2Q2LA

Crystal structure of superoxide dismutase from p. atrosanguina
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
152
structure length
152
Chain Sequence
b'MAKGVAVLSSSEGVAGTILFTQEGDGPTTVTGNISGLKPGLHGFHVHALGDTTNGCMSTGPHFNPAGKEHGSPEDETRHAGDLGNITVGDDGTACFTIVDKQIPLTGPHSIIGRAVVVHADPDDLGKGGHELSKSTGNAGGRIACGIIGLQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide Dismutase
molecule tags Oxidoreductase
source organism Potentilla atrosanguinea
publication title SAD phasing of a structure based on cocrystallized iodides using an in-house Cu Kalpha X-ray source: effects of data redundancy and completeness on structure solution
pubmed doi rcsb
total genus 33
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2q2lA00
4A7QA 1HL5A 1F1AA 1SXAA 1E9QB 5KBLA 4B3EA 2E46A 2R27A 3HFFA 5CU9A 3CQPA 3ECUA 3GTVA 3L9YA 3MNDA 2VR6A 1IBHA 1IB5A 1BA9A 1YAZA 3PU7A 3GZQA 3L9EA 1OZUA 5KBKA 4N3TA 2ZKYA 1B4TA 3H2QA 1DSWA 1FUNA 1YAIA 1F1GA 1N18A 4OH2A 4A7GF 2AF2A 1SXBA 2AEOA 3KM2A 4BCYA 2GBTA 2WWOA 1OZTG 1PTZA 1U3NA 3KBEA 1RK7A 2WYTA 3MKGA 1JK9A 2VR7A 1XTLA 1EJ8A 3F7LA 1IBDA 3HOGA 1SDYA 1CB4A 1UXLA 2Z7UA 1KMGA 1EQWA 1F18A 3H2PA 3CQQA 1SXSA 4A7SA 1TO4A 2WWNA 1AZVA 2AQRA 2ZKXA 1SDAB 1E9OB 1E9QA 3K91A 3QQDA 2SODB 4N3UA 1CBJA 3S0PA 3GZOA 1OAJA 4A7TA 1F1DA 1SXCA 4A7VA 2AQQA 2XJKA 4MCNA 4U4IA 2VR8A 1SRDA 3GZPA 4L05A 2AQPA 3T5WA 1MFMA 1IBBA 1PU0A 2E47A 2V0AA 2AQTA 1BZOA 1SXZA 2JLPA 1COBA 2WZ5A 3GQFA 3RE0A 1JCVA 4OJAA 4A7UA 3ECWA 1N19A 3KM1A 1OEZW 1P1VA 1SXNA 1Z9NA 4BD4A 2K4WA 1QUPA 5KBMA 1E9PB 3KH4A 1HL4A 4MCMA 2WZ0A 1OALA 2ZKWA 2Z7YA 1B4LA 3KBFA 1SPDA 1DO5A 2AQNA 2XJLA 1E9OA 3QQDB 2GBUA 4FF9A 1Q0EA 1JK9B 2C9VA 2JCWA 2WKOF 1UXMA 3CE1A 1E9PA 2WZ6A 1SOSA 2WYZA 2Z7ZA 1L3NA 2GBVA 3ECVA 1ESOA 3KH3A 3SODB 2LU5A 1TO5A 2ZOWA 1Z9PA 1S4IA 2AQSA 2C9UA 3GTTA 2NNXA 1XSOA 3HW7A 1IBFA 4A7GA 4BCZA 2APSA 1XTMA 2Q2LA 3LTVA 2C9SA 1PZSA 1YSOA 3F7KA 2Z7WA 2WKOA
chains in the Genus database with same CATH superfamily
1BZ7A 1FZKB 1CU4H 5JW4N 2GTQA 3A22A 1ACXA 1IL1B 1AE6L 2Z64C 5JO5B 3D0AA 3EJSA 5EU6E 4NNPL 3FULA 3LZLA 1A2YB 1XF3A 2CM6A 2WLHA 4PV9B 4Y9CA 3OGCA 4U1JB 5FF6A 4LHUA 4CVZB 2ICEC 5FW6A 3ARRA 4K94L 3G04A 3H85A 1UKTA 4J6RL 3WJMB 2H9GB 4GOSA 1ZANH 1MRDL 2X2YA 3UYOD 1OP4A 5A16A 3EO1B 1TEYA 3HZMA 4FNPA 4H8HA 4YEFA 4Y7OC 3ZDZB 3FB7A 3UBXI 4U1IB 1V7NH 5DLLA 4HIXL 3RB5A 1TZOA 4UV4H 3TWYA 4I48B 3OF6A 2NY5H 4IU3B 4FZ8L 4H40A 2Y7NA 1F97A 4NZDA 1CB4A 1KCUH 3NABH 3MJ9L 4BH7B 5EN2A 2XX0A 4MXVF 3V8OA 3GLDA 3QWQB 3KLHD 1CXFA 3D25A 1EPFA 5J06A 2PPAA 3O4OB 4PJBF 4Z77A 2IALA 3X12B 1RUMH 2NUPA 3MRMA 5JZ7C 4MNQD 1RIUL 4KKLC 2KBGA 1MRFL 2DQFA 4Z7WE 4G82A 1NPUA 4KX9A 1S5HA 5E0QA 3MV7B 4M6NL 5IUCA 2R15A 3S36X 1GTFA 5C07A 1BV8A 3OPZH 2K7PA 3FZUD 1VLXA 4K7PH 1BD2B 5L9DL 2VN7A 5B8CB 4PTUA 2B1AL 1VJSA 1M6OB 2AEQH 4I1PA 3C8KB 5IFJA 2PP9A 3CZFA 1HKLH 2FLBT 5I28A 1OAKL 2AFNA 4FFWC 4QHNA 4M00A 4BDVA 1CF8L 5EBMB 5BV7H 3DVFA 3UBXG 4WEMB 3MBEB 1DN0A 3HAEH 3P3RA 2MQ3A 3C8DA 5F1NB 1QAWA 1KJMA 3G08A 5JPMA 1N2RB 4EI6B 4PJAA 2ZUQC 3BYYA 1RZIB 1FLRL 4NGHH 1JHKL 5GGRA 3C6LC 4IU2A 3FCSA 3VACA 5C2UB 5I1GH 2E75C 5INDB 1PL3A 1NIEA 3R4DA 5J5EA 5BVPH 2EC9U 3HZ3A 1WHOA 4XC1H 4LLDB 4XHQA 3RL2A 2VDPH 5EWIL 2YR3A 3WKYA 4I0CC 2BNUB 2UY6A 5JQ6H 1YEFL 1T1ZA 4PJ5D 2B3RA 2I26N 1DUYA 4NO0D 4PQXA 5DD3H 1AFVH 1A6PA 1O5DT 1T5WB 3VWKD 3Q5TA 5CAYB 2HCZX 4ZUSA 2CA3A 2ZYHA 3SBPA 4TVUA 3MBXL 3HTLX 3TS8A 1J11A 5AUMA 5BRZA 2OYKA 3SQOL 2P8PB 4J2XA 3NA9L 4M6MH 4OZIF 2NNCA 2ENJA 5DVNA 3FQNB 2K9FB 1GY2A 4MJ6B 2JI2A 1FVEB 4ODUB 3B3IB 4RQQB 1I8KB 2XWTA 4Z5RB 4ZXBA 4CC4C 5FGCB 1QFUL 2J4WL 3T0EC 4J3XA 1FNFA 2CLVB 4AZ8B 4MMZB 3TNMA 1P7BA 4P23D 2P80A 5ESVA 4JEGB 1JXGA 3WTWA 2WSPA 4UILL 3WMPA 1OP9A 2WLKA 2J1WA 3TCTA 2VWEE 3T6QC 1ZIAA 5BVJA 2J56A 4N2NA 1OV8A 2AF2A 3ZW3A 4PJDB 1HHGA 1WFOA 1HQ4A 4I2XE 1BM7A 4FP8L 1I85A 5IVZB 3ZVVA 5J89A 2ZYIA 3G6DL 4HJ1A 1V05A 3KYAA 3N6YA 2WVTA 4MMYB 1T20A 3ILEA 2E7CA 4AQ8A 4LLVB 3Q8EA 4J8RB 5CEZL 3OGCB 4N9OB 2OL3H 4BBWA 3IB4A 4H25A 1M7IA 1LO3L 3D39B 5F89A 1Z5YD 1G87A 5DA4A 1PY9A 2R69A 3BDXA 4HXBL 1AO7E 2WO3B 1AHMA 1CBVL 4BFJA 3K2UL 2BVOA 2WSDA 4RFEA 3FB5A 1WCBB 2WXGA 3MMEA 3PWPA 1NLDH 4FXLA 3G9VA 3GO1L 4ZTPL 3ZPDA 5JQ6L 2CO6A 4FG6C 1S7WB 2AJUL 4M3KB 1DVZA 3CMOL 1PEWA 1JCVA 1N3NA 2VDKH 2J1YA 3RWIA 4BFIB 5ICZA 4NHCH 4BZ1H 3GEFA 4XCNB 4E9VA 5SWZA 2OK0L 2G75A 3NSJA 1JZ3A 4OCWH 3IT8D 5AVRB 1YNTF 1SQMA 4LP8A 5C09A 1HIMH 1T89C 2QPSA 3QNYB 2DQJH 2WC7A 1VKXA 5C0BE 1JWMA 4TQIA 3S4SA 2UXFA 4GXVH 4G43B 3VXUD 4UZGA 4KY1L 1KXHA 4NYLA 2XY1A 3GXPA 3U9WA 3APMA 3MJGX 3NJIA 4A38A 4DGWC 4HAFA 3QPQD 2WZ6A 2R51A 3X3GH 3LXCA 3EXJA 2P5EA 2G9HB 3JWNH 4G5AA 3VFPB 1CZ8H 3NABL 5HHXH 3RTQA 2W91A 3F04A 3L5WB 1IBGH 2VL4A 4K5MA 3SY6A 2LU5A 4AM0A 4X0KB 4GJTB 2F8OA 4G8GA 2XNAB 1WYJA 2AXJA 5E51A 2W1NA 4HGMA 3H9YA 4MZ2A 3UH8A 1RZ7L 4UTBL 3G5XA 2YQBA 4DGUA 4HQQH 3LSOA 2B9AA 3FFCB 3DKHA 4Z7UB 3J7HA 1NH6A 2F5BL 5GZND 1A1MB 3KEDA 3IJHA 2Z92B 4M1CD 5HHME 3FTXA 4ZAKA 3WKML 2ZAIA 5KN5A 3MRLB 1F58H 1EERB 4WU7A 2L4OA 4D7PA 3FCBA 1WFJA 3TC9A 4FKHA 2YD3A 4HPYL 2JQMA 1GPOL 5F9AC 3FT2B 3GPEA 4GIPD 4PJHE 4HIHA 3P77A 4I48A 4JRXD 1PF3A 4OLYL 3M88A 2DWXA 4ZFFB 5GRWA 1BLNA 3GK8L 2EAEA 4G7YH 2L7JA 3QUGA 2P24A 4DCQB 1M2VA 3M1OA 4GXFA 1R3HA 3HI1B 4NWTL 4JFEA 4WKZA 4RRPA 4DK6A 1WT5C 1KJVA 2BSSB 4FMKA 4MA3A 5JW4M 1HINL 1IBDA 4G80A 3WOVA 4ZMZA 4WTZG 2E6QA 2FSDA 1I7RB 2Z1PA 3GSUB 3LZOA 1RHFA 3OC8A 1E4WL 5EBWB 4XPGH 4PJGB 2ZPKH 2VR5A 3DJRA 1NUGA 5FDWB 4FHKA 4R4FH 5EG6C 1KCUL 4BHUI 5BUGA 4D7BA 1BHGA 2VDQH 2W81C 3W0WE 1EAPA 2ZYRA 3C87A 3EAKA 2B59B 3QR0A 1C5CH 3C5ZB 3T4YA 4BCXA 3AREC 2JMRA 1QSEA 4V1DD 5T1MB 5JHDE 4HWEH 5TGBA 4H4NA 5C0CA 4HIJB 3TYGH 5KSAB 5C0BA 1ZLUK 3V4PL 4UF7C 5DMIH 1QNIA 3TESA 5A2LH 2NW3B 2IWFA 5C09E 2NSMA 1YO4A 2PCFB 3WKNA 3RI5K 1IEAB 1LNUB 2OX5B 4OCLC 3VFMA 3R4RA 1JNNH 1RJYB 4CN1A 1YEJH 3KDMA 2WHVA 3AABA 4Z8FH 1R3LA 1CCZA 4IRSD 5C0DB 2IWEA 2DQCL 3PJSA 1S7RA 3IMUA 2AQ1A 2XACC 1KTCA 4ODHH 4P46C 3V0GA 4PJBB 2DJMA 5DHVH 4Z78B 4QO1A 2WGXA 1JZ4A 2DQGL 1GOHA 1ZS8A 4UQDA 1U58B 2OMXB 3D50A 4MAUH 4AY0A 2IAAC 2N3JA 3W1ZA 1KIPA 3BGMB 3LMJL 2V5MA 4IQHA 4UU9A 5KSVA 4M8QB 5F9WB 3TH2T 2J8UE 4LP5A 5SWSA 1HILB 4PRHD 3QIWB 1CYXA 4ODBD 1Z9SA 2FJGB 2YOAA 5C3LD 4B53A 1G7PB 3ORJA 4PCKA 3X1BA 5J6HB 3BP4B 2G3XA 1PGRB 1HXYB 4GSDL 4AMXA 1ET8A 5E9DD 2OR8A 4IS6B 1T0PB 1U8NB 4TUKL 2VZSA 1AMYA 3LN5A 3LS5L 1T03H 1S7VA 2E9JA 2VT0A 1FWXA 4PGDA 2O5XH 2DI7A 3PE9A 5AL0A 3CQPA 4L2YA 1BFOB 2A6JB 1BQLH 4JG9A 2F53B 4U6VL 3QJOA 2VXQH 5D7LB 3RVTD 4MD4B 5DEFB 1L7TH 2DBJA 3ARFB 1Z5HA 3MFFA 1VGEL 3MOAH 4YAQA 3DK2A 1ZEAH 3TT3H 4ZUUB 1J7VR 1JFQH 1NC4D 1JZJA 1A6AB 2GJJA 4N5ED 1F3JB 4FYSA 2D9CA 1XBDA 2GEEA 4I13B 5IJVB 3KVPA 1GGBL 1UWXK 1PSKH 4Y2DD 5F1SA 1XGTA 2ED9A 4IYKA 1ZLDA 3QQDA 2QFPA 4QHLB 4JM2F 1LP9B 4Y8AA 1YY9D 5EUOB 1JGUL 1BBDL 1SBSL 2FBOJ 2GUOB 5FO9A 1A9EA 2P7TA 3I9PA 3NTCL 2X4RA 1SRDA 2AJ3B 4XPFL 1VGKA 1MLBA 1ZE3C 4YO0B 3TZVD 4M5YH 4BFBD 3N40P 4E0RB 5HI4C 4D9QD 4HGWA 3LXUX 4GAFB 1AG0A 4L1BA 2DIBA 3AT8A 2YA0A 2OJ1A 3B4NA 4OTXH 4RBPH 4N2CA 2CA4A 1X7QA 2B0SH 5DJ6A 1AQMA 3SDXA 4HEMA 3DSNB 4OD1L 3OJDA 1HS6A 3DIFA 2IG2L 2H1LM 4MXQC 3L13A 4Q2ZB 2F8IA 1CGTA 2FIRT 5B39A 4C56D 3KGUA 1SOKA 2AJXH 4QRUB 1UD6A 3X13A 2AITA 2GITB 5M95B 3QUMB 4NQCD 4XVTL 2ZX7A 3Q1EA 1M57B 3BPOB 1EHAA 5FK9B 1RPUA 3E2HC 2RMNA 3OPZL 1PZ2A 1XCWA 2K70A 1I9JH 3VD1A 4F58H 1KCLA 2BVUA 2B4CL 1L0XA 43C9B 3GMRA 4KHTL 5FFGA 4HUVA 1CFNA 3B6SB 1GOFA 1D3CA 3PLYA 4X7TB 2CIIA 4Q6IC 4YEEA 4WI2A 3SYOA 3QDMD 1VZIA 1KSRA 3HR5B 5H2BA 2BNQB 3C6SA 1ZRUA 3G5YB 1JWSA 4LZKA 5MEOA 4UIMB 1IAII 2APSA 5MEQA 1KV7A 2DM7A 3QDGA 4K07A 1KFAH 3MTRA 1PZ5A 5GZOD 1F4HA 4KI5E 1DANU 4APQD 3CAFA 4ZXBC 5FUZL 4M6AA 4YXKH 3N85L 4PWIA 1SJEB 1LMKA 2BY3A 3EYUL 5HHNA 3SE4C 4FG0A 1D7BA 3TGXA 2O5ZL 4EI0A 4JHZA 2ZF8A 3BGFB 5IJCC 4P48A 2E8YA 4XMTA 2PETA 1DQIA 4MNGE 1MW0A 1LD9B 3U7YH 4MNQA 1NAKH 4XNMB 1ZHKB 4H8WL 1MVFA 1JBJA 4MVBD 4IM8A 4GAAA 4BWUA 1JZDC 3CDZB 3NA4A 3N1QC 4ZUTA 4FTVB 1FAKT 4XB7A 3V6BR 4D0DB 4D0CB 1CXEA 3O45B 4KC3B 1G0YR 1HH6A 5EN3A 2V4LA 1BQHB 3O11A 4Z3GA 3QRGH 4BDVB 4XZ4A 1UCBH 4J3SA 4PJ9B 1GYAA 4MNGB 1QKZH 1QFWL 5CLXA 4OT1L 4M61B 1BBJB 4HWUA 5IG7B 2VMCA 3QUXC 3RVWC 3TN0C 1AGFB 3BVTA 5AAPA 1H8OA 5D2NB 3FF8A 1ZVSA 3QEQB 3V0VB 4G6FD 4GKSA 4ZNEE 1PAMA 4F2ME 1RFDL 2R1XA 5H4ZA 3ZBMA 2HKHH 5A3IC 1W6WA 5CIPH 1C8PA 4N9GA 1NCGA 1NCBH 3ZZQA 4N5UA 2H0EA 2B1HH 2Q1EA 1JTPA 4N2AA 4NKMA 4AYFB 2EZ0C 1I7ZA 4GRLB 1HI6A 2ATKA 4O5LL 5JA9A 1AQHA 2YHGA 2Z1KA 2A6KB 3E9UA 3HNVH 3KLHC 5CEYA 3IJ8A 5IMKA 1AGBB 3KHOA 1Y1DA 5HJ3A 1FYHB 2VC2H 2YIHA 3T4YB 4OJFH 1YEIH 4BD4A 5KTEH 1C12B 3HPJB 4GFXA 4TVPL 4Q0XL 4GMSH 5BOZG 1L9RA 5D71L 1MHCB 3L4XA 5E1IA 5ES4B 4R8WL 2N56A 3ME0B 5ITFB 3MCKB 1PVHA 5DZJA 1NANI 3FT9A 3BUBA 3FT1A 1H8LA 1MUJA 1BIIA 2ZWLT 3AW5A 1AO7B 4HOXA 1R6VA 3EH5B 5I15H 3OKMB 4BSWA 1MNUL 5FA4A 3X14B 4L1SA 3INOA 1BG1A 3QHFH 3II3A 3SGDH 3L3IB 1TT6A 2EDKA 2Z8RA 4Z7VE 3W2DH 5HHOB 1JSYA 4N1HB 3V0WH 3E3QC 5FAAA 2OJZL 4I18A 2BIHA 1NMBL 1UA6L 2WCGA 1FAIH 4FFWD 5BQ7B 5DF0A 1GS7A 3OHMB 1KGWA 2QTVA 1MY7A 2JCCF 2FRGP 4TSAL 3QG7H 3BN3B 4JCLA 3V10A 4QRPE 1NBVH 2JJUA 2WLZA 4J23A 3GLEA 5I66B 2DM3A 2CD0A 3QK0A 5F0MB 4AGOA 4MQ7A 1U3HB 4JM4H 3VXSB 2A4EA 1XCQB 5IQ7H 4LVHB 4OFPA 2CCWA 4PJCB 2EKJA 4GO6B 3VNZA 5LAXA 3MCLH 3OD3A 1IFRA 1RZ8B 5T5FH 3OKOB 3VXRE 2HMIC 1RSFA 3DX9A 4Q56A 1YJDC 2H3KA 4A2EA 4Y4KC 4DKEH 3PHAA 1EJFA 4NAQA 3EYQC 4XNZC 1NIAA 4D0DA 2WCSA 4ZMOA 1NBYA 3GUFA 1AHWB 1IAIL 4XPTL 3P30L 3MNWB 2XNAA 2KUTA 1C5DA 1W0YT 3DBXA 3IFLL 3QPKA 4FP8H 5E8NB 3VFUA 1CG9B 3VXNB 5K9JL 4G9DB 1F42A 3P3TA 3VW3L 3PFQA 4FG6D 1YZZA 3HOGA 1J9QA 4RDQG 2AK4E 2VR9A 5DEGB 1I9JL 3LKSA 1AMXA 4AITA 5A3ID 5I6LA 4UOJA 3QNFA 4F80A 4MJ2A 5T1LA 1UUNA 2EXWD 5I0WA 3KVQA 2F2HA 2EECA 2WBJC 1NPJA 2ATPA 3IRPX 1D6EB 3LCYA 4YWGL 4NIYE 2WYHA 2GABA 4YHML 1ADQA 3K2UH 3S5ZA 1A4CA 1CFSB 2XPZA 1FP5A 1VFAA 2EADA 3D6GA 5CSBA 5TDOB 4ZX3A 4X5PA 2ZG3A 5BZXA 1FSKB 2CGYA 4JCMA 4Z7VB 3CVCA 3BUIA 4XNQA 4WLCA 1TLKA 3T4AA 2H6PB 1RUKL 3V6FA 2J1KA 2OLDA 2OMUB 4NQEB 3U25A 5KJRH 3LB6D 3LZRA 4X99B 3R8BB 4KXCA 4RFEB 4ENZA 1GZPB 5ITFA 1TTAA 3S3CB 1OY3B 2EC9T 3GRBA 3M07A 3TBSA 3DA0A 1ZPUA 4GXVL 3NCJH 3GS4A 3J8F7 1U8JB 2XETA 2ZWKA 3CK0L 3MV8A 4MAYA 3BIAX 3O41A 3Q2LA 5E6IB 4WI0A 1OWRM 4X6DA 1WBZA 2CRMA 1TSHA 2EUXA 1E4XL 1S7VB 3RGVC 3BKYL 1TNNA 4FG4A 5E5UB 4H8WC 4M8VA 1XD1A 3HG2A 4MSWA 4LVNB 4OCXL 1Y1UA 4L29A 5BXFB 3WS6A 2XA8H 1E27A 3DOHA 3FT3B 4KHTH 5HSFA 4F2MB 4TNVK 3B8SA 1BX2A 2C9UA 5A2KH 4OVUA 2PMZA 1UWGH 3SPCA 4DP5X 3AMLA 3ASOB 1XAKA 2ZSWB 4A7GA 2HFTA 2DLHA 3RUGB 1M71B 3ZDZE 3KPRD 4BSVA 5IMLB 1IGMH 3VQ1C 3FQ1A 3V4VB 1OD7A 4J3OF 1F1AA 3H9ZA 3VD5A 3CWGA 3WSQH 4TMPA 2F7PA 2VW7A 2XWXA 4HJJH 4LASL 2UUDK 1JPEA 2GEQA 2VKXA 1FH2A 2VXSL 2VJXA 4JZNB 4DT2A 3T8XA 3MLRH 5MI0C 2VABB 4QHKI 1IC0A 1VFAB 3GS0A 3BHBB 5DZAA 1YYLL 1T83A 3KJ6L 4F7KA 2E74C 1RVFH 2NR6A 3CPUA 2X1QA 3FU5A 3V4VH 4EQ2A 3G5ZA 3MU3A 4L9LA 4R0LA 1I9IH 1CL7H 1CR9H 2CM5A 2HX7A 1HAUA 1DZ0A 1T1WA 2JKNA 1RHHB 2X10A 5SWSE 4RFNC 4N85A 4ZW7A 2VQTA 2QFRA 4GS7C 4KKRA 1MRCL 4CVXB 3TYFA 5JHDD 1NIBA 5BV7L 4IRZA 4GKNB 4ORGA 5F8RC 1G1OA 2XU9A 1B9KA 4K3HA 1OAZL 1N10A 2WXRA 3MYZA 1A5FH 4UZSA 3U7AA 5I17B 5IESL 3WFDL 1SJXA 2YD4A 1CBJA 3UJIL 3EJPA 5DS8B 1Q9LA 1T0MA 2ENQA 5I0ZA 4XHJC 3BKYH 3UMNA 4RGNB 4K8RC 4E5XA 1OPGL 1WICA 3ISRA 4Y2DB 2DMBA 2EKSB 2IGTA 4LSQL 1I8LA 5J9PA 1XCTA 2YRZA 3GMRB 3JWNE 3FN3A 4JO4H 3DGCR 5CGBA 4OZFG 4HIIB 4N90D 3I6LE 1RMFL 4WV1B 5MP6L 4M8QA 3DOSB 3K4DA 5IKCB 1E40A 4ZPVA 4X4XA 5IQ7L 1U95B 1Z3GH 2AGJL 5DVLA 5HDWA 3W82A 4KJWD 3FN0L 4H26B 1SF5A 2A77L 3IMSA 1SYVA 2GSMB 4RMVA 1QEXA 1N59A 4F15B 4NP9A 3A4FA 5D5ME 4AI7A 4S11A 3ME0A 1E9PB 2PYED 4JRFA 4PJBA 5CF3A 1RUAL 1UA3A 8FABB 2P5WD 4NUJB 1ZY9A 3CIQA 4NPKA 4W9GC 3Q6GL 1K4DB 1TPXC 1G43A 4QXVA 4QAMB 5CWSB 3ET9F 1WAEA 1YMHB 2JELL 5CEYB 2ODHA 2Q8AH 4KUZL 2WKOF 4QIRA 4I88A 4LKCA 4E41E 1IM3B 4QKXB 4WKXA 4MD5B 3IVKA 1MAKA 3FL7A 5DK0A 3SJVE 1A9EB 1F8TH 2FATL 3TOPA 2Y2WA 3D3VB 2A73B 4TQEL 5JIIA 2CPUA 2PW1B 3GMPA 4GQQA 2FGWH 3QSKB 3TASA 5GGVY 1G7HB 3CSPA 3QEQA 2VXVL 2V2WA 1U3HC 1KGCD 1NEZA 2X0UA 4H1LH 3ARXA 3WS3A 4HG4J 2HG0A 3HIZA 1C5CL 4OZIA 5HVHC 3A4EA 1R3IH 1GGIH 2Z65C 1UA7A 3TO2A 1YYCA 3NCBB 4ANWA 3BAEH 1FFTB 1M1SA 3GEWB 3LKOB 5F93C 1MNNA 3MAWA 5IF0B 4APQB 4Q58C 3QQXA 4IW4C 4IMLB 3MCLL 5DHMC 3OQ3B 5FEBA 3T1WA 4GIOA 3BQVA 3E8UL 3ETBF 5F7BA 4HIXH 1ES0A 2CALA 4YPJA 1DLHA 1NFIB 1UWXH 4X4ZA 2PCXA 5AVTB 5I5JA 1TUPA 1N7MH 4X4MA 4QRRA 4X9IA 5I16B 5DJXA 3WL9A 2F58H 3F65A 3ARGD 1KBWA 3LEXB 4EDWH 4CSSA 2VYRE 1WEJL 5DHXB 4KITB 3P77B 5MENB 3F12B 1V3KA 5DWPA 3ZKNC 5KJ4A 1D5ZB 4MD5A 1IZJA 1EQWA 5CEZD 3D33A 3A6CL 4ES8A 3U4EA 5JDSB 1JWUB 2P5EE 2BHUA 2X1PA 3X11B 2UV3A 5JIQA 2BC4A 3N1PC 3AG2B 1CFSA 5ECJE 4R4BB 5FYLD 5GGSB 3ETTA 4N2HA 2XZCL 2YA2A 3P4MB 1YUHB 5K93A 5B21A 3IGUA 4JK0D 1ZHNA 2VUOA 4MXQD 2A9AA 5EMYA 1XGRA 3WNKA 5DEJA 1G9NC 1IGFH 2XG4B 2GSIB 2WLMA 2Y7MA 4G1MA 4FQCL 4PCYA 1J12A 3NESA 1FIGL 5D1ZB 4Z95L 5GIRA 5LCVA 1WWCA 5JPMC 1U95A 4YSTA 3LPGA 3NCYP 4PJBE 2W38A 1UZ8B 3FU9A 4QRUA 5FM8A 1SXNA 1WITA 4IKKA 3ZE1E 4UT6A 3PWPE 3IBOA 4MDRA 2PPFA 1PG7X 3LEVL 1IKFL 3KZ8A 4F2FA 4ELKB 4XN9A 1UXSB 2WIMA 2AJZA 4C4KO 3HPLB 2YPVL 3WD5H 5FKAA 2EE3A 4NC2B 1M56B 4R3SA 3ZUNC 5IFHH 4KZCA 1U30A 5I5RA 1EK3A 4P3CH 2J7LA 1E0OB 2CJ3A 1XF4B 1XCQA 5AYUL 1AOZA 1VFUA 3HVDA 5K39B 2ZAHA 4ELMA 3H3KA 5IOKA 1PY0A 2B4CH 5C0CB 4YXLH 3SDAC 5KSAA 4JM2C 4M1GH 3MLUL 4NFCA 3NCCB 2QKIB 1NFIA 2YD7A 3W0WD 3RGHA 4ZS6C 2OI9C 3QUMA 5KOVC 3WTSA 5SX5K 3ARBC 4NN5B 4ZO8A 4JFPB 2YSSA 4POUB 4B60A 4U1KA 2V8LA 1NDMB 2R39A 3G6JB 3DMMC 5FGBC 1J8HD 1IFHH 3VVVA 4NQCA 2CHZA 2B39A 1TMCB 3T0DA 3RQ3A 2YGOA 3BH9B 2AI0H 1QEWB 2QZ5A 2WOBA 1I3RA 1G1KA 3GNML 1A7OH 1E6OH 2D31A 2Z7WA 4NX0A 5DD6B 1ZXQA 4F7TB 3KYKH 5INDA 1GS6X 1KYUA 2OBGA 4PCSA 2O6EA 4HETA 3RFZC 3D05A 5GJTH 2Y23A 1Z1WA 4OCRL 1V5JA 1DYZA 2A77H 3OQRA 1KPUB 1O6VA 3FFCD 3RVUD 5E95B 4UM9B 4EZMA 2C26A 3KR3H 4RGNC 3ZTCC 3DX8B 4GBXA 4A68A 1U92A 3II2A 1I75A 2X6UA 4XWOD 2X70A 3UO1L 3L45A 4PR5A 4J3TA 1SXBA 2CLRA 4Q6IA 3FRPG 4ZBJA 1G9NH 1YYLH 3D0LA 3FOMA 5CLYA 5HGAA 3NACL 4H1LB 4JDEA 1AGDA 1DJXA 5F6HI 4BZ2L 2EP6A 2XZAL 4JO2H 5C71A 2H7WA 1IAIH 5EPMB 3AB0B 4D9RD 4FMFA 2A83B 2OSXA 4Z8FL 4GLRI 2IADA 3L08A 2XWZA 1NPNA 5IESH 1A5FL 5E6IA 2VKWA 2VMFA 3BGFC 3NZHH 5DUMH 5PCYA 4G42B 2B7DT 5IW6A 4RA0C 4PJCA 1YVLA 5I2IB 1AC6A 2HT3D 1BFVL 4LBEA 3ZGHA 4L1HA 2LTQC 5G4NA 1E6JL 2WWKT 3US1A 3FQWA 2YMTA 1TEGA 2YKLL 4LF3A 4WWNA 1I1RA 1GJIA 4F7CB 3FMGH 3UGUA 4XZUB 1J5OL 4DN4L 4PB0H 2EDBA 4OZHA 2AEWA 1BFTA 1YNKL 3TFBA 1BM3L 3PJSB 2OMVB 3GSNL 3ABZA 3ZMRA 1ANUA 4Z76B 4Z7IA 2D3NA 1VFOA 2HN7B 1OQXA 3RTLA 5GRZA 7TAAA 1T89A 2A9MH 3X1NA 2MMXA 5HHOA 5EO0B 4D2NA 4F24A 5SWZB 2VDLL 4PG9B 2MQCA 1W91A 4HJSA 5T1LB 3W57A 4QRPD 4J3VA 3TN0A 2A73A 2B8OT 2HH0H 1SNRA 4L3EA 4HJGA 2X4QA 1M6UA 1MUJB 1AGEB 5TGBB 5MEND 4XWOC 2ZXEB 2VITA 2AABH 4XBPB 5DJYA 2PR4L 4ZAKC 3GBML 5I19L 2W0LA 5E94A 1D5IH 2IOIA 2FATH 3EYOB 3FQ4A 3G5WA 4OLYH 3FUJA 3PJNA 6FABH 4Z0XA 3QQ3A 3N1GC 4HPOL 3QRLA 2XZCH 4K2UL 4PB0L 2UZIH 3NJJA 1JF1A 4YFEA 1QEWA 5F88A 4Z7AA 3QUYD 4DUXA 1RIHL 4OFIA 4M8RA 3ARTA 3GXNA 1YEHH 5C0RH 1RZ8A 3D9AL 3TO2B 5CHNA 1KLFA 5F9WC 2VH5L 4HBQA 1H3VA 4X6DF 3BD5A 4NDMA 4HHWA 3PS6A 4ZXBD 4G80B 2IJ0C 2EEDA 3AU0A 3MV8E 2DL2A 3ERXA 3HAEA 4H1LG 2CAKA 1RAMA 2X4OB 3SY0A 4KMLB 3D25B 3AUWB 4ELMF 3MLTA 2GITA 1Q1PA 5D7IE 4HZAA 4YFLF 5BRZD 5FS5A 2MOGA 4CSZA 1ZHBA 4HEME 2Y0SA 4TF4A 3K72B 3UJJL 4G42A 2CR0A 1P7KA 4FJ6A 2K6YA 2XKNA 4X5XA 4A6YB 1H6FA 1ADWA 3DHJA 1KUMA 3IJ7A 4GW4A 5DMKA 4QXUL 2B4CC 3ZX1A 3HZVB 1KBBA 3FCGA 2K0RA 1DQLL 3B2XA 4DKTA 5EZJB 1T2XA 1V54B 2C3XA 3PL6A 1A6VL 2QGDA 2XI9A 2VR7A 3DRTB 3MJ8A 3VXQA 4Z7QB 1LO2H 1UWFA 5DMGC 5TH2B 5BW7A 3V5KB 1S6NA 5KN5B 2M8XA 4MA1C 2E0PA 1R5VA 3DVNB 3KPSB 3MBEC 1A1MA 2EDJA 4KJQC 4BK5A 2OXGA 2WJ7A 2GUOA 2EINB 5FO9B 1HH9A 1U3JA 1I7TB 3ZL1A 1G7QA 2VLRA 2X40A 4AL8H 3G5VA 2GTZA 2VXUH 2WAQA 3EZ8A 3REVA 1S9XA 2DRUA 2Z8SA 1EZVY 2OMUA 4DZ8A 4Z3TA 5CSGA 4FXKA 5CZXD 3R06A 3POCA 4ODHL 2F15A 2I25N 3Q8FA 4JLRA 1T7ZA 3P30H 1QLRA 3S9DB 2KMWA 4L2LA 3SE3C 4BEIA 5A43C 1IC1A 2E47A 5KVEH 3H56A 2QSCH 4I2XB 1NANH 4NRYB 3PHOB 4AYFA 2WZ5A 4JHWH 1A6WL 1P1VA 1IBYA 1AP2A 2IF7A 4L37B 1A7NL 2RBLA 1BVNT 4M7JL 4MX7A 5C6PB 5F0LB 5K5YA 4YE4H 2WQWA 4KDTA 4XE0A 1BCIA 5TE4H 1ILSA 1Q1JH 5HDOA 1AGFA 5IIEA 1JN6B 2L7QA 3FT3A 1XF4A 4PJGF 3U83A 4YHKH 5HTSA 4F92B 3V9FA 3PWUA 5D70H 5BO0D 4D3CL 4GBXC 4P06A 2SEBB 2MFNA 3NP3A 3F6JA 5I30H 4JFWA 4R7DB 3UYPA 4K94C 4A66A 4XAWH 3E8VA 1MCLA 1VADB 2WB1A 2ZSVA 3A0OA 3MLWH 4Y5XB 2EVJA 1ASPA 3DTXA 3FTWA 1PBYA 1U0QA 2J71A 2N1KA 4P2OD 2FO4B 1J88A 2NXZC 2JCCE 3NCMA 4PP1C 4PV1C 3D2UD 4ZK8A 1P1ZB 4PBWD 4UINH 2R69L 3P0VH 1MLCA 1OT1A 1SLVA 2YUWA 5GZNA 1ZGLB 2Q3XA 1KB5A 2YARA 4HOZA 3O6LH 4AL8L 2FHCA 1WS8A 2DYPA 4CC4A 2NY7L 1DVFC 4QGYA 5I8CA 3ULVF 5AG8A 3MBXH 1QKZL 4KK8C 5D72L 4QT5A 5F6IB 1FE8L 2D7MA 1Y0LA 3IETA 3ULSB 1P84K 3LH8A 4XWGL 1CICA 4H0IA 4KO5A 5GGTH 1RVFL 4FLHA 1T1XA 2H9GA 2JTYA 2V3DA 1CT8B 4RETB 3B9KC 1DUZB 2B1HL 3KWWB 2XTJE 1NUNB 2WNXA 1RK1A 3ZK0A 1WCQA 1NCBL 2R4RH 1R0AH 5DJ8B 1I4FB 5DQDH 2R2EB 4N2BA 2ZXQA 1HHJA 4PGCA 1M3IA 3T71A 5IHZA 2EDNA 3FQTB 3THMH 1OVZA 3ARFA 2GCYB 5DFWH 2MCPH 5GS0L 3F83A 1WWWX 4WWKD 4C4BA 2OJEB 2WLLB 1YEIL 1R33A 2IWKA 5KVDL 5GZOA 4N0UE 5TK4A 1JK8B 3T65A 1JI2A 5KG9A 2E9WA 1AS7A 3GJEA 4Q7DA 5I5IA 3PIQA 5KSBB 3MNMA 3H7BA 4L8BA 2EABA 3DX9B 3QORD 1H6TA 2QGCA 2EDOA 1DO6A 2JWYA 2YS4A 4AGMA 3OJVC 4H7VA 4P4KB 2FL5B 1SEBA 5FHBH 1RXLA 1U8OA 5ITBH 3V6ZA 3E6FA 2C1OA 1LWHA 1NEZB 4HWBA 1JFHA 2CKNA 4WEEA 4AE1A 3GMQB 3BPOC 5HHMD 5AUMB 5BRZB 1LO5B 3MRIA 2F18A 3DJ9A 3H3PH 2YO3A 5KBMA 5C97A 2WBJD 3OAYH 4OFDA 2NNAB 4QHPA 4YXKL 1ZT4A 3LKSB 3U36B 4WI5A 5DK0B 1NQBA 2EE0A 2X6CA 2X4PB 1NOAA 4IHBA 4PLJD 2OULB 3MJ6A 3VRIA 3QR1A 5ADPL 1MVUB 3CE1A 5DJAB 4IDJL 5FUCE 4ZDHB 4Z7OF 4R4NC 1BYOA 3NEEA 6TAAA 2Z0BA 3D30A 2X12A 3JTTA 5EOCL 5FYKE 4ZFOL 3WYRA 2WUCL 5EB9A 3CHPA 2HTKC 2QVTA 4Y4FB 4AJVA 2WV3A 1JF5A 4UT6H 1KY7A 1WZLA 2DKSA 4ZNCD 3PCYA 1TR7A 5FYJL 2Y22A 3WUZA 2V7NA 1S3KH 3ARGC 3QWOA 3EOTL 5EBGA 9CGTA 2NCMA 4KQ3H 4KK6C 1YEHL 1UM6H 5E5LA 4TOYH 1PZ5B 4ZMLA 1FL5A 2UYLA 3GB7A 4DEUA 3QB7C 4DUWA 1I7ZB 2FEDD 3E80A 2R1WA 3RIAK 2OJEA 4M02A 1S9VB 4QHMA 4NZJA 5DJ0B 1FORH 5ACLA 3L9YA 4MSWB 3N91A 1X4ZA 2XZQH 2GTWA 4XOEA 2BFGA 4A55A 4CJ0A 1H8NA 1JFQL 1QBBA 2R29A 2K1MA 3L9EA 4IGBC 4MB4A 5DTFA 5IR1A 1MJ8H 4KY2A 1EZLA 4N0YL 2FJGA 4LLMA 3P9MA 1CFVL 4E42A 3KBPA 1A2YA 5ANHA 1DQQB 2W60A 1UVQA 4LSUH 3SQOH 3FBKA 1ET5A 2VXQL 5L8LB 3OPUA 2CKBH 2YLKA 1LGVA 3KXFE 5BMFL 3QNZA 2BIPA 1SEQH 4WUKL 1ZS8B 1XMWA 2QDVA 5GGVH 3OC5A 4W6XB 3NJLA 3D0VB 5T5FA 4XNUH 4X6BA 1CFTB 4OZGF 3AXIA 2AQRA 4L4TD 3S7GA 5EU5A 1Z66A 1QW8A 5BS0E 4XMWA 4FNSA 2QR0A 3TA3A 4NFBA 1DJYA 3COOA 2WZAA 3ABLB 2QLYA 3ARPA 1R3LB 5L0QC 4PJ7F 3T8XB 1ZHKA 4YL4A 1NCOA 4JZNA 3ZTDC 3RWCB 3R7RA 1J1OH 1QLFA 2VM3A 3VI3F 4AXWB 1ZDQA 4NM8H 4JY6B 4P9HC 4PLKC 5IB3B 2JB6A 4KMTH 4PV9A 4ZFGH 1AJ7H 1Z9MA 3MODL 3ZU8A 1EO8L 4Y9GA 5JMRA 2XIIA 2GC4C 4JQVA 4Z7NF 5SWQA 1K3IA 1MAML 2Z3FA 2DWSA 2OMBA 1O7DE 1BXAA 1G7MA 4P46D 1D7FA 1NAMB 2NZIA 3TEUA 3UTSE 1XGTB 2L3BA 4KPHL 1J8HA 1DVFA 3QG7L 4HLJA 1UM4L 1E50A 1AI1L 1INDL 2Z9TA 2A74B 4PYGA 5GRJH 2HG5A 4BFFA 5L2KE 3C6LB 1F11B 1SQ2N 1AQKL 4ZQKB 5TE4L 3FRUA 1VPOH 3QZMA 4WIQA 4KU1A 1R5WA 3QYMA 1KXQA 3QPXL 15C8L 3H9SD 3IF1B 3SZ6A 1VFMA 2X0VA 3LIZH 1H3WM 4PRBA 2WVVB 5I76A 3CH8A 1KTLA 5FUOH 3STLA 2BCMA 3K4ZA 3P9LA 3NIGE 3WBDA 2OPCA 3IJSB 5DO2D 5D96C 3L7EB 4OCWL 1NIFA 3PREA 4YDJA 4XPAH 2K9UA 5D4QA 1J8SA 2A9NL 4KKPA 5F7HA 3TEYA 2OYPA 4FYTA 4HIEA 5K59E 4JG1H 1A7OL 1EJOH 3MV9B 2DIAA 4HAKA 4KPHH 3WHE1 3FT2A 1W0VA 2OKMA 3CBKB 1HJBC 5FM5O 5EU7C 1OE3A 2VLJD 5IBUG 1XZWA 4G6AC 3K6SB 3ECUA 2QKSA 2N0MA 3N44F 3R1GH 4JE4B 5F3BB 3EXLA 1KCSL 4L0PB 2X6VA 1JPTL 1C16A 4PJAB 4WI9A 4NNPH 1AJ7L 3AWEA 2R56L 1MCFA 1JRHL 4ILDA 1UJTA 3ZZLA 1JMZA 3ZHLA 1RZ7H 4UTBH 4IRJB 2YRLA 2HG5B 4CC0A 5MI0B 5C92A 2YQGA 5CUSH 4P3CL 4U1GB 3SCMA 4RNRA 3RUGF 1M6OA 5CKAA 3HG4A 5E2WL 1Z0NA 1C5DB 3CX5K 3OZ9H 4I9WE 2DQHH 4K3EH 4WGKA 4XPAL 1NAMA 4NQCE 5CNHA 2OMTA 4GPVA 2O61B 1DVSA 1QFWI 2EDHA 3MI6A 3BQUB 1F18A 5FLVA 3BSZH 4WFED 1Z6JT 1A14L 1BOGA 2B5IC 2G5RA 3F7PC 5TQ0L 1O9VA 3SDXB 1I53A 4L4TE 4UQ2B 4ISVA 2KH2B 3L3GB 4QXGH 1XZ0B 2V9TA 2UWEB 4TUJA 5C09D 5LAXB 2HX8A 1S7UA 4ODTL 4OSUL 1OLZA 5JHDB 2JB6B 3VQMA 1FV1A 4MDIB 1FBIL 3IAQA 3KLQA 5E4EB 4MYPA 3UIZA 2DI9A 4K7FA 1DQKA 1LE5A 3I85A 5IW1B 3S88L 2EYSA 2J5LC 1V55B 1KTDA 3VCLA 3NJKA 2DQDL 2P5ED 3F62A 2IH8A 1BVKA 2YXFA 3DOIA 3LNHA 4L3FA 4OM1L 4AMKH 4P2QE 3CSYB 3UTZA 4KGLA 3IEAA 1A1NA 2I7SA 4HV8B 4NNYB 2UZXA 3N0AA 2K8QA 4CAGA 1H3GA 5T3XL 5A2IH 3KW7A 1J5IA 1JGEB 2OL3B 4L3EB 5EEWA 4LSVH 5DQJA 4LCWD 4XO8A 4OCNC 1L6XA 4KKCD 5IQLA 5EIIG 1BREA 4LLVA 3DRQB 1VHPA 3AXLA 1UD2A 2C9VA 3D8MA 4FLRA 3RPIA 1P4IL 4W4NA 4KKBC 3JSSA 1CLOH 4KOCA 4KKAC 4M5YL 1YDPA 1J48A 1UGNA 1O9WA 2E86A 3W5NA 1Q94A 1AKJA 4MD4A 1KT2A 2WPGA 1RPQA 2MJWA 4BFOA 1OCCB 4JFHE 3WI9A 2F1BA 4FQQA 5HVWA 3OSVA 1XDTT 4WY7L 5AKTA 4FRWA 4XCFL 4A6YH 4P4RA 4Q9CA 5I1EL 1GCYA 4Z3FA 1H0DA 4P5MB 2YD1A 3VXOB 3QXAA 1ZA6B 4UDUB 1QX1A 5ESVB 4LRNL 4IBQA 3KYOA 1GS8A 1HVXA 1DR9A 4P2RD 1K2DB 1MHPH 2GY7B 1JHTA 1BOGB 1ZWIB 2UX6A 3A6BL 3D4CA 4OLWL 5EHFA 4P3DA 4WI7A 1R9FA 1T6VN 4S2SB 1GZHA 2DQUH 4HSCX 1HT6A 3AROA 4RGNE 3RB7A 2IOOA 3CFMA 35C8L 1JGDA 3FTUA 4FJZA 4WF7A 5ABDE 2AEIT 6FABL 3VWJB 3L54A 2FX8L 2NR6C 1A6UL 2X6MA 1AC0A 2DJUA 1IM9A 1FNEB 4XP9H 1SMDA 2NXYB 2ADJB 4Q8BA 4NKDA 5DCCA 1BVKB 1U3NA 3IGKA 2GAZA 4B9ZA 5F21B 5JW4R 2CRZA 1L4IA 3CFJB 3M86A 3R0MA 5C08D 5DJ6B 4O2EB 5K9QI 1U8PA 3M8OH 2CCVA 2OM5A 1ZGLA 4IU2B 4DKDC 2CUAA 4JY6A 3QUXA 3EDEA 5J12C 4IKJA 4F7TA 3K6FA 4KKZA 4KTEH 4Y5YA 4JPKL 5CO1A 4R7VA 2P5WB 3ESVF 1NFDA 4CDHA 1SGKA 4HLEA 4Y1AB 2GJ6B 2GPZA 2DEWX 5KSUA 4RIRB 4AYMC 2V8MA 3HRPA 4X6BB 5E8DL 5KANI 3EJCA 1C08A 5D9SA 2MHAB 4CKQA 2IGFL 4L5FH 4TN9A 2DEYX 3PWLA 1D5BB 1DBKH 4KI5D 1QUNB 1BD2A 4AV0A 1CGXA 4FG2A 3PL6C 3T0VA 4ALAL 2EE6A 4WHTA 1MG2C 3DGDA 1PX4A 2YSTA 1GGTA 3UJTH 1KCRL 2GJ6E 2PWHA 4L9DA 3D2UA 3KLKA 4KO6A 5AVXB 4XMVA 5T3ZL 1F11A 3MFFB 4GKLA 4JUSA 4M6ML 4PJIB 1JTOA 4MB3A 1AR1C 3BLPX 3UCRA 2XN9D 5KVEE 1BBDH 1VPOL 3AS3A 4EIBA 1DVFD 4ZSOE 1R3KA 3IDNB 2Y07L 3QAQA 1HNFA 3FW6A 1CYWA 4Y5VB 3TIEA 2G4GA 4XMUA 2R0WL 2WUBH 1UH3A 3UO1H 4I18C 4LCUB 1CLVA 3K1KC 2FZ3B 1KB3A 4CSTA 4G7RB 3V79C 2AZUA 3KR3L 4O00A 4AUYA 3UEZA 4WJ5A 1H19A 3GTTA 2P5WA 3BAJA 4V1DB 1JS4A 2CMRH 3HW7A 3IJYA 4D9LL 4DOHB 6PCYA 2WVUA 4QHUB 3RGBA 3NRPA 2H32A 3KVDD 4AQZA 2XTLA 3G6DH 1HILA 2BP8B 3ML9A 4OFVA 4W9EC 4NUGH 2DWDA 1CFTA 3NEOA 5CEZE 1W0WB 3QUZD 2A38A 2E9BA 3K3QA 1D5XB 5AVQB 4YSUA 3QJVB 1CQYA 2WINA 1MFEL 4QO1B 4GAYB 4H44C 1EBPA 3RWEB 1Y18A 5C07E 5DO8A 1DSWA 3QXTA 2OFQA 3ARSA 4HCRL 4JL1A 1TYRA 3DGGB 3QUZC 2VDLB 4Z7OE 4UIKL 2A0LD 4Y5YC 3WFBH 2YRBA 1T20B 4JPVH 2OTWA 1KPVA 4UM9D 3EGXB 1GC1C 4UB0H 3GBEA 1KLFB 3ZKMD 2BIOA 4NC1C 4ZQKA 2QMKA 1AR1D 4HIJA 2QQKH 3TJPA 2A74A 1A0QL 1FRGL 4ABWA 3OV6A 5HBBA 4N1CA 1BFOA 2XJKA 3QW9A 2ZOOA 4GG8B 2ADGA 2ZD0A 3V7MA 3GSQA 1E42A 3BEVB 2XV6B 3WNJA 3ESOA 4CNIA 4PJHF 3D4YA 2NY3B 3LKNA 2GTZB 4F5CE 3L4YA 5EZLB 1GR7A 3CFKB 1I1CA 1NGPH 5I18H 5CFHA 1B0RA 3DVNA 3OB8A 1U8MB 4NENB 4ZZFA 3I9IA 1HSAB 4MA8H 2XVLA 3V5KA 4YGAB 1NLBL 2ITEA 3SDAA 1F3RB 1FLTX 2GI0A 4KAQH 4WSGA 2WZ0A 3O4LB 5T3XH 4I0PA 3HZKA 2AJYH 1U58A 3CLWA 1XSJA 3D12B 4PRAA 4YHZH 5D4JA 2UX7A 5DJ0A 1IAIM 3U6RB 2VLMD 2XPGB 4HXAH 4FI6A 4Z6AT 1CIUA 5FCUL 2FEJA 3FH5A 5E00A 3CFBA 3EYVB 5I5MA 2HKFH 1MAMH 3QWOB 4FQXD 5TQ2H 3IJEA 4ODXA 4BJLA 4EZJA 3ESUF 5I71C 3GRWL 2C1PA 3UZQA 2Q76B 3NN8B 1LO2L 4BGDA 1XCTB 3JWDH 2NYZA 5DURD 1UT9A 4OLZL 2EXWC 1QSZA 1MW1A 3BAIA 5TK2A 4LSRH 4QI3A 4MGXA 4FNQA 3MHZA 3PXJA 2CPCA 4LOFA 5IWLA 2YC1B 2Z31A 5DSCB 3MGTB 4HFWA 5DJ2A 3EH3B 3PNWB 1OAKH 1RZJC 4NKOB 4YBLC 4XCCL 4PBXA 3LS4L 1FZMB 2OJZH 3RWHA 1Z5LB 3CSGA 2UY6B 4JM2B 3OR7A 4N6RB 4Q9QH 3Q1SL 4NQDA 2CBPA 3W2DL 5KYUA 2P26A 4QEGA 5AVVB 1NC4A 1OT4A 1KCSH 1N67A 1TENA 2LHAA 2IANA 1MKFA 2XX1A 1MFNA 2M2DA 4TV3A 1JDCA 3GJFH 3SDDB 1KNOA 1HWHB 4U1LB 3MV11 1MXDA 4CC1A 3LKPA 1I8UA 3JV6A 1PG7W 2X28A 5H94A 2YPVA 3RA7L 4GRLD 4YHYC 1NMAL 4JCWA 2J1ZA 4WI8A 4Y2LA 1CLYH 1EO5A 1TLMA 5JW3H 3WEXA 1JGEA 1OGAB 4PREB 1E8ZA 3V55A 3JV5A 4PRAB 2DYPB 3OKDA 1TNMA 4ZTPH 2XWRA 3EFFB 5E8PA 2OMWA 4HXBH 1OE2A 2BDNL 3QUKB 5HGDB 3HR6A 2FBJH 1XCXA 3JT2A 4HWZA 5CLWA 4L0YA 1S46A 1KXVA 2H0FA 4XR8C 5HGHB 3GMNB 1CGUA 3B8YA 4YX2L 2RA1A 3RYMA 1DSFH 2XQYK 1N6UA 2FQGA 3JYBA 4NZUL 5IROD 1X6LA 3TBYB 1DQDL 1HE8A 1ZANL 1IT9H 3HMWH 4PGCB 2Z4QA 4K8RL 4ZS7H 1DHKA 4X7CC 3TO4D 4IBLT 2FL5A 5I71B 1YYML 1Y07A 2YN5A 5AAMA 5DJ8A 5FYLH 2PTUA 3ZLQC 1NC2D 1MFCH 3AUVA 3PWUB 1EAOA 3BH8B 4FTVD 2BNQE 5DHEA 1TCRB 4P05A 4FHBD 1CL7I 4PWGA 4IDLA 1P7KB 2XQYG 3BDBA 3CVDA 3SD5A 3WKQA 1U93A 4HW6A 2D0HA 4XMPH 3FRPA 1K8IA 1FYTA 1MCQA 3DURA 5B38A 1ACZA 3QULB 1XX9C 2GK2A 4LSPL 4GI6A 4YSDA 4I3SH 3FQRB 4K4KA 4GG6A 2MWCA 3PXHA 3UBXB 1KENL 2KYIA 3QBTB 4YK4B 5D55A 2Q10A 1RIHH 4GSRA 2HVKB 3N9GH 2ZTBA 4F20A 3ULVD 1N8ZB 3MRRA 5IQ9B 2AVFA 2NMSA 5DQDL 5D1QC 3EBIA 2WAHA 3WJLA 4H8PA 1KXTA 2XN9E 4Z0XB 1YQVL 1JAEA 2Y5TA 4R83A 4LSVL 5DZ9A 5E94B 5IVOA 4NRXA 1QATA 2G9KA 4ETQB 1TZHB 1YPZA 3WIHH 3BXNA 3ULSA 3ZKQD 5LLIC 4YZFF 2O72A 1KB5L 3C5ZC 3REVB 1J05A 3CU1A 1WCBA 4OD3L 2J57A 2GY5A 4J39A 2VRAA 2E46A 2R27A 3CNKA 3MRNA 2J8UF 4UNIA 5GSVA 4A2DA 1AO7D 1NFDB 3L4WA 2OXGB 3LIZL 4GQZA 3TN0B 4YDLB 2IH1B 1QQDB 3HBGA 2CZNA 4Y5YB 5AW9B 3EG9B 3W56A 2VXUL 5IUSA 5KS9F 3EZJB 3RNQA 2X2UA 5HI3C 3ARZA 4EI5B 1CWVA 1KYAA 4DGYH 2ICES 3N42F 5FO2A 2ZOKB 5A2FA 2MOQA 3VSVA 3ZTJG 1AP2B 4X42A 1N2RA 3BUPA 4EI5C 4UQ2A 4I5BA 1MCIA 3ATAA 1QYGH 3PFUA 5DYFA 1FYTB 1WFMA 3WNNA 3BE1L 2IBZY 2NTFB 2GUYA 2JIXB 5J11C 3BSZL 5BW7C 25C8H 4NEHB 2SEBA 4I0PC 1CI5A 3SE3A 3D87B 1MF2H 2XXMB 3ZT6A 2Q6WB 2CSPA 4I9XA 4PJ6A 2IGLA 2OA9A 2Q3ZA 5FR3A 5I0YA 5IBLC 2NDGA 1G7QB 3GINA 5D8JL 3HBQA 2VM4A 1MHHA 1G4MA 3NQKA 4HFUH 3F7YA 2GBAA 2XG5B 3M7OA 2GC7C 3DTDA 4DK5A 4O51B 1N0LA 2VZTA 3IDGB 2RIKA 2BP5M 3AQDA 5BQ7A 1W2KT 1G7IA 2EH7H 1QLFB 3BN9C 2A9BA 2ENYA 3SPVB 5HXMA 1N68A 2A99A 1ZV5A 3OAZK 1DUYB 2DIJA 2PPCA 5EZOH 5KSBE 3UYRL 3KLSA 4KDVA 4LKXB 4PJ5E 4ZPTA 5L6YL 4EXKA 1S9XB 2E3VA 1P53A 3WY3A 4GXUM 2YEZA 3H9HB 5DYOB 3D4ZA 5ICYB 2EYRB 2DQMA 4FFZA 4KTDL 5T1DH 4BHUA 2F5AH 1H9DA 4X4YA 2DH3A 2XQBL 5BS0A 2HTLD 2XYBA 4X4KA 4DN3H 3M17B 1T22B 1FZOA 1BXUA 5DGQA 4TSCL 2Y7QA 4UDTB 2YC1A 3GHEH 4WGVB 4G1EA 1ZVSB 5JIMA 1IRAY 3THML 4M4RA 2WBJA 2JK5B 4YHYB 1RIUH 3VYOA 1Z7JA 3OKKA 3HRZB 2EDEA 4YPGB 1MH5A 3KYOB 1F4XL 3ATDA 5KS9A 5EOCJ 1CE6A 3NOIA 3MA9H 5E8EA 4BQ8A 1QFOA 1MZYA 2ROXA 3T4AC 5KG9B 1J1OL 1OSEA 2AK4B 3VRLE 5LJYH 3L5IA 2XN9A 5EOQL 3PP3H 4QRAA 4TVSa 3FTGB 5DDHA 1IV8A 3KBEA 4YUEH 3T3MF 2R2CA 4YSSA 1HQRA 1C9SA 1BECA 1LD9A 2P43B 2JKLA 2VQ1A 2MNUA 1AGEA 3O2DH 3FQXA 1XGQB 2F8VA 2YMOA 3TJEH 4IJTA 1X4XA 4HS6B 4TVPE 5DFVC 1UKSA 1TJGL 2VGLM 3BZ4B 5CD3A 4HJEA 3BUTA 3LOWA 1LO5A 3RAJL 5GGUB 1USZA 2E7HA 2H0JA 3TONA 1GZQB 5CFAA 4F8PA 3QPXH 5J57B 5CM1A 1GXEA 5E08H 2LVCA 4OF6A 5FW8A 4P2OA 4PJHA 1FG2B 4U4IA 2H3XC 5JHLA 3WIHA 3ULUD 1E28B 1Q0XL 4BKLA 5CGYC 4GEIA 3UAJA 4CRPA 3WDIA 3X17A 3RUGA 2D3LA 2QPFA 4HH9A 2X5PA 4P2AA 4UNUA 4LCIL 1J86A 3H7BB 4L8BB 2RACA 3CFIC 3QFJB 5FLUA 4LASH 4XB3A 4LDCA 4I87A 1O6SB 3P4NA 4DZBA 4K9JA 1CGSL 3VFTB 2GK0B 4LVOC 4L4VD 4R0LC 4C58B 1J5HA 1DLHB 3O9WD 1BQHG 4TRPL 1MIEL 5LHDA 5L0QB 4TUJB 4OLXH 4N0CC 4ESKA 4AT6B 2AV7B 1MCEA 2J88H 1C5BL 4FL4B 2ED6A 1XF2A 5EBLA 2IIJA 2BSDA 2LOEA 1GJWA 5EU6B 2ETWA 4UWQB 2EDYA 4R5XA 6CGTA 1IKOP 1DJGA 4KV5E 2Y36L 2VZ1A 5KSBF 3RJQB 1MREL 5DK3A 4OZIB 1Z9PA 1QI4A 2CLRB 2PUQT 3LV3B 5IVXF 5BMFH 1SEQL 4WUKH 3IKCA 4CADA 4FQXB 3WNOA 2FK9A 3C5JA 3MRIB 2YGPA 3WHXA 1C16B 3EOBB 5CJOH 3T6ZA 2VDLH 3F7KA 4HFUL 5ISZA 2WMPB 4N2IA 5FOBB 2DIEA 3VFOB 3RWJB 4NRYA 5IB3A 4UANA 2APTA 2O6FA 4ZODA 2P8MB 5BQDA 2VR6A 3QIBC 2V33A 4J1UA 4Y5XA 5ERWA 4DZ8B 5HHXL 2K8MA 2RFXA 3H2QA 4Q74A 3S3JA 4JJ5B 5B1CA 3UPCA 3J07A 2YZ1A 1TQVA 4PS4H 1QO3A 4XN1A 5A6MA 1E4HA 2WZPD 1XBRA 1UWEL 2V9QA 1N5AB 4EPSA 4ZPVB 2AAAA 2W60B 4GKZA 4N90E 4G8FB 3VFSB 5IHBA 2J72A 2W95A 2J73A 5BPPA 4YBQC 1ZV9A 3SPIA 4WO4D 4K7PX 5JXED 1JZ5A 2PCPB 4P2QB 1F6FB 1WIOA 1BVLB 2LU7A 3HE7D 1JDAA 2CQVA 4F37K 1BEYH 3B5GA 3LKRB 4JQVC 2WD0A 4OQTL 4OQ1A 1Z0MA 4FX5A 2BC4B 1R24B 3BLKA 4ODWB 2GJZA 3S8FB 4F7PB 1TXKA 4XPBH 4ELME 2IDQA 1RUML 1R3IL 1A1OB 1PU0A 1RIVH 3QG6A 4EE2A 4OCYH 5KSAD 1JV5A 3D3VA 3K71A 4JO3L 5E1QA 4JO1H 4YHOL 3LV3A 5ILTL 1UWGL 3MGAA 1X5GA 3KPTA 4X7SH 3E2HB 2D7OA 1EEYB 3LN4B 2HJLB 4DGVL 2PTTA 4Z23A 1I1YB 3E1F1 4NO0A 5D7HA 3I9AA 4X83A 3F6IA 3MV9D 4PMEA 3ZYIA 5IF0A 1A7PH 4JN2A 4JZOA 5H8DA 1MEXL 2QSTA 4WW1B 4ZDHA 5EIIB 3B3BA 3VG9C 4KUZH 5IMMB 2ZOLA 3NP4A 4YDZA 2J8UB 2GBVA 4JGNA 3ZKMC 5D1ZD 1CVRA 3LDBC 1TJGH 1PZ3A 2GK0A 5IHWA 1SM3L 1YEKL 1YNTB 3Q6FA 5I16A 5SX4H 1RP9A 3W11C 3CUPA 2BWDA 1RY7B 1ZWIA 5IROA 4N28A 2I9TB 4KJQD 2X4OA 2O6PA 4M61A 5AW2B 1E27B 2NYYC 5IG7A 2VDNL 5BXFA 3RWGA 1PZCA 4IMLA 5DZOA 4QTFA 4N2OA 1T0MB 4AQ8C 1UTDA 2W65A 3WN5C 2WKOA 1JF6A 5CEXA 5E1AB 5J1AB 5C0AA 5FHAH 1D9KD 4JPWH 3S36L 3QZPA 5B7EA 1ED3A 3BAEL 1KCVH 1UXWA 2UUDH 3GTVA 5T5FL 1PKQB 3L3IA 4OV5B 4JRWA 4PD4K 3RVVC 4M62L 3QXDB 1TJIH 4OZ4B 5K59F 4J3BA 3GRGA 3HBPA 4KNSA 1ZLVH 2HJLA 1QFHA 3I6KB 3SZKC 3RWFA 3WKPA 1XGQA 2HUEA 2MPAL 3WTVA 1BIIB 2JTDA 3DO7B 2P8LB 5D7IA 1U8QA 4OKDA 4Z95H 2WSKA 5ACZA 3TA4D 2R69H 3MKGA 4XX1G 1UZ6E 3Q9QA 3W0WB 2ZUSA 1L0PA 5D7KD 2YLHA 4DP4X 1R5VB 3ARFC 4XVJH 4YDKH 5AKSA 3TCLA 1SY6A 3JTTB 4AWJC 1A21A 3IFPB 1ZTMA 3KPOB 5IJBC 2J55A 4LKCB 3ZHDA 2VMJA 5ANMA 3IXTA 3QJUB 1JIBA 2A1WL 5FV1L 2VRKA 3E38A 3LNDA 4L4JA 4XNAA 1A7PL 5JORA 4WJG3 3POHA 2DTMH 3C6SB 4QRTB 5D72H 3HMXL 1J0IA 3SKOB 3SKJL 4V2CB 4F7CA 3BSGA 3GXUB 4MS6A 2XFGB 3U0WL 3MZGB 2J8OA 4PJAF 4GSQA 3WE1A 4JREC 4JY5H 1YEKH 4PYHA 5FGBA 3W11D 3CLEH 3ILPB 5IB4B 1MFBH 1G0DA 4LCIH 2R4RL 1P1ZA 3UBHA 2WOYA 3FB8A 3ECQA 4JDZA 3ZTNL 4OM0H 4PBDA 5T3ZD 2GSGB 3RTQD 3T0XA 1W15A 4MCMA 2EH7L 3KXFB 1CDYA 2NY0D 5AOLA 1R3JA 1F2XK 2X4SA 2OXHA 3GBNH 1AR2A 1SJHB 4GUOA 3EYSL 1P0SE 1KZQA 3BRDA 2DMHA 2X4TB 3MV9E 3R8QA 2GBUA 3VRLF 1RD6A 3UZEA 1HIML 4PI2A 5DRZA 3U30C 4HUXB 3OKEA 3DECA 1GGYA 2MCAA 1VZGA 2VXVH 2YPLB 2NY6C 4ZOBA 4K9EC 3DDGA 4EIUA 3QISA 1KXVC 1EFXB 5EU3B 1E2VA 2VAAB 4QRRD 3EGDB 5JOPE 2ZZUT 5GJSH 2RB8A 3EYFB 4O58L 4YR6B 3ZQXA 1XSOA 1A25A 5HYIA 1JTTA 2BSCA 4ZW5A 5GGSA 3WIHL 2R1YB 3FTSA 5CS7A 1QWHA 2ZAGA 1HL9A 4RISH 2XXCB 4OQTH 2OMVA 3QT2A 4DKFH 4NNXB 2BZDA 1Z32X 4KROD 3P4LA 3P2TA 3T08A 4WDIA 4J8RA 1RPKA 5DJDA 3HFFA 4D8PA 4PGEB 43C9A 1C7TA 4Z7UF 1K5NA 1RL1A 2ZCKH 5CGTA 3ZMNA 3CHOA 5I2IA 4DUVA 2P48B 2X89A 1LILA 3O3AA 4FE9A 1U2HA 2ZKYA 4UQIM 3WFHB 4J12A 5F1KC 4JKMA 1PJ9A 4FQPA 3IBEA 4XBEL 4F2MA 1O6SA 3P4NB 4DZBB 1CO1A 3P11L 4R4BA 1R5WB 3T2PA 4LLUB 2VZUA 5ERWB 1GKOA 5C0AB 2CO3A 5C7XL 4XCYB 1JVLA 3FQYA 3PGCA 5CU5A 5ICXB 2Q3AA 3N9GL 3DVGA 4OQTA 1IAMA 1F3DH 3NFSH 5E9DA 2PR4H 1L9TA 4WQOA 1PFCA 1QLEL 1FIGH 1SM3H 1QR1A 5BZZA 3EFDH 3MLTB 4U6XA 5JXEA 3QEQD 5HPMA 3UAJC 3KLAA 2BMKB 4QRQA 3VGEA 5E8PB 3HC3H 3BIKA 1T3FB 2WM0A 3OZKA 2J6WA 5BZDB 1BQHA 3FDWA 4NQQA 4G7VH 3ARVA 1XGPB 1LK2A 2APFA 1WD8A 3IFPA 5E6YA 2D31B 2IQ9H 1A02N 1YRKA 1ILUA 1YNKH 4OZIE 1BM3H 2C4FU 4TUOB 5BJTB 1UOVA 4IRSA 1MFAL 5FYKL 4DGYL 4XNMA 5DYOA 5CEZH 5ICYA 2UXGA 1AIFA 3O4OC 4WFGD 3L5XL 3CZLA 1ZTXH 1KLUA 1S7QA 4P99A 1P2CA 4JO1L 1JHLL 3ESNA 1E9OA 4FJYA 5IV2B 3NIDB 2Z6FA 4NI3A 4NQEE 3SD2A 1QSFB 3W9DB 3T0EB 1PKOA 1YPZE 2DQTL 2AAVA 2F53A 2D7NA 1XXFC 3CN0A 4WV1A 5GJTL 4ABQA 3DV6B 1JNHA 5K39A 3IFOA 2EEBA 1BMZA 2IBGA 2P45B 1TG8A 5MEQB 3H0TA 5TPWH 5ACMA 1YUKB 3GRWA 4FQLL 4YC2B 3K5RA 2X1WL 1R3JB 3WLBB 4HKXA 2F54E 4N6QA 2D2OA 4U3XA 5B1AB 5IHHA 4K3JL 4OLWH 4MNQE 2VTFA 1B4JH 1G9NL 5DU7A 1K4CB 4X5XB 5HDBF 3MRMB 3BD4A 1QA9A 2B9BA 2XDHA 5DK2A 4KHXH 5CD5C 2ZOTA 4LESA 4LBEB 1K8DB 1D2PA 5IKCA 2C4FT 3MV7D 3VXSA 4TNEA 3TT1L 4APXA 3TV8A 3NZHL 2HTLC 5DUML 4Q2ZA 5AWNL 4HPHA 5I0VA 3VFGL 1NMCB 1YEEL 3O6KH 3KWTA 2DD8H 1HQRB 5D1QE 3DSNA 3EIFA 3VD4A 2HAZA 1LJMA 4N0FA 3GF8A 3L8QA 4Y4HC 3M6DA 4JPIB 2CBTA 3ULUC 3QCUH 3KGRA 3MV7E 2DDQH 2OZ4H 4Y4KB 1AY1L 2XV3A 1MVUA 3IDUA 3O4LA 1L7IL 5D1ZI 2XICA 4KRNA 5JW5A 3GSXA 1R47A 4UAHA 4HOMA 1EJ8A 1T7YA 4PR5B 3N1MC 2PPEA 2QADC 4CJ1A 1N9PA 2C3HA 2PWFA 4JFFA 4EUPA 1T80A 4RMBA 4NP4L 4XE5B 2AXHA 4U2YA 4DESA 4XMPL 4OI8A 4R6UA 1FDLH 1KLUB 1QOKA 4M4PA 4FNLL 5DD5L 3SO3C 1GH7A 3C5ZA 1JGVL 1ES0B 3LXAA 4J27A 1PD0A 1OSZA 4IRSC 4N0UA 3IXAB 3KPLB 5CP3A 3VWKB 1HKFA 2G9HA 1NCCL 5FDWA 1MWOA 3L1FA 4NQED 1BQ5A 4TLSA 4YSPA 4KUCF 1HNGA 3KPQB 1KIRB 3CG8A 4HUVB 1OGTA 4R26H 3O3EB 3HZYB 4EQ3A 4NCDA 4QRBA 1WWAX 2B15A 4KRLB 1MRCH 4TRPH 2R7EB 4JFZL 4WEBH 4PH8A 4MNQB 3CLEL 1H5BC 2ZSWA 3KWXA 5F7FA 5FO8B 1OAYL 4YE4L 4XNDA 1NCDL 4YL9A 3SKNB 5EC1B 1P5UC 5DGRA 5HHNB 1EEZB 3QDGD 5JIDA 1T0OA 2JCCB 3AG1B 3ULVL 1TCMA 3BI9X 3MRFA 1DUZA 1P5UB 2N01B 3LH9A 2CR3A 1YPZB 3VTTA 2JH2A 5GGTL 3BP4A 1FFNB 1OGSA 3BHBA 3H4FA 5IB5A 1NCJA 2WMPA 4IJ3C 1JYWA 3IWUA 4N0FB 1D6VL 1WGVA 4PJCF 3LMJH 4HWZB 3V7AE 4CKVX 1U8CA 1EFXA 5EU3A 3D39D 3WIIH 4UOW1 4BSVB 4UQ9A 4KDWA 4E36A 4KZ0A 3B5HA 3EDJA 5JXEC 2X4NB 4LHUG 4RAHA 1MCPH 3N85H 3PWPD 3S37X 2BW4A 1FN4A 4L8SC 3VFPA 3V0HA 5E4AA 1IBHA 4PWEA 4K9EH 3L6FB 5EEVA 2ZSVB 4ZMNA 3UPRA 4KQ4L 3QRBA 1JP5A 3WFZA 4RSYA 1ETJA 4KK5D 4YLQT 5CBAB 2EUVA 4XVUC 3T2QA 5GS0D 3ULUE 1I9RL 4LEEA 4PWJA 4FABH 1DVYA 1KGXA 3JZYA 1ZJBA 2YPLA 4J2QA 1UXLA 2FE0A 3MNVB 3WL9B 1G4RA 4WNQB 5MEPA 3CFUA 4PRIB 4HHAA 1EANA 4BZ2A 5KVDE 2R0KH 3FO1A 1MFDH 3UBGA 2ZKXA 2RR3A 3S35X 5LUMA 3KPSE 1IQDB 3MR9A 5DUBA 4F8OA 4AMWA 1XH3A 1SLUA 4JW3A 4G9FB 4LAQH 2KZ1B 3OKDB 4WV1C 1V8HA 4O9HH 1CIDA 1MJ7L 2EVGA 3MNZB 3PL6D 4HMDA 2R83A 3VGHA 5I1IH 1YG9A 1EX0A 2IV9A 4PTTA 4S1QL 3Q2VA 3QP3A 2ZWNA 3DC0A 1RCYA 4H25B 3WKMH 5FYLL 4KTDH 1FNAA 1PYWA 4WEUD 5GGUA 4JB9L 5T1DL 2X05A 1HAWA 1CDBA 2J2ZB 4JHBA 2FNWA 3UBXA 4YBHA 4P59L 2IFGA 4CU8A 4S1DC 2AJ3A 5I8OL 1EEQA 5DO2C 1P4BL 4HX1A 3IAPA 3A4AA 2EUWA 2E4TA 5I1CH 4N2FA 2ZWSA 4WUUA 2RHEA 4TVPH 1AANA 3EGSA 2PWEA 3QEQE 3MRGA 3L1OH 5GPRA 3VI3A 5AZEH 3QWNA 2X38A 3L5XH 1BDYA 1KB5H 2B08A 3BAWA 3GBLA 3PHSA 5DQ9B 1T66D 5EFIA 5TE6L 3RWDB 2OP4L 5IJVA 1CLZH 4QJ3B 1KGCE 4F3FA 2WYZA 2A3TA 1SY6H 3NBNA 1J0KA 3GRWH 2I69A 3O6FC 4CMMA 1CD8A 1J5DA 2JVUA 2FJHA 3I9GH 5TF1L 2NW3A 3JWOH 4MNHB 1T5KA 3L3OB 4U0RB 2VIRA 4JDVB 1TQUA 3ZY7A 4OR1A 1Z3GL 2AGJH 3SGKA 3UFIA 3SPHA 4EO5A 2DJSA 3VFWA 3BEVA 1BZ9B 2YK1H 3ZDZF 5JLZA 5FDYA 1FYTD 4MNGA 1IO4C 3TYGL 2PNDA 5JMOC 3U2SB 1WC7B 2BSRB 2JIXA 4B9YA 3LKOA 1IAKB 4NO3A 1X9UA 5B4MC 2H6PA 3TBTB 3FT4A 4QY8B 4RH4A 1XXDC 1N6QH 2CJUH 3S97C 4OF3A 4X4YB 4BUHA 1OGAE 1QWNA 5JW4Q 4JKLA 3K81A 4HZLA 1TTGA 2BSSA 2UWEE 4MA3B 4YHLH 5DLML 2FHFA 2H0PA 4FNTA 1PLBA 1U6AH 1A3LH 4QR7A 1LM8V 4AVJA 3WGUB 1K6QL 3H9SB 5D1XB 3LIUA 5EO1A 3ZDXF 2IFFH 5D93B 2HH0L 3FXIC 1IC7H 1JXJA 2OS7A 4JFOB 5C0IB 4BH8B 4G6MH 1NCUA 1UOKA 1BZ7B 1FZKA 4O2CB 3VFNB 2YD9A 3BSZA 3DPBA 4A2GA 4DTGH 1HKLL 3SPVA 5AZEL 3MGTA 2D0GA 3MLZH 2B59A 2BP0A 3GMOB 5GGSY 3S3DB 4IRSB 4UIMA 1S7RB 5LQBH 2VLJB 4A37A 2A74C 4ZFQA 1SYSB 4DP2X 5C7XH 4M5ZL 2MNJB 1HI6B 1G0XA 2IPTH 5C1MB 2NYYD 4N2KA 1JHKH 3LSOB 5SWSD 4EAEA 4AGLA 1J1XL 4UIKH 4JDZB 1XF5B 3APCA 3TIDA 3NIDF 3BWZA 3CHQA 4UT7H 2HLFC 2HZHA 1GRWA 2K4AA 4JRYE 5T1KB 5JNYA 2JK5A 1A65A 1J0ZA 1A1OA 2V5YA 1DVTA 5MHSE 4N2LA 3MJ7B 1DQMH 1K4CA 1HDMA 1E5BA 2C7UB 4PRNB 3S3SA 4Z7VF 1EHLH 2HLFD 5C8JB 5HP5A 3RVTC 3N04A 5FC9A 5EUOE 2X3BA 1QFWM 2WXOA 1DL7H 1N0XH 1URLA 5EOCH 3RDTD 2NXYC 1J18A 3HE6D 3EO1A 5B1JC 5L4JA 2H2PD 1XB3A 1GOGA 3VMNA 4I18B 4JY4B 4N24A 2QKIC 4MXVE 5C09B 4YE0A 3P1VA 1PZUB 3NPSC 4L4VB 3O9WB 1Q0YH 2KZBA 3FOLB 2NX5E 1MFBL 3WFHA 3KH3A 4UQBA 3T3PF 2FD6H 1EEUA 4BSWB 5JOFA 4QOKE 5TQ0H 5IVXA 2CO6B 5AEAA 1OW0A 1EZUA 4Z7WF 1E67A 1FIEA 1ITBB 3VXME 4R0LB 3D51A 1NL0H 4HBCH 2X0WA 3HS8A 1ZTXE 2X9XA 1AHKA 4GUQA 1TZHA 3T6XA 4PPTA 4BCZA 1MCCA 1KGJA 3BP5A 1X7QB 4G70B 1GKEA 3RVXD 3GHPA 2QPEB 3DUSB 4XX5A 5J8OA 4FI8A 1OAQL 3L3OC 3KPPB 4PN6A 4QUOA 4YDIL 4WWPA 1KIUB 4XP1L 1ECYA 2H6OA 2MKWA 5F9OL 1N8OE 1X5XA 5LWYH 2FLMA 4JFHD 3CSFA 2VL5B 3PV6B 5F3HA 2Q7YA 4PVBA 5EF1A 3ZSTA 2CIIB 2OTWB 1MI5D 4LLWA 4PLOB 5HHPA 3DX7A 3QZNA 3D18A 3ILDA 4MAZA 1TJXA 1URIA 1EFQA 4OUOA 1YPZF 3ZKSD 3W9EB 2OZ4A 1EDYA 2YXWA 1OZTG 1PTZA 1OGPA 5DWUH 3RZCA 2AJVL 3ARDC 3P4OB 5D70L 1XTLA 2ITDA 5SX5H 1C1EL 5T8IA 3SBRA 1P5VA 1EHLL 5FWRA 4NRZB 2BY0A 4JE0A 3CQQA 3K0YA 5E2TH 3TL5A 2ADIA 5CR8A 1SN5A 4E9TA 3FFCE 1EDQA 1G6VK 4C56B 4D0CA 4QF1B 3I3BA 3T3MB 4FQHA 4O58H 1TYEB 3FZUC 4NQUA 1SJVA 4AYBA 3I50L 2WIIB 2F19L 2KDGA 2Y06L 4Z77B 2ZOKA 5D7SH 3ZYOA 4KK8D 3EHBB 3NSFA 1GMEA 3LVEA 4OJDH 4NQXB 5A7BA 5LCVL 1BAFL 1H3PH 2OK0H 3UX9B 1BYNA 1HCVA 3SGKC 2BW5A 5A2BA 3DUHA 5E8OB 1MREH 1L3WA 2EDDA 3QQNA 2NXYD 3VXRD 4MJHA 3C60C 5GRUH 1IGCH 2LVEA 5KW9L 2VM9A 2A6DA 3RVWD 2F54A 1RLWA 2BOCB 1U2CA 2E27H 5EORH 4DKAA 4AK2A 2J6EA 3V0DA 1L9PA 4TNWF 1M7IB 4RMQA 3BPLC 2XCMC 2YJQA 3Q6GH 5BVPL 1GZHC 3H54A 1KJMB 4PG2C 2R9HD 3JTBA 4BQ9A 5DRXA 2Q86B 5IJKA 1HEHC 2IEPA 4NLHA 3AITA 1IQWL 4PRHA 4ONHA 4YNYB 3PHQB 4G9FE 4XBGA 5B22A 4HUXA 4FMVA 2E5EA 3IGFA 1OSPL 2R9HC 5IBTH 1HZHH 4AQEB 3CZUB 1HDMB 5DZLA 1RLBA 2JKSA 3VX0A 2PTVA 2VNCA 4K23H 4Y16C 4ZUVB 3UDWA 2A6KA 1YEGL 3GSWA 3MUGA 1RJYA 1AGCA 4DFHA 3KXFA 4QCIB 5K1VA 1E7UA 4E41B 3DI3B 1AQ8A 3WY4A 2NY3C 4ZJ9A 4EUPB 4P5TA 2F7RA 4G6FB 3F00A 2ARJB 5A6LA 3B2UC 5ESQA 1J8RA 4RMWA 1MJ8L 3Q2CA 4ZXBB 4GRWF 4HAGA 3KL5A 5KZCB 3Q5OA 4L8SA 1CXKA 2C3VB 4G7YL 1Q9WB 4I9WD 3DX6A 3L7FB 4PY8I 4S10A 1WZAA 3QDMB 4HXAL 3B9DA 4ALAH 3PU7A 2H8PB 4YUEL 4JVPA 5AZ2H 1EXUB 4AYEC 3TO4C 4ZOCA 2JJSA 4MMXA 1FO0H 3VFNA 1QG3A 3MROB 5JQHC 1GAFL 2Z91B 4IRJC 2NNAA 4KI1A 3ZHFA 1MWAH 2BERA 4WW1A 3TBWB 4UBDC 3VXPA 1L9OA 3QNXA 4WRLA 3O2WL 2DMKA 4UYPA 5EULV 5IB1A 1K6QH 4WFHE 5F0PB 3BWSA 4JFDB 5E99L 5T3XE 1JZ2A 5G55A 4X8CA 5J1SC 4YJZL 4PFEA 1MI5E 2COVD 5G2NA 1UB5B 3TVMD 4PRID 2GTWB 4X6CE 1OAJA 3LKNB 1NJ9B 2GI7A 4YVNA 4D8OA 5HYSG 3O4LD 1XZ0A 4N8VG 3DV4A 3S5LB 5B3NA 3S5LG 4QRFA 4CBZA 4JNXA 4TOYL 2Z4TA 2ZJSL 3GGWA 2GJZB 4JRXA 3RU8L 3BKJH 2Z31B 4WU7B 5SV4A 3MRLA 3ML8A 4B27A 2UZIL 2AW2A 3VFWB 2JE8A 1OP3K 4J6IA 2R0ZH 3EHBC 3TP4A 3VGDA 3HE7A 4HMEA 1CTNA 3VSUA 3WIFA 3UTTB 1YQ2A 1MJJA 3NT0A 3RX8A 1WZMA 2E8ZA 4XC3H 4GBXD 1U3HD 3MUY1 5BJTA 4HS8H 3FFOA 1JZ7A 1VIWA 2DKMA 2BHZA 3FHEA 4G8GE 1BZEA 3L9RB 4LRNH 4ORGB 4XVSH 4ZX4A 2CNZA 4DPCX 4ZOAA 3UC2A 3UYRH 5IQOA 1R3HB 2OL3A 3P2DA 4MDJA 4Y16D 1A6TB 2CHWA 4QRSA 4TVPD 3BIKB 3FQXB 1OM9A 2VQUA 2DL9A 4LE8A 3HB3C 1FC2D 3ZDYF 3CHSA 3F2LA 2WQUA 2B1OA 4NRXB 3U6RA 1EAJA 3OWRA 3RZCC 2Y1VA 3OAYK 1WS7A 3NZUA 2B3IA 3SPGA 5TDPB 1UD5A 3DVIA 1W9XA 1MHEB 4WTZA 3H2WA 1M2OA 4ANXA 1GJUA 5JIKA 3FSAA 3IDYC 2YUZA 4HUWA 5CBEB 2JJWA 5DVKA 5TFSL 2CWRA 3DSFH 1RH8A 1IGML 1XR9A 4LPYA 3ATEA 3O6ML 5FOBA 2EEXA 1JPTH 5E03A 1RJLA 3G6JF 3EBHA 4GUCA 5HHOD 4AQAA 4M6OH 1BQUA 5F1IB 2LU3A 4R7DA 3IDIA 5I1LA 1A6UH 4PMFA 4JKWA 3IDJA 1PQZA 2XA8L 3CZJA 2HWZL 1F4AA 4HF5H 5IOPA 5A1AA 5FW7A 3T2NH 2ITDB 2YXVA 3WHE0 2NRDA 2OTPA 3QJTB 4Q14A 2X41A 4AYID 2VLJE 3V8CA 2R8SH 1G7MB 3AS1A 4RFOH 1OAUH 1OM3H 4WU5A 3T3PB 4DGIH 3UG5A 5ALCL 4WI4A 1KGIA 2Q7AA 5LBGA 5IR1B 3OHXB 4HK0A 5FUCC 4ODSL 4RQQA 4R96B 1H15A 3H2PA 3TO4B 4X6EB 1J9CT 3RRQA 5F7UA 2HKFL 3H4HA 4KK6D 4ZUSB 1JPGA 4ADIA 5CCKL 3MZTA 5CMAB 4YHNA 2QDWA 3QS3A 5KVFE 4M5SA 5BRQA 1NTDA 2K3TA 5D7KE 4D3CH 3H3BC 2AQQA 5B8CC 4AV4A 3V6FB 3BP5B 4QXWA 2VAAA 3DJZA 3WXWH 5HYJB 1WZ1H 2J21A 3RZCD 4AZ8A 3MOBH 1A9BA 1BAFH 1H3PL 1IBBA 1MRDH 4N0YH 4N20A 4XT1C 5E08L 3FFDB 4RAVB 2CU9A 2ZKHL 2HFFB 4JM2D 2JLPA 4LL4A 2MIZA 5FYKD 5ETUA 4DWHA 2BVYA 3WTUA 3NIGB 4F2EA 3O6MH 4Z7WB 2ZP9A 1PFOA 4N8VB 4J3OG 4XBMA 5F71A 2YAOA 4LCWA 3V0IA 1OAXH 4LAQL 4JO8A 4C57C 3KG5A 3JT0A 4GRWH 4BZ1A 4GIAA 3AU1A 5DJ2B 4M3JA 2FZ3A 5GRVK 7FABH 2M26A 5AL8A 3OZ9L 4AM0B 5E8NA 1A8ZA 4AC4A 2W94A 2YPVH 4JFUA 1OWWA 3WD5L 5C6TL 1AH1A 4F9LA 4X5QA 5F1IA 2FO1A 4HWBL 5ADOH 4ALAC 1DJHA 3AC0A 3S2AA 3SSGA 5F7EH 3SDDA 3BMVA 5HHOE 4AIZA 1VZHA 2ZUUA 4ODSH 2KERA 1ZXKA 1JD9A 3PUUA 3DETC 3TM6A 1D5RA 1QBML 3NIDE 2KPNA 1GTNA 1F5WA 1R75A 2ADFH 3R18A 4JPVL 3RIAF 2R2BB 3Q3GA 4WTXA 1G9MC 2DF3A 4JS7A 5C86A 2WW8A 2FDBP 3P69A 3HG5A 3RWIB 4BFIA 1D9KA 2OW7A 1UM4H 3LZNA 1JUFA 4NPYB 5CSZB 2WTPA 2FX7H 1QFWH 2COQA 4I0PD 1LDSA 4RRPM 3WXVL 1Q94B 4LLYA 3QAZB 3FB7B 1WRFA 4AE0A 1IUZA 3K8LA 1BLIA 2HPTA 4AW7A 1OK0A 4P2YA 4BH8A 1E2ZA 5C0IA 4R7NA 1KZYA 4GEJA 3FOLA 3NMEA 1V10A 3WNIA 4A63A 5GGRY 1T66C 4NXKA 1HCFX 1F2QA 4MZIA 3VXPB 3OWEA 4HA1A 4MZ3A 5I23A 3KEHA 1TZAA 3EH1A 3FFDA 4RAVA 5HHQB 2JKJA 1HHIA 1MFAH 2Z35B 2W80C 4X6FA 4EKJA 1ZV2A 2J6EL 3MGOB 4I89A 4JG1L 2DLTA 1INDH 1S9VA 5GRJL 1J0YA 5KTEL 1UOLA 1MWAL 2QQQA 2RTTA 3P9WB 3S3BB 5C0DA 1S7XA 1A3RH 2O4EA 4XNYL 5FXCH 1OAYH 2XN0A 3QO1A 2NQ3A 3VWJA 4AQ1B 1T04A 1PD6A 1SLXA 4IBUA 4LSTH 1UOWA 2VO8A 2AQ2A 4ODVH 2BX5A 4C56E 4FTVE 2IOMA 3ULUH 1HSAA 1AXTL 3B7TA 3IJHB 5IW6B 1WBXB 3DTXB 2VN6A 5DVPA 2CBQA 4A04A 3QIWC 1KJ3L 1S2EA 1VADA 3GD1C 2MRYA 1NGZB 3VVWA 4X8JB