2Q2LA

Crystal structure of superoxide dismutase from p. atrosanguina
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
152
structure length
152
Chain Sequence
MAKGVAVLSSSEGVAGTILFTQEGDGPTTVTGNISGLKPGLHGFHVHALGDTTNGCMSTGPHFNPAGKEHGSPEDETRHAGDLGNITVGDDGTACFTIVDKQIPLTGPHSIIGRAVVVHADPDDLGKGGHELSKSTGNAGGRIACGIIGLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide Dismutase
publication title SAD phasing of a structure based on cocrystallized iodides using an in-house Cu Kalpha X-ray source: effects of data redundancy and completeness on structure solution
pubmed doi rcsb
source organism Potentilla atrosanguinea
molecule tags Oxidoreductase
total genus 33
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2q2lA00
1SXZA 3ECUA 4L05A 2Z7WA 1SPDA 4OJAA 2XJLA 1U3NA 1OALA 3H2PA 1PU0A 2WKOF 3T5WA 1TO4A 1F18A 1AZVA 1IBHA 1SDYA 1DO5A 4A7VA 1CB4A 4A7SA 2GBVA 4N3TA 1IBFA 1SDAB 1E9OB 1UXMA 4MCMA 3GTTA 1UXLA 1HL5A 2WWNA 2WZ0A 1F1GA 3H2QA 1YAIA 2V0AA 2R27A 2AEOA 2ZKXA 1HL4A 1F1DA 3RE0A 1JCVA 2APSA 2Z7YA 3PU7A 4OH2A 5KBMA 3F7KA 1SRDA 2K4WA 3L9EA 1E9PB 1F1AA 2Z7UA 4MCNA 3K91A 1BA9A 1JK9B 2VR8A 1MFMA 2WZ6A 1XTLA 1EJ8A 1Q0EA 3KBFA 5CU9A 1RK7A 2AQTA 3SODB 2ZOWA 3KBEA 3QQDB 3CQQA 2AQPA 4U4IA 3KH3A 2LU5A 1EQWA 4A7TA 1YAZA 2XJKA 4BCYA 3GQFA 1S4IA 2AQSA 4A7QA 1E9PA 1IBBA 1OAJA 2E47A 1JK9A 1XSOA 1E9QB 3KH4A 2E46A 2ZKYA 2Q2LA 2WYZA 4A7UA 3HFFA 3CQPA 3S0PA 3QQDA 2ZKWA 1BZOA 1IBDA 1SXBA 1SXCA 2GBUA 2JCWA 4A7GA 1E9OA 3MKGA 2VR7A 1TO5A 4FF9A 3GZOA 1DSWA 1PZSA 1QUPA 3ECWA 3HW7A 1N19A 3MNDA 2NNXA 1E9QA 1YSOA 1Z9NA 1COBA 1L3NA 3GTVA 5KBKA 1Z9PA 2GBTA 1OEZW 2AQQA 3F7LA 1ESOA 3HOGA 2C9VA 1IB5A 1P1VA 2AQRA 3LTVA 2VR6A 2WYTA 1CBJA 2C9SA 1SXSA 2JLPA 3ECVA 1SOSA 4BD4A 3KM1A 2SODB 3GZPA 2AQNA 1KMGA 4BCZA 1XTMA 4B3EA 1B4LA 1OZTG 1N18A 4N3UA 3L9YA 3KM2A 2WKOA 2WWOA 3GZQA 1OZUA 1SXAA 2C9UA 2WZ5A 4A7GF 2AF2A 2Z7ZA 1PTZA 1FUNA 5KBLA 3CE1A 1B4TA 1SXNA
chains in the Genus database with same CATH superfamily
1FFRA 1QD0A 2HT4C 3QZOA 3QDMA 5CFAA 2BSTB 5D55A 5ICYA 3UO1H 3MLXH 4PV8A 4FQ2L 2ORBH 2VJ8A 4IKLA 4KVNL 3D0AA 4LPUA 4NHUB 2DQTH 4XPAH 2PYFB 2YBRA 4UIMA 2H1PL 4YZWA 3KXFD 4DOHB 3B2MA 1SJHA 3SKMA 4B9KC 1FL6B 1QHQA 1NMBL 1GPOH 3RDTD 2WLMA 1AYOA 1RZIA 5D4JA 3B5TA 2NDFA 1ZWIB 4M29A 2ZKXA 1FVCB 2EDHA 2GC4C 3BD3A 2VL5B 5E5MA 2D8KA 5E03A 4N90E 4PJIE 4KFMA 3KS0H 4MSWB 2EO7A 5LNEA 2HTLC 1CGSL 1TITA 2LU7A 3CQFA 2CLRB 1JPTH 2CIKB 2Y1YA 4MRBA 4MX7A 4XGZA 4DQOL 4DO4A 3KJ4C 4P4KD 1PJ9A 1BBDL 4M6NL 5FR3A 2V2XA 4Z7VF 1D7DA 3WN5C 1V3LA 4XAWH 3WN5A 1Q9OA 5DEFB 4ZODA 5KEZA 4XOAA 5EHFA 5KVDL 3UZQB 4CSZA 1V7NH 4HSCX 2BC4B 3MBXH 1E4WH 4XBGB 4KZDL 2VDMB 1OF2A 1DBKH 2IANE 1R0AH 2VM3A 5AKVA 2F8OA 3IMBA 4XPGH 1NMAL 1NIBA 1GC1L 4FA8A 4IBVA 2A1WH 4KI5F 2DICA 3O3AB 1OHZA 3K1DA 2AK4D 3QXVA 4FYRA 2PWDA 1JPSL 2X1QA 3MCKB 5AZEL 2VLME 1WG3A 3CVIL 3BRDA 2D7NA 1AGEA 1PEZA 3D33A 2XWJA 5E8PB 1G4MA 3STZB 1VACA 2OR9H 2VL5A 3BESR 3OJVC 5CD3B 2CHDA 1M7DB 2Q76B 2X5PA 4TQPA 4H25A 5EU5B 2MRYA 4L3ED 1LYQA 4CADB 3NAAL 3E38A 2V7NB 3BO8A 2M2DA 5TDNB 3WMPA 2VXSH 1R1CA 3HCVB 1SF5A 2CIKA 1RLWA 1A9BB 1WAAE 2BCKB 2UWEB 3FQTA 5HHMD 5EU6B 4IOIB 4DO5A 4ISVB 1NANH 1DFBH 1CF8L 3HHMA 2R1XA 3L48A 2A83B 4R26H 5GGUA 1TJHL 1AACA 2HG5B 3AFLA 4N0UB 3TBTB 1I8MB 4LP8A 1BXAA 5J56B 1WA2X 1G7PB 3T1FB 4H88H 5LJYH 1NOAA 1NLDH 3MTRA 5E94B 5IVZB 3O4OC 2AGJH 1I7UA 3BPLC 1HQ4B 2G4GA 3HIZA 3B4NA 5EIVA 3T0BA 5CS7A 4N6RA 1UUSA 1PTZA 3MLWL 1XHHA 1Y7VA 2OTUA 4BJLA 2UXFA 4IM8A 1S7RB 2XOTA 1WFOA 5BRZB 3ZVVA 5ESVB 4BZ1H 5CD3A 2KZ1B 1OGPA 2MWCA 3QR1A 4OR1A 4X5XB 1M7DA 2VLJA 3U6RA 1DBAH 4OTXH 4F1SA 1HXMB 5JIDA 3FFCE 4IBZA 2JTYA 3N0PB 3HZYB 3FUEA 5DZLA 1YUHB 1UFUA 1NOLA 4U1MB 4GQ9L 3BT2L 4ZUWB 5A2FA 2BCKA 3PHOA 2UWEA 3Q5OA 3QQ4B 4N8VG 3CD4A 3HB3C 3C5ZA 4NUMA 4YHLH 5IQ7H 2Y7NA 1R5IA 4N0UA 4EVNB 3RYMA 3G7TA 1TJMA 5C0AB 3FW6A 3WLWC 4Z77A 5LGJB 1W72H 4XB3A 2IH9A 1U8LA 1OM3L 4Z7VE 5IVZA 4B7LA 3V0WH 1KN2H 2JQZA 4F7TB 3DVFA 5KSAA 3B43A 3L9EA 2CDFB 4LAQL 3MA9L 3HNSH 2V33A 4F20A 3B34A 1DJYA 4WK0B 5BUAA 4JG9A 1A7RL 4M5ZL 4M6OH 4Z95H 4EXKA 4KI5E 2VDQH 5ESVA 1CXFA 5KYUA 3LXAA 4AM0B 4YDJB 5D1QC 5FM5O 4CW1B 4B9FA 1O9VA 5DS8B 2HVJA 4N22A 3F6LA 4X5XA 3UTSE 1PLGL 3NCMA 4JLRA 2A38A 3BZFB 3C08H 4NFDA 2HVBA 5D9SB 1RVFL 5EOTB 4XBEL 1LGVA 4JX0A 3C60B 1XCQB 2FNWA 2R69H 4LLMA 1WAEA 1HINL 4R4FL 5EO0B 3S4SA 2R2CA 4YJZL 4Q9QL 4FYQA 1DUYB 2ZX8A 4QMEA 4EI6B 1M6OA 1IGMH 4TNEA 4EVNA 1LE9B 1LO2L 2GFBA 3RFZC 4NC1E 2XWBB 2XWXA 1ZDSA 4KKNA 4NO5A 2CRIA 1ADQH 4G6ML 1B2YA 2VE6B 1RZKH 1MREH 4GBXC 4V1DD 4GBXA 3SE6A 2WLNA 4MAUH 1RULL 3BKCL 3GD1C 4KTDL 1DQMH 3QT2A 4MAZA 5ADOH 4R7XA 4FNSA 2ZXAA 3IPBA 2UXTA 5DSCA 2HFFB 1A3RH 4AM0A 1ZLUH 2ICWA 1FFNA 4FNTA 1S9YA 2HT2C 1ZLEA 1BV8A 3MV7A 1S46A 3IS1X 3FO9B 4JFHD 4BCZA 5EFIB 3ULUH 3H54A 4PP1D 4F2FA 3CH1A 2LT9A 4OW6A 4QRUA 4S0SD 1QFPA 2MNUA 2O26U 3C60A 2F53E 4P2RB 2WP3T 3VXRD 4EBQH 5AB2A 5JHLH 3J7HA 4R2GD 3N6YA 4FFYL 4G6FD 1WCBB 4WTZG 4X4YB 3VFGH 4M62H 4KROB 4L8BB 4AQEA 3PV7A 1OGAB 2RD0A 4ZD3H 1W0YT 5A7BA 1ZTXE 4Y89A 4EI6A 3EO1B 4JQIL 4MZIA 3RDTC 4TNVF 1AQKH 4KBPA 4AUUA 1MCHA 1NJ9B 4Z7OB 3DOSA 5GS0L 4WEMB 4HBCL 4HJ1A 2ZCKL 1VFOA 2WIIB 1ASOA 2X40A 4M8RA 2ZOTA 4G8FA 2BNUB 2MH4A 1SMOA 12E8H 4G5ZH 4JS7A 3U83A 3BW9B 4HETA 1G7HA 5MERB 3ZYOA 1NKOA 3MJ9H 2CRYA 4GSRA 4XPBH 4P4KC 2VQ4A 1Q4NX 4PJXA 5EFIA 1BYNA 4HIHB 4HIJA 4PJFF 4PJDF 4HXBL 2A6KB 4HF5H 5GGTA 4LLDB 2X4RB 4MYWB 1DLHA 5EOQL 2GUOB 4OI9A 1JNHB 4MCNA 3QWOB 3AWFA 4Z0XA 4PJEB 4IBWA 3QFDA 3K2UH 4L8BA 5TDPB 5TH2A 3F58H 3VXSB 5C7XL 1A0QH 5C2UB 3CQQA 2V2WB 2XJKA 1QSFA 5FUZH 2F74A 4L1LA 3CFNA 4DJMA 1NJ9A 3VXUD 4NS0A 2ADJA 2WIIA 3OTTA 2WLYA 3QW9A 4CSPA 5GGQL 4Z3IA 2AJUL 2PTTB 4LE8A 2JCWA 3BW9A 5IIEA 2PWFA 2BVTA 4GRMA 1L7IH 4XNQB 1NCHA 5MERA 5ICUA 1IM3D 3UAEA 5IK3A 3DXAD 5TE6L 1CL7H 1KLGB 5EZPA 4ZXBB 1MFBL 3D12B 4HIHA 2NY5L 2A6KA 1BF5A 1W6WA 5E1IA 2X4RA 1A6VH 4JPVH 5ERWB 2GUOA 3I6KB 4LSTL 3EYOA 1B4JL 1JNHA 1P1VA 1Q0XH 3JV5A 4PJEA 4QOKB 2YD1A 2EE2A 4OB5H 3VVWA 3KPOB 3QUZD 3VXSA 3SYCA 3IBEA 4XWGH 5I1DA 5FV2A 4V2CB 3VMOA 1ND0B 5EZLA 3EDJA 1UD2A 3QGVA 3DHPA 4QF1B 4FZ8H 2CCLA 4EZKA 2EICA 3ATBA 3Q8EA 3X1FA 3DJRA 1RIHL 1JOIA 4RRPA 4N2NA 3TX4A 2PP8A 3OKMA 5KJRH 5D5MB 2NW3A 2XVLA 4UQEA 5KVFE 4W6WB 5TJWK 4WSJA 3PWUB 5CEZH 2YIHA 1CGWA 1KLGA 1RSFA 1A5FL 1ZT4B 2ATPA 5DMKA 4RFEA 3WHXA 3GB7A 1UKTA 3VGFA 1AZVA 1AS7A 1M2VA 2AI0H 4HGMA 5I1HL 5E2VH 4OGQC 5T3XD 2AABH 4FA6A 4HX1B 4PJFE 1GSKA 2HJKA 3QPXH 4QOKA 4PJDE 3TIEA 1CE1L 4LVEA 4O9HL 5T1MA 1NFDA 5E4OA 1S8DB 2XCMC 4L8SB 4YE4L 3V9FA 1TJGL 5DD5H 1ND0A 3MA7B 3O0RH 4ORZC 4MNQA 4EAEA 3AZUA 3UADA 5L88L 4MGXA 3TA3A 1A02N 1IO4C 1ZPUA 2E7BA 1LEIB 1F1AA 4HALA 5C0EA 4U1JB 5FCUL 5T1KB 1UWEH 1PSKH 4HHAA 5C0GB 2FH6A 4WEEA 1E67A 3BZ4A 4KRPB 5T33L 2B0SH 3OKEB 3BAJA 5IMMA 2X2UA 4TL5A 5KOVC 5EO9A 5FKAA 1ZT4A 2MQCA 1YAZA 1IAIH 4WWOA 2Y6SD 5C0IB 4J3VA 2COQA 3BIKB 3DYOA 3BP6B 3NJJA 4PHZA 4PMFA 4P8QA 2G2NA 3NZ8A 2AC0A 2FWUA 1JIBA 2BMKB 2WLKA 4ZQTA 1Z3GH 2EXWD 4AE0A 3GJFA 4H20L 3NTCH 5JQ6L 1M7UA 1FSKB 4Z76A 5G5DA 4G7VH 2NNAA 2O5YH 2XVBA 3MV8E 5EC1A 2RCSL 4IJ3C 3I50L 2VDLH 4X6CB 4G8EB 5C0CB 1N19A 1T6VN 4NM8H 2V3FA 2W88A 3QG6B 2DDQL 3MA7A 4FXGB 5DR5H 5J1AB 4TUUA 2E9JA 4IHOA 3EO9H 3OLIA 5FHBL 5FA4B 5KSVB 4U49A 1MAKA 4PP1C 2KMWA 4MJIB 5JA8B 2BSED 5T1KA 2JKJA 2H2SD 3QIWB 5EO1B 3B5HA 4K7PY 2KDGA 2Z3FA 4MA1C 4R2GC 5AKTA 1G94A 3RWHB 1EHAA 3ZXAC 5DQ9A 3CSYA 2YPLD 2YZ8A 3QJQB 1G6RH 3VXPB 1XD0A 2OCJA 3M88A 3BIKA 3P77B 3VXME 2FD6H 2AZUA 2Y06H 5F21B 3B6SA 3BVTA 5JXAH 4K8RL 5B1JC 5LAXA 1YN6B 4O5LL 5B1JA 1YUKB 1XGRB 2YZ1A 4QAWA 4O2EB 4RMSA 5FYKU 4LVNB 3RTLA 5TD4A 3VCLB 2D2CC 4C58B 4HJTA 5DO2D 4G8EA 1FO0L 2YKLL 4JR9H 4KWUA 4X9GA 3RVXD 1EDHA 1NCNA 3QEHB 2CE6A 5A43C 3LD8B 3UACA 2BFVL 2V3EA 4LNVA 4LOVA 3ULVE 4JQIA 5FA4A 3TT3H 4MJIA 5C08B 4NAJA 2Q6WA 1D6EA 2BIQA 2NY3D 3GSNL 1PX3A 1J8HE 4HDIB 4FDWA 5I6NA 3L2NA 1VKXB 3RWHA 2PR9A 3UMNA 2Z8SA 1ZTXL 1AHWC 1I3RA 1AHWA 2WKGA 3VRLF 1KPUA 2DEWX 2O6PA 3P77A 4RFNC 3MGOB 1A4JA 2G4EA 1Y6KR 2VYRE 4QLWA 5ID1B 4F37F 4CBZA 1N68A 3Q0HA 1J12A 3HUJF 1XGRA 3BXNA 4APQA 2DWTA 2MTAA 1XTLA 4N2BA 3MLRL 1S9VB 3OSVA 1U2HA 4OM0H 2AHIA 3KBEA 1N2RA 1NUGA 7PAZA 1BAFH 4H8QA 1MHHA 1QI3A 3DXAA 4W6YB 4H26B 4IRJB 2XWZA 1YEJL 3TO2A 1MAML 3OHMB 3V5HB 5LBVA 3SGKA 5IFAH 4N0CD 4QO1B 4KZCA 2X05A 5C08A 4DP6X 1IGFL 5K9OB 3MRNB 3RIAF 3UG5A 3GM8A 4K07A 4GO6B 2HFEA 3I3BA 4M4RB 1BFOB 3WO4C 3I6LE 2EDKA 3DTDA 4ODVL 1AANA 5HYSB 3QUZC 4UDUB 2PR4H 3HJ0A 35C8L 1X7TA 1AXSA 1AMXA 2VLRD 3MGOA 4ANUA 4XMVA 1YYLH 5ID1A 2D0GA 1E7VA 5FHAL 4AQOA 1WUZA 4QI3A 4FTVD 4RA0C 5I73B 1IQWL 3ARBD 1OAXH 3HFML 3QXDB 3TFBA 3DV4B 3VFUB 4NAQA 2X6VA 4NOFA 1FL5A 3KLDA 3IDYB 3REVA 1NAMH 4Z0BL 2G2PA 1A1NA 2DD8L 1ACZA 2ZX7A 4UQ2A 3UIYA 4NWUL 2DQJH 1N4XH 5C3LD 1N59B 5JOFA 1XTMA 1FP5A 4IRJA 1U3HB 1MHCB 2PXYB 2Y7QA 2WN2A 3KD4A 4PIRF 5F8QC 3MRNA 2QFPA 2WGNB 1QVOB 2WTOA 4NPJA 3EJYD 4LOUD 4UINL 1E4KA 3DETD 3WL9B 3TCTA 3PGCB 4HUNB 4LCWE 1J0JA 4OCRL 4P5MB 3T77A 4N2EA 5JHDD 1WVZA 3OX8B 5IMLB 1TPXB 3PLYA 4J23A 5AOZA 3EBAA 5DJCA 5IHHA 2WQXA 3DJ9A 4GOSA 1UCBL 5HHNB 3WFDL 1TZHB 4DSYA 3RGVD 3VRLE 3FKUS 4YN3A 4MCZA 5I0ZA 2Y24A 2OMZB 2X70B 5LHDA 4MJ5A 3B9KA 4BH8A 4FP8L 4Z7VB 1W8OA 3W0WD 4NX0A 2X6UA 2F7IA 2EUVA 4AE1A 5E9DE 4HOMA 3VFVB 4OSUH 3HUJE 4TUKL 2BOCA 5BZWB 1KCLA 1FFOB 3LKRA 3NABL 5IB2B 3DRQB 1VRSA 1GKEA 4JG0L 1T2QL 4C56D 3PNRB 4PM1A 4PYHA 4IRSD 1YMHA 2Y6SC 3BAIA 1MCDA 4OZFG 5C8JB 1MHCA 1XZ0B 2G3XA 4L9LB 4Y5XB 5L7XH 4YHMH 2VDOH 3KAAA 2IO5A 8FABA 5EU4B 2JXMA 1XR8B 1GS8A 2EXWC 3UTTD 1ZJBA 1CD8A 1X5YA 1KXQA 2OP4L 3BPNB 3R06B 1JFQL 1FC1A 4KPHH 2ZAIA 3HI5H 3C6LD 1NBYA 1AGFB 4PRID 3QZWA 1OXYA 2BXYA 5DWUL 2LU5A 3T6XA 1C5CL 3HBZA 4UT7H 5FYKE 4OZIE 2BOBB 2MQ0A 5FGBC 1OTUD 2EVJA 5FGBA 1BQKA 3WNLA 2JJVA 1C7TA 2UY7A 5CN2A 2X70A 3STLA 4AMXA 4E0RB 4LP4A 1KXHA 2CDGB 5KVMC 4OCSH 1J88A 3D2TA 3VFVA 3TBVB 4XB8A 4FQQA 1HEHC 3BKYH 1KB9K 3DOHA 5IB2A 5I5RA 2MPAL 3H9ZA 2QSCL 4PGDA 1GGYA 1OOAA 3RUGF 3BE1L 1FZJB 3D18B 3F6JA 2H3NB 2YPLA 4PQXA 3BVDB 1WK0A 1FO0B 4L9LA 5CJQH 5L8LB 5B39A 3T9WA 1NM9A 3IDGB 1MFEH 1XR8A 1O6TA 4YGVB 4D9RD 5ICZA 2ENQA 4PGCB 1UZGA 4DUWA 1CN4A 2R2HA 5F1NB 4AQ8A 1AGFA 1UXSA 1K72A 1BQ5A 2QQNH 4MQXD 1I8AA 4QHNA 2Q86A 1AD0B 3P1VA 4UMGA 5FYJH 1OT2A 3ILEA 3P4OB 5CILL 5DO2C 1N64H 1JRHL 2A77H 3OB0K 3GSNB 4QRSB 1L9QA 3AT0A 4D0CB 4I8DA 4YEFA 4W9CC 1A6TA 3HNVL 4AIXA 1B6UA 2GTWA 4IMKA 5IMKA 3KYAA 2VUKA 4XP6L 2R0WL 4LSVL 3GHEH 2R29L 1KF9B 5IFHL 1MSPA 3CAFA 2F7QA 1L0YA 3TVMD 4OCYL 4PTUB 1I8KB 3D06A 3TBVA 1DJXA 2ZF8A 2EDYA 2NY3C 1HI6B 4Q9BA 3AREB 5CU5A 3RL2A 5IHUH 4LHUG 1UQSB 1LQBC 3BWAA 2ESVE 4WDIA 4NUJB 1C7SA 4OZHB 3QUYD 3ZLQC 2VZ3A 1OALA 1ROCA 1PU0A 2N3JA 4LLQA 4DGYL 4DKFL 1ADWA 1BQHB 4NB7A 4YDIL 5J11C 2H3NA 3ALPA 5DUPL 2UZXB 4G7YH 3L9RA 1ZANH 2LLGA 4NO3B 1G7JB 3VXTB 4BH7B 1UGKA 4FJ6A 4QXUH 5CAYB 3IDGA 1X4YA 4C47A 4YGVA 3CZFB 4PGCA 4B41A 3S96A 2PPAA 4NQXB 2FDBP 3MV9D 3VQLA 2BRRH 1IBZA 3GTTA 3L5WA 2E3VA 1HL5A 1OVZA 3ZO0A 4WGVB 3P4OA 4QRSA 3WXVH 3MRFA 3GSNA 4D0CA 3FZUD 4NZRH 3E80A 3VI4F 1ETZA 3ABGA 4GMTH 1NIEA 3ULVL 3QDME 1MNUL 3NDYE 4JRXD 4XXWC 1T2JA 4XXWA 3CZEA 4JO5A 3WDIA 4NT6B 4QPEA 2H32A 3D0VA 43C9A 2VIRA 4M93B 4N0CC 3NPSB 5I0DA 1I8KA 3DVNB 3E8UL 2ZZUT 2C9RA 1A4AA 2OL3L 2XQBL 5IVXA 4JDZB 1LD9A 1D5ZA 1NL0L 2XV2A 3AREA 3IMUA 1JF1A 2DLHA 3MO1B 1TMCB 1R47A 5D7SL 3L17A 2V2TB 2HA1A 3HS0B 4P9MH 5GZOA 5HHOD 4AV0A 3MJ8A 1YVLA 2UZXA 4JDTH 3I6GA 4U1LA 1XGPA 3VXTA 3UBXB 1E9QB 4BH7A 3RUGE 2VLRA 3MCLH 3HKFA 2ZKYA 4A7UA 1S7VA 4JY4B 4NM4H 3N06B 1H3WM 4CN1A 2OKMA 5BPPA 5JDJA 2XQYK 5AOMA 2WLJA 3ZKSD 4UOQA 5CJXA 1TT6A 1JV2B 3NEEA 1R9FA 3HBPA 3ARBC 3ARBA 4XNZC 3V4PL 2E7CA 3AG3B 1NDTA 2XKUA 3PS6A 3RAJH 1DLFL 4MXQD 1OWWA 3CLWA 1KJMB 4PH8A 4YNYB 3BZEA 1I8LC 2H0PA 5DWPA 1I8LA 4JKPH 3WTVA 1CGXA 2CJSA 2EXYD 5EPMB 3TV3L 1AFVH 3TBBA 3CDZB 3Q8AA 5JHMA 1QSZA 2QDVA 3MO1A 3IGUA 4JN2B 1YJDL 3EJYC 4P5TA 3DETC 2F18A 4X0NA 1OPOA 1I82A 1T22B 2GIMA 4D0BB 3DUSB 2Q1EA 2K8MA 1AG6A 4U7MA 3V4VL 4WWKD 3UBXA 3X11B 4CC1A 1O7SA 3BWUC 2WKOA 4RISL 5EZIL 3RGVC 3RGVA 3ZRSA 4RH4A 1MCWW 5ENWA 5D7JD 4BGDA 5BRPA 4X7DC 3BGMB 1AKJD 1RPKA 1IGTA 3DJZA 4PI2A 4ANKA 1PX8A 2OMWB 1ZLWK 2FLBT 3AS3A 3DURA 3W0WA 3SBWC 4QRPE 3QNZB 3SBWA 4AG4H 1H6EA 1H0DB 2OM5A 2W0LA 4PEEA 4DVRL 5B8CB 1UT9A 1FLTX 2HFGH 2FX9L 4AUYA 1T7VA 2WXFA 1CLYL 3F04A 4I77L 1DVFD 3B9DA 3WIFA 4C56A 4HWBH 2A9BA 4IRSC 3VI4E 5FM5M 3L6FB 4IRSA 4E9LA 1VPOL 1WCQA 2SEBA 5EPMA 2CBPA 3ZDYB 2YPKB 3SYQA 2P8LA 4H8WC 1ANUA 5BS0E 3QDJD 3UBGA 1UM6H 1ZPLA 1WS7A 5DURB 4BWTA 3C6LC 4NZ8A 5I71B 3C6LA 2Y23A 1T22A 1OP5K 4D0BA 3DUSA 4ODTH 4LSUL 5FXCH 2OBGA 1FH5H 1QWHA 3LKNB 3LSOB 2DM2A 4RMTA 3RE0A 3VWKC 4H5SB 3VWKA 4BELD 2EVHA 3IJSB 3DO7B 5GJTL 2GYSA 1LEKB 5EIQA 2CUIA 1E8ZA 1U4FA 3V0IA 2VLJE 4HIEA 3FU0A 1JNJA 4MRCA 1OTUC 3RY6A 5FYLH 1BA9A 3FQXA 2WJ7A 4NQCB 3TT1H 1Q0EA 2OMWA 1MHPL 3QEQB 4IU3B 5T3ZD 1RUKH 1JDDA 2WSKA 3IXAB 5D7LA 3MV8B 1TENA 4HCFA 4LIQE 1OAJA 3HS9A 5EEVA 1Q0YL 3L6FA 4JANB 1J1XL 1KNOA 3S0PA 3MACL 1JZ2A 2OULB 1I7ZA 3CHQA 4IKKA 1QATA 3HI6H 4OZGB 2H8PB 5HI5D 5LVEA 1AY1L 4AX3A 1TQCC 1SEQH 5TFSL 2WO2B 5LGHL 3MNZB 3LQMA 1CDCA 2NNXA 3QNXB 4DGIL 4MQXC 2L0DA 2UXVA 2R0KH 4PJHA 4NQDD 4W68A 2OMTA 1RK1A 4LESA 2K78A 3F65A 5CKAA 5D1QE 4G8GB 5IB3B 2B5IC 3OAZH 4UTAL 1AVAA 3BVNA 2DYPB 4NQCA 4PB0L 4XO3A 1P84J 1MRFL 3H9SB 1JGEA 4OUUB 3TVMC 4W1TA 3X3GL 3ATAA 2OW7A 1T1WA 3IXAA 5DHXB 4N26A 1NTDA 4PGZA 3W5NA 5LNGA 4GQRA 5IWLC 1T83C 3L5XH 3QUYC 3AVEA 1B4LA 1CD1A 4K94L 1UWXH 1WZ1H 3QEUA 3RZWA 1X6NA 4WHCA 4JANA 4PLKC 4HG4J 3TO4D 5LAPA 5IREA 1GYCA 2WVTA 1VF5C 2WZ5A 2OMBA 4WFEE 3IGKA 3M1BB 3OF6D 5FF6B 1JERA 3UTZA 2R29A 1CWVA 4PV9B 3APFA 5KWYC 2EP6A 1T5KA 2MCG1 3U0TA 1SUHA 1J8HB 5LCVL 2OL3B 2VKWA 5CHNB 3TEZA 5D7HA 1GJWA 1KYOK 3FZUC 1CK0H 2YARA 3MV7E 1SDYA 1U8HA 4G8GA 1U8PB 4X9IA 2VAAA 2YRBA 1XGYH 4JRXA 2Y4SA 5JW3L 2DZEA 2DYPA 1IBFA 1NBVL 2QHLA 4CSTA 1NUFA 4XX5A 1HU8A 1J18A 3X14A 5JXEA 1R5VA 1HHGB 2A9NH 2ZOKB 1KLUB 5KVGE 1JWSB 4P3DA 3KXFE 3NK3A 1SFDA 3THMH 3FT2A 4ENZA 2R39A 2APXA 4Y1AD 3FB7A 5ISZD 4KK9D 5HHOA 1JXGA 3V4PB 5F72S 1KGUA 2IOOA 4FABH 1OCRB 2ITCB 4Y16D 2F5BH 3CWGA 1UCTA 3O6FB 3WTWA 1MFMA 1PZAA 5DHDA 1Z2KA 2XPYA 4OJDH 4X6DF 4G83A 4C59B 4HEMA 4ZMYA 3KYOB 2B7DT 4HZLA 4DP7X 2I25N 3D4CA 4FQ1H 1SOXA 5CHNA 2DKMA 5F3BA 4UV7H 5E6ID 4MMZB 1R24A 3EG9A 4MXQC 3H3BC 3RWCA 4ZUUA 2DQMA 4X4XB 4X7EC 3V6FB 4P46A 1M1SA 3V4VB 1NFDF 3PDDA 3OLGA 2WY3B 3FMGL 1B0RA 3DX8A 3VNZA 1SBSL 2EXYC 5IJKC 3BEWA 1MLBA 3VYPA 3MVSA 2ZOKA 4P9HC 4F57H 1NWPA 5GZNA 4PJGB 2JKWA 4I89A 1IFHL 2DI8A 2J4WH 1BVKB 3VD0A 4DP2X 2AK4E 3V4PA 2FEDD 3HNTL 3KPPB 5C07A 4WWKC 4IEFA 1KYDA 3MRIA 4BZ2H 1WEJH 1BEYH 2GSMB 3P30H 4ZI8A 5HJBA 5JR1H 5DMIL 1U30A 3CLFL 2C9SA 2CSPA 5D7JC 4L3EE 5D7JA 2FL5B 1ZGLM 3L5HA 4JO1H 1B0GB 5AUMB 1F56A 1MCWM 3FU8A 1ONQB 4Y2OB 2EIJB 4OJEH 1TQVA 4LCWB 5HHME 2W59A 3Q6GL 3WEMA 1TTCA 1Z5LB 2OMUB 2YEVB 3HZKA 1DVFC 1LM8V 1DVFA 4MKMA 4X4XA 3SKJH 4GIOA 3OQ3B 3V6FA 4TV3A 5I75B 1VZHA 5SX4H 3G6JE 4QHUB 3JV0A 3KLQA 5AOJA 4QHLA 1J0YA 1KY7A 4NFCA 3TNNB 4PJGA 5I6XC 5E9DB 2FJHB 4KMTH 5DUMH 4ZPTB 3HUJB 2ZG1A 2FBJL 2DYSB 3U48A 4YSSA 1GR7A 1YHPA 2NUPA 3ULSB 3O3BA 3V5KA 1ZAGA 4XMZA 1U8NA 1UJ3C 3VQ2C 1UJ3A 2WQAA 2P44B 4JMNA 4NQSB 4GSDL 3CZNA 4JFXB 4MLSA 1MJ8L 4QWWD 4GG8B 1BFSA 1K5NB 3EDKA 4JPIB 4XPTH 4ZFGH 1G9MH 3IFLL 2VM4A 5C2BL 2MMXA 1B0GA 1PG7L 2ADFH 3KBHE 5AUMA 1HDMB 4A2DA 4Z7QB 2G0KA 4L8CA 4X6DE 2HPTA 3FN0L 2R7EA 1CU4H 4LLVB 1Z5LA 1L9MA 2OMUA 4N8VA 4YBLC 3GSXB 4N1HB 5J13C 2E6QA 3RTQB 2QLYA 4ZUVA 4OZIB 1CFNA 2APWA 2IPUK 2CO7A 2HX8A 3FU3A 4FL4B 4S11A 1QTYT 4HMCA 4Y4FA 1IC0A 4FFVD 3O6MH 3PWPD 3TEYA 5HI5C 3FOMB 5AW1B 1KELH 1FN4A 2FJHA 1UWGL 5L2JB 1KCKA 4I1RA 2Y07H 3EF4A 3QG7L 4MDIB 3QQDA 5IW3A 4F7MA 1BZOA 3CCHB 1J9RA 1F90H 5H35B 5T1DH 4JPIA 3WS3B 5L2KD 1T03H 5E08L 4BSJA 1DSWA 4JCWA 1KPVB 3SQBA 5DZAA 4XOBA 4E5XG 5ES4B 2A73B 1KB3A 4PD4J 4BFNA 4YL9A 4GAGH 5ILTL 3FO2B 2GBTA 1Y6NR 2Z8VC 2TRHA 4OD1H 2YPVL 4UNUA 5AEAA 3UYOD 3ZTJH 3QO1A 2IWGA 4WI2A 3RTQA 5D6CA 2WYTA 1QNZH 1X9RA 3TO4C 4DN4L 4Q89A 3EOTL 4KNUA 2G3NA 1BIIB 2TSBA 3NJNA 4G7RB 5IVOA 2FUQA 3WNPA 1JSYA 4MQSB 4V1DE 1C12A 4DVBA 4EN3D 4A2GA 3LKOB 4KDWA 1P9MC 4YQXL 3MFGB 4AJYV 2ESVB 3RVWD 4NAMA 3FQRA 2FJSA 4R0LB 1QR1A 2D4DA 3CZKA 5E8OB 5EV7A 3X13A 4JFHE 1P5UC 5H35A 1P5UA 3WS3A 2DLFL 3EOBA 2H6OA 2ZP9A 3OGOE 5DRXB 4URKA 1LNUA 1SXNA 4DO6A 5D4HA 4Q6KA 3TEWA 4OQTL 3VXRE 4S2SB 1J9TA 2HRLA 3QUGA 1CYGA 3C8KA 4ZFZA 2I60H 4KHXL 1MQ8A 2N56A 4D3CH 3V7MA 4BZYA 2X2IA 15C8H 4Y1AA 4KK9C 5ISZA 2V5YA 4R7DA 3CFTA 1EGJH 5C0BA 4GMSL 4Y16C 2FX7H 3MCG1 1CFBA 2WWNA 3BP7A 1HHKB 2X4QA 3B8YA 4OCXL 3N9GH 3IAPA 3OB8A 2CO6B 1DVQA 2A0LD 4AZ8A 1IBYA 2ZT9C 2EECA 4Y4HB 4Z7AA 1FNFA 2YAFA 3OZLA 2YOCA 4FJYA 4OLWL 1NLBH 1INQB 4MYPA 5E6IC 4X9HA 5E8OA 1OW0C 3CX5J 1OW0A 3RUGB 3G9VA 3D87B 3T2QA 2DJ4A 4G70B 1EUTA 3FO1A 2PLTA 2YEZA 4LT7A 3PXLA 4S2SA 5K9QG 4BCYA 4JQXA 2PP7A 3KPRD 2ODIA 3NIFF 4ETQA 1KC5H 5A2LH 2BNRA 2XNAB 2OSLA 3HE6D 2Z1PA 1P2CB 2ZKHH 3KJ4B 1HSBB 1RP8A 4EDWH 2V5RA 1R3KB 3VXUE 2OJ1A 4Q9RH 2KHAA 3BC9A 4TTDD 1PZSA 1XF3B 1O7DC 1DE4B 4J3OH 2EE3A 3WIIH 5BJTA 4MJ6B 2R59A 1HHKA 5C86A 3EF7A 1DJHA 2G75B 1EHXA 4PJ8D 4WJG3 3W1ZA 4G9FD 2OI9C 4Y4HA 1MUJA 4OJFH 1FG2A 3UYPB 1KGXA 1K3IA 2OQJB 3NJXA 3O3EB 1SLWA 1JPGA 3CDGB 1BZ9A 4FULA 5JW5B 4N4YB 5B3NA 3MRBA 1PZUB 4JO2H 1HCVA 3K72B 3MZTA 5FUCC 3VVVA 3C12A 2YGOA 2YK1H 1NAKH 2EH7L 3P40A 4QRPB 5HI3D 3H7LA 5CIPB 4MZ2A 3SKUD 1P2CA 1DQKA 1WHOA 1I9EA 4E36A 5AVZB 1CGYA 2WLLB 4WEBL 4XB7A 4GJTB 1DE4A 4YBHA 4QWWC 1UOLA 4MJ6A 1IE5A 4AGLA 1RUAH 3WY2A 1H8LA 1JNLH 4YHYB 4R84A 5BS0B 2AK1L 1H19A 5GHWL 3COOA 3UYPA 3X12B 3G9AB 4F37K 1U58B 3E2HB 4JRFA 3W9EB 4JFYA 1N6VA 1FBIH 1MFDL 3RWGA 3WTUA 3LRSA 3F62A 3ETBJ 3O3EA 1X4XA 5JTWA 1NPJA 4XMLL 4DKTA 5J9PA 4ESKA 4X6EB 3KWWB 2ILLA 5T3XE 1EFXA 1R75A 3K72A 3AB0C 4FFVC 4A39A 4LASH 1QFUL 4G3YL 3PWPA 5I1JL 4FYSA 4KZEH 1GGTA 2E9IA 2DIBA 2ZUWA 1D5IH 4HEPG 2PCPB 3NIFE 4UT9H 3INUL 3FT1A 4JFED 1MKFA 1LK2A 2VL4A 4AV5A 2P7TB 3BAXA 3KPSA 1UXWB 1WF5A 4U4IA 5I18H 1DBBL 5AKSA 5KSUB 5L2KA 4OV5A 2AQSA 3NCYS 2OYMA 2EE9A 1Q9LB 1UASA 1E3FA 1JN6B 1E3XA 2E47A 4F7PA 5C6TH 3Q48A 2FEEL 4NHCL 4R4BB 4ZW7A 1WFIA 2WXHA 3GXPA 4HUUA 4WWID 3W9EA 4HFUH 5HY9B 1J0ZA 1JE6A 2R23B 1HILA 5HJGA 4S10A 2VMEA 3VD1A 4HCGA 3FN3A 5D1QB 1I9RH 2CBQA 3KWWA 3T0VA 2Q20A 2NZ1A 2MCPH 1D7FA 5EU3A 2NTSP 1VLXA 3U4EB 4E42B 1T21A 3T2OA 2YAQA 1HXYA 3LEVH 4CMMB 3QC5X 5CBAB 1T7WA 4FQLL 5T5NG 4EN3C 3D69A 3GNML 1KCBA 1WYJA 1XL4A 1MI5D 1QLEH 4JY5L 4L3CB 4NP4H 5CZKA 4EN3A 5ELIA 2XWTA 2VN3A 3T08A 3G5ZB 4UV4H 1HT6A 2YUZA 2ZUSA 3RVWC 3IXTA 2J71A 3L3HB 2O5NA 3BQUD 3R19A 4ZDHB 5IVXF 2DMHA 2NQ3A 3EYUH 3RFZB 1Z1WA 2YMXL 2H6PB 4U7SA 1JJUA 4OM1L 1BMGA 1OAYL 2N4IA 5KSUA 3VM7A 4ILDA 5HSFA 1JN6A 2WINB 1LK3H 3ROLA 2AMUA 2ZJSH 2X6BA 4YDKL 1FFPB 3NPZB 1E7UA 4TQ8A 5HY9A 2YPLE 4FE9A 2P52A 1TVHB 3ZT7A 4ES9A 1RZ7H 2HZHA 3FTZA 1PY9A 5FM8A 2AV1B 2F8IA 5LXGH 4F27A 3ILDA 3N1GC 5F9OH 3HRZA 1J86A 2A9MH 3GSUB 2GJ6D 5C6WH 3U4EA 1RXLA 2GJZB 4CMMA 1OIOA 5KANI 5MEPA 3V2AR 1L4IA 4GFXA 3D50A 1IBHA 1QFHA 2A0LC 1FVEA 4OQTA 3G5ZA 1G9NH 1S9XB 2N01B 3V8OA 3UDWC 2QTVA 3X1BA 2YAEA 3D3VA 1CLOH 4PTTA 3UBHA 4XNMA 1A7PH 3RDTB 4CKVX 4PLNC 3L81A 1WZAA 5DMJB 5BV7H 3H3PL 2Y6TE 3P3SA 1J5OH 3P0YH 2DL2A 4JZNB 3M7OA 2VXUL 1HL4A 4LNRB 4BFIA 5JW4N 2V5TA 4HS3A 4ZFFA 3MGAA 3P4MB 4QCIB 1BZ8A 4AL8H 4AXWB 2DQCH 3L5JA 4LHUD 3BWUF 5EF2A 2WXLA 5C0RL 4N85A 1AS6A 3TBYB 1TVHA 2IDTA 3B3BA 1M4KA 3HE6C 2AQ2A 1JP5A 4NWTL 1TTGA 2DQGH 4P4KB 1TYEB 3QUMB 3LB6D 2R83A 4R3SB 3SCMD 3TLRA 3SB3A 2PETA 2VZTA 4TTDC 3E9TA 1ZMYA 3P2BA 2ZYSA 3PAVA 4PVMA 1V7MH 4JHWH 4N20A 1GGCL 1ZHLB 4PJ8C 3SE8L 1JK9A 2W0FA 2G60H 4LXFA 3S34H 2QDWA 3ASOB 1A6ZA 1FH2A 4XP1H 4IK7A 4NYLA 5M94B 5D4IA 1YC7A 4JFFB 4W9JC 1AC6A 3QI9B 4XMKH 3V9EA 2DAVA 5F71A 4YHPA 3VFMB 3ECWA 5GGSB 2BCMA 1RIUL 3ARSA 3RNKA 4N8CL 3F84A 5IVXE 2QQQA 4EIZC 1JL8A 3P4MA 4L3EB 4QCIA 5LBSH 5FGCB 4I9WD 4CKQA 1CR9H 3BOVA 5HI3C 1PLBA 1HJBC 1ZHBA 5HHMB 4BWUA 1CICA 2F54D 3HZVA 3BSHA 32C2B 4MD0B 5IBTH 5DEGB 7FABH 1UC6A 2M83A 4KJPD 1O0VA 4WU5A 2YD9A 4BK4A 3DWTA 4HA1A 4FTVE 2D3NA 3G6JB 1FGNL 1PFOA 3MBEB 1ZHLA 3SE9H 4DF9A 2IH3B 1LJMA 2Z35B 2PCFB 4KTEH 3EFFB 4Y2LA 1T0PB 1G7QA 1BQLH 3BKJL 3QI9A 3SQOL 5F7EL 1XGQB 2VDMH 4I1NB 1OM9A 4XPHH 5A6IA 3T4YB 1OGTB 4HQQH 2H6UA 5AAPA 2CK0H 1T04B 2FQDA 1L6PA 3U0PA 4HKXB 2VITB 2OYKA 5EG6C 4LKCB 3MBXL 5JHDE 3VTMA 3N85L 5BQ7B 2A1WL 3PWLB 4J3TA 5HPMB 3SDCA 2BP3A 5C0ND 3GRWL 3CZGA 5K1NA 4ANXA 4WUUA 32C2A 2ZONA 1GW0A 2CXKA 2PPCA 3G6AB 1JBJA 1WBZA 4P59H 4JFEA 4LU5H 2GKIA 4H13C 5F7KC 4P3CH 4QTFA 5BUGA 4AKQA 5IQOA 2EABA 3MBEA 4KY2A 1G7IA 3LN5A 4Q0XL 1JWUA 4N1EA 1KZYA 1QRKA 4UIKH 3P9LB 4Y5YC 5LUMA 3OZ9L 1QRNA 2Z35A 1QABA 1KIRA 2BNQD 2PCFA 5FDYA 1YNLL 4C56E 5SWZB 2YD5A 2R2EA 3FC8A 2DJSA 4MA7H 2EYTA 3NEXA 3FTGB 3L3OA 2DQEH 3APCA 5J57B 2IV8A 4JHAL 5HDOA 3H0TB 1T04A 2C3VA 1S4IA 3NQKA 3PL6D 2VITA 4MWFA 3UTTE 1I85A 4IDJH 2B2XH 4YHNB 2B77A 4F80A 4PRIE 3WDJA 1FIGL 4Q6YA 5EZOL 5CD5D 1S7WB 3P0VL 2CALA 2FWOA 3SJVA 5DJ2B 3VRJB 3LPPA 3PF2A 3PWLA 2V5MA 1RJYB 2HXAA 4HP5A 1AOHA 2DM3A 1KN4H 3WAJA 1I1AD 5GRJH 4DZBB 1FCGA 3BQUC 3BQUA 2CHXA 1DQTA 3MRPA 4HV8A 1QUNB 1XF5B 2VCOA 2X7LB 3AY4A 3RVUD 4JPWL 4DFIA 3P9LA 4V1DB 3I9IA 2DQFB 5KN5B 1FV1A 4IJ3B 2WUBH 3OKKB 5DJXB 1JGIA 5I8OH 5ITFA 3GK8H 1UOWA 4LRIA 5F8RC 4HG4K 2AJYL 1G1CA 3AADB 1FYTB 5C09E 1T5WA 1U8QB 5CUSL 4D9RE 3PIQB 2XA8L 3L54A 3GXIA 5JIKA 3DX9B 3N42B 5IESH 4X8JB 3VG0H 2V9RA 4ZPVB 3NIGF 3L4VA 4WI8A 3VXRB 4BEIA 2F0CA 3BH9B 2WLIA 4QR7A 3HZMB 1A3LH 3C6SA 4YXHL 4JJ5B 3KLKA 4HC1H 2XG5A 3CN3A 4UQ9A 3HNSL 4HKBB 2MKWA 1MFUA 3WBDA 1ACYL 4M4PA 3MUJA 5DTFB 4JJOA 1UA7A 1XH3A 3Q5TA 2OTWB 3O3DB 1M42A 4V2BA 5I74C 3IMWA 1E5UI 1M9SA 1EERB 2CHWA 3FU5A 4HH9A 1RZJC 4K3DH 1R3IL 1FNLA 5D93C 5KN5A 1H15B 3WTXA 1KPRA 4KC3B 1V3MA 2OR7A 4B9JA 5FGRA 3KW8A 3GMOB 2GC7C 2Z8RA 3L4CA 3NCJL 5HDRA 3RIFF 1INEL 3ZUNC 4LCUA 2IBBA 3Q1SL 1LVEA 1CPUA 2YLKA 4P4RB 3W57A 3CVDA 1E43A 2ALWA 4FQ2H 4B9CA 2GTZB 2Q7YB 3LB6C 3VFPB 3SCMC 3UZEC 2H1PH 1F8TL 3UZEA 3MV9E 4MDRA 1IGIL 4ZPVA 5G4MA 1RZKL 4OFIA 4KRMB 3TCLA 1VENA 2WWMD 1NMBH 3IDJA 3L3JA 4M3JA 4A2LA 5L9DL 5GRZA 3OXSA 2N0KA 1DQML 1EJ8A 3PGDB 2Y7SA 5LGKA 5F7YC 2W5PA 4WV1A 2HKHL 3OAWA 4IBSA 3BPCB 4OFVA 3RURA 1BW8A 3LHPH 3G5XA 2FR4A 3IM1A 4L9DA 3BVXA 3VXUB 2NX5B 5FFOA 4JPSA 4JM2A 1CGSH 1NICA 3OJDB 4TQEL 3F7PC 3OHXA 3CZSA 1V5JA 5J6GA 4DQOH 3QFGA 4M6NH 1BBDH 1SN0A 3EZ8A 2Q7AA 3GMOA 2BINA 2HUHA 4NQED 4XCCL 1K2DA 2W65B 1IM3B 3G5YB 1OD9A 1E30A 4P4RA 4ABWA 3N40F 1MFNA 5KVDH 2GTZA 5DJ6B 3VFPA 4KZDH 2JKNA 3FHAA 4YSTA 3A4FA 4KJPC 3M7FB 5I26A 1Z9PA 4DNLA 3NRQA 4QHKI 1QWUA 1NMAH 1GC1H 4HEME 3ULUD 4G72B 2BSSA 1YEIL 2XPGA 1NBZA 3FSZA 3KG5A 4JVWA 2YMTA 1CI5A 3WO4B 1G9EA 1Q94B 4DESA 5AZEH 3IETA 3K6NA 3CVIH 3NIGE 3NJIA 3FK3A 2Y36L 3QUZB 4L1DA 3PGFL 1AXTH 2IGFL 4HUKB 5E4AA 5ANMA 1C5DB 1V54B 3CN1A 3PXHA 3MROA 3Q01A 4XPBL 5FFLA 3Q8BA 1XAUA 5D70L 3IDUA 3NAAH 4HWUA 2ICEC 2NX5A 4F2EA 2ICEA 2YD2A 4X0KB 2IFFL 1NCJA 4HF5L 5C3TA 7PCYA 2DS4A 4I48A 4ODXB 4WFGD 3K0WA 2E9BA 3HE7B 3QNYB 4N87A 3LXBA 1NGWB 1CF8H 2J1WA 2XN9D 2P46B 4N2DA 5DD3L 1TJHH 6TAAA 1WA0X 4CVZB 4F9LC 3BIAX 3ECBA 4F9LA 5C0NC 1NEPA 4OGXL 1BX2B 1JV5B 2DEYX 2XRAL 4J1UA 2B59B 2KPWA 1GHFL 3APDA 2BERA 4OV6F 4B60A 2QSVA 4MJJA 1PF3A 4N5UA 3SEPA 5HDLA 5I6KA 2K9FB 5DFAA 3MLWH 2L8AA 3ZO9A 1JTTA 4EQ2A 2V7HB 2OAAA 3FSWA 2FZ3A 4OIIL 5FW7A 1CG9B 5EUOA 3BQVA 2BNQA 2HRHA 2RQEA 2NYZA 4G8IA 2EZ0D 2PW1B 2Z31B 4KOBA 5F7DA 4FD0A 3KNBB 3Q3GB 1BECA 5ECGA 1KXVC 1KXVA 1T7YA 3GI9L 3IJHA 3A6OA 2B4CL 3PL6C 1GYUA 3PL6A 3BT2H 3CHXA 4GQ9H 4ODXA 3N1MC 3QDJE 5D2NC 2BW5A 3HE7A 2CCVA 2XXFA 2ED6A 1NGWA 2YMOA 3L7EB 4RA3A 5CD5C 3VQMA 1HSAB 4PW3A 1GMIA 4QT5A 3AS2A 1S7SA 4PRAA 4HUVA 1DVYA 5I8KL 1JV5A 1OM3H 3W9DB 3KH3A 1I1AC 1I1AA 4ANVA 4IJTA 4LAQH 1IV8A 4PJCB 2FIKA 2B08A 2GCYB 5T3ZE 3MA9H 3RVUC 4TOYH 1XGUA 4EUPB 3SDYL 2X4NB 1K8IB 2V7HA 4QHKJ 5I28A 4NQUA 2X09A 3D25B 1MCEA 1A7RH 1T2XA 4X6FB 2GBUA 4M5ZH 4N2HA 3TJEL 1UVQA 3QFJE 4IKNA 1PLGH 1EJ6A 2Z31A 3N5AA 4PW4A 3V52L 1RVFH 4XBEH 2BO0A 2VZUA 3BMWA 4NRYA 1HINH 4R4FH 1KCWA 2NLJB 4TRPL 5LDSA 3CN2A 2L7QA 3FCUB 3QZPA 1Z3RA 2AQRA 4Q9QH 4M56A 5FV1L 1HK6A 5HJ3B 4NQDE 4NQVB 4L1SA 5TF1L 2KZKA 3KCWA 1LO2H 1KGWA 1IAOA 4RMQA 3SKOB 3NCCB 1MVYA 1IRAY 1WFTA 2VO8A 5GGRY 5ETUB 5CEZD 5F7MC 2AQNA 3ZE2F 4PJCA 1L5GB 5LO7A 1CD0A 2DKSA 2Z4QB 4ELKB 1RULH 3BKCH 4KTDH 5K1JA 3TJPA 1XH0A 4F8OA 2VH5L 3D25A 5CCGE 1SXAA 5SV4A 2WAHA 3FRPG 4P2YA 1EZVX 1BWMA 5IBUB 1OKEA 3ELAT 2ADIA 4NN5B 1ETB1 4HUWB 4TUOB 3ORJA 1N8OE 3PABB 3MJ7A 4FFYH 2EDTA 1DHKA 4GQQA 3PDGA 5D1ZD 3VXQA 1AO7B 4XN5A 1F4XL 5SWSD 5HJ3A 5HYJB 4JQIH 1YEHL 2WWMC 3NG5A 4FMFA 3QARA 4NQVA 4BFOA 3KWXA 1MF2L 3IDNA 2D9CA 4Y4KD 1Q9KA 2R69A 3T1WA 3ILPB 3QQXA 5GS0H 4HBCH 4NLAA 3CX5K 3OB0H 3U4BL 4PP2A 3LNEA 2ZCKH 3VSQA 3ZTJG 4ZFOL 3L13A 5FWRA 1TTAA 3AJ7A 3U30C 3QORA 4GS7C 3CBJB 3P9MB 4Y2DD 2P5WA 3DTXB 1DJZA 4J6RL 2X4PB 1ADQA 2VMCA 1D9KD 3U36A 1U3ZA 5ISZE 1N7ML 2NRDA 2VW7A 4L8DB 4PJ6A 4WI0B 3DX0A 3CG8A 4NQEA 3QZMA 4HXBH 1YEWA 5DHMC 1KTRL 1KCRL 3K2KA 1MCFA 5JXAL 3PABA 1CLVA 4YOKA 3ZIYA 3ULUC 2EIZB 5I0XA 2VDNL 5C7XH 5HYJA 3H42H 5JHLA 1ZXQA 4YS4A 3P73A 5KYWB 3UAJA 5I5MA 5GGQH 4RZKA 2AJUH 4FNQA 3HOGA 3TT3L 3ZE2E 3VD3A 3T2NL 2CU9A 2IPTH 4FTVB 4QRFA 5HYEA 1G0XA 4FHBD 1B2WL 4HGWA 1QLRA 1I8IB 3T6VA 5TE6H 1GOGA 1MFBH 3BH8A 1WQVT 2NY5H 1X5ZA 5T1LB 3ATFA 1RJLA 4UOJA 4KJWD 4N0YL 3GHPA 3OG6B 3VFNB 4UM9B 5B38B 4LSTH 1O7DE 1B4JH 5INCA 5ABAA 1UZ8B 3VI3A 4AOFA 3MJ9A 2H41A 1TEFA 5FWQA 4XMPL 2CO1A 2J20A 2A6DA 1T0MA 2EIZA 3LKPA 4M1DL 4PGBA 1E4HA 1FORL 3ETSA 1BXVA 1MFVA 2Z92B 4DEWA 4KXZI 2XY2A 1KWKA 3FBKA 4AQ1C 4L23A 4AQ1A 5JHDB 4Q6IC 3HA0A 3ZHDA 4Q6IA 4F33B 5HBBA 2VLKD 5DFTA 2EZ0C 1RIHH 5I2IB 3LMJL 4PJ9A 2NUTA 3AACA 4P9HL 3MCYA 5CP3A 5DCCA 2QHRL 5IFAL 3PAZA 5FUCE 4DAGH 4HHWA 1RLBA 3FH7A 2OMVB 4CU6A 4J3OG 4KX9A 1A5FH 3DUUB 1SHWA 3DX2A 4M8QA 2YGNA 3FHQA 2ED7A 1AHKA 3VSUA 4UM9A 3F7QA 3WAKA 2IAAC 3S8FB 1CE1H 4O9HH 3AU1B 3W5MA 4PRHB 1TOXA 3UTTB 2KL6A 1WWWX 4GP8B 2MFNA 2XA3A 3E0GA 4YE4H 4BFJA 1CDHA 1RUQL 1TJGH 5F6HI 4U6HB 1EJFA 3WEXA 4PJ5B 5F0PB 1QBBA 2W92A 1ROWA 4QYOB 4CRPA 2O61B 2QR0B 3BSZH 1KTDB 2DQJL 3OKLB 1M57B 5L88H 1KFGA 1EEYA 4OZ4A 4WKXA 4CN4A 1R33A 4NUPA 3LH9A 1AGDA 3UXFA 5FCUH 3BP5A 4EN2A 5F93C 2N1TE 4M5TA 3AXLA 3POHA 4U3SB 2NYYD 3PWPE 4U2ZA 1LQSR 2AXWA 3FULA 3VDBA 3HFFA 5T33H 2A2QT 1T5XA 4LDEB 4J3XA 4OFQA 2Q3XA 3OAUL 5KG9B 2APBA 5A2IH 1MRDL 4Z7WB 2AJZA 1ZEAL 4PBXA 1OP5H 4WNSA 5D1XD 3V5DB 5BVJB 4FCAA 4H20H 4ZMQA 5JQ6H 3O8XD 2GITA 5C09B 5L2KE 3AWGA 3D0LB 4PRHA 1I7TA 2RCSH 3I50H 5F9JB 4RGNB 3K81A 5BZDB 2WBJD 3GMPB 2IVFC 2FATL 1TNNA 2DDQH 4U6HA 4PJ5A 1CXEA 3POCA 4QY8B 2JK5A 1WD9A 2HFTA 5CGBA 2QR0A 4IBUA 4KI1A 2XUWA 3QUKA 5FHBH 3LRKA 3GBML 2B5IB 1NOFA 3VE0A 1JGUL 5LXVA 5TPWL 4ZRGA 2UZIL 4LF3B 4QXVA 3V6OA 2X1OA 4Z5RB 3L9YA 4U3SA 3MUGA 2BP0A 1A4KB 3LZQA 4ZFOB 2C9UA 5E23A 5D1ZC 3QSKB 5D1ZA 2CGRH 4ABQA 4N0FB 2ZPKL 3DPBB 3EUDA 4Z7WA 5IV2B 1ZIBA 1U3NA 1ET7A 4Y4KC 1EO5A 3S5LB 5BVJA 4Y4KA 2NXYB 4K8RH 4A6YL 2ISDA 5KUKA 2WTRA 5JPMB 1OB1A 3KVQA 1YZZA 2Z91B 3V7AE 4F7KA 1MIEL 3CPUA 5HTSA 2KI6A 4KKZA 5BZDA 4PRPE 5DQDL 1FO0H 2YKLH 2J1ZA 4LBEA 3A23A 4Y2DC 2GEEA 3IYLW 3L5IA 4QY8A 1D9KC 2BFVH 2VDNB 3ARTA 1EO7A 2XKSA 1PJWA 1BREA 3TBCA 1YO4A 3WUWG 1IGJB 4LCIL 4E9TA 4LAJH 2YSTA 3GSNH 5E6YA 3H9YA 1RMFL 2B1OA 1ZTXH 5IUSA 2W1NA 5DA4A 4NKQB 3D2UB 5F97E 4DPCX 1W80A 4Y88A 2AKRB 2D2OA 4F5CA 3HPJB 3MYZA 4NNYB 3ES6B 1IAKB 5JPMA 5IUCA 1DO6A 3SDDD 1G6RA 4XVOA 3UX9B 1EK3A 1MWAL 3U46B 3MLRH 3WY4A 2FJGA 3WELA 4NZTL 2OK0L 4MBOA 4AQZA 3IJ8A 1KFAL 1RI8A 4U6XA 3KPRE 2G5UA 5B7MA 3WTYA 4NC2B 1BM7A 2J1YA 3JSSA 4GP4B 1JZGA 3WMQA 3FQNA 1DUZB 1D2PA 4EI5B 4MAYA 4JGNA 1YEJH 5E8EB 1BPLB 1MAMH 4F8PA 3NIGB 5KSBF 1Z9NA 4D0DA 1IGFH 5AD0B 2VDPL 4KJWC 1AIZA 1A3QA 5I17A 4BKSC 5EA0H 4PB9L 1OE3A 2IGTA 4ODVH 4G9FE 3U9UB 1B0WA 2EYRB 4G1MA 3GSWB 1RIVL 3D2UA 2X9WA 3SDAA 1SOSA 1CFSA 1TETL 3HN5A 4JAMB 4WI9A 4BV1A 3IRZA 2AXFB 4NNYA 1CTOA 1HS6A 4BSWB 5FHAH 4X9YA 3FTYA 1FCCA 1MZZA 3RI5F 2WNXA 3DGGB 4NZFA 1IQWH 3TWCL 2JV6A 4ATWA 3HFMH 3TNMB 2QVKA 3GT6A 2DWYA 3LOWA 1U3JA 4Z0BH 2DD8H 2LU4A 3GXUB 5E2WL 3FB5B 4NWUH 1CT8A 5CSZB 4N2MA 3GIZL 4UYPA 4B5EA 4IYKA 4EI5A 3GEWB 5GRVK 2OPCA 3JBG7 4GIPD 2P8PB 1MDTA 1LP9B 1M2OA 5AKRA 2P5EE 3MLYL 3RWIB 1T1ZA 4UWQB 1WBYB 3U9PL 4UINH 1KT2A 1BM3L 4J12A 2A9CA 3B2XA 4OCWL 2P8MA 2V9QA 1BZ7B 2DJMA 2FWLB 3U9UA 1BMZA 3QE5A 4RSYA 2M1KA 1JTPA 3QDJB 1C16B 5I6XB 3U6XS 2CCWA 4Y5VC 1KB5L 1PG7X 2VJXA 4Y5VA 1UCBH 3WFDH 1EBAA 4DGUA 2XTLA 4WJ5B 4OUOA 3MRGB 4G11A 1JYNA 1IC7H 1QPPA 1MJUL 1KJ2L 4RX4D 5I1EL 1GA2A 3KPNA 2X1WL 4PS4L 4HXAL 4GW1A 4B9IA 4L4VD 4FP8H 2OSXA 3HLKA 3U79A 5CR8A 1YMMD 3TNMA 1QHOA 1HE7A 1EZLA 4TUKH 1HWGB 2NYYC 1KJ3L 3ZN6A 1AFVL 2DQDL 3NABH 1KXTB 4JG0H 1T2QH 5AAWA 1Y1DA 2E75C 2RR3A 4IRZH 1K4DB 2IDUA 3UC0L 2P8PA 5JYLA 4JPKL 1U9KA 3UPRA 1LP9A 4YBLB 1NAMA 3QFJB 5D1XC 5J13B 4YDVA 5D1XA 3TN0D 2YAOA 2ADGA 2Y2WA 2XXMB 5KSBE 2OP4H 1JFQH 1TZIA 2LFGA 4K5MA 1NH6A 2JJTC 2PO6D 3O8XC 4Y7OC 5D7IF 3ARFB 2R8SL 2XFXB 3H4FA 5C9JA 5DWUH 4H8VA 1RJZB 1T1XA 1E4XI 3RPIA 1C5CH 1T7ZA 4CC4A 4N2IA 1P5VA 2AVFA 3EBGA 3HG5A 4MNGA 2MHAA 3LRGA 1RFDL 3RWJA 2A74A 4HIXL 2VN7A 1WLHA 4E9VA 4LPTA 4F8TA 3NH7H 3PV6A 5CBEA 4A6YB 4JFUA 1JZ4A 1U8JB 2CJ3A 3S3BB 2MPAH 2QSCH 4TN9A 1MI5E 1SXSA 3BE1H 3H6AA 2RMNA 3I6SA 4PWHA 2YXFA 3OGCB 3B7TA 4RAUB 4TPRL 4XO5A 5I1AA 4F3FB 3RY4A 5KYNA 2IBZY 3TO4B 1EAJA 4PLJC 4ADGA 2P43B 3ARFA 2ICES 1N67A 2XFXA 3HR6A 2NTFB 1N0LB 1DN0A 2NY0B 1U8MA 3BMVA 1MJJA 1XCXA 3EIFA 3IFOB 1P7QB 1WRFA 3JZ7A 3RBGA 1A2YB 1NEZB 3ZHLA 1Q38A 1ZOXA 3F00A 3AY2A 3HNVH 2HJLB 3W82A 2BZCA 2WXNA 4BHUA 2R0WH 4LSVH 5IFHH 2R29H 3QA3A 1PD6A 1WBXB 4FMKA 4AT6A 1UH3A 4OCYH 4FKEA 3QPKA 2APFA 5IB5A 2J12B 3K3QA 2GJ6E 4KTYA 3II1A 4HOZA 1YPZA 2C4FU 1OAZL 5FYLD 4IGBD 4DGYH 4DKFH 4QRTA 3DX3A 3S4SG 3V4UL 3MGTB 4YDIH 3LYRA 2DWEA 3OR7A 4X7SL 4ADIA 4FG6D 1S5HA 3DMMA 3VXOA 4RAUA 4H1LB 5IJVB 1KACB 3IJEA 4YR6A 2X9YA 1E6OL 1JK8A 4RMBA 4Y16B 1VADB 1C08A 3R1GL 1DBJL 3D4ZA 3ALWA 2C4XA 2X2YA 3SDDC 3IMSA 2R4RL 3SDDA 1J05B 2OMYA 2VDPB 4NRZB 1UB6B 3IFOA 4X98B 1P7QA 4NCC2 3EJQA 5D7IE 5F3FA 4X7FC 1G0YR 1ZA3B 5B3JF 3QJHA 1E5ZA 3FQWB 3ULVH 2PYEA 4ZMWA 1MNUH 1P4UA 3E6HB 5MEOB 4AJVA 3L5XL 1WT5C 5F9AC 1SLUA 3PCYA 3X2QB 2Y2YA 4QKXB 3E8UH 2OL3H 2JJUA 2XQBH 5FGSA 2AQ1A 1NL0H 3FQ2A 5D7SH 5EUOF 1JVKA 4GAAA 3FB6A 2UX7A 1AZUA 3ZE2B 4BA8A 1MWAA 5KS9A 1XX9C 1OP3K 5AVSB 2B39A 2PPFA 3HN3A 1KJVB 2DIEA 3OL2A 4H1LA 3EJZD 3Q2LA 4FXKB 1MCPL 1IKFL 2EDRA 1VADA 5L0QC 1S9WB 1JXDA 1OO2A 1UD5A 1B6DA 1F45A 3H55A 1PVHA 1J05A 3KPTA 4NRZA 1OK8A 1AQDA 4ZQKB 3V4PH 3VJ6A 4G59C 4HKJA 4I1PA 3RB7A 3EADA 4EE2A 3E9UA 4BGLA 1DLFH 1CVSC 2Y5QA 3ZRFC 4I9WE 4CVXB 5B3SB 4GAYA 5DUBB 2X44D 3DX7B 5FC9A 1EFQA 2F54E 2QGBA 3ESOA 1KB5B 2FO4A 1ZSHA 3FTSA 4WO4B 3TV3H 3WD5L 5HHQB 3JWDC 3D85D 5GSRB 3GYRA 3KEDA 1KJ2B 1YJDH 1UTDA 1HWHB 5DC2A 1YQVL 1LMIA 1ORQA 4H7VA 4P0DA 4MXVF 3LZRA 4JPQA 3V4VH 1ED3A 2V8LA 1N6QL 2KBGA 2AANA 1KJVA 3UTQA 5ANME 4RISH 5EZIH 2HUEA 5GSVA 2D31B 4FXKA 1NC4A 3IN2A 4RNRA 4RX4A 4GAFB 5FO7B 4L4VA 1FNEA 4M9PA 3W56A 4ZQKA 1EHLH 5I15L 1YMMA 1JUFB 1NM4A 1SHMA 3QDGE 3WE6B 5F9WB 4DVRH 3PRZA 4JG1H 4NEHB 2FX9H 1EEZA 3BT0A 4JY6A 4F57L 4HAGA 1WV7T 4HVBA 1CLYH 2AJXL 2IH1A 1D5XB 5IW6B 3PDOB 5DUBA 3DX7A 1M9WA 1S7UB 2ROYA 4WTXA 5B3JE 1VPOH 4MDJA 3IF1B 4WO4A 1EO8L 3TN0C 4UAOC 3TN0A 5DVOA 3QIUD 2C3WA 3CBRA 5GS1B 1FF5A 2PO6C 2PO6A 1JGVL 3ARGD 5IQNA 3E1F1 3AQZA 2L7UA 4LSUH 4B96A 5DZ9A 4KJQD 4MNHB 5EUOE 1XCTB 1QSVA 5DD0L 1BWWA 5GJTH 2BNQE 3GQFA 5DT1L 1JHTB 3T8XB 2NY2B 4JVPA 3AAZA 1FNSL 4ERSL 4Z3GA 2B3IA 5E5RB 1XFPA 5EBMB 1BHGA 2ERJC 3D4YA 1KIPA 1MHPH 3OKDA 4RRPG 4MMXB 3ILQD 5CWSB 1JUFA 3WE6A 1RJCA 5D2NE 1F6AB 1P69B 3WLBB 1CFQB 2HJFB 3QAZC 3WY1A 4W9FC 3HBQA 1ES0B 1Q0YH 2J8OA 1YG9A 4KMTL 3TTSA 1J1XH 4KVPA 5ADPL 3GSOB 2QQLL 3MACH 5DC0A 3F7LA 4JRYD 4OD3L 5HGBB 3BUIA 3RWDB 1SJEB 2GAZB 3T0EB 2VABA 4AJWA 5LGHH 4KV5F 5TFSH 5GS1A 5EIIB 5IF0A 4DW2L 2CO2A 4DGIH 4NKDA 3MRJA 5GRUL 2EIMB 4ZSOB 3TGXA 4BD4A 4G43A 1ZLSL 3FT9A 2AP2A 4MXVE 1FZMB 4UTAH 1FE8L 1MG2C 4PB0H 4BSVB 4F8LA 3ULUF 1MRFH 4PJAA 4MMXA 2WNKA 2AF2A 3X3GH 4Z7UA 1BYPA 2WD0A 1F6AA 1G1KA 2EIEA 4CA4A 5IKCA 3OWEA 2C7UB 3QRBA 1ZK5A 1AP2B 4IGBC 3C2SA 4PRPB 4RGOL 4IGBA 4K94H 2OYLA 1ES0A 3SE4A 5DZOA 1HXKA 3HC3L 3KLAB 4MB3A 4FG6C 1HQRB 4YH6A 4AW4A 1D5MB 3I74A 2C3GA 1U8KA 3VGAC 5HGBA 3RWDA 3ATDA 2GAZA 3D9AL 4LLUB 4NZDA 3T0EA 2WNWA 1C5BL 1XGTA 3BISA 3BVWA 4P23B 3MQIA 5BVPL 4KK5D 1AGCA 3O41B 4UZUA 1LO4L 5JPNA 1R3JA 3D34A 5LCVH 1VEOA 4L4TD 2NXZD 2C7FA 4B95C 2ZOOA 2O6EA 4AEFA 3U9WA 2W9DL 1ZRUA 2BVPB 4GKNA 1HZHL 4KGLA 4KQ4L 4XN8A 5JW3H 1NBVH 1QR4A 2CA3A 4GY4A 3VXNB 4HUCA 1H9DA 5B7EA 2BVQA 1G84A 1KDIA 3PG2A 2GSGA 5HVGB 5G55A 1RV6X 1RU9L 5JW4R 5T5FH 1W8EA 1O6SB 3CVHL 2W8CA 1TKWA 2GI0A 1HN1A 1LDSA 1DDHB 4LLUA 3NYKA 1DQJB 3B7RL 3EJZC 3MREB 3PUUA 4P23A 1K9TA 1UWYA 3EH4B 4NKMB 1WWAX 1SXCA 2KKQA 4S1SL 3PWJB 5E24E 3CTTA 1PL3A 4HK0B 3MNVA 4E41B 4U1SB 4KV5E 3EJJX 1DCLA 4PJ8B 1NC2D 1TVBA 1BLNA 5GQBA 3MV11 5I1KL 1CS6A 4NQEE 3SOTA 2XT1B 4AYDC 3NSXA 3HC0B 1XMWA 1ZGLB 2XZQL 4GLRH 1PX4A 3FMGH 3GMLB 1QX1A 1SBSH 2W60A 4AIZB 4XWOD 1JF5A 4L3FA 3AGWA 3H2WA 4U31A 5AW3B 4U0QB 3D85A 1CL7I 4ZW5A 4ELMA 3ULUE 4AYEC 2D73A 4QHMA 1ETA1 1GW6A 1A4CA 3JTTA 3HNTH 2C9QA 4HWZB 3QEGL 5HGHA 4XZUA 5DMIH 3P2TA 2HWZL 3MLTB 4UT6L 2CKNA 3CLFH 4K3JL 3BUDA 4QTHA 4UTBL 5D72L 2P5EB 4NKMA 3NSYA 2QPFA 3PWJA 3F7VA 1WWBX 2GIXA 2WLZA 4ZOAA 1KYFA 2BHYA 4JFDD 1UOVA 5GIRA 4WFGE 3QQ3B 3AW5A 3Q6GH 1II4E 1S7TB 1ULVA 3L7FA 2XN9E 3QRLA 3JUYA 1LL1A 3GMRB 4I0PD 5TK4A 3C8DA 4XBPB 1UB5B 3GMLA 4ODUA 4P5KB 2GBVA 5DD1L 2ZNXA 4RGMC 3GLAA 3ZTCC 3DIDA 3I75A 4H8UA 4EDWL 3TPUA 2X1PA 3QIUC 1UXMA 4ZUSB 1VFAA 2EIBA 1FJ1A 1JGDB 1L0XA 3ARGC 2QJDA 1MDAA 2FBJH 3ARGA 1YAIA 5AL8A 3K74B 1YEFL 4KJQC 2WNGA 3NGBC 2YLHA 3HG2A 5AW4B 5GJSL 1VEMA 4KOCA 1N8ZB 4QRRD 2WQSA 5GS2D 3O4LD 3REWB 1TF4A 4UZSA 4GSDH 1MJ8H 1MPAL 4OVVA 2NW2A 1N9PA 5JIIA 4J8RA 5GGVL 1F6LL 5C2BH 2ITDB 1OAQL 5CIPH 1PG7H 4S1RL 1OP9A 3ILQC 3MR9B 4M02A 4U1GC 3L3GA 5FO9B 2TSAA 4J3OD 5H2BB 4P57B 1L9NA 2V17L 4DP1X 1E9PA 3AS0A 4LRNL 2OJZH 4X6BB 3BRGC 3QRFM 2FJFB 2X1XR 1LTXA 2XQYG 4XBPA 1G1OA 5AVYB 3GFUA 2QGCA 1TFPA 3JWNH 3CC1A 2YO3A 2UZPA 1ZY9A 3MI6A 4KK8D 4NI6A 1T4WA 4HKZA 5DU7A 3EYSH 5CEXA 1QUPA 1CZ8L 4C83B 3B7YA 1R46A 4PYGA 1JS4A 4HZAA 1GGBH 4QRQB 1B3JA 3RZCD 4MD5A 3GTVA 3QG7H 5AB0A 1MI5B 2QTEA 3F7RA 4CSSA 2DWSA 4PS3A 3UG4A 2FUTA 2P80A 2BP8A 2BFGA 5E08H 3IDMB 5B1AB 3ZE0B 2VR6A 4KZ0A 3PJSB 4RVBA 2VXTL 2F7OA 4V11A 1JYWA 1VCAA 1TEGA 1EEQA 1U8OB 4LIQH 3P2DA 2FBRA 1K4CA 5DZJA 5ILTH 3LNFA 3R0MA 1WC7B 1KV3A 1AHMA 3EGXA 2ZUVA 5DZNA 1S7XA 1PKQA 2YPVH 4P2QB 3TA4D 4A37A 4HUXB 4BE5A 4FQHB 1CFTB 1HC1A 5ANHA 4XO4A 3PQYD 1ERNA 2XETA 2ZXGA 2WVVB 1MIML 5EH1A 4DN4H 1XIWB 4JHBA 4PWFA 1AQ8A 3EOTH 3RGHA 3LKQB 1TCRA 2ZCLL 5CEZE 4M6AA 2IIJA 2G9HA 2J1KA 3O2DL 4KK5C 3WFHB 4F15C 3QH3B 2ZKMX 4YQXH 3U2JA 5GRWA 1I9IL 2GSIB 5K9QI 2NXZC 4L4TA 1EA9C 1QBML 2QPSA 4KUCD 1BD2D 1OAKL 2YS4A 4OCNC 1XSJA 4WENB 4AKOA 2Q3AA 4PGJA 1PQZB 3CVHB 3IDMA 5IEKA 2D0HA 5CM1A 4KJYA 2XU9A 5CMAB 2ZUQC 1E28B 4OQTH 1GZHC 5I74B 3OAYH 3X3FH 1GZHA 5DRWA 2MEJB 4K71B 3FU7B 3HG1B 1OAUL 2F15A 5AVWB 3C8HA 4KHXH 5FOJA 4GG6A 4G2AA 3RWFB 2J8UB 4P2QA 4GRWE 5E7BA 5SWSE 1EWHA 2P5PA 4G6KL 5D7IB 3TBWA 1ZVYA 4ZUTB 3ZKXC 4NO2A 3FTVA 3MJGX 1X5HA 2CXGA 3ZSTA 2CG9X 5HVFB 4GMSH 1XIWA 1G6VK 1RZ8B 3K8KA 5CINL 4WUKL 1NIAA 1FZOA 3LKQA 3T65B 4H2CA 5J12C 1F3DJ 1IEAB 4AEHL 4OCXH 4AVIA 3SCMB 3WFHA 1LXMA 4EF3A 2BX5A 2ZF9A 3X1NA 4UNIA 1A7NL 2IQAB 4XC1L 4OLWH 1LEGA 2FYYB 3RA7L 2X4TA 1NC2A 2HLAB 4NENA 4A1RA 3CVHA 2IAMB 2BWDA 4FFWD 1E28A 3K8LA 5KVGH 2CBOA 4LGSB 5DJ8B 4XWOC 3O11A 3ROOB 3FU7A 5BVPH 4JG5A 5KBDA 3BDYL 3WOVA 4KXCA 2ZWYA 1BJMA 4YXLL 4DEUA 3WNIA 2Q86B 3QULA 2QKIB 3LQAL 1BBJA 4OCMC 1XGZA 1YYML 1ICTA 3SDXF 1NGZB 4G1EB 3IGFA 1G9NL 5K93A 4UB0L 4QD2E 1IEAA 2F54B 3V8CA 3BJLA 2Z1KA 1L9RA 1OSPL 3DOIA 5E6RB 2E7DA 1WIOA 4PY8I 1BSIA 4I2XA 4DGWC 2B1AL 1DZ0A 4OGYH 1EGJA 2VZSA 3BAWA 4G80B 1SJXA 3T3MB 3OLDA 2WOYA 1CBVH 2FYYA 1YY9D 3QS2A 3ARDD 1EAPB 1B88A 4JZOA 4A2EA 4DT2A 3MJ6A 5FA3B 1XAKA 5E0QA 4I0PC 4G9DA 3SZKC 1CYWA 2IAMA 4R7VA 4IK6A 1O9ZA 2YD6A 3RIKA 2E9WA 5DJ8A 1PCSA 1JZHA 5A16A 3JTBA 1E3ZA 4ALAL 1AIFA 2NZ9D 1NMCC 4GRLD 4KDTA 2J56A 2EH7H 2QZQA 1TQUA 3QDGB 3H56A 4X7TB 2JIXB 1BQHG 2QKIA 5MEND 3T4AB 1WFUA 1T3FB 2E7LC 3MBWA 1XF4A 4WEBH 1UM4L 4N3TA 2F6AA 1DVUA 2VLKE 5HPOA 3UC2A 4JFZL 5DI8B 3EJUA 4XMKL 1SY6L 4YAQA 3EHBD 2AXGA 4P49A 1UWFA 2AK1H 3KCPB 1A7BA 5GHWH 2HSIA 4G5AA 2XYCA 4WU7A 1RHFA 5FYJU 2UV3A 5EUKA 2NNCA 4X5LA 1QLFA 3ZMEA 3OKOA 1P6AB 3Q13A 3QHFL 4J3OC 5JNYB 2YUXA 1YNTA 1A25A 1MFDH 3T6ZA 2X0WA 2PTUA 1GZPA 2F2HA 4NJAL 4XMLH 3TIDA 1CR9L 4FI7A 3CPLB 3ABLB 3BSGA 4HJIA 4NIKB 3HI1B 3U4AA 1FHGA 1QFUH 2VSCA 1M1XB 4G3YH 4KK8C 4AYFB 4H8HA 5I1JH 2GJRA 2O4EA 7FABL 1IC5L 4KKBD 4N2CA 4OF8A 1UKSA 4JREB 2JIXA 1F86A 1AGBA 2JJSC 3SO3C 3RZCC 3INUH 3RZCA 3UBXG 5ID0A 2D7PA 2WYZA 4YDMA 3D30A 4ZOBA 4JDVA 3SDXE 1IBDA 3B5GA 2AEWA 2VDML 3UGUA 5EZJA 1DBBH 1F11A 1FLRL 3DNKA 4O2FA 3PPEA 1EX0A 1UURA 1ZDQA 2ZWKA 4PY8J 1YSOA 2JKXA 2K0RA 5BO0D 4NHCH 3UJJL 2EC9T 1U92B 2ZXQA 3PWNB 5JNYA 1ZT7A 2EE0A 3HS8A 2YC1A 3RI5K 4LL4A 4BXSV 3HR5B 3OLEA 3LNDA 5D1XE 2ALAA 4UOZA 4HJSA 1NCWL 3PNWB 1A14L 1PCXA 4JZJC 3DV6B 4ZS6D 3WNOA 4FQLH 4L0ZA 3GNMH 3NJMA 2BSBA 2WQ8A 4JY5H 4CU7A 1XBRA 1AC0A 3S37L 5ICXA 4Y19A 4AUJA 1IEBB 3SIKA 1A6AB 1MVUB 1MJ7L 1VESA 4JUSA 3VM5A 3H7BA 4RRPM 3TURA 1S9KC 3QWNA 4MA3A 4Z78A 2YJQA 2YMXH 3JV6B 4TVPD 3TZVA 4OM1H 1OAYH 2GHWB 1HHHB 1CLZH 4IIQB 2YJLA 5KS9F 1PDKB 5F1IB 5J89A 4IBYA 4YDKH 3V6ZA 1U92A 3QXAB 3PWNA 4IDJL 5EU6D 3WEBA 3O2DA 1IVTA 5D2LB 4LSPL 2BY1A 3RQ3A 5E5LA 4U6VL 3C5ZD 4M1GL 4PJ7B 2IFGA 1SNRA 3FH5A 2ITFA 4LP5A 3ZE1F 4J28A 5E95B 3WNJA 2XKNB 5DJAB 4U4BA 3I9AA 3IJ9A 1F13A 5IMOA 1W0WA 2TAAA 3DV6A 5KSAD 3C9NA 1P7HL 3PAUA 4JQVC 1SYVB 4JQVA 1Z0NA 2YEQA 3ZKQD 2TRYA 3FQ1A 1E2ZA 3P3UA 4LHJB 4MXWL 1I1FA 5J06A 2IPUG 3EYVB 3H3PH 4LSRL 3DIFB 1WO2A 3JV6A 3EW3B 4KKRA 5INDA 2BY2A 1SVBA 3HPLA 2VXUH 4FFWC 4U1IB 3SODB 3CFBA 1E8WA 4ZZKA 1PDKA 3ECQA 4TMPA 5F1IA 5CEYA 2IGLA 4GS7B 5C0RH 1IBBA 1KB9J 5D2LA 5HVHB 5LDUA 1MNNA 1MFAL 1JPFB 2UZYB 1PZBA 4NWTH 5J0BA 2FLMA 4U1HA 3R4RA 2N0MA 1AKPA 1EUUA 1T89C 4HSAC 4OGAD 5DJAA 4AYMC 1QZ1A 5MHSD 3W2DL 3NSFA 1F6FB 4I18A 1PMYA 1LMKA 1B9KA 4HWEL 4ICXA 3ZQXA 1SYVA 1GGCH 4PRDB 3SE8H 4X5QA 2PMZA 4LOEA 4OD2A 3ME0A 5IGXL 4ZNEA 1FNGB 1L3NA 5TGBA 3HJEA 1IQDB 1QW9A 4WO0A 3QUXB 4WGWB 4AC2A 2AV7B 1BAGA 1YY9C 3EYVA 1EXUB 3ARDC 4F7CA 1KWGA 1PNDA 3FONA 1RIUH 4HIIA 3ELQA 4IBQA 4ZS7L 4LCCA 3BUQA 4N8CH 5I8CB 4F7EA 3C60D 3BGFC 4L29B 4XNXL 4HFWA 4PG9B 4LGRB 1TZGL 4ZTEA 5BV7C 2R2BA 4JGJA 2NZ9C 3FT4B 4PR5B 4PRNB 2ZE0A 4GRLC 5KS9E 4GRLA 4X9FA 5DHYA 3SYOA 4XPFL 1H3PL 1WWCA 5MENA 3DJSA 1HWWA 1JWMB 1FFQA 5EN3A 2XN9B 4AL8C 3AQXA 4MLIA 4XN9A 1T0NB 4N2KA 1ZA6B 3M45A 3ZE1E 3EJSA 3HAEB 1IL1A 1FGNH 3D39B 4F9PA 3FRUA 3EHBC 3LHPL 3MRCA 3S9DB 3LY6A 4DGVL 4WW2A 4HS6B 4EZMA 1UYWL 5JLZB 1NDMA 2AV7A 3BKJH 2CH8A 3SQOH 5F7EH 2JKRM 1ODUA 4WKZB 3DVIA 3KBPA 4XMWA 4AKPA 1XMEB 2BSTA 3CMOL 3FBQA 2JKSA 3NESA 3SGDI 1E40A 4NHUA 3II3A 2PYFA 3NJFA 3F5WB 4KKBC 4PRNA 1HX0A 3QCUL 4KROD 2LR4A 4I5BB 4L18A 3EYFB 3N85H 2ZSWB 4R7NB 4YPGB 1PFCA 2NNFA 1FL6A 3GRWH 1JWMA 5AVTB 1UG9A 4HK3J 1QSFD 3GSQB 4PJAF 4RAVB 5K1VA 3TU6A 1W2KT 3RWEB 4Z7UF 4RLDA 2I9TB 1T0NA 4YK4B 1ZWIA 3K71B 4AW7A 5LBSA 1FVCA 1AXTL 1ZA6A 2Y69B 4PVLA 3WHE0 3HC2A 3HAEA 3D39A 4L4VE 4PMEA 4Q0XH 3NMEA 3WJJA 1YMME 2IXQB 1YA5A 1CUOA 1P6WA 4CMHC 4GO9A 3IPFA 4MSWA 4HJGB 3OZ9H 4HS6A 4AGQA 2A3TA 2HN7B 4FLQA 3K80A 5DQJB 3WMSA 1OSZB 5TQ0L 2CLRA 1YNLH 5SWQB 1VFUA 2WO4A 2FT6A 3QBTB 4WKZA 3MRDB 1SLVA 1UD4A 4Q4IA 1U93B 4JHAH 1QSEB 3FS9A 3M46A 4X2UA 3ZR6A 1C9SA 3I02B 4PJBB 3W81A 4NN7B 5DEFA 3UPCA 2CRMA 5G2NA 3UZQA 4P2OB 1T4KB 2BC4A 2WJ5A 4XBGA 4ZS6C 1F3JB 3HC4L 4J27A 1ACCA 1QOKA 3F5WA 3QHZL 1FIGH 5EZOH 5IQLA 5AFAA 3P0VH 1FQ9C 2GUYA 3L4WA 1HHJB 2ZSWA 3VXSD 5K59F 3O3AA 3ARPA 1ZHNB 2N7BA 3MCKA 4TLKA 3RLSA 3L8QA 1RPQA 3KPMB 5HYQB 3STZA 5E8PA 3JUZA 4NO0B 4PIBA 2Q76A 5EU5A 4JPWH 4CADA 1PD1A 1QYGL 1S3RA 3B8SA 2V7NA 1JD7A 3CFUA 4FLHA 6CGTA 1DDTA 5TDNA 3VACA 5DQJA 4I88A 3PUCA 1D7CA 3HCVA 2FHCA 4N3UA 1A9BA 3S5YA 4E5XB 5KJ7E 5EU6A 3T6WA 4IOIA 3VMPA 4ZXBD 4ISVA 3C5ZC 2AJYH 3DSFL 1H6FA 1QSEA 2A83A 1FUNA 3LPGA 4M5SA 2HG5A 4FZEL 1I8MA 3TBTA 4EUPH 2X3CA 1AZCA 3KDPB 5CUSH 5I6OA 2XA8H 1G7PA 3T1FA 4N8UA 3ECUA 3QJFB 5E94A 5E70A 3L45A 2XPZA 3NN8B 4QOKD 4FQXB 2LV4A 4R97B 3AITA 5KSAC 5E2TL 4NC0B 2DLEA 1HQ4A 1QEXA 4MD4B 1UA6H 3WFEL 5FPIA 1K85A 1RHHB 2X9ZA 1A6PA 1IUZA 3LN9A 4YXHH 2JCCB 1GIGL 1XXDC 3K0YA 4TOYL 1M56B 3SGEI 2X87A 4C4BA 1ZHNA 1ACYH 4GRWB 4OF7A 1WSST 5SWSB 3VA2C 4YDLB 1S7RA 4K4KA 4YFEA 5BRZA 3HLAB 4YWGH 1SLXA 4MNQD 4Z3JA 2OXGB 1M3JA 4PWIA 3TA3D 2FSDA 5FB8B 2Q9OA 4PJAE 3DTUB 1HXMA 4Z7UE 4JBSA 1R3IH 2XXCB 3J2PA 3FYEB 2Y0SA 3HZYA 5B21A 2EEXA 4MKTA 1CGUA 1YUHA 5FDWB 3K4AA 2OSWA 4U1MA 4ZUWA 4XP9L 5HD8D