1M4KA

Crystal structure of the human natural killer cell activator receptor kir2ds2 (cd158j)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
193
structure length
193
Chain Sequence
PSLLAHPGPLVKSEETVILQCWSDVRFEHFLLHREGKYKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords KILLER CELL IMMUNOGLOBULIN-LIKE RECEPTOR 2DS2
publication title Crystal structure of the human natural killer cell activating receptor KIR2DS2 (CD158j)
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2002-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1m4kA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1m4kA01
5FDWB 2YUXA 3BH8B 3LB6C 3MRRB 2VR5A 5KAQG 5ESVA 1LP9A 5DD6B 3T65A 3V0VA 1TCRB 4P46C 1MEXH 1NCBL 2D9QB 3CPLA 3H9SA 4QYOB 1IBGL 3PJSB 3RKDC 5IJKA 5FA4A 4CGTA 4GH7B 3AM8A 4HBQA 4J4PA 1MFEL 3VGBA 1MY5A 5T3XE 2JB5H 2CJUH 4KQ4H 4LSPH 4Z7WA 4RA3A 2W9LA 5DUBA 4D94A 5IVXF 5L2KD 1AP2B 1OGAE 4HH8A 4UU9B 4KDTC 4F58L 2FSEB 3ZTNL 1FL5B 3EO1B 4P59L 1RZ7H 2EZ0C 5J13B 4HWEL 4U3XA 4RGNE 4KUCF 4U1IB 4X7CC 5CCKL 1OWRM 4YHNA 4LQFH 1X5KA 2DF3A 3PWJA 4GLRH 5EIQA 4X4ME 2LQRA 3TT1H 3ZDZF 3WXVH 1S3KL 1DDHB 2C7UB 1H3GA 4AEEA 2P48B 1L9MA 3OX8B 3B6SA 5C0BE 4IOSD 4JG1L 4H88L 1KC5H 3HPLB 4CMMA 2OJEA 1TQBB 3RIFK 1JTTA 4P4RB 1IQDA 3IU4L 4XCFL 1KEGL 5EU6D 3HUJF 3AREA 4KRLB 4OF0A 4RZCA 2GJZB 2X7LA 4OUUA 3R1GH 5GXBB 4MAUL 2Q3AA 1H3UA 2VE6A 3MJ9H 1MRDH 5K9QI 3EJZD 2QQLL 1RSFA 4CKVX 2ARJA 1XF3A 3IGAB 4PB9L 5LCVH 5D2LF 2DKUA 1RJYA 2OTWB 3HE6A 4M9PA 2P8LA 3G9VA 1NAKH 3THMH 4U6HB 1WC7A 3QG6B 1MQKL 4OZ4B 3BGAA 1U8OA 4JDVB 1BAFH 3VGAB 4AMKL 2DQUL 3L3GA 2VLMD 2R1YA 2AJ3B 1GAFL 1UM4H 3RTQB 1DQTA 1EHLL 3OAZK 3TBVA 4QOKE 1IM9A 3HG1E 2R69H 3T0ED 4DW2H 3NGBC 3MO1A 3M07A 2X1XR 2YSSB 5GRXG 3V6ZB 4YAQB 3FT3A 4WUUD 2GJJA 4RCAA 4UQ2A 5JO5B 4AEHH 3STLA 4OCXL 4F7PA 3HMXA 4NQCB 2BFVL 2OS7A 3ULUF 3CX5K 2JJVA 4EI5D 1I1FA 2B39A 5E2WH 2C1PA 1MFDL 4FQCL 1TFHA 3MGOB 5FECB 3MXWH 2CXKA 3L5WB 1JF1B 2H3NB 4U0RB 2BDNH 3KPQB 2Q7NA 3C2SA 3DRTA 4K8RL 3Q2CA 1J1XL 3MCKA 4U1JB 3OHXB 3DUUB 3QB7C 1KT2B 4S2SB 2NNAB 3FRPA 3TA3B 4KXZH 1KB5H 3P11L 1NFDF 4HFUL 5HPOA 1R3KB 1TJIH 1I3GH 4ZXBC 4CRPA 3WKMH 3SN6N 1K85A 4CJ1A 3WD5H 1H15A 1REIA 3BZEB 4PJCE 5T3ZH 4F3FA 3ILPB 3UYRL 1NGWA 4UDTB 1SVZA 1EO8H 1E4JA 3Q6GH 1Z9SA 3VDCA 3PV6A 4GKZB 3NCMA 1H8OA 1GZQA 2APFA 4DJMA 3BISA 5MEPB 2ZG1A 5L7XH 3VWJA 4WFHE 1N4XH 3O3EA 3W0WB 2FB4H 2DIBA 2X4OA 4F7TA 1DN0A 1Q9KA 1Z9OA 2PXYD 2C3VB 4YHOH 5JZ7D 1NBQA 1NCWH 1DBJH 3KHOA 5IVZA 1WZKA 5HI4C 3HZVB 3ZKXB 4HBCL 4K2UL 3GBLA 3JV6A 5K9OB 2EDNA 5E4EC 1OSZB 2HJLA 3IJYB 4TSCH 5F9OH 5K93A 3MLRH 4N5UA 4GRMA 3U6RB 2F54E 5A2IH 5ALCL 3RY6A 4KAQL 4FXGA 1JN6A 3EHBD 3WIFA 4A6YB 3I50H 4PRAB 3LCYA 3TFKD 2YRZA 2XA8L 3U9UA 2J88H 1QTYT 4R3SB 1YN7A 3ALPA 1KELL 5HYJE 1CE6B 2OZ4L 4WW1A 3TO4D 5J3HD 4Q9RH 1HQRA 1RD6A 1OY3B 3IDIB 4LCIH 4MJIB 4GQ9L 5FXCH 1U8PB 4R4FH 4LEOA 5CGYC 1X5HA 3QYCA 2WWMC 4J3UA 4NSKB 3GSUA 4ZQKA 4CVWA 1KBGL 3BVNB 3S3SA 5AWNL 2VDLL 1WUNT 2NY6C 3QQ9C 1YA5A 3KPMA 4PRDB 3D6GA 1Y0LB 5I6XB 5HHPA 3MCLH 1VFBB 1YPZA 3DMMA 2A9NH 4JGUA 2RHEA 4YUEH 1MJUL 3D3VD 1UKSA 4I18C 4QXWA 3T2PA 1OARL 35C8H 3P30H 2ERJC 5I9QC 3NIFF 1NFIA 1KJ3L 2WW8A 4M61B 4YHPA 1T1WB 3MRHB 4PRHA 1AO7B 2VH5L 1N8ZA 2VABA 1KCVH 4XCYB 3T8XA 4HXBL 4LFHD 1ONQB 1MLCB 5D1ZD 1U8JB 1GXEA 2AGJH 4MGXA 1QO3B 4CN1A 4OUOA 1GVIA 4MB4A 4WW2C 5EOCJ 4MB5A 4KI5F 2EXYD 3QIWA 5MHSE 5E5MB 2SEBB 3NCJH 3SCMB 1NBVL 2AXFB 5IFJB 5ADOL 5EOTB 3T0AA 4XPBH 4YHLH 5DVKA 4QRPA 2A6JB 4NO5B 5FKPA 1QLEH 1CICC 3IYLW 1SMOA 3U0PB 4PRIA 3EO9L 5CP3H 4AL8H 5FCSH 3T4YB 1YC7A 3CSYB 4OI8A 5FYLD 1WBZB 4RX4A 2OLDA 3MGTB 1XFPA 1RPQA 3LN9A 2X41A 4ISVA 4U31A 5FUOL 3KPOB 1WF5A 1T20A 5I18L 3QUZC 1E4KC 3GUTA 3UTTB 4OIIL 1QYGL 5KZCB 4G8IB 2H32A 4G8GB 4OF8A 1KLUA 1V8HA 1A3RH 4XNQA 5B38G 3QUYD 1YEIH 4OBRA 5L6YH 4HMDA 3B2VL 1D5XB 4MNHB 3SDCC 3IDXH 4Z7VA 3MNZA 4XPTL 5F44A 5C6TL 4GBXC 3RY4A 1FV1B 2AQ1A 5C0AE 4IRSB 2XQYK 1HH6B 1FL3A 2XXCB 4I8DA 4BK5A 5TQ0L 1NFKA 4J2XA 3Q5YA 2WLYA 5CEZH 1G0XA 3V4UL 2DI8A 4G9FA 3VXSB 2ITDB 1E27A 3ARGB 3BH9A 2XG4A 4EUPH 4APQD 5B3NA 1ZLWK 3FQNB 5EBMA 1P5UA 1S9WA 4RDQG 3MV9E 4XBEH 3SDXB 4K9EL 2VDML 2VTFA 5T3XL 1BM3H 4LFHG 1L6ZA 4ZS7H 4KKNA 5CWSA 1A7NL 1J05A 2XTJB 1JWMB 5IF0B 3FQXA 3SPVA 3ZDXE 5C07A 3GB7A 4X6DA 1N6QL 2P47B 4M6NL 3OKDB 3SE3C 3GNMH 4X6FA 3RNKA 1RUQH 2MKWA 5LQBH 3TCLA 4ZOBA 3ROOB 4ZUUB 4BKLB 3TH3T 4R4BB 2JCCB 4FMFA 1I7RB 2RCSH 3S7GA 1HHGA 2YOCA 1UM6H 3SKMA 4XZUA 2AK4E 4XB8A 1RU9L 4DVBB 4GAJL 3TEUA 3IFOB 1R5IB 2YC1B 2EC8A 5FUCC 3IDNB 3QXTA 1AGCA 4Q6YA 1CFSA 4JM2D 2HVJB 4CU7A 2DLEA 2HT2D 1GHFL 5GGVL 2H8PB 3RWEA 1G7IB 4NP4L 4HHAA 3CFDB 2XZZA 3OXSB 5E8DH 1HHKA 1IGCL 5HJ3A 5E08L 1LDPH 1WBYA 4KTYA 4MAYD 1J7VR 3ARFD 4LLYA 5M95B 5EFIA 3VA6A 3CAFA 3RVWD 1AQDA 3CSGA 4PJBB 1RJCA 3MUY1 1QP1A 4XP9H 5EOQH 1T2QH 5E70A 1WZ1L 2DQCL 3QH3A 4RFEA 5F97E 1MHEA 3G6JA 3L5HA 4DZBA 1TQCB 4PTTA 4JY5H 5H2BB 3JUZA 3RGVD 1T83A 2H6PA 1QFWH 4XRCB 1MJ8H 5T3ZD 1OAZL 3GMRA 3IDYB 3FQWB 4KRMB 4QHLA 4W4NA 1UM5H 3KYMB 6FABL 4JHWH 2IPUG 1NGYB 2HFFA 3TWCH 1PG7X 1M05A 2XKNB 2DQIL 3MZTA 1V7MH 3NFSH 2ZOKB 2HKFL 1IQWH 4TSAL 1DEDA 5C2BL 1EVUA 4R0LB 1JNNL 4GO6B 3VXMB 4LLAA 2I24N 5DD0H 3MLXH 43C9B 2X9YA 5FUCE 2OZ4A 3TN0A 1A9BA 3DJ9A 4NQEB 1HSAB 3QFJE 3UTSA 4Y19A 1MI5E 1YZZA 3OXRB 5EO0B 2P49B 4YH6A 1IC1A 5JW4R 5E5UB 3G6DH 2GY5A 1XGRB 3KNBA 4FZEL 3MLTA 3OGCA 1RV6X 4ACPA 1MHCB 3FCTB 3QIUD 1S7UA 3LQMA 5FCUL 2I9LA 5AG8A 3EYSH 2NY0B 3QDGE 4JPIB 3BRFA 3M45A 1F97A 1A22B 2ZCLL 3V6FB 4A2MA 4NYLA 2E3VA 2EIBA 1CGUA 1U6AL 2E7LC 2VISB 5C09D 1KXVC 5EUKB 2NX5E 5KSAA 5DQJB 1Q0XL 5I71B 1T5XA 3ARDC 4Z7NF 1FDLL 4GSDH 4LCWA 3K2UH 4GW4A 2QSQA 4RMWA 3RWIA 1CLCA 4LPWA 1V3JA 5MEOB 1QR1B 3PL6A 1JV5B 4Y8AA 2D7TL 3PP3K 3VMNA 3PF2A 1F2XK 3S37X 3VXUE 1OPGL 3FHQA 4ZYKB 1OWWA 4PJ7B 3OL2A 2YEZB 1HOCB 2R2BB 4L3ED 4HG4K 2Y23A 1G6RB 2EYSB 5I73C 3O9WA 4FFYH 5GRUL 4U7KA 4CU8A 3HNSH 1FC2D 5GGTH 4U1GB 1BOGB 1OLLA 1HXMB 5DEFB 3QNYB 5IHUL 3ZMRA 5D7SL 3RBSA 3FN3A 4XGZA 1OGTA 2YD3A 1BFVH 1Q9WA 4OI9A 4QRSB 4WW2F 3TIEB 5C08D 3RWJA 1F58L 2HJKB 4U4BA 3F7VB 4D0BB 1MRFH 1U3YA 1RZIA 1KPUB 3VD5A 2ZKHH 4MJ6B 3AVEA 4W4OC 4MA1B 3L3JA 3QWOB 5SWSA 5KS9A 1QKZH 4KMLB 2GJ6D 2V2WB 1Q9OB 3D18A 3VDAA 1VADA 2FBJL 1WSST 4L4VB 3RA7L 2FGWH 3OKKA 2GTZA 3AU1B 4NO3A 3L3IA 1BZ9A 3C9NB 4YIQA 1XGUA 1WV7T 1QUNA 4PV9B 4OJFH 3EYQC 3LPFA 4ZD3H 4MDIA 5KVEL 5E94B 1W72L 2DD8H 1DEEA 3HZYA 3CCHA 5D7JD 1F4AA 1E4WL 4AM0A 3UJJH 3ULVH 4Y5XB 3BP4A 5CMAB 3RVTD 1H3PL 3FFCE 4WEBH 4P23D 1JFQH 5E6IC 4WHYH 3IFLH 3KWWA 1F11A 2IQAB 4OZFA 3WSQH 3D9AL 3M8OL 5BV7B 5MENE 1T04B 5FM5O 5KVFH 3T09A 4J23A 4LLWA 1A6UH 1GPOL 3QHTC 4P4KC 4RFNC 4PGDA 1Y18A 1Q0YL 1RZGB 5I1EL 3TBYB 1F13A 1I1YA 4M1GH 3GHBH 3QXAA 4NNPL 5D5MB 1R5VA 1IGIL 5B4MC 1HQ4B 3WFBH 4L8DA 1B2WH 3N85L 4Y16D 1T1XA 2ID5A 1L9NA 1OGAA 5DJAB 5DUPL 4JJHA 4LU5L 5GZND 2BCKB 3OJDB 5E8OA 4JFQA 1CDJA 1X7QB 1BP3B 3BIKB 3O0RL 1EH9A 5CEZD 4LPCA 1DBBH 4GKNB 2QHRL 1INEL 3U36A 3RZCD 1ADQL 3BN3B 1CDCA 1KTRL 4JQXC 4WCYH 4XP5H 5DO2D 2AXGB 2VN4A 1JI1A 2YPKA 2IMMA 1LP9F 1DLHA 3NFNB 1U36A 2ATKA 4M6OH 5I1HL 2VR9A 2R15A 4LPTA 5EWIH 3HI1B 3UDWA 1RULH 4EN3C 5IW1B 3CFKA 5ICYB 2O61A 3MV7B 1ND0B 3LQZB 3O45A 5T1KD 1JGUL 5CINL 1AKJA 2G5BA 3EYFA 4PV8A 3MRQB 3C2AL 4KQ3H 3SGEI 4EQ3A 2FX9H 4KKBC 1CVSC 2BNRB 3NVQA 2CKBB 1FYTE 4YXHL 4HGWB 4CBPA 2VDKL 5C0FB 4G7YH 1QSED 5D7IE 3HRZB 1BFOB 3QJHB 1YEGH 4FQLL 4XTRD 5B22A 5BZDA 3X11B 2V5TA 2X4TA 4JLRA 4NUJA 1A4KA 4XMLL 5D2NA 3BQUC 3KYNA 3FRUB 1H5BB 2WQ8A 2UY6A 3EYUL 1CXKA 2HTKC 3QDME 1A7RL 3ILQD 5E2VH 3OR6A 3V6OA 2Y6SD 4OCMC 3S96B 1RK0A 1C7SA 2VZ3A 1N59B 4D9QD 4DTGH 4LCUB 2GSIA 3DROB 4GG8B 1F3DH 4XC1H 1KCKA 4C57C 1U58B 4QOKA 5CUSL 5L8KB 3BO8A 4LASL 4YC2C 1QHPA 1LD9A 2RQ8A 3TT3H 4F9LC 2H26A 3QHZL 5IMMA 1RMFH 5FYJH 4UT9L 2OP4L 5E7FA 1UH3A 4WY7H 2ESVE 1A0QL 5KSVA 5LGJA 5D7KD 3QWRA 5DJXA 4CAGA 3SKOB 4JEGB 5E2UH 2BJMH 1U2HA 4YBHA 1K5NB 2WK2A 3VXOA 5F1NB 4EKXA 4Z7OE 3BZFB 4HCRH 4LKCB 1ACYL 3HS0B 1OD9A 5D1XB 2VDOL 1ZT4A 4O02H 5LGHH 4H1LA 4UV7H 1Y6NR 2VXQH 4O58L 1ZHLB 4JR9H 5FGRA 3RIAF 4HK3J 4NO2B 4FQQB 2IAND 4FA8A 1U91A 3GJFA 3CVIL 3WEXB 2DQHL 1ULVA 2XY2A 4G42B 1YMHA 3WXWH 3O6FB 4G43B 1R24A 1SYVB 3TGXA 3CDFA 5I1GL 4EUPG 3QPXL 2RB8A 2W65A 4PJCA 4X6CB 1FNGA 4JY6A 5TQ2H 4OZHE 2AI0H 1MIEH 2Y7QB 3KPSD 3HE7A 2MSPA 3ES6A 4PR5A 2QKIA 4YFEA 1JZ3A 1JRHH 2DI9A 3R0MA 1TTUA 4QRRE 4DOHB 1UACH 3PHQA 5DK2B 4Y2DD 1UVQB 5J12B 1JHTB 3DSNA 1OTUC 4QWWC 1JWSA 3ALXA 1WCQA 4JPWH 1CQYA 4UUJB 2Z0BA 3GSWB 5CJQH 2QR0A 1XCTB 5C0GA 1NJ9B 4JG0L 1J11A 12E8L 4IOIA 3V5DB 5EZLA 1R5WA 4LCCC 2AV7A 1AGDA 4POUB 5F7EL 3CXDL 3SDDB 5GZOC 2AEWA 4QCIB 3B9KA 4OCRH 1LO3H 4MQSB 2R0WH 3MBEB 4FOMA 5IEKB 1FZJA 1NGQH 4KGJA 3JWDC 3WNNA 2Q86B 2CK0L 3LEXB 2L0DA 4KY1H 4U7SA 5IKCA 2F54A 3C6LC 5D1QC 3UROR 4YQXH 4AZ8A 1JYVA 1EJ6A 1ITBB 3BZ4A 4ZTPL 2X1PA 1E4XI 1FL6A 1OM3H 1DQDL 1T2XA 4RAVB 3VG9B 2PTVA 5FO8B 3BKYL 2JTDA 2P44B 2GTWA 5JQ6H 3VFVB 1I7TB 4MQTB 5IBLC 3ZKSD 5DI8B 5HYJA 4Q9CA 1ORSA 2IBZX 5FB8B 5F9WB 1GC1H 1U8KA 1NMCB 3NPSB 1MIMH 1NGZB 1PBYA 4QF1A 4NQDE 4F7CA 3JV4B 4DVRL 1G9NC 3H9YA 4XCEB 3E6FB 4PJGB 1MCBA 1ZLVK 5AZ2H 1U8HB 1QLFA 5JW3L 1QFUH 4V1DD 4MNQB 1X4YA 2EH8L 2JIXA 2GFBA 3HCVA 4OAWB 4X98A 5F7NC 2HLAA 1YN6B 3QXUA 2E27L 5IB1B 5DQDH 2VLJE 1RHHA 2CDFA 1UJ3B 3VFOA 2GSGA 3GJEB 4KPHL 5BS0E 5EZIL 2IJ0C 2ENSA 4HUUB 3X12B 4EI6A 1TJHL 3MRNA 4YO0A 1J0HA 3FO0L 4OM1H 3OF6A 3WDHA 5EO1A 2AXJA 3ARPA 2A74A 3PWPA 1DQLH 3NACH 4LLVA 5EA0H 1W0WB 1ZXQA 3SDAC 1DZBA 3MCG1 2WP3O 1UJTA 2XWJB 4PTUB 5I1KL 3QDJD 3PWVB 3ULUH 1CLOL 4ZFFB 3NCYP 1UH2A 1UCBL 1NEZA 5BW7A 1D9KA 4AK1A 2WINB 4KK8C 1DE4A 4PJFB 1TVBB 4WI5A 4GQPH 4HIJB 3NMEA 4JVWA 3GI9L 5SV3A 2RJMA 3VWKB 1CL7I 3T4AB 1S7XA 4PD4K 3KJ4C 1X5GA 3HN3A 3PQYB 4RQQA 5GISH 5HHOE 3ULVD 2PW1B 3FJTA 3FN9A 4P5TB 3RWFA 1ADQA 1M7DB 4JFPB 3MLSH 4IMLA 4L29B 5TE4L 3TNNB 1SEQH 4KHXL 5ICXB 5DJCB 4ODHL 4PGCA 3X17A 3VDBA 3VFMB 4IRJD 3GZKA 5I16A 3D85B 4K3JH 3QXDA 2Z31C 4FQHB 2R39A 4XHQA 3SO3C 2F53B 1KULA 3TCXA 4H26B 3NAAH 4LIQE 2Q7YA 3U7YH 3L3OA 3IAPA 1L0XA 3BP5A 1MOEA 3MLWH 3Q48A 2IAMD 4X80L 5EC1A 3M17A 2OM5A 1DR9A 4N9GA 4QRQA 4ZO9A 5C0AA 4W6WB 4PLKD 2BY0A 4NZTH 4Z7WB 2VLRD 1G7QA 5DUBB 1R3IH 3E6HA 1P4BL 1X5AA 3SJVB 5I75B 4L5FH 4JRYD 1CG9A 2H9GA 2IGFL 3IS0X 5A2KH 1BBJA 5HD8C 4G9DB 4ESKA 2LE9A 3BDYL 3R8BB 3PWUA 1KGCE 4K71B 2XACC 3MNVA 3MV9A 1IKNA 3PWJB 2IALA 2ZJSL 2VDQH 3V4VL 4XVJH 1FFPA 1MREL 2Z91B 3B6SB 5ERWA 3R4DA 3DVGB 4Z7VF 3HI5H 3LQAL 5LG1A 2VZSA 3R06B 4HWUA 1IQDB 2V2XB 1GGIL 5HVGB 1UXWB 3EZ8A 2BNQE 4JRXB 3AREB 3X14A 3LKQB 1LVEA 4OCWH 4LL9A 3JTTB 4PJXA 4MJID 2AJXH 4L4JA 5DF0A 3VE0A 1RJYB 4P2OD 4UB0L 4P9MH 1CXEA 2AK4A 4M00A 3DSFH 4RGMB 2P8LB 3NCFB 1WC7B 4WHYG 3KS0H 4N0CC 4HJJL 5JORA 4ODSH 4M5YL 5C0CE 1DP0A 1IAKA 4TQEH 3HPJB 1CFQB 5FYJD 5BXFA 2FHBA 4BH8A 2EH7H 5GIRB 3KDMA 2AABH 3O41A 4RFOL 1MUJA 1YJDC 3U46A 3TBVB 1DUZB 3UC0L 2WZPD 1YY9D 3MO1B 5I1DA 4LSRH 5F93C 4P2QB 3PE9A 3H6JA 5BMFL 4JQIH 5DVMA 2BVYA 1MLBA 1ZLUH 4AEIL 3HNTH 2JKXA 4F7PB 1N64H 3D39E 4PJAE 3WE6B 4M48H 3AAZB 4FQIL 4S0SD 5SX4H 5I74B 1FRGH 4HS8H 5E2TH 1I1FB 3FTGB 4IMKA 2W0LA 1ZA6B 2UZIL 2W07A 3O2DH 4Q0XH 1CWVA 1TZIA 3GSNH 1EPFA 2IPKA 4LNRA 4YDLB 2E7BA 2G9HA 4EOWH 3DRTB 4JN2A 3GM8A 1NC4D 3MA9L 3VFRA 5C0EA 5KTEH 4TTDC 5HI3D 1LEIB 4LGRB 1RZKC 4L1HA 1DFBH 2DQFA 2VUOA 4UQ3B 1AH1A 4KVCL 2ICWB 1XR9A 2QSVA 1HKLH 1A1MA 1H15B 1BBDH 1AXSA 4MS8D 4EEEA 3G6JF 1TZHB 2GAZA 4YJZL 1C1EL 3ARBB 4G6JL 4I0PC 1Q8MA 5ISZE 3QFJA 3QFDA 1MI5A 3PDDA 2R0LL 2WV3A 1EZVY 2XZAH 1ZE3C 4DQOL 1AGBA 5HGDA 4AENA 3C5ZA 4KMQA 3U4EB 2APTA 3GI8L 4LVEA 3Q5TA 1DQJB 3HA0A 3IFNL 5JR1L 4ETYA 2X4OB 4L9LB 1ZA3B 1FZMB 4F7TB 4YZFE 4WU7A 1Q9KB 4PJ5A 1OOAA 4QKXB 1XGYL 3ZHKA 1Q38A 3DXAB 4P9HH 5IQ9A 3KPNA 1MFCH 2ZCHL 4JZNA 3JV6B 2X42A 4YPGA 4NM8H 3UPRB 3VFWA 3TVMA 2QADB 2HJLB 3FOMB 1A7OL 1NDGB 3MACL 4X99B 3TZVC 4HAGA 1PAMA 4GRMB 4HGKC 1FO0B 3VW3L 1K2DA 1D5BA 4GRLA 3NIDE 4KHTH 3STZA 5DA0B 4U1LB 2A0LD 4MJ5B 5AYQA 3QZWA 4D9LH 3S8WA 1IILE 1YN7B 4HK0A 2GI7A 3GMQA 2RAMA 3GEWB 3VFUA 5C86A 1NH6A 1F2QA 1KJ2H 4MXQC 4WW1B 3FQRA 3DBXA 2VL5A 1HQRB 3VH8G 2XTJD 1OCWH 5F7KC 5DTFA 4Y4FB 4BQ8A 3NH7L 4TNWK 4Y4KC 4ODWA 2X40A 4I77L 1EV2E 1SBSH 4OGXL 3NZ8B 1ITCA 1C16A 1KACB 1HINL 4B5EA 5EBLA 2EDOA 5HGHB 2IPUK 3CFIC 1J86A 2XQBH 3OZ9H 3WO4B 4G3YL 3HC3H 3TJEL 3G04A 2DLFL 4NOFA 3EOTL 4JFFB 3U30C 3O2VL 2X09A 4ZPTA 1AFVH 5E9DE 1NUNB 4OF5A 3JV5A 3BWAA 1ZOXA 5D7LD 4YHPB 5HYSA 2JB6B 3T3MF 1BEYH 1V7NH 3WHE0 4UTAL 1N8ZB 1SJEA 4Z95L 1ES0A 5D4QA 3T8XB 5MERA 5EOCL 3LKNA 3VFPB 5TDNB 4ENED 2NY7H 4BUHA 3T0XA 1P4LA 2XA3A 4TUKH 1JHKL 1FIGH 1J8HE 2AJZA 1VSCA 1FNHA 2XRAH 3CU1A 3ME0A 5CJOL 4ODBD 4HIHA 1GOHA 1DBMH 1WWWX 3VRIB 1R0AL 5FKPB 4KRPB 5E00B 2EEDA 3L3KA 1F4YL 5LBSL 5MENA 1FN4B 3B9DA 3D2UB 2ATPB 1JMZA 4UINH 1T6VN 2XFXA 1T03H 3PABA 5DMJB 2AK1L 2IFFH 2ZZUT 5HVHB 3D1MC 2FO4A 2A9ML 3WHXA 5JA9A 2Z8SA 5ITFA 4X6EA 2CIKB 3GUTB 2QQKL 2H2SC 4W4OA 4JFEE 3ZLQC 4YDVA 2VN7A 1LO4L 5IB2A 4JFDA 1F6AB 4N90E 5DHVB 4HT1L 1Y6KR 3RNQA 4Z8FL 5EU7C 3D0VB 5IMKB 3WL9B 1CLZL 3WUZA 5F7DA 32C2B 3QI9D 4KZDH 4KTDH 1I9JH 1YDPA 3BXNA 2Q8BH 1QR4A 5FV2A 1CD1A 1JVKA 4U49A 3L7FA 4HH9A 4ZO6A 5E8PA 5DVNA 5C9KA 1ED3A 5JXAL 3P3YA 1P84J 3O4LD 4X4YA 2BMKB 5LJYH 3FQTA 4MQ7A 1FYTA 3FHAA 2DWDA 3UYPA 1S9WB 3S34H 5IVNA 4AT6B 2F8OA 3LV3B 4NQXA 2YZ1A 2OCFD 4IIQC 4TUJA 5CWSB 3CMOL 1J05B 4KUZL 4LCYB 1P4IH 3RWCB 1R3LA 2AEQH 2VKWA 3GB7B 4RIRA 4X6DB 1Q72L 4NJAH 3GBMH 2CDEA 5B21A 3MLUL 3BESR 5KVGH 1AHWC 2YMXL 4KJPC 3TCLB 2BSRB 3EDDA 2F74A 4NDMA 5DRWB 2BY2A 2GCYA 3KGRA 3FT2A 3QJFA 5EC2B 1LK2A 2DDQH 4JZOB 5L0QB 1HZHH 2ESVA 1J87A 3FQUA 4Q74A 5I17A 5JHLH 5EUOB 1AGCB 1CFSB 5TPWL 1TPXB 4KROB 1BQHG 8CGTA 3MV8E 2F58H 4KI5D 4M7LT 2MHAA 1VFAB 2G2RA 2YD9A 5J6HA 3I84A 5HJ3B 3GSRA 4AIZA 1OW0A 2LU7A 4MCZB 1QHOA 1CDGA 1MCOH 2GK0A 2OL3B 1UB5A 4XPGH 2HFGH 3U7WH 5EU4A 4KJYB 4L4VD 3GKWH 3A67H 4ZFZA 3QUMB 4UILH 3UZEA 4HEPG 4W70A 5T33L 1HH9B 5IVXB 1T0PB 2YK1L 1G0DA 3NZHL 5J7CC 4DZBB 1G7PB 4PTTB 1FZKB 1MNUH 2H6PB 5HVFB 4LRIC 1T66D 4F80A 5DYOB 4OLXL 1P7QB 2EIZA 4P2RD 3ZE1F 4R96B 2YD2A 3ZKMD 4OD1H 1C7TA 4QHLB 1VESA 3F58H 3VD7A 5ESQA 3ZKND 2DQJH 5BZWB 3LEVH 4GOSA 1RFDH 1M05B 1MF2L 4X0KB 5BRZA 4XMPL 3EJZC 4Y4HD 5DWUL 4DK6A 3L6FA 3CFJA 1S7TA 4M7JL 2P5WD 5F7MC 1NANH 5GRJL 4ONFH 1A9BB 3TF7C 1OAXL 5KVMC 4FXKB 4M93B 4Y19B 3DRQB 1IL1A 1HIMH 3QIBB 1WBXB 3TYFB 5GGUB 2X4PA 3ABZA 3KNBB 1F90L 2GKIA 3MLTB 3OGCB 2P24B 4X7EC 5I66A 1PZ5B 4XNZC 2C26A 1NLBH 1M71A 2FD6H 3T0EC 5KANG 5JNYA 3ZT5A 3NCYS 5L2KE 3HMWH 1CFTA 4V2CB 3A6CH 1LGVA 4NYLB 2R0KH 4PJ9D 1R3JA 5F1IB 1IGFL 1VA9A 4PRPD 1QEWA 1XEDA 1TIUA 2HA1A 3OAUH 4OSUH 5GSVB 5FUZH 5FHBH 2X89D 4EI5C 4HV8A 4G8GE 1JNHB 4JJ5A 2P45B 3WFDL 2VLJA 1FPTH 4JFHD 5EN2A 4FQXB 3T2NH 4QXGL 2CKNA 1LO0H 3PGDB 5EU6E 3DVNA 2ZUQC 4U1SA 1ZAGA 5TH2A 4KMTH 3K0WA 4LCCA 3O9WB 4UT6H 1I85A 2M2DA 3GMNA 3JTSA 3H9HB 1A7PH 3V7AG 1F4HA 1NFDB 4M43L 4ORZC 4BQBA 1RURL 3VG0L 7CGTA 1NBYA 2BHYA 4IDJH 2AS5M 5F3BB 2OXGA 2P5EB 4FTVA 2OQJA 3Q6FB 1RZIB 3U4AA 4E42B 1WZLA 1DQMH 3BJ91 1HHIB 3L3JB 5SWSB 2L7UA 4POZD 5KS9B 1T1YA 4WDIA 4MCYB 3PXHA 4FXLA 2PXYC 5DSCA 5JZ7C 1AC0A 2ARJQ 3O6LH 4WUUE 4NO3B 4Z0XA 3SE4C 5DJ8A 5HHOA 4UV4L 1W0VA 1FFNA 1BZ9B 4JB9L 4YIQB 5D1XD 1XGUB 5TF0A 1B0GA 1YMMB 3UZQA 5LKNA 4G6MH 5ESAB 4KRNA 3HMXH 3E2HB 4FNLH 3DARA 3F6IA 3O3DA 4XB7A 1UWGL 5IJVA 4DGVL 5C6WH 2Y07H 4KJQD 3VFNB 3EHBC 5E99H 3O6FD 1I9IH 4PY8I 2A2QT 4AM0B 2EIDA 4LSSH 2MTPA 4XVTL 5DC4B 3TFKC 3TBSB 2FCBA 5F3HB 4E9LA 2WBJB 3V0WH 2EE2A 1ETZA 1U8QA 2D9CA 1F11B 2X1QA 4PJEB 4OI7A 3RU8L 1IT9H 3TO4C 1DANU 5J3HC 2ADGA 2NPLX 1ODAA 2J8UF 4LLWB 4NWTL 1I8KA 3P9WB 3GO1H 2VAAA 1P1ZB 1Y18B 4JFXA 4YDKH 1I1YB 2EE3A 2ZCKL 4NRZA 1R5VB 4PJ8B 5FO7A 4XBGA 1L7TL 2D7MA 5CGYD 1T1XB 2W9DL 4HK3N 1D5ZB 1NL0H 1B90A 2ZSWB 4XXDA 3I3DA 1M7IA 5C0DA 3OB0H 2IADA 1J1OL 1I1AB 2W9EL 1QSFE 4CMHB 1CGXA 4NN5B 4WV1A 4RGNB 2NXZD 1HKFA 1HILA 4FFWD 3MMEA 4MVBD 1IMHC 4YXLH 4KK5D 2YPKB 1JYXA 1CT8B 2RIKA 3L3HA 5C0BB 3WUWG 2ATKB 3N9GH 5IT2H 5HDLA 5CKAA 4NKDA 3OAYH 4ODTL 3WFCH 2GUOB 1I7UA 3I75A 3CFKB 2XN9D 3RDTD 4XP1H 1JGVL 1Q1JH 1T21A 5D1ZC 2UWEE 2C1OB 3O8XA 4PV8B 4X7SH 3VXME 2ZOLB 3IU3A 2NTSP 1FFOB 1RIVL 4L3AA 4NQEE 4U2ZA 1BD2D 2NYYD 1GGYA 2EXYC 2OJZL 2ILLA 3NTCH 4Z7UA 1S7SA 5BZDB 1I7ZB 4NWUH 3KPRA 4MNQD 2X4TB 2VDPL 4CVZB 2OTUA 4DGYL 3LKOB 4MA3A 3LMJH 3QUXD 5JUEH 1XR8B 2VC2L 3IDGA 2ADFL 3SE9L 4P46B 5B3JF 5C0CA 1DBAH 3OR6B 3WBDA 2DYPB 2DB8A 2NY3D 2WUCH 2X1OA 1RK1B 5ETUA 1D7FA 1TZGL 4KTEH 2FWOA 2ICWJ 4YHYC 5JIKA 5CZVL 2GSIB 4GXVL 2EECA 4OD3H 2X4NB 4QOKB 3IRZA 1G9MC 3HG1B 3BO8B 5F9JA 1LQSR 4AQ1B 5E1AA 4L4TD 3VXTA 1ORQA 1CGSL 1LD9B 4HDIB 4RWYH 2H26B 4JO4H 4PJXF 5JXED 2J6EA 1FFQA 1L6XA 1FAIH 4PJAA 2DMKA 3JZ7A 3O3AA 3WFZA 4NQSA 3MLYH 3C8DA 1D5MA 1VGEL 3QUYC 3MRGB 3MOBL 1BIHA 4F37F 3DX7B 4YHKL 1DCLA 3VXOB 3GSQA 5L88H 4PJ7E 1EAJA 2X4UA 4UDUB 2A77L 5GRWA 1AC6A 1GGBH 5FM8A 2IH3B 3SDYH 1WITA 4NKIL 1YNLL 3C8KA 1DBKH 5J1SC 3V4PH 3VWKD 3D69A 3AFLA 4ZS6D 2COQA 4Y5VA 1DVFD 1NCBH 2CK2A 1FCGA 3F7RA 3ZYJA 3W81A 4G7VH 1IBGH 1R24B 1K4CA 4W6XB 4EDXB 3WFHB 2WBKA 4HUWA 2VDNH 1MFEH 4APQC 2ED8A 1C5DA 3CDGB 4JY6B 5I0ZA 4LVHC 4FABH 4PR5B 5ISZA 1FIEA 2JJSC 4EJ1C 3PHQB 5J56B 4YR6A 2W1NA 1BJ8A 4P59H 1SY6L 4OZIE 5CCKH 2ZSVA 3SGDH 4XMKH 5C0GB 4IOIB 5EZLB 1R5WB 1S3KH 1CLYH 1AGDB 3NGBB 1JCKA 3P4MB 1NEUA 1U95A 3EGSA 4Y2OA 1TCMA 4GMTH 4JG1H 3T3PF 3TM6A 2HT3D 1OAQL 3B9KB 4H88H 4ODVL 3FL7A 3UJIL 3H9SD 4L9DA 3KR3H 5CD3A 2VITA 5EPMA 1UXSA 4XCFH 4Z7QE 1FZJB 3PGFL 4U3HA 4H0IA 2H32H 2CIIA 2HJFA 3KAAA 1KJVA 1CU4H 1OT2A 5IKCB 2F54B 5DJZB 1I9EA 2AEPL 1LE9B 2Y06L 3CH8A 5ALBH 4JM2C 4ELMB 2QQLH 4JKLA 5LGKA 2HT2C 4BSWA 3MXVL 3T2QA 4XNUH 3N06B 2IPTL 4OGYH 5FDWA 3BH8A 5BVPL 2GTWB 5DD6A 1TCRA 1PGRB 3ARFC 4ONOA 1MJJB 5HYJB 3MFGB 3CUPA 3PJSA 3RVWC 4AMKH 1U8KB 3LZFL 4QF1B 4ZXBB 2QQNL 3HNVL 1C08B 5F8RC 1IC5L 4D2NA 1CE1L 4LOUD 1GAFH 1EHLH 3MPCA 1BJ1H 1AP2A 4I0PA 2JIXB 2GFBB 3HCVB 4UU9A 2HLAB 1FL5A 3SGKC 3I2CH 2NW2B 3RGVC 3AS0A 4O9HL 3A6BH 1RHHB 5DJ0B 4ETQB 4GAFB 3ESUF 2EE6A 1UA6H 4XAWL 3LRHA 1HWHB 3CSBA 3QEHA 4YHZL 2EYRA 1W72B 3HE6D 3QDAA 1DDHA 2C7UA 3ORJA 1JPFA 3OX8A 5IK3A 4GG6E 3EOYG 1MFDH 3HPLA 3PV7A 5EO1B 4P4RA 4HPOH 5EZJA 1KPVA 2R1XA 5IGXH 4LLVB 5E4EB 1WEJH 4RRPG 3F62A 4K8RH 1OL0A 3QG7H 1IM9D 4PJIE 3DNKA 1F6FB 3IGAA 1JI2A 3P11H 1NEZB 4HFUH 1D9KB 3VMPA 1J8HA 4CDGC 5DMYA 2YD7A 4U6HA 4XNXL 3QG6A 3UYRH 4JFZL 1HHHA 5DVOA 3CZFB 3QIUC 4OZ4A 4J8RA 2NMSA 1T7WA 4M7ZB 5IW3A 4JDVA 4UIKL 3VD3A 2E9WA 2VWEC 1Y6MR 4PREA 4PJHF 3RTQA 4YDIH 5DFVD 1F3DJ 2AV1B 5K9KA 1MCRA 3U9PH 4L8SC 3EUUA 5A43C 1QBBA 4IMLB 2YSSA 3ZZ1A 4YAQA 2PN5A 3NPZB 1QSZA 2NY6B 1P9MA 3CLEH 5JO5A 3U1SL 4OLVL 5I16B 2JELH 1IEBB 1FGNH 1P5VA 4HBCH 4K2UH 3EIFA 1MJ7L 3FZUD 2D7NA 4C56D 4NQCA 3QXDB 5T3ZE 5I8CB 1U8LB 3WFEH 4I18B 4M6ML 5JOFB 3UX9B 3MGOA 3L3OB 4XP4L 4Y5YC 2RFXB 2ERJB 4FN0A 4M8QB 5IBTL 5I9QB 3L5WA 3KPQA 5CLWA 4N9GB 3HAEB 3VWJD 4OTXH 4K3DH 1ZEAL 4U1JA 3OHXA 3DUUA 1QG3A 1KT2A 2BHZA 2NNAA 4RGOL 4P2YA 3TA3A 4GAGL 1FH5H 1KELH 1RIUH 2OZ4H 3HLAB 1G7QB 4U6YA 5A2LH 1NCAL 1NCTA 4RMSA 2MCPL 4GT7A 1CG9B 2H9GB 3ILPA 2PNDA 4UDTA 2RGSA 5J11C 2I9TB 5HY9B 3C5JA 1AGEB 3VXNA 5E6YA 1PSKL 1UKTA 1IKFL 2BRQA 2R29L 4GKZA 5K59E 5AWNH 1TJGL 3MNVB 3MV9B 2VWEE 3DGGB 3I6GB 1CICB 3W0WA 2Z92B 3BEVA 4XPFH 1I9RL 4EXPX 3BPCB 4NT6A 2LTQC 1Q94B 5C09E 2C3VA 25C8H 5AZEH 4HFWA 1MJUH 3MBXH 1P7HL 1JNLL 4O2FB 4F15C 1NCCH 4TSBH 3X14B 3JWOL 2DI7A 2ZUTA 1T5WA 3BT2H 4YPJA 1ERNA 5K9OA 3KXFE 5D7JC 1OSZA 3MJ6A 3VI3F 3U6RA 4Q9BA 2VH5H 2AK4B 1O7VA 3B5TA 4HXBH 3RVTC 4S1DD 5L9DH 4GMSH 3K3QA 1U92B 3L1OL 4P23C 5F72S 4A6YA 3CDYA 3R8QA 3SDCB 4PRAA 1S9YB 5DLML 4CNIB 1CK0L 1B0WA 1NC2B 4URTB 1IAKB 4WUKH 4GBXB 2AJSH 1H0DB 4R3SA 2YN3A 1EEQA 1FNEA 1IARB 3DMMD 5E6ZA 2P42B 1KF9B 3RUGF 4JRWA 2QV2A 3IDIA 1MCIA 3S5LG 4P3CL 5I1DB 1U8PA 2AQ2A 4PJGE 4Y16C 1SY6A 2ICWI 3RAJH 1TTGA 3EO9H 4BJLA 3S4SG 4NSKA 2YUZA 1FLRL 5GZNC 3BVNA 4PRBB 1H8NA 3RHWF 4PRHD 3VGFA 4AIOA 1ZANL 2BVQB 4U6VL 3RZCC 4PRDA 1Y0LA 2I60L 4YE4H 1AGFA 1BVLB 5DO2C 2VZVA 1CDIA 1VFBA 5I18H 4OIIH 2ZUSA 2IPKB 3QIWD 5GJSH 1RUAH 4WO4D 5T1LD 2XWBB 4JN2B 4QRPD 3B2VH 3ZE0F 1FVDB 4OQ1A 4KRPD 2DQFB 4FFVD 2HLFD 1T1WA 4PRID 2EICA 3MJGX 4Q7DA 1MFAH 4XCYA 3OPZL 1SBBA 1AXSB 5I1JL 4RX4D 4LLMB 3WN5C 3KG5A 1QO3A 5TQ0H 4JM2F 5KW9L 4XTRC 4YBQD 1G6RL 3JVGC 3QFJB 3QFDB 2D7OA 1MI5B 3BYYA 4R8WL 1QRNB 1CDYA 5E5MA 1S8DB 4PB0L 4OZFH 3C5ZB 2AXFA 5IFJA 2N4IA 5EOTA 3W5MA 3ZYIA 3DHJA 3ILQC 4ZNEA 2Y6SC 3PIQB 4LVOC 1FZOA 2A6JA 3FT4A 2B5IC 8FABB 5FKAB 4EIZC 1NAMH 2VDMH 3QDGB 3LIZL 1TXKA 5HGGS 5HHMD 1A7NH 2NY4D 1QNZH 1WBZA 4CN6A 4JZNB 5E7BA 5A3ID 4JY4A 3BE1L 1N6QH 4K3GA 1QFWM 4PP1D 5CEZE 3BD5A 2NX5B 3H3PL 2PTTA 2BOBB 3WNMA 1F4XH 1K2DB 5F9DC 3UTTA 1XZ0B 1TETH 4G9FD 4G8IA 4JZJC 2DOCA 4G8GA 1YJDH 1YEEH 3S36H 3VXUB 5EU6A 4MNHA 3VFUB 4LSVH 2CJUL 5DURB 4LSPL 4KV5E 1A6AA 5T5FL 3UEZA 4CADB 4IRSA 1GHFH 4X5WB 1AQKH 2OR9H 4PS4H 5MI0C 3CDCA 2APBA 4G8FB 4DCQB 2ICEB 3F7PC 1RZ7L 5C07D 1LNUA 3SY0A 4LPUA 3MRFB 2ITDA 5FYKU 4ZFGH 4LQFL 1C16B 4WWKD 3ARGA 3TT1L 1CD8A 2HYMA 4J12A 4Y2DC 4F57L 3T77A 2HMID 1KSRA 2HT4D 4NCC1 1PQZB 3TH2T 1D5IH 4K8RD 5IB4B 3SDXA 3WHE1 2XXMB 5DRXB 4D9QE 1RZKH 1OTUD 3G04B 3LN5A 2NTFB 2Q1EA 5E24E 4U33A 3E1F1 5ACLA 3MJ9L 1MRDL 1JWMA 5IF0A 2VXSL 3ULSB 2DLHA 3OKDA 4E41E 5HYSB 1SJEB 3WJJC 3ARDB 4U0QB 1E28B 1YQ2A 3ROOA 5D7KE 4ZUUA 4BKLA 3P4OB 3THML 1I7RA 1ZGLB 1WQVT 2PYEB 3DURB 5HPMB 1BZ7B 2VXUH 2HKFH 3ZKQD 4DVBA 3IFOA 3S4SB 5C2BH 4PG9A 2YC1A 1A64A 5J13C 5CHNB 1ZLUK 5JDSB 1UM4L 2HVJA 3FFCB 4H1LH 1T1ZB 2IANE 5I73B 2H8PA 1G7IA 2R69L 3CFDA 2FL5A 5MENB 1PLGH 3GJFH 3FO9A 5CILH 2CKBL 2YD1A 2GW5A 2XFXB 3P9LA 3PABB 4U1KB 4ZO8A 2EYTA 2V5MA 4P2QE 3KPSE 3WHXB 4PJBA 1U3JA 1U8IA 5HGAA 4GRWF 2OI9C 1J0KA 2ZCLH 3OB8A 5DD1L 4R26H 1FQ9C 1KUMA 4J6RH 5ITFB 4N8PA 2APWA 2PF6A 4RAHA 4YDVB 3MRCB 1N26A 5IB2B 1WICA 1WIPA 4GS7C 1QSFA 3TN0D 1MCPH 1Q0XH 5H2BA 1FDLH 5HGBA 3UTSD 5B39G 3U82B 4XRCA 5HYIA 3C8HA 1BQSA 1CR9L 4CDHA 1KB5L 5F7DB 3H8NA 2X10A 3VGAC 3FQWA 1JL8A 1TJIL 1I3GL 3PNWB 3KYMA 1OPGH 3EFFB 3WD5L 3MA7A 1NGYA 2A73A 3QHFH 1YDPB 1EO8L 4OM0L 3F5WA 2FDBP 4ZSOE 1EFXA 5L2JB 3VI4E 5GS1A 4R0LA 3VXMA 4HH9B 5E8PB 43C9A 5L7XL 4NQEA 5D7SH 1HSAA 1N4XL 2AERT 4FS0A 3FQTB 4LK4A 4MQ7B 3RKPA 1FYTB 2FB4L 3OXRA 4BQCA 2DWDB 2XY1A 5EO0A 5KSAD 5D7IB 3AB0C 5E6IB 4YK4C 1WFNA 1JZ5A 4LCWD 4MZ2A 1XGRA 1LE5B 1DBJL 3SKJH 3OKNB 1MHCA 2YUVA 3PL6D 3QDMB 3ULVC 1EUTA 5B38A 3PHOB 4JPIA 4RIRB 4P4KB 4U0RC 4RFNB 4BFIA 4XI5C 3DWTA 4V1DE 3DXAE 2FBJH 4BK4A 2CR3A 4RMUA 3O9WD 1JUFB 1WISA 4PYGA 2VISA 1X5FA 3HRPA 4IRJC 5KVDH 5JIIA 3QXWA 4U7MA 2GCYB 5EUKA 4Z18A 5CEYB 3FT2B 3OKOA 4Z7UF 1F8TH 5AUMA 4K94H 5KVEH 2ESVB 4FMKA 5MEOA 1FORL 3MOAL 1JV5A 3UTOA 3MYJB 3QEQB 2LU3A 2IAMC 4WI7A 5T1MA 1KB9K 1Z9MA 5ELIA 4ZYKA 4LCIL 5DRZB 2X70B 4PJ7A 5JW5A 1J88A 2YEZA 1HOCA 5SWSD 4AIZB 1KCUL 4EN3B 3VD9A 1G6RA 2EYSA 3OJVC 4LAJH 4PLKC 4BSVB 3QDJE 4WI2A 2IG2L 1BOGA 2DBLH 1HXMA 1RY7B 2NCMA 1I3VA 3QNYA 3GMOB 5DEFA 5C3TA 5I8OL 4NQTA 1VGKB 3TIEA 1VB9A 2FH8A 3MCLL 3NABL 5BQ7B 1Q0YH 1C5CH 2A9NL 2HJKA 3TLRA 2GEEA 4H5SA 4OZHB 3F7VA 1BFSA 5C3LD 4JKWA 2YN5A 3BQUB 3N85H 4MJ6A 35C8L 2B1AL 4LKXA 4QRRB 1FE8L 3P30L 4LU5H 4MSWA 1J9CT 2P4AB 4S1QH 2V2WA 1Q9OA 1JYWA 3B9AA 3O0RH 1AD9B 4JFFE 4OZIA 3ZSTA 1ADQH 2C3XA 1KCVL 1Z9LA 5ESQB 4KVNL 4YC2B 1GGCL 3C9NA 5B8CC 5I1HH 4JKPL 4PV9A 1LO5B 4QT5A 5ECJE 5E94A 4LHUD 4P2OC 4LSTL 4MWFB 4GW1A 3NFPA 2V5SA 4XPBL 4YHLL 3B5GA 1JGUH 1S5IH 1KYOK 1GZPB 3C2AH 1OGAD 3RZWA 1L0YA 3QQ3B 5CMAA 1KCLA 4KK9D 5F1OB 1MHPL 4FQLH 3HB3D 1ZKAA 4XMLH 4OCSL 4YXKH 1RZ8B 1T04A 3SKUD 1OD7A 5B39B 1YY9C 3QWQB 3TYGH 3EYUH 2Y5TB 4LSUH 1CFTB 5I1LA 5F9AC 1A7RH 2M26A 1FHGA 5IMOB 1BREA 4HIXL 1R3JB 5CIPB 1RZGA 4NQDB 4O51B 3TBYA 4XC3H 2W60B 5D5MA 2DWEB 1QEWB 1HQ4A 3WIHA 3L3DB 1YEJL 3MJ9A 3P0GB 4HWBA 5DJAA 1YEIL 2BCKA 3OJDA 5I2IB 1AJ7H 1AKJD 1MRCL 5CD5D 4JJ5B 3BIKA 1BLNB 2DIJA 5J6GB 2NXYD 2VLJB 1LO2L 5HDBE 4GKNA 2OP4H 3LEYH 5BS0B 2EDFA 3EYOB 3AXLB 1A0QH 2O5XL 2AXGA 2NY5H 4NO0B 3AMKA 4LCCB 3NFNA 4GG6A 5HI3C 5CEZL 4MXWL 3HI1A 1U3ZA 4PJDE 1S7QA 1ACYH 5IW1A 2Q20A 5ICYA 2VDOH 3BAEH 3MV7A 1ND0A 3LQZA 3H9ZA 1YC8A 4MS8C 3MRQA 3C6LB 4XBEL 1KCSL 4HS6B 5D1QB 3CVIH 2DQHH 3G6AA 2BNRA 1BM3L 2CKBA 1U3HA 4OZFG 5C0FA 1FBIH 4ZS7L 5FYJE 5I1GH 1BFOA 3QJHA 4R7NB 3X11A 1T1YB 3QNXB 3FRUA 1EUUA 1H5BA 1KJMA 3IFPB 4MAYA 4LHUG 5DJ2A 5AAMA 3QWRD 3GNML 2IBZY 4NNXB 1C5BH 5LQBL 3RWHB 2R1WB 2PW2A 1IGMH 1N59A 5HHOB 1D3CA 1NCDL 3DROA 4GG8A 1WWCA 1U41A 3EDJA 1B0GB 4S10A 1U58A 2B4CC 1MQ8A 3O6MH 2YXMA 4KDWA 12E8H 2WM0A 4I3SL 3CXDH 4TVPH 1KB5A 1G1CA 2J4WH 1GC1C 5IFHL 4MLSA 3JUYA 2A0LC 2CLZB 1IM3A 5JQHC 3RVVD 5IESH 5EUOE 2CK0H 1MCQA 2EEBA 5CBAA 3HE7D 3OKMA 1K5NA 1I8LC 1A14L 4XAKD 4TRPH 1A3QA 3I02B 2YR3A 3I3BA 4MD5A 3HS0A 2ADGB 1IGJB 1DQDH 2XTJC 4WFHD 5EOQL 1T2QL 3BKYH 3SDAB 4NO2A 3UAJD 3B8YA 4K07A 3WEXA 4W68A 5MP6H 1KG0A 3LHPL 3ETBF 4G42A 5FO7B 2HVKA 3QCVL 4BH7A 5A16B 5IVXE 1SYVA 4JY5L 1PY9A 2GYSA 2X5PA 5I8KH 3B9KD 4HKZA 1IAOB 1QFWL 4X6CA 5GSRB 2IADB 2Y7QA 1BF8A 1WWBX 1AI1H 1YYLL 5DT1H 4N0UE 5DK2A 1UVQA 1JHTA 1C12A 2J8HA 3ZDZE 1UM5L 3IVKA 3MMEB 1B0RB 2E27H 4RMTA 4JHWL 3KJ4B 1HEZB 4UUJA 3L3HB 3TWCL 3GSWA 3B9EA 4ZAKA 4BQ6A 2YKLL 1V7ML 3NFSL 1XF2A 1FP5A 1S7VB 1NJ9A 1F6LL 5C09A 3V5DA 1TJHH 3SDDA 3HUJE 2EDJA 2BNQB 3ZHLA 5DD0L 3MLXL 4X8JA 3I6KA 1JYNA 4QCIA 2NZ9D 5HYJD 3KVQA 4ENEC 3MBEA 4NZRH 1CFNB 3IU3B 3G6DL 2Q86A 3LEXA 3KXFA 5D2LE 4NGHH 2EDLA 2CLVB 1S7SB 5I1KH 1GYAA 2DLIA 2BERA 1TQCC 3QAZC 2I27N 3WMSA 4UNTA 4LDOB 4RAVA 3H3KA 5DS8B 4QRTB 1P69B 5C0CB 5FO8A 4DKAA 1CZ8H 4QXUH 4Y7MA 4OZGF 3FKUS 3HZMB 1I7TA 5F7LB 4U6TA 2FWOB 3L9RB 2PYFA 3H7LA 5DI8A 5H94B 1SEBA 3IDYC 4X6BA 1FC1A 3OF6D 1QOKA 3SO5A 2KPNA 3K8LA 5ITBL 3KHQA 4KFZC 3VXTB 3QA3B 3E6FA 4PJGA 3K2UL 1ORQB 2ARWA 2PCPA 3TO2B 3PWPD 3O11A 4OF7A 3FAWA 2BHUA 4GAYB 4K3EL 4OAWA 4AYFA 1EGJH 3D39B 4PJAB 4WTXA 3ULUE 3DGCR 4HGMA 4NQSB 4WI6A 43CAB 2YHGA 1UJ3A 2HAZA 3GJEA 4PPTA 1D9KD 3HNSL 4M6AA 3WNPA 2KZ1B 4HUUA 3X12A 3HR5B 3MJ8A 3TH4T 3WS6C 3BKMH 4XT1C 3OKLB 4HF5H 1YUHA 3QI9C 4JAMB 1XIWA 3HKFA 1FO0L 1BMGA 1MVUB 4G80A 4ZUSA 3D69B 4OD2A 3P2TA 3RIAK 4Y5VB 1W0WA 1NFDE 5D7JA 2JJTA 2ZNXA 2XWJA 4PTUA 1IC4H 1KCRL 3PWVA 3MLPA 2VXVH 2P5EE 5D70H 4ZFFA 3B83A 3V8OA 1ZMYA 4HZLA 2WINA 3DIFA 1P4BH 4R97B 4PJFA 1TVBA 3VJ6B 2WIMA 4H25B 5T5NF 5IWLA 4HIJA 2IGFH 2J5LB 3LS5L 4QHKJ 5HDQH 3T4AA 2Q3ZA 4GKSB 5BO1H 4XNYL 4D9RE 5TF1L 4OJFL 3V4VH 5F7FA 3PQYA 2PW1A 3EGSB 4Y16A 4P5TA 1YMME 1YNTB 1M7DA 3LQAH 3TNNA 2G60L 4Y8DC 1N5YL 1EAPB 2VITB 1UXSB 5EPMB 1GGIH 5ICXA 5DJCA 5C0AD 1UZ8B 3C60D 2CIIB 4J7RA 2HJFB 1KIQB 3S35X 3D85A 4X9IA 4WEBL 1JFQL 3SE8L 2QEJA 4FQHA 1WLHA 5E4IA 3WLBA 5CJBA 4RISL 2F53A 4KI5C 2FYYB 2HFEA 3T0DA 3OB0K 4HWZB 5GHWL 4PJEE 2EE9A 1G9MH 5FYKL 4CUCA 3GHBL 1T80A 2QJDA 2R23B 3CUPB 2QTEA 3QNZA 4YDJB 1B2WL 1FLTX 1OQOA 1KTKE 1DSFL 3AROA 2MCG1 3O4LE 3X3GL 3OAYK 2APXA 1OB1B 1GSMA 4CL7A 4I0PB 4HKXA 3B9VA 1MCHA 3SJVA 2EO9A 4Y1AE 1HNFA 5JPMB 1EJOH 5ACMA 4G9DA 5HI5D 1T66C 3FB8A 5M7QA 4AEIH 4FQIH 3QEHB 2EYRB 4Y5XC 1RULL 5F1SA 5F7YC 4QNPF 3ZKMC 1GIGH 2Z91A 1JPFB 5IK3B 1U93B 3DVGA 1MHHB 2DMBA 1JZ6A 3ZKNC 2XICA 5K9QG 1PG7H 3R06A 3NIFE 2UZIH 2V2XA 5E9DB 4OLZL 4LF3B 5EZJB 5BV7C 1KPVB 1UXWA 5JIHA 2R1XB 4JRXA 4Y4HC 4KQ3L 5HHVH 2FX9L 1VPOH 3LKQA 4U1MB 4E41A 2F15A 3F8UB 3TZVB 3MA9H 2AKRB 4G7YL 1YEGL 3LVEA 3JTTA 5M94B 3K74B 4M02A 5EO9B 4P9HC 3L95A 1A4JA 4KI5E 4XHJD 4KVCH 1J8HB 3GHEH 5FGBA 5I76A 5E2VL 4WI8A 1HHHB 3SDXF 4ZUVB 1C1EH 3HHRB 4N8VG 3B5HA 4J8RB 4OKVA 4TVPD 1BQUA 4DTGL 2WBWB 3HPJA 4JDZB 1CFQA 4LPVA 2XWTA 2KDGA 2R0LH 4DAGH 4PREB 4DQOH 3RI5F 5AD0A 5GIRA 1HXYA 3NN8B 4LARL 3GI8H 5K9KB 3TT3L 1S7RB 3IFNH 3QQNA 4PJ9C 1RMFL 2WLZA 1DUZA 5FYJL 4WY7L 4P2QA 1G9EA 4JFOB 2JCCF 5KN5B 4Y2DA 1VKXB 3V7AE 3WE6A 1M1SA 1PVHA 3AAZA 3KLHD 4JFEB 4HCRL 1ZT1B 1UH4A 3S37H 1A7OH 1X5LA 1U8NB 3FTGA 4MZ3A 4O02L 2PO6A 4UV7L 4NZUH 4YEFA 1ZA6A 3QFJD 1W2KT 3U30B 1D6EA 2IQ9H 1BIIB 3EDKA 5C1MB 2P7TA 4TOYH 1S5HB 4XX1G 3L7EB 3C5ZD 1QSVA 2JJUA 5EU5B 3WXWL 2VMFA 5J9PB 1B4JL 2P5WE 7FABH 1LEIA 4NFBA 3UPAA 4PJ5D 3P77B 5JHDE 3CX5J 1A3LH 4PJBF 2AI0L 4UQ3A 1MIEL 5F7WC 4X9GA 4DK3A 4U6YB 3KPLA 2ICWA 1JRHL 4ZSOA 1UEYA 2F8XC 4JO2L 2LVCA 1TZHA 2FIKB 3ARBA 1EHAA 2EDYA 4JPWL 5DMIH 3C5JB 2OL3L 3TVMD 3VXNB 4POZC 4I77H 1S9VB 4J3SA 3GK8H 1GH7A 5CJQL 5IV2A 1TMCB 3NBNA 4S1SL 2R0ZL 4GRLD 3PDGA 1HINH 3U4BL 3U4EA 4CVXA 3QUML 3QSKB 1DQJA 3PWLA 3BEVB 4L9LA 4NT6B 1ZA3A 1FZMA 4OCRL 2JE8A 1LO3L 2R0WL 1IFHH 4G3YH 4P3DB 3CMGA 4PRPE 3TJEH 3BGFC 4HFWB 3CVHB 5D1XC 1NGQL 4YFDB 2A38A 2DLFH 4HUVB 3DXAA 1UYWH 3F7YB 1T5WB 1L7IL 3UPRA 4YQXL 5GS2D 3BIAX 3H3BC 4ZOAA 4YGAB 1NDGA 3FOMA 4JFHE 4M8VA 4KJQC 4X99A 1SJXA 3O6FC 4WI3A 4XCCL 3B3IA 1FO0A 4OF3A 2VAJA 5EOCH 4ELME 4C54A 4U1LA 4MJ5A 5ICZB 1JHKH 2VIRB 5GGSA 3TPUB 1UADC 3MV8B 1GC1L 2MOVA 5D8JH 1FNEB 3GMPA 4KZEH 5AZ2L 4TYUA 1QFUL 3RVXD 1OAKH 1R0AH 2YPVH 3VA2C 5JA8B 3U7AA 1F4YH 2NR6D 3E0GA 5LBSH 3V5HB 4Y4FA 1XCQB 1HE7A 2HRPH 1BJ1J 4GXUM 5DQDL 4FQPA 4OFKA 2K3TA 2AK1H 2O5YH 1YEDA 3NZ8A 5KSBB 4KKCD 2A9MH 5HGHA 2NXZC 1QACA 1AGFB 1NMAH 4OM1L 2Q87A 4FFWC 5D6DA 4MVBC 4KK5C 2IH1B 2VXTL 1F42A 1XGQB 4PJ7F 4O2EA 3LRGA 5EA0L 4JFFA 2N56A 2IEPA 2X4QB 3CU7A 3RDTC 4N8VB 1AHWB 4XP6L 4ELKA 3ULUL 1CLZH 4M5ZH 4GRWH 2JB6A 3P0VH 3SGEH 4I2XB 1WT5C 5EULV 1P53A 3VFPA 2A6DA 2NYYC 1ZHBA 5TDNA 3GDBA 3OQ3B 1A6PA 3MUGB 4OLWH 5F88A 1JPST 1CVRA 5I15H 3GGWB 3VRJB 3RWGB 3QUXC 1EMTH 4K7FB 4M4RA 5JXAH 2ED7A 4H8WH 5GISL 2YBRA 3VRIA 4Z5RB 2YPLD 2NY3C 5H37H 4JFDD 1FZOB 2B8OT 3FT4B 5E00A 3MLSL 3K80A 4QHKI 5FHAH 3IXAB 1FN4A 3D2UA 1UFUA 4XCNA 4YHML 2ATPA 2YXFA 3QPQD 3CMOH 5L2KB 1XGTA 5GRVL 1OF2A 5J89A 3UMTA 5JXEC 4JY4B 3K8KA 1B4RA 2V9RA 1IGTA 1EIBA 1DL7H 1QD0A 3P0YH 3NCBB 5DD5L 2PTTB 3MLUH 4S1RL 3NAAL 5FDYA 2UVEA 2CIKA 1RUKH 4ZO7A 1J0ZA 2FH6A 3MC0A 3MLWL 4TULH 1F6AA 4BZ2L 5DHVA 2FJFB 3IF1B 4DN4L 3V7MA 5DDHB 3D0VA 5EU6B 5IMKA 2XN9E 3WL9A 1YNKL 5DZNA 4J1UA 1A6AB 32C2A 3OGOE 4GUPA 3VWKC 1R3IL 2BOCB 4ZS6C 4PG2C 1DVFC 1BD2E 1KFAH 4Q6IA 1CTOA 5D5MF 1LK3H 5CJXA 5CJ5A 1LNUB 3SY0B 4HPYH 2DTSA 5C70A 1EX0A 4FQ1H 5E95B 5BOPA 1PW3A 1GCFA 2VDQL 4XVJL 2R4RL 2BMKA 4XPHH 5T33H 4WGWB 3T77B 3QUKA 4NN6C 1FNSH 4AT6A 3T1WA 3LV3A 3ARVA 1ROWA 2YK1H 4WHDA 4XNZB 3KJ6H 3LN5B 4HIIA 3IXTA 3VXRE 5D9SB 5LVEA 4LCYA 4L4TE 4WUUB 3RWCA 2HT3C 4XBPB 3LKSB 1JGLH 1T0MB 2AJXL 2W92A 2Z8VC 2J6EH 5IJKC 3AM8C 4Q2ZA 2HG5B 2BSRA 3LD8C 4UBDD 3DSFL 3DO3A 4EI5B 1INDL 5DRWA 3VH8A 4UT7L 3MJ7A 4BQ9A 4XMPH 4PIRF 5EC2A 5DWUH 2D4FA 4JZOA 4TQEL 5I75C 1E4XH 5GRJH 3CFCH 3EDFA 4PG9B 2EH7L 1A1NB 2ZUQB 5E8NB 5EUOA 4CU6A 5IIEA 4N0YL 2AABL 1RZFL 4K71C 2WWKT 1RUMH 5DK0B 1VFAA 2B0SL 2KKQA 1MWAH 4LSRL 2FL5B 4MCZA 1UCTA 4JVPA 3FO9B 1F90H 2OL3A 4ORGB 5GS0H 3P9LB 4G6FB 4AG4L 4JQIL 4LOUC 2EYTB 4B7IA 4KJYA 1AE6L 1N64L 4HLJA 2EDDA 4M48L 3QUMA 1U8IB 5HGAB 5DQ9B 2VO5A 3IDMB 5E2TL 1HH9A 5IVXA 1W8NA 4WFEE 5BRZD 2DS4A 1MCCA 1G7PA 1FZKA 1QVOB 2BSED 3BUYB 1QSFB 3HE6C 4EOWL 2PXYB 5HGBB 4N0UA 5KTEL 1EBAA 5DYOA 1QQDB 5IW6B 3VXPA 1P7QA 1XF1A 4JPVH 2PR4L 1LP9E 1RVFH 3WFDH 4PUBH 1DFBL 2W0FB 4R96A 3H9SE 2MJWA 2XZCH 1HKLL 1VFOA 2ADIA 1BBDL 1IZJA 3DV6B 3MA7B 5BZWA 2A73B 4NJ9H 4X0KA 3UO1L 3F5WB 3B8SA 2UWEB 1EFXB 4RWHA 5GS1B 3BMVA 1MELA 4I3RH 2A83A 4I9WD 2Y72A 5IHLB 4X6CF 1NUGA 2P1YA 4FXKA 5D2LA 3DRQA 4M43H 4P2CG 1RURH 4NUGH 1QRNE 3VG0H 1CTNA 4G6AD 2V6HA 3QIBA 1WBXA 3TYFA 5GGUA 2X44D 2CRIA 2P8PB 5FGCE 1KTDA 2P24A 1CL7H 4AIXA 1H3VA 5CBEB 2DLTA 2VLJD 1PZ5A 1MFBH 1ZGLM 3DV4A 3AY4A 3GMLB 5DFVC 3ZTJH 5B38B 3GIVB 1J10A 3OJMB 4PJHB 4BFIB 1BWMA 4V2BA 3LPGA 4JO3H 4DKDC 4NQUA 1Z5LA 1KN4L 5F1IA 1KIPB 4LVNC 4KHTL 1MH5B 3ZSSA 2JLLA 3FZUC 5GSVA 4JB9H 1NMBH 2N7BA 3T0WA 3OKOB 4N1EA 4G8EB 5D72L 5AUMB 4D9LL 4MJ2A 3D3VB 1OT1A 1F3RB 1JNHA 3RX8A 4DUXA 4NQVB 1KJ2L 4FTVD 4JVUA 4M1DL 2FRGP 5CSBA 4FQXA 2N1KA 3PGDA 1CFVH 5T1MB 1FSKC 2MNUA 3VWJC 5JW5B 4DUWA 1OCWL 3QEUA 3SKNA 3CC5A 4KKLD 4S11A 3BSZL 1SBSL 5D1ZB 1KV3A 3H9HA 3PGCB 1JGEB 1NUFA 1NFDA 5CZXD 5FIEA 3KYKH 4PGZA 4MB3A 2XQBL 5F3BA 2P5EA 1YEFL 2A1WH 3HC3L 4H5SB 1CXHA 4BZ1H 3Q6FA 4C58B 4E42A 1L7TH 4HG4J 1UEMA 5DJDA 4LKXB 1HHIA 1ZHKB 3RY6C 3VRLF 4MSWB 3NIGF 2VLKD 4H0GA 4EDWL 4MCYA 1J18A 1J1OH 4FG6D 5JIPA 4R7DA 2XOTA 4OZIB 4YHYB 4LP5A 1BEYL 1V7NL 4GXUN 1UQSB 3DO7A 3S35L 1CN4A 1BQHA 3NOIA 1B3JA 3O6KH 4XVSH 2NY7L 4IM8A 1OTTD 2KQMA 2XV6B 4C56E 5JDJA 2CDGA 1YMMA 2J2ZA 4ODTH 5ESAA 1ZLSL 1FIGL 3GJFK 3BP7B 2CLRB 3MROB 4QT5B 3EYVB 2QL1A 4GW1B 4XXCA 3NFPB 1JGVH 2PYEE 3QUYB 2DJ4A 4OB5H 4S1DC 1KLGB 3VFNA 4PJFF 4HD9A 4W6YB 3TBSA 5F3HA 2WBJA 4K23L 4UINL 1T03L 3DMMC 1IGYB 1NSNH 4PJEA 4B50A 2F9BT 4IRZL 3MV11 2XG5A 1EA9C 2VDPH 5E1HB 2FX8L 1HHJB 3SOBL 3CXHK 2ORBL 2R2HA 3SE9H 2ADFH 5AEAA 5I1LB 1OVZA 2AJYH 3RPIA 3EJYD 1P1ZA 3VGDA 4TUOA 5A2JH 1WIOA 1F5WA 1JZ7A 4APQB 4WFGE 4PJ8A 3RRQA 4EVNB 4R2GD 1NKRA 4LVHB 3V5KB 3WV0A 2X4RA 1D5ZA 1N0XH 2ZSWA 4JGMA 4Y1AA 3O8XD 4PLNC 1CGSH 1JE6A 1V3LA 3EFDL 1I1AA 3ARZA 2C4XA 2IF7A 2ZPKL 5IEHA 3QIWC 4WO4C 4X4MA 2MQ0A 3UXFA 4KZDL 3KPRD 1CT8A 4Q97A 3MLVH 3MOBH 5C0BA 1SHMA 1I9JL 4GG6B 5DUMH 1G7LB 2Q8BL 4KRPC 4FFVC 2YRPA 2HLFC 2GUOA 1S7QB 4NKOB 3TC9A 4JHBA 4MNGB 1CIDA 2V5RA 4BFEA 4Z7WF 4NKIH 4ONHB 2C1OA 2VZTA 5IOPB 5GGRB 2XYCA 2UVFA 2ZOLA 4PJIB 4YBQC 1FFOA 3RWDB 3G6AB 1U42A 4D3CL 2Q8AL 1U3HB 4A6YH 2FBOJ 4YWGL 1G84A 1I7ZA 5FAAA 1JBJA 3BD3A 4CVZA 1P4IL 3LKOA 5FF6B 4C59B 4AH2B 1KJMB 1XR8A 3QULB 4MAYB 5DJ2B 5GGQH 3ARFB 4P46A 5DEZA 3X13B 5CLTA 5KVGL 2DYPA 3OG6B 4MHHI 5J4MA 1B6DA 1RK1A 2PW2B 2NY4C 3GFUA 1CFBA 3LN4B 4O5LL 5A3IC 2XIDA 4ZTOH 2NY2D 2X4NA 3GSXB 4JPKH 3HG1A 4PRHE 1PKQE 4PP1C 4O00A 4NC2B 1EEZB 4KDTA 4KGLA 2YWZA 4F8QA 1HZHL 2ED9A 4HDIA 1RZJH 1KB5B 4PFEA 3RGVB 3DUSA 5GS0D 1OAQH 3UJIH 1FGVH 1IM3B 2GHWB 3MRGA 5CBAB 3CX2A 1HSBA 1MSPA 3QEQE 3OKMB 4QRPE 2EDTA 3DX7A 4XPGL 2AEPH 2Q6WA 3U7WL 5ISZD 3ZDYF 4MD5B 4UDUA 3GKWL 2VDRH 3A67L 4QXTA 2IH3A 2X9WA 3FMGH 2P5WA 1N3NB 1KG0B 5JHDA 4BH7B 2HVKB 4PGJA 4WU5A 1MNUL 1ZTXH 4WWKC 4EDXA 3WFHA 4HSQA 4F7EB 5J57B 1JPTH 3N50A 3LZFH 4HKZB 1JGDB 3HNVH 4ZUWA 2VQTA 1IC5H 3CDGA 4UNUA 1CE1H 3REVA 2ADJB 2HMIC 2HT4C 4GFTB 4K8RC 3QIUB 2NY1D 1YY8B 5D93C 3V52H 1B9ZA 4OD1L 1C12B 3IVKB 2Z4QA 3ARYA 3F58L 1QBMH 5HHME 2DQJL 4Z7VE 1NGPH 1QFPA 5TDOB 3LEVL 4XAWH 4ZAKB 4L8SB 1XF2B 2XZQL 3CH1A 4FZ8H 4YHZH 5C09B 2FJHB 3P4MA 4PRPA 1UB6B 2QSCL 5HBBA 3AMLA 3PG2A 4P48A 1FNLA 4X8JB 5JOPD 3I6KB 4HJ0D 2LAGB 4G9FE 3KXFB 5DD3L 5DJZA 4DGIL 4XPAH 4JM4H 1LE9A 4ELMA 4Y5YB 4L3EB 2KQNA 3IJHB 1IC7L 1T83C 1J0IA 3HMWL 5FK9A 5JTWA 2K9UA 2B4CH 2R0KL 4EIGB 1FYHB 3VFSA 1QPXA 1MJJA 2PYFB 1MCLA 3HFMH 3GIZH 1SEBB 4OSUL 5FUZL 4X6BB 4U1NA 4UIKH 5C08B 1A7QH 4ZXBA 2BX5A 5FHBL 1C08A 2CD0A 3WUWA 3MNWA 3LRSB 2PCPB 5C7XL 3O11B 3CSPA 4UAOC 5J11B 5IQ7L 3BKJH 3W2DH 2BXYA 2OTPA 3T2NL 4Z77B 1A6TB 2GJ6B 4MA8L 3TN0C 2NW2A 4ETQA 5DJ0A 4KMTL 5L8JB 1LDSA 2BVUA 1J5OL 5IB3A 1MJ7H 5AAWA 4UT6L 2FIRT 2DQEH 2LTQB 1IAII 1W72A 3MJ8B 1J8HD 2AJVL 4QO1A 5CS7A 4Z9KB 4F37K 4LBEB 5FGSA 1YUHB 1A7PL 4M6MH 4F15B 1X4XA 1XIWB 2E7CA 3E3QC 4XP4H 2NZIA 4G80B 1MCFA 4ZUSB 4QRUA 2D03H 4UIMA 5IBTH 5CP7A 4OD2B 4Q58C 4LRNL 5D7JB 3RTQD 5E03A 1BVKB 2FECI 3B4NA 2OR7A 3H42L 3MR9B 4HKBB 4RGOH 1BQLL 3G6JE 4MXVF 3RY5A 5KSAC 2FZ3A 4MA7L 4P23B 2E7MA 2O26U 4HZLB 1NCAH 3DIFB 4LP4A 2NLJB 5FOJA 2MCPH 3FB5A 1YPZF 1IRAY 4NQCD 3CZFA 3PL6C 3S98A 4FQ2L 3OKEB 1PSKH 2R29H 1IKFH 4UNVA 1H9VA 3N1FC 4N90D 3KLAB 5EG6C 2C3GA 4FNLL 2AV1A 4Y16B 5TDPA 3O9WC 3T2OA 4XI5D 1WWAX 2Z35A 3B43A 5E99L 1I9IL 4WTWA 5K9JH 3ISWA 1WFOA 4LSSL 3TA3D 5AYUH 4PBWD 1IEBA 3RZCB 4LMQE 3UTSE 4QTIL 2FHCA 2V9TA 3OJ2C 4H20H 4PD4J 3WLBB 1IT9L 4EUPB 4X5XB 5I8CA 5ILTH 1EFQA 1U8LA 5LWYH 2HFEB 4I18A 4ZPVB 1P7KB 5JOFA 5DRNB 1JWUB 5A1AA 2UZYB 3CZJA 4YLQT 2RFXA 4M8QA 5E5RB 2XN9A 2BNUB 3U0TB 5T1KB 5I19L 3HAEA 4PLOB 4N8CH 2K1MA 3W0WD 3QNZB 2VR4A 3MQIA 3JBG7 1ZHNA 3W9EB 4Z0BH 2DQGH 1NL0L 4LLUB 5DMGD 1N2RA 3HLAA 3WN5B 5JW4M 1X5XA 1QSEB 5ANME 1BGXH 4HKXB 4WW2A 4NKMB 4P3CH 3E2HC 1IVLA 4EBQH 1JK8B 2ZUYA 2I9TA 4YXLL 5HY9A 1NUDA 2IFGA 5FA3A 1AGEA 1ZSDB 3FB8B 3GRWH 5IT2L 4LVOB 2BVOA 3WFCL 3DGGA 1ZANH 3I6GA 5MEQB 2B5IB 5IR1B 4U6VH 1CICA 2Z92A 3UJTL 3MODL 2R4SH 2VLLB 3BPCA 4XP1L 3VXRA 4F9PC 3WJLC 4FHBD 1Q1JL 1Q94A 4ZG1A 2AQ3A 1FJ1B 4HUNB 4KJWD 4X7SL 4O2FA 4YEEA 2O5ZH 3T3ME 4QHUA 4E41B 1AD0A 4X7TA 2BY1A 1IAIM 4YGVB 2E7HA 4NWUL 4QHMA 2FNBA 3QUZA 1E4KA 1KN2L 2MQ3A 4JZJB 1EDQA 1K8IB 3LMJL 4OLUL 3L95B 5DGRA 5HHXL 1A4JB 5JUEL 3W9DA 2WUBL 3KYOA 4R6UA 1RIHL 3PDOB 4X9HA 5I76B 1U92A 2B1HL 4KK9C 5I1JH 4QTHA 5KW9H 4OKVB 3SDCA 4CMHC 5KJRL 4X4XB 1S9YA 3OR7A 4CNIA 1G6RH 4NN5C 3HB3C 1NC2A 4GBXA 5I1AA 2XWTB 4R8WH 2IANB 1H0DA 1LEKA 1E0OB 5AD0B 1R3HB 4LSQL 1HXYB 4X6DF 1JIBA 2L4OA 2WIIB 5MI0B 4Z78A 4JO4L 3I85A 3EZJB 2BVPA 4NN7B 4QY8A 3UDWC 3O3UN 4OF6A 3L5XH 1Z3GH 1FAIL 3H7BB 3KPSB 3P9MB 2F5AL 3LIZH 3WS3B 1QA9B 3ARUA 4RBPH 1XF5A 3QRGH 4PRBA 4Y2DB 4D0CB 5CD5C 2DAVA 2OMNA 4RMRA 1AO7D 2D7PA 1X9QA 2BVQA 2NXYC 3WYRA 3PP4H 5EH1A 4JHAH 3EDEA 4R4ND 3H3PH 4YFLI 1BVLA 2PO6B 1GGBL 1HK6A 2X6MA 1AXTL 1D6EB 3MGAA 2EDWA 4P57A 1RJLB 5D2NC 1Z6JT 2P7TB 1S9XB 4MLIA 3SCMD 3ZL4H 3MRJA 2XWBA 1X5ZA 3KYAA 4ERSL 2DKSA 4AJ0A 3C5SA 3SE3A 4G7VL 2ENYA 3V6OC 2Z93B 2VDNL 2YRLA 1FVDA 1CGTA 2KUTA 4FABL 5T5FH 3ESVF 3KPLB 4ZSOB 4P5MA 3O3BA 4LLMA 4YBLC 3VXQB 4I1NB 2HH0L 3UTPD 2BSTA 3TBTB 5DHYB 3W82A 5IV2B 5HXMA 1QRNA 3F12A 4NBZB 1S8DA 4XMKL 2HWZH 3SQOL 3ROLB 3K4ZA 5BV7H 3UBXG 3UTTD 4CVXB 1CDBA 1CLYL 4MYWB 5KZCD 3PWLB 4F57H 4G8GD 3PIQA 4FQJH 4IS6B 4GMTL 3QCTL 3G5ZA 8FABA 5FKAA 3KR3L 2VQ1A 1M6OB 3QDGA 1X5JA 1YEKL 4V1DB 4IHOB 2VOTA 3WIHH 2OI9B 1I1CA 1CU4L 3CLFH 4HWBH 2BRRH 4C55A 2GT9A 2VXSH 4IRSD 3LPWA 3QO1B 1X4ZA 1M4KA 5ALBL 1SJVA 3H2WA 3HR6A 4HEME 3TPKA 2NX5A 5T5NG 1T7VA 2BOBA 3B3IB 1F45A 4GS7B 4XNUL 3RVVC 1GOFA 1UWEL 1PJ9A 1XZ0A 4OGYL 3VXSD 3HE7C 3S88L 5D2NE 3ARGD 4WENB 1A6WL 3C09C 5JMRA 1FFRA 5GGSB 4F8TA 3V6OE 3VXUA 3BDBA 1EERB 3GMPB 3TBWA 4BELD 2XTLA 3UAJC 2B2XH 3MREB 4CADA 1F4WH 3QDJB 4KWUA 4X5WA 4G8FA 1JP5A 4DCQA 2ICEA 3I2CL 1YQVH 3B9KC 1A6ZA 2CKBH 3A6BL 4YX2L 1UA6L 3MRFA 4O2CB 1YEDB 4K7PX 3AB0B 4YK4B 2C4FT 1EO7A 3UTZB 3JSSA 1IEAA 3RHWK 4NRXB 5DD1H 4OQTL 4ALAH 1TVHB 1PQZA 4J3VA 1X5YA 5IB4A 1PY4A 4ZUTB 4HPOL 5DRXA 4O2EB 3A0OA 2NTFA 3ZE1E 5IGXL 1INQB 1WEJL 2FATL 5LAXA 3FN0L 2DQTL 2VKXA 3ARXA 1QRKA 4ELKB 3QG7L 3ULSA 2E7LA 2NZ9C 4IRJB 1O5DT 1CR9H 3ZE2F 1UWXH 2I25N 4C56A 1FG2B 2CMRH 2HP4A 3ARDA 4G6FD 1E28A 2A6DB 1ZHBB 3P4OA 4DKEL 5F88B 1ZGLA 3S5LA 2PYEA 3DURA 4XAKE 1BZ7A 4OM0H 5HPMA 3MRKB 1PDKA 3S4SA 2IAMB 3DX6A 5KS9F 5JDSA 5CHNA 4MDJB 2NW3B 2YBRB 4YDIL 3JWDL 3FFCA 1DLFL 3IAQA 3WNLA 3U9PL 4K94C 1T1ZA 1QSFD 3JXAA 4OZGB 2VLRB 3N1QC 4XCNB 3CLEL 4J3WA 2FGZA 4NHCH 4U1KA 2JELL 2H2PD 5C9JA 1FGNL 1XGTB 3REWA 1OF2B 4JRYB 5SWZE 4I13B 1S7WA 1KLFA 5EU3B 1IGTB 1JPSH 3WFEL 3BJLA 2WSKA 5CAYB 5D71H 5IHZB 2ZUVA 2BVTA 3G5VB 5ENWB 4X5LA 2BC4A 1EFXD 3MRCA 3BZDA 3G9AB 3VXMD 3VFGL 5BW7C 1D9KC 1G9NL 1JF5A 1K6QL 4NQED 4OTXL 5F6HJ 1E6OH 4K3DL 5TE6H 4PJEF 5JLZA 3MRPB 1T4KB 5IB5A 1M7XA 1Z0NA 4J1UB 4M7ZC 3OSKA 1FORH 3MOAH 4X7DC 1FH5L 1RIUL 1WFUA 4GUPB 3RL2A 3UBXB 3PNWA 2F5BL 2W0KA 5B8CB 3EFFA 4OGAD 4PJDB 2NY0D 1KCUH 4Q6IB 4P2OB 4U6XB 3BPNC 2IG2H 4N68A 4A2LA 5L2JA 4LIQL 5I8OH 4NM4H 3DETD 5DR5H 5E0QA 1N5AA 4XPFL 3QUKB 4KKAD 5D7IA 1P2CB 2I5YH 5E6IA 2DM4A 3NABH 1N6VA 25C8L 5AZEL 5FFLA 4HIIB 1LE5A 3MBXL 5KOVC 3IXTB 3OKNA 1NCCL 4TSBL 4OT1H 2B1AH 3QDMA 1FE8H 5JW4N 3BT2L 4WNQA 3PHOA 3PWPE 4P4KA 4XNMB 2Z9TA 3TP4A 4Q2ZB 1CS6A 2R56L 1JUFA 1PKQA 3C60C 2OK0H 5L9DL 1TDQA 4GMSL 4KVNH 4PP2A 5ID1B 3VH8B 1GGCH 3MJ7B 4P3WA 4I48A 5CEYA 4PRNB 4JKPH 4WUKL 5KG9B 4JQXA 2K7QA 5EU7E 2AJSL 3LS4H 4WO4A 4LSTH 5T1LA 2WWKO 3FB7B 5IIEB 3SGJC 4LEXL 3RL1A 1NC4B 3MYJA 3QEQA 4F7MB 1IKNC 5DRZA 2X70A 2F19L 4EN3A 3RAJL 5BJTA 1BWWA 2J8UE 5C0IA 1EXUB 1MHPH 4BSVA 2CGRH 5D6CB 4LDLB 4D8PB 4ODUA 2NY5C 3GMOA 5TE7H 5CSZA 4OIAA 4OCSH 3RVUD 4LAQL 5IVOA 3QEGH 2X05A 1VGKA 4YE4L 2HKHH 3KPPB 4JDTL 1MAML 5BQ7A 4HIXH 1OP9A 5KSBE 5HI5C 3I6LD 1CXIA 4OZHA 1CBVL 5GJSL 1RUAL 3BQUA 3CIQA 5DC0A 5HDOA 1KENH 1YEJH 4QRRA 4N0UB 4WWID 3BD4A 1VEOA 3QT2A 3BP6B 3VXPB 1MRCH 1T6WA 3S6CA 1AD9A 1LO2H 1F3JB 4G6KL 1MFAL 1X3DA 2O5XH 4JCLA 2ADIB 3HUJB 1IZKA 4F9LA 1U2CA 4MXWH 4I2XE 2Q76B 3ARTA 4NPYB 3SQBA 1LO5A 1ZT7B 5C8JA 2A83B 4XHJC 4MWFA 4HX1B 4PJCF 2HN7B 4C4KT 5D2LB 5IFAH 2VZUA 3QO0B 1AR2A 2IWGA 4P49A 1GZPA 3FOLB 1KCSH 1NAML 3WNKA 3QQ3A 4DN3H 2EDXA 1KTDB 3N1GC 4IMKC 1PG7W 5B3JE 1MCSA 3X3FL 3INUH 1CF8H 3Q1SH 3DV4B 4U2YA 1WTLA 1QNZL 1G7HB 1BOYA 2UY7A 5GGVY 1RZ8A 1NGXA 3U2SA 5B39A 2Y5TA 4OQTA 3TV3L 5I1CH 1A1OB 5F8QC 4IJ3C 4XX1E 5IMOA 1Z5LB 1F4XL 4WWKA 5CIPA 2VQUA 3D0LB 4NQDA 4O51A 2W60A 3UPCA 1A5FH 1TETL 2DWEA 4PJXE 4JO1L 1IAIL 1NCDH 3L3DA 2M8XA 3BKCH 3I9GL 3IKCB 5DJYB 3KLHC 1YJDL 1YEEL 1ZS8A 3MV7D 4IOFD 3S36L 5ADPL 3DX8B 5I2IA 4I3SH 5TFSH 1K4DB 4N0RA 4ELMF 1BLNA 5J6GA 1RQ5A 4LSVL 5GRYA 5T1DL 5IFHH 2BNRD 1NCNA 1U3HD 1SM3L 5BS0A 5I1IH 3EYOA 3AXLA 3C5ZC