3WTXA

Crystal structure of the complex comprised of ets1(y329a), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
118
structure length
118
Chain Sequence
GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
total genus 18
structure length 118
sequence length 118
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3wtxA00
3VD2A 1CO1A 3WTXA 3US0A 2WGXA 5AOLA 3D0AA 3ZMEA 2ATAA 4IBVA 3EXJA 3D07A 5AOKA 3QYNA 3VD1A 3D05A 4L0ZA 5AB9A 2RMNA 1LJMA 2IOOA 3KMDA 4IJTA 1IO4C 2BINA 1GZHA 4IBWA 3TS8A 1KZYA 2J6WA 3US1A 3WU1A 2X0WA 4AGLA 3WTUA 2J1ZA 4LO9A 2P52A 4XR8C 5LAPA 4L18A 3WTYA 3D06A 5ECGA 2BIPA 1EAOA 2J1YA 1TSRA 1HJBC 3IGKA 5KBDA 2ADYA 1HU8A 3WTTA 2XWRA 2OCJA 3EXLA 5AOMA 4G83A 5G4OA 2H1LM 3WTVA 1GZHC 3Q05A 4L0YA 4MZIA 1UOLA 3QYMA 2J1WA 1E50A 2FEJA 1EANA 3WTSA 3VD0A 4AGQA 5A7BA 3D09A 3WTWA 5LGYA 2AC0A 5AOJA 2BIMA 4QO1B 2J20A 4IBSA 2BIQA 1CMOA 4A63A 4IBZA 2X0UA 4IBUA 2X0VA 4AGNA 2YBGA 2J21A 2MEJB 2J1XA 2GEQA 4IBTA 1TUPA 4LOFA 2VUKA 3Q01A 4AGMA 2IOIA 2IOMA 4AGOA 5BUAA 3Q06A 2XWCA 1HJCA 1EAQA 5G4NA 3IGLA 5ABAA 4IBYA 1T4WA 4LOEA 4HJEA 3D08A 1H9DA 4KVPA 4G82A 4MZRA 5AOIA 4GUOA 5G4MA 4IBQA 1YCSA 4AGPA 2PCXA 3KZ8A 4GUQA 2BIOA 2AHIA
chains in the Genus database with same CATH superfamily
3B6SB 5FX3A 4MJ6B 3BP4A 4G7SB 4AYGA 1OPGL 1L7IH 4ZTPL 3ZIMA 2DKSA 3DTUB 3L5WA 4ZOCA 2D9QB 2JIXD 4TYUA 1CFSA 1T2QL 5C7XH 5EC2B 3UXFA 4MJHA 4KVNL 5MEOB 4XP1H 2WNKA 3QWRD 4HS6A 4YHKL 5E2WL 4IGBB 3SPGA 4KDVA 1NCNA 3G3LA 3INUH 4H1LB 5D96C 3I3EA 3QPQD 3BRDA 4TSCH 4R7DB 1MH5A 2J88L 3LD8B 1U30A 1RI8A 4YDLB 3FUJA 1U8HA 5FKPB 1HT6A 4ZO8A 4WWKA 1J05A 3FT4B 1XF2A 4IS6B 3H4HA 3P73B 1RXLA 2X4QB 3P11L 3VD4A 1PTZA 4PJEB 1S7UB 3NSYA 1DSFH 5DMKA 4PJHE 3L3JA 3W5MA 5BRZD 1BXAA 5CZXD 2MQ3A 3RQ3A 3S3JA 3F62A 4QEGA 3VFMA 3JTBA 4RNRA 4KHXH 3NSFA 2VDLH 2CK0H 4QXUH 4LSRH 4DK3A 3TCTA 3C8HA 1JFQL 2ZF9A 3FU7A 4N2EA 2MCG1 5HVHB 2HJLA 4PVNA 4ESKA 2JIXB 4OQTH 5JA8B 4MWFA 2PCYA 3KD4A 5GS1C 5IQLA 4NHUA 5T33L 3FFDB 2PWFA 1WFMA 3UDWC 4KV5E 2P24B 5I5MA 2WQXA 1KJ2L 4IGBD 4N0CC 4TOYH 5D55A 5CJBA 4NM8L 5D1ZC 2CIKB 1G9MC 1P9MA 2J57A 2X7LA 5JA9A 1H3TA 4C4KO 3NFNA 2BVUA 3MLYH 3IRZA 3OX8B 5IQ7H 4YPGB 4R90H 1Q9LA 2F53A 3GS0A 3OAZH 2QZQA 3RL1A 5K59F 5LWYL 2B2XH 2XRAL 1WAAE 1MCPL 4G8FA 1N4XH 4F33B 5A7EA 5F9JA 1OVZA 5JQ6H 3CLEH 2E7MA 2RFXA 4IOFD 3RVUC 1VF5C 4KK5C 3O2VH 3BSHA 2I27N 4Y8DC 2YRPA 5EEWA 2P8PB 1DVZA 3STLA 1UB5A 3OZLA 3T2QA 1GZQB 4JDZB 3SDDB 4M1DH 4K73A 1IT9H 2EUWA 1JZ6A 3ATEA 3QZWA 1HXMB 2FTAA 3O2WL 4A7VA 5EOQH 3ARYA 3VWJD 5KVGH 4UAHA 4AQEB 2Y1YA 2KQNA 3F7KA 2HJFA 1R9FA 4PJCF 3O3DB 1ORSA 3MRPA 3CFMA 4PRIE 3BQUD 3IKCB 3ZE2B 1L4IA 4MMXC 1BF2A 4NP4H 3CZFB 1J5HA 3B9EA 2OS7A 3L95A 5BOPA 3I6GB 1FL5B 3FFCD 3GXNA 4YC2C 1P84J 1A3ZA 2EZ0D 1N2RB 3S3BB 5GS0H 3VA6A 3KPRE 5F9AC 3PJLA 2C7UB 3D25B 3NTCH 5IW1B 1JGVL 4LSPH 2WVTA 2A3TA 3UIZA 1A8JH 3FW6A 1PJ9A 1SEBA 2VXSH 4XOBA 2OYPA 3A67H 4HPOH 4F1ZA 2NNXA 5DD3L 2WKOF 3QQNA 1G6VK 3KCPA 2AMUA 3QIWC 2Y5TB 5J4MA 5FO8B 4HIHA 2FGZA 3KYKL 4JLRA 3B1TA 4OZHF 4YEEA 5LG6A 4X5RA 2J1YA 3CCHB 3EYFB 5F72S 2J55A 1V54B 3NP4A 2XVGA 4FNLH 1LP9E 2HKAA 4JFWA 5T5FL 3CZKA 3DX8B 1TO5A 1LDSA 2B4CL 3SDDD 5AKTA 4MYWB 4HSCX 4U6VL 1X9UA 1XIWB 4WHYH 4N2AA 3RFRA 3UPAA 2W5PA 1BJ8A 4JKLA 5EOQL 1VKXA 1XGTB 3BCFA 1GY1A 3B6SA 1RFDH 4G1EA 1UH4A 1Q4NX 4OZIF 1TQSA 5C0BB 3LIZA 4WENB 4UM8B 4UMGA 5C0CB 3VFRA 2ZJSH 2DTMH 1G9NL 4IEFB 3KBFA 4O9HL 4N86A 3MU3A 2W1NA 2BNUB 2OTUA 2WLNA 4YMPA 1NL0H 3BJ91 4JVWA 4UMSA 2D3NA 5IB5B 4Y16C 1AXTL 2HPOA 5AAMA 2EE3A 3DXAD 3MGOB 3I50H 4TNVF 5T5NF 4MBRA 3U48A 3EG9B 1GMIA 1MQ8A 3V4UH 3G5ZB 4J2QA 4G8EA 1NGQH 4P8QA 4V1DE 3WJJC 5C0RH 2R9HD 3IE4A 2E75C 4QRAA 1W8EA 2VRAA 4HWNA 3TA3A 1Y1DA 3C6LC 5LXVA 4JFPB 1O6SB 1M9SA 1U8PA 2WMPB 4UQ2A 4RX4D 3NP3A 2PYEB 3O0LA 4UT9H 4XBGA 2IAMC 3TIDB 3GKWH 2R8SL 5T5FH 4NDMA 4PUBH 4OJYA 1ADQH 4OB5L 3A47A 1HQ4B 1G1YA 1X3DA 4X9IA 3CK0H 1NOAA 3L1OL 3NEXA 4LCVA 2QDVA 5KSAC 3KPLB 1WSST 4KFMA 5A40E 1LLAA 2WTRA 2AI0H 2AQRA 2R0KL 3QUMA 4XNQB 5FYLD 5DK0A 5C0CD 4HKZB 4OT1H 2VKWA 4KKZA 4FHBD 4LVEA 4NZUH 2XVLA 1BWMA 1IC4L 4HU8A 4Y5XB 3GO1H 4XVSH 1NKOA 2YEQA 4DO5A 1QUNB 3UTQA 1TJMA 1HCYA 2VXTL 3DBXB 1TZGH 1JN6A 1W0YT 3NMEA 4KK9C 4Z7VE 5T1MB 2B1OA 4H8PA 3UX9B 4E5XA 2NUTB 4DPRA 4PJIA 3SO3C 2XWBA 3WNJA 1YMMB 1MCOH 2DQIL 4M7JL 2X89D 2CIKA 1VADA 2VZUA 4QPEA 3SGKA 2EH7H 3GMOB 1KBGL 5CEYA 3BH9A 1RULL 4JRXA 5D7SL 5C0AA 2F53B 1JHKH 4Y1AA 5I76A 2FGWH 1MRCH 3WU1A 4RDQG 4TF4A 2BVQB 5DD5L 2G5BA 3BAWA 1WITA 3PL6B 2PTUA 3QQXA 1HHJA 3JVGC 2HLEB 3FXIC 4KRNA 3GUTB 4XPHH 1A7RH 4ZRGA 3MRJB 2EDTA 2FVNA 4N2IA 2ADYA 4P5TB 2OYLA 3PAUA 4G7YL 4V33A 1NGWB 1UFUA 3E1F1 3MJ9H 1G0DA 1Z9OA 2HN7B 4MZIA 4P46A 3W38A 1A1MB 4JFFA 4OT1L 4AKOA 3MRKA 2VXQA 5C09E 4HOWA 5CLYA 3TU6A 5DZLA 4NUPA 1UACH 3QXAB 3C08L 4H20L 2OCFD 1E3FA 4KJPC 2AEQH 3AC0A 2W95A 4AEEA 5C0GB 2YMXH 3TBWB 3TO2B 1NFKA 4BKLA 2UYLA 2QKIB 1S7SA 5LCVA 4DP4X 5EO9B 1OV8A 2OMBA 3CH8A 4Q4IA 1ZDSA 3DUHA 4XBPA 1RVFH 4PLNC 1XF1A 4PCTA 1HAUA 4W9EC 3FONB 4C56D 3N85L 4LSSL 1RULH 1JNNL 4O02B 3BIBX 5LB1A 2VR5A 4M6ML 4DGYL 1FFOB 4EN3C 1AQDB 1QFWL 4XPTH 5KVFL 4QF1B 1M1XB 5GRWA 2MHAA 3DKHA 4LCWA 4U3XA 4HG4K 1XCQA 4HALA 4WHDA 4CUCA 1E65A 5D7JC 1P7BA 5D96B 1TFPA 1ZT7B 3FPXA 3KH3A 2PR4H 1ASOA 5F0PB 1BVOA 4JREB 3G6DH 4YZFE 3H3PL 3IDUA 3I6KB 3EF7A 5IEHA 3LSOB 1T1ZB 4R5TA 2DRUA 5D1XC 2DD8L 5D1QB 5AW8B 1NAMA 1GHFL 2AEPL 3CBRA 3ETTA 2JKWA 5HYSA 2X1XR 3ZZSA 1NIEA 4IOIA 2AV1A 1U3HA 4NRZB 2V9RA 1FN4B 4XN1A 2WKOA 4B9KC 4CMMA 2ZSVA 1DQIA 3RTQB 3FZUC 4AIZA 1MW0A 2JKSA 5C92A 3OKOB 3EJZD 2I9TB 2ZG1A 5B4MD 2CDEB 5HGDB 3R0MA 1CDCA 3UO1H 1QA9A 1Z6JT 2QDWA 3NVQA 1Q72L 3RU8H 3RWIA 2NNAB 4BXSV 2JJVA 2OSLB 3G5ZA 4HGMA 4JFZH 3DC0A 4TUKH 3OPZH 5GS1B 2EJ1A 3B5GA 2AXFA 3DIFA 3Q8AA 2GJ6E 3EGXA 5M94B 2UZYB 4HH9B 5E6IB 25C8H 3TA3B 4LHQB 1P2CB 2JCWA 2VH5L 1VPOL 1U8PB 2WMPA 4P4KD 3T1WA 4UQ2B 4V11A 2G4EA 1KCRL 4XNMB 1R3LA 4HXBL 3IU3B 3QULA 2DIEA 4LO9A 4EIBA 3WLWD 1V7NH 1XF5B 2UUDK 1IQDB 3FCSA 4I0PB 4X6CA 5B4MC 2WQVA 3GEWB 3PP3K 1BD2B 3S36L 5HYEA 3P3TA 5D1QD 2EKSA 3GLDA 3QEGH 1JNHA 4R2GC 4WV1B 3B7TA 3FB6A 2VDPL 4GKLA 3M8OH 3MTRA 2VXVL 4HCRH 4MJIE 4QRTB 3HMWH 5F1OB 1DSYA 1EEYA 1KEML 2BH0A 1ES0B 2MOGA 1Z7JA 2IFFH 3UJTH 4EVNA 5K1JA 2WLLB 2WXPA 4CDGC 1G1CA 5F7FA 2EDBA 3SKOA 5F9OL 2WBXA 2ZOKA 5AZEH 1A3RH 4GIPD 3EBHA 3GMLA 4JQIA 1MAKA 3T8XB 4DPBX 1PNDA 1MAMH 1NQBA 2O26U 3VCLB 5DO2D 1NCWL 1H3PH 5TFSH 1BZ8A 2AJSH 1CDUA 3O4LD 2OL3L 4PGJA 5DFTA 3V8CA 3LKPA 1VGEH 5J12B 2NX5B 3O3EA 2QR0B 3OKLB 4RFOH 5J57B 4YR6A 1I1AA 4HIJB 1YEKL 2ZOTA 4DOHE 2Y7OA 1LO5A 5TGBA 1VPOH 4G1MA 1Y18A 5DUBB 1AZVA 3QFJA 3RA7L 3V6OC 3QIBC 3UEZA 3MV8B 5CEZL 5K9OA 5AVWB 3CSPA 2FEEI 5CILH 2FIKB 2YPKB 3TNMB 2R2EA 3U7YL 3VQMA 2YHGA 3KPRD 1KYOJ 1YEDA 1YYML 3EFDH 4BFGA 1DBKH 1IZJA 3DMMA 5F1NA 2R1WB 2XNAB 3GJFA 3DO7A 1A1MA 4JFFB 2OI9C 1MRCL 2F8OA 4UT7H 1J9TA 1XGUB 4PJDA 4YL4A 4JG1H 3L3DA 3PWUB 4Y2DB 3GXPA 3VWKC 3UMNA 1MCJA 1E4KA 3VRIB 3QCTH 4HEME 4OY9A 2C3GA 1WD8A 3M86A 4FYTA 4CNIB 3O4LB 3MRHB 4X99B 4OKVA 2A0LD 4XBPB 5CF3A 4I3RL 5LUMA 3CN1A 1LJMA 5AW5B 2X88A 3UH8A 4G6FD 3QIBB 2DQCH 1ASPA 1JHLH 3S3DB 1P4BL 4KJQD 1AQ8A 2GI0A 1JFHA 1CE6A 1FLTX 1WPCA 4N2CA 4L4TE 3IRCA 2D4DA 4KKLD 1GIGL 1IB5A 4KVNH 4NUQA 3LAFA 3FTGB 3ISWA 5HDWA 3N9GL 2HTLD 4GKZA 3VFWB 1J0YA 4UV7L 2DZEA 2R69A 1JZ2A 3QNZB 1IM9D 4LLQA 2WANA 3WY1A 1VZIA 3ABMB 4NN7B 1MFAH 3CUPA 3F65A 2Y36L 4MDIA 2BFVH 2JH2A 4BFKA 3ARBB 4LCYA 2XWRA 2AQTA 5GGSY 2QT6A 3N0PB 5B39A 4PRDA 1CICA 1XH0A 3O2DL 1RZFH 1QFWH 4KRPB 4U6YB 4UTAA 2A9BA 2BSSB 3GMMA 1BFSA 2BDNL 3G5WA 3HCVB 3L3IA 4XMLL 2YKKA 4MJIA 3MLTA 3O6FC 1FN4A 1DN2A 2G60L 3FAXA 5E9AA 1ZS2A 1C8QA 4GNKB 3BT2L 3ZPDA 3IFLH 4DVBA 3D3VD 2D73A 3KM2A 1BGXL 2BP5M 5C07A 1G87A 1GS6X 1HH9A 1QA9B 3H55A 1G84A 4POZC 3TPKA 4BK5C 4AYEC 1ZAGA 4WSJA 1CR9L 3FF7A 2HKHL 5C71A 1GL4B 1DLFH 2AVGA 4DN3H 5GS1A 3IDMA 4QYOB 2IQAB 4G6KH 5J6HB 4POYA 2J1XA 1ZK5A 4JM2B 5DEFA 5DUML 2XBZA 3V4VA 1CDGA 3EJQA 3WKMH 2VABA 5AL8A 1R5IA 1H0DB 4QHNA 4XC3L 1FNAA 3ROOA 3T2NH 1V55B 1QQDA 3MNVA 3CBJB 2R8SH 4HMDA 4L1HA 5FDYA 2WQAA 3VFOB 3RNQA 1ZV9A 1YMME 4KJWD 3CK0L 4M5TA 4Q0XL 4OF5A 2YAPA 3OXRA 3PNWA 2BFVL 2CCVA 3CPLA 2H3XC 4S2SB 1ZGLM 5ACMA 3IJHB 5FGRA 1QSFA 1UGKA 4AT6A 3Q1EA 5EIIG 3U36A 1FRGH 4Y4HC 4UOZA 1EFXD 3MJ7A 1E5UI 3HA0A 4QXVA 4U1JA 2C26A 4MKTA 1XXDC 3IJEB 3N40P 1CGTA 3DJTA 4X6DE 3ZRFC 4TL4A 3NH7H 5EZOL 3US0A 2FBJH 4HJJH 4AH2B 2ZNXA 3CHQA 3PV7A 2AFNA 4J3XA 1ITCA 5DTFA 1XGQB 1JZ5A 3KPRA 4Y4KC 5AZ2H 2VZOA 3V52L 4E42B 4X7EC 1T0MA 1IGYB 1I1AB 4G6JL 1GYWA 1QPKA 3K72B 4X7TB 2G9HA 3UG5A 2EDLA 1INDH 2J6WA 4TTGA 3ECUA 1TEGA 2DBLH 3K2MC 1MI5B 4M8VA 1UEYA 4Y89A 3MO1B 5MERB 3PYCA 1AG6A 4DGVL 5ADPH 1UZ8B 4HMCA 1JI2A 1M57B 5LQBH 4QHLB 1CIUA 2FX8L 2Q3AA 3ULSB 2WWKT 2R23B 1ODAA 2PTTA 4XH2B 3WDHA 5IEKB 3AS2A 5IB4A 1MVUA 1RZ8B 4J2XA 3PWUA 4WHYG 1NIBA 5GPRA 5C2UB 5CEZH 3NZ8A 4WJ5A 1WAAA 4FYSA 5IQNA 3CSFA 2N4IA 3MCKB 5FA3B 2VWEC 3EOBB 4JMNA 3IF1A 4PY7B 3QG7H 3EJZC 4QRRD 1SM3H 4K5OA 1ZSHA 1E90A 3GSVB 1SOKA 4JHZA 3PPSA 1NPJA 4GXUN 1MHPL 2JELH 1WBZA 3MLVH 4UIKH 3W11D 4HEPG 3P0VH 4KOBA 4G8GD 3Q44A 4OCLC 3L4VA 5B1CA 3JTTA 4KMQA 3C60C 5ALCL 4BDVB 3LDBC 2SEBB 3F64A 5ICYA 3PHOA 3NCYS 1M2OA 5DHEA 4JDVA 1CXIA 4DP8X 4Q74A 1RUQH 3DLQR 4AGMA 4LKCA 1CTNA 2PCFB 2B39A 1ZKAA 5C0FB 4ONGL 4PG2C 3VSQA 1J1OH 2HUEA 3MJ9A 1DN0A 4OSUH 4CSZA 1JWUA 5FYJU 2ZXGA 1ETJA 1FGNL 3PY9A 3D0LA 4NQVB 1NOFA 5MEQB 2DLTA 3EH3B 3U4BH 4NI3A 2FD6H 1CICB 3V4VL 1AACA 4YOKA 1S7VA 3SE3A 1U95A 2FRGP 5LWYH 4OAWB 4LOEA 1TFHA 4N5UA 2XJLA 4JL1A 4H0HB 2PPEA 4PRIB 3COOA 5I1JH 3VGBA 5JQHC 1AQHA 2FE0A 1JPTH 3W37A 4Y4FD 1MAJA 3EJRA 2VE6A 3L6FA 1SEQH 4GKSB 4IOSD 4OBRA 4QTHA 4WDIA 2XU9A 4DUXA 3W9DA 2YD7A 3UZVA 1UM5L 1FNGA 1KIRA 1BA9A 2IH1B 1MHPH 4EBQH 5D2NC 5MP6L 2A77H 1NUGA 3MSPA 4U1LB 4OZFB 4PHZA 4ATTA 3D52A 1CF8L 4F7TA 4KQ0A 2VUOA 3CPUA 4PJ5D 3RNKB 4DESA 2NW3B 3VU1A 5J13C 3OZ9L 2WTOA 2Z91A 1JWMA 4BH7B 2HH0L 4PJ9A 3UYOD 3ZUCA 4P5KA 3KWXA 3Q2LA 1E9PB 1AQKH 3GJFK 3THMH 5FHAH 4J3OD 2YGVA 4H1LA 4CVZA 1DLFL 4LSPL 4YGAB 1DBJL 3KPPB 3WTYA 4I1PA 3GQFA 1A7NH 3I2CL 4D0DA 1KIUB 4JFEA 1AY1H 2NR6D 2XXGA 2YKLL 2XWDA 3GRBA 3NQKA 1BIIA 2I5YL 3V4VH 1HEZB 1QVOA 3DPBA 4IKLA 4XCFH 5L4JA 3QVAA 1EEZA 3X12A 3MFFB 4XN2A 3IJEA 3MJGX 1DTUA 3CIQA 1ZHNA 3QRGL 4BCXA 1ZLSL 4APQC 1ACCA 2EYTA 3F6LA 1FE8H 2UZXB 1XCTA 4D9LL 2N56A 4F27A 4YVUA 1GGIL 1NANH 2BVOB 1UXSB 2MQCA 2XN9D 3QNXB 1WHPA 3OKNA 3MJ6A 1QBLH 3CVHL 3E80A 5A3ID 3OF6A 1R4XA 4H25A 2Z7WA 3C08H 3QS2A 3ARFD 1CDBA 4K8RD 4OLXL 3SQBB 1Q0XH 2RAMA 1G7PA 3FUIA 2Z7YA 2ZUUA 3ZMRA 4BK5A 3WV0A 5JPNA 3BVTA 4U1IB 1PZAA 5DLLA 2N7BA 4ZW8A 4P59H 5F9DC 3KGSA 4NQED 1JGDA 4FQCL 1E5ZA 4YAQA 3TWCL 2CWRA 2YMOA 2W07A 3ZRSA 2O6DA 2ROYA 3CFQA 2EAEA 4UU9B 4QRUB 4L9LA 3RY6A 4AM0Q 1RZKL 1MCHA 2DQJH 4N8VG 2Y2TA 4F5CA 1EAPA 4QRQA 5GS2H 3VD5A 3FFOA 3E7JA 5CR1A 5SX4I 3OAUL 3GSNL 4LFHD 3VMOA 4AQOA 4HJUA 3D39A 1D5XA 5I8KH 2P8PA 3QUHA 1JZHA 1VLXA 2WQWA 2C3VA 4PG9A 3WE6A 3QDJE 4KZDL 3NAAL 2MQGA 2EACA 2ZUYA 1FLRH 1EJOL 1NMAL 2VERA 3KYNA 2APTA 4JDEB 3NGBC 1E27B 1U8KB 1NUDA 5BUPA 1LEIA 4PBDA 5I6OA 5D7IE 5EUOB 3H56A 1I7RA 5F3HA 2WLIA 3ARFB 2XN1A 4LLVB 4XCNB 3PL6D 1UKSA 2P48B 2IXQA 3ML9A 3KGUA 2CE6A 3NIFF 2D2CC 3H6AA 3BZ5A 4QWWD 4FAAB 4NQEB 5KSBE 4XMWA 2FT6A 4XE0A 4BH8B 4P5TD 1GGCL 2EVJA 2I69A 3BXNB 5L2KD 3VW3L 1CGYA 3TWCH 1U36A 1E4XI 3B2DC 3QXDB 3MBED 1BFVH 2F74A 3L81A 4N68A 3KYAA 3U4KA 4TUKL 2DKMA 5JOPD 2I60H 2DWEA 1E9OA 1JXFA 4A6YB 3IGKA 5B38A 1GYVA 1BVNT 3WEAA 3X14A 4AVKA 5ITBL 4P2RB 3VA2C 4BUGA 3HI1A 1EV2E 4N8CH 1TTAA 4HLJA 4CKVX 1QLFA 4QHUB 4HS3B 1U8QA 4AEFA 1A6VH 1ETA1 2A6JA 1FZMA 1IAIH 1PD6A 1WZKA 4B7IA 2QQNH 3QUYA 3LHPL 2JI1A 1XGTA 3LKRA 2VXVH 4HCRL 4EUPB 1Y7VA 2WSKA 3KJ6H 5IOKA 4RWHA 5F89A 4JFED 3QQ4A 2CBMA 5JO5A 3R19A 4H26B 4KK6C 4BZ2H 3ESNA 4WTXA 3NZHH 3WI9A 2OP4H 5C0IA 3II2A 4KTDH 4OD1L 4NQDD 1T2XA 2AGJH 3HW7A 5E8EA 4W9IC 1BBDL 1WP6A 2QVMA 3QCVL 4WTQA 2KLRA 3MRQA 5K69A 1EJFA 4QWWC 3WEMA 4ZUUB 1SMOA 2VZVA 4JB9L 4YHKH 1NDGA 4Y1SA 5E2WH 3PABB 5EORL 4F15C 2HUHA 5DRWB 3LQAL 3KPPA 4GUCA 4ZX5A 1CFNA 4AEHH 1W2KT 3CFEA 4OFKA 4PLJD 3RPBA 3UJJH 4JG0L 1INQB 2A4EA 3ZTEA 4CKQA 2HT2C 2WXKA 2NY5L 3NPSC 3K80A 2BRQA 3DTDA 4P48A 3VXRE 5BXFB 5T3XE 1H6TA 3ERXA 2C9VA 1E6JH 4FQLL 3HG5A 1UWGL 3NZUA 5T1JA 2BVYA 2KH2B 4O4YL 4CAGA 1PLGH 2EXTA 1EHLL 3QIUC 1R0AL 5E51A 2YZ8A 3BZEB 2OMYB 4FABH 3TFKC 2ORBL 4HKZA 1WCQA 3RTLA 2H0JA 3O8XA 4NQCA 3SDAA 1X7TA 3ZMNA 4M5YL 4FNRA 2YPLD 4MCYA 4NS0A 3F58L 2AV7B 2GTWB 2HVJA 4L3AA 2F18A 2LU3A 3HB3B 4I3SH 1DLHB 4N3UA 3PGCA 3V5DA 3EJCA 2LT9A 4LLMB 2H32B 4NI6A 3TEWA 3JWDL 3PAVA 1IGTA 2OMXA 5SWSA 2EVHA 3ZT6A 2EUVA 3TOPA 5FF6A 4JPWH 3BVNB 2BJML 4LSUL 3FUMA 3U46B 4B9PA 1VB9A 1NWPA 4MJID 1TZGL 2XVKA 4L1BA 3W39B 4DT2A 3IMRA 3BE1L 5T3ZH 4Q9CA 3APFA 5FGCE 4ZUSB 1NGPH 4IKKA 1ZVYA 5D1QE 4A1RA 1FL3B 35C8H 1KELH 4Y5YC 3KPOA 3VXUA 1OAZH 1LP9B 4HEPA 3PU7A 4YHZL 4NOBA 3HNSL 4RA3A 4Y16A 4YHYB 4ABQA 4G8AC 3OD3A 3VXRD 1TETL 2H2PD 1E40A 2ARJB 2YPLB 3ILDA 1B0IA 3N42B 1KTDA 4Q8BA 3IJ7A 3MODH 4TLUA 3EDDA 4JG5A 1OCWL 4IMKA 1D9KA 1HHHB 2EDOA 1U21A 3SKUD 1A7RL 1C5DA 6PAZA 4U1NA 4F8OA 1W91A 3IDJA 4OF7A 1GYAA 5C8JB 1CK0L 3GS4A 4PWHA 3C6SB 4UT9A 5SWZD 3FC8A 2H6PB 2K70A 5CFAA 2AP2A 4X5WB 1OGSA 2CH8A 1IBBA 2NYZA 4FA7B 4X4XB 1QSFD 3ARZA 3P02A 3FCUB 2AANA 1CD1A 2YA1A 1Y1UA 1OWWA 3HC4H 4DF9A 1FFNB 1Q9WB 4YSSA 4MAYC 2PXYB 3KR3H 3RPIA 4AIEA 5I0DA 1KWKA 2GPZA 1M7IA 1R5VB 3OG4B 3VI4F 3UZEA 4YHIB 1VESA 4NZJA 4X7DC 3ZDZE 3QEQE 3DOSA 7FABL 3INUL 5BS0D 3UABA 2XUWA 3QEHB 3E38A 3N85H 3NN8B 1XR8A 3DOHA 5E5UB 1KEGL 1P1ZB 3HG3A 5T1LD 3LRGA 4M6MH 4DGYH 1WBYB 3C8DA 5E2JA 4UIMA 4MNQB 2Z31C 5IVNA 3F7VA 4H5SA 2J6EH 6TAAA 3AQXA 3FT2B 3SCMA 4KDTC 5EEUA 3VACA 2Y1ZA 5JW5A 2AK1H 2K9UA 3DUUB 4JO4L 4K15A 4PJ7F 5F3BA 3QYNA 4FGMA 1H15B 5IJKC 1MG2C 4ODTL 2APSA 3ZT7A 2FNWA 2WV3A 2X05A 4ZXBD 2FBJL 2P5PA 3ATAA 1ILUA 2RACA 5E8DH 1E8WA 4HWEL 1I9EA 1OM9A 3QZMA 3M1BA 4FG4A 4L1DA 4N87A 4NO0B 3BLBA 4PW3A 5T5FA 4A2DA 1AO7E 4B9FA 4F7MB 5LXGH 1L9PA 4O5LL 3QO1B 1RJLA 4KRPD 5DSCA 1SY6A 5I6XB 3B34A 1XB3A 3BW9B 5JHLH 1OD9A 4MWFB 5TQ2L 4FD0A 1WVZA 5DK2A 1P4BH 1HHKB 4PGDB 3O8XD 4XR8C 4JRYA 5DI8B 3SDAD 5HYQB 3HE6A 4BINA 4XB8A 3AAZB 1AKJA 3TJEL 1L3NA 3IU3A 2OMTA 4E9QA 3JTSA 2J44A 1XCWA 4ZFZB 3P69A 3TGXA 1XO8A 1J0KA 4NJAH 1KTBA 5J1TC 4ZZKA 2OXHB 2AJXH 5T1LB 1H3VA 2O6FA 2BOLA 4Z7VA 1FE8L 3JV6B 5BW7C 1VSCA 3G5YB 5E8NB 1E50A 1YNLL 3C6LA 1HL4A 3PWLB 3U7WH 4JM2D 1DJXA 1EEYB 1FZKA 2VW7A 1QSED 4PRBB 1Y6KR 2YEZB 3KLKA 3GXDA 5TPWL 4RGND 5I1DA 1K85A 3GK8H 4JFOA 4N0CD 5ISZB 3B2VH 4FLQA 3ZJAA 4M61B 4RCAA 4ZYKA 3UERA 4G42A 4NO0D 4QXWA 4FABL 1EDHA 4OD2A 3H9YA 2J21A 2NNFA 5IMLA 1G9MH 3T5WA 5AD0A 1ORSB 3MRPB 3NCEB 3ORJA 3O3EB 2EABA 3EDKA 3IJ9A 4P9HC 4PJFB 1CDJA 2IOMA 3CFBA 4M1CC 4OI7A 4PJ7E 1JZ8A 5INDA 4B0MB 3L4UA 4JDTL 5CBAA 4EQ3A 5BOJA 3DSNA 4HX1A 4XMXA 5HDLA 3GZKA 3SODB 4I9WD 4GQPH 2GW5A 1MCSA 3IDNA 1DQVA 1HZLA 3SBPA 1NCWH 5TFSL 4EIGB 4PJIE 5HI3D 1NDMB 1UD8A 2ADFL 2VL4A 4PB9L 2VJ0A 4U4BA 4BA0A 7PCYA 5KSBA 2Y6SC 1MCWM 2C9PA 2CO6A 2PPDA 5HD8D 2Q7NA 3AS0A 1YNLH 3KXFE 2CSPA 1AANA 1VFAA 5CHNA 4Z7WA 3GRGA 2IWFA 2X42A 5B8CB 4OGYL 5I1JL 3ETBF 2FBRA 5LBSA 5ISZD 4NLAA 3ZBMA 4M5ZL 1KJ3H 3DX8A 5IVXA 2P24A 1T1XB 3ARUA 4JO1L 1KCSH 3IFNL 5AOKA 4OLVL 4AUUA 2VR7A 4NUJB 2FDBP 2IOOA 2OW6A 2VLKA 4RIRA 4HJJL 3NFNB 2BMKB 5MEND 2V5SA 5F7LB 2D3VA 1OHQA 2G75B 2G3MA 2NNCA 1S5HB 1MFUA 3NDZE 2W0PA 2OXGA 3OB0K 3N42F 8FABB 3MRGB 2O1AA 3WHXB 1FL6A 1JNNH 5FYJE 4MSWA 4UQDA 3RZCD 1TVDA 2GJZA 4HISA 4L18A 4M4RB 5KYWA 2MFNA 3A6CH 3RJDA 5IMKB 1HNYA 4MQ7A 4HIEB 4XP9H 2AJZA 1BIHA 2N1TE 2IANB 2AZUA 2IAMD 1PW3A 3GGWB 1DO5A 2ZWYA 3LS4H 4W9DC 4ZFOA 4NAJA 4KKPA 1W80A 3F85A 2X4UA 3Q05A 3NPZB 2ZG3A 1TZHA 3MAWA 1MPAL 3WE1A 1JYWA 3QYMA 2XZAL 4ICXA 4P49A 4XOEA 5DEJA 3FQYA 2PYEA 3MLTB 2F7QA 3SE9H 5AOJA 3O8XC 3SDAC 3SPVA 4FRWA 4JQVA 2CHDA 2ZXDA 2EO9A 4WFHE 1CBVL 2E27L 4G5ZL 4WFED 3KJ4C 3CDFA 2K3HA 2BSRA 4Q6IC 3QWNA 5EPMA 1Q94B 3Q6FA 4NO2A 4YSOA 3VFPA 5BJTA 2IALA 1Q1JL 1QBAA 5F1KC 2ADGB 2DWDA 1B0RA 5GGRA 3I9PA 1CL7H 1YUHB 3BW9A 4N0YH 4M9PA 4Y1AD 3EADA 1E6OH 1LWJA 3C6LD 4LDOB 5ESVB 2Y5TA 4KROD 3ULVD 3PHSA 1J1PH 2IH8A 2Q3ZA 4JM2A 4PRID 4X0KA 1OALA 3V9EA 5J6GB 3BAEH 1A66A 2R51A 3NJLA 2E3VA 2D0HA 4ODWA 4BFBD 32C2A 3K1KC 1KTLB 4QHNB 3BEWA 3VFVB 3M45A 1NDTA 2FZ3A 5DJ6B 1MXDA 1MCOL 4JFYA 2DI7A 2UZIH 1MIML 2VZ1A 1NEZG 3BUIA 3HUJF 4V2BA 4UT6L 4X80L 3BZ4B 3LQMA 4Z9KB 2WXJA 3ABZA 1UUNA 4P2YA 1S78C 3GMRA 4PFEA 2BHYA 1DBAL 4UQ3B 3CZSA 5T3ZD 4AMKL 3KPNA 2XZAH 5IJKA 2YS4A 1MFBL 5EU6D 1HKLH 1NJ9A 4KKLC 3PQYB 5GGVL 4ZT1A 4KZ0A 3OR7A 4KZEL 1JUFB 1S7UA 1XIWD 4G80B 3RLSA 4F2FA 1SVCP 2FWLB 4W4OC 2QPSA 3O45B 5F7YC 4PJCE 3WGUB 1FFRA 4G5AA 5H4ZA 7TAAA 2X70B 1BEXA 2JQZA 3I84A 4EDWH 5F88B 1DJZA 2EDJA 2ZUQC 3IGFA 2IIJA 1RFDL 2NY6D 3KLQA 4OGXH 4DUVA 4JCLA 4PJXF 5DJXA 2ZF8A 1IC5L 4PRPB 3RWDA 3MRMB 4TV3A 4LARH 3PWVB 2EXSA 1DSFL 3DYPA 3FFDA 4TQIA 3MRLB 5IG7A 3RAJL 3JYBA 5GGQL 4AKPA 3GSWB 1WFNA 2LQRA 3ZDYF 1DQDL 1QABA 3BO8B 4NPYB 4OLWL 2OCJA 3FONA 1DQKA 3P0YL 2XN9B 1IGJB 3ZYIA 5KG9A 5BRQA 3VB8A 5FDWB 3W0WA 5C0BD 4GXUM 3RL1B 3M07A 1BMWA 1KPRB 2NXYC 2PW1A 2WP3O 2IQ9L 4XH2A 4Z23A 4LCWB 1RZ8A 1IAKB 3WCYA 1QUNA 4F2ME 1TJHH 3FU5A 5MHSD 2TSBA 3FB7A 1ADQA 4OZFH 5HHQA 3WAKA 5BQ7B 3TJHD 3HBQA 4WI5A 3EOBA 1NWOA 1AS7A 2GIXA 4PJIB 2ADFH 3ZU8A 3HMXH 3REVA 3X17A 4HT1H 3ZQWA 5AW3B 1OP5K 5LQBL 2ZCHL 3MA9L 5ES4B 4GSRA 1ZLEA 3RKDD 1WZLA 4N6QA 3NA9H 5F44A 3EZJB 3S5YA 4DN4L 3DGGB 3D48R 1B6UA 2F19L 3RWFA 1FL6B 4OGAD 3ROLA 2Y23A 2QLYA 3ML8A 2OP4L 1MHHB 3V0VB 2I9TA 4A7QA 4Q9QH 3QIUA 1G7LA 4LLYA 4F37K 1FL5A 3T0VA 2AGJL 5F93C 5K5YA 4YSTA 3G04B 4G9FE 1JWSA 2P44B 2WVSA 4PLKC 1TG8A 1DQDH 4YPJA 4CN6A 4FG0A 1OSEA 5EEXA 5DWPA 3ARQA 5GGSA 3PJNA 3VFGH 3MLZH 1BZDA 4XCCH 4J1UA 2DIJA 2E9JA 4RDQF 4ADIA 4N8UA 1ORQA 4FLOA 4BFIB 1IEBA 2KPNA 1SQMA 3IYLW 4H8WH 1F02I 4PRAB 5AAWC 4A39A 1I3GH 3ETSA 4B9CA 3FBQA 3OAUH 2YAHA 4XCYA 4NEHB 2VAAA 4HS8L 1QTPA 3TBVB 5I8KL 3C5JA 1JDAA 1SNRA 1E4WL 3AG1B 5E9NA 1GMEA 3D6GA 4B5EA 2Z8WC 3HMXL 4ANWA 2NT0A 1NSNH 1UG9A 3NIFB 4J3UA 1ZHBA 3UTSA 1FH5L 5K59E 5BJTB 3BMWA 1QFUH 1R24A 2MOQA 3BESR 4NENA 1INEL 3V79C 1JI1A 3H85A 2J3SA 1GGBH 1IO4C 5GHWH 5ALBL 1BECA 3CXDL 5KSUB 2EDQA 2QBWA 4JFDE 3PGDA 4LP5A 5I8EA 1QSFE 3H9HA 1S9YB 3JT0A 3U1QA 3WELA 2OSWA 2Q7YA 1UKQA 1D5IH 5A1AA 2WZ5A 4I85A 4ZAKD 3GSRA 3PDDA 3IGAA 3ARPA 3FU3A 5IB5A 2VLLB 1BQ5A 2AVFA 3FT3B 5DS8B 1ZANH 5L7XH 4OUUB 5DRNA 3WTTA 4XX1G 3WIHH 3NSJA 1MRDH 1PBYA 1UZ6E 4BBWA 3LRMA 1CG9B 1NFIA 2YAOA 2QSQA 4JFEB 4DK5A 3QK0A 2AV1B 3QWQB 4FXKC 5LO7A 1XGYL 4LVOB 2B3RA 4AK2A 3UBGA 1KACB 3K2UH 4KXZI 1LWHA 3N1GC 4WAFA 1M9WA 5JR1L 1E5CA 1HHIB 5DC2A 3W3BA 5EZLA 3ABLB 2D7NA 3O3AB 4K7FA 4S1RL 1YY9C 4NDMB 2P8MA 4QO1B 1AI1L 4YX2H 5DYFA 1EJ8A 3CLFL 4AW7A 1DBKL 1MJJB 1SBSL 3BAYA 3HNVL 3HZYA 4ZDHB 4PJHA 5F96H 4JREC 2V17L 4RGNC 3WEXB 3VDBA 2Q10A 3EIFA 2XTLA 3V55A 4HVBA 1TSHA 1U8CB 1A5FH 4Q4EA 1J8HB 3HE6D 4MGXA 4LOFA 1AKJD 3VRIA 1R3LB 1T20A 3BKJL 3SQBA 4YE4H 5G55A 4ONOA 2P7TA 5FA4A 1A3LH 1SN5A 3O3BA 2RR3A 1PY0A 3QUZA 4K3JH 3GLAA 5F8RC 4E5XB 2XIBA 5BCAA 1ZLDA 2MPAH 1BOGB 2CHXA 3QR2A 4OW6A 4DP6X 4AQAA 3IXTB 5BPPA 2NMSA 2JNZA 4NPYA 5KUMA 1VACA 1P4UA 3FQRA 4N0FB 5EFIB 1U41A 4GG6B 2FWOB 4QRTA 3CFKB 4MA3B 4TRPL 4AEHL 1QWHA 3DHJA 3D08A 3TA3D 1TPXB 1T1WB 3DX3A 4JG0H 3S5LA 1AGEB 3MV9A 2ITFA 5IVZA 3CLWA 1EXUB 1KFAL 3DRTB 4LPCA 1XGYH 3NFPB 1VJSA 4XP5L 4I77H 5H94B 5IROD 1KV3A 2VDKB 5JW4R 3AG3B 4TVPD 5LNEA 4I0PD 4E9TA 5B21A 2Q86A 3QNZA 3T4AA 1SOQA 4WY7L 4KVCL 4YK4C 3CSYA 4WUUE 5DJAA 3EYQC 5AVQB 1S5IH 4J3OH 1X7SA 5FM5O 5IB2B 1Z32X 1AH1A 1PZ2A 3KYNB 2NY2D 4D7PA 2CMRH 4YXLL 4B9IA 2ZIDA 3H0TA 3VVWA 5I19L 2CDFB 4HUMB 2O5ZL 3GMQB 4R4BB 1GVIA 1J0HA 4LLVA 5E6ID 5F1IB 5EWIL 1NC2A 4L8SB 5EO0B 3LKSA 4OF8A 4WWID 1JGLL 4IIQA 5K9KB 2FQFA 1RUQL 1H6FA 5JOFB 3B9KA 3FUNA 4BE5A 1F42A 5GS0L 4TUOB 3FQ2A 3GMNB 4XNXH 3OKEA 4HWUA 3DVNA 3L2LA 3K5SA 2OYKA 2CJUL 1NAML 1YNKL 5DEFB 2ZT9C 1U2YA 2AQNA 4MJ5B 3D4YA 4YXKH 3A67L 1IL1B 4HPOL 1VFBA 1KGCE 3TA3C 3IFPB 5I23A 4LBEB 4PWIA 3PP3H 4P2QE 5TK4A 4KNQA 1WUZA 4W9JC 3VFTB 3GBNL 1B9KA 3I74A 2A6JB 3SDXE 3UFIA 4ABUA 5TDPB 3BSZA 4YSCA 3ULUL 3O41A 2CKBB 5AAMC 1IE5A 3KLSA 1BF8A 1RK7A 4JFFD 4OZGF 3CVCA 2WWMC 4TSBL 5HJGA 2BXZA 3U83A 3V4PB 4J12A 2QGBA 2GC4C 4OFDA 2R0LL 1Z3GL 3DTXB 3FT4A 3IDYB 4EE2A 3FQNA 5DFVC 4X50A 5FFLA 5I24A 5D7IA 1WIPA 4E9YA 1EBPA 1HILB 4H8QA 1G9NH 4CMMB 4ICWA 2PTVA 4W9ZA 4LSVH 3SHSA 3L3JB 4PJGB 3BN9D 1K4CB 3STBA 2Y7SA 5DJZB 2HX8A 1CI5A 4L8DA 5HGDA 5ICXA 3MRBA 2QSCH 4DCQB 4LCUA 2CRMA 1NDGB 12E8L 3S36X 4YJZL 2RH0A 4GG6F 2BOCA 3A4FA 3EO9L 3BKMH 1DVYA 2H6OA 2A9MH 2HKFL 4ETYA 2FUQA 2J73A 3IPEA 4KTYA 4PM1A 4QD2E 5AYUL 3T3MB 4L3ED 4QJ5B 2J4WL 4PEEA 3FB5B 3NJFA 2NXZC 3I2CH 2CKBH 5DJYB 2ADIA 4GAGL 1IC7H 3MLSH 1A6AB 4MAUL 1EVUA 2VMFA 4P5SA 3OMAB 2BC4A 3TIEB 4K5LA 3W82A 4YZWA 5EUKA 4LGSB 4TOYL 4LCIH 4C8XA 2Z4QB 1JNHB 2APXA 5JW4N 4FZ8L 3BP7B 3LPPA 2PTTB 4G6FB 4GBXD 3ARDC 3H42L 1A2YA 1JZDC 4RMRA 5IB4B 3BZDA 1FIEA 4HZAA 2B0SL 1IBDA 4G6AD 2DYPB 2FWUA 3ARBC 4L8BA 3J27A 4BIKA 2K6YA 3B9AA 3FO9B 4UILL 4PJDF 2AV7A 2WXLA 1R5IB 3DA0A 3NIGB 1UH3A 3S6CA 5JQIB 1RU9L 2JK5A 3QJQB 3TYGH 5F71A 5JYMA 2X6CA 3NK4A 1CVSC 3QUXB 1AGBA 1RHHA 1Q9KB 3M8OL 1F3JA 3RBGA 2MRYA 2JELL 3P9MA 1WZAA 1PCXA 4KPHH 2PWDA 4DN3L 3RWGB 1YECL 1EO7A 3BVNA 4G8IB 4OCYL 2NDFA 2QV2A 2QVKA 1UCBL 3HLAA 3NCJH 3QI9D 2YQGA 3SGDH 4OJFH 1YEIL 3NJHA 2WKLA 4JHWL 1JF1B 3IXAB 1CLYL 4FS0A 3VGGA 3GSNB 3CFIC 4HJ0D 4RNRB 3TNNA 4DEWA 4HT1L 4D9QE 4AZ8A 3S3SA 2OTWB 4P5MA 3MA9H 2HT2D 3QORB 1RUKL 1QBBA 5GGTA 5BRPA 1DQQA 2OM5A 1KUMA 5D71L 1HINH 4LLWB 1MEXH 1HVXA 1EERB 5IFHH 4Y2DA 1XZWA 2VN5A 2V3DA 5IR1B 1IC0A 3H1ZA 4V1DD 3HPJA 3TJPA 2VE6B 3L6FB 3OWEA 1BEYH 1JPTL 2KL6A 4H20H 4PJCB 1MJUH 5GRXG 2GSGA 3UACA 4DZ8B 3P3YA 4WUUD 4WEBL 4N9GB 1V3LA 2C9RA 3SB3A 1ZS8B 4XPFL 1GGCH 2BW4A 1LE5A 1FG9C 2IH1A 3PXJA 2OMWB 1EGJA 1PY4A 5C0BA 3O81A 3TEXA 3GIVA 1MWAH 1EH9A 1D5MB 4H88H 1OAYL 5IEKA 1N0XH 4M7KH 1NEUA 3T1FB 3TIDA 5EEVA 1CTMA 3JWNE 4Y1AE 3QI9B 3AWGA 3UJIH 4KVPA 1I1AC 1EO8L 3C09B 3VFTA 1MLCA 3DX6B 4XP4H 4QAWA 4XMPL 3BN9C 4L37A 4YHLL 3ZDZB 5E5MB 2V33A 3R18A 4UT6H 4HKJB 2ILLA 4AENA 4FEIA 2ERJC 3TZVC 1ZOXA 4FXKB 3WTXA 3QORD 1NBZA 3VRJA 4IMKC 4RWYL 3BQUB 5GJSL 1INEH 2XV3A 3QISA 5K9QG 4QRSA 1A3RL 5CSGA 3PHOB 4GIOA 4NB7A 3UADA 5ANME 3VYOA 3WD5L 3LVTA 4JO2L 3EYUL 1JJUA 4PJGA 4PBWD 4N2HA 3CDZB 1RK1B 5HD8C 3CH1A 4QRRB 4G3YL 5JHDA 2ZTBA 5IB3A 1I9IL 2MJWA 5K39B 2MSPA 4X9BA 5BMFL 4W9HC 1GRWA 3GJEA 4HETA 1ICTA 4FFZH 3GKZA 4A38A 4HA1A 4PJEF 1B3JA 2B1AH 3N55A 4TNFA 1WT5A 4KQ4L 4L9LC 3RY6C 2NR6A 5BNXD 1CD9B 3NCXA 1TZOA 2VABB 3AB0B 3IAQA 2OMTB 4MS8D 3MLUH 4GH7B 1E2WA 4FC3E 1BJ1H 4FHKA 2QSCL 5B3JE 2FAUA 4YSEA 5EUKB 4PHXA 2XG4A 2EQDA 4BSVB 3AY4C 5DR5L 4UT7L 1R34A 3P9WB 2F61A 3RY5A 1RSFA 1X5IA 3ZSTA 3HR5A 1CICD 2W9DH 5DEZA 2GEEA 2DQTH 1SJMA 2ATKA 3RBSA 3MJ8B 4IK7A 5DJ8B 3RVUD 1Q0EA 2WBKA 3PL6A 1MW3A 1XB6A 5KOVC 3T6QC 4M5YH 2H2SD 3NA4A 3QIUD 3MRJA 5JTWA 4YE4L 1TUPA 4P5TA 2MNJB 2FX7L 3QDMB 4G3YH 2P5EE 4KNTA 1PFCA 1RHHB 3OHXB 3FOLA 2X89A 3RDJA 1F3JB 1XGQA 4G8EB 1UJ3A 1XAUA 4GO9A 3G6AB 3RTQC 4MJ4A 2YOCA 4TVSa 4PR5A 4F2MB 2BNRA 4KKBD 1RD6A 2CKNA 3DX7A 5KVDE 2HVKA 2W0KA 1LMKA 2VM4A 2OR9L 2AS5M 4TUJB 4Z1PA 1FO0H 5FGSA 1ZPUA 3AROA 4OFQA 4X8JA 1GSKA 4AQ1C 1A65A 4PI0A 1KB5H 4YS4A 5A16A 2YA0A 3GT6A 1RVFL 1IJ9A 2CR0A 5AVYB 3KWTA 2B08A 1OAZL 3I9IA 2BSED 4P3WA 1AIFA 4P5MB 4W4NA 1OY3B 1XH3B 4XAWH 2KLTA 3OGCA 3OAZK 2CIIB 5IHHA 4UB0L 3X14B 5I1GH 3P9LA 2VKXA 3HI1B 1ESOA 2B8OT 4EI5A 3L2NA 3F7PC 3UAJC 3R7QA 1ZT7A 1MG3C 2NT1A 3HE7C 5T1MA 3WFBH 3CN2A 1QHPA 3LCYA 5GGTL 3ULVL 4GKNB 3K6OA 1YMMD 1UWXK 3PHAA 3KHQA 1RPKA 3NZSA 3P2DA 3UTPD 4DGVH 4HHGA 1A6VL 4ZX4A 2WZ6A 2EH8L 4KBPA 4NZTL 5TDOB 5IP4A 1LXMA 2P5EB 2IPKA 4GI8A 3Q3GB 3ZYOA 3HMXA 4OUOA 1CFVL 2AW2A 1KYAA 5AW4B 5EZJB 1V7ML 3PXLA 1UM6L 5D2NB 4KJYA 5CWSB 4H26A 3T77B 2JJTC 5B3NA 1LQSR 4R4ND 2J5LB 2G5BB 3EO1A 3B1UA 1Y6MR 4YDIL 1RZKC 4FZEH 1XCXA 3AITA 2QQQA 1JZEA 3L95B 3LZPA 4OIAA 5JIQA 5E2TH 1M3JA 1KY7A 2OZNA 5DF0A 4HUUA 1UWEL 1BPLB 2LLLA 2W9EL 4PS4L 3D3VE 3I02B 5EORH 3E6FB 5ITFA 5CFHA 1MRDL 5KN5B 3QUYD 3BGFC 3C60A 3UPCA 2DYSB 1IAOB 1S7VB 3FL7A 1TJIH 4AE1A 3UJIL 1BX2B 4AM0A 3ZE1F 2VQ1B 3OJ2C 1YC8A 3TN0B 3N6YA 5L9DH 2XQ0A 5JZ7D 1RJYB 1CXKA 4JRLA 3FCSB 4AGNA 4F93B 5HGBA 3MLWL 4XZ4A 3BXNA 2P5ED 3II3A 4NQDA 3T0AA 3QR0A 1YEWA 1EZVX 3U25A 4EZKA 4HBCH 4OVUA 1F4WL 1D6EB 5E8DL 1G7QA 1YYLL 3KHOA 4H40A 1U91A 1P4LA 5FK9A 2CU9A 3NA9L 3A6BH 3L5WB 2R29H 5KS9B 3OC5A 4A2MA 1JXJA 1KIQB 4B95C 4F7CB 5GRZA 1OL0A 1CL7I 4OIFA 3CZUB 4N2BA 2EDMA 3PP4H 4K3JL 2YMXL 2F54B 3HAEG 3MNDA 4ZW6A 3TONA 5IHBA 3V0GA 4KU1A 1N0LB 3L08A 1GYUA 2MCPL 2X12A 3QUYB 4AGPA 1E8YA 2JCCE 5PAZA 3VD2A 2Y7MA 1P4IH 3ASWA 4D9RE 3I9AA 4KDTA 3DSFL 4HKBB 4TL5A 3VXME 3W9EA 1U4EA 4P2RD 1YQVL 3QFJB 2WJ5A 1XF4A 5JO5B 2R83A 2F8XC 1V3JA 4PJEA 1VA9A 3AVEA 5DMKB 1X7QA 2F5BH 2G2RA 1A4JA 1QBML 1SDYA 1FL3A 4LEOB 5TPWH 2AJYH 5EU3B 4E9WA 3EOTL 3E1ZA 4MD0A 3BEVA 4WSKA 4AIXA 4HAKA 1E7VA 3F7RA 4NPJA 1QRND 2CRZA 4GMSH 4D0CB 4HZ1A 4JPVL 5HI5D 1FNSH 1SHXA 1YVLA 3ZN6A 1JZJA 1X6NA 2BNRB 4NUGH 4C54A 1BZ9A 1T21A 2AERT 2XKSA 3V0IA 4GYBA 2DLGA 4G6JH 3OXSB 1FUNA 3ESPA 1GZPA 3CFUA 4U1NB 4Y7MA 1XZ0B 4GRLA 4ZFGL 2AJUL 4Z7NE 3OB8A 1GAFH 2BY0A 3C8KA 4KJWC 2FH6A 3A21A 4U1IA 3WBDA 4HJTA 3B2XA 3CN4A 4NC0B 3OL2A 2X5PA 4X6CE 5GGUA 3WJMB 5FECB 1YMMA 3C6SA 5FGBC 3D87B 1PD0A 1IAIM 3MUUA 4PJ8B 5CO1A 5FCSH 5BS0A 1ZEAH 3ELQA 3K6FA 3VSVA 2DBJA 1X5FA 5KG9B 3U4AA 2J56A 2IWGA 4JFZL 1CFTA 1F6AA 2D3JA 4I18B 4K71C 4R9HA 1EIBA 2RFXB 1VIWA 2B3IA 1PZDA 4OZHE 1N18A 1Q0XL 3L3OB 1QFHA 4IBSA 1K4DB 3LNEA 1XF3B 3CC1A 4ZMPA 4OJAA 4GSUA 4N2KA 2DH3A 5IFHL 4Q7DA 2VN4A 2Z92A 3RAJH 4BK8A 1RIUL 1DVFC 2P4AB 3L3HA 4K7PX 4LFHG 2CNZA 3ILQC 3L5XH 4IBUA 1WICA 4ZNEA 2R4SH 2YBGA 2OQJB 5DGRA 5TDOA 3RX7A 4YSDA 3LMJH 3WKPA 3BAJA 3KWWA 4JFQA 4PAZA 1IGTB 5B1AB 4Z8FH 1S9WB 5SWSB 3BVXA 3IKCA 5CSBA 3WIIL 1VCAA 4TTDC 1ID2A 5FYLL 2FEEL 3U46A 3SE3C 2FJUB 1Y18B 3ZHDA 2PPFA 5I66A 3DIVA 4F58H 1FJ1A 2ZSWA 3OMNB 4CMHB 2GT9B 4HHAB 4Q6IB 4KC3B 2X4TB 3ULUE 1R3KB 3FO0L 4E0RA 2PKDA 1FAKT 1HOCA 2CDGB 4MZ2A 3T8VA 2IVFC 1MSPA 5EO9A 5CEZE 1YLBB 4PTTA 4R7VA 5IOPA 3HB3C 4I7ZC 2BS71 3AS1A 1OAKH 1FVEB 4DN4H 3V6ZB 4HC1A 4CN4A 3LKOB 2Z31D 5E6SB 4J1UB 4KQ3L 4OGQC 2XBTA 3SYAA 3V4VB 2R56H 4Y2DD 3X3FL 4O51A 3NIGF 2VQ1A 1WC7A 2Y69B 3QXVA 4MHHG 4IOFC 3GKWL 3K91A 5E2TL 1E42A 3C5ZA 1OAQH 3P3UA 4XPGL 1HS6A 3G9VA 1JYVA 5CLTA 3QDME 2ZZUT 4CNIA 1S9VB 3VDAA 4QNPE 5F7UA 2PO6B 3JWNH 1EX0A 1F4AA 3M1CA 2P80A 2V2XB 1U93A 3QJVB 5DDHB 3JV5A 5EU5A 5AB0A 4BRVA 1U8IB 5B3JF 4XNYH 5GGRY 1RUPH 1MOEA 4X4XA 4JKNA 1AGDB 3K1DA 1WS7A 3US1A 3V4LA 4OLXH 4X6DF 3PWNB 4J3OG 2X53A 1OAXL 2NOYA 5I8EB 4WJG3 3CWGA 2D7TL 4HUXA 4B41A 2NR6C 4F7CA 1ET5A 3HVDA 4F58L 3EH1A 2O93L 1ECYA 1NCAL 3B2VL 1NH6A 3B4NA 2CUHA 4LHUD 2CUMA 4F37F 4Z5RA 1XMWA 3PQYE 1XR8B 2VDLL 4ALAH 4BSWA 2APVA 2Z31B 2G0KA 2VL5B 4JRXD 5C0AD 1T3FB 4JFPA 1CWVA 2OPCA 4GW4B 1RJZA 4KKAD 4ZOBA 5EF3A 4Q2ZB 1Y0LB 4YXKL 4BRJA 4QJ3B 5HI5C 4OLEA 3O0RH 4JRXE 5C0AE 3RIFK 4L8CA 2I5YH 2WWMD 4OD1H 4YIQB 3RUGF 1RK0B 5HHME 5E9DB 2Y0SA 1CPUA 1EMTL 5DS2A 5J3HC 4Z78A 1IVLA 1UZ8A 1I8LC 4R83A 2KHAA 3SPHA 2YUVA 5AFAA 2NZ9C 3MREB 3WNNA 3QQ9C 2R23A 3NFSL 1RUPL 4QYOA 3MRNA 4JR9H 2GITA 1HAWA 4R90L 1PX3A 3BP4B 5JIKA 4R5XA 5BV7C 1U8CA 2YEVB 4K9EH 5DK2B 1UYWL 1BZ9B 1T21B 3L5JA 1H3UA 5EBMA 2H1XA 5AW2B 5CD3B 4FI6A 3AMKA 4JCMA 4O4YH 5I1EH 5EC2A 4JO1H 2ZXEB 2Y6TE 1YEHL 1KN2L 2HSIA 4RAVA 3QEQD 1EAQA 1DLHA 1JV2A 2DQGH 3VI3A 3AT8A 3JBG7 1L7TL 4DGUA 5I15H 3CTTA 4OFPA 5BS0B 1XBRA 2FX9H 12E8H 1NBYB 1U4FA 4HU2A 4WCYH 4H4NA 3O3DA 3KL0A 3HFML 2MIZA 3QHZL 1CXFA 4MTMA 2GSIB 2AEWA 5ICYB 1RZQA 4N3TA 5EB9A 2YUWA 2C9XA 5AEAA 3UTSE 3KGTA 5SWZE 5GXBB 3LH2H 3FS9A 3MR9A 4FQJH 1ZHLA 3L3GA 3VXUE 1HL9A 4UM9B 4BZ1L 1IV8A 4ZYKB 3WFBL 2ATAA 2DJSA 2WXFA 4MQSB 2DQDL 5T1DL 5ERWB 2ZKXA 1YDPA 1BG9A 2O5XH 1UATA 2X6UA 3CFCL 1LMIA 1BLNA 3SDYH 3UBXI 3BGMB 3AWEA 3IVKB 2ESVA 3MBWA 1UD2A 2X4RB 5JW4Q 4YQXH 2EUXA 2F19H 6FABH 1H5BA 5DWUH 3O9WC 3OLEA 5T5NG 5JORA 4WEUD 1L9QA 3D06A 3GS7A 2R4SL 4XNAA 3UAEA 2ZPKL 4LK4A 3WO3B 1IBGL 1AC6A 2M26A 3N44F 4QXGL 3ZW3A 4X99A 3APDA 5HYJA 1UM5H 2VLJA 1OT1A 4IGBC 1KXTA 3REWB 2H6PA 3APCA 3VRLF 3ARRA 1CL7L 1V27A 3HE6C 4OGAC 1MJ8H 5DC0A 1M7DA 2F1BA 5KYYA 4HBQA 1CU4L 2RHEA 4A68A 1RLWA 2P45B 2OJZH 3KL5A 1ZLUH 3RI5F 4BQ9A 4Z7NF 3QXTA 1KTLA 1ACYH 1BQUA 2TSAA 4K94L 4OZ4A 5L9DL 3S36H 4CRPA 2Z65C 2JJSC 4W93A 5B7FA 5C08A 4GKZB 3UAJA 3CQPA 1FPTL 3U82B 4FQXB 4APQA 4ZW5A 2W92A 4HC1H 3NN8A 1NCHA 3GMRB 4UQ3A 1QTSA 4G71B 2DOCA 3A4EA 4I13B 5TTRA 1D7BA 8FABA 4LHUG 3HEIB 4BM7A 3M1OA 3Q9QA 2W38A 3RJQB 5C0EA 4BDVA 5HVHC 1CZ8H 3HG1A 3C9NB 2EILB 3BGAA 4R26H 4B7LA 5H8DA 5C0FA 3DUSB 4HUVA 2ZPKH 1MCDA 4K8RL 5FB8B 5JHBA 1ZY9A 3U9UB 4U3SA 2O4EA 1ZANL 5L7XL 3IJ8A 3DRQA 4M93C 1QO3A 2XXMB 7CGTA 4WW2B 4M3JA 43C9B 1H6EA 4GW4A 2H8PB 2HFEA 4OAWA 2CRIA 4YE0A 4J8QA 5DJYA 5IHUL 3HE7A 2WNXA 5K1VA 4TNWK 1D5ZA 4UOJA 1XWVA 4YIQA 3EH5B 4PGEB 4KGLA 4LCCA 1YEGH 3SPVB 2P5WD 2YN3A 4PP2A 3TIEA 2CGRH 2VZSA 5EEYA 1YHPA 3H7BB 4FQXD 4WV1A 4PP1C 3W9DB 1BBJA 3LKNA 5G5DB 3BHBA 5GIRB 4BSJA 3E6HA 4Z3HA 1NIDA 1AVAA 3HG4A 5E1QA 2X44D 1SJHA 1EHKB 4P07A 1L7IL 1DQML 2F2HA 3SYOA 5D5MA 5HJ3A 2GABA 3QCTL 4I48A 3EJYC 5LN8A 1V10A 3FO9A 1QP1A 4N90E 32C2B 4JUSA 4YK4B 1IJNA 2NX5E 2KT6A 4R7NB 4WNJA 4OLUH 5DLMH 4BZ2A 3F58H 3VCLA 4YSQA 4P23A 2QLVB 4LLAA 3FB8A 2JFCA 1G7JB 4CVXA 3TM6A 4DGIH 1F4XL 3F6IA 4UT6A 5FV1L 1E27A 2MPAL 3BPOB 3KS0J 1KDJA 5AD0B 3LIUA 3V4PH 2EXYC 3MJWA 4M62L 3RGVB 3C60D 1UYWH 2FUTA 3L9RA 3NACH 3MGAA 1BHGA 4NNYA 5C0DB 2CO7B 5EUOE 4R3SB 4XN7A 5AVTB 1JUFA 1RU9H 4X4MA 5A7BA 1Z0MA 1ZTXE 2FEDD 3GHBL 1ZHNB 1J18A 1KCLA 1R47A 3KBPA 3WSQH 1RIUH 4TKWA 1L9OA 4I3GA 2IDCA 4OV6F 4ODXA 1IM9A 1SXAA 3PLYA 4IBZA 1ROCA 2X2YA 5CN1A 5I0ZA 1ZIBA 1SGKA 2W91A 3HG1E 4PCYA 4HQQH 4U6XB 2LE9A 1IMHC 1JFQH 2OSYA 2VQUA 3O6ML 3VI4A 2CO6B 2NZIA 3T65A 4N8PA 5B38B 3VFNA 3EJSA 2B16A 1DQQB 2E9GA 4JM4H 2Y6SD 1XB8A 2MHAB 1PJWA 2Y9RT 3B9DA 4ZMZA 1H5BB 2WWKO 4I9XA 1SDDB 2F1EA 4LESA 4CSSA 3L7FA 2E47A 4BEIA 4LMQI 2J8UF 2QJDA 5SX5K 4YDKH 1TJGH 2GSGB 4DZ8A 2DQDH 5EUOF 5T1DH 3ZGHA 4YAQB 2EE0A 4GRLC 3HZKA 2J71A 1K3ZA 5KVEE 1EFQA 2X1WL 3RWHB 1I1FB 4C83A 1KGYE 2DJUA 2IPUG 3GNMH 4HZLB 4Y5YB 4EUPG 2Z9TA 3IMTA 3V6OA 5IMMB 1JG9A 4BYHA 5F21B 1HEHC 3RIAK 4LVNC 1N59A 1V3KA 3KNBB 4HKXA 2WXMA 4NZUL 2JQMA 2XZQL 2CK2A 1R5WB 2A73A 2OK0H 3OGOE 3OKOA 4M6NL 4PH8A 5HHQB 4Y4KA 4ZUUA 4XPGH 2WNGA 1BM3H 1RSYA 1C5BH 3B7SA 4J3TA 5FGCB 4CILA 4PJAF 2Y7LA 1NGWA 1BAFH 1I82A 1R3HB 3S3PA 3CFEB 3P0VL 1G6RB 5DMYA 1T0PB 3FO1A 4J3OF 4LCWD 4XMTA 2V3EA 4IHOB 1S78D 4ZSOA 4JKPH 1EFXA 4K94H 2W59A 3GBEA 3MXWH 4OLZL 1KCRH 2B9BA 3GMPB 5TF0A 4UI2A 4PSRA 5IHWA 5D7LE 4KKCC 1EGJL 3FQXA 4DFHA 1AGFB 2LTQC 3QEUA 1ZE3H 3NBNA 4QRRA 3QUMH 4N22A 5JHDB 1S7SB 1NFDB 1KXQA 3NTCL 2OMYA 3N2JA 1NIFA 4LZKA 4RQQA 4BUHA 3VU2A 4N90D 2E7LC 1MFNA 3ZR6A 1MKFA 3FUKA 2OMUA 1E9OB 3BKML 2EDDA 4PJBA 2YPVH 4FI7A 4QHKI 4R97C 5DJCB 1E5YA 4OZFA 5HHVL 1ORQB 4BFIA 3FHEA 3ZKXB 4QF1A 4K2UH 4AWJC 4GRWH 4ZS6D 3SN6N 2C1PA 2VDRL 4ZMOA 4PGEA 2J1WA 1BJMA 4M6NH 3ROOB 3QNFA 4JN2B 4PB9H 1G5AA 5AVZB 5C6TL 3H2QA 2DYRB 3HAEH 4JFYB 3T8MA 3ZDXF 4GEIA 2DMKA 4IDLA 4MXVF 2YC1B 2HWZL 1T1ZA 4I88A 3DV6A 5F7HA 2JKTM 3Q2NA 5FLUA 4C4BA 3J8F7 3LB6C 2YD2A 3N1MC 4KQ4H 2R1XB 1IARB 4GW5A 2AXWA 3ULVE 3PGDB 1LO5B 1BIIB 2NDGA 4NUMA 5TGBB 4D8PA 5FXCH 4MRBA 5CXPA 4FG6D 1RIHH 4OLZH 5KVFH 5K9OB 1WIUA 3AADB 4PCKA 2F54D 4FG2A 4X2UA 3MOQA 3A23A 1BWWA 1A7OL 3NQIA 2C5DC 3U2SB 4HWZA 3ZHKA 5EOCH 5DUJA 4NT6B 3HI5L 2VZ3A 5L6YH 4LMQE 3T2PA 3O9WB 3S88L 4X6FB 1IC1A 3BAIA 4RMWA 4JS7A 3ZE2E 2E6PA 4ELMF 5FUOH 5I30H 4YO0B 4KZCA 2B59B 3EH4B 3WNOA 4KXCA 3T0WA 2Z35A 4JY5H 4FTVA 1UCBH 3ESOA 1AR2A 4OQ1A 2Q87A 4YH6A 3CHPA 1INDL 2MWCA 2VDMB 1QNZH 2Z8SA 4I0PA 2X6AA 5FO2A 3H9SE 3LZQA 4L2LA 5CU5A 1MZZA 4F57H 5E4IA 2FD6L 3BZEA 1SMAA 1EPFA 3DX4A 4J8RA 4H0GA 4NX0A 1VAHA 3D07A 3QE5A 2H0PA 2GVYA 3R06B 2PYEE 1JCVA 1N5AB 3QZOA 3EGDA 4NZDA 2XA8H 2ZYSA 1KBPA 1W0VA 4TNEA 4HGWB 4FNQA 2XFXB 4WU5A 1BF5A 5BVPH 1FO0L 1BZQK 4MHHI 5JXAH 3K8MA 4S1SH 1HN1A 1PAMA 2AJYL 3REVB 5GS2D 3S37L 1I1FA 3EOTH 2FYYA 3QJHB 1WBZB 3Q3GA 5HSFA 1MFAL 1I9JH 3AT9A 3IAPA 2B9AA 4H7VA 4RBPH 5EFIA 4LQ1A 3CXHJ 5B39B 2DQJL 1TSRA 1CF8H 1I85C 3AREA 3NOIA 4M3HA 4P99A 3MLVL 3DGDA 2Y5QA 2O61B 4QNPF 3BIAX 4MJIB 4P4KB 4FFZA 3WLBB 4JE0A 1VZGA 4DVRH 2OMVB 4LSVL 1N5YL 4EO5A 1AQKL 1UQSA 3THML 2J8UB 3V5HB 5HYJE 2Q86B 1U6AH 1ODUA 5HPMB 1MCCA 2IDFA 3T71A 3TV3L 4X6DA 5D1XB 3HC3H 5BOZG 1R19A 1BD2D 2AC0A 2ARWA 2AJSL 4GMTH 2XT1B 5E1HB 4JZJC 3VXRB 2VXQH 3MUJA 1FZJA 3IN0A 3PFQA 2ADIB 5L88H 4ZO7A 3SKNB 4IHOA 4M29A 4UT9L 5IFAH 1AKJB 4AQ8A 1SYSA 3DV4B 2ADJB 2Y5EA 4KMLB 3T2LA 1H0DA 2BC4B 3AQZA 1TPXC 5LKNA 2CBPA 1KCKA 2XFGB 4QTHB 3GDCA 3Q43A 2XTJD 4S1SL 2AXGA 5DHDA 3TXAA 4JKWA 5DVKA 2J5WA 4UAOB 1OKEA 2UWEB 2AJXL 3U6RA 2R2HA 2E76C 4OBSA 4FQPA 5FO7A 5DD0L 1SBBA 3P4OA 4BWWA 4EXKA 2VR8A 5I19H 3RWEA 2NY0C 4FFZL 1Q9OA 4Z0XA 1PLAA 1UVQA 1PZ5B 2DS4A 3QQ4B 2XETA 3ZQ9A 1EGJH 4G82A 2YRZA 3SY6A 4F9PC 1KENL 5IHUH 2LU7A 4M61A 3DK2A 5D1XD 2XX1A 1KXVC 2F54A 2J8UE 5FUCE 1AGBB 3VFMB 5BO0D 2ITEA 4XO3A 3DOSB 4TPRL 3N43F 4OF6A 3US9A 2V5MA 3P9MB 3WLWC 5AQ0A 1WF5A 2W60B 4NSKB 4HF5L 3RWGA 3ARBA 4OR1A 2XWJA 4W9KC 1HEZA 4FX5A 4MNQD 3ZTNH 2R29L 2VSDA 4KUZL 2W9DL 2NY0D 3VI3F 3F7LA 2JVUA 2VDOL 1J1XL 2WQ8A 4XO9A 5IK3B 1QSEA 2IC2A 4FQQB 3BKCL 1QFWI 5DXWA 2J25A 5DJZA 4IBWA 4LHUB 1MJ7L 1IEAA 3LTVA 4ZXBB 1OP3K 3ZK0A 2ZCLL 1YEIH 3VE0B 2HFFB 2ZCKH 2WUCH 4UBDC 1Z9MA 3QRGH 1WJ3A 3WIHL 5I1KL 4XWOC 4NHCL 2RQEA 3WEXA 4IRSD 1RZJH 1NCBH 3BUYB 2IQAA 1MVUB 3O8XB 3SDAB 1NM4A 1ZWIA 3HBGA 4OCRH 3SY0B 1VFOA 3Q1SH 2CLVA 1NAKL 1A6AA 2D4FA 1FNEB 2GTWA 1KPUA 2VRKA 5J9PA 3ABGA 4ZO6A 2XWBB 4S1RH 1FG2A 4H8UA 4HLZG 3PDOA 3CVDA 1SYVA 1ZGLA 3IWVA 1PFOA 4AL8C 2OR8A 3WAJA 3I75A 4J28A 3S4SA 5I1AA 3HS0C 4Y4FC 3BYTA 1S8DA 2B1HL 3CMOH 4GXVH 3S88H 2E7BA 1A25A 4HDIB 5CD5C 3L4ZA 1GKOA 1UHVA 2DEYX 1T0OA 4EEEA 1J8KA 1PZBA 5CP3A 2TAAA 3T3ME 4G43A 5E2UH 5JHAA 1CGSL 1UC6A 4G11A 4IS6A 3FTVA 3SOBL 1QNIA 1TF4A 4U1JB 2ZICA 5AZEL 1XF3A 3I6LE 3QQ9D 4PREA 5F8QC 5J5EA 2DQUL 4NNPH 1OB0A 5KSBF 5CEZD 1BVNP 2X6VA 4XC3H 4YHLH 2YD8A 3ZUNC 1WG3A 4QKTA 3ZO0A 1C7TA 4OZIA 3QJHA 3EHBC 5TQ0H 3QARA 4IBLT 3CSGA 3QFDB 5I71B 3AW5A 3WNIA 4KJPD 2K7PA 4C55A 3ECQA 1A8ZA 1NCBL 3UP6A 3MBXL 1ZHKA 3KXFB 5I2IB 2YPLA 3U4EA 3NEEA 4IRSC 4DH2A 5TE6L 1OTSC 3CCHA 4WI0A 4X8GA 2ODHA 1G7HB 2JKXA 5CP7B 1H9DA 4GKSA 1WWCA 2BVTA 3BWUC 4N5EC 3RVVC 4Q9QL 3CFTA 3VH8G 5CIPH 3KL3A 3QW9A 3ET9F 1BSIA 3NT0A 3TNNB 1KIRB 3KW8A 5GISL 3WO4C 4XAKD 1IQWL 2O30A 3HPLB 5E4AA 1AGCB 3ZKXC 2UX7A 3HG0A 5AZ2L 3RIKA 3V6ZA 4A6YA 3PL6C 4LOVA 3WL9A 3MNWB 3VSTA 3RL2B 1R1CA 1M1XA 2I60L 1M56B 3FFCA 1QWNA 3QAQA 2GY5A 3SOTA 2DICA 5H4YA 1RZPA 4C47A 5FO9A 4CU7A 3KMDA 2HLAB 1KIPA 3T2OA 1PKQB 4FJ6A 3D85B 2E74C 2WHVA 1YEEH 4OFYD 3DO3A 1QLRB 1JERA 5BO1H 2VNCA 4JMXA 1S7TA 4LVHB 2CKBA 2AK4E 4ABWA 4FN0A 5TF1L 3ZLQC 3K4DA 4GSQA 1QFUL 2EDXA 3MJ8A 1AGDA 1PF3A 1P6AB 4Z95H 2WLMA 3FQNB 2JI3A 2BM3A 1PZ5A 3KJ6L 4RRPA 1R3IH 4IOSA 1EAJA 4XAKE 3KH4A 3SCMB 2EVFA 2EVIA 2E59A 4B3EA 4GFXA 4WUUB 3FJTA 1N2RA 4UV7H 1MI5D 2IAMB 4B96A 4LPXA 1P5UB 4MCNA 4N1EA 5SX5H 3HUJB 4Z7NB 3QCVH 1LYQA 1PG7L 5DA0B 3V6BR 5KSAB 2D3LA 5CZKA 5HHNA 3NCMA 4XRCB 4Y4HB 5DRXB 4WI9A 5B39G 4XGZA 3DROB 3D4ZA 1UD4A 4H88L 2OW7A 4Q2ZA 3V0FA 1U3ZA 4F2EA 2PP9A 3T04D 3M46A 4PGDA 1MHCB 1NC4A 2FO4B 4JUTA 4FJYA 4U7SA 2GTQA 4JY4A 1CXLA 5DMGD 1T03H 1U0QA 1VEPA 2HX7A 2EP6A 4HD5A 2WQSA 1RK1A 3ARVA 4ZFZA 5E9DA 3QAZB 3WY4A 4FQCH 3VXUD 2BSRB 4DKEH 5FHBL 4ISVB 5CNHA 3IDGA 4CGUB 5H2BA 4ZO9A 2YQ2A 4ZQKA 3BAKA 4QOKA 1PEWA 5F7EH 5F96L 4KROB 1TCRA 4QUOA 2CBOA 2YQBA 4WW1A 1TIUA 3SCMD 4XBMA 5HPOA 1J5OL 2DYPA 2V5RA 4JJ5A 1BMZA 3V0WL 4LKXB 4A7GF 4GKNA 2DKUA 3D2UD 4K07A 4QHMB 2ZX7A 2RGSA 1T66D 4OZGE 4LLMA 2DAVA 3TVMD 1SYVB 3QJXA 4G42B 1PEZA 4NZTH 4BJLA 4Y4HD 4YFLF 2EYRA 1XGZA 3BD5A 1BMGA 1S46A 2JLLA 3ARFA 4PJFA 4EN2A 4CW1B 3QC6X 4F8TA 4KO9A 4HW6A 1NAKH 3GIZL 1NCDH 1O6SA 4AJYV 5HGHB 2NY4C 3BJLA 5C09B 5EU4A 1JZIA 43CAB 5KUKA 2RTTA 1ROWA 2M8XA 4PRHE 4WU7A 3D05A 3KS0H 2X2UA 1X5XA 4PPTA 2A6DB 4RMSA 1G7IB 3WYRA 2QKIC 4WQOA 4OZIB 3IXAA 1JPFA 1BFTA 1SUHA 1ZLWK 3SEPA 1WZ1H 3C60B 1X5ZA 4JRFA 2DWEB 1T1YA 5JDSA 2NCEA 1P6WA 4LSSH 3RKPA 15C8L 1AQDA 1ZHKB 5I2IA 3BPCB 4Z3IA 2Z93A 5DVLA 3RG1C 4OCMC 1S7QB 3DX7B 4H25B 5KWYC 2X4RA 4RH4A 4ACPA 3ILPB 3BSGA 4ELME 2VSMB 2JSFA 3D33A 1G7HA 3C5JB 3NIFE 5CP7A 5BV7L 2BSTB 1OCWH 3AQDA 3EYSH 4FMVA 4HS8H 3TYFA 4BKTC 3NRPA 2IADB 5C07D 3VWJB 3OR6A 3T08A 3MRDA 4K5MA 4Y19A 3FQWA 3SPCA 1K8DA 2Z64C 3VJ6A 5CLWA 5MHSE 5HYSB 2FEJA 4GUPB 5FDWA 4M62H 4AGQA 4UDUB 1IC7L 5GRVK 3CVHH 3T1FA 3FFCB 2GBTA 3QI9A 1KJ3L 3UBXG 3TF4A 1M7IB 4MCMA 5C97A 4L8SC 4OLVH 3V9CA 3SDCD 1D7FA 4M6AA 2CDEA 4W70A 2VLLA 1IAII 3LHAA 1I1RA 5EC1B 3MV8E 2P5EA 4MDIB 5B22A 4LCYB 4DP9X 2VUKA 3NRFA 1DJHA 1FVDB 4FXKA 3SBWA 1KPVB 1OAJA 2EH7L 2XX0A 4UIMB 5AENA 5HJBA 4DIXA 4JBSA 5I18H 3GHPA 1IGFL 2R9HC 4WGVB 3JUYA 1F58H 1Z3GH 4MB1A 5IJVB 4AL8L 1QUPA 3SGEH 2I32A 1O6TA 4KHTH 3GB7A 1CLZL 4WWKC 1A4JB 4IM8A 5BUGA 4XWGH 1R46A 3WS3A 3ZT5A 1C08A 1QBMH 1KGIA 1CLCA 1U33A 4IBYA 1TNMA 3TO4B 1AD9A 2A9NH 2SODB 3ZXAC 3DUSA 4HUVB 2R0WH 5D7LA 2W88A 4JHAL 1TOXA 4AC4A 2K8QA 5EHFA 5GGSB 1IGIH 3S34H 4TPRH 1EEQA 2LAGB 2ORBH 4M7LT 5K93A 1O0VA 5A6IA 5J6HA 3DROA 4HAGA 2CR3A 3A3YB 4JRYB 4O02A 1ZTXL 4F80A 5LXGL 1UWFA 2WLLA 3F01A 4C57C 1C9SA 1UENA 4GT7A 5CR8A 1TEFA 5JPMB 1XZ0A 3EYUH 3MZTA 4P2RA 5ACZA 4XXWC 2Q5BA 4PWKA 1ZLVH 3SDXF 2VLKE 1KGXA 3MNZA 3M7FB 3O11B 3SDCC 3N0AA 1LDPL 4UQAA 1KJ2A 4PTUA 5F2FA 3V8OA 1A4AA 3FKUS 1BFVL 4PRHB 3R4DA 4YR6B 2KMWA 1JRHH 4PVBA 2Z7ZA 3GYRA 3B37A 4JW3A 1OM3H 1N7ML 2PYED 5T1KA 1T03L 4G6ML 4U0QB 1S9YA 2NXZB 4RSVA 3LRHA 4AE0A 4LKXA 2ZSVB 3JZYA 3TO4D 5CUSL 4AIZB 1RKRA 1RLBA 4HULB 4GRLD 4OD2B 4WY7H 3QUML 1MCKA 3SBRA 3QUZD 2CLZB 4IIQC 3VXPB 2V5TA 1REIA 3FUFA 3N41B 1YAZA 4TQEL 4L0YA 4TS6A 1MF2L 3SGJA 5ADOH 2A74B 1UOLA 2QQNL 2FYVA 1KJMA 4H0LC 4HKBA 2Y7NA 4IJ3B 3QHZH 2XOTA 1GH7A 3AWFA 4L8SA 4KNUA 5DCCA 2WVVB 4I2XA 3ATDA 4R3SA 3MRMA 1CGSH 3DX2A 4HHAA 4Q6IA 2YXFA 4Q9BA 4Z7OB 1RQ5A 3GZQA 1ADQL 4OB5H 3O4LA 4FQHB 2FO1A 1D3CA 3B56A 4PTTB 1BOYA 2AJVL 1CQYA 2J2ZB 3GSWA 1QI3A 1P7QB 1SLXA 2JB6A 3DVNB 5HGAB 1E3ZA 3RVVD 3OX8A 1J88A 5A16B 5CKAA 4YPGA 1MNUL 4QGTA 3ARFC 1Q9LB 2X1OA 2YK1H 1F2XK 3B3IB 4XXCA 4Y9BA 1BZ7B 3TTSA 3Q01A 3LQAH 4OFIA 4D0CA 4LGRB 3NACL 5ANMA 1IC4H 5LNDA 2WC7A 1FGVH 3QFJD 5E5RB 3BPCA 4D9RD 1Q0YL 5EIVA 3EBAA 5IFAL 4JZNB 2C9SA 3ULUC 1BW8A 1JVKA 4PJFF 1OAUH 3U9PH 3FOMB 4C58B 1WTGT 3WKNA 3QO0B 3UPRA 4KUCF 2Y7QB 3QDJB 1WCBA 4LDCA 1MCLA 4M7LL 3PGCB 3RWCA 4PP1D 5TK2A 3AM8A 4OGZA 3HG2A 3ETBJ 1P1ZA 1OTSD 4ES8A 2IH9A 1BYNA 3JTTB 3O2DA 3MRGA 4GKOA 3WHXA 2F0CA 4RVBA 1P6FA 3EJJX 1S6NA 4ZMTA 4MSWB 1GOFA 1N59B 1E5AA 1B3IA 2ZQKA 3FT2A 3QORC 4IU2A 2JKIS 2QPUA 1A9VA 2VO5A 2XV2A 4TULH 1PX8A 4R4FH 4H2AA 1AXTH 4Y5VC 4AG4H 3A6CL 2G4GA 2CHWA 1I8IB 2FIKA 2YPKA 3G9AB 1V8HA 3QC5X 4F7MA 4P2AA 2HTKC 2DF3A 1DUZA 1T80A 4LT7A 3TV8A 3HN5A 4UWQB 4GIAA 4XT1C 1ZEAL 4Y9CA 1J5DA 4ERSL 1Y0LA 4M1GL 4ZD3L 4DOHB 1FGVL 3ZDWA 1B2YA 1T6BX 3OKYA 2WCSA 1OZUA 1YEKH 2BRRH 3QPQC 3RIFF 4LSTL 5DUPL 3U0WL 3MDJA 1T89C 4WI8A 2LR4A 2QADC 2C3WA 1XIWA 3QDGA 3WD5H 3QEQA 3CHSA 1QQDB 4LQFH 1ZLWH 1RURL 1K6QH 4OF3A 1C5BL 3V7AE 1WWBX 4HUNB 1ANUA 1T66C 1SJXA 2D9CA 4KVCH 4ZUVB 3EOAB 4K8RH 3VGDA 3IRPX 2OZ4L 2WLJA 4EJ1C 1IC5H 3PWLA 5I0WA 4KFZC 1WS8A 3U36B 1KC5L 5D93B 1QSEE 3SQOL 3BQUC 3QPKA 2H3KA 2Q2EB 4HV8B 4L3EA 1A9EA 1YN7A 4WJKB 1LK3L 4J6RL 3Q1SL 2JB5L 5D8JL 4AW4A 4GEJA 2K4WA 5IBTH 2FZ3B 1PS3A 2XTJB 4MLSA 4IHBA 3TBCA 3VI3B 3BPOC 4OLWH 4XN4A 5E56A 3ECVA 4CVZB 3NIGE 2CGRL 3NESA 2XLLA 1J9QA 3EG9A 4LLQB 5TDPA 2BFGA 2DWXA 1OTTD 3LHPH 4D0DB 1NEZB 1FH2A 1PG7X 5IGXL 4GJTB 4ELKB 4ERSH 3TC9A 1NJ9B 2YJQA 4FQ1H 4XNUH 3QWOA 1RZGB 3C09C 1SXCA 1LO4L 1OK0A 2FJSA 3G7TA 1HCZA 3I9GL 4UTBH 1JGUH 2I24N 3RUGB 3QJZA 2BHFA 2OMZA 3CFNA 1TQCB 1N8ZB 4JCWA 4GLRI 3EYQD 1OQOA 1JF1A 2ZCHH 2EO1A 3E9TA 2JXMB 4LB8A 1CI3M 4HWZB 4S0HA 1V7MH 1T4WA 4KK5D 4KGJA 5A3IC 4BSWB 1X5AA 2X28A 4Z3JA 4L0PB 3ZE1E 3HZ3A 1B4RA 3DSFH 3O9WA 2VUYA 1VFAB 2GJRA 5A43C 3NIDF 2WIMA 2XQBH 3AJ7A 2L7UA 3KZ8A 3QZWG 2WVVA 2NQCA 1BCIA 3IJSB 3KLAA 5FCUL 4DP1X 5BS0E 1AP2B 1DDHB 2E7CA 5D4IA 5LVEA 1CURA 1LEKB 3N40F 2IAAC 1HWWA 3T6WA 1C16A 2VISA 4JQXC 1R75A 1CLOL 1Q38A 3FRUB 3LZFH 1PYWA 5D6CA 2OXHA 4UV4H 4KNSA 3NG5A 5ID0B 3BH9B 5BV7B 4QOKD 4PW4A 5LCVL 1RAMA 2GITB 4QRQB 3TESA 4FE9A 3ARGD 1LO2H 1MJ8L 3IE9A 2DYPD 2Z1KA 3IBEA 4I18A 3FSWA 3FCBA