZPA 3LPFA 2ZKHL 3RL2B 3SE9L 4LASH 4AW7A 5BOPA 1ESOA 1NGYB 3F12B 2DM3A 3KPNB 1MCPL 3WD5L 2X3CA 6FABL 32C2B 1IBDA 2C34A 4KAQH 5ILTH 3ARWA 3QUYC 3M8OL 4PWFA 3RVUD 2ZSWA 4A66A 1KBGL 1I3UA 3PHAA 3BHBA 2P5WB 1L9SA 2ENQA 3GJFH 3W38A 1KTJA 3NZSA 4LMQE 5IUCA 5FC9A 5L7XH 5LQBH 3V9EA 2VZOA 4HOZA 4UQ2B 3TJPA 2QKIC 1JV5B 4JZNA 4N3TA 1JNLL 4HHGA 3P54A 3E8VA 3T08A 4XBEL 2HKAA 4P57B 1QABA 1F00I 3NJLA 5C0CA 3MOBH 5MENE 4Q9BA 3ULSA 4TSAL 5DLMH 3U30B 3NN8A 3MJ6A 5ICYA 1GYCA 3VCLA 4LZKA 1F42A 1VEPA 1DBMH 3FMGL 1QHQA 3CZFB 3MUGA 3MRLB 4AK1A 3I6SA 3GBDA 5J6HA 3QJHA 4HIIA 5EU5A 5BZDA 3MRNB 3MC0A 2X40A 3M7FB 2DJ4A 5IHZA 1JVLA 1RZJL 3GMNA 4YIQA 1JFHA 5CBAA 2J1YA 4XBPB 3RY4A 3MLYH 5E5MB 1A65A 4F1ZA 1HXMB 1FNAA 3I85A 1J5CA 4YSSA 2RB8A 2R1YA 4RGOH 2X4UA 3LN5B 2PUQT 4XC3H 4HZAA 3H3KA 4OLVH 2NQCA 2ZX8A 4DHLA 4EDWL 2G9HA 3K4DA 1QFOA 4LCWB 4WWKA 1X5GA 1Z0NA 2COQA 4DKEH 5JPMC 4IDJL 3EJZC 2A9AA 2DQIH 1TQBB 2YRBA 3OF6A 1FL3B 4QR7A 5EHFA 2JB6B 4Z8FH 1JS4A 2EXTA 4WFGD 3D2TA 3IJ7A 3QO1B 1DDHB 5K1VA 5BZXA 1GGIL 2ZUVA 3VG0L 4Z7IA 1QW9A 2WLHA 3EUDA 4W4OA 3QWNA 1E7UA 2P8LA 2XXFA 4JN2A 5GGUB 1E7VA 4W6XB 3AFLA 5DRWB 1NSNH 2EDTA 9CGTA 1ZS2A 4XP4L 2X4RB 4JFYA 2NY6B 1MHHB 4QF1B 5HYJD 5E9DA 3K6FA 5EO1B 2Z35A 3HN5A 1UT1A 3RRQA 1LK2A 4GUQA 3RWDA 1JWMA 3O6FD 1KB5A 3HR6A 1L9QA 5L4MA 2BRQA 3LQAH 1NGZA 1BFOA 2XTJE 3QUXA 1DLHB 3TWCL 3Q6GL 4P4RB 3D8MA 1RY7B 4GQRA 3ARBD 4HS6A 3A4AA 4NM8L 5E00A 4JFFB 4L4JA 1HDMA 1SZNA 4F5CA 4FNLH 4MRBA 3QQ3B 1IM9D 3VFOA 4U6XA 1E6OH 1MUJB 1VF5C 1VJSA 3VMOA 1WBYB 2YXWA 2VGLM 4WJG3 3NDYE 1KB5L 5HHXL 3TO2A 2OTWA 3F5WB 3UDWC 4E9XA 4FNRA 1OV8A 2GBAA 5LGJB 4CVWA 4X8JA 1J5OL 1BFVL 4IMKA 1RLWA 5ETUB 2BP8A 1U93A 3KNBB 4D7PA 1KULA 1U6AL 3FRPB 3PYCA 3S48A 2KHAA 2J8UE 3CFNA 3I6LE 4HUVB 3FH5A 2CNYA 3TPUB 2ARJA 1JGLH 1ZOXA 2XV3A 3PGDB 3A6CL 5E99H 1HIML 1TJXA 1X4ZA 2HFGH 3HNTL 2OYPA 4ZQKB 4QRRA 1QFWI 3BE1L 1F56A 5HVGB 4JGUA 3OJ2C 4PQXA 2I5YH 5I15H 1F3RB 3O2DH 4ZUTB 4NXKA 4F33A 2XKUA 5MI0C 1GZPB 1V3KA 2VM3A 4Q9QH 3H54A 4S11A 2QSCL 3PU7A 1XL4A 3ARRA 3DTDA 5IQ9A 3U30C 1IC7H 3PAYA 2R2BB 2XRAH 5TQ0L 3DRQA 4AVIA 1ROWA 2A6IB 2V7HA 1KGUA 1Y6MR 2WB7A 3DX4A 2ZXBA 4WU7A 4FP8L 5E2VH 4P5SA 1J9TA 2ED6A 4UV7H 3FH8A 3X1GA 3CK0L 5HGHA 4FI8A 2DKUA 5DHVH 3T0EB 1A6UH 1DUYA 1CDBA 3DRTA 3UAEA 3ZYIA 1G9NH 1R3LA 3MBEA 3HS9A 4HWBA 7CGTA 3OJDA 2X0WA 4JQIH 1J7VR 1RZFL 1WO2A 2AEWA 1Q9KA 3HUJE 4DOHE 3D48R 1QFWM 3VXPA 3S35H 2VN5A 1U8IB 1XCQA 1I75A 3CXDH 4PJHB 1P4LA 3D07A 2W81C 1CYWA 4LQFH 2IGTA 3CFQA 2H2PC 2B59A 4NZTH 3WNLA 4AMKH 1HC1A 1KC5L 4XGZB 1N6VA 2Q3XA 2MOVA 1TQBC 3ILQC 1OAXH 1A1NA 4WHTA 2X87A 2XZQH 4NZJA 1URIA 1WC7B 1TO5A 1OT1A 3BAKA 1M7IA 1AMYA 1WEJL 2CHNA 4OZHA 4RAVA 5GGRA 3VXNA 5CCJA 1KGWA 2AJYL 5C0BD 1NANH 4D9QD 2YPVL 4HJJH 4L1SA 4Z23A 1MCBA 1DLFL 4JE0A 4L29A 1MXDA 4Y2OA 1AMXA 4OI9A 3PL6C 2NY6C 4R3SA 1QLFA 2YFNA 2XQBL 3MCYA 2AQSA 3D3VE 5J0BA 4HFUH 2Y1YA 2R69L 2UWEF 4UDTB 3EGXA 4IIQB 4XPTH 2EDYA 1E27B 4G6AD 3DGGB 1EJ6A 1P1VA 1N64H 1NDMA 1VFBB 3VFSB 2WQUA 5CM1A 2BZDA 2VAAA 5EU7E 2M83A 2VM4A 4MJ5B 4NBYB 4HG4J 4Y8DC 1A5FL 1MEXL 2DWDB 3AY4C 4F7PB 3MV9E 1WFIA 4QGTA 1BZ8A 4NKMB 2O5ZL 4J3XA 1BAFH 3MRMA 3MUZ1 3O3DB 3RVXD 5GRVK 4NFCA 4CC0A 3GQFA 1XT5A 2WQ8A 1EHAA 4UQ3A 1PG7H 3ECQA 4RZCA 4H5SB 1IKFL 4R7DB 3CSYB 3L45A 1DEEA 3V6ZA 4YJZL 2VUOA 4MAYA 1JPFB 5HI5D 1AGFA 2MRYA 3I02A 3NRPA 5JNYA 3AU0A 4IOIA 3FULA 2GJRA 4FG6C 3N04A 1KCBA 1DJGA 2A9ML 2OTUB 2J2ZB 1G7LA 3MOAL 3QI9B 1XF4B 1S7QA 1UURA 4I5BB 3B3IA 4X5LA 2NSQA 5C1MB 2IQAA 2ZUXA 2ZUSA 1KY6A 1EGJH 3EH3B 5IEKB 3CIAA 1AGDB 1U9KA 2CLZB 1MAJA 2WIMA 5DK0A 1HJCA 1HTYA 5IFJB 2OMXA 2PYED 4ETQA 5HHOA 1NUFA 1B0GA 4P59L 4PWEA 1CIUA 4XODA 5HDBF 3K0WA 1QACA 4LPVA 2HN7A 3G08A 2VRQA 3BLPX 4WI5A 4K2UL 1MWOA 3CPLA 4ZFZA 1MPAH 3W1ZA 3INUL 4G8GB 4YXKL 5I1GH 2APXA 4ZAKD 1QLEH 3GK8H 3ZQ9A 3T2PA 1T04B 1TTUA 4FMVA 1HT6A 2VLJA 3QCVL 4PGCB 2ZUQB 3CXFA 3D06A 3EOAA 3IPEA 4U1GB 2YGQA 5DO2D 3TPKA 1A6WL 4WO0A 1OHZA 4TNWK 1OQXA 1TVHA 2CDEB 2VH5H 2R8SL 4LSRL 1WDAA 4M61A 3ZY7A 4ELME 2DBJA 3CVIH 1B2WH 2D2OA 1HXYA 1SDDA 4TUJA 3U9PH 4F9PA 1D5BB 2SEBA 4F7KA 3PY9A 3QDMD 3SDAB 4XO3A 1TQUA 4U1HA 3B56A 4K9EL 3LPOA 3RZCA 2BSEA 5GRJH 2NPLX 3ZKMD 3F83A 2OMWB 1JV2A 1CDHA 1VKXA 5F89A 5KYNA 3BSZL 4KC3B 1KZQA 1FO0H 4OZHF 1U8LA 4GW5A 3BWSA 5LGKA 2FL5B 3BGAA 2F6AA 3D39D 4E41D 4NUJA 4Q4IA 3VRJA 1BZQK 4MD4B 1FZKB 2ZKWA 1J1PH 3CQFA 3ARDB 4CSPA 1HZLA 2X2JA 3MUY1 4GRWH 3TNNA 3MJ8B 1MCKA 1ZK9A 1BM7A 2ENJA 4ICWA 4IKIA 4K8RH 4PW3A 2LLLA 1YJDL 2BVUA 2KC0A 3W9DA 2AABH 2EDKA 4KMTH 5FV2A 1U58A 4IBUA 1QFUL 2OMYB 1BQSA 4N0UA 1JPEA 1KOAA 4JVUA 4OGYL 4Q6KA 3CX2A 3V7AG 4S1SL 3G5WA 1F4HA 4KXCA 4PWHA 2DI9A 5D7SH 4DVRH 5JO5A 5ALBL 3DETD 4IIQC 2PCPB 5KYXA 1O0VA 4OZIF 4X7TA 2E27H 2ICES 4KUZH 4HWUA 3TVMD 1AANA 4XE5B 1ZE3C 2H32H 4HT1H 1SLWA 2BHYA 1MRDH 3U1SH 4BK5A 1X5HA 1YEHH 2D3NA 3PWLA 2XV0A 1EZVX 1FL6B 3ROLB 5DZAA 1I31A 3SDXF 4RWYL 4HMEA 4K94H 3V0AC 2A4ZA 4P5MA 3V0VB 3F6LA 3VXQB 2I85A 4U3HA 5AYUH 2HLAB 1L6ZA 3LPWA 4F91B 4GAYB 3EYVA 3OD3A 5E8DL 3CPUA 3ULVE 3P2BA 3BGFB 2AJSH 1H3WM 1Q0YH 4W9ZA 1FC1A 4GFTB 1BG1A 3CHXA 1HN1A 1K8IA 3PGFH 4GXUM 2YD7A 1NIBA 1K85A 5BJTA 1CICD 1F3JA 2JIXA 3KPRE 4M62L 5DZPA 5IMMA 1KIRB 1A3LH 4LGPB 4AEEA 2Z31D 4S1RL 1P5UA 3P0YL 5C0AA 4O2EA 2BOBA 2VXUH 3QI9C 1I3RB 3BUTA 3FPYA 4PEEA 3Q44A 4I0KA 1XF2A 1MCQA 1P84K 5DA4A 5LBVA 5KANG 5FKAA 3FYEB 1LD9B 3TV8A 1HJBC 3MFFB 4P46D 4G7QB 3OKMA 4OZGB 3INOA 2HZHA 2AXFB 1BEYL 3QUKB 2X4OB 3JWDC 1G6RA 5C0GA 5C3IA 5B21A 1G9EA 2BRRH 4W9EC 3U4BL 1QRNB 1IGFL 3G5ZB 1IGML 5E2TL 1OQOA 5HJGA 4NQDD 1E4XH 3PGCA 1JIBA 2FT6A 4PVNA 3IDUA 4DTGL 2O61B 5EBGA 3H9SB 4U1GC 2ZUQC 5JORB 4PJDE 3CVBA 4IIZA 4YZFE 3VI3A 4KNTA 2BC4A 4WY7H 4ZFFB 3KGTA 3TF7C 1G6RL 4OSUH 2XV2A 4XMLH 3BCDA 2G5BA 1GOFA 3CLFH 1Q9OA 4M9OA 2A83A 2OLDA 3NJNA 2EVIA 5AZ2H 3SDAC 2GSIA 1MWAH 4UAOC 2XY1A 5F6HJ 4Y2DA 4ZFQA 3CD4A 4M5YH 3HZKA 5CGYC 5B39G 4GKOA 2FSDA 5AQ0A 4G9DB 2DQUH 3NTCH 1XGZA 1XEUA 3Q01A 2AJ3B 4I4WA 3QPQD 2BVTA 1P69B 2ZKMX 2CCVA 1YNTB 2FHCA 1GYVA 1M05A 2Y0SA 3MV11 2VDQH 2X6UA 1OB1A 1DN0B 4KKNA 3JTSA 2Z92B 5DHEA 5I9QB 4PJ7F 3KCWA 2N3JA 5JW4Q 3ARDC 3G04B 2DMHA 1HHJA 1I7UB 4Y16D 2HVKA 4HXBH 2CM5A 3S9DB 4L0ZA 2C4XA 1BVLA 1C12A 3ZL1A 3HI1B 5EC1B 3QA3A 1RUQL 3BKJH 4XTRD 4K7FA 3CDYA 4N26A 1UM5H 4ZUWA 4QRUB 5DHVB 4KQ4H 4OJFH 5FYLD 4R4BB 3MGOB 3VFVA 3V79C 1B3JA 1VZIA 3HHRB 1OGSA 1AXTL 2ALWA 3GSRB 2NUTB 3KPPA 4C56E 4NHCH 4HV8B 1AP2A 1DVZA 5GJTL 1TQTA 1A1MA 1BGXL 3NH7H 4EI5A 4J3OG 3RIFF 3EO1B 2DQTL 3P4OA 3BVDB