3WTXA

Crystal structure of the complex comprised of ets1(y329a), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
118
structure length
118
Chain Sequence
GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
total genus 18
structure length 118
sequence length 118
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3wtxA00
2IOOA 2XWRA 2J21A 4AGQA 3WTVA 1T4WA 3KZ8A 4IBZA 3Q05A 4MZIA 3WTYA 3D05A 4AGNA 2IOIA 2J20A 3D09A 4HJEA 1CMOA 4GUOA 3D06A 5AOJA 5KBDA 1HU8A 4AGMA 2P52A 1CO1A 4LOFA 1GZHC 3WU1A 3D08A 4IBYA 2H1LM 2J1ZA 5AOKA 3QYMA 4IJTA 4IBQA 4XR8C 2X0VA 3US1A 4QO1B 5AOLA 5A7BA 1EANA 2J1YA 4LO9A 5AOIA 4AGPA 3WTXA 2J1XA 2RMNA 4IBSA 5G4OA 3WTTA 3US0A 1TSRA 3EXJA 3WTSA 5BUAA 2X0UA 4AGOA 2GEQA 4L0ZA 2FEJA 3EXLA 5G4MA 3VD0A 4G83A 2BIMA 3WTWA 5LGYA 3D0AA 4IBVA 2ADYA 2VUKA 2OCJA 1H9DA 1HJCA 1HJBC 3Q01A 1LJMA 4IBUA 5LAPA 3WTUA 2WGXA 1UOLA 4LOEA 2YBGA 1TUPA 5G4NA 3D07A 5AB9A 3IGLA 2AC0A 4L18A 4L0YA 4IBTA 2BIQA 1IO4C 2AHIA 4IBWA 4MZRA 2BIOA 2IOMA 2J1WA 2XWCA 3VD2A 5AOMA 4G82A 4GUQA 2ATAA 2BINA 1YCSA 5ECGA 1KZYA 3Q06A 3QYNA 2J6WA 2PCXA 3TS8A 2BIPA 2X0WA 1GZHA 5ABAA 3IGKA 2MEJB 4AGLA 4A63A 3KMDA 1E50A 3ZMEA 1EAOA 3VD1A 4KVPA 1EAQA
chains in the Genus database with same CATH superfamily
4KI5E 3QUZB 4NC1E 1NGZB 2WLMA 3EBGA 4S2SB 2FH8A 3T6ZA 5CCKH 3P1VA 5DJDA 3U4KA 4C4UA 1CC3A 4XN7A 1NFDA 1HESA 2MIZA 3HKFA 4CGTA 2VR7A 4YX2H 4NO3B 3SHSA 3CSYB 2BHUA 3VD7A 2Z92B 1H15A 4AENA 5I9QC 1CIDA 4B9GA 3QR0A 5GGRA 5FM8A 1OAUH 3OZKA 1CS6A 4XODA 3K8LA 5AW2B 4F8QA 4KRLB 1J9SA 3B7UX 5AG9A 2Y06L 3CSYA 4P23D 1JXKA 2Z92A 3H6JA 4AENB 5ITFA 4O51A 1KGIA 1A0QL 4WHCA 5GGRB 2FGWL 1VAHA 1ZS2A 3SKOA 2DH3A 3FT4B 2DQUH 4Q6KA 5D7LE 4FQJL 5AFAA 3P40A 1UWGL 1DLHA 4DIXA 5HDBF 4DTGL 5ITFB 5K5YA 4WWKC 1VADA 4AKQA 4AG4H 4DKTA 5JZ7D 1SPDA 5LDUA 1S7QB 5D1XB 2A83A 3PAZA 2ZKXA 5ICZB 4CBZA 1I7RA 4BFFA 2NZ1A 1E28B 4IW4C 1PZUB 3SKNB 1LP9E 4H8HA 4YDLB 4ORGB 3QHTC 1CFNA 2ZKHH 3GIZL 4TNWF 3GZPA 5KTEH 3T3MB 1F4HA 2BVQB 3GFUA 2I7OA 5L7XL 2ZCLL 2PCFB 1R3JB 2BVPA 3IFLH 5IREA 4RMTA 2LHAA 1QO3A 4R3SA 4XOEA 1OCWL 2X9WA 3RAJH 1FE8H 2MPAH 3B6SB 3FUEA 3VD9A 3T04D 7PAZA 4L3FA 1OM3H 2DQIL 3G6JA 3NDYE 4WKXA 3U79A 2EH7L 4R3SB 2I69A 4NM8H 2V9UA 5DO2C 3RJQB 4YSQA 3MGOB 4KK9D 4LPUA 3WIAA 2YD3A 8FABB 5GGSA 1IEAB 5EUKA 3T8VA 4K2UH 2B1HL 4NZRL 1J8HB 1AP2A 3TU6A 1SHWA 1TDQA 1O9WA 2NXZC 1VFBA 1PKQE 4HJ0D 4CILA 4P46B 3WFHA 3QYNA 2G3ZA 1OW0A 2QHLA 1J8HA 1QMUA 5MEPB 3B9KC 4C55A 1YEFL 3MOBH 4FQIH 2F5AH 2L4OA 1VEMA 1N12A 3PWUA 3MRFA 3X2QB 2YA0A 3AY4C 4C4KO 4AM0Q 2OZNA 4ZRGA 5DLLA 2DLFL 2Y06H 3PXLA 5ACMA 3TJHC 32C2B 4M6ML 1UT1A 2R2HA 3NAAH 4U1LB 5J1AA 3BAXA 4LIQL 3IKCA 1M9SA 4XGZB 2ADIB 4FQ1H 1A22B 3GHPA 2BJML 3OAUL 4XN9A 4EI5D 3CBKB 32C2A 1CGSL 4ELME 3LKRB 4F7KA 5HI4D 4ONGL 2G3XA 3IDXH 5JIPA 2X05A 3AGVA 1RK0B 2GJJA 1G84A 1DFXA 4XGZA 1T5XA 1XF3A 3OKEB 3SE8L 4Q89A 5BZDB 1IEBB 2GBUA 1WAPA 3OKKB 4L5FH 2N0KA 1T5XB 3LX9A 3QYCA 2VLME 3EH2A 3IMUA 3T3PB 4A2GA 3FT1A 1FI8C 3FZUC 5BZDA 3BAEH 5E9DA 1HT6A 1LQBC 1KJMB 1KXHA 4TS6A 4DQAA 1BZQK 3GBML 4PB0H 1EJFA 3OLDA 3D2UD 5IOPA 4OJYA 2YGNA 4POZD 2Y23A 2X4UB 2O5NA 3IWVA 3DV4B 3X1NA 5HDBB 2O6DA 5E99H 3BX7C 2CO3A 3RTQB 2Q7AA 3MRDA 3PHAA 2GTWB 1S46A 4HEME 5ABZA 3DVNB 4JGMA 3ZSTA 5C7XL 2JNZA 1XGYH 3HE6D 2DQEH 1IQWH 1N3NA 1J86A 3MNMA 4WSKA 1E2WA 3RL1B 3C5SA 1JGEA 4OIFA 4BHUA 1ASQA 3MRDB 1GIGL 2WYIA 3CSFA 1Z3RA 4JDTH 3V8OA 2AXFA 4HDIA 4F8OA 2E9WA 1N3NB 5BNXD 2ADFH 3EAKA 2OL3A 4ZFOA 5DI8B 4G42A 1ZHBB 3K0WA 1LILA 4ZXBA 3QIBC 5BJTB 3VXSE 1EEZB 2WXNA 3N9GL 2P8LA 1E3ZA 1A6TA 3NZUA 4ANVA 1LEIB 3KBHE 2VABA 4Q9BA 3WFCL 4POZC 3ECUA 1DL7L 2QDWA 2YK1H 5TDPA 3ZRFC 1FFOA 3NCXA 3L48A 1QSFD 1CVRA 1FVDA 3C2SA 1YEGL 4LVEA 1KZYA 2HKFL 1ZT4A 5KVGL 2FHBA 2ZG1A 5E2UL 5DJ8A 3V0WL 1V5JA 4LK4A 4MAZA 3BLKA 1GYUA 3S35X 4AMWA 5GGUA 1E9OB 2BZ7A 1HIMH 3OXRB 5ADOL 1HX0A 3AUWB 4NAJA 2BSDA 5F0JB 4GRMA 2CR3A 3MV7B 4J27A 3V4PL 1NAKL 3K71B 1E9OA 3KYNA 2Z7ZA 4WSGA 3BVTA 3HFML 2MMXA 4KKCD 1FZKA 3SZ6A 3P0YL 5KZCD 1V7ML 2EDFA 5GJTH 5DVNA 3CFCL 2HLAB 1AAJA 3U0WL 2NY6C 5FYKE 1NCDL 3FNKA 1M56B 5JXEA 2F5BH 1FZKB 3EOBA 3GSOA 3CXHJ 3L5WB 3OQRA 2W94A 1UENA 4JY5H 4B7LA 4HG4K 2AQQA 4UM9D 2CA4A 2R0WL 3HA0A 4ZZKA 4ZS7L 2QQNL 1E8YA 3PHQA 2A6IA 2H1LM 3L5WA 4Y9GA 2EYSB 2MOGA 4XNXH 1SXZA 1AI1L 2J5WA 2R2BB 4Z7QF 3S0PA 3B83A 4TQEH 1PJ9A 4N2BA 1IC7H 3PY9A 2F74A 4Y5VB 3C5JB 3PRZA 4KKPA 4LLYA 4NQXA 4Y89A 4Q9QH 1S6NA 3GF8A 3KH4A 3UAJC 4P2RD 3PLYA 5I6XC 1GGCH 3V6BR 2F74B 4Y5VA 3EKCA 5C0GA 1C8PA 2JTYA 4LB8A 4HS3B 4ZODA 4PJ7E 1TR7A 1W8EA 4A7QA 1SF3A 3T6WA 4XMKL 4HYTB 5F1KC 4H8UA 2NY6B 1JFHA 2ZG3A 5T1KB 3FJTA 3T08A 3DURA 3UP1A 3CN4A 1IC7L 1QFOA 2IANB 3E6HA 1XTMA 1QUPA 5E6UB 2N0MA 3KE0A 1FVEB 1L3WA 3BT2H 1G7LB 4OLWH 4KVNL 5D2LB 1EERB 3T77A 3VWKD 1OK8A 3ZO9A 3LPFA 3DURB 5E70A 1L7IH 2YQGA 2Q6WB 2XXCB 4FXGB 5KWYC 5HHOE 4TL5A 3RILA 4AQAB 3U1SH 4KZDL 3S3JA 2XV3A 2D3NA 4QOKD 4UV7H 3T0EA 1CD9B 1GC1L 4OF8A 1SY6A 2NY2D 3ARGA 1S9XA 4TKWA 5GS2H 4X7DC 3IDMA 5I5JA 2ETWA 3K6SB 1T0NB 3T1FB 4IYKA 1TKWA 2YN3A 1H5BC 4YBQC 4YE4L 3CCHA 1XCTA 2R4SH 1C8QA 4BCYA 1UXSA 5IQMA 1TO4A 1DJGA 2QV4A 4XWGL 3MV7D 1BMWA 5DJZB 5J11B 3WOVA 4EDWH 5IW1B 3VMPA 3C6SA 4P49A 3IE4A 1CICD 1XCTB 5JDJA 3I02A 2OMNA 2JFCA 1ZWIB 2XU9A 1EGJA 1U21A 4LLVB 4XP5L 2ZWLT 1BG9A 1G1KA 2Y36L 1YEGH 1JL8A 3QG6A 3AY2A 5CEZH 1AVAA 3Q3GB 4FXGC 3L3IB 2IOOA 1QSFB 1UJ3B 2WHVA 1XF4B 5CEXA 4MZIA 4RSVA 2E27L 5DT1L 5E6RB 1NDMB 2EDRA 2G0LA 3WL9A 2ZKMX 4GO6B 1CGSH 1EAJA 2NW2A 3X3GH 3QEHB 5BW7C 4QT5B 1HQRA 1NL0L 2BRRL 1JGLL 2X40A 4W9CC 2G3MA 2J5LC 2V7HB 3ARGC 4FZ8L 3ULUC 5HYJA 1FZOB 1Q72L 2R1XA 3W56A 2JKJA 2FB4H 4GS7B 3R1GH 4H25B 3OJDB 2AXGB 1IM9A 2YPVH 4YHIA 1FZOA 4NO0B 4E68A 4ENED 3GSNL 4OCXH 4NP4L 2HG5B 4LZKA 4H25A 5DHVB 3T2QA 4DKEL 4XMKH 2M26A 4PUBL 2YIHA 4XVUC 3EOTH 4X4ME 1KTJA 5DWUH 2WUCH 1G87A 2YXMA 4PV9B 1N5YH 5CD5D 3G7TA 5DVMA 1UJ3C 5B1KA 4Z0BH 3ZY7A 5LKNA 3A6OA 1C5DB 4M7KH 3CZLA 3TCLB 5EIVA 3QK0A 4PRDB 1QNZL 3FULA 4TQEL 4YE0A 1TO5A 1S3RA 4HZLA 4KTYA 1E40A 2IPTL 3E6FA 3K4ZA 1ET8A 4OD3H 5BO0D 1C5DA 2YHGA 4C57C 1L9QA 2WP3O 4U6XB 1ONQB 2A6DA 4RMUA 2PW2A 1X7QB 4G3YH 3AU0A 1RUKH 2F6AA 3N1MC 2XWZA 1BAFL 3WXVL 2OJZH 3TBYB 4RWYL 3MLUH 4Z7QE 3EYOA 3W0WB 1A2YB 4OJEH 4JY5L 3IFLL 3N1GC 1EPFA 3QXAA 1FCCA 3HHSB 1PG7H 2HT3C 1E43A 1NMAL 4NRYA 4W70A 3VXME 5A16A 2OMZA 1LD9A 3IKKA 3EYOB 2IDTA 4OFPA 1IV8A 5AZEH 1FL5B 2YSSA 1IGYA 1FFNA 3ETTA 1U0QA 3HHSA 2ICCA 5J9PA 1WFNA 2VERN 3Q8AA 4PS4L 4MCYA 1LD9B 4N6RB 3SOBL 2CALA 1KTDB 3U6RB 5GSVA 5ECGA 5BMFL 4Z78B 4RX4A 3X14B 3QJFA 1I1AB 1XIWA 1T0MB 4U6TA 2ZE0A 4OM0L 1KTDA 4TLTA 4NQED 4UT7L 3WNNA 1K72A 1I1AA 2YLKA 4RNRA 4NX0A 4Z3IA 3UJJH 1T0MA 3ECWA 4TVPD 4YHNB 1QPKA 3DRTB 4KVPA 3ZTDC 1SYSB 4UOW1 3VFUB 5CJOL 1EEYB 4OJFH 4GW1A 1KJ3L 4RNRB 3AU1B 3CFKA 5FKAB 2K45A 2BP3A 2VDKL 2VWEC 4ODSH 4AYEC 4YHZH 1BYNA 2DLIA 5CP7B 4JFDD 1Q0YH 3ZTJH 2L8AA 4XH2B 2PPDA 4PRIE 5FKAA 1B4JL 4M48H 1E6JL 3JV0A 4PJ7A 3T8MA 5INDB 1A6VH 4O2FB 1EJ8A 4XH2A 5AOKA 5J5EA 3FFDA 1JF6A 1RK7A 1YPZB 4FYTA 1I8MB 3K91A 3VG9C 5I5MA 1WZMA 1VF5C 2P49B 4X6DB 4QXTA 5F7YC 2ROXA 4Y2DB 4ACTA 2C3VB 4GRWE 2IQAA 4L2LA 3UO8B 1ACYH 5ANMB 3GIZH 1UZ6F 3BZEA 4PWHA 5FV2A 3S4SA 4DZ8A 4NT6B 1MHCA 3HZYA 4UV4H 4D9QD 4TTGA 2J7LA 4X6DA 2ED8A 1QZNA 4WI0B 3LJ3A 1BEYL 2BP8B 4KY2A 4AIZA 1T6BX 1XSJA 3GRWL 4YEEA 4LSSL 4JG0L 3BZEB 3SGJA 4LOUC 2YEVB 4NPYB 1TU2A 3FT2A 4KFMA 1I7ZA 2G0KA 5DEGA 1U3HD 5F97E 2IGFH 1ZA6B 3ATFA 3DX2A 3KBEA 3QDJB 4EOWL 2DMBA 2WBWB 2X4QB 1TU2B 1E0OB 2JJWA 2XNAB 4PWFA 2APSA 4OQTA 1RUMH 4WU7B 1D5MA 2YLHA 1RZIB 1OVZA 1YC8A 2BNQD 3N04A 4R96A 5JHDD 1RULL 2BW5A 2WVTA 4YDIL 3UPCA 1TVBA 1JG9A 1YN6B 2JJSC 3NZSA 4JKLA 2DWEB 2MKLC 4XNYH 4BK5C 4ERSL 4YSEA 1D5MB 2FTAA 3BH9B 2WWKO 4G7SB 4PG9A 4DPAX 5A6LA 5I19H 1J9CT 2Y5TA 5GSRB 4PBXA 4N0CD 3U36A 3LXUX 1HCYA 3OHMB 3SEPA 3F8UB 1YN6A 4BDVA 4IU3A 4NRZB 1CXHA 1RUML 1MWAB 2DIAA 3H7LA 3HJEA 4L3EA 4JCWA 5TTRA 4BZ1H 3MRIB 4NRZA 5A2CA 1N6VA 2R2EA 1KXQE 5JIMA 4QRPE 5AAMC 3VSTA 3DSNB 3P3SA 5GS0H 5CM1A 5KSAD 5L2JA 2QBWA 4WNQB 3D50A 2GJ6E 3PQYD 4NRXA 3O0RH 4N86A 2G9HA 1T4WA 3S36L 2LT9A 2VUOA 2XQYK 3DSNA 3L3GB 1EX0A 1P6WA 1I1YA 3OXSA 3WNMA 1AZUA 1KN4L 5H37A 5AB0A 1PLGH 2AVFA 2FIKA 3V0GA 1SVBA 5IG7A 3A24A 2DQIH 1H6FA 2R69H 5HDWA 4R7DA 2V2TA 3I9GH 2HSIA 2XC8A 1JSYA 1SY6L 1BBJB 2XJKA 3HNTL 3NFNB 4Q58C 1JZIA 3CZNA 3HEIB 3RZWA 4LP5A 2ZX9A 1P4BL 5IG7B 3RJDA 1B4JH 2XKSA 2CDFB 2HTKC 4G5AA 2V2TB 3AT9A 2OW7A 3DGDA 2ARWA 3DHPA 4X8JA 4Y2OA 3SQBB 4BZ1A 1BBJA 3NFNA 2VQ4A 3OC8A 4JFDB 4WTZA 2CDFA 1WD8A 1I3GL 4RMSA 3VFWA 3RGHA 2P44B 3BVDB 4M00A 3LYRA 4P06A 3VI4E 3S2CA 5I0WA 1BHGA 1PF3A 3ENEA 4WI8A 5FGRA 2XOTA 2XA3A 3CFUA 4NUJA 2LVCA 4HOXA 4L3EE 5AWNH 4KAQH 1GYVA 3QJHB 4CMHC 2YD6A 2BM3A 3BWSA 3GMMB 3SKJL 3N50A 4MAUH 2FQDA 1JNNH 2FJHB 4OZ4B 3GMNA 3HI1A 1SBSL 1MWAL 4MSWB 1U30A 3B5HA 4RQQB 4PVMA 3TO4C 4Z0XA 4M6OH 3QFJA 5HGDB 5EFIB 1SXSA 3NFSH 1NWOA 3VNYA 4FLSA 5E4EB 3SOBH 3DX9B 2M8XA 3KPPA 1Z9NA 1MAJA 2OMYB 3G5XB 1D9KD 1YZZA 4NGHL 2Q7NA 4EN3B 4ZFQA 4XNZB 4AEHL 3P9LA 2FATL 4WLCA 5CP3H 4Z0XB 1XR8A 3QFJB 4BJLA 1M7IA 3SE9H 3JXAA 2CXGA 5E6IA 5LBSH 3CV5A 4XB3A 4RISH 2P5WE 3BH4A 3WE1A 1LEKA 4PRHA 1IM3B 3NMEA 2AI0H 3G6JE 3FU5A 4PJGB 2DMGA 2QKIB 1GGBH 1CCZA 2HJFA 1W91A 3BQVA 3HG3A 1IAIM 1MHEB 2WNWA 1S2EA 2WNGA 5CWSA 3SQOH 4GSDH 3V6ZA 2Z9TA 3SE9L 4MA1C 3EJCA 5C1MB 1J1XL 4C59B 2R56L 4ELKA 3RWCB 2QTEA 3ZYJA 3CMGA 1QNZH 4LCYB 1KEGL 2HVJB 4WO4B 1V55B 5D7IF 4P5TA 5IMLA 4QJ5B 2IH8A 1RZ8A 3HRZB 2GTZB 5CJXC 1Z5HA 4PRHE 3UGUA 4HW6A 4R5XA 1T7WA 4Z7VA 1NGYA 4PIRF 5J13C 2A9ML 1KGWA 4N8VG 2VM9A 1F3JA 3DK2A 1PZSA 1QD0A 1RZ8B 2XTSA 4XOCA 3KCPB 5LQBL 2NTSP 4D94A 1NH6A 3HKZA 3QUZA 2NNFA 1NGZA 2EDBA 2X4NA 2G5RA 5TE6H 4G8FA 1E2ZA 4LRNH 5D7HA 1MXDA 1NJ9B 3J7HA 1PAMA 5AYUL 5FGCE 2WAQA 3HUJE 5ES4B 2E4TA 5G55A 4ZBJA 4EVNB 1UB5B 2AVGA 3T65B 2X4NB 1TZGH 4H1LH 5FFLA 4BV1A 1NJ9A 4PLKC 1F90L 3BT2L 1Q72H 3QQ9D 3WNKA 1NSNL 4PGCA 4W81A 4KUZL 1AR1C 1PW3A 1UB5A 5AOIA 1JNHA 2X2YA 4KO5A 1PKQB 2DYRB 1V8HA 1OAQL 3IPFA 3MBEC 1SM3L 2AJSH 3B5TA 3VU2A 5IB1A 3VD3A 3KXFA 1G7HA 1URLA 2F19H 4BWWA 1DLHB 4PS3A 1JNHB 5KSUA 1CL7H 3KWWB 3BAWA 3OLGA 3MNWA 2DY2A 4ZAKC 3UROR 5KOMC 4HCRH 4MNQE 2UWEE 4XRCB 4PW3A 3TZVC 3VGBA 2DL9A 1GJIA 4ZPTB 3EYUL 3O9WD 3R06A 2YD1A 3N91A 2EC9T 2WB1A 2VKXA 4QAMB 3U2SA 5AVRB 3MNWB 2IBZX 4KZEH 5DD1L 1LYQA 2AQTA 1FA4A 1N70A 2GI0A 3ZPDA 1SFHA 2DQFA 5EV7A 1KCUH 3WKMH 1KCSH 4XN2A 4KPHH 1OPGL 3M1BB 1INEH 1NEZG 4DK3A 4EI0A 3B6SA 1K3ZA 4OFYD 2XVGA 4K23H 4UV7L 2ESVA 1EHNA 2CJ3A 3ULSB 5JIKA 3SDCB 4B6ZA 4KPHL 3D0VA 1KWGA 4ANKA 5B1JA 3QRFM 1ZVYA 2GCYA 3EDJA 5AEAA 1ZY9A 2ATAA 4FE9A 4QRPA 4JN1L 1SXCA 3BDBA 4RLDA 2JJUA 4B9JA 5SV4A 2B59A 5DSCB 4NO5A 3IFOA 2E7BA 4ZAKD 4YDIH 2WSDA 4YOKA 1MFCL 1IT9L 3FTSA 5DA4A 3NP3A 4HIHB 1C16A 3FUIA 4PREA 2WP3T 1HWGB 1LE5A 4Z7NE 3BPNC 4KKNA 2ZKYA 4NO5B 3S35H 2AGJL 3HN3A 3PFQA 4NKDA 5IB5B 3MRPA 5ESAA 3ZRCC 3I6LE 4PREB 2WSPA 2CK2A 1LE5B 1FQ9C 1KLFA 5HYSB 1VFMA 4CGUB 2G60H 2R2HB 4U1LA 4UCFA 3DX7B 4G7QB 5TQ2L 3IKCB 3INUL 2Z7UA 5FHAL 5KBDA 3BVNA 1JPTH 4LASL 1PZAA 3DTDA 3O2VH 3QIUD 2QADD 5DEZA 3BE1L 4YC2B 5JOFA 4K73A 5FXCH 1GAFL 1XF3B 2YPLD 1T7ZA 1XO8A 1L9SA 3N06B 1IKFH 4JGJA 4YXKL 4QAWA 3JWNG 1IC4L 3L95B 4KKQA 1CT8B 5CZRA 2ESVD 2H32B 5DU7A 5F0MB 3T0BA 5J12B 2O1AA 3U82B 3GTTA 3QFGA 2C34A 2O6PA 3RUGF 3VNZA 5ACZA 2VDLH 5KBLA 1JNLH 4OKVA 5DQDH 3CHPA 2H32A 2NR6C 3D2TA 2JB5L 4PJ7F 2WXHA 3IMSA 3UTZB 1TZIA 2FUQA 4OKVB 1URZA 3NCFB 3CVHB 4LCWE 3RZCC 1MJUL 1U42A 3ALWA 4DVBA 2J3SA 3OM3B 1WEJH 1OV8A 1QWNA 1TZIB 4ICXA 1TETH 4PJEF 1XEDA 2FWOB 4WVRA 1A47A 1O9VA 3CVHA 1O0VA 2VW4A 4X6FB 4Y2NA 5DMIL 3OV6A 4LVNC 4L5FL 2IAND 4JN2A 3FQTB 5FYJU 3MLVH 4I3SL 2VDMB 1R6VA 4AK1A 1FO0B 2DQJH 3QQ9C 4HDIB 4S10A 3X11A 5E23A 4L8CB 2ZWZA 3JWOH 5EOQL 2IBBA 4MXVE 3VFOA 2CJUH 5IFJB 4HG4J 4CNIA 2XPZA 4I85A 3CTTA 1D6VL 1TVHA 2CU9A 3TYGL 1YCSA 1H5BB 1YMHB 3ETSA 5A2JH 5JXED 4N2DA 1LEIA 4JDEA 3IJ9A 3N41B 4HWUA 2PWGA 3BUPA 3ISWA 4A6YH 1NCIA 5IW6B 1FFOB 1IFRA 3LHAA 4HIXL 2FBOJ 3VFRB 4ZUSA 4TNWK 1ZT4B 2JELH 1AS7A 4JPWH 1MJ7H 4PI0A 5A3IC 1AD0B 2VLJE 2ITDA 3KMDA 3KDMB 5D6CB 4WIQA 3OXRA 3UCRA 1LE9B 1H6UA 4JKPL 4IBZA 4BZ2L 1AQMA 1D7BA 3IEAA 4QHUB 5KYYA 3H42L 4ZW6A 3BYYA 2NY5H 5B7FA 2AFNA 1BV8A 2NDGA 2WOYA 3QAQA 4YHLH 5AVYB 4DT2A 3C09C 1CMOA 1VGEL 1SJEB 1IGIH 3KW7A 3MMEB 4PCYA 4BE5A 2CCVA 3IDUA 4JO3H 1Q94B 4JREB 5JW3H 4BEIA 3SDAD 1WZ1H 2XTJE 1N5YL 2OS7A 3OGCB 4I5BB 2ITCA 3NA9L 3O6MH 4JFFD 1CGXA 2F7QA 4UYQA 3MMEA 5I8KL 2AEPH 3M45A 3Q1SH 4M1CD 4E9TA 5A6IA 2CBTA 5IV2B 2FCBA 4IBQA 4M4RA 3RB5A 1MOEA 3TBTB 3ZXAC 5JPMA 5I15L 2BSCA 1RZKC 3RYMA 5C9JB 3TN0C 4FJYA 1MW0A 3CFQA 3DVIA 3VDAA 5CN1A 3OAZK 4IHBA 5DC4B 2R2BA 1BJMA 5I30L 2GEQA 3VH8B 4K3HA 2DQTH 3A5VA 1B0RA 2H4EA 1XDTT 3ZE2B 4F27A 3LH2H 2VXVH 1WC7A 1NFDE 4LBAA 1T83A 3UZQB 4P59H 5C0GB 1B0RB 1E4XI 2P4AB 3IJEB 1KGXA 5E0QA 1FHNA 5I75B 4JFHE 5E08L 2YAQA 1VA9A 3ZE0F 2ZOLA 4ZSOE 1U3YA 1RZJL 2AP2A 2IANA 2K6WA 3E6HB 4AEEA 3DPBA 1KDJA 4DGIH 3TWCL 1EQWA 2VYRE 4HU2A 4OIIH 3ARBC 3AVEA 2HT4D 4ODVL 5EIIG 2ZOLB 1J8HD 1JUFB 4ZK8A 4GIOA 1MJUH 1AGCA 1XEUA 2VDML 1J9TA 1AC6A 4U1SB 1IO4C 2NCEA 4JRYB 3QUYC 3CXDH 1AO7B 2XZZA 1JUFA 4FG2A 3ZDYB 1KT2A 5E2TH 5I76B 1ZIAA 4M5ZH 3AXLB 2XG4A 5A43C 3VQLA 3D9AL 2CIIB 3L3JB 1Y18A 1INDH 4LVHC 3Q06A 5KVEE 1ITCA 5KVGE 3KGSA 1KBGL 4LQFL 1T0NA 1UCTA 1TKWB 3LB6C 4UMSA 5EU5A 2VLKB 4GLRI 4O00A 3KWUA 5C09B 1BVOA 3CCHB 3VACA 2CIIA 2V17H 3V4UH 4F7TA 1E4WH 2EYRA 4ONOA 5CD5C 1S7TB 4A63A 4R97B 5E9AA 4CC1A 5T3ZD 3DXAE 1DBKH 5EU5B 2VLKA 2HLFD 4BELD 4EN3D 4YEFA 2WQ8A 4JRXB 4QY8B 2EEAA 4KJYB 4MNHA 2EYRB 3AFLA 2PN5A 1FV1B 1T5WB 2IIJA 3NT0A 5JOPE 5JUEH 4AY0A 3L3IA 4Z7UE 4QY8A 1QSFA 1WUNT 2A9NH 4IOSA 3D30A 2C4FT 2G75A 4ICWA 3OZLA 1E4KC 2R0ZH 2NLJB 4YLBA 2BIIA 3IK2A 4BQ9A 2EEBA 2F68X 3DJRA 4MJIE 4LAQH 3M07A 3P02A 5CINH 1HQRB 1JYWA 3OJVC 4PJAF 1UT2A 5HYJB 2QPFA 1OSYA 4FFTA 4J1UA 1DJZA 4FNSA 5C0CE 4AXWB 1WGOA 3VW3L 2J1XA 4KK6D 5IQLA 4P23B 2WBJB 4CKVX 4F33A 2LOEA 3NJGA 1CFQA 4J1UB 2WLLB 3V7AG 5JW4M 3DYPA 3S3BB 4WY7L 4ZUVB 5I6XB 5DHVA 3B2DC 3CHOA 1M3JA 1QLFB 4JFTA 1CFMA 3ZLQC 4JL1A 2J12B 4GPVA 2EKSB 3GPSA 4EDXA 4NQQA 4OQTL 2D8KA 3CFCH 2Y3NA 3CFEA 1FDLH 4PJDB 4NHUB 4RSYA 1V7MH 4ZUTB 5GJTL 4BBWA 3QQDB 3NIFB 2MNWA 5SX5K 3QXTA 1S7RB 4MRBA 1DN2A 4YFLF 4UIKH 1AIFB 1KCKA 2SEBA 1QI3A 3APFA 3FB8A 3GS7A 4HZLB 4TSCH 3E6FB 3OAYK 4NHUA 4RGND 4ZUTA 3U25A 3BWUF 4FFZH 5C07B 4KGJA 1A9VA 1ONQA 3UMTA 4HU8A 3FO2B 1G6RL 1L7TL 2GBVA 3DO7B 3DLQR 4W6XB 4DJMA 4PRPD 5AZEL 1AIFA 1I9RH 2FX9H 5T3ZH 4CUCA 1KLGA 3MV9B 4KKCC 1ZT1A 3MYZA 4MA8H 5C07A 4IBWA 5CD3A 3GSQA 4NOFA 4MJ6A 5FK9A 4M8UA 3ZQWA 4CU6A 1J05B 3W2DH 3CSTA 3MRNA 5FCUL 2W9LA 4RWYH 4IEFB 2BH0A 2YSSB 4OGAD 3S8FB 4NP9A 3NJKA 4MJ6B 4Y2DD 2BNRA 4LT7A 43C9A 5J9PB 1NICA 4XI5C 4OUOA 3QXVA 4X4XB 4JVPA 4RBPK 2D9QB 1IBDA 2N7BA 3FCTB 2UZYA 1Q9OA 5FR3A 1EZLA 3QJFB 2BNRB 43C9B 3L9RA 4M7KL 5KVMC 1E50A 1P84J 2DQ6A 2W0LA 1EAOA 3VFGH 2K4WA 5I1CH 1WP6A 1Y0LB 3JUZA 3DGCR 2IDQA 1K4DB 1QI4A 4OZHF 2VLLB 2IQ9L 3KL3A 5SX4I 3SBWA 5CZVL 5HI4C 1XCXA 3L3KA 2ARJQ 1NCJA 1PYWB 3UL4A 3VVVA 3U9UB 2BVOB 2KC0A 4PD4J 1QSEE 2X4TA 4O51B 3H54A 1LO4L 1DE4B 1U3HB 5EU6A 4GXFA 3HG1E 3CFKB 3L3KB 1OL0A 5E99L 3GEFA 5C0BA 1U8JA 2QPDB 3DX6B 1CBJA 5E5RB 3S3DB 3S4SG 5B4MD 5IBLC 3F85A 5DHYA 5EU6B 1VADB 2VDOH 4WHYG 5D6DC 3IRPX 3RKDC 4PB0L 3MV01 4APQC 3UBHA 1L9PA 2R4RL 3KYMA 4KITB 4HCIA 4ZFFA 3T2NH 2Y7QB 4HIIB 4DAGH 5ICZA 3UTQB 1T7VA 1LQSR 5I5IA 1RUAL 4YDNA 4B5ZA 3VI4F 3F7PC 3OB0H 1NGPH 4KQ3L 1J5HA 1GY2A 2EICA 2UVFA 1HL4A 4F2EA 5I73B 4N2HA 4GOSA 2C3VA 1IAOA 1VSCA 5DFVD 1WWCA 4QGTA 4S0TD 3GINA 1JGUL 3UTQA 5ANMA 1AYOA 3LXCA 3WKPA 2A38A 3QI9D 1EH9A 1NGPL 4NT6A 2WKGA 4OZFA 3MPCA 2MRYA 4G6AD 5DJXB 4AIZB 1IAOB 5F6IB 2CRMA 4J2XA 4KC3B 2YD0A 3N0PB 1MCWM 4JRYD 1SMAA 1IEHA 3E38A 3LS4H 2YMOA 4PJGE 3QCVH 2CWRA 3G6JB 4OZFB 1LJMA 4JB9H 2CLRA 4FQLL 1ZA6A 4YE4H 4JO4L 3S5YA 1R9FA 4XO5A 3MLPA 3HI6L 2Y3AA 3FBKA 1SBSH 3NP4A 2OA9A 3I9IA 4DGVL 4PGJA 4NN7B 4HWEH 4BCXA 7PCYA 3QDGD 2QVTA 2EO7A 1WFIA 2CLRB 3QFJE 1VHPA 3QCTL 2ZSVA 3TGXA 1UWEH 4B97A 3RKDD 1VFBB 4NC0B 1G4RA 1KIPA 1C1EL 4BZYA 3COOA 4J3TA 4P46A 3W9DB 3UC0L 3WFHB 4KZDH 1I1RA 3K46A 3GMOA 3U6XA 5D1ZD 3TCLA 2DWEA 3MAWA 4HD5A 1TOXA 5M7QA 4QRFA 4PWKA 1UG9A 5DO8A 3IMBA 4OLWL 3KDPB 2XXFA 2BNQA 2VXUL 1MWAA 4JMNA 4XX1E 1YN7A 3ARQA 3ZN6A 4IRJD 3NJHA 4L3EB 1KB5B 4ZQKB 3VG0L 2PWHA 3MRIA 1BYPA 3F5WA 2OI9B 3EJYC 5IFAL 4YH6A 3LKRA 5E03A 1QLRA 4ZNCD 3HIZA 3RWFB 2X88A 4DUXA 2DH2A 2X42A 2OCFD 3SE6A 3U83A 3RWJB 3NVQA 3NJXA 4PWIA 2KQMA 2NUTB 3HLAB 4PJ5E 1ADQL 4P4KD 2BC4B 4CA4A 3EUDA 2G9HB 1RHFA 3RWFA 3EZJB 2VQTA 1ZA3B 4F8NA 1KCBA 3TIDA 3T0ED 1XZ0A 1OAXL 1A1NA 2F61A 2W60A 4MGXA 1KJMA 4H8WC 3AQYA 4HEMA 1TNNA 4PJ9A 5AKSA 3TBBA 1GYCA 4UF7C 4S1RH 4UANA 1BZ7A 1ZA3A 4GG6F 4ADJA 3TIDB 4E9LA 1BM3L 3SDDB 1AD9A 4O4YL 1HDMB 2JLLA 1R34A 2QLVB 4UTBL 1BVKB 1CLZH 3RTQA 4P4RB 4NZTH 5JHLL 4Z5RA 3QWOA 4ZS6D 5D7IA 5DJ0B 1AD9B 5GIRB 5HDQH 4X8JB 4Y2OB 4ATWA 1KYUA 1QFWH 3HAEB 4UNIA 4Z77B 1FH5H 4G6FD 4JFDA 3ZIMA 2CKBA 4F57H 1TEGA 1H8SA 5I75C 5DFVC 3W5NA 4M1DL 3FT3A 1M1SA 3UC2A 4OV5A 1NAML 3HAEA 4JFPB 1NCAL 3FOMA 3PWPD 5CS7A 3GKWL 3F01A 2FYVA 5FFGA 1W0WB 2A1WH 1AY1H 2PR4H 1RUPH 3CX5K 4KQ0A 4W93A 5HI5D 1PEWA 1Y1DA 4ONHB 1P6AB 5BJTA 3GS0A 3FOMB 3OWEA 4OLZL 3T0EC 4KKAC 1SJHB 4YHML 3KPQA 4EKJA 2YJLA 4MB3A 1P4IH 4MYPA 3MNDA 3HNSH 1N64L 5HGDA 4ONHA 1OGAB 3F12A 4KX9A 2VDNL 4MAYD 4WUUD 1V7NL 1U8IA 5HHNA 5TDPB 2O4EA 2BIQA 5I1JL 5C6PB 3DJTA 2WZ5A 4JHBA 4JFEE 2UY6A 4UT9A 3V0VA 4BQBA 3KPSB 2JKXA 3WHE0 1U8IB 3TA4D 5HYSG 4R5VA 2BINA 4FMVA 5BOJA 1MCLA 4UU9B 3O41A 2BNUB 4S1DD 2NQ3A 3ZDZE 4AJWA 2UY6B 3D39E 3QI9C 3V0VB 3BJ91 4DN3L 3VTAA 3QHZL 4Y1AD 1IC5H 3IFNL 2VMJA 4XPGH 5EOTB 3IWUA 3D33A 1MRDH 1WHOA 4RDQF 3O41B 3UBGA 2FYYA 3HE7B 3P0GB 3ZTCC 2A4EA 4M6AA 5T3XH 3V6ZB 2OBGA 1UADC 3MN8A 5DYOB 1D2PA 4M7JH 3VXTA 3SBRA 5EOTA 1E6JH 4MCMA 3K4DA 2AF2A 3GSOB 5JQ6L 2HVJA 4XC1L 1WICA 1RK1A 3D05A 5T1LA 5I6MA 5SX4H 4Y1AB 3G04B 5ADPL 1ZVSB 2Z93B 1MFBH 1TQSA 1PD0A 2VDMH 4FP8H 1YEJH 4HVBA 1YPZE 4Z7VB 5DC2A 4JPVH 5F1NA 2Y1AA 2FAUA 3LD8B 2W9DH 3QZWG 4MB5A 3ARZA 4UM9A 4DQOH 1U8HA 4OIIL 5EZOL 3CMOH 3K6NA 4POYA 5B7EA 5C0FA 4HK3N 4GO8A 4HULB 3PPEA 1U8HB 5F8QC 1E3XA 1LO2H 1OCRB 1EO8H 1R17A 4EVNA 3T65A 1HQ4A 4POUB 2GI7A 1EFQA 2EH8L 4XXWA 1XH0A 4ATTA 2YGVA 4RZCA 4AWJC 2Q2EB 5FUOL 5BMFH 2PWEA 3STBA 3PGFH 4FN0A 3CVDA 3BW9B 3Q43A 4OGZA 3BIKB 2GJZA 3BFQG 4L3CB 2VIRB 1BSIA 4OY9A 1U58B 4PJIE 2AS5M 1NEZB 4B53A 4TRPL 4I2XA 4LF3A 5J3HC 3IDJA 3RY5A 4FADA 3KXFB 1G7HB 2UZIH 2XBTA 4GAFB 3RZCB 5CJ8A 2X70A 1RHHB 2Q6WA 4KWUA 4FXGA 6CGTA 4L3CA 4FI7A 5FO7A 4XNDA 4AQAA 4ZX4A 2G4GA 4S1SH 4BIKA 1FG2A 3HE7D 1WBZB 1ZVNA 1RZKH 3ZT7A 4JKMA 3FONA 5IROC 4AL8L 4AV4A 1KTKE 4EJ1C 5CGYD 5IQ9A 1QLEL 3TN0D 1MXGA 4FLOA 4UT6H 2D0HA 2HFEB 4MQXD 4C56B 2ID5A 3OKOB 4Z3TA 5KYNA 1WBZA 4AJ0A 2CBPA 3T1FA 3L4VA 3L3HA 4U49A 3KJ6L 3ATAA 3H0TB 1LK3H 3VWJD 3PP4H 4NM8L 1YY9D 3W0WE 3ARUA 1AFVH 4IGBA 2N7AA 2ZAHA 1SZNA 5F7NC 2H32H 3VD2A 4YR6A 3GZQA 4CDHA 3CZUB 1RIHL 4MD4B 2DQHH 1J87A 1UURA 2VDQH 2LLNA 5IW1A 1DZ0A 1ZRUA 3Q2CA 1NIAA 1ZWIA 3SDCA 4IGBB 5IHBA 4JO1L 2VGLM 3QZWB 2C1OB 4A2LA 5ID1A 1EHXA 4YR6B 4QNPF 1M7UA 3N42B 4NFBA 3G5YA 1NIBA 2FWUA 5D71L 4ZJ9A 3O45B 4XPAH 4G6JL 5CZXC 4P99A 5DSCA 3LZQA 1SOQA 3BKJH 1EAQA 1SNRA 2X6BA 3C2AH 4V2BA 5KUKA 3QEHA 1JZ2A 1TTUA 2YN5A 1GPOL 4XE0A 1DJWA 3B2UD 2NRDA 5FYLL 2VDRL 2CQVA 2CHZA 4AG4L 2R1XB 3A3YB 3DETD 4PRNA 3TO4B 2AQRA 3PL6C 1CURA 3C12A 4Y16C 1ZLSH 1WD9A 3MRPB 4YHIB 3T6VA 2PF6A 2H8PA 1I9IH 2X4SB 4YDZA 4LKXB 4EN3C 4TTDC 4Z3FA 1KLFB 4PRNB 5HYSA 1ITBB 3BKCL 1G5AA 3D08A 2DJMA 1EUUA 2NY0C 4J8RB 1AS6A 2WAHA 4Q4EA 1XBRA 1AZVA 3L5JA 3L6FA 4GP8B 5DZPA 4F20A 1D9KA 4JFYB 4KMQA 1AQKL 1FF5A 4UINL 1KB9J 4YX2L 2AQPA 4XXCA 1BF5A 3WLBA 5HP5A 4GXVL 2DTML 2FRGP 2IWFA 1C5BH 1OF2A 4JY6A 4UYPA 2OFQA 2Z7WA 1JXDA 4JFYA 1IGJB 1U92A 3HI5L 3FTWA 4LSQH 4Z7WF 5ACZB 3FSWA 4H1LA 4APXB 4OD1L 2OTWB 1OF2B 1G1OA 5T3XL 4U6XA 3TC9A 1OZUA 4KDVA 3PL6B 3RPIA 2Z35A 1PY9A 3B2UC 1MVUB 5IQ7H 3FRUA 4HMCA 3IB4A 4H1LB 3U46B 1A2YA 3GYRA 3B7YA 3TCTA 1E4XL 3WFDH 2APBA 3PL6A 35C8H 1HC1A 2XXGA 1MVUA 4NO2B 3FRUB 5I6LA 4UTCA 4LCWA 1A66A 5HHME 2H45A 4MJ4A 1FL5A 2V9RA 4OUUB 1IGYB 2C7UA 3BLBA 4PJXE 4M4PA 1MLCB 5ILTL 2GK2A 1X7SA 5KBPA 4TNVK 1F3DJ 3N5AA 1J0KA 2NYYD 1MLCA 1ZLUH 4LVOB 2W9EL 1IC1A 1MSPA 1ZHKB 3CVIH 1PD6A 2Y7SA 1DEDA 3X11B 4FL4B 1OKEA 2X89A 2MPVA 3QC5X 2F18A 5ERWB 1QQDB 5KEZA 1HSBA 4FEIA 4QKXB 2D0FA 1ZJBA 2YEZA 3FQRB 3L5XL 3DRTA 2ZZUT 1N0XH 4LOVA 3VFUA 3L08A 5B39G 3UBXG 5FYJE 3ILPA 3QP3A 1VEOA 2YEZB 1GGYA 4KH2A 4GSXA 5E5MB 2DD8L 3DYOA 4IRJC 1YMME 4ZUSB 1ZGLM 5DXWA 4M93B 1HI6A 1CR9L 2P47B 5F7AA 4B9FA 4PP2B 3ILPB 2ITDB 4P04A 4TNEA 2YBRB 3KDMA 3TJPA 4WCYL 1AXTL 4LSUL 5IROA 4GINA 4BUHA 4H88L 2V5TA 2WQRA 1YPZA 1EXGA 5KYYB 5IJVB 2VDKB 2TSAA 1ILSA 4Y4HD 1M7XA 5FOBA 5E9NA 4Y2DA 3U4BH 4KTDH 4HQQH 2CK0H 1I3VA 1SJEA 1QYGL 3AWFA 5CZKA 4FKKA 5J1SC 2HMIC 1ZGLP 1QZ1A 3UXFA 2BO0A 3K0YA 3QIWD 3W5MA 4IDLA 5J12C 2IWEA 5EF0A 2XN0A 2F1EA 4QI3A 5EU4B 5IT2H 5DRWA 1JHTB 1SMDA 4MKTA 4QYAA 4K3EL 4FMKA 4OB5H 4OF3A 5E2UH 4P3CH 5I24A 3KGUA 4K71B 4RAVB 1X4XA 4QRTB 1A14H 4TNFA 5DRWB 4E9WA 2J88L 1GS7A 2BIMA 4ZD3H 4K5OA 2R0KL 2HJKA 2LU5A 2X4QA 5DRXB 3E8UH 2NPLX 4ZI8A 1F4YL 2XNAA 1BD2E 5BV7B 1D5ZA 4OD1H 3CDCA 4LMQI 3SYAA 2ZYSA 3F83A 4WU7A 3LPGA 4FQXC 4R90H 1WT5A 5DEFA 3TFBA 3WD5H 1LO5B 1QVOB 3ZUNC 6PCYA 3PV7A 4PM1A 1OT2A 1JV2B 3WKQA 4LLAA 4GBXC 3B56A 4H8WH 4PG9B 2YXWA 1QVOA 4JX0A 5GSRA 3ERXA 4F2MB 3U2IA 3TASA 5MP6L 4G7YH 4YSCA 3MFGB 1DO5A 4DETA 5MENE 1UD5A 5K9OB 2X1XR 4P2OD 2VN3A 3VX0A 2Q3AA 2UUDH 3DRQB 1JGIA 3C60D 3BIBX 1KFAH 3WN5C 5MERB 3ZHFA 1ZV2A 1MIMH 4Z7VF 1QRNE 2R2EB 4NAMA 3MV9D 1F8TL 5L6YL 4E0RA 3ZZQA 1AO7A 3DRQA 4XE5B 1DUZB 1CK0H 2JI3A 3O2DL 3P9MB 3K72A 4QOKA 4AYID 1R3KB 5KSAB 5I76A 5L2JB 1T89C 5MERA 1RZ7H 4LL4A 2HFFB 3RU8L 3TA3D 2F53A 3L3JA 1EJ6A 3CSPA 4YXLH 2XLLA 3FKUS 1DUZA 2HT2D 1A6AB 3P9MA 4KHXH 3K72B 4BRVA 5KSAA 4RFEA 1BEXA 3REWA 2WXFA 5K9JH 1QFUL 5FCSH 1DQJA 3QDGA 4LSRH 4MZ2A 1KSRA 3QNXB 4LMQE 1S7TA 2Q20A 1M1XA 5IVXE 4KQ3H 1P9MC 4HBQA 3QDJD 4JO1H 5TQ0L 3T3PE 1DQJB 2CGRH 3BZ4A 3QORC 4YSOA 1IBGH 4UQBA 4H2AA 2WBJD 5MEQB 1I9JL 1R75A 3UBXI 1M1XB 3MACL 1NC2D 4EPSA 1SN5A 1A6UH 4WEBH 4PQXA 4HZ1A 5D72H 2Z0BA 5JHDB 2ENPA 1EGJH 1MAMH 2YAHA 2G75B 5KVDE 5D6DA 2ERJB 4ODTL 1MWAH 4HKBB 3QJRB 3ZW3A 2NOYA 4F8LA 1EANA 1MY7A 4KV5E 5JHDA 1JNNL 3TV3H 4KRNA 3G9VA 2X2UA 4ODWA 2QVIA 4NUJB 1G9NH 1DANT 3I6GA 5J4MA 4JFEA 1OTSD 2FX8H 3BZ5A 2B4CL 4HKBA 3GMMA 2XXMB 5FUZL 2W07A 3FCSA 2UV3A 3CHXA 1HYSD 3QAZB 3WJJA 2GB2A 3BMVA 1PY0A 3I6GB 4QMEA 4ZMAT 5I1CL 2V8LA 1I1AC 1OTTD 2PPFA 2Y2TA 2CRZA 2WLLA 3EFDL 4JFXB 4QOKE 4RFOL 1W6WA 1K8IA 4DEPB 2EUWA 4XVJL 3WIHL 3DMMA 1I8KB 3Q7JA 1QLFA 4L1LA 2VL5B 3DOSB 3FHEA 3MO1B 1DJYA 1NCCL 1JD9A 2DQGH 1MVFA 2EXYD 4JFXA 3LN4B 2YMXL 3UZEA 1M7IB 4N26A 3GUTA 2VR6A 2VL5A 1ACCA 3CFEB 3DOSA 3MO1A 3I9GL 1AJ7H 4EIUA 4CMMB 4NENA 5BZWA 1II4E 1S7RA 1EO8L 4QRRB 5D70L 1IM3A 3ARVA 2EDLA 4KDWA 3S36X 2VB5A 4CMMA 5BZWB 2AK4D 2FQEA 1CD1A 5HTSA 1MHEA 2CO2A 2R9HC 4MQXC 5CWSB 4G82A 1DVFD 1SUJA 4AIXA 1LNUA 2ORBH 3HPJA 5I66A 4JPVL 1TQBB 3GSQB 4KI5F 5FK9B 4WO4A 3MCKA 3O3EB 5I8OL 3MRNB 4P5TB 5IMLB 2XA8L 1AGEB 1KCRH 5I1KH 2OJ1A 2FGWH 4OCWH 3O3EA 2HMID 4D0DB 1IIKA 2FBJL 1KB9K 5D1XE 1IRAY 3KCPA 4NWUL 2K6YA 1ADQA 4LSPH 2ZCZA 1KYFA 1H15B 1O6SB 3ILEA 5L88H 4WI5A 5DRZB 2F15A 3GSWA 1KJ2L 2WUBL 1X5LA 3BAKA 4KO6A 4PLJD 4PR5B 4Z3GA 1CDUA 2HTLC 4LHUG 1GGIL 1VKXA 5BRZA 1XGTA 3SKOB 1XF1A 5DRZA 4PGCB 1T66D 1PYWA 3B1TA 5DCCA 2AW2A 4L4TA 1QHOA 5JQIB 4AIOA 4N4YB 4BXSV 3RIKA 1TZHA 1DE4A 1MRCL 4O9HL 5JDSB 3SY0B 2OMWA 5GRXG 3GO1L 5DGRA 1BBDH 2APFA 2OSWA 2R0ZL 3DX6A 3GHEH 3T5WA 2WXJA 2AABL 2RCSH 5L0QB 1HXYB 3OKLB 1T03H 3KWWA 3O6FD 4YDVB 5KW9H 4AV0A 1BVLB 4RCAA 2NR6D 3H8NA 2WLKA 4LFHD 5JDSA 3BFOA 1D7FA 2WQWA 3GMRA 1OOAA 1MCSA 4ZPTA 5BOPA 3R06B 3OKLA 5GZOD 2O5XH 3LXBA 4XMLH 2I60L 2ILLA 4U0RB 4YDVA 5MEOB 2V3EA 1YSOA 3VXMD 1G7IA 3VGHA 3TEWA 4K9EC 4YHKL 1O5DT 4OJCA 3IMWA 1WFJA 4ZT1A 2LV4A 2V5SA 2AQNA 2X2JA 2DQFB 5GGQL 1QHPA 4F93B 5C08E 5MEOA 1M05A 5EA0L 1TLMA 5J6HA 3TT1H 1EO7A 1G7IB 1U36A 3KEHA 4FLQA 4LPWA 3S88L 1GVIA 4Q6YA 4KXBA 3MBXL 1XXDC 5GGSB 2ESVB 3ULSA 5I1DA 1KCRL 2NQCA 3TWYA 5AB9A 3UAJD 3TF7C 1AP2B 1QUNB 1QASA 2NY4C 3WV0A 1UXWA 3V4VA 4NQEE 5JA9A 2CKBH 3UTTA 1CFSA 1U91B 4FFWD 1KJ3H 3FTVA 5DHVH 3JQOB 4FFYA 3BISA 1OE3A 2ZSVB 2IBZY 5LB1A 3KWXA 3V4VB 1CYGA 3CLFL 4HJUA 5DJ2B 4BH7A 3UTTB 2AERT 2WBJC 1SVZA 4KY1L 4TLKA 3EDKA 2ZCKL 5E08H 2F7PA 4DEUA 4AMXA 4FA7B 1NGWB 2W0KA 1W80A 2YD8A 2IWGA 4OM0H 3BI9X 1G4MA 4M93C 2WQSA 5DD0H 5I8EA 3NH7L 2BERA 4HFUH 4UQIM 4XPHH 5ESAB 3HG1A 2VMFA 1ZANH 1A64A 5IFAH 3IMRA 5LDSA 2VXVL 3A6CH 1YN7B 5GRUH 5E1IA 3SGDH 2ZP8A 2VXTH 1E5BA 5K9QG 2ODHA 3OKEA 4ZQKA 4KUCF 2K8QA 1J5DA 1L9RA 1DVUA 1IEBA 1I85A 2XQBH 1KIRA 3PWVB 3VYNA 3WEMA 4YFDB 1NMAH 5D4HA 4AK2A 2R8SH 3WO4C 1FAKT 3L7FB 5GJSL 4LU5L 1JPSH 3RWJA 3HLAA 1GKEA 2AEPL 5E1GA 3L95A 1HCFX 3SDCD 5IUSA 3LCYA 3NEXA 4BINA 2ICWA 5JPMC 5DJ6A 5KVEL 5IOPB 1OGAD 4Y9FA 3V52H 5FA3B 5IMKB 1XZ0B 3TH3T 3DV4A 3QRGL 4EF3A 4AEIH 3MV8E 2DAVA 2ZX6A 4N68A 1WFMA 2P8MB 2Z3FA 4H0LC 4MAYC 5FA3A 2COQA 1EDHA 1YG9A 3OZ9H 2A6KB 2C1PB 1MW3A 1BQLL 3MLSL 5EEWA 1NCBH 4Z0BL 4LGSB 2B3RA 4I0PA 1AZNA 1BVKA 1AOHA 2VRKA 3QUZC 3KHQA 1JN6B 2CA3A 4Z5RB 4G9FD 1KY7A 2FT8A 2BWQA 1QKZH 1AE6H 2J55A 3HC3L 1E6OH 5CU9A 5F6IC 2ISDA 4Z77A 1IQDB 2YARA 5BRZD 3FO0L 2UX7A 3FQTA 2CKBB 4XCCH 2EVIA 2OL3B 1E4HA 3KLHD 4OV5B 4XOBA 3QWQB 5SWSD 4E41D 3FUJA 1LDPH 3KS0J 2VZVA 3OG6B 1I31A 2P8LB 1A6TB 3TA3A 4JDZA 4M1GL 1UXMA 4KO9A 3FF8A 4G7VH 5GZND 2NY2C 3S34H 4RMBA 5IHUL 4L0YA 2WCPA 1TVHB 3KPQB 1U3NA 4NQCD 5E8OA 5IR1A 2F2HA 2W95A 4YUEL 5FKPA 2WXKA 4GKOA 1CU4L 5KSAC 3EGXB 3F12B 2BW4A 2R0LL 5AOMA 2N59A 4CL7A 4RA3A 2YXVA 5DZ9A 5D5MA 1E27B 3EYQC 5GGUB 5E2VL 2BPBA 3VFRA 2K9FB 2DOCA 4HV8A 3ISYA 4K8RH 4KZ0A 4GUPB 5ESVB 3A4DA 3NSXA 4HX1A 2OV0A 1LE9A 4LSTL 5L2KB 3ETBJ 5CILL 3RWHB 4QHUA 2V37A 3HJ0A 4R2GD 3H3KA 4MMXC 4CSZA 3T0DA 4DN4L 3MBED 3NABH 1BJ1J 3VGDA 2V5YA 3VE0A 5MI0B 3UACA 2Y7LA 2FYYB 3Q05A 1XCWA 4UNUA 1DSYA 3SD5A 5T33L 4DKFL 2DL2A 4IDJL 1IM9D 3VE0B 5A1AA 1P1ZA 1YJDH 3FQ1A 2EYSA 3MJ6A 3HS8A 3U1SL 5T1LB 5IV2A 3O4LB 5B3SB 4QHNA 1XVSA 2ZCHH 5AZ2L 4LOFA 3TBTA 2ZOUA 3RBGA 3P3TA 2WLHA 4L9LA 3BE1H 3OMIB 3P2DA 4OZGF 1P1ZB 1B2WH 1LLAA 1RZFL 4EUPG 3FFCB 4FFVD 3CGTA 1NOAA 3MNZB 2EIKB 3PDDA 3O6LL 3VH8A 3ZTJG 4L9LB 1FYTE 4JAMB 4NJ9L 1DSFL 2XZAH 3MRCB 1SOSA 4HS3A 2GKIA 2DM2A 1EZVX 1WC7B 3P0VL 3R18A 3NCYP 3MNZA 1E9QA 4MMXB 4P46D 4X80L 1QA9A 2PTVA 5FYLD 4JQVC 5G4MA 4Z1PA 5BO1H 2EIEA 2FT6A 5IROD 4EZKA 3V10A 5D2LA 3T77B 3K8KA 1H6TA 3BIKA 1DBAL 4DP1X 3DPBB 1EXUA 2XI9A 3QULA 3V55A 2P5WD 3HW7A 1NEZA 1Y07A 4I2XB 1C12A 2CD0A 3ALPA 3LIZL 3DUHA 4LPTA 3FN9A 2ZUTA 4WO4D 3T0EB 4PJXF 5DMGD 4OIAA 5F9OH 1EXUB 5FO7B 1I8AA 4OBRA 3ARGB 3BSGA 3S37H 2Y5EA 4N0UB 4K5MA 3EG9A 4KXAA 1JRHL 3J8F7 3ZMNA 1C12B 3GTVA 2V6HA 1A7RH 3PG2A 3L5XH 1M7DA 7FABH 3K6SA 4AW7A 1KT2B 1QNIA 3BSZH 5D1QE 4QRQA 1OIOA 3JYCA 4J12A 4K94L 1INEL 2PXYC 1SVCP 5EC1B 4LE8A 4PVBA 3IXAB 3HS9A 3RVVD 2HFEA 4P5TC 2J1WA 4PRHD 2J73A 1KB3A 4C56A 2EVFA 2VH5L 1WISA 2WYTA 5C09A 3H0TA 5SWZD 1ZXKA 5E6YA 4PJ9D 1NKRA 2HH0H 1URIA 1OGSA 2XZAL 4AZ8B 4MD4A 4N22A 4NEHB 1KOAA 1IL1A 4MXQC 1HNFA 5ILTH 3LHPL 1UJ3A 3QPXH 4U3XA 2NY7H 5CEXB 1FV1A 1T5WA 4QWWD 1QR4A 2C1OA 3KAAA 1W8OA 1NUNB 2XG5A 3CHSA 4UQAA 5HD8D 4HAKA 1IL1B 4E5XG 4KVCL 3BPCB 4B96A 3WFDL 1MFVA 4QT5A 4YLQT 1TJGH 2Q3ZA 2GITA 2EXSA 2RTTA 1WFUA 1NCOA 1BM7A 3DTXB 4QCIA 4YIQA 4QTIH 2YMTA 5E6ZA 1KXTB 2VCOA 4Z7WA 2ZPKH 4ENZA 4J3VA 3TBWA 2PUQT 2HFTA 2NDFA 4HJTA 3TO4A 3FS9A 12E8L 4YIQB 1XSOA 3ASOB 1CVSC 1RPUA 4EIBA 1CDBA 1A3LH 4P23A 2R23B 5H37G 4LCUB 4MX7A 2H8PB 4A7VA 3N85H 1XZWA 4TQHA 2YEQA 4ZPVB 1E8ZA 1OD9A 5AW4B 1G6VK 1IAMA 4Q7DA 4LEBA 4LCUA 3L5IA 1S7WA 2H3NB 4U7SA 1UTDA 1NLBL 2Z65C 3ILQD 4EI6B 1HHJA 3L6FB 1TPXC 5LNEA 2E8YA 2EE2A 5IKCA 1LTXA 3MOAH 5BQ7A 5JPNC 4PRDA 3WENA 2WZ0A 4XP4L 3B1UA 1RVFH 3CPLB 3BPOB 1WT5C 4ZOEA 3WLBB 4EI6A 4K5LA 2HLFC 1P1VA 4PJBA 5IKCB 2Y5QA 5KVDL 1OM9A 5CEYB 3LQAH 3GIVA 4L1TA 3T4AC 3CPLA 1ZEAH 1KLUB 3L8QA 3W0WA 4APXA 2OTWA 1IBYA 3NZ8B 1XB6A 3FO2A 3MFFA 3V95A 3V5DA 3ULUD 1S5IL 2OMZB 3SGDI 3TCXA 1KLGB 2CMRL 5IESH 1OARL 3EOYG 1QBLL 4ZNEA 1BZ8A 1FFNB 3VTTA 5CD3B 1A02N 1RAMA 3Q6FA 4V11A 1A4BA 3VM7A 1J5OH 4X9GA 3V5DB 2DQDH 3MV8B 4KXZH 2JQZA 3AY4A 4NZUH 3U6RA 4NIKB 1HTYA 4JL2A 2F58H 3LNDA 1CF8L 3X14A 1TJIH 3EHBB 4JQXC 1AR2A 4E9QA 2ALAA 2H6PB 2FX7H 2YKLH 2ZUUA 4MYWB 5F72S 3DOHA 2YZ8A 4XMWA 4FNPA 3MLRH 3MV8A 5F0PB 2CHWA 4GSQA 5E0FA 2UZYB 2WKLA 3V9CA 4L1DA 4X42A 3UERA 2R83A 1PZ3A 4OLVH 2FQFA 5AKTA 4YXHH 1Y0LA 5E8DH 5DEJA 1H3PL 4HK3J 4BFGA 4CU7A 4H7VA 4AITA 1K4DA 4FJZA 2AQ1A 2VLLA 3QUXC 3ZHNA 4AC4A 4K15A 4YDLC 1USQA 1DVZA 4G59C 2WV3A 1ZXQA 2H2PD 5DK0B 2BVOA 1PNCA 4FHKA 5HVFB 5HGGS 4CADB 4GW5B 5GJSH 3GM0A 4U0QB 1U3HA 3F64A 1YNLL 1MUJB 5E5MA 4EIGB 2BDNH 3BD3A 1RLWA 5LAXB 4HF5L 1E90A 3KLQA 3AG4B 2R29L 4O2FA 2XRAH 2XQ0A 4GW5A 3S2AA 4CADA 2AJUL 4FFYL 1MIEL 3L4WA 4HS8L 2VDPL 1I8MA 1MEXL 1MUJA 1ROWA 4EI5C 4ES8A 4ZYKB 1F4XH 3BZFB 2C8NA 2EIZA 4QXTB 3I74A 5GGVY 2MPAL 2CSPA 3I50H 3DVFA 3KYMB 3S48A 1F6LL 2YQ2A 1E67A 4JGUA 1MW1A 4KTGA 2FWLB 3ZKNC 5CIPB 4OJAA 1J1OH 1MHCB 3HZYB 1BZOA 2KI6A 3BZFA 1FC2D 4GI9A 4NQEB 3PAVA 4PP1C 1SDDB 5KANI 1TFPA 2BOLA 3NSCA 4OCSL 3MLVL 1W72H 4Y88A 5F7WC 4NQEA 4NLHA 1YRKA 2K0RA 5DJXA 2KMWA 1U93B 3BLPX 4IRZH 5BS0B 1NPUA 1LO0L 5EU4A 3WDJA 2ZNXA 3AJ7A 4ZMOA 1T2JA 4NN5C 3O8XD 1MG2C 1UACL 1R0AL 2DWTA 1U93A 5BS0A 5FYKU 5CP3A 1MCEA 5T1DL 5I0XA 1EZUA 1ZVHA 3SGEH 1N67A 4FNQA 5DRXA 4CSTA 4R6UA 2RA1A 1JTPA 3MOAL 3OKMA 4XWOC 5FUCC 1D5ZB 2VW6A 1V3KA 1B88A 2CLVA 4NKIH 3QEQD 2Y5TB 1Z1WA 4H8PA 2ZSWA 4TUOA 4MBOA 1JV2A 3W9DA 1UM6L 3OKMB 3UDWA 3IGLA 4O02L 2P24A 3QEGH 1JHLL 4NO0D 4HETA 4WENB 4XCYA 3WIFB 2ZUYA 1KZQA 4X6CF 1O6TA 1FBIL 4C56D 4FL4C 2BFVH 2E7MA 2IJ0C 3GRWA 4HWBL 3HZMB 3Q8BA 4JJHA 3OTTA 3WN6A 1NCTA 2D7NA 4XVTL 1F1AA 2GC4C 4R7XA 1J11A 1F00I 3MX0B 5JPNA 3SDAA 4RETB 4JVUA 1UM4H 4GB9A 4WNQA 2QQLL 1L9MA 3Q5YA 3GBDA 4WW2B 4X5XA 4E0RB 5EMYA 3MX0A 1DQLL 3BSHA 4K3DL 3SDAB 4E2OA 4HHAA 1T89A 2HFFA 5T1MA 2NUTA 1UOLA 2F53B 2YD7A 3NDZE 5T5NG 5L8KB 3ZK0A 1KJVB 1IT9H 1AY1L 2PR4L 3MLYH 2FLMA 1MJ8L 2V7NA 3UG4A 4R7DB 4HHAB 2KLTA 1I4FA 2ICEA 3G6AB 2HH0L 4FMFA 4BKSC 4B50A 1CLOL 3Q2VA 1TMQA 2QELA 1WCBA 1DFBL 2V7NB 3SDDA 5TK4A 3BH8A 3HC4H 4JANA 5HPOA 1QFWL 1ZTXH 3SQBA 1HDMA 3U30C 4NI6A 3H3PH 1L0XA 5MEQA 3BQUB 3TTYA 5JORA 3NCWA 3H9SD 3QWOB 5GIRA 1S7SA 4X7EC 2W59A 2WQUA 5GHWH 4Z95L 1CXKA 3OVUB 4GMSL 4GT7A 4N2KA 3JWNH 5I8OH 4GG6A 3ZDWA 4XBPB 4TL4A 3NEOA 4U1HA 4N90D 2ARJB 1P7KB 4R26L 5F6HI 4WFHD 1YYMH 4ZUUA 5GISL 4AGOA 1QATA 3CZEA 1LP9F 1JZHA 3MUY1 4U6HA 1IBFA 4AW4A 3HI1B 3HR5B 4FXKB 4OCSH 1SJHA 2RAMA 4MMZA 3FH8A 1S7VA 1RURH 5DD5L 4EN3A 5LNDA 1OGAA 5HHNB 4B41A 2IFFL 3DMMB 1DCLA 1XWVA 5D4QA 3ZO0A 4LHUB 2A77L 3QARA 5A2FA 2YAOA 5L8LB 1GOFA 3HVNA 4MMZB 2TRYA 5E6IB 4XWOD 1NCCH 4D9RD 1NCWL 1MIEH 1PS3A 1SGKA 2FVNA 4HS8H 4TUKH 3LN4A 5G4NA 3RVVC 2FJGA 3SKMB 3UPRB 4Y2DC 2WZPA 3QJUB 4L18A 3F04A 1K5WA 1C5CL 4Q6IC 5C0AE 1ZSDB 4NENB 4KXZI 4UU9A 1HOCA 1XX9C 5FAAA 3WE6A 5E9DE 2EDJA 3OG4B 1FORH 4JR9H 3WIIL 2D03L 1KNOB 5TE6L 1KIQB 4LCYA 4DOHB 1E5AA 2I85A 1CD1B 3HE7A 4CN6A 3C08H 3BMWA 3ZE1F 1QSVA 5CEZD 5DYOA 3HRZA 2GTZA 3VXTB 2O5ZL 4YXHL 3FRPB 4WDIB 4N2LA 1CE1H 5I66B 3UPAA 1LMIA 2VR4A 5D8JL 5IFHH 3X3FH 1F3JB 4JB9L 1AGEA 3G04A 5AW7B 4W4NA 4QPEA 2WXPA 1I85C 2AKRB 4MASA 4BFEA 4YGVA 5F1NB 4YLCA 4NUGH 1DVFA 5KYUB 3BUDA 3F7QA 1H8LA 2BMKB 4CJ0A 4D0DA 4AMKH 4UM9B 4ZMYA 4M5YL 3CK0H 5FECB 3QRBA 4X6CE 2AKRA 5F3FA 2EZ0C 1QG3A 4YHPB 1O6SA 3DX8B 2DM7A 4UQ3A 2KKQA 4X6DF 4ZMTA 4D7BA 3UG5A 4K3GA 2OLDA 1HQ4B 4IBYA 3K5RA 4UTAA 3LMJH 2ENSA 2J1ZA 2D3LA 4XNBA 5F7EH 3KEDA 3DX8A 1VKXB 4RZCB 4RDBA 2Z8WC 4A67A 4AH2A 5J7CC 3E7JA 3US1A 1ZEAL 3BDXA 1PGRB 5IB1B 4JHWL 4L4TB 4AEHH 3UCQA 4UB0L 5KSUB 1TZHB 2GJZB 4HAGA 4PJFA 5EZLB 1JZ8A 4AH2B 4UQ9A 3SY0A 4F80A 4LF3B 4UZGA 5CLWA 1WG3A 4NZFA 4BFNA 4RGNE 4O5LH 1YEKH 2OTPA 5SX5H 2MOVA 1O9ZA 1BVLA 2AJYL 3WJJC 4DPBX 1ZTMA 3JZYA 3GMRB 1GRWA 4PRPE 5B3JE 1QKZL 1IUZA 4LNRA 3JYBA 1FN4A 2IGLA 3AS1A 4ZTOH 5CF3A 3EBAA 1U95A 3WKYA 1B9KA 1KBBA 1EXHA 3BVVA 2GY5A 2J4WH 4XP6H 5FW7A 3KYOA 3OZ9L 1N4XH 1XB3A 3BZDA 4JJ5A 4K7FB 1VPOH 5JIIA 1RJZB 3OR6B 4UDUA 1MG3C 1M05B 4WI7A 3QNFA 5GZOA 1CL7I 4M8VA 3KYOB 4PN6A 3UIYA 1J5IA 1ZD6A 1KELH 4Q0XL 3V6OA 3ARRA 3MA9L 4OZFH 4UDUB 5B22A 4LDOB 3WSQH 1YVLA 3QZWA 2Y6SC 1QUNA 3GLDA 1X3DA 3TT3L 1DTUA 3IFOB 3ECVA 2GUYA 4IKIA 4Y5YC 3WFBH 2OMBA 4HIHA 3WNPA 1C5CH 1CGYA 4RGOL 2EDNA 4NWTH 4PG2C 5D7LD 4AVIA 5EO1B 1HL5A 3D48R 3WLWD 3O4OC 3DHMA 4BH7B 1QSED 1WITA 3FH7A 4WU5A 5FO9A 3L45A 4L9DA 4J2QA 3GXIA 1Q9LA 3U4BL 3VXQB 1NGWA 1H8OA 4F9LA 5IB4B 1YMMB 2EUXA 4XCFH 5E4EC 3DX7A 3C09B 1MWOA 4J3BA 5CCGE 5DD0L 1A4JB 1XD0A 3HE6B 3WTYA 2WOBA 3BVNB 5DUML 4CKQA 1YJDC 2Q7YB 1YNTA 4ZXBC 2PCPB 3L3OB 3D25B 2Q1EA 1KEMH 5AKVA 4XO3A 2KPNA 3AB0C 1E8WA 4N2FA 5KJ4A 2GW5A 4WFEE 1JRHH 1XGRA 2K4AA 2Q7YA 2AK1L 2PCPA 3L3OA 3FUDA 5FYJL 4G7RB 4X99B 4H26A 2DD8H 1BFTA 3GRBA 1D9KB 1CT8A 2AQ3A 2QKIC 4Z3HA 4U05A 2COVD 4ZS7H 2MCG1 1MCHA 3L7FA 4UTAL 2FH6A 1X5GA 4KMLB 4XNQB 1KJ2B 4JY6B 4B3EA 4W9FC 3F05A 4TNGA 3WUWG 2ICWB 4MZ3A 5DJ6B 1WE5A 1IGJA 2ZUQB 4FQXA 1A9EA 3VX1A 15C8L 3UTZA 5IMKA 3RA7H 3GSVB 2C9VA 4WFFD 1E5CA 2WVUA 4JJOA 5LCVH 2RGSA 4DVBB 3LEYH 1FPTH 3Q5OA 2O61B 1KBPA 3RWDB 3KLKA 3SDYL 5T1DH 3GSVA 2FWOA 3DV6A 3QFJD 2ICES 4X6FA 4TPRL 1EEQA 2QPUA 5KSBE 3MLYL 2QSCH 3W57A 1CGUA 2O61A 4LRIC 3ARBB 4KZCA 1U3ZA 4OZGA 3QJSB 5LBGA 1FO0A 4F7PB 4JKNA 4BRJA 1IQDA 4ODBD 3LV3A 3E0GA 5B1BB 1AHWB 5DYFA 1ACYL 2YD4A 1IGCL 2ZTBA 4HIEA 3WFCH 4JZJC 2YUXA 4AYMC 3P2TA 3EADA 3ZSSA 1AR1B 3AG3B 4FQPA 3HLKA 4OF7A 2QPSA 1XQ4A 1EMTL 1YMHA 2D7TH 5D7SL 4TULL 2IAMD 2MQ3A 2PW1B 3I50L 4JDZB 3MCG1 4PTUA 4DKAA 5EIIB 3SDXA 5ACLA 3OPUA 2JK5A 1OGTA 3CH1B 5JNYB 3NJJA 5CIPH 3RB7A 4RGNB 1KULA 3K74B 5E8OB 2R29H 5IR1B 2FNWA 4CJ1A 1G7PA 2HX8A 5GGTH 5FKPB 3SKUD 4ENEC 2ENQA 1AD0A 4JDTL 3EGXA 3HC2A 5EBMA 1HINH 4O02H 5D2LF 2CDGA 4I77H 5D5MB 5JNYA 1IGTA 3NFPB 3FAXA 3MCLL 3P2BA 4NS0A 4PP2A 3K2MC 3PWJA 3TTSA 2F54A 4GUPA 3CC1A 5ESVA 5CU5A 4BD4A 4FNUA 3AQDA 1IX2A 4WW2F 3TYFA 1GCFA 1IGTB 1KCVL 1CFVL 5AVXB 4I89A 4L4JA 1HK6A 3PWJB 1F4AA 2F54B 5E8DL 4H1LG 2QSCL 3GDCA 1MI5E 2J20A 1J10A 3FUFA 3ORJA 5FOBB 4OV6F 4IRSB 5DJCB 1OD7A 3U1QA 4PCKA 1A3RL 4FD0A 3UYRH 2IPKA 3LH2L 2AJXL 1BQ5A 4X6CB 5TPWL 2FEDD 3JV4A 1KYAA 3VRJB 4F7EA 1FLRH 4IRSA 4JHVA 5JPMB 4G43A 3ZL1A 3G08A 4DSYA 4ZMQA 5C9JA 2IPKB 3A21A 1OWRM 2DM4A 2ALWA 4E9RA 1IARB 4XNMA 4IKKA 5EOCH 2WXQA 2Z1PA 3FN0L 3JV4B 3VRJA 3O0LA 4QRTA 2XWDA 5BVPH 1BFSA 1MRFL 2QHRL 5T8IA 1TF4A 1NDTA 2ADGB 4HUMB 4DWHA 5IESL 1T80A 2M2DA 4J8QA 3KLHC 1AG0A 1OTUC 1WZ1L 1UOVA 3O2DA 2C5DC 3UZQA 4NN6C 4AYBA 3MRCA 2HWZL 5JHBA 2GIMA 3MLSH 2IPTH 2AJUH 3OSKA 4FFYH 4OD3L 1IGIL 2P5EE 3F00A 4R97C 3VI3E 2IV8A 3II2A 5F93C 1RLBA 5C3TA 5KVDH 2J8UE 3Q2NA 5E8PA 1IGMH 4NQTA 4OFIA 2Y7NA 2ZP9A 5D2NE 1I82A 5A2KH 4JKPH 1WWBX 1Z6JT 2MQGA 1VFOA 4F2MA 5E8PB 1YYLH 4N2MA 3STZA 3TURA 1NBVL 3FT9A 1MCDA 4U1SA 4JRYA 3QWRD 2JCCE 2F7RA 3D87B 5JTWA 3U7WL 1FL6B 1OP3K 4PJ9C 2FJSA 2F1AA 3B5GA 3STZB 5CR1A 2P43B 1Y18B 1GA2A 5E1QA 5GS0C 2XHNA 3CXHK 5EOCJ 4AQOA 1TCRA 1BQKA 3U9PL 1B3JA 2CHDA 3DI3B 3F6IA 4OFVA 4FXTA 1DEEB 3BHBA 4WHYH 3IXAA 4XVOA 4Q0XH 1S3KH 5SWSA 1JZJA 2BWIA 1QBML 4RFEB 2O93L 5K59F 2ZOWA 3V0JA 2E9IA 4JRXA 1DEEA 3H6AA 4MNGE 5DK2A 1UGKA 2HJLA 3CBRA 4KY1H 2EEXA 4PD4K 4Y9CA 4XAKE 1KFGA 4HA1A 1DQVA 4EAEA 5DMIH 4XOAA 5EZOH 2DBLL 4U2YA 1NLDL 4KMTL 2QDVA 3JWNE 1SN2A 3QPXL 3KZ8A 2HJLB 3ZYOA 4P8QA 4TLUA 4XHJD 3RU8H 2VZTA 5KBMA 4KXCA 1RI8A 4KK5D 2C9XA 2ZXAA 3D8MA 4XP1L 5KYWB 3BPCA 2QVFB 4GMTH 3WNOA 5ABDE 2R4SL 4NNYB 1S9KC 4FQJH 2BZDA 1RVFL 3ZDZB 4AXWA 1A0QH 4NBYB 3SGKA 2G2RB 4M7JL 5JYLA 1FNAA 1KXTA 1ECZA 5FF6A 4KNSA 3AACA 4PJ5A 4F33B 3TBWB 1OAKL 4JFEB 5AAWA 4GRWF 4G1EB 4Z7NF 4IRZA 4HBCL 4J3XA 4QHKI 4LARH 1FGVH 4WK4B 3KPRD 3N85L 1Z9MA 5CJQH 2ZWKA 2PABA 2GJ6A 3DSFH 5F7EL 3TH4T 4RH4A 3DDFA 3KL5A 1QFWI 3F58L 4XMLL 3MZGB 1PBYA 4ANXA 4PJDA 5I18L 2IPUG 3U2JA 4NQDD 3CZGA 2WQXA 2XDHA 3CN3A 4FZEL 3SPVB 1NA8A 4R4BA 3CK0L 1G7QB 2RCSL 43CAB 2G30A 2SEBB 3FB8B 5DUMH 3VWJC 4PJBF 4QD2E 4M5TA 4NZ8A 1U4FA 2A0LC 2VLRE 3W9EB 5HY9B 3SPVA 4DUVA 3DO7A 4QRRA 3GIVB 3DKHA 1ZHNA 3SJVB 3T4AA 1RIUH 3MV9A 2V3FA 4AYFA 2ZUSA 3NPZB 5E6SB 3KXFD 2WLZA 2L04A 1G94A 3MFFB 2JJVA 3SJVA 4IEFA 1B2WL 3HPJB 4RA0C 4MZRA 5GGVL 1RERA 1FRGL 3L54A 4L4VA 4ODHH 1ULVA 4I9WD 1QTPA 4BA0A 4PJHE 1Q9OB 3MA9H 5BS0E 4J6IA 1EWHA 1R3IL 2H6PA 3IU4L 3UJIH 4DKFH 3C5XA 1UA7A 4GAYA 4JFQB 4MNGA 5E2JA 3SB3A 3SJVE 3OMZA 2XETA 2CH8A 3FQWB 4F1ZA 4AKOA 4TTDD 5LO7A 2ATKB 1O7DC 3GGWA 4K71C 2VKWA 3GSWB 1TTBA 5F9AC 2V2WB 2W0FA 4PR5A 1SLUA 2BS71 4ZTOL 4ZFGH 2VC2B 2B08A 1GL4B 3QUHA 5BRZB 1T1YB 1T2XA 4YHOL 1WAEA 5E7FA 2V2WA 1U8JB 5C0BB 4KROD 3LRLA 3CZJA 5D1QA 4KRPD 4NZDA 3EUUA 1DBJL 1JF5A 1LHZA 4PJDF 4PYGA 2OMWB 3HS0C 5LUMA 2CM6A 4YUEH 4QHPA 4IM8A 3FU0A 3VG0H 3UZVA 2RB8A 5K59E 1BJ1H 1X9QA 3H3BC 1F1GA 3PXHA 3D3VD 5DDHA 5TH2A 2J8OA 1CGVA 3EYSH 2TSBA 1AMXA 3VD5A 5A7BA 4LCCA 1HH6B 4H20L 3MRHB 3QFDA 2QR0B 1CGWA 1UVQA 4M7ZB 3TO2B 5CIPA 4JK0D 3WFBL 4A6YB 5T3ZE 35C8L 3CX5J 3PABB 4FA6A 1SDDA 3M8OH 1R47A 3P4MB 4MJIA 1P7QB 4OT1L 4X5LA 5EZJA 5ITBH 3MRHA 3QFDB 1WA0X 2QR0A 1C1EH 4Y7MA 2XTJC 4PJAB 5AUMB 2DQEL 4XB8A 5D7JC 5J6HB 5DD3H 1OCCB 2JVUA 1X7TA 4MXWL 1P7QA 5EZJB 4GQPH 2QEJA 3QORD 1WBXB 5CGBA 1PEZA 1Z7JA 1IAIL 4PJAA 5AUMA 4ZAKB 2HRHA 5I1DB 5T1KD 3VFNA 5ICXA 2YXFA 1WBXA 3P4NB 1CBVH 5DHDA 1KIPB 4OGYL 4BGDA 3EO9L 1TQVA 3Q44A 4HMEA 5IVZA 2PTTB 4BK8A 2ED6A 3VFNB 2NXYB 3GMOB 5ICXB 1IILE 3H9SB 4N8UA 3P4NA 4JO2H 4PJCE 5DJ2A 5FYJD 1JK8B 2ZSWB 4TUOB 4PRID 2PTTA 5DUPH 3VWKA 1NFDF 1AKJD 1HXMA 1HNGA 1DLFH 1UD6A 2P24B 4WWKD 1HYSC 2ATPB 1CICB 5E4AA 1CZ8H 1KC5L 5I8EB 4MDJB 5EDSA 1WVZA 1YEIL 2FLRT 4IQHA 4N8PA 3HG1B 1ZLSL 1MREL 2ZXCA 4Q9CA 4PLNC 5IHUH 1JZDC 1BFOA 3SDDD 1CDGA 3F5WB 2JV6A 2VDLB 2WC7A 3HZMA 5HGHB 2MCMA 4A04A 2ZF8A 1CK0L 1EDQA 4F5CE 4MDJA 5BUPA 1I8LA 2OP4L 1YEIH 1JI1A 2BY2A 3FXIC 3NAAL 2I07A 1SBBA 2CUAA 2WQAA 4RMVA 5GXBB 3VD1A 3X17A 5EWIL 3EH1A 3RWGB 1TYRA 1KIRB 3MXWL 3PWVA 3ZIYA 2BC4A 5B1CA 2E74C 4HFWA 4KRPB 4BFRA 2OMUA 2CCLA 1RL1A 2BNRE 2JI1A 4GAJH 5DMJB 3UAAA 2NXYC 1A1NB 3RWGA 2W60B 1MHPL 3AC0A 3IU3B 1XH3B 1ZCRA 4PJIF 1L0PA 1KJVA 3F6LA 3D06A 3GMQA 3KS0H 4M6NL 1PVHA 3LZOA 1EHLH 3VGFA 1CBVL 1XIWC 3QH3B 3RVUD 1JIBA 2RIKA 2YAFA 2ED7A 4M3HA 2YS4A 2ICEB 3G6AA 5DC0A 5I1HH 4MXVF 1I3GH 3ZDXB 3GMQB 3VU1A 2P8MA 2WLIA 1F58H 4KKLC 5EEVA 5JMOC 1QFPA 3QGVA 3ZE2F 2FR4A 2F8VA 2Q10A 5D7IB 5DJ0A 1BD2D 2MKWA 2X41A 3QRGH 5EF2A 4I0PB 3IETA 2XBDA 3US0A 5DD3L 1GOHA 1S3KL 1AOZA 4YPGA 3A67H 4LL9A 3FT3B 4N8CL 1WJ3A 3BVUA 2HKAA 2YRPA 3I9AA 4KNUA 1HAUA 3K8MA 3NK3A 3ZL2A 4OLYL 3N6YA 2ZCLH 1KBVA 2W0PA 1W0WA 1FO0L 4YPGB 2ZUWA 4WK2B 4E36A 1L3NA 3QUXB 4WV1B 1P7KA 4ZUUB 4PJDE 5C97A 5E5LA 1FGNH 4TRPH 3N1PC 4PCSA 2XZQH 2KLSA 3JWOC 4YBHA 3QUXA 3HR5A 5E2WH 2A77H 2CK0L 4L8DA 5A2LH 2FE0A 2R39A 2VSMB 1PSKH 3B7RL 4RFNC 2GVYA 1C9SA 2DWXA 2XWJB 1MELA 2E7HA 3R0NA 5C0BD 2GAZB 2V33A 1TQWA 4JPKH 1CD8A 1TUPA 4BM7A 1BBDL 1A1OB 3WJLC 4I0PC 5KS9E 1JXGA 4AVHA 1W0VA 2BSTA 2WWNA 2GAZA 2BNUA 4M02A 3CU1A 1UD2A 3RI5K 3WY1A 3CMOL 4OI7A 1OGPA 1CR9H 5JO5A 2HPTA 1YYML 4P5KB 5GISH 2X7LA 4YO0B 4M03A 2GK0A 4C58B 2H1PL 3QS3A 1B9ZA 2BSTB 4HC1H 2IEPA 3BC9A 5DHEA 2OCCB 2CKBL 2Y4SA 3SPJA 3V6OE 1HOCB 5L2KA 3WE6B 1KJ2H 2WUBH 5CLTA 1E5ZA 4OKDA 4NAQA 1M57B 3D4CA 3ESVF 1N0XL 5D7JA 1GR7A 3CN1A 1GZHA 4WW2C 2BZCA 2DKSA 4FYRA 3RY6C 1KNOA 1KIQA 5EN3A 4BWUA 1XFPA 3Q2LA 4P9HH 2XYBA 4X0NA 4AOFA 2KZ1B 4QYOA 4PMFA 1D7DA 5I6KA 1RK1B 4FHJA 4P5TD 3VJ6A 5DMYA 2H5UA 3MRKA 1X5AA 1BGXL 1ZVSA 2XICA 2Z93A 5KSBB 1KIUB 3D18B 3HMWH 5GS3A 1OT1A 3O4LA 2WBKA 3SE3A 3CLEH 2JIXA 2HP4A 4HJEA 5A3ID 4DK5A 4WHDA 4GUOA 5C0FB 1DVFB 5KYUA 3BN9C 2J2ZA 3UP6A 3BD4A 3T4YA 2DBLH 2GYSA 1DBKL 4RX4D 2E9JA 2NT1A 4PSRA 4FNLL 4M56A 3ARDD 4JDVA 4FYQA 5IMMA 3BP4B 1PAZA 3M7OA 3EZ8A 5DJYA 3MCLH 2PKDA 1NKOA 4MMXA 3RUGE 2VW7A 3RDTD 2Y1ZA 2EE0A 4R2GC 2VIRA 2ZYIA 2OMXB 3MREB 4OZFG 3ARSA 3RUGB 3IJ7A 4D0CA 4DCQA 2CKNA 5I1LA 4LVHB 4XP9L 4LLUB 4ECNA 1VB9A 4AJYV 4DHLA 3RZCA 3VTMA 2P48B 2X70B 4OW6A 2OMXA 1THAA 2NYZA 4ZMLA 5EZLA 4HJIA 1SDAB 1NCAH 3BWAA 1FVCB 4LLUA 1A65A 1JPEA 3QEGL 3RIAF 1B0GA 3MI6A 3GI9L 4HBCH 4B7IA 4OI8A 2E3VA 5BV7L 5AQ0A 4RRPG 1SEQH 3EG9B 3WLWC 4Z7UF 1ZLVH 3Q1EA 5IIEB 2YKKA 5KJ7E 1B0GB 3OKOA 5FYKL 2EE6A 3DNKA 3TIEA 4U4BA 3L3HB 1HS6A 4QRQB 1VERA 2CHNA 3QXUA 3X12A 5TDNA 5EC1A 4P5RA 3TV3L 3D4YA 2CPCA 4HT1H 3K6OA