2Q2LA

Crystal structure of superoxide dismutase from p. atrosanguina
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
152
structure length
152
Chain Sequence
MAKGVAVLSSSEGVAGTILFTQEGDGPTTVTGNISGLKPGLHGFHVHALGDTTNGCMSTGPHFNPAGKEHGSPEDETRHAGDLGNITVGDDGTACFTIVDKQIPLTGPHSIIGRAVVVHADPDDLGKGGHELSKSTGNAGGRIACGIIGLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SAD phasing of a structure based on cocrystallized iodides using an in-house Cu Kalpha X-ray source: effects of data redundancy and completeness on structure solution
pubmed doi rcsb
source organism Potentilla atrosanguinea
molecule tags Oxidoreductase
molecule keywords Superoxide Dismutase
total genus 33
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2q2lA00
2C9SA 4U4IA 1OEZW 4A7GF 1SPDA 3GZPA 1PZSA 2AQQA 2C9VA 1SDAB 2WZ0A 1Z9NA 1JK9A 1RK7A 1SXZA 1F1AA 1IBDA 1IBHA 4MCMA 1XSOA 1BA9A 4BCYA 2JCWA 3HOGA 1F1GA 1E9QA 2WYTA 4BCZA 1TO4A 3H2PA 2AEOA 1F1DA 2R27A 2WYZA 1IB5A 2AQRA 5KBMA 3ECWA 3GZQA 4OJAA 2AQNA 3HFFA 4N3TA 1DSWA 1B4TA 2GBUA 2WZ5A 2Z7UA 2AQPA 2C9UA 1IBFA 3SODB 1TO5A 3KH4A 3KH3A 1HL5A 1E9OA 1DO5A 3MKGA 4L05A 2GBVA 3MNDA 4N3UA 1AZVA 1EJ8A 2SODB 4A7SA 3L9EA 3QQDA 5KBKA 1FUNA 1YAZA 2WWNA 3H2QA 4A7GA 1E9PB 1IBBA 1N18A 3GTVA 3PU7A 1UXLA 3K91A 2XJLA 2WWOA 2ZKXA 5KBLA 4OH2A 2AF2A 4A7UA 3S0PA 1HL4A 1P1VA 1SDYA 1CB4A 1U3NA 3ECVA 1OZTG 2GBTA 1XTMA 3F7KA 4A7VA 2E46A 3CE1A 3ECUA 1YAIA 4A7TA 2ZKWA 1XTLA 3GZOA 1SOSA 1CBJA 2ZKYA 3RE0A 1JCVA 1ESOA 2AQTA 2WKOF 1N19A 2K4WA 2Q2LA 3KM2A 1Q0EA 3LTVA 2Z7WA 2WZ6A 1E9PA 1B4LA 4MCNA 4FF9A 1EQWA 1L3NA 1QUPA 3QQDB 1SXCA 4B3EA 1OALA 2V0AA 3KM1A 1SXNA 2APSA 3CQPA 1SRDA 2VR8A 3GQFA 3GTTA 1E9OB 1PTZA 2Z7ZA 1COBA 2NNXA 4BD4A 2XJKA 2WKOA 3KBEA 2Z7YA 3KBFA 1Z9PA 1SXBA 3L9YA 1YSOA 1OAJA 2E47A 3CQQA 2VR6A 1F18A 3HW7A 4A7QA 1KMGA 1SXAA 1BZOA 3F7LA 1E9QB 1MFMA 1OZUA 1S4IA 1SXSA 3T5WA 1PU0A 2LU5A 2AQSA 1JK9B 2ZOWA 1UXMA 5CU9A 2VR7A 2JLPA
chains in the Genus database with same CATH superfamily
4DQOH 5DHVH 3RIFK 2V7HA 1U4FA 2CM6A 1PS3A 4WNJA 1CTNA 2CDGB 3BKCH 4KH9A 1M56B 1UA6L 2H3XC 5F93C 3DROB 2F54E 2NDGA 1KJ3H 3DX6B 1QFHA 1IJNA 1U41A 1P4LB 1FE8H 2DM2A 2X9XA 3HBZA 3RB7A 1FFOA 2IPUG 3VGHA 2BZDA 2IDTA 2F8OA 4P2OB 1NAKH 1Y7VA 3QUYC 4OJAA 1RUAL 1YA5A 3QFJE 2IBZX 1T7ZA 4P5MA 4V1DE 2NY0C 4NN6B 3L7FA 3MLUL 1XDTT 3DK2A 4AEFA 1NBVH 1H9DA 4J39A 5FYJU 2D7NA 1MJJB 4P9HH 3R8QA 1AHWA 1DLHB 3DHPA 3KVQA 2GBVA 2C8NA 1R3IL 1GC1H 1PF3A 3B1UA 4ZMVA 5L4FA 1XCTB 1FUNA 1MHHB 1NCUA 2ZXWB 4P2RA 3UROR 2FHBA 4GBXD 3K3QA 4S11A 4S1SH 5K1JA 1XF3B 1W72A 5CUSL 1QLFA 2CLZB 3DGGA 3PAUA 4PJDE 4QHLB 4F5CE 5EIIB 3BZFA 5FW7A 2CRZA 4TNWK 4ZPTB 3D30A 4ERSL 3IMRA 2QGCA 1QLEB 2NY4C 1GOGA 3HVDA 5ENWA 2ZCHH 3AY4C 4RX4A 2W95A 4W6YB 4UQ3A 1JZ5A 1IBGL 3WE6A 3IN0A 3LN5A 2OXHA 5DUBB 3ATAA 2CIKA 2Z31D 4PJ5A 2NY4D 4ACTA 4JZNA 1I1RA 1TLKA 3QFDB 1G0DA 1PLBA 2NCMA 4WW2C 4L23A 4YPJA 2BVEA 5FCSH 1CL7H 4YFLF 5G5DB 5C0RL 1QWNA 3ARPA 5D1QB 1NBVL 4AM0A 1XIWC 3SKJL 2JSFA 3C2AH 3ARGA 4OAWB 5AAWC 1NBZA 2ZOOA 1CICA 3IFOA 1NCDH 5FV2A 4Z77A 4JFQA 1BMGA 2WKOA 2D7OA 1HXMB 2OX5A 1MFEL 4OLVL 1JDCA 1DN0A 2WCGA 4Y2LA 2CJ3A 4Y4FC 1M6UA 3Q6FA 4TL5A 3S5LA 1E6OH 3QIWC 4Y7OC 1D2PA 4K3EH 1VPOL 4ILDA 1K8DB 3PWUA 3L5WB 1HTYA 5D2NE 4W9CC 2D73A 3BUPA 2H6UA 1L3WA 4P46B 3C60D 4E36A 4QAWA 5AEAA 2ZOWA 3F2LA 3FHEA 1TYRA 5F89B 1Z9LA 3BH8B 1MNUL 4PBXA 3T1FB 5A40E 1I7ZB 2XVKA 3PF2A 1P4BH 3MV7E 4MAYC 4PCTA 1NBYB 2PNDA 2HG5A 4N87A 4L1TA 3O81A 5I1JH 4X7TA 4XI5D 3GJEB 5LAXA 2LGNA 1J5HA 4F8TA 1GA2A 4KROD 3KNBA 3FUFA 1RPQA 4JFFA 4KY1H 5DQDL 1A0QL 3UEQA 3S37H 4JKLA 4LLUB 4H8QA 5D1ZC 2PCXA 3C6LD 1CL7I 1QVOB 3LQZB 4CU7A 5IB3A 4GG6A 4MD0B 5EU6B 1JVKA 2KLRA 2YSSB 5LAPA 1NCDL 2JELL 5BO1H 4ODWB 1WUNT 2PCPA 2CE6A 2D3VA 1IM9A 4LGPB 3VW3L 3B3BA 3OKNA 2H8PB 1JZJA 2QPSA 3IJSA 3KYNA 5KBKA 1W8NA 3PXJA 3ZL4H 3WTXA 2VLJB 1Y6NR 3IVKA 2P52A 2IAMA 1JGIA 3O4LE 4FNUA 2VDPL 1EUUA 3EG9B 3PDDA 4ISVA 2VNCA 5KYUA 4DCQA 1S7XB 3DXAE 1X4ZA 3WEXB 2EH8L 1IQWL 5HHVH 1YZZA 3QXTA 3VA6A 2XOTA 5E9DA 1AFVL 1ZT1A 3JT0A 5ETUB 3OHXA 2QTVA 2VN7A 3U2JA 4B3VA 4L1SA 2CRYA 5K69A 4TSBL 2WUBH 5C92A 2WINA 3N43B 4LP8A 3M8OL 5C0CB 3ME0A 2Y7QA 3KR3H 3PWJA 2Q86A 4OZGB 4Z95L 1EJFA 1OGTA 3AY4A 2IALB 4WTQA 1U3HD 5C07B 4KJQC 3RUGE 3TC9A 3IXTB 3ZMEA 5CD3A 4MQSB 4RFEB 2FYYB 3MV8E 2HKAA 4DEWA 1HSAB 4OJEH 2FJHB 4JZOB 4P49A 4E41E 2ZWLT 1D7CA 5F9JA 5CZXC 1BG1A 3SKMB 5TTRA 3O2DA 1BVZA 5IVZB 1FWXA 3UO1H 4YAQA 3NJNA 3LEVH 3GSUA 2FWOB 5EUOF 3FQYA 2B39A 2WQVA 3GDCA 3C60C 3L3HB 3ZOAA 3LNIA 3ZZ1A 2XXFA 1CT8A 1LDPH 4NENB 1EDYA 4WGVB 3FRPB 4IOIB 1E8WA 1BD2A 1M3IA 4EVNB 3OMNB 4XT1C 4A6YB 3HZMA 4X4ZA 3PYCA 4L3EA 4JNXA 4J3OD 2DLIA 1YEEH 4MLSA 3UL4A 4PUBH 4WHTB 2QJDA 4F20A 4YIQB 4EN3C 1E4WL 3FL7A 4HK0B 1H3XA 3DX7A 1LK2A 2WXOA 4P5SA 3S37X 2K70A 3CHXA 4M5SA 4ORZC 3IAGC 3LKNA 2NXZB 4JANB 1E6JH 4NEHB 4KTDH 1HHKB 4XP1L 5FYLH 5K39B 4MCMA 5DLML 2CSPA 3CFJA 4Y5XC 3W0WB 4K7FA 4UV7H 1VEPA 4R7VA 5AVRB 2WKLA 3OX8A 3ECBA 4NQSA 1H9VA 3WS6A 4RCAA 3QZWB 4PJGB 2DM7A 2R27A 3ZZLA 1WCQA 5KVMC 3FCTA 1GPOL 2GY7B 2AQNA 2X42A 1WPCA 4ODTH 2DF3A 4JK0D 4PLJC 2IAMC 5A2BA 4EKJA 4LFHG 4DP8X 1J12A 3TNNB 3CSGA 4FQPA 4LCCC 4X7SL 1IFHH 3OZKA 1EANA 1G9MH 4WJ5B 1A02N 2BLFA 4G1MA 1UENA 1PIGA 5D70H 4N3UA 4A7SA 4DN4H 4JVPA 3DVNB 4ZXBC 3OLGA 4G11A 3O6FD 2WTRA 1OGSA 4JR9L 1X6LA 4N0UA 4BUGA 1YN6A 2NDFA 1UD2A 1AKJD 3BEWB 3L1OH 4Y5YB 1BD2D 4OLXH 3UZVB 1SEBB 2J1ZA 3KPOB 2VLKA 3JBG7 4NQDE 4ZFZA 2D9CA 2R7EA 4OIFA 2XN1A 1TZHA 2YEZA 1A7QL 3TA3C 4R97B 4OQ1A 3D9AL 4H0LC 5HYSA 4OQTH 1NIDA 1PY4A 2YGVA 3MLVH 3V5DA 3PNWA 2HT3D 2X44D 4KK8C 1UA7A 2KPWA 1FSKB 2AJYH 4HMCA 5DSCB 3QPXH 2WLJA 1NGWA 3JTSA 2X10A 4GW1A 4YH6A 5EEXA 1ZCRA 4XMXA 1KB5B 3K6DA 1MCQA 2VDNH 3VI3E 3PAYA 2I5YH 5C7ZA 1EDHA 1MW3A 2IPTL 25C8H 1K6QH 3HRPA 3TNMA 2BP0A 3SE4A 4J3XA 5AYUL 4I0PC 4TUOA 3CU7A 3TESA 3WUWB 1COBA 2FD6L 1U92B 2H3NB 3GWJA 4Y89A 1JZ8A 3AQZA 3QUXB 5LHDA 1U95B 3PABB 5DK2B 4FQIL 4WWKB 4X4XB 4LLWB 3KVDD 2LR4A 2D2CC 4OFIA 1ZA6A 1MJ8L 5JW4N 2HVJB 5EWIH 1EVTC 1KIQA 1WFUA 4KZ0A 1S7RA 4FQQA 5AZEH 4QHKJ 1RIUH 4AGMA 5K9JH 4PCYA 2DWEA 1MEXH 4CC0A 3LEXA 4X8JA 3Q6GH 2FWSA 1Q8MA 2VL5A 3L7EA 3VWKB 5EH1A 1AYRA 3KPOA 1T0MA 3OKDA 5I5JA 5AAPA 5CEZL 1B0RA 3SN6N 4PJFF 3POCA 3G5ZA 1IC4H 2XVGA 1FNLA 1BJMA 2IH1B 4L8DB 3CFCL 3N9GH 3RZCB 4JG0H 5I8CA 5I6XB 3TF4A 5FYLE 1QLEL 3HUJE 2YPLA 1JK8A 4DZBB 1LO0L 2PYFA 1SZNA 3TFBA 4X6DA 2WNXA 5AVWB 3VRIB 5I66A 2VDNL 2YAQA 2BIPA 1UH2A 4QKTA 1GZQA 1M6OB 1N5YL 3I02A 3ECWA 2BY0A 1Y0LA 1MF2L 2I7SA 3KD4A 4AQAA 1XZ0A 1IAOB 3FFCD 3NRQA 1YQ2A 3MRLA 1NGZA 1JHKL 3QIBC 3V4VH 1GYCA 2G3XA 1M6OA 1KGJA 2P5WE 3AWEA 3H42L 4LSSH 4WY7H 3PWVB 4JLRA 1L9SA 1KFGA 1UWXH 1LEGB 1RI8A 3L3OA 2PCYA 2NRDA 3BKYH 5EU7C 2VZSA 2WTPA 4IRJA 2EDMA 1QSFA 2JCCA 2JNZA 4A7GA 2NY6D 1MH5B 1MCOH 2LOEA 2CGZA 2XIDA 3B9DA 5ALBL 3RWHB 1NDMA 2G30A 4AEIL 4U6VH 5C9JA 3H4HA 4PRBB 3QULA 3WLBA 4HWZB 2X53A 3DSFL 3AC0A 4U6XA 2ADGA 3KXFD 2ED7A 5F7LB 1GYAA 2WTOA 4GRMA 2NOYA 1KIUA 1XTMA 5CP3H 5JOPE 4WLCA 1X5HA 3FZUD 4M5ZL 4Y88A 3C5ZB 3R0NA 2VDPB 3QORA 5EZIL 5EO9B 1KGCD 3ZKMD 1MVUB 1UZ6E 5BNXD 3HS8A 4LCYB 3JV4B 1JCVA 4EZJA 1TPXC 5MP6L 1LP9E 2OJEA 2XBTA 3BLPX 3HJ0A 2H26A 5F8RC 5DS2A 5EEZA 2JIXA 3MUHL 1NOFA 2NY6C 3BE1H 1AS8A 1G7IA 4G9DA 2ESVA 1RXLA 2UZXA 5DRZB 1VENA 3LKSB 3SE3A 2YA0A 1M7DB 3BKYL 1S3RA 2ROYA 5BJTA 2KHAA 1IGMH 4F9PA 4HJJH 5TJWK 3V0FA 5MEOA 1KELL 1K5NB 1FF5A 2OCJA 3G5YA 4NP4L 4UDUA 1CFQB 1KNOB 5CGBA 2EYSB 4NO0B 4F3FB 1DQML 1HH9A 4R7DA 5IW1B 1CXLA 1I8LC 3QJVB 2VUKA 4XN4A 1RK1B 5CXPA 3NEXA 3T4AC 2NYZA 4RMSA 4X4KA 4KX9A 3WFHB 1I1AC 5E9DB 3WY3A 1JXGA 4M5ZH 1AO7E 1KB9J 5FGCB 5HYQB 3BEWA 4FERA 5C6TL 4PJGE 1S7XA 1TKWB 4A7GF 1VFAA 4HA1A 1OAKL 4JY5L 2ZCKH 3RL2B 4XAKE 3MJ7A 1B4JL 5B1BB 1H15A 4ADJA 3P30H 3HVNA 4RA3A 1MHCA 2HLAA 1V54B 2QV2A 4ZPVA 4BXSV 4O2CB 5SWQA 1D5BB 2QMKA 1JGVL 1U2YA 2ICES 4NKMA 2YWZA 4YSEA 2EKSA 4AENA 5JHDB 1H6FA 5DJ8A 2O6EA 4F7TB 5JQ6H 5C0RH 4PBWD 5DMIH 5LG1A 1HINL 2C4XA 3FUEA 3M07A 3O6FB 1I1FA 4WSKA 4Z23A 2R29A 1AKPA 4PJGA 5KVFH 3KNBB 3ZGHA 5D7IA 3KLHC 3QR0A 4X7TB 2YXVA 3VFWA 3AT9A 2HG5B 1MFEH 4OLVH 5C07E 5C0AA 3VFGH 3VMNA 1WBYA 1OPGH 1C16A 4FTVB 1IBBA 4EI6B 2V2TA 4XI5C 3LN9A 4IGBA 1BGXL 4RMTA 5D72L 2HRHA 4OUUB 4BINA 2IH9A 1TMCB 5F7DA 1S7RB 4FQQB 2VLRD 3HB3C 2CR3A 1A6WL 3CSYB 3PWLB 2JTYA 5CN1A 3RTQB 5GS0D 1OF0A 1NCCH 4NUJB 3VFPA 3GRWL 1HHGB 2I7OA 3A6CH 3U30B 1AC6A 1A3RH 2C3VB 4LCCA 2J8UA 3LXBA 4K94H 5DU7A 5HGHB 3GMOA 2EH7L 4U2ZA 3MJ9H 4EOWL 4X6BB 1DJWA 2BP0B 2YQGA 4U6HB 2WBJB 4F58L 3X3GL 2VJXA 4Z77B 2IQ9L 3BAEL 1RZQA 2MSPA 1JDDA 1KB5A 4WQOA 4GBXA 1LP9A 2XUWA 1SN2A 3KEDA 5AB9A 3QWRA 3EF7A 3UGEA 1ZE3C 1I1AB 3RVVD 1FO0A 1ID5I 3EOYG 3G6JA 3OQ3B 3V0WL 2B4CC 2WKGA 4R0LA 3N40P 5FUCE 4OGQC 5HJBA 1KN4H 5EO0A 4XODA 4HPYH 4WHYH 1HK6A 2VDOL 4C56E 4ZNEE 5C0EA 2ICCA 3C09B 4ZO7A 1IJ9A 4FE9A 4JY6A 1CLYH 3V0GA 3KPQB 4JFEE 5D2LA 2DIJA 4YHYC 2AXFA 4KI5C 5BV7C 4GPVA 2XN9B 4OLWL 4HEPG 2R39A 4WEEA 2AKRB 3GBEA 3I6KA 1WIPA 4DZ8B 1QSFE 1AQHA 4NFCA 4G42A 1U3HC 3MREB 4KDVA 4F2ME 3AXIA 3QXAB 2XQBH 2NR6C 5I9QB 1WC7A 2UXGA 4PJFB 3A6BH 3VXQA 1A3RL 3GSQB 5A2IH 2P47B 4KVNH 3CMOH 3G5XB 3CPLB 2ZXAA 3VXQB 4W9KC 5L2KA 2NY2C 3IVKB 3HI1A 3GSVA 4KOBA 4Z7VE 2WUBL 1XGRB 4CC4A 4OLZH 1JGDB 3DHJA 1PMYA 3K4ZA 5E08H 1U91A 3LH2H 4M7JL 4B96A 1OF2A 1JXDA 5GQBA 5KS9F 1UM4L 4FG6C 3OQRA 4HJUA 3KLHD 3QG6A 1T66D 4H25A 2DQJL 4PW4A 4X6DE 1CJYA 5KSAB 3RX7A 2X4PB 1BX2A 3HUJA 3Q0HA 3U0WH 3C8KA 2FO8A 4HH9A 3WKQA 4AIEA 2PWHA 1ROCA 3HFML 4EUPH 3HS0B 1BOGA 5ICZA 1YQVL 2ZUXA 4J3TA 3TVMD 3GNML 4RWYL 3IFNL 5EF2A 3H9HA 4JHVA 1PZ5B 1ZY9A 3SPGA 2YBGA 3SE6A 4QXVA 1OWWA 1QBMH 2V7HB 5AAMA 3U6RA 3QWOA 5IQ9B 2PYEB 5F89A 1ZEAH 2B14A 3DURA 3QYNA 4U7KA 1VIWA 2I69A 3U4BH 4KVNL 2DLFL 4F37K 1ES0B 4X5QA 2IV8A 5EBWB 3UBHA 1F90H 1WZAA 5KVEE 3TYGH 1CDIA 4W9GC 2XVLA 4MA8H 1E3ZA 3DUUB 3FXIC 4TQPA 2YGNA 3ZDXE 5FYLL 3OLEA 4M9OA 3K6IA 4GKNB 1SBSH 4GW5B 3SQRA 3QA3A 1KUMA 4WUUE 4LIQL 5BV7B 2NY0D 1IGYB 1PL3A 4YX2L 5I1IH 2YD1A 2PXYD 4PB9H 1PEZA 5FO9A 1FGVH 1ED3A 5E51A 4AV4A 3UMNA 2EO7A 3K2MC 5FECB 3QIWD 2H7WA 3QEHA 4LDEB 4PG9B 2AV1A 4LGRB 3T65B 3CK0H 1U42A 2BSSB 4B60A 3K74B 1AS7A 1IEBA 1THCA 2P8LA 3TM6A 1R34A 3T8VA 4F7TA 4ZFOA 2VLKE 1IX2A 3KG5A 4NQDA 3QJRB 2CXKA 5E8DL 1P9MC 5F3HA 4DN4L 2JKIS 3L17A 4XBEH 3SYPA 3P3TA 1BVKA 3L6FA 3F7PC 1R4XA 1U8IB 1TU2B 2EDDA 4OW6A 3U7WL 2HLAB 3P9LB 1KXVC 4OZ4B 3S4SG 4KPHH 1CU4H 1DVFA 1WBXA 4OCSL 1BVKB 1A7QH 1MRDH 3L6FB 4LARL 5CFHA 1G6RL 5DCCA 1GY1A 4NN5B 1XSOA 4GI6A 2LHAA 1OW0A 2HAZA 1H0DB 1TQTA 4UNTA 2ARJQ 3ARBB 2EEAA 3GJFA 4XNXL 3VB9A 4QHKI 2Z93A 1OY3B 5H94A 2AXFB 5I1HL 3I6SA 4LLUA 5JIHA 2GT9A 4M43L 4HVBA 3L7FB 5DC4B 3QFJB 2HH0L 5DC0A 4HUVB 5F7WC 4HULB 1KDIA 3WFEL 4UQDA 2OCCB 4M5YH 4X8XA 3AAZA 5EC1A 4Y4FD 2A0LC 4FNTA 3MKGA 4NZFA 4Z3TA 4N85A 1MLBA 3D8MA 1RUQL 2P49B 4NYLB 1J8RA 1BXXA 2IMMA 4OZFG 3RKPA 2DEWX 2R0KL 2MCAA 2GITA 3R7RA 3U7WH 4PGJA 3BW9A 3NCWA 3QORC 2WNGA 5IFHL 2VRKA 3V0JA 1MI5B 2BSCA 2VW7A 4FQLH 4XR8C 1Q1JH 1QUNA 1YO4A 1OP9A 4GFXA 1RKRA 3BSZL 3WO4B 2WWKO 5B3SB 5T1JA 5K9QG 2J8UB 1PFOA 1W72H 1UFUA 4ZAKC 1AACA 3ZDYB 1XGTA 4WO4A 4O58H 4LLQB 4HPHA 5CEZH 3RVWC 4OTXL 5T1LA 3S2CA 5E1HB 5G4NA 4OAWA 3TBVB 5ESQA 1G94A 2J25A 3DX3A 4GQQA 4E41A 4PRBA 3MCLL 4JKKA 2CAKA 3MV8A 4JFXA 4KKLC 1MH5A 2DWTA 2JCCB 2Q7YA 5CBEA 1XR8A 2PCFA 3LS5L 4DO4A 1IGFL 5C7XL 3V95A 1N5YH 3NCCB 5AW5B 3BVNA 3LX9A 5T3XL 1HXYA 1VADA 4JPIA 3SZ6A 4PJ5B 4KZEH 4CBZA 2GABA 4WRLA 1B0WA 4XMZA 2FECI 4NQCB 1M7IB 3MOBH 3IJEB 3AS2A 4Q6YA 3DRTB 4MZRA 3UOAB 2WN2A 3TTYA 1KCRH 2ZWKA 4L8CB 15C8H 3EYSH 4HPOL 4LQFL 4M6AA 3SBQA 2YRBA 5JQHC 4ZO6A 1NCGA 1UGKA 3KPPB 4M1GH 2Y0SA 2FJFA 4NQUA 3RKDD 4K3GA 5AENA 4IKNA 1R5IB 4OFVA 3WKPA 4E68A 3O4LA 2AVFA 4NC0B 3PQYE 2K6ZA 1SUJA 1T21B 4WI3A 4WTWA 2X70A 4WW2F 3DSFH 2JXMB 2NT0A 3FQXA 4FFWC 5CLTA 3TCXA 2APXA 4WEMB 2RHEA 3O8XD 2D31B 2PYED 3KJ4B 2AJSH 2QELA 5F9DC 2JCWA 1I82A 2GKIA 1XFPA 1I85A 1TYEB 2VOTA 3RVUC 3VWKA 4BK4A 4XC1L 4S1RL 4MASA 4GG6E 3SBPA 3RIFF 3KPMA 4F3FA 5T1MB 2DKMA 1DJZA 5CJQL 3TX4A 4JFFE 3WV0A 3HFFA 3HG3A 4WWKD 4LKCA 2GFBB 3ZTJH 5HHOB 5K9OB 1G87A 2BNQE 1DBBL 4W9JC 2WQWA 1E30A 3VXTB 3GBMH 4HIIA 3K80A 2HLFD 3NEOA 4P2OC 2BWQA 3UCQA 3K5SA 4XCEB 5DMKA 1AZVA 2W65A 1QEXA 1YNTA 1KB5H 1T6BX 2OMXA 2OW7A 4JAMB 1SN5A 4AMWA 4M6OL 3TA3D 1I53A 2X6UA 3FQTA 4U49A 3PV6B 5E1AA 1G84A 3FTUA 3KWTA 3ESOA 4A2FA 1BQLL 3ZHLA 2FR4A 4IJ3C 1HEZA 3NGBB 4FQCH 3Q5OA 3S96B 1OP3K 4HAGA 2QDVA 5FUOH 4PJ8D 3V5KA 2G5RA 4DKFL 5CCGE 1UOLA 4WCYH 2J55A 5F6HI 3E6HB 1DR9A 2CLVB 4L9LB 3FN0L 1ZWIA 4UZUA 5TF1H 4F8QA 3PHAA 2R2BA 2WBKA 4XMPL 4UQ2A 5FGRA 4TNVF 5ITBL 1NCBH 3RU8L 4S1RH 1OAKH 4I9WD 3RLSA 1NMCB 2K78A 5JDSA 2FLRT 2NZ1A 3TIEB 5HY9B 4U33A 2G4GA 2NY4B 1ILUA 3VRLE 1JPSL 2A6JB 1H5BC 4DTGL 1QFOA 2WTRB 5SWZE 1JGVH 3J8F7 4L1DA 1P1ZA 3G9VA 4IRZA 1SY6A 4GY4A 5HGGS 3X1FA 1U8NA 1EFXD 4R97C 5JIPA 4AENB 1G7PA 2EYRB 3BDXA 3B5HA 2CK2A 1DVXA 1GOFA 1NFIB 2WXGA 2ZYRA 1A6TB 3HNVH 4H5SA 3VXPA 3L3DA 1MCKA 3HBQA 3NIDE 5EEUA 4P06A 3CGTA 3FT0A 4NJ9H 4KMLB 2V3FA 4XN8A 1YMMB 2VERN 3GJFK 4Y5VA 4B5EA 2ADJA 4Y4HB 3EKCA 2FX8H 4Q89A 5TQ2L 1SQ2N 3PS6A 1ZLSH 4MA1B 4HG4K 3G5WA 4DKFH 1ZV9A 1MCPL 4LOFA 2RCSL 4EZLA 5T3XE 5IJVA 2HKHL 4HUNB 4JO4H 4L4VB 1GTFA 1J05A 3D69A 4PGBB 2YFNA 1DQJB 4QO1A 1YY9C 4WHTA 2BNUA 1NL0L 2NY5C 4V1DA 5KVGE 2FX7L 3W0WE 3T09A 1HI6B 3HNTL 4NERA 4QR7A 4AV5A 1DHKA 2NQDA 3MJ9L 4DTGH 1AQKL 3QFJA 3VG9B 4CU6A 2O5YH 3NP3A 4EVNA 3B37A 3RGVB 2NUPB 5F7YC 2Q1EA 4DKEH 3WN5A 4MNHB 4UNUA 2FNWA 3K6OA 2AEIT 3UAJA 2E5EA 2APFA 4MMZB 4LNRA 1UB6B 2YR3A 2V5TA 4U6TA 1JGEB 1V10A 2ZXGA 3D4GA 4ZUUA 1MCCA 5BZZA 1CGXA 1DBJH 1MSPA 4Q56A 3W81A 3ATBA 4UTAL 2DW5A 4QHUB 2EVIA 3FO2A 3L13A 2R4RL 1KN4L 2HFEB 4S1DD 3WFZA 2QT6A 5JW3H 3BEVA 5IMKA 3E9TA 4CJ1A 3FTGA 1MVUA 1UWFA 4KRLB 3BWUC 8CGTA 2VJ0A 2CO2A 1FC1A 3ZDYE 1WG3A 3GIZH 3O6FC 4MJID 4Y2NA 2WXPA 4I3SH 4JO4L 5C0JA 3ILQD 3CLWA 4NN6C 4NQDB 5AYQA 4BUHA 1QZ1A 1TEFA 2DZEA 2O5NA 1E67A 3H3BC 5CLYA 3OAUH 3VYPA 3UCRA 1NTDA 1E8YA 3CNKA 5I1LA 5B8CA 2J2ZA 2BSSA 4N0YL 1HS6A 1LMKA 3CCHA 2R4SH 4IJTA 4JM4L 1PW3A 4PREB 3UACA 2X4RB 2Z7WA 1KYFA 1KEML 2QHRH 3PL6B 5DJDB 4NZUL 3B83A 3GHPA 1NGYA 2P46B 1YYML 4D9RE 4ISVB 4XBGB 3OKLB 1CE6A 3RPBA 3MLZH 1JFHA 2DLHA 3E3QE 2YPVL 4GQZA 4JQXC 3RGVD 1UM4H 4GW5A 6FABH 3V6FA 3DVFA 1KLGA 4G1MB 2Q8AH 3FB8A 4OKVB 3HZVA 1ZSHA 1P6WA 5EUKB 4J3OH 4LPYA 5E94A 5IMMA 3V6OE 5CKGA 4AGNA 1GHFL 3Q1SL 4I2XB 2E9GA 1PLAA 4PJDB 1MG2C 3LKPA 5C09D 2C9RA 4MAZA 3RHWK 5IB3B 3SSGA 4CBPA 2A1WH 1TTRA 1M71A 4J7RA 5H4ZA 4MXVF 3NN8B 1L5GA 5C0IA 2Y5TB 1KTLA 4LCWD 3HAEA 3QQ4B 3VXSD 5JPNA 1MCJA 3LS4L 2GYSA 4R4ND 1EERB 3CDGB 1NSNH 3ULAB 3WEAA 1UVQB 4GSDL 4LGSB 3P4NB 1A6UL 2DMKA 3JSSA 2B1OA 4M7KH 4XNMA 1OP5K 4YXLL 3UAFA 3EUDA 4TQHA 3QQ9D 1DEEB 1PZSA 2EICA 2IDQA 4N0YH 4HK0A 1YRKA 1INDL 1D9KA 2F1EA 4M7LT 3VXME 3T0ED 1RSFA 4XWOD 3GSNA 2QPDB 1ZA6B 4NZUH 1JHTB 3SD5A 4YC2B 5IESL 3L5WA 5FHBL 2EVJA 1UACH 3E8UH 5M7QA 3C08L 4KMTL 4K2UH 5TPWH 1NDTA 1CICC 1U92A 2H3NA 3ZY7A 4BZ1H 3WN6A 1ORQA 3ULVD 1FYTB 2OQJB 4XC3H 1GVIA 2DBLL 4K3DL 2AQPA 5DR5L 3ZTNL 2R0WL 2HRLA 3M17B 3OWEA 4BSVB 5FYJL 1DBKH 1RSYA 5KTEL 4XMKH 2XTJC 3UIYA 3ARGB 3QJZA 5GRXG 1MPAH 4AEEA 3SDCD 1JXJA 2A1WL 4X83A 1NCTA 3BAYA 2SODB 1HH6A 4L8BB 4MAUL 4XBMA 3RWJB 3U6XA 3OKMA 2CBPA 4HIXH 4JUSA 1ITBB 5AOIA 3MV7B 3NSJA 3S3PA 4OVVA 3EO1B 4XBEL 4ZT1A 3LMJL 4LL1A 4OGYL 1U9KA 3BOVA 1P1VA 2R0LL 3MOAH 5HDQL 3FAWA 1YPZB 5EOCJ 3B1TA 1RZFH 3FT2A 4FZEL 3BPNC 1P7BA 3G3LA 5JYLA 3CVDA 3F7YB 3VTTA 2ADIA 1M71B 2H6PB 5ADPL 3CFBA 3M1OA 4KGJA 3GMMA 3BZFB 3H6AA 2A0LD 3EGDA 1OARH 3NQKA 2C9PA 4FA8A 2WLMA 4K8RD 3KLKA 4YXKH 4ZI8A 1J5IA 3N55A 1WS7A 2MIZA 2XV0A 2DL9A 2E76C 2YXFA 3MRKB 4NIKB 5BRZA 3U79A 4NPKA 2G5BB 3ZTNH 4I1PA 1BIHA 3LB6C 1MI5D 3DX1A 3FB6B 5FYJH 1DBKL 3MLWH 5TE4L 4M43H 2APSA 2W07A 5C70A 1FYTA 4Z6AT 1QSED 1UKQA 1FC2D 4JFVA 4QWWD 3WTVA 1AP2A 1H8NA 2X2IA 2GIYA 3UTQA 2VW6A 4GSRA 3QXDA 1CDUA 4G8GB 3FQ4A 4D3CL 4FFTA 2NPLX 1NMBH 3PWLA 4N4YB 4BE5A 2VO8A 3QDME 1NEZA 1RVFH 3ERXA 1YVLA 3QHZL 4JHAL 5CEZD 5HPOA 1ZS2A 1K3IA 1CMOA 1RZFL 4FZEH 1IE4A 4NQED 5SX4I 4XO4A 3CZJA 2F5AL 1AHKA 2DQDH 3EZ8A 4ZJ9A 3W37A 2WD0A 2A6KB 2I60L 4XN9A 3HLKA 4JEGB 1UWGL 3GSRA 1BIIA 1GL4B 5HHQA 1NPUA 3RDTC 2YARA 1KGCE 3ZTJG 1ACYL 4YSSA 4PRNA 5DD5H 5T8IA 3RY6C 2YAFA 1JVLA 5DJXB 5C97A 3UJTL 1B6DA 4WSGA 5DZOA 3NJJA 3DO7B 2GHZA 5I6NA 4PGZA 1IL1A 2F68X 1X5KA 3LS5H 2VSKB 2ZUVA 4RGMC 3T04D 1G0XA 2Z1KA 4JRXE 4ZPVB 3ZYOA 2ZOUA 3UBGA 4BRVA 1S9WB 2X1XR 3EH4B 3UJJH 3TFKD 3TBWB 1E5UI 3HC4H 4OF5A 3REWB 3FOLA 1E43A 2E3VA 1I75A 2WXFA 4JPVH 5GSRB 4H88H 4K5OA 5DUMH 4PSPA 4XMLH 5CJXA 4CMMA 5EN2A 4ZW5A 4EI5A 4G82A 5DA4A 2P26A 4IBSA 4N1CA 5J9PB 2J8OA 1JL8A 2PW1B 1PG7X 3EJTA 4HJGA 3AS0A 2V37A 1F58H 4K73A 1NDGB 5EG6C 1WD9A 1MCLA 2WXLA 1KBPA 1O6SA 4NS0A 4BGDA 3REVA 2Z91A 1I4FA 2VXTH 4KJYA 1S9YA 3WEMA 1R3HA 1UD5A 1QW9A 1CFVH 2IEPA 1H3PL 2H5UA 2X12A 4LSTL 4X98A 4AMKH 1GYWA 3L3DB 4LSPH 3HG1E 1XEDA 2AK4D 3EXLA 1UD4A 4RETB 2LU4A 3ECQA 4MCNA 1XXFC 1NIFA 4X99A 4ZFFB 1V7NL 3NJMA 5IQMA 5C6PB 3NIGB 1RZ7H 5KZCB 1YEWA 5AZUA 2ZF8A 3HC4L 1JNJA 5DFAA 2AQ2A 5CBAA 5I16A 1DLHA 3U1SH 2OMYA 4V11A 1FL5B 2VZ3A 3R1GH 1HEHC 3AS3A 2HTKD 2ICEB 5DT1H 1T5WB 1ZPLA 2AW2A 3VG0H 3Q2NA 5DUJA 2N7BA 2VR6A 1LO5A 2Y7NA 1DBAL 4TUKH 3MRIB 4NPJA 2VH5H 4JFSA 4UQEA 1M2VA 2WLIA 3VXOA 2OSLB 3FCSA 4G6JL 1ODAA 3PQYD 3HKFA 1IVLA 2YJLA 5ECJE 2W9DL 1RH8A 2K8MA 3DXAD 3C5JA 4IIQC 1E90A 5CHNB 1DZBA 3SDDC 3PPSA 2UYLB 2GJZB 2YUZA 2VLRE 1FNFA 1AGCB 1AI1L 4KKAD 4DGUA 4AMKL 2OA9A 4YDMA 3PJNA 2ADJB 4Y4HA 3CFDB 1CC3A 2B0SH 4YDJB 3HPLA 3RX5A 1FDLH 3TV3L 1MCWW 5CS7A 3WIFA 4MMXA 2QADB 4H20L 4JQIA 2VDKB 1DVTA 1OO2A 3O0RH 3O6KL 5TF0A 5DMGD 2Z31B 2CJSA 1OM9A 3IFPA 2NZ9C 1OAUL 1OD7A 2Z7UA 1UXSA 5CZVL 1P7QB 1S7WB 3A0OA 4J4PD 4TRPH 4BHUA 3TEZA 2H9GB 4IKIA 2P4AB 1CVSC 1S7QB 2CO1A 4TL4A 1NWPA 1IUZA 1U8KB 4FMVA 1KXQE 2N59A 4OM1L 1S9KC 2GUOA 4Z1PA 2HG0A 3V10A 4GINA 5IG7B 3GDBA 2ZCZA 3TH4T 5IW3A 4ZW8A 4XB3A 3QCVH 2DWEB 2JXMA 1JWMB 2X7LB 3EGSA 3RVWD 3SE4C 1UD3A 1S9VA 5ILTL 4FQ2H 3LEYH 2APBA 2WO2B 1AD0B 4MA3B 3RNKA 5KN5A 1YPZF 3ALXA 1ZVYA 4NWTH 5A6LA 4S0TD 1A7RL 4UIKL 4OBSA 4WV1B 2X9ZA 1S9VB 2WVSA 4HDIB 3ZGIA 1BM3L 5KSBB 1XCTA 3HB3B 3AWFA 2BMKA 2NZIA 1A7NH 5LXGH 4R4BB 5IEKA 2FECL 1ZTXH 2A6IA 4HMDA 3RVXC 4NKQB 3K8MA 1I7RA 3FFDA 2ZX9A 4J6RL 3BVNB 1W0YT 3U9PL 3PGFL 2OXGA 3GLEA 4AVHA 3O4OC 5ESVA 1RZ8B 1OXYA 1JZGA 4DP6X 2CCLA 2BVQB 1DLFL 4J4PA 1UOWA 3KBFA 4KRPC 3X11A 1E27B 3SO3B 4P9HL 3FH7A 5CSZA 4OFKA 4Y19B 1T5XB 3CIQA 1EHXA 3L8QA 1OE3A 3SDXB 5JW3L 5ACZA 3CFEA 4FQ2L 1T2QL 3ZL2A 5H2BA 4OFPA 1PU0A 4BFNA 1HCFX 3I6LE 4EIZC 3KCWA 1T21A 1J0ZA 4G1EA 3CLFH 5BVPL 1CYXA 4HOXA 3RVUD 2P42B 3MKKA 3QEQA 1DE4A 5LXVA 2GITB 2ID5A 3FSOA 4R26L 3T0EB 1QKZL 3DV4A 2UXVA 3FTVA 3CVHA 3HOGA 3IDYB 2X5PA 4TULH 3Q5TA 5EU4B 1A5FH 4JRXB 2H1LM 4KAQH 1AYOA 1AR1D 3SJVE 2NNCA 1AOHA 1W0VB 5E2VL 3DVIA 4NDMB 1KBGL 3MBWA 4G5ZH 1IT9H 3ATDA 3ZN6A 4Z78B 2CK0H 2X89D 2LLGA 3D25A 5JOFB 3NFPB 1DLFH 4N2OA 2UX7A 1LP9F 4LLYA 3DMMB 3WENA 2KQMA 3OJDA 4J2QA 5ICUA 1WFIA 3WLWD 1J88A 2X6BA 4KKAC 4UIMA 3OMAB 3RWGB 4ZTPH 4MDJB 2ZUWA 3VVWA 3TJHD 4M56A 1UADC 4L4VD 4WNQA 3BFWA 3MGTB 3NABL 4QYOA 4V1DD 2Y1VA 1UXLA 4AL8L 4C4KT 3HZMB 5GHWL 2R29H 3WS6C 4IBVA 1PVHA 2VDMB 3BVUA 1I8UA 2OM5A 2R2CA 4X98B 1UM5L 1U8PA 4FN0A 4NRZB 4Y16B 4K9EH 1Q0YL 4ZXBB 4JJOA 4KKZA 2GBTA 4KK8D 3SBWC 3REVB 2ZWNA 5E00A 3FQRA 1YLBB 2BWIA 4MXQC 3SPHA 2JQAA 1RZJC 3SKMA 4AQEB 1FE8L 2ESVD 5BOPA 1ZVSA 5C08D 3MLTB 1NAKL 1OCCB 2Q2LA 3JYBA 4WUUD 5EU5A 5SWZA 3BYTA 3OL2A 1I8LA 4X5XB 2C3HA 1BEYL 5EEYA 5IQNA 3L3GB 2N0MA 4JDEA 3TZVD 3RI5F 4YR6B 2H41A 3ZXAC 1YHPA 5L0QC 2K45A 2F53A 2AGJH 4PJEF 2JQMA 2Z35B 5AW0B 3ETBF 4BZ1L 3FOLB 3MVSA 1KIPB 3ULSA 5HDOA 2DBLH 4K3DH 3X2QB 1LYQA 1JHLH 2ZOKA 3CUPA 3QZNA 5GZNA 5I73B 4X2UA 3AADB 5DRXA 3WIHA 3EYVB 3B2VL 5LCVH 3L4WA 4PY7A 5CUSH 5T5FH 3K72A 4XPHL 3DV6A 3AG4B 3FH5A 4C4BA 4FLRA 5E6IA 4A67A 2H2PC 2VDPH 1JRHH 3MJGX 2DLEA 4JCWA 2COQA 1B0IA 4NO2B 2PYEA 1I8KB 2ZKHL 1WBZB 4ZXBD 2MMXA 5ALCL 5EBLB 5DJCA 3OKOB 3MGAA 1QZNA 2X4QB 4HXBH 1U30A 2VO5A 3ULUC 4L4TD 1SJXA 5ADPH 3B56A 4IMLA 3VI4F 3HMXH 1HU8A 1A22B 2NUTB 5TDOA 2HT2C 4MAYA 3SJVD 5B38B 2AQRA 1AZZC 3U1QA 3BQUD 3U36A 4IDJH 4XO9A 1MAKA 4C56B 1MW1A 1F4HA 4JKWA 5E4EB 3QZBA 2VCOA 1HL8A 1MFBL 1NGQL 5F9OL 4FHKA 5KJ4A 2GC7C 1OAZH 3NESA 4JO1H 4R96A 1H3VA 4LOUC 4HFWA 3BH8A 5D1XD 4GT0A 1S78C 1JWSA 1OT4A 5F7MC 1U3JA 4EF3A 4CADB 1EXGA 4FQ1H 3QIBB 4PV9A 1OP4A 1UYWH 3KDMB 3OMZA 4EIUA 4AQOA 4ZZKA 1L7IH 3UYPB 1ZT4A 4XNMB 1SFDA 2C9XA 5GRVK 4DKDC 1MCBA 4JO2L 2EILB 1QSVA 1AIFB 4G42B 2NYYC 2VZUA 1KACB 3TURA 3OG4B 1OZTG 3FT2B 3QRBA 1S7VA 1UD8A 4F24A 1P4UA 3L45A 2NSXA 2GPZA 2QSCL 4FC3E 4PJCF 5D2LB 1DVFC 3MAWA 5KSBF 3KHQA 3EDFA 1MRCL 2X87A 1IM9D 4KTDL 1WEJL 4KY1L 2DRUA 5DQDH 1FG2A 4KNQA 1GGBH 1CXIA 4IMKA 4ANWA 3KYMB 4U1JA 3SDCB 1RZKC 4HZ1A 3PJLA 3OTTA 2JK5B 4RA0C 4F92B 5D8JL 2X4PA 4HKZA 4PW3A 4PSRA 5KYYB 2F18A 2VR8A 2GBAA 1EEYB 3U9UA 3MA7B 5J0BA 3HMXA 3F05A 3NACH 1SF5A 3L1FA 5D55A 1U91B 2JJVA 4LKXB 3U82B 3ZKND 1W6LA 2HVKA 1CQKA 4Q6KA 2EP6A 5HYSG 3SDXF 4H88L 2DD8H 2XZQL 3HI1B 2OULB 4A68A 1I1AD 1URZA 4FTDA 3VXNB 4WNQB 2O6DA 1EEZA 3GINA 3QP3A 1BBDH 2VMFA 2WXKA 4JFOB 2BC4B 1WBZA 3L9RA 4WHYG 4N0FB 1O75A 5E2WH 3IMBA 1OANA 1RK7A 1X7TA 5GZND 4HUCA 5I74B 3EJPA 4U1SA 5INCB 3L4XA 5L7XL 4Z7WA 1PQZA 1W0VA 2BCKA 3P9MB 4FNLH 2I9LB 1A4BA 1AG6A 3KJ4C 2EQDA 3DUHA 4NLHA 4JVUA 3WKYA 2CXGA 3FNKA 3EFFB 2I5YL 3EOAB 1DBMH 1SYVB 1LP9B 3L95A 1EFXB 3MRHA 1KBBA 5JW5A 4LVHC 4AIZA 3QHTC 1C5DA 1CFTB 1SLVA 1TTBA 3NCFB 2G3NA 1HWWA 4JGMA 5D7JA 2VN3A 3IGLA 1DVYA 3QQ9C 2CKBA 3FB7B 3T6XA 2I07B 3PGDA 4NNYB 1VACA 3HZYB 5C0FA 4M1DH 4LAQH 3A6OA 1PY9A 8FABA 2XLLA 4XWOC 2J1KA 1GGIL 4B6ZA 4TUKL 2B15A 3CFEB 1RIUL 1QFPA 5HYQA 2WXNA 4RGNE 5KBLA 5BO0D 3ZE2B 5AOLA 3CFIC 1IKFH 5E8PA 2OI9C 4LLVA 5E6ZA 3HZKA 1ICTA 3VE0A 2BS9A 5JNYA 3GBLA 1YEHH 4Q6IC 1YMMA 4J8RB 2Q0ZX 1IC4L 3L3KA 1CFNB 5ID0A 4O00A 1ESOA 2ZTBA 3GMPB 1S8DB 4ODTL 1JZ2A 3HN8A 3FFCB 3AREB 2B77A 2W1NA 4DPAX 1CG9B 1BOYA 3BWAA 2ESVB 4EUPB 5EFIA 4ZFOL 3LVTA 2CLRB 1NC4D 4L37B 1MREL 1OALA 2BMKB 2MJWA 5IVXB 3GSNL 3WI9A 2BNRE 3PY9A 2CHDA 3MA9H 1VDGA 5CGYC 3TBCA 3OKEB 3FC8A 3MLRH 4WV1A 1AVAA 4LNRB 3V4VL 3FU6A 4QRPE 5E99H 1ZT7B 5CN3A 3UG5A 4LCYA 3CAFA 1T03L 4LAQL 4MJ2A 1KBKA 4NDMA 5GGSB 3VD2A 2N01B 4OLXL 3HE7D 2GY5A 2MQGA 4U1GC 1Z9SB 2XV2A 3VGDA 3HI5H 4WW2A 4ZAKA 4HKXA 2PPDA 4JKNA 3D9AH 3F58H 3DWTA 1DJIA 3V7AG 5MEQA 4MNQD 1RMFL 4D0CA 1MIMH 2QKIB 4FQJH 2IPUK 4KHXL 3PV6A 5E1AB 2H32A 1SDAB 1TNMA 1WIOA 1J9TA 3L3OB 3VI4B 3ZKXB 1GGYA 4L48A 4UIKH 4DOHE 2OMTA 4HH8A 3WELA 1OSEA 3A3YB 5FS5A 1A66A 1R5WA 1DQQB 1M7DA 3P11L 1EIBA 1FNEB 2VZTA 3VSVA 3HHMA 3GSNH 4OGZA 1HJBC 4XPTH 5D5MA 1QNZL 1TPXB 4RH4A 4ECNA 5I19H 1VAHA 4YFLI 4XO5A 2PTVA 4JDZA 5HHXL 3ESMA 2LQRA 5FIEA 3PQYB 4ESKA 5EU6E 4JFUA 1D5RA 4AITA 1D7DA 4NUGL 3NFNA 2L0DA 3NK4A 4X6DF 1U8HA 4PV8B 1HFUA 4E9TA 5I28A 2IH1A 3RZCA 3MNVA 1YYCA 5ES4B 1FZJB 2VLKD 2VR5A 4HT1L 5D2LE 2YJQA 4HXAH 3DIDA 4A2MA 3M1CA 2I26N 2FH8A 1MQKL 1JPST 1Z1WA 2W0PA 4YHZL 1PX3A 2XWRA 1EZSA 3I6LD 3BESR 3QDJD 4Y4KA 3I2CH 4HHGA 2FZ3A 4NN5C 1HHHA 1JRHI 5AW1B 4PJHB 1FL5A 2XHNA 4KK9C 3DX9B 3TGXA 1K8IA 3FKUS 3AGVA 3RWEA 2LABA 2CO3A 4RFOH 3VU1A 2N4IA 4M8QB 3P11H 4EJ1C 4HIJA 3KM2A 2FX9L 3LTVA 3PWVA 4JLRB 4O5LH 5E1IA 1OGPA 2APTA 3LPGA 1RAMA 3D3VD 5CZKA 2IGLA 4U6YA 3X17A 4PR5B 3TH2T 4X42A 4OGAC 3BIKA 3T3PE 4PJAE 3OC8A 2XKNA 5D5MB 4UUJB 5BVJB 2WLNA 2Y36L 2VXUH 2VGLM 4N28A 5CBEB 1ZGLM 1MQ8A 1KPRA 1UOVA 1KWGA 1R5WB 5FUZL 3K6SA 3HZKB 5DSCA 3ARXA 4XXWA 2ICWI 1DVSA 4X0NA 2VWEE 1W2KT 3UIZA 4RIRA 4O9HH 3O3BA 4JFPB 5CR8A 5JHLH 4P2QE 3BFQG 4CVXA 2TSBA 3M1BB 4HWUA 4LVOB 5E5LA 3QUKA 4P59L 1OPGL 1MFMA 3FQ1A 3QUZB 3LPWA 4WFEE 4YHZH 4HUMB 1VACB 2VL5B 5F6IB 2MKLC 1XF5A 4JREC 4K9EL 4N0UB 1BW8A 3MI6A 4I77H 5DO2C 3ZU8A 4GQ9H 1AMXA 3O9WD 5F1NB 2P3YA 1TJHH 2F1AA 4OU3A 1KIQB 1MFCL 3TBWA 5AL0A 3US9A 3KPSB 4L8CA 3ISRA 2OL3H 3IU3A 1BZ7A 3MUUA 3O3EB 1M2VB 1IL1B 5EULV 4MA1C 4IRSA 3WFBL 2NW2A 3GIVA 2OMVB 1T89C 2E9BA 1ASPA 1B9ZA 5GIRA 3BZEA 2FWLB 3Q8EA 3IETA 4NQCD 5FUZH 5D7LD 4GKLA 5IFAH 1FLTX 3BWAB 2WV3A 3ZE1B 4E5XB 3BVVA 3UDWC 4HJJL 2OSWA 1PCXA 3TLRA 3HMWL 4XPAL 1D6EB 5G4OA 4FI8A 1G4RA 1ERNA 3G5VA 3DI2B 4BYHA 2XQYG 3S48A 2IBZY 1AO7A 3QDGA 3O45A 1DSFL 5AUMB 1M7UA 2JB5L 1BJ8A 1CFMA 2XU9A 1Z66A 1T22B 3FUMA 1CIUA 4L4VE 1T0PB 2ZOTA 3MLXH 4LHUA 3SCMB 3VXNA 2MHAA 4L5FL 4L4TA 3L4ZA 4W4NA 3WIHL 3B7RL 4Z8FH 4KK9D 4Z7UB 4ABVA 1NEZB 1HT6A 5DHVB 1PZ2A 3VCLB 2XWDA 1N10A 1NAMA 4UZSA 3MACH 1MAML 2IVFC 2H2SD 1E3XA 4GQ9L 5IW6B 5KG9A 2ZNWA 4A6YA 1MFCH 3WFDL 2YD0A 3GSOB 5C0FB 3ZJAA 2KS0A 4OF3A 1LNUB 3RVXD 2ZKYA 4KKBC 1QG3A 4HXBL 1N7ML 1AR1C 4Z0BL 3UBXA 4XO3A 5FKAA 4OZIB 5D1XC 4HWBA 3MRKA 3CN0A 4B9ZA 1HQ4B 1PBYA 4OF6A 3SGJC 1XEUA 4J1UB 4N9GA 4QRPB 4QAMB 1TYJA 5KYWA 2CD0A 2NX5A 5DMIL 1T7XA 2AJXL 3RYMA 4B9KC 2NSMA 4PU2A 2ROXA 5KVFL 1E65A 4GO8A 1IGYA 3QVAA 5DEZA 4X9HA 2FEJA 2F53D 4FEIA 1DSFH 2EYTB 2ODIA 1KJ2L 1BQHA 2F08A 4QRRE 4X7CC 3ZYJA 4CVWA 2V4LA 4WI2A 5C0BB 3BPCA 2E47A 2J6EA 1KYUA 1INEL 4L5FH 3MNZA 2IXQA 3CFJB 3QI9B 3MUY1 4E41D 3A22A 3F6IA 1P5VB 2V9UA 3ZIMA 3TONA 1VFMA 3MACL 4A38A 3FMGL 1B4RA 2ATPB 2YN3A 3NZUA 4AIXA 2FO4A 1A65A 1QTSA 1MXDA 1O5PA 4L8BA 4YHNA 3X3FH 12E8H 2C9SA 3LZOA 2DLFH 3NRFA 4LCIH 1YNTF 4KNSA 4KO6A 2OZ4A 3FRPA 1NMCC 3TPUA 2HZHA 4NENA 1CGUA 4BCYA 2ZXQA 2J72A 3IJSB 1GGTA 5GSVA 2FVNA 1A1OB 4EN3D 5KW9H 4RNRB 1F3RB 1CYGA 1MRCH 2X1OA 1ETA1 3DETC 3OLIA 5H4YA 3Q9PA 4ELKA 4L4JA 1F4AA 1LWJA 1SEQL 3EOTH 2ICWB 5IF0A 3MMEA 4JFZH 4ZS6C 3QYMA 1DJGA 4B7LA 3BSHA 4FG4A 1SYSA 5IF0B 2WLKA 3SGEH 2X1PA 3AQDA 5JA9A 2VDOH 2IDSA 4PLOB 5F9WB 2ICEC 1KCWA 3M6DA 1UM6L 4NNPL 2I27N 1V7MH 4QNPE 3D07A 4PJAA 2KL6A 2IWEA 3V5HA 3NACL 4WI8A 4MMYA 5DWUH 4YC2C 5AQ0A 1OP3H 3LHPL 2BHZA 2NNRA 2WXHA 1SGKA 4NQTA 3CVHH 2CO7A 4OCWH 1LDPL 1UURA 2DD8L 1MRFL 2XZQH 4NZ8A 1WRFA 3NN8A 1MDAA 1QHQA 2IANA 3EHBD 5HD8D 5JORB 3MREA 1KENH 4P46A 3GSXB 2CR6A 3CMOL 4X7DC 1E3FA 2ADIB 2H6PA 2BHYA 4LCIL 4PUBL 3L5JA 4Q9QH 4K3JL 2K3HA 4KC3B 2XTJB 1CS6A 2XN9A 1E4WH 3VFNB 3RGHA 2EEXA 2VMDA 4N68A 1UCTA 2NYKA 1OTTD 3K4AA 3MNZB 3E3QC 4W70A 5EUKA 1MRDL 1YY8A 3LH2L 3V6BR 1L9PA 3VD7A 3I3EA 7FABL 1KTBA 4P5TB 1Q0EA 4NN7B 3G04A 2WZ6A 4NQDD 3FO1B 4K8RH 3TZVA 3QI9C 2DQUL 2A9BA 1FIGL 3OPUA 4QRFA 3UGUA 5L7XH 4QHPA 5KVFE 5GRJL 4CVZA 2O93L 5EBMA 4G80B 4H8WC 3A24A 5EU6A 1UM6H 2IFGA 3X12A 3GJFH 2A77L 3FQRB 2BERA 4HK3N 4U6HA 5KSAA 1LILA 5EMYA 4IMLB 4NFBA 3H3KA 1U8PB 4DIXA 5JZ7C 4JG9A 2A6DA 1L4IA 4WW1A 2VDLL 1O7DC 2X4SA 4N0UE 2XRAL 1A9EA 1KENL 2H0JA 4YGVA 3S3DB 1SXSA 1QBLL 3O6LH 4I4WB 4UB0L 2EDRA 1CGTA 4Q2ZA 4RAHA 3IDIB 3PIQB 4K3JH 4ZX5A 2ATPA 4F8LA 2J8HA 1WZKA 3B2UC 5JZ7D 3DX8A 1M2OA 5AB2A 4WHCA 4Y1AD 4BUQA 4LEOB 3UPCA 4PJBE 1TEGA 3LNFA 5J3HD 1NOAA 4PWHA 2XACC 2ZWSA 4RRPA 4GKOA 5FDYA 4QT5B 3EYOA 4M3JA 4MMZA 1ECYA 2DQUH 5B22A 2V5YA 4AUJA 3O11B 2VLMD 3JQOB 2AEOA 4NRXB 4MNHA 5FFOA 3MBWB 1J0IA 2ZOKB 3CUPB 4V2BA 3ILDA 4Y2OA 2PETA 3EO9H 4LCWB 3MRNB 2WMPA 5J12B 4KK5C 4D9RD 5SV3A 3BT2H 4BEIA 4G7VL 1BAGA 2W0FA 4QRPA 5IP4A 2A2QT 1J86A 4G7YL 1OGAA 4N1HB 3FB8B 2FAUA 4NLAA 1T66C 4PGCB 4MHHI 3EJQA 2UWEF 1DUYA 4P23A 4A2HA 3Q01A 1YAZA 1KTCA 3IJ8A 2GG1A 4LPVA 1BF5A 4JE4B 3U9WA 4XX5A 1U3YA 5K9JL 5KG9B 1T6VN 1S9XA 1QATA 4OCSH 1HL4A 4BV1A 1NAMB 2CA3A 1KCVH 3BP4A 5EIIA 3U7YL 4BQ6A 3I3BA 4LARH 4MVBD 3CPUA 1F2XK 3MRBA 4ZW7A 3VUAA 5I6XC 1NLDL 2EYRA 3ARGD 4FLHA 2MTPA 5CJ8A 3N40F 3L3IA 4PJGF 4QTHB 5EUOA 3KPLA 2WHVA 1TLMA 3VXRA 2D3JA 3LVEA 1C16B 3Q2CA 1AHWB 1WFOA 4ZOCA 4WNSA 3S5LG 2F0CA 2YUXA 3DTXA 5DRZA 3RUGA 4X5WA 4AKQA 4G59C 3WKNA 4AJVA 2HX9A 4QRRB 4R4BA 5GRYA 4JS7A 5GIRB 4FHBD 5F7AA 3W11C 4Z78A 2C9QA 2ZICA 2DIAA 2NNXA 2KZKA 3P9WB 4NUQA 1X5LA 1VJSA 2EABA 2H26B 4TVPH 4UQ2B 4QRPD 3Q06A 1RUQH 3QQ3A 3DA0A 4FNQA 4OQTA 5DJ8B 2V9RA 3RWEB 5F7KC 2B2XH 4WY7L 3KPSA 1AD0A 1FQ9C 1TZGL 2UVEA 3PDGA 5E9DE 3RNKB 1FLRH 5KN5B 4XCFL 4QEGA 4AVKA 4X4YB 2DYSB 3DXAA 4FJZA 5HVGB 2E7LC 5T1KB 4Z7WE 3U7YH 5ALBH 4X4MA 2VUYA 4OCXH 3TBSA 3NIFB 4ZOAA 4MTMA 2E7HA 1PLGH 1FZOB 2GUYA 2WYHA 4AYMC 5LNGA 1VF5C 4OGAD 2P24A 1NM4A 3EFDH 2R2HB 3EGXA 1U8HB 4PV8A 3EHBB 3ETSA 3I2CL 2WIIA 4HWBL 3H9SA 1JOIA 1TUPA 3QBTB 4HLJA 4UINH 4ZK8A 5I0ZA 4WF7A 3LRHA 2IFFL 1OHZA 4KZEL 4NKIL 3E9UA 3MRLB 4LHQB 4FI7A 1CQYA 3W56A 5DRNB 1U6AH 3BLKA 1NLBH 2QVIA 1RULL 1U3HA 4F57L 4F7PA 5BS0B 4HD5A 5I0YA 4NB7A 4YSAA 2VAAA 4BZ2L 2JE8A 3MX0B 3OHMB 5CD5C 1PYWA 3SQOL 1WZ1H 4KJWD 4TNFA 1FLRL 2J44A 1BYOA 2VR3A 2VWEC 3HNVL 2JIXB 4ZBJA 1IGML 3PGCB 3DJ9A 3QO0B 3Q43A 4WIQA 4WVRA 2Q76A 1A7PH 1WCBA 4UM9D 2N56A 3ARUA 1WAAF 1MWAL 1N18A 3MRRB 1BVLA 4M6ML 3Q05A 4BA0A 5L6YH 4UTBH 2WLIB 3ARGC 1ZLSL 5CEXA 1PLGL 1SBBA 1TETH 4EDXB 1HSBA 4YHYB 2D8KA 2RFXB 3QAQA 3X13A 3FSWA 1D6VL 4NQEA 4R3SA 5D1XA 1OOWA 1TZIA 3AS1A 4JVWA 4HCIA 1XF1A 3A47A 4QCIB 3FQNA 1JF5A 4HUXA 5IG7A 2GIXA 1R0AL 5K1NA 4YDKH 4Q0XL 4B9CA 2OL3L 4QRSB 2NY2B 4YK4C 1BVNT 1ZDQA 3WFBH 3WJLC 5I76B 4RGMB 2GK0A 4WWOA 4JFFD 2ISDA 2H45A 2XY1A 1XL6A 2CR0A 1H6EA 1SXNA 4P5TD 4Y1SA 5E70A 3WUZA 2JMRA 4RMQA 5IB1A 4Z5RA 5T1LB 4DT2A 1QI3A 1JNHA 1WGOA 3RDTD 3K6NA 3TO4C 3HPJA 1F4WL 1XGYL 3V9FA 3HNSL 3CDCA 5HHOA 1A1NA 5K9OA 4XPAH 2AXGA 5HPMA 4UTAH 1AD9A 1DP0A 4ZUWA 3CFNA 5DUPH 1RU9L 3V0AC 3CX5K 2Y6SD 5FEBA 3VE0B 3FB5A 1PDKA 4NZJA 3SPIA 3BPLC 1TR7A 4JGNA 4CILA 3LKQB 3TOPA 1JK8B 4NAMA 1D5ZB 1KXVA 3CFKB 5MEQB 4Z7QE 1UKTA 3S3JA 4L9LC 4XPFL 3TIDA 4M8RA 1A6WH 1FZOA 4BELD 1W16A 3VXOB 3DGDA 5SWSE 5FYKL 3FQXB 3B9EA 1KT2A 1NBQA 3MRIA 1C5BH 1J8SA 3NCJL 1AY1H 2OR8A 4QXUL 4W4OA 3L4VA 4PRPE 3GKWL 2NTSP 4QY8A 5LVEA 2VQUA 5T33L 4X8JB 4XTRC 4BCZA 5JLZB 4AIZB 1PKQE 1IAMA 2FT7A 4JM4H 1OQOA 5EC2B 1J1OH 3JWDC 4XPGL 3BUTA 3B9KC 4F58H 4CN1A 1XF4A 2BOCA 3V79C 4HS6B 5HP5A 1J5OL 1EZUA 1FHGA 4E9XA 3WSQH 3FCBA 3WNIA 1U8CA 4Q97A 3HC0A 1ZPUA 2VR4A 4P2CG 35C8H 3O9WA 3JWNC 4YZFF 4N90D 5C0CE 3ZTCC 1DQTA 4MQXC 1KPVB 3BO8B 4ZS7L 4HPYL 1C08B 1LDSA 3B43A 5C8JA 3U4AA 3H7BA 1L6XA 4B9YA 1INEH 5T1DH 1EAJA 2W9LA 4KO5A 2AK1L 3K91A 5TE6L 3NJKA 4ZOBA 5FO8B 4EZKA 5A6MA 2QSVA 3SDDA 5A43C 1TVHB 3LKRA 1I1CA 1M53A 4J23A 2OR9H 4KRMB 1VEMA 4WGKA 4WUUB 3UERA 3GO1H 2XKSA 2JJWA 3X3FL 1N68A 1BFSA 1CR9L 4F7CB 2YMXL 2AMUA 5DJAA 3LNEA 4ZAKD 2EVHA 3BXNA 2O5YL 4AT6B 4GEIA 1PEWA 3MV9D 4XVSL 2A83A 3RFZA 1ZVNA 1ZLDA 1S5HA 3GM0A 4IBQA 1GZPA 1I3GH 1MIEL 4BKSC 5A3ID 4LHUD 1HXKA 1X9RA 3GPSA 3QDMD 1E2ZA 1JG9A 4AZ8B 5GS0H 4B3EA 2BHFA 5FC9A 2I25N 2B8OT 5E8EA 5F96H 4DO5A 4IS6A 4TSCH 5IM7B 3H7LA 3VACA 4ZS7H 3F7YA 3QB7C 4ENZA 4LMQI 2ENJA 3ULVC 4K7PY 1IEAB 1BQSA 1T2XA 2EDYA 3CFMA 2JB6B 3D85A 2UY6B 2V3DA 4HSAC 5GGUA 4HUVA 5L88H 3QEQD 3DYOA 2B4CH 1FBIH 1MELA 1UZ8B 3KWXA 4FQXC 4RWYH 2BSDA 3QWOB 2DIEA 5IQ9A 4HGKC 3RJDA 1DUZA 1L0QA 1H0DA 5HBBA 1ZS8B 2GCYA 3V4PB 5GZOA 1AE6L 1ZT1B 1RIHL 1MRFH 2DQMA 1IE5A 1C5CH 1QEWA 4PYHA 3LNHA 1KXHA 4Q9RH 1ZT4B 4GUOA 3WEXA 3GS0A 2WOBA 2R56H 3ZYZA 5IQ7H 4P46D 4G6KL 5CZXD 2QQLH 5C8JB 4JL1A 2MOVA 4XVSH 2ED6A 2PWDA 3M17A 3TYGL 4BSVA 1XCWA 4UT9H 5DVKA 1N0LB 5BS0E 1TU2A 1U8LA 1A9EB 4QOKD 3CSBA 3N06B 4KKNA 1NGXB 4Y19D 3TCLB 2A6DB 4HLZH 1EEYA 1THAA 1TITA 4KK6D 3RB5A 3U9UB 5B1JA 3CDFA 1INQA 4B9JA 1A14L 2G4EA 4HFUH 3QIUD 4JHBA 4KX7A 1T7YA 4MS6A 4PJIB 4QRUA 4P3CL 1YEFL 4OFYD 1A6VL 1RZGA 1B88A 3D2UD 4UMSA 4ZW3A 4TQEL 1D7BA 2VJ8A 3MLWL 5EC2A 5TE4H 3V6OC 2NR6D 5L88L 4ADGA 3UTPD 5TFSH 4NWUL 2DLTA 3FBKA 3SGDI 1WC7B 5LGHH 2IGFH 1MCSA 4QOKE 3CDGA 1M1XA 5E03A 4MRBA 1VGEL 1FSKC 4PLKD 3WNJA 4JHAH 5I9QC 3D85B 3VFNA 4M61A 4IQHA 5ACLA 1XR9A 3H53A 2Z3FA 5C09B 2GJ6A 4ZO9A 1EO5A 1PG7L 2YMTA 2BJMH 1G4MA 3UG4A 5J11B 1JWSB 5JORA 1I1AA 3MRCA 3U0TA 5I0WA 2DQHH 3QUML 4K2UL 5IGXL 2YAHA 3GXNA 1TF4A 1Q0XH 2K9FB 1BLIA 2V9QA 1CICB 4Y2DD 4C58B 5DD5L 1X3DA 2FH6A 5D7HA 3RUGF 2XBZA 5DYFA 1YEFH 4TN9A 3UTSE 2MQ3A 4NZTH 3VMPA 2WBJA 2YOAA 4O2EB 1YMMD 2ZX5A 3T3PB 4I2XE 2JKXA 1OE1A 3BDYL 2J2ZB 2AS5M 4HH9B 2Q6WB 1ZOXA 2J4WH 1KCUL 3BYYA 4G7YH 4K71C 4JJHA 3SB3A 2EDNA 3JV5A 4HOMA 5DJ6B 3RTQA 5EU3A 6TAAA 2DQFB 3VX0A 1J9QA 3P0YH 4N8VA 4IK6A 4WUKL 3CXFA 3MBED 4IHOA 2DN7A 2H1XA 3FQWB 3GBNL 1UCBH 3MCKA 4L8SC 5FUCC 4E9VA 4OGYH 4NM8H 3WTWA 4L3AA 1HSBB 4ENEC 2OMUB 3MODH 4NOBA 4ZPTA 5IFHH 4P4RA 2AQSA 2HX8A 2JJSA 2EIBA 1UVQA 3LIUA 3N43F 3NTCH 4QHLA 4YSPA 4NCC2 5IFJA 2XX1A 2ADYA 4KTEH 5G55A 1F58L 5AVZB 3QQ4A 5JPNB 1EHLH 2HRPL 2IOMA 5D6CA 1JTTA 2VLRA 4WJG3 2PKDA 3II2A 3S3BB 2XZCL 3VRLF 2KUTA 3DV6B 4ZSOA 4ENED 4GH7B 1XGZA 2VXTL 1ET8A 2ZYHA 1CD9B 3AU0A 4OIAA 3RTQC 1I85C 1WTLA 5GS3A 3HLAB 5HJ3A 3WNLA 1MCEA 4PWIA 3D6GA 4UQCA 4Q14A 3SDXE 1HZLA 4N5UA 4KI1A 4QRTB 4R2GC 1IGTA 5DVMA 3SE8H 3VFMB 2OTUA 1IIIA 3GK8H 4Y2DA 3VWJA 4YSUA 2E6QA 1IGFH 4PWGA 5C7XH 2WBJC 1P2CA 32C2B 5TE7H 1C1EH 3VFUB 3MLSH 1K5WA 1T2JA 3EJSA 1EAQA 5GRVL 2ZT9C 2VB5A 1PX8A 1DQJA 3B8SA 3ILPA 4LEXH 1CE1L 2VN5A 5I1KL 1J05B 1LTXA 3P0YL 4TQ8A 2B5IB 3C6LA 4TVPL 2HWZH 5DT1L 4B41A 4RDBA 4UQBA 4S1QL 4N9GB 3GBNH 1UCBL 1KCRL 4IIQB 4TVPE 3CJJA 4XP4L 4FMKA 3JWOC 3B9KB 4ICXA 1J1XH 3Q8AA 5AW2B 4RMVA 1FAIH 3FB5B 4PJ7F 3HG1A 1I8AA 2HLEB 5HVHC 2UZYA 4ZUWB 1NQBA 2WGNB 3QS3A 3ZBMA 1ONQA 2CALA 3VJ6A 4X8CA 5DJ0A 3MXWL 4YDLC 4JFHE 4N2MA 3UP1A 1AXSA 3NZ8B 1EJOH 4RGOH 5DZVA 4F2EA 3HPJB 4HS8L 3O9WC 3EJZC 1NMAH 1ZHLA 3R4RA 3TPKA 3NZHH 1ACYH 4Z5RB 2FCBA 4NOFA 5E8EB 2HFEA 5EOQH 3GXFA 3RJOA 2CHXA 1XX9C 5ACMA 3TV8A 1E27A 1Q9LB 4HWBH 5I6MA 2X4OA 3B9AA 2YOCA 3DMMA 3GK8L 2VC2B 2P28B 3MOQA 4XC1H 5J56B 2ADFH 3PFQA 2RJMA 1UGNA 3BD5A 3FHQA 4LSQL 4I89A 1AR2A 1HESA 1HX0A 2AFNA 2NTFA 1BBJB 1QW8A 2GSGB 5CAYB 1OAUH 3KE0A 4LPTA 1CE1H 1SVCP 1ZJAA 2Z9TA 5DUML 4J3BA 1EZLA 1TZIB 5HI3D 4GW4A 1DFXA 4NT6B 4ES9A 1JWUB 1PKQB 4KKLD 3GIVB 3KPRB 4P2OA 4XBGA 2X05A 5CCKL 4Q74A 3V6ZB 3LZQA 3NFSH 2MNWA 1P4IL 3BP4B 2CUMA 1S7TB 3V9EA 2CDEA 3DROA 3SKOB 2J8UF 3IF1B 4OD2B 5DZJA 1R3LB 1E5AA 3CV5A 4JFYB 5DC9B 5C0ND 5I17B 1BQLH 2EDKA 2IQAB 1H15B 1HOEA 2OP4L 4MVBC 2VR7A 1LEGA 4Y9GA 4ZSOE 3HHSA 1GAFH 5FGBC 1VFAB 3POHA 1XF5B 1TETL 3ISWA 3FFCE 5FUOL 1WV7T 4AJYV 1H6UA 1IBDA 4O02H 4XCYA 5FWQA 1ROWA 1DUYB 3VD5A 2GUOB 1BEXA 2Z4QA 1N6UA 2ITCA 4GSXA 2CIIA 4Z76B 1DQDL 2VMEA 1QD0A 1QA9B 2JCCF 3KZ8A 5F6IC 1IB5A 3WMPA 5C08B 1K2DA 4HZLA 3I02B 2ZD0A 4LLDB 1IAIL 2YC1B 3B6SB 3U1SL 1PSKL 1JPSH 2EXWC 4HMEA 4Z7IA 1OGAD 4HKBB 2AABL 3QRGL 3R1GL 5I8EA 4RDQF 5DJYA 1N59A 3G9AB 2YPLB 3L5IA 5CGYD 2YA2A 1JF6A 4GIOA 4QXGL 3PGFH 1H3WM 3B2MA 4DO6A 1T04B 5IHWA 3SPVA 4BHUI 2YLHA 1WTGT 3EYOB 3FT9A 4WO4D 4A2LA 2ERJB 2I24N 1I8IA 4M93B 1YEIH 5JIKA 4HBCL 3GKZA 3PWPD 5EF1A 5BRZE 1DJYA 3BIBX 1FN4A 4LEOA 4MSWB 1M42A 3UG3A 4WWKC 4XAWL 2UYLA 1R5IA 4WTZA 5GGRY 2IDUA 2CLVA 4L9LA 4TKWA 4NGHH 1G7QB 3DX9A 5IWLC 1OW0C 4R8WH 5J3HC 1HHHB 4HCFA 1AGFA 4M62H 2GJ6E 4YBQC 1RHHB 3VTMA 3QQ3B 1U95A 2BY3A 2QPEB 3E7JA 3PABA 3K2KA 3AM8A 3BQVA 3J07A 2UZYB 1PZUB 5E2UL 5ELIA 2VDRB 4HWZA 1TNNA 2WKOF 2I32A 3DETD 4G9FB 2O4EA 1A5FL 3RURA 4FF9A 2R69L 3IRZA 3RUGB 4A2EA 2MPAL 2FQDA 1UWEH 2OJZL 3EOBB 3EH2A 1KCKA 4WAFA 4E41B 2UUDH 4L0PB 1KBGH 3MUGB 1JF1A 5FHAH 1BPVA 5HGDA 2WQAA 4OM1H 4WWID 2PABA 3Q7JA 2XYCA 32C2A 1P2CB 2R8SH 1QA9A 2WO4A 4OF0A 2XG5B 4PWEA 1NH6A 3UYOD 3K6FA 4DJMA 3QCVL 3L4CA 4HKJB 1ETJA 5DEFA 3A67L 4A7QA 2ALWA 2X28A 3ZZSA 3G6AB 1OB1A 5E1QA 2Q9OA 1OLZA 5JQIB 3F85A 5F8QC 5T1DL 1S7SA 4B7IA 2OK0H 4IJ3B 2CRIA 1GY2A 4FXGA 5I17A 5JPMA 4KVCL 2WC7A 3ET9F 3VXMA 2JLPA 3EJRA 3HCVA 1MLBB 2BH0A 3N1MC 2ZCLH 1WAEA 1Y1DA 1SQMA 2CO7B 2JKWA 4LRIC 4ERSH 3V6ZA 2C9VA 3RVVC 2H0PA 2OR9L 3UTPE 1J0YA 4TXVB 5KUMA 3RDTA 2ZCHL 4OD1L 1N64L 5EA0H 1MLCA 4HKXB 5CEYB 4NT6A 3LN4B 3MV01 4KROB 1Z3GL 3ZDXF 5KVEH 5LDSA 2CUIA 4MJ5A 3STLA 5ESAA 1OHQA 2OJZH 2VDQB 3GXDA 3DBSA 4LPXA 4LVOC 5DD1L 43C9B 5H8DA 2RAMA 1DSYA 1SDDA 2Z93B 5IEHB 4FQXD 2Y7LA 3DMMD 5B7MA 4HJ0C 3P4OA 1CL7L 4XZUB 4APXA 4YL4A 2NY7L 1FRGL 3AXLA 3K0WA 5CSGA 2L04A 4KV5F 5L8KB 4YXHH 4GIAA 4MNGB 3SKJH 1E9OA 3SO3C 3F7QA 3FT4A 2HB0A 2NZ9D 5GSVB 1WH0A 1NICA 3JYCA 2UY7A 1OM3H 4KV5E 5ESQB 3TPUB 3T0XA 1J8HA 3CZFA 5BRZD 3KL0A 1OLLA 1QABA 2DBJA 1URLA 2DM3A 2H1PL 4PJ7B 2MEJB 1RPKA 2B4CL 1ZXKA 4XPHH 1ETB1 1MWAB 3CLFL 4WW1B 4XNYH 1CLVA 3G7TA 3LH8A 5BVPH 2F54B 3T8XA 2ETWA 4N5EC 1KCBA 5E4IA 2NW3B 2AJZA 5JMRA 2EUVA 5HHME 4R26H 1FA4A 2W81C 2W88A 1HL9A 1N8ZA 2E46A 3BVWA 2PPAA 5E8OB 3ARDA 3ECUA 2FHFA 1Z0NA 2O5ZH 3JUZA 4YHPB 1RL1A 4KITB 2VLKB 4I88A 4QRAA 2QQLL 5AW8B 2DJSA 4JRYD 4FFZL 3SCMC 2N0KA 1N67A 2ZX6A 4UT9L 4AGQA 3QUXC 5FO9B 4KX8A 3SY6A 3N04A 3J27A 3TVMC 3OXRB 1FVDB 5IVNA 4ETQB 2NY7H 1FRGH 3GT6A 4UM8B 2HJFB 1FVEB 5FB8B 1LE9A 4FYSA 5T3ZH 3CN2A 3X1NA 4H44C 1FNSL 5C0CA 3H9SD 5HHMD 5ANMB 4KKQA 3TTSA 1EFXA 2XSKA 5DR5H 5L4MA 4Z3JA 4Z7UE 4OFYA 3RJQB 2C4FU 2L7JA 1EZVX 3CN4A 4M5TA 1C12B 4HV8B 3Q3GB 3H9YA 1Q94B 3FT1A 2K6WA 1FGNL 1NAMH 4RQQB 4W9HC 4ZSOB 1CDBA 2XC8A 5EIIG 1CVRA 5LGHL 4YWGH 3ZL4L 1EXHA 1MKFA 1IZJA 3ECBB 2BVOB 4NQSB 1KY7A 3HHSB 3QAZC 3W0WA 2LU5A 1PZ5A 1UQSB 2BXZA 1PLCA 3CZNA 4R9HA 3T1WA 1L7IL 3K46A 4PRPA 3N85H 2HRGA 5CU9A 3LMJH 4UT9A 3TA3B 2H2SC 1JI2A 4YO0A 5SWSA 1U0QA 2YRPA 4FQXB 1HVXA 1O7DE 3VFTA 1VKXA 3SPJA 1T22A 2BFVL 4LHUB 4N0CD 2Z0BA 4TSBH 5MEPB 2HTKC 3K71A 1J11A 2PPFA 3BD3A 3EADA 1JZDC 3M8OH 1I1YA 4N8UA 2UWEA 4LSRL 5HDBB 3MMEB 5CEZE 3QWRD 1GMEA 2P8LB 4E9QA 3HE7A 4QGTA 1ML0A 5L0QB 1W0WB 3QFJD 1DVZA 1CLOH 2C1OB 4ORGB 3TYFB 2ZOLA 3SOTA 4GUCA 3D2TA 1ED3B 2XKUA 3GSUB 3DDGA 3T4AA 2G5BA 4YAQB 2Z92A 2NW2B 2QZQA 3R7QA 1LEKB 5TK2A 2P7TB 3F5WB 5FA3A 2GEQA 3CPLA 4PJCA 3O3EA 1AGEA 1LWHA 1TSHA 4JGJA 4W6WB 3GSQA 1ZKAA 3LEVL 3GUTB 1C7SA 3DX4A 3TL5A 4GP5B 4XX1E 4PY8I 3H2QA 4YL9A 1GZPB 1JRHL 3RILA 2OMBA 2GJ6B 1ZA3B 5IHUH 3KVPA 3UPAA 4ZMNA 4NQQA 4ZQKB 2YO3A 3TU6A 4FRWA 1YEEL 1XMEB 1P4BL 2Z1PA 4MX7B 1S7VB 4C83B 4P23D 1KCSH 3CD4A 5D1XE 2OR7A 4KTEL 4JHZA 3S8GB 3W38A 1B3IA 1BREA 1I31A 1FZMB 1SFHA 1QPKA 2A9DA 4JRYE 1A0QH 2ZXEB 3X1GA 4YZWA 3VGAB 1JE6A 3APNA 2VT0A 7CGTA 5G5DA 4UANA 2QZ5A 5K59F 3AQYA 4WI6A 4KQ4L 2LAAA 2XKNB 5BVJA 2DWXA 3FBQA 2YK1L 1KPVA 5E56A 2NY0B 3SE8L 5PAZA 2DWDB 1OAZL 5F6HJ 2IH3B 4ZMXA 1ZDSA 1CDGA 1RUKH 2Z7YA 1AZUA 2YD7A 4TF4A 4XRCB 2G2PA 3TN0C 3MQIA 2BNQA 2F15A 1G9ML 4XBPA 3MTXA 4AW7A 4TNWF 4PGDB 1D9KB 3FO0L 4GRWH 3STZA 4EKXA 4DF9A 2VLRB 4L3CB 4UAHA 1VZGA 3SQBA 3FSVA 1O6VA 1Z3RA 1LD9B 1J1XL 2L7QA 3WJMA 1FYHB 3BRDA 1GGIH 5CP3A 3ARSA 1ZLVK 4F91B 1FV1B 3VFWB 1GXEA 3KGRA 5TQ0L 4FFYL 3NUKA 2VABA 4G6FD 3B8YA 3DRQA 3ETBJ 1WEJH 2GI0A 3CC5A 3IMWA 4PVNA 4KO7A 4DGYL 4TLTA 4MJJA 4X4ME 5IHZA 4QF1A 5I1AB 3PQYA 3BP6A 4TNGA 5FCUH 5AB1A 2Q2EB 1NANH 4M1CC 4P9HC 3L9BA 5SWQB 4E9LA 3BAXA 3BRGC 2ADFL 5TH2B 2NY6B 1A4JB 5D7LE 4QHMA 1HYRC 5I6OA 2EDQA 3HI6L 2ZXDA 4AE1A 1DQQA 1PNDA 4WI0A 3QPQC 5F9AC 4PIRF 3MA9L 3ZRFC 4W9FC 43CAB 3WDIA 3LXAA 3ZR6A 2WNWA 4NX0A 1XAUA 4ZMLA 5F7HA 4PREA 2YKLL 4X50A 2GK0B 1BFVL 1EO8L 2FEDC 3M7OA 4DNLA 4AG4H 4TTGA 1QR1A 4U1NB 3WFHA 4HG4J 2DYPA 1USQA 1DQIA 2FUTA 3KGSA 4NIYE 4YDZA 4NBZB 3QJFB 4FQHB 5EUOE 4FFYH 4P46C 5KSBE 1MAJA 3R0MA 2G0LA 4OUUA 1SJVA 2EDBA 3TCTA 4OBRA 4NQEB 4R3SB 3B5GA 2XZAL 5BJTB 1AQMA 4EI6A 5I71C 3WMSA 4N2LA 3DHMA 3VXSB 4A7TA 4EE2A 3ZQWA 2C1PB 5C0CD 2Y07H 1SJHB 4R6UA 5CEXB 1TZOA 4ANKA 3RE0A 5FCUL 5K9QI 2D3LA 4FNLL 1FDLL 3TV3H 5E4AA 3ABGA 3GLDA 4NXSA 2NLJA 3TEXA 2Q76B 1KGUA 1PX4A 3NT0A 3UPRA 2DS4A 1MHHA 3G08B 3V55A 3T77A 2VC2H 1SXCA 5IVXA 1U8NB 2IBGA 3GXPA 3HI6H 4EIBA 3PV7A 5HHNA 5JOEA 4HS6A 3FAXA 3OSKA 1F11B 1OGAE 1G9EA 3ASOB 5B7FA 1EO8H 2FZ3B 1DDTA 4FULA 1JHKH 4EEEA 5I19L 5J11C 3IPEA 5T1KD 4PWFA 1KIUB 1HWGB 1CGWA 4QXGH 1WWCA 3ZUCA 5DRNA 2K0RA 2D3NA 1QHOA 5CKAA 1LMIA 2B1AL 5JNYB 2XG4B 4LL4A 5DHVA 3BAJA 5FAAA 1YEIL 3QULB 1HJCA 1Q90A 1S78D 5E8PB 4Y5XB 3RL2A 2BW5A 4JO8A 5E9NA 3Q5YA 4N20A 1J8HD 4FZ8L 1FL6B 4OQTL 4MB1A 5IJVB 1OQXA 1IGJA 4YUEH 3EGXB 5TDNA 1FPTH 3LKQA 5C3IA 5I75C 3U2IA 5HDBE 4JMNA 4I9WE 4NRYA 2DYPB 1YEDA 2JKNA 4PJBA 3UC0H 3ZRCC 4M62L 1QR1B 1Q9OA 4E5XA 4IEFA 3V7MA 4Y9FA 5EZIH 4PWKA 2Y24A 1X4XA 3ELQA 4PJEE 4PRIE 1KBVA 2EUWA 4JN2B 3MV9B 2JVUA 1UTDA 3GZQA 1SYVA 2YA1A 3MRHB 5IM7A 5BW7C 1ZVHA 1JIBA 1XWVA 3WTYA 4GEJA 1G7IB 3CX2A 3SDAD 3I9AA 1JZ4A 2WSDA 2MPAH 2V2XA 1GGUA 2BCKB 1SLUA 1XBDA 4FQIH 1SUHA 5L2JA 1JPFA 3BPOB 2AEWA 1AGBA 3VYOA 2H32B 1A9VA 1FYTD 3O3AA 1L9MA 4ELMB 4NZRL 4TOYL 4G83A 2V17L 5AALA 1TG8A 1T0MB 3OKDB 3TIEA 1L9NA 2VISA 3KLSA 3NBNA 3U25A 3HI5L 1ITCA 1HHIB 4IBYA 1KELH 4MS8D 4XVJH 1E9PB 4NSKA 1TJIH 1UB5B 3AU1A 3SGDH 4FZ8H 4WW2B 1BQRA 4NHCL 1JD7A 3CZLA 5DYOB 4WI4A 3IGFA 1GGCL 5EPMB 1VFBB 1N3NA 1QQDB 1NJ9B 1TVHA 3EYQC 2QKIC 4HWNA 2Q3AA 1U3NA 5K1VA 3SDDB 2G2NA 1XD1A 4N8VG 3TVMA 4G6AD 2ILLA 4KVCH 1NDMB 5C9JB 4IOSA 4P2YA 3ROLB 1G1KA 2ZCLL 3RRQA 2DWSA 4RISL 4UUJA 1QAWA 1L7TH 2VLLB 2W65B 2FEEL 5I18L 1TJHL 3GEFA 2IANE 2HP4A 4L37A 2PXYA 2VLJE 4R4NC 4OJFL 3RG1C 2IH3A 4IRSC 4CGTA 3AREA 4B0MB 4EDWL 1Z3GH 3BJ91 4LBEA 1G7LA 2TSAA 1FIEA 4HKZB 4YDNA 2BNRB 1U8KA 1RJLB 4HW6A 4Z7AA 5DHYB 1SNRA 4NZDA 2V2WB 2XTJE 4NUGH 1YY9D 5KS9A 3KYAA 5IR1B 3RWFB 4GG6F 3H56A 1VGKA 4QXTA 3MR9A 4HALA 1F8TH 3FRUA 4TPRL 3ZK0A 3KMDA 4DZBA 4P4KC 4IOFD 2X4NB 3NDYE 5DHEA 1XGQA 1GC1L 1TZAA 2WXJA 3EFOB 5JR1L 1SEBA 1OM3L 5E5MB 2JB5H 3D12B 1OD9A 3BIAX 3LNGA 2PWFA 5IVOA