2Q2LA

Crystal structure of superoxide dismutase from p. atrosanguina
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
152
structure length
152
Chain Sequence
MAKGVAVLSSSEGVAGTILFTQEGDGPTTVTGNISGLKPGLHGFHVHALGDTTNGCMSTGPHFNPAGKEHGSPEDETRHAGDLGNITVGDDGTACFTIVDKQIPLTGPHSIIGRAVVVHADPDDLGKGGHELSKSTGNAGGRIACGIIGLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide Dismutase
publication title SAD phasing of a structure based on cocrystallized iodides using an in-house Cu Kalpha X-ray source: effects of data redundancy and completeness on structure solution
pubmed doi rcsb
source organism Potentilla atrosanguinea
molecule tags Oxidoreductase
total genus 33
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2q2lA00
3T5WA 2Z7UA 1SPDA 1TO4A 3ECUA 1E9QB 2C9VA 1IBFA 4FF9A 1Z9PA 1CBJA 1XTMA 3GZQA 4MCNA 4OJAA 3GZPA 1IB5A 2ZOWA 3CE1A 3QQDA 2AQPA 2R27A 1F1GA 1HL5A 4B3EA 2VR7A 1FUNA 2K4WA 1OALA 1AZVA 1DO5A 1N19A 1YAIA 3F7LA 1RK7A 1HL4A 2Z7YA 3KM1A 1YAZA 3KBFA 3MKGA 1EQWA 2AQQA 1E9OB 1SXSA 1P1VA 1OEZW 1OAJA 1PU0A 2GBTA 1EJ8A 3HW7A 1IBBA 3KH3A 1COBA 2LU5A 2WKOA 1XSOA 1Q0EA 1SDYA 1F1AA 1PZSA 4L05A 3KBEA 2AQTA 1UXLA 3QQDB 2JLPA 3GQFA 2XJLA 2ZKYA 1Z9NA 4A7GA 1IBHA 1JK9A 2JCWA 3CQQA 1SXAA 4A7UA 1DSWA 3MNDA 3GTVA 2WZ5A 2WYTA 1L3NA 2NNXA 4U4IA 3RE0A 2WWNA 2VR6A 2AF2A 1SRDA 1XTLA 2ZKXA 2XJKA 3KM2A 3H2PA 3K91A 4BCZA 1E9PA 1SXNA 1SOSA 2WKOF 3L9EA 3GTTA 3ECWA 2VR8A 2WZ0A 1BZOA 2APSA 3F7KA 2Q2LA 2ZKWA 2AEOA 2WYZA 3CQPA 3HFFA 3SODB 2AQRA 4A7GF 3LTVA 1JK9B 1BA9A 5KBKA 1OZUA 4A7VA 2GBUA 1IBDA 2SODB 2Z7ZA 1SXZA 1TO5A 5KBLA 1YSOA 1ESOA 1OZTG 1U3NA 1N18A 3H2QA 4A7TA 3S0PA 1B4LA 1E9QA 4N3TA 5KBMA 1E9PB 4BCYA 4N3UA 4BD4A 1B4TA 2C9SA 4A7QA 1JCVA 1SDAB 2WZ6A 1UXMA 3ECVA 3KH4A 2AQNA 4MCMA 2AQSA 1F18A 3HOGA 1S4IA 1F1DA 1QUPA 5CU9A 2WWOA 3L9YA 3GZOA 1SXCA 2E46A 1SXBA 1CB4A 4OH2A 2Z7WA 1KMGA 1E9OA 2GBVA 4A7SA 3PU7A 1MFMA 1PTZA 2V0AA 2E47A 2C9UA
chains in the Genus database with same CATH superfamily
2ZUVA 3MRDA 3LZNA 3EH1A 3T9WA 1X4ZA 4MNHB 1IILE 2G5RA 2VIRA 2X2HA 1AKJD 1U36A 2R8SL 4TVUA 2CNYA 4RGNE 5E1QA 3LRHA 5F8RC 1AZBA 2RFXB 3HRZB 5IK3A 4FN0A 1R3JB 4ANKA 1G1YA 4YDZA 1AIZA 5JLZA 1E28B 3CTTA 2AABH 3ULUF 2FT7A 3E6FB 4S11A 3NIGF 4MCZB 3V4UH 5JQHC 2O93L 1YEKL 5DFVC 2HT4D 5C0CE 2N3JA 1KV7A 3EOAB 1GL4B 4MS8C 4X2UA 2X28A 1R3IH 2FJFB 1D5IL 1WT5C 4O2EA 1PAMA 2MNJB 2H1PH 1FNEB 3MCKB 2HN7B 5H4YA 4ENZA 5L4FA 5KYNA 1MW1A 4NHUA 3QQ4A 4A6YA 5IMLA 4H13C 3C8HA 3C08L 1LD9A 3V9FA 1D6VL 3HNSL 1S7XA 4U6VH 4WFGD 5BZZA 1XAUA 1C8QA 2WCGA 3AWGA 5F7LB 2VWEE 2XKNB 3I02B 4UCFA 1JK9A 4HJ0C 1YEIH 2IFFH 5FK9B 4K0OA 3ROLB 4DKEH 3GPEA 5ITFA 1F6FB 4KUZH 2OSWA 4GXVL 4NPJA 2G75A 3VSQA 3UIZA 4PRPB 4KXDA 2KDYA 3E3QE 1MUJB 4F7CB 4PRHE 1P6WA 5C7ZA 3Q8CA 2W9DH 4XPTH 4QHUA 5SX4H 4AQ8C 1EO7A 4X0NA 1EXGA 4FTVB 5GGUA 2BVPA 4L4TE 4G6MH 4X7DC 5T3ZH 2DQGL 3DOSA 5I8OH 4IIQA 3KPQB 4QPEA 1QSFE 5GSRA 1I3UA 5DJ6B 2PPEA 3ZKNC 2EQDA 1HDMA 1AQKL 4IJ3B 1E50A 4YC2C 1TQBB 2YEQA 4U2ZA 5I17A 3QDMB 3MCG1 3TEXA 4DK6A 2MEJB 5ALBH 2Q1EA 4WFHE 2F53E 5A6IA 2AANA 3ISYA 3PXJA 2OI9B 3IDIA 5I16A 1FC2D 3EBAA 2YN3A 4MB1A 4NFDA 2NW3A 3OBAA 1SOQA 4H20L 3WFDH 2BSTB 5KS9E 3TBSA 1QBAA 2VDOH 2PXYA 4UIMB 1QHOA 1IEBB 3FB6A 3MJ9L 5BRZA 3OWEA 5TDPB 2BDNH 4Q8BA 3U4AA 1I1AC 1UXWA 1LDPL 4JPKL 3W56A 1VSCA 4APQB 2LE9A 3EJTA 4O51B 3KPMB 5A2BA 4C4KO 3PNWB 1GSMA 1YPZF 1B6DA 4HZLB 4ES8A 3ULUE 4NLAA 5D7LE 3VQLA 1PEZA 3QAQA 1QMUA 3O6ML 4FJ6A 4E41D 1A9VA 3MRMA 4FF9A 5TQ2H 5LBVA 3P11L 1L7IL 3UZQB 1Z6JT 5D1ZC 2VXVH 4AYFB 4EE2A 4MB5A 4RMVA 1JZ6A 5E8NB 4D0CB 3S34H 3U0TA 3BKJH 1BZ7A 4S1SL 3L9RB 4IEFA 5EBMA 4HD9A 1AD9B 3FT1A 4OFQA 4ZX3A 5HHVL 9CGTA 2WW8A 4CKQA 2XSKA 4Y1TA 5DWPA 3BJ91 2H0FA 3B6SA 3H7LA 3BISA 4JZOB 2X4RA 4IBLT 5L6YH 3RGVA 1A6UL 2HRPH 4PLJC 5FXCH 1R3LA 1N6QH 1Q1JL 1JD9A 4V33A 2VLKE 4IRZL 3ZTNH 2IANA 2J6WA 3F7YA 5DK0B 5DO8A 2GJZA 2X7LB 2XN9D 1CDCA 1MCIA 1SMOA 1BIHA 3L95B 5AVQB 4B7IA 4GAAA 1NFDB 2JIXD 1DLFH 2YPKA 2OTUB 1DBMH 1OTTC 4W4OA 4B6ZA 4YVUA 3FRPG 2ZP9A 2QSVA 4UAOB 1D9KC 5BUGA 2RALA 2AK1H 3QUZA 4QXUL 1ZLWK 1KJ3H 1ZHLA 4N68A 2NX5E 1R6VA 1T04B 4N8PA 1AO7D 1K5NB 4NOFA 3WXVH 1MJUH 4QGYA 4GUOA 4H8PA 3QORB 3KPRA 5AW6B 4EN3D 1KJVA 4I0KA 2DOCA 3ECWA 1SUHA 4HPHA 5B3JF 3ES6B 5C0IA 3CZFA 5L2JA 1OT2A 4MD5A 2E3VA 4UU9B 1RCYA 3V6ZB 3V6FB 1SDDB 1PY0A 3RILA 2AEPH 2DQ6A 5SWZA 3INOA 1J05A 3L5WB 2BW5A 5IB3A 1I4FA 1A6ZB 4CC4A 1HIMH 1QUNA 4JO8A 5F7YC 2OSLB 1BYNA 1EAPB 1LO3H 4OVVA 1O9ZA 3MLTA 4QGTA 1BP3B 5T5NG 4B9CA 5TJWK 3W39B 1J0IA 1YPZE 4OB5L 4FEIA 5DS8B 2IQAA 1P4BH 1UWEH 3IFOB 4OCMC 4BA0A 2L0DA 1MHEA 5IHHA 3D1MC 5D1XA 1OGPA 3ZGIA 4PJ9B 3FCSB 1MCWW 5E0FA 2NZ1A 5LCVH 1IAIL 3ZTEA 3QRFM 1BVNT 4OU3A 3II3A 1P4IH 3UBXA 2EVJA 2ARJB 3BSGA 5DRNB 3GB7B 2NTSP 4G11A 2VXSH 1M6OA 4NQEB 4OUUB 4MAYC 3NZHH 3UADA 4QJ5B 4N9GA 4EVNA 1IM9A 1KIPA 3MRGB 5F7AA 5CJQL 3RAJH 5IKCA 3DO3A 1NIFA 4FEMA 3VFOB 3KLKA 4K7PH 4Y0GA 1NAML 1X9LA 1DANT 1GGUA 5F7DB 5H37A 4XMKL 2FHBA 3CK0H 5KJRH 1G94A 5GGQH 1NCIA 2C3HA 2D73A 4FXGA 4OVUA 4F93B 1A3RH 4JFED 5F9OH 1T1ZA 5I1JL 2NY4B 2V2XA 3IE9A 3OR6B 4LQ1A 3H56A 4XP4H 1AJ7H 2YEZA 2GBTA 1A6AB 3BD5A 1KCRL 2HFEB 4KDWA 3Q5TA 4JG9A 4Z7QF 4CNIB 1Q0EA 1G87A 3EHBB 1YN7A 4P9HC 3ECQA 3KYKL 1GS8A 4ZUVB 2GB2A 4S0HA 1NGPH 4IGBD 4MMZA 1SLXA 3BLPX 4EUPG 3GSUB 3L3IA 1U6AL 1IQDA 5D9SB 4QHPA 2KLSA 1ROWA 2R51A 1QKZH 3GTVA 4ZJ9A 5B3JE 1NCCL 2F5AL 2JNZA 3MNZB 3IGLA 2YAHA 1T4WA 1KF9B 4H8WH 2J2ZB 3TWYA 1NGZB 3Q3GB 4H8HA 1OE2A 5EWIH 5B1AB 2WQRA 3WKMH 1NGQH 3HG1D 3PPSA 4L1HA 1WV7T 3U2IA 3U7WH 3BKYL 5ITBH 2C3VA 3GXUB 3T4AA 4KC3B 3GS7A 1GPOH 4QYAA 4KKLD 4XPHL 3HFFA 4WO4A 3TN0B 4JB9L 3RWIB 2CDFA 4E42B 2AXFB 1CDJA 3L3KB 4MJ5B 3BZEB 2X53A 3RNKB 4O02H 1WSST 5E4IA 1C08A 3CFQA 5JPMC 5JW4N 3MRPB 4UM8A 3QIBD 5HDOA 5HHME 1UXSA 2YAEA 3HZ3A 2E9WA 4X4XA 3MRIA 2VLRA 2BY1A 3ALPA 2ICWJ 5CZXD 2IWFA 3D25B 3NCFB 4IBSA 3WLWD 1L7TH 1KYDA 3GLZA 2NR6D 3QUGA 5CLTA 3LAFA 3CBJB 3FQTA 3O4LD 3VH8B 4MLSA 4MQXC 1TVHB 4XH2B 2V7HB 4FP8L 5FA3A 2OP4H 1JPFB 4EIUA 2E74C 4WHYH 1JZJA 3CSBA 4MA7L 5IVNA 5C08D 4DF9A 3BQVA 2CJUH 2VC2L 2ZSWB 3I6KB 4XBGA 5EEYA 4U1HB 3LKRA 2C9AA 1E9OA 2J73A 2KKQA 4U1NA 4FLQA 3SYQA 3U4EB 1KXTB 1PCXA 3UJIH 1I75A 1JZ5A 5JNYB 4Y16B 1AZUA 1N59A 1EK3A 3ULVH 5DJ0A 1HWWA 1Z5YD 3NACL 5F9AC 3EFFB 2IAMC 2NXZB 3CXFA 1ZGLP 4X80L 2BERA 4FQXD 1D5MA 3QG6B 2E7BA 1O6TA 2BNQB 4R3SA 5DMIL 1E6JH 4FRWA 3CZSA 5A7EA 4Z7QE 3HI5H 1DUYB 3D3VD 4OV5B 4NQDB 1E90A 5K39B 4L1SA 2IG2L 1NGYA 3KBFA 4TOYL 4NQCB 3DO4A 2P28B 1BQLH 5ECGA 4PJEF 4YUEL 1NC4B 4OCWL 3L3DB 2J21A 2NYYC 1EO8H 2PW1B 1EAJA 3KPNA 5KTEL 1KIQB 1K5WA 4MAUH 3MGAA 4K9JA 3N0AA 3PY9A 4MS6A 4WV1C 1G9MH 3R18A 2XFGB 4HAFA 4LLMB 1RVFH 3LSOB 2VO8A 4PRDB 2AJZA 2IMMA 4KNQA 3QEQB 4GRWE 2GSIB 4H1LA 4JRLA 2D7QA 4LCCC 2JLPA 5ANMA 1E3FA 1Z1WA 2UYLA 5EBWA 1HJBC 2HKHH 5DEFA 4J8RB 4G80A 1OOWA 5J57B 2BSRB 5KVGE 3FN0L 4YSTA 1E30A 3HAEH 2NYKA 5FUCE 1OT1A 4J7RA 3DTUB 3RIFK 4P46B 1ACYH 1Q0XL 4HEMA 2ZX9A 2ZWLT 3HTLX 3HB3D 1TKWB 2VXQL 1GSKA 2XFXB 3DJZA 1IAOA 3FCBA 4N2IA 3VQMA 5BS0B 1ES0A 4AK2A 3GC3A 4AUYA 5JHDB 3HRZC 5E2UL 1PSKL 2R0KL 4DGVH 3KXFD 4PRBB 5KUKA 5ISZE 1H19A 1MVYA 2JKWA 2XWTA 4MDJB 2AEOA 2ATPA 4ELKA 3NFSH 1FZOB 1CXLA 2J8OA 4QOKD 4ELMF 3ESUF 3TIEA 3EYSL 2CGYA 3QQXA 4NQUA 4WI3A 1BF5A 2RH0A 1O6SA 5IT2L 5BO1L 2BLFA 3PP4H 2WLIA 1D6EA 4JRYE 2G3MA 2EYSB 2ZE0A 1J7VR 2JJWA 4NUGL 2XQ0A 2A74A 4LGRB 4PUBH 4P8QA 3BKML 4X8XA 3ASOB 4J3VA 4NN7B 1JHKH 3CXHJ 1HJCA 4QNPF 5KEZA 3N5AA 3W5MA 3VI3B 3RVWC 1FZJA 4LAJH 5T1LD 2P45B 3B56A 4E9XA 1IL1A 2DQIH 2Z0UA 2NY5H 3CFBB 4I3SH 4M4PA 1AGDA 3O0LA 2ENYA 4I0PA 3UBHA 3AG3B 1CDGA 3K6DA 3FXIC 4HUUA 1DEEA 4LIQH 3SSGA 3UJJL 3VU2A 1DVZA 1TZHB 1XB3A 3OKOB 3MACH 4TNGA 2HZHA 4NQTA 1KBGL 3EJQA 1ZJBA 2MIZA 4JDTH 4DN3L 1JWSB 4HOXA 1RUQH 1UOKA 1MW2A 4C56D 4ODHL 5IJDC 2B77A 4XNDA 1JMXA 4IU3A 4Y2LA 5A16B 2XPYA 4U7MA 1TQBC 1AGBB 3HFML 4J28A 2PPAA 4KH2A 3AW5A 4OCLC 4ZUUB 4G8IA 4XNUL 2ZX8A 1A0QH 3GM0A 5GS3A 5CAYB 2ZT9C 1GYUA 4C8XA 4Q2ZA 4BFGA 5IQ7H 3LS5L 1NAMB 2OI9C 4PGJA 5E4EB 4LCUA 2CR6A 3AM8A 4CBPA 5C07B 5HYSG 4E5XB 1WFTA 4YDIL 3W39A 1ACXA 5C6PB 4I3RL 5AKVA 4J3OC 3IJ7A 5SWSD 2NUPB 3UBXI 4UBDD 5HBBA 4MA1B 3HG2A 2YMXL 4RSYA 4R5XA 4APQC 2RR3A 2QADD 1U9KA 1RZJH 1S9WB 5FYKL 4GRLA 3ZKMD 4OLUH 4JGMA 2WOYA 2V5TA 1F02I 3O3DA 3KL5A 5BZWB 1DQKA 4RIRB 4UQCA 1UA6H 3B9KA 4OUUA 3RWCB 2EDQA 1SJXA 2ORBH 3U2SB 4QYOA 2DMBA 3QZNA 1F4WL 5CMAA 3S4SG 3TGXA 3ERXA 4ELME 3BESR 2WN3A 1ZDSA 5A40E 4M1GL 1M1XA 2ZKHH 4JDZA 4NC0B 3IDJB 1A5FL 4ANXA 5HYQA 4XHJD 4TNWK 2C1OB 4XX5A 4FZ8H 3FF7A 1DVXA 4OQTH 5IFAL 3BE1H 5JIMA 4NKIL 4A04A 4DZ8B 1YEFL 1JZ2A 3SJVA 4LGSB 3QPXL 3O2VL 5IQ9A 4KK8D 1W0WB 3OQRA 3VJ6B 2D31B 4QNPE 4ZNCD 1AOZA 2SODB 2P26A 5LHDA 1ZGLA 1HNFA 3PWPD 3QUXA 3WNKA 3ARQA 1R0AH 2WY3B 5KJ4A 3F64A 2HCZX 2WLKA 2XA3A 2HG5B 1KENL 1Y6MR 1HINL 1KIRB 3CC5A 4YH6A 3V0VA 4IBQA 3BAYA 4LPUA 2DTMH 3JTBA 3WN5B 4P59H 2OK0L 2J1WA 2FLRT 5DD6A 3J27A 1KSRA 1MCEA 5CGYD 4UAOC 3IDMB 1FNAA 4Q6IB 1F1DA 4AMKL 1D7FA 5ABDE 2CDEB 3L9YA 4N0YH 1G7PB 4WU7B 5I8KH 4ZO9A 5CD3B 4HS3B 1CD1A 5EIIG 1H3WM 4FFYH 3IGFA 4GAYB 1R5WA 1T4KA 1Y6KR 5EB9A 3C60B 2FD6L 3LNHA 3OJMB 3PAVA 2XOTA 4BA8A 3AY4C 2FSDA 4F5CA 3DDGA 5B1JC 3DC0A 1AFVH 3BT0A 1SFHA 4P2OB 2V5MA 3FRPB 4OT1H 1YMMD 3TEYA 5FUOH 4OGYH 5IOPA 1WF5A 1XCTA 2O5NA 1W8NA 4IS6B 2VW6A 3GI8L 3KLSA 5E1AB 1SOKA 1GGIL 4K5LA 5FEBA 5I1HH 2C1PA 3ZT7A 1A7NL 3E0GA 4PJIB 3VFRB 4OLEA 4LK4A 5KANI 4JPIB 1KCLA 1TNMA 1MW3A 1J8RA 3OAZH 1AZRA 4X99A 2HVBA 4LEXL 2UUDK 2RMNA 1H0DA 2RB8A 4HBCL 3W2DH 2CGRH 4PJ9C 4I1RA 4TSBL 2ZTBA 4JY5L 4UTBH 1E67A 1JBJA 1BXVA 1F3DH 5DQ9B 3O2WL 1HXMB 5EO1B 3TYFA 3HR5A 4ZX6A 3KEHA 4OZFH 3LNGA 2V6HA 4Q0XH 3WO3B 4Q74A 3O3AA 2DWTA 1IGCL 3CXHK 4YPJA 5E5LA 3V5DB 2VYRE 3N41B 1RSFA 2PETA 3CU1A 4M7JL 3OGCA 3APFA 2CUHA 4X6DB 3RBGA 2BO0A 3G3LA 4ZDHA 1KNOB 3P0VH 1CI5A 2ZUSA 1TETL 2XC8A 3H9HA 2GFBB 4P3DB 4F7EA 4XNMA 1QRNA 3T8VA 3GSWA 4LBAA 1KG0B 5GRUH 1NMBH 2X38A 2UWEA 1INQB 2DLFH 4NZTL 4PTUB 1UVQB 3F62A 4JJ5A 3TBCA 4KO7A 2DMGA 4JGNA 2WCPA 3BPCA 3VFMA 1WS8A 1AHKA 2NY4C 3C5SB 1SF5A 3OJ2C 1EEZB 5I1AA 5FM4A 3X17A 4YZFF 1UHVA 3VXUA 1FRGH 4B0MB 1IBDA 3O6KL 3K5RA 2WTOA 1U91A 1B3IA 2AQ2A 2D7NA 3TYGL 2OL3B 4HPYH 4P5KA 4HXBH 2GY5A 3NA9L 4XX1G 2NY3B 3O3BA 2DIEA 3AC0A 3EHBC 4HUXA 4R2GC 5IV2B 5DDHA 2VLMD 3DV6A 1HSBB 1GKEA 1RD6A 2OX5B 2WXPA 3FONB 2RQEA 4LHQB 3QVAA 3B37A 2WINB 3MLVH 4Q97A 3HE6A 5DSCB 2BSBA 1TZIA 1J8KA 4FGMA 1PLCA 2CHXA 3JV4A 1SMAA 3SDDA 3RIFF 2QPEB 4HDIA 2EIZA 5HYJB 5AKTA 5E08H 4HJJL 4NKOA 3SGJC 1WTGT 1FDLH 2Q7YA 3II2A 1D7CA 5E2WH 5I1LA 4JDVB 4Z7NF 1WVZA 5CJ8A 4M1CD 1EFXB 2E4TA 3ALWA 4OQTA 1U2YA 4B9JA 2OAAA 5FKPA 4JLRA 3TA3B 4OM0L 2ZWNA 2I9LA 4PWIA 2E0PA 4UINL 1CBJA 4KJWD 3D39A 2C7UA 5AVXB 4G42B 5IVOA 2UXFA 2AK4B 3TN0C 4MDIA 3X3FL 4F7TB 2EEXA 3MV7E 5J9PB 4CDHA 4HK0B 4OV6F 3F00A 3G5XA 1HHKB 1G6RL 1GRWA 4D3CL 1NIBA 3EGSB 5IUSA 4BGLA 2G60H 2VSDA 1U8NB 5FF6A 4JEGB 2X3CA 4L8DB 2YPVL 5MEQB 4ONHB 1LTXA 3LN9A 1XCXA 3HI1B 1S46A 4JKLA 4TULH 1NGWB 1OD7A 4WUKL 4XMXA 3R7QA 3W82A 5KG9B 3DURA 4E36A 1X7SA 4JKMA 4KX7A 1AS6A 4KZEH 1F1AA 2GBAA 3HZKA 3S97C 2R9HC 1XV8A 2FE0A 3PWLA 3UH8A 4R5VA 5B39B 1R1CA 1ZA6B 3F7VB 2CPUA 1F41A 1JK8B 3JYBA 2WVVB 5E4AA 1ZVSB 1JVOA 3G5VB 2XQYG 4GINA 4NO2B 1FIGH 4OCXH 3VWJD 4BQCA 4QRRA 4Y16C 1TU2B 2DQHH 3IN2A 2WXKA 4FA7B 3IETA 1KLFA 1OGAA 4HLZH 3AQZA 4LVEA 4AZ8A 2VJXA 2NXZC 3W38A 1YEJL 2B59A 3EG9B 3PWNA 2ITFA 1H3PH 1ZSHA 4M8VA 1ITCA 4WY7L 4YZFE 2VGLM 1FYTD 3WMPA 4N6QA 1X5XA 4M9PA 4UMSA 3Q9PA 4OLVL 2UZYA 4L2LA 4FYSA 4M93B 4JR9H 4KRPB 4ZS7H 3Q6GL 3D0VA 4FULA 5D7IA 2Z0BA 5JQ6H 3QFJA 4XBEH 3U6RB 5I0XA 5JR1L 2CGZA 1IC7H 3MBWA 3B3IA 2I5YL 4P49A 2ATKB 4MS8D 2D4DA 1YO4A 4ZUTB 4OZFA 2M83A 4Z7NE 4GQQA 3GSNB 3DX1A 1IVLA 1K9TA 2JI1A 4FLSA 4NERA 4UV7H 1U4FA 3M88A 3NSCA 5EFIB 1LDSA 4L3ED 1NLDL 2CBTA 4D9RE 5D70L 2HJKB 3EF4A 4PRAA 4PJCF 3QNXB 2XQBL 1OAUL 5FA4B 2EC9U 4HJ0D 3AG1B 4XMVA 4WK2B 1CZ8H 3EH5B 3CFJA 4P46C 4B9ZA 4Q9CA 5EU7C 3GK8H 3W0WA 4FG4A 1P53A 4Z7OF 4ZUWB 4YX2H 1BZ8A 3N44B 4PCSA 1WRFA 4W70A 2ZXGA 4OIFA 2I85A 4B50A 1OW0C 5E2TL 2B7DT 3QIUA 3G9AB 3D30A 3D7PA 4WNQB 2VSKB 4ZW5A 4RETB 3IYLW 3BMWA 1EZLA 2Y1AA 1AANA 1WC7B 4MJIE 5D1QE 3EOBB 4NQVA 1H5BB 1RUML 4JFQB 3L7EB 2FX8H 1HQ4B 2EXWC 3O41B 5EA0H 1FLTX 4NT6A 1IBGL 5DHXB 3CBKB 1E8XA 4WHCA 2KMWA 1JGDA 3MC0A 1IGIH 1Q9WB 3RTQB 1IBBA 3HMXL 1JV5A 3FTSA 4G6KH 3LXCA 4WGWB 2PYEA 4YSRA 1ZANH 2ZYIA 1ID2A 3TBVA 2IPTH 1MCWM 4RMSA 2NT1A 1OPGL 1QBBA 2ZKYA 3MLXH 4A39A 2H26B 3BN9C 1HHGA 2D03L 4KDTA 1DQMH 3KYNB 3P54A 1ASPA 5AW4B 1WAAA 2JF1A 1YEWA 5F89B 2L7EA 3GEWB 3EO0B 1CE1H 5DT1H 1QVOB 3FSVA 3AWFA 5DUPH 3FYIB 5D71H 1FORL 2AF2A 1I8IB 4XNAA 2R29H 3MOBH 1TSHA 3DDFA 4BH8B 1A1MB 1WBYA 1EGJA 3QUKA 3S36H 3ZBMA 2OYLA 3P30L 5FYLD 2FYYA 1MI5E 3WL9B 2XYBA 2L4OA 5D1ZD 1RULH 2XZZA 3MFGB 1IAIM 1MN4A 4TQEH 1Q9LB 3O45B 1J1XH 5AW5B 3LPOA 1YECH 1ORQB 2WB1A 2XICA 5AAWA 5DRZA 3KCWA 1U58A 1J5IA 5JHBA 1ZT1B 5E4EC 3AS3A 4M62L 4Z76A 4YHZL 1RZFH 4FNUA 3RGHA 3TT1L 4PM1A 3BSZH 4PJCE 4HJTA 4YPGA 1A9EB 5D7JA 2WXOA 3S2CA 3ULUL 4R96A 3NFNA 4KO5A 1AHMA 3P9MB 3K3QA 4MA1C 4U6HA 1E4HA 4ZX5A 3QHTC 4Y9BA 4Z7OE 3O0RL 5E6IA 1RLWA 3QNYB 3LKPB 4V2CB 1P84J 1UD5A 2MHAA 2Z92A 1NUNB 3BZ5A 2D9QB 1I7TA 3PWUB 5HYSB 4YXLH 4ODUB 5T33L 1DVYA 1XIWA 3L4YA 2ETWA 3WKNA 3A4EA 1CD9B 3WFEH 5TE6H 1U8JB 1DQJA 1W6LA 5CNHA 1MFCL 1T6WA 4I2XA 5FM8A 5IZ7A 4QRQA 3A4AA 1S9XB 3FT3B 1KG0A 1JRHH 3BUIA 3ZE2F 2DM7A 4H4NA 1EWHA 3L4WA 2LLGA 4GSRA 4GAJL 3JWNE 4UTAA 4WEUD 4D7PA 2W65A 1N6VA 1MHPH 1UTDA 2BVUA 3QCTL 1HT6A 3MZTA 3QUHA 2CK0H 4N0FB 1SQMA 3F7LA 5IROC 3S96A 2M1KA 2PO6A 3S4SB 1BQUA 1JFQH 3DTXB 3N3EA 4Z7WA 3C75A 2WBJA 4WFGE 4BH7A 3G08B 1ZV2A 1TTFA 3FO2A 3W11D 2JK5B 3EADA 3KH3A 1COBA 2OPCA 2IADB 1VRSA 3WN5C 3WE1A 4X9BA 4F57H 2AQTA 3ARFD 3K2UL 4ZW7A 5TDOB 4DN4L 3CVHH 4Q6IC 1MF2H 4AW4A 1UM6H 3L1EA 3SKOB 5BRZD 3QO1B 4HPOH 3QISA 1S6NA 1U30A 3BXNA 2KH2B 3MGOB 3MLYH 2F7PA 3X3GH 1IC0A 2H32H 1XF2A 5CILL 4TQIA 5L2KE 1VDGA 3C60C 1FZMB 2JLLA 4EUPA 1I1FA 2X2YA 4KNUA 4TLKA 3VFTA 4Z3IA 5E03A 5K9KB 4P2OC 1DE4A 2PWFA 1BG9A 1CICC 1KB5H 3UX9B 4H44C 4NRYB 3KWWB 4GXFA 4MWFB 4R7XA 1CFNB 1TCRA 3DIFA 3VXQA 4Z5RB 2VAAA 3MUY1 1HSAB 3MTXA 3MUGA 1ZS8A 1E7VA 1FAIL 4X7EC 2CCWA 2EJ1A 2ZCKL 4MSWB 4JFFA 1G7IA 3FH5A 1SVZA 1WO2A 1D5XA 2OMYA 4N28A 5F0JB 1P9MC 3SE6A 1NOFA 1M05B 5IEHA 1T21B 5DZOA 5IOKA 3DVGB 5FPIA 2P8MA 1IJNA 1N26A 4X5WA 4EDWL 3P3YA 3NK3A 5CEYB 3FTGA 5J11B 2FATH 1D5ZA 1TENA 4E41E 1FIEA 3TEZA 1T1XB 2BOBA 3T3PB 4PJHB 3ZE2E 1XGUA 5D5MF 1X4YA 4Y4KA 3L3HB 2IQ9H 4P9MH 2XU9A 3V5HA 1B0GA 4RGOL 4R7LA 3L13A 4MD0B 4X8JB 3DI2B 3PU7A 1F58H 5I1IL 1CT8B 1XO8A 4OI9A 3B2DC 1S7VA 2BCKB 4P5TB 4YJZL 4AUUA 3UEZA 2X6CA 5BZDA 3OKEA 2WZAA 3VQ2C 3Q2NA 4P2AA 1MCOH 2CBOA 2PW2B 1QI4A 2WUBH 5I76B 3N1QC 5C0CB 4ZPVA 5GS2H 4ERSH 1J1PH 1NBYB 2DQFA 2CHWA 3BSZA 9PCYA 5IFJB 2ADIA 3QPQD 2R23B 3IU4H 1ADQA 3D0AA 4D94A 3N43F 4EI6B 4IU2B 1XZ0B 1A3ZA 1WITA 3MFFA 4A2LA 1IM3A 3NZ8A 4GAGH 1HCVA 4KKCD 1MXDA 5AYUL 2GUOB 4XC1H 2XN9E 2N0KA 4LSQH 4X98B 4I9XA 4R0LA 3PJNA 4PLOB 4P57A 4XZUA 3BP4B 2NPLX 4MMXB 4X5PA 2AMUA 4U1IB 1U8HA 2QQKL 4B0MM 4BFFA 4NZRH 4JFXB 3EYOA 4DW2H 1T7WA 1F3JA 5FW6A 5HVGB 3OX8A 3K71A 1NSNH 2J3SA 1AO7E 2PWDA 1T0NA 3KVPA 2MRYA 3IPBA 4QWWC 2QPUA 3I3EA 4HIJB 2G9HA 5EEWA 4PY8I 5DLMH 2JJSC 3LB6C 1U41A 4WHTB 3MA9L 1SN0A 3TA3C 5JXAL 3M7OA 4XBMA 3BGMB 1CE6B 3JV6A 3FQWB 1ZA3A 1UCTA 2WXMA 4IOSA 4LEOB 4QRAA 2KDGA 2HFGH 1QSFB 5C0BA 2WKOF 4KPHL 5IHZB 1XGQA 1QNZL 4OF6A 1H6UA 3QARA 4JAMB 2F8OA 3ILPA 2F53B 4PG9A 1XH3A 3U48A 3QWQB 2DV6A 1CU4L 3ATEA 3F12A 25C8L 1UURA 4A7VA 3JV0A 3K0YA 2H2PC 4Z3TA 2B8OT 5KN5B 3LEYL 5KS9B 4G8GB 1X6NA 2YMTA 3CVHA 43CAB 5B3SB 1R3HB 2E7DA 1G7QB 3BIKB 3L3OA 5EUOF 1F6AB 1QHQA 4L8SB 1OSPL 3CPUA 3TEUA 2CJTA 4F8NA 2XVKA 3FUEA 4OSUH 1CFQA 3GJFH 3MR9B 2G3XA 3JWDH 4NKQB 3RWJB 2GSGA 1OF2B 5MERA 2NY7L 3DUUB 3GKWL 2VKXA 4OLZL 5DVMA 4ZMXA 4TUKH 4JO2H 3VD0A 2JKRM 1KB5A 4QRPE 3UCQA 1F4YL 2OSXA 1G0YR 2FX7L 1K8IB 3RUGA 4RAHA 3T2NH 2SEBA 4AJVA 2E7HA 4GLRH 1L9RA 3G6JE 1PLBA 1TVDA 3V5KB 4F2MB 2HH0H 1SN2A 1VPOL 1WZ1L 2X9WA 4FC3E 3ZTJG 4G6FB 3B2MA 3N0PB 5EEUA 4JBSA 4B3EA 4WW2F 4M93C 4KRPC 2FX9H 4X6CF 2P24A 4J3UA 4AZUA 3DX8A 3VYNA 3FB7A 1B9ZA 5KAQF 5KVGL 4LASL 1PFCA 2VLKB 2QL1A 1F11A 3CX5J 1XGPA 3FC8A 4HIEB 4LIQE 5H4ZA 4XXWA 3ARRA 1UWXH 5ERWB 2X4TA 2BIOA 3UAJC 4L1LA 1AD0B 1LWHA 4JFDB 3RVTD 1IUZA 1GGTA 3QA3B 4GO6B 3OKLA 4JRXA 5DC4B 5AZ2H 5IHBA 2E8ZA 1GIGH 1GJWA 4K94H 4N2NA 3HG1E 4PBVC 4AQOA 4A7GA 1ULVA 1MVUB 2MQ0A 2NX5B 3UTTE 4QT5B 3QAZC 4HLJA 4PJ7A 2GTQA 4GSQA 1FNSL 3EYUL 4PRPD 5KBPA 4P9HH 1FFOB 2PYFB 3KLLA 3SPVA 3V0WH 4M7KL 2D7OA 4CL7A 5JW5A 5BV7B 1DLHA 1EXUA 1VGEH 2Y2TA 4AV4A 5AD0B 3FB5A 3LEXB 2Z4TA 4DP9X 5L8KB 4HH8A 1H8SA 2IH9A 3DHMA 5CXPA 4N1HB 2Q3ZA 3OAUH 3WIIL 4DP0X 1AG0A 1KLUB 4X9FA 5D96B 3LS4L 4HT1L 4YXKH 1PD0A 2O5ZH 4XXDB 43C9B 2DLGA 5T1KA 4TSAL 3BMVA 5CBAB 2ZG3A 5DMJB 5JPNB 5FLVA 2P5EB 3G08A 2J72A 4JCWA 3O4LE 4X50A 2K7QA 3RTQC 1L9NA 4AL8H 5CZVH 4HLEA 1LEIB 4L4JA 1EX0A 1MPAH 2RCSL 1DEDA 3HMWH 1B4LA 5C08E 3ZO0A 3V0DA 3AGVA 1M3JA 4I48A 2EABA 1W72H 1YN6A 3ZL2A 4L3CA 5IB4B 5DZAA 3TO4A 5TFSL 4N5UA 5BOZG 2ZPKL 3EGDA 3ZHKA 5K69A 2QLVB 1T1WA 4RFOL 2AV7A 2JMRA 3HA0A 2BOCB 2X42A 2Z31B 2OMXB 1W9XA 4G1EA 1KTRL 2VITB 2ZCLH 1KMGA 3U0WH 1CDBA 4HALA 4X6CE 3D3VE 4J4PA 1QO3A 4Y8AA 2Q86A 2XZCL 1LYQA 1ND0A 1MY7A 1YQ2A 3WD5H 4K3DH 2AJSL 4NQSA 2ZG1A 1CLYH 2EDBA 2WQXA 2DI7A 3E38A 3C5ZB 1E2VA 3ECBA 1JHTA 4PPTA 5EIIA 1K4CA 3OB0K 3QXWA 1FUNA 4H8VA 4NNPL 3AFLA 4JFPB 4Z7AA 5B7FA 1FG9C 3EJUA 4NJ9H 3VFWB 1FLRH 3VRLF 2WLNA 1CK0L 1JCKA 2QKIA 4GMSL 2X12A 3BHBB 4NGHH 4WHYG 4JFOA 1JPGA 4I0CC 5IVZA 4HGKC 3UTQB 5IJVA 1AY1H 2ZOUA 4Q6YA 5HGHA 2DJMA 4L1BA 4PQXA 4XVSH 2N7AA 3SDCB 3QQNA 4OZHB 3QXUA 3W9DA 3IU3B 1NCTA 3IVKB 4M48H 3ZU8A 5T1MB 5L88H 2ZP8A 1QX1A 1AS8A 2AXGB 5CEYA 4BDVB 1N0XH 4IMKA 3GHBH 1LP9F 3AG2B 5JHLA 4UUJB 1ZIAA 1NUGA 3PGCA 3WNIA 1ZVHA 3NFPB 3OKMB 4G6JL 3LKSB 1QYGL 1DN0A 1MEXL 1V54B 5CN3A 1KBBA 3S36X 1BEYH 3JV5A 4N8CL 5GHWL 5FO9B 2EVGA 3ARBB 4M5ZL 2HB0A 3EH3B 3CSFA 3J2PA 3IGKA 4KOBA 1FZKA 3JVFC 1V7NH 1WWAX 4O4YL 1RZGA 3HG4A 4YBHA 2Y24A 4IM8A 2EDNA 4LKCB 4PJDF 4QOKE 4CSTA 1WBXB 3ZHNA 3QORD 4NENA 3SDYL 2H6UA 4AJYV 3IDGB 1L6XA 1J5OL 1GZQB 1THCA 3BDYL 4AH2A 1IFRA 1RP9A 2I9TB 4X4ZA 2FEEL 1QWUA 5HGGS 4JREB 4X7FC 5DRXA 2BFGA 4NXSA 1ZD6A 2DTSA 5GRJH 1CC3A 4JO3L 5I30H 2OJ1A 5IMMB 1CVRA 2R2HB 3M17A 3HZYA 5FECB 3OAWA 4DO4A 4QHNB 4NDMB 1PDKB 1C5DB 4NB7A 4PB9L 3RDTA 1BLNA 4FQHB 5EBGA 1VFAA 1NDMA 4CILA 5KSAA 3ZJAA 1JL8A 4A37A 1U3ZA 4GB9A 4AG4L 1P0SE 1JRHI 4TUUA 3K8KA 15C8L 4HIHB 4TLSA 3S3CB 3ARXA 4EZLA 5C0FA 5DQJB 2R4RL 4HWBL 4PJ9D 4G2AA 2C4FT 1OL0A 3E8UL 1ZTXE 3PDGA 3QXAB 1DBAH 2TRYA 5FCUH 1ZT4B 3IDXL 2CSPA 4WI8A 2MQGA 2IWKA 3H7BB 4IJTA 3AXLA 4PREA 3RG1C 4X6EB 6FABL 4DOHB 2P42B 2FO4B 3DX6B 1XB6A 3H9SE 4C56E 3QEUA 3AMLA 3V0GA 3B9KD 3LRLA 2DWSA 4NQED 4OGXL 4TPRL 3NCXA 4XWOC 5DJXA 4FDWA 4JHWL 1B4JH 3GZQA 4YDLC 4MMYB 4I85A 2FGWH 3NPSB 2A6JA 4KHXL 4OW6A 3SOBL 1M2VA 1U42A 2E9BA 4FNTA 2CO1A 4IRSA 4N0UB 2F9BT 5K9QG 2YO3A 4PTTA 3KW8A 4D9LH 3SDXF 1NIAA 3F05A 3NCJL 1HZKA 1QLRA 5DZLA 5SWSE 3SJVD 4FXLA 4GMTH 3WTXA 2ADFH 3QUYB 4GRWB 2X3AA 3ZDXF 4M6OL 5HI3C 5HHXH 1DVFB 4ZQKB 3VSUA 1EJFA 4TRPL 2TSAA 4U1MA 1DBBL 1FVCB 1YEHL 5J11C 1JI1A 2CO7A 4YHIA 2H6PB 5LGKA 4HAKA 3TNMA 4QRTA 2WANA 2GIXA 1DSFL 4JDEA 1MCHA 3IMRA 4I18B 2P5PA 4MCYB 4BELD 4PJDE 3H3PH 3V4VA 3NDZE 4N0CC 4OD3L 3K6SB 4CW1A 3P9WB 4ZFGL 5FGRA 4WK0B 3RA7H 3HE7B 2MNUA 3DXAA 3L7FB 3L3GB 4KZCA 3BLKA 3MXVH 4FXKB 4P5TC 4J3OH 4K3GA 5DD0H 2LU3A 1KCUH 2CIKB 2CXGA 2WVUA 4JG0H 2R0LL 4JHUA 2Y7QB 4ZMZA 3D4CA 3KD4A 2BNUA 4FZEL 4QAMB 5C0JA 1K85A 2Y1VA 5FGBC 3MX0A 2D7TL 4DGIH 2AZAA 2W9LA 3V95A 3AS0A 5HGBB 1RUPH 1BDYA 2VR8A 3DRTA 3FB8A 5B38G 3PWPE 1YNKL 5CJXC 4HA1A 2Q2LA 2DAVA 2VDPB 1DVSA 3QRGH 4XPGL 3TN0D 4D9QD 4MZRA 3THML 1F90H 1CPUA 5BJTA 5I66A 4PW9A 1NMCB 3AU1B 3ME0B 4Y19A 2GKIA 3QDGE 5IR1B 3LZFL 3S3DB 1QEXA 2Z1PA 2VN6A 2ZIDA 1OAQL 3B7RL 1IGFH 2VDQL 4LRNH 4MMXC 1LO0L 4RH4A 2DQUH 4CVZB 5A2LH 1CR9L 1DFXA 3IGAA 2DIBA 2G2RA 5AVTB 5TGBB 5I5MA 1AP2A 2BX5A 5E5UB 3MLRH 4E0RB 2H2SD 4RISH 5CR8A 5D4HA 1OP3K 1S3KL 1ZLVH 2XA8H 3SE8H 3DI3B 4PJBA 3DHUA 3E3QC 1JXGA 1OCCB 1BOGA 5FFLA 4KI1A 3U82B 4R4BA 1AQDB 3L5XH 3RX9A 3T6VA 4ZUSA 4Z7UE 3VUAA 4Z3HA 3RWHA 3MRBA 1NFKA 1YMME 3WKPA 1JHLL 1SEQH 1XWVA 2KZKA 4ICWA 4GEJA 4NUPA 4ODVH 1Q8MA 3SDXE 3ZDYB 4ETQA 5I1DB 3BEWA 5C9JB 4TSCH 1X3DA 3IBEA 2XVGA 2BXYA 4XCNA 4HWZA 2NXZD 2NTFA 3KL3A 2Y5EA 5CHNA 3AROA 3ZDXE 5LBGA 3I9GL 2BNQD 3TV3L 4QF1A 1ZRUA 1NLBL 2EYTB 4HZAA 3H6JA 1T6BX 1WIPA 4HBQA 3VFVB 5JIDA 4AVKA 4LRIA 1QLEB 4OAWB 5JHAA 3WAJA 3LMJH 2YBGA 3V4UL 4IMLA 4LLWB 4X6BA 1NKGA 4NQCD 5LNDA 1B9KA 1Q38A 4HSAC 1M7IB 4KXBA 4F7MA 4IHOB 1WFJA 2DD8H 4UOW1 5FHAL 1INEH 5TE4L 1R3IL 5EBLB 3HHSB 4FABH 2FB4H 4L8SC 3NABH 5HPMA 3A4FA 5F7WC 1XAKA 1N5AB 3IF1B 2AKRB 5G55A 2QV4A 2YD7A 2AERT 4HYTB 4R9HA 4XGZB 5DVOA 4LCWA 1L0QA 4QXVA 3ZE0B 2KL6A 1Q90A 3ULUC 2AW2A 1S7RB 2G9KA 1OTSC 5F3HB 1IGYA 1PX4A 3MXWH 1P7QA 2B20A 2IDSA 3V55A 2N56A 4S1DD 3GYRA 3KJ6H 3SDDD 5JOPD 5DURB 3NAAL 2IPKA 4FQJH 2A9ML 3D69B 4ZMWA 5EOTB 4N20A 3RVVC 1AACA 3FDWA 4KY1H 4Q9QL 3D09A 4F3FA 2VDKH 2KPWA 2W0PA 3KPOA 4BKSC 2P5WA 4YDVB 4LHUG 2XWZA 2P8PB 3VRIA 3VXME 1IFHH 4LSPH 1KWKA 1A47A 1ZDQA 5F1IB 3D39D 4ADJA 1HEZA 5T3XH 4FA8A 5DQDL 3VI4B 2OS7A 4LCVA 1YQVH 2IIJA 3VTAA 2VLME 2ITDA 5INCB 5E99L 3FPXA 1OCWL 4JKNA 1CI3M 1ZSDA 5DS1A 3F04A 5GXBB 3JUYA 2NY6B 3X12A 3I3BA 3ZT5A 5EIQA 7FABH 3DBXB 3ZYOA 4OLYL 4RFEB 2X4PB 5HHNA 4KTDL 3ZMEA 2YFOA 2R8SH 3REWA 5JORB 1NKRA 2DIJA 1QSEA 2NQDA 4WZ9A 3FTZA 1DJSA 3OHMB 2WZPD 5C09A 1FV1A 2DDQL 4PJFF 2XACC 4LZKA 1A3QA 1GVIA 4HKBB 1YEKH 3BN9D 2KQMA 3EYVB 4TTDD 4ZPTB 4YFEA 3VDBA 1MZYA 4HWUA 4QRRD 5C0GA 1A4KA 1P4LA 1D5IH 2JQMA 2XWCA 1PZCA 5EZLB 5BV7C 3BZDA 1P7KA 2AV1B 4PJGE 2KZBA 1OGAD 3DWTA 3HUJA 3QI9A 2WLZA 4Z7VA 3TS8A 3HNSH 1CGUA 3TTSA 2UX6A 2AJVL 5D96C 4UZSA 4BHUI 5IB1B 3BVDB 4JMXA 4UM9B 2R7EB 4HUVB 3TBWA 1RJYB 3LOWA 3U7AA 2VLJA 5F72S 2ZXQA 5JPNC 4LFHG 2DN7A 3A6CL 4GXVH 1NBZB 3QJTB 2BZCA 3BH8B 5G5DA 1NM4A 4GUPB 4GT0A 4F2ME 4XVUC 2GCYA 2Q5BA 3KWTA 3RJQB 4WKZA 5GGRB 3X13A 3ETTA 1JNJA 5J0BA 4ODWA 3TM6A 3II1A 4XCEB 1BD2B 2YPLA 4UQ2B 2DYPB 2R2BA 5TH2A 3MBEB 2GC4C 5EU6A 3QQDB 5J13B 2DQGH 4HKXB 3E6HA 2AVGA 1IIIA 5FB8A 2ZWKA 1TXKA 3TPUB 4N6RA 1ZV5A 2JCWA 1AQKH 4WJ5B 2Z31C 3J7HA 1FYTE 1NJ9A 2ZUUA 4CN6A 1DBML 4S2SB 5E8OA 4PJAF 1W0VA 4G8EB 4NN6B 5EDSA 4Y2OA 5BVPL 4QY8B 3W0WD 5KBNC 5FW8A 3N85L 5F3BB 1QA9A 1XQ4A 3RPIB 4H20H 4JQIL 4LVHB 3C5ZC 5J12B 3C6LA 4OZ4B 3ARTA 5CEXB 2VKWA 2L7JA 1BOYA 5IJKC 3MJ9H 5ABAA 3BDBA 1BXAA 3FU0A 5IBLC 3SEPA 3IDUA 3PXHA 4ZOCA 1LDPH 4JPKH 3MRJA 1U93B 2WP3O 5IQLA 1W8OA 4I4WB 4N8UA 4FG6D 3RU8L 3L08A 1T5WB 5IIEA 5HVWA 2VDNL 4LESA 1PJ9A 4L3EE 1SXZA 4E9WA 5C2BL 3T65A 4LKXB 4PJFE 1V8HA 2WLLB 3SDCC 2JTDA 3O6MH 2ZOKB 4JFZH 3WUZA 3PGFL 2V2WA 5LUMA 1PW3A 2EDEA 3P11H 5A2FA 4L8CA 1KTBA 5CWSA 2XUWA 1KEGL 3ABMB 3ZL1A 1RFDL 2VDQB 2LTQB 4KK5C 3JT0A 1VA9A 3UG4A 3U9UA 3KLDA 3ARBC 3DO7B 4S1SH 2YHGA 1IU1A 1U3HB 1OSZB 1CLVA 3NJIA 2BH0A 3GT6A 5HHVH 4GBXA 3GZOA 1TJGL 3GMPB 3IBOA 2X9XA 4A7SA 2XN1A 5CGMA 3CN2A 4NO0A 4PCYA 4CSPA 1JZ3A 3BN3B 5GS1A 1HOCA 4ZSOB 4CU7A 3C5JB 3TVMA 1A6UH 3EYFB 4LGPB 2P43B 1Q1JH 3IJYB 3B8YA 3CFUA 4IRZH 5F0LB 2FT8A 3PABA 3N1GC 2E9IA 1C7SA 3BD3A 4PV8B 3VWKB 1KEML 4JREC 4Y4FA 1EXHA 5GRZA 4XC3L 1AGEB 1XCQA 5SWQA 1J12A 2KUTA 5GS0C 4IDLA 4MVBC 1NINA 2BCMA 3CK0L 4QXUH 1A3RL 3QT2A 3QFDB 4K23L 5IM7A 3BT2L 12E8L 4AENB 4CMHB 2LW3A 5JXEA 5D7JD 4P4RA 4BK4A 1S3RA 2P48B 2OMZA 2P7TA 3CZLA 4PJAE 4G7YL 4R4ND 5EU5A 4JFTA 1WHPA 2QDWA 3MLZL 3LKNA 4PEEA 4Z18A 3ZPDA 1AGFA 3DGGA 3ZW3A 3ENEA 1A7QL 4B96A 4WVRA 1QWNA 4F9PC 1UD2A 4FFWC 5DHDA 5IVXF 3NT0A 5BRQA 3BPOB 5FYLE 1J0YA 1XGRA 1S8DA 4U4IA 1XF4B 3ARGA 4Z77B 5F9DC 5I28A 3UL4A 4N24A 5FLUA 3H0TB 2EE2A 2I60H 4IRJB 3NPSC 3MV8A 3WKML 1YRKA 4OB5H 4POZD 1RHHB 1BBJB 4H25A 3Q43A 1WGVA 1LXMA 3SIKA 4KGLA 1IAIH 2HX7A 4U1SA 1X5HA 2TAAA 1AQHA 5IWLA 4CBZA 4Y1AA 4LLYA 4NXKA 2ESVA 2XKUA 3QUYC 3FFCA 4LOVA 1JPST 4S1QH 4LCIL 1DVFC 4X4KA 2Y6SD 4O02L 4WI7A 3ZLQC 3AS1A 3HS0B 1E4XL 2H4EA 4RAUA 2NY3D 1QZ1A 3PIQB 5CJQH 3UDWC 1DUZA 1QQDA 3NJVA 3QJFB 4I18C 4K8RC 4K07A 4GKSA 4RQQA 4LBEA 1WA0X 4Z0XA 2E6JA 3KWUA 1I8MB 3T6WA 1L7TL 1NAMH 2Q0ZX 4JG1H 5AB2A 3T8XA 3RHWF 2A4EA 1S9YA 1LK3L 4Y2DA 2Q76A 5HYJD 3A6BL 3HE7C 1KPRB 5I1JH 2CLVB 4FXKC 4I87A 2ICES 1P69B 3FO1B 3DX3A 2J8UB 2XVLA 1EFXD 2X88A 1C12B 3MJWA 4PYGA 2VMFA 2A6DB 2BFVL 1KCRH 2HRLA 4LLUB 3WS3B 4G1MA 5HI5C 4FD0A 1KXVC 1VZGA 3MOAL 4N2MA 4MJIB 2H9GB 4L29A 3KYKH 4O2FB 1OHQA 1WPCA 3NOIA 4ETYA 2H0PA 2XWJB 3MV9A 2ZSVB 3PDOB 4JZNA 1GGBL 5E70A 1U6AH 2C3WA 3CDCA 2NY1D 1E6JL 3CH1B 3WDIA 4E2OA 2BIQA 2HVJA 1NCCH 2F5AH 1DJIA 1KULA 2FBJL 3Q48A 3RL1A 1XGYH 1AZNA 1DO6A 1T22B 3M46A 1U95B 1BQSA 1KCSL 1QWHA 2H2PD 1OEZW 5BRZE 5IVXE 1F97A 1PKOA 3G5YB 4UYPA 3WEMA 1Z9SA 3BKYH 1Q9KA 3MO1A 4HCIA 1I7RA 1RZ8B 3HIZA 3B2UD 5K1JA 3N06B 4XPHH 1UUSA 3M1CA 1L9QA 1X5MA 1DCEA 2C26A 4IIZA 1HQRB 2XTSA 1FO0L 3OKNA 3V2AR 3OL2A 3IMWA 1Z9LA 4I3GA 4LCYB 3UCRA 1KTLB 1LLAA 1IGML 3MNVB 5EHFA 5F7FA 4GG6B 4FFZA 3UOAB 2Z4QB 4Z78B 3FH8A 2X4UA 5F2FA 3PAYA 3VD3A 4NCC2 1XR9B 3FK3A 2NNCA 3S35L 4JHZA 5GGTA 1XF3B 4UNUA 3C09B 3SCMA 4P06A 4FP8H 4HMCA 5LNEA 5DI8B 4PJCB 4MA7H 4WUUB 4TLUA 5KSBF 1MOEA 4YOKA 4Y88A 1IM3D 5M95B 4U6YB 2YARA 3MLPA 3NACH 3FQNA 1W80A 4CN1A 1MKFA 3BH4A 1L6ZA 1YNTB 2VN4A 4X80H 3IJSA 4BZ1A 1JWMB 3LN4A 4PAZA 1AKJB 3UAJD 2X70A 1LO2L 1KACB 5DMIH 4PGBA 2WJ5A 4NPYA 2DWDB 3MRNB 1X5IA 2EC8A 3APDA 3NN8B 4EEEA 4OJDH 3PYCA 3LRSA 5IGXL 4BCXA 2IG2H 1MCPL 4TOYH 1Q72L 4PY7A 5ID0B 3MJ7A 3U36A 2NY5L 4I3SL 2K8MA 4J8QA 5AKSA 3Q8EA 4OCWH 5KTEH 2JXMA 1LEKA 3CNKA 3N55A 4QHMB 2BNRA 4LIQL 3KPPB 4PJ8A 3IRCA 1F4XL 2E7MA 2ZOTA 5C0BD 2DM2A 4M29A 2P8LB 1UGNA 4AX3A 4JDTL 2QLYA 2RQ8A 4O9HL 5HYIA 4IKJA 1NFIA 3ZZ1A 1XXDC 2FHFA 4OCRL 1GJUA 3OG6B 4YHPA 1E5ZA 3UYPA 3FN0H 1RPUA 3T0EB 2NY6C 1UFUA 4U1LA 3IFPA 1ZHBB 1JDDA 1MQKL 3APMA 4J12A 1S7SB 3US0A 1PS3A 4JHAH 4BBWA 2VXQH 1R24A 4W9FC 5DYOB 5CCKH 2CIIB 1DVQA 1F2QA 1HYRC 3V6BR 4AE0A 1E65A 5IW1B 5E2UH 3KYMB 1PSKH 2R0KH 3CDGA 4H5SA 5MI0B 3D34A 5EPMB 5L4JA 1CIDA 1LM8V 1UADC 3OR7A 2OL3H 5DHYB 1FN4A 1RZJL 4HJGA 3EYSH 4FA6A 4OLUL 4QO1B 2V9UA 5IT2H 1MJJB 2QGDA 2X9ZA 1T2XA 3X1NA 3TC9A 2NZ9C 3N6YA 3SE3A 1A9BA 5F44A 3LKQA 4NUGH 2PP9A 5KSBE 2OMVA 2JCCA 1IE5A 3BKMH 2J57A 3ROOB 3EH4B 3NMEA 1QTYT 2ZXWB 5I2IA 4P2YA 5DJDA 1JYVA 4XVJL 3D2UB 5DJ8A 1MAKA 1OSEA 2B39A 3RWDA 5ILTL 5KBKA 1JDCA 1CURA 3DROA 3LN5B 5CCKL 3D0LA 3MGTB 3NJHA 2HTLC 3WY4A 1YYML 3ML8A 3UJJH 5D2LB 4G72B 4OUOA 1QPKA 5F0MB 4JN2A 3GFUA 1R0AL 3MBEC 4G5AA 4XB8A 3MUHL 1E9PB 1KBGH 4Y89A 1H3VA 5J13C 1I1CA 4NUQA 1XSIA 4HC1L 4MZ2A 2DQMA 4XMUA 3KJ4B 4ODHH 1OE3A 2Z65C 1V3LA 3MQIA 3EDEA 4HHAB 3HFMH 2J71A 5DHVB 1AGCB 3SBPA 1OARL 2WWOA 3UAEA 2RD0A 3LS5H 4WCYL 3BRGC 1JGIA 4ZD3L 1JGEB 5ESAB 2XY2A 4LVHC 4YDIH 5J12C 1EEUA 2DWXA 4LARL 1N6UA 4I3RH 1Y18B 3Q2CA 1EEQA 3OMIB 1JNNL 1B0RB 2GYSA 3L2LA 1OP5H 3VYPA 3S37L 1QPPA 4U1GB 3BP5B 4OKDA 4UQ3A 3F6JA 1A8ZA 3OQ3B 4M5TA 4HU8A 2JIXB 2TRHA 4OIIL 4X5XA 3WIFA 4OZIA 1MG3C 3HLAA 5DGRA 2YAOA 4WU5B 2K1MA 3PJSA 1J0ZA 3Q6FB 1F4WH 1P1VA 2IBZX 4JQXA 3QH3B 2O6FA 3D4GA 3DVNA 3QUMA 1EHLL 1MQ8A 2BM3A 4M1GH 2JKJA 5M7QA 1WBZB 4XE5B 1A5FH 1TTUA 4OF0A 4XOBA 4PRPE 2LTQC 3AY2A 4AQ1B 3ZX1A 4R83A 3HZVB 3FZUC 5IFAH 3AITA 5TK4A 4NKIH 1U3HC 2FO8A 4HIQA 3KAAA 1YEFH 4L8BA 1G1CA 1TG8A 3QPXH 3O2VH 3O6FA 5KSUB 1ZK9A 5J6GB 4XCCL 3RWFB 3FO1A 2OW6A 4CVXA 4JZJA 2GW5A 2QFRA 5J8OA 4YNYA 3GSNH 4PHXA 1FO0B 3D33A 3QBTB 3ZTCC 1SVBA 2F19L 4P48A 4QDGA 3WJLA 1CCZA 3WY1A 1A4AA 2X4NA 3GSRB 4PRNB 3KM2A 1MWAL 1KENH 4MJ2A 4TNVF 1HINH 2VL5A 3QDME 3TIDB 3VWKC 4JRFA 3NYKA 1S7QB 4UYQA 3FO9B 3F7KA 5GIRB 3WXWL 4EDXB 2X0VA 1IC1A 2FUQA 4Y5YA 4AMKH 1MAML 3ZUNC 4R97B 4YHOL 2W60A 1IT9L 2ZXCA 1ZTXL 3DSNB 3MRLB 5T5FL 3RVUC 4OZGB 4H40A 5JO5B 3W9EB 5I5IA 2DI9A 5I1KL 3TPKA 1T7XA 4CMHC 2WXIA 5ANME 5B38A 4DFHA 3N40P 2FD6H 2O72A 3OAZK 3RBSA 1QEWA 3PQYA 3O11B 1ODUA 4ZMTA 2IWEA 3B8SA 3LXBA 5C86A 3QPKA 4A7QA 1CFSB 1CGVA 3LD8C 2VZUA 1DTUA 3PPEA 4G7RB 1Y6NR 2EE3A 1JAEA 3GI8H 4HF5L 5AWNH 4HEME 3BPOC 2RTTA 1GGIH 3CSYB 3E8VA 3DETD 1F18A 2XVBA 3G6JB 1A7NH 2X4SB 3D4ZA 5D6DC 1KN4L 4JFEB 5EDXA 3V8CA 3CMOL 3CVCA 4GPVA 4V1DA 5CO1A 4IRJC 3F01A 1JGLL 1PKQA 4LEXH 1UYWL 4P5TD 1XR9A 4HBCH 5AVRB 3LV3B 2A73A 1HH6A 3PHOB 5A2IH 4TSBH 4YFDB 5E9NA 2HX8A 4JY5H 1A1OB 4PVLA 4Z9KB 4OLWH 3PUUA 1FFTB 4FQQB 5J89A 3JTSA 2AEWA 3VGGA 3DMMA 2MWCA 1YAIA 4RRPG 3BAEL 5C8JA 1NCJA 2GTWA 5BQ7B 1IGCH 3FQRA 1DFBL 3QDJA 4ZW3A 2V7NA 4K7FB 3HS0C 5FO7B 4LDEB 5FKAA 4KNTA 3P3TA 4XTRD 3VVVA 2VDML 3MRHA 1TETH 2BP8B 2YQBA 3C8KA 3RDTD 5C6WH 1H6TA 4FTDA 5AAMC 4HISA 4JHBA 4P5MB 3GXPA 4G9FA 4HAGA 5E0QA 5MENB 3G9VA 4J2XA 1U8CA 1Q94B 4YGAB 1Q9OB 5I1GL 3AS2A 5I82A 5TDNB 4LVNC 3IJHA 1IAII 1P1ZB 2IBGA 3L4VA 1UWYA 2B4CL 3ZOAA 3O6KH 3QJHB 4QRFA 2J8HA 2LVEA 4ODXA 1ZOXA 3NA9H 3QIBB 4PGCB 3Q44A 1KXQA 1U8QB 4AQAB 3O6LL 3D87B 4WGKA 3VE0A 3IAPA 3IXAB 5FDYA 3QDAA 3D18A 2CO2A 1Z5LA 1VEOA 4YDMA 1OGTB 2FR4B 2X0UA 4QHLA 2GABA 3CQPA 4EI5A 4HCRL 3WOVA 4HJJH 1KJ2L 3STLB 2VN5A 3OKDB 2D3VA 3NZSA 1OZUA 1B0IA 2GAZA 4LHUA 4PR5A 5SX5K 1EERB 1X5JA 2GJ6A 1NEZB 4FI6A 3KDMB 3WHE0 3DX7A 4K9EL 4QCIA 4G8GD 4OM0H 4TNEA 1JUFA 1X5LA 4YSCA 2E6PA 4BRJA 4TYUA 3KBHE 4UINH 3LNIA 4BKLA 3TF4A 4AKOA 5EZIL 1Y7VA 4FQXB 3MRFB 2IDQA 4M5SA 3WTTA 2YUZA 4WWNA 1FGNL 3X3FH 4NQEE 1N2RA 4MTMA 5DD3L 1VFBA 3U4KA 4FQLL 1S7TB 1HI6A 2YOCA 2DH2A 4D3CH 3EZJB 1SEBA 6CGTA 1BG1A 4XVOA 3A4DA 5HGAB 1JYNA 3CVDA 3HJEA 5DJYA 4B3VA 1KYUA 2YPVH 3RQ3A 4WUKH 5J1TC 5FYJD 3R06B 4NBXB 1ZV9A 3BEVB 4PW3A 3SJVE 5BXFA 1M56B 3C09C 4G6FD 2WQUA 2YZ8A 3KL0A 5HDLA 5F7EL 1TFHA 5BO0D 1YZZA 5ICYB 5I15H 5L8JB 4GKLA 3VXRA 5A6MA 4BGDA 1TJXA 3PUCA 5L7XL 3SY0A 2F54A 1I8UA 5LJYH 1A6PA 1I8LC 1WH0A 4IOFC 1T7VA 5BUAA 4WKXA 4MYPA 1HAUA 4HP5A 2O6DA 2MFNA 4BFRA 3UBFA 2WMPB 5AB0A 5LQBH 5LN4A 3FCTA 1YEJH 4WY7H 3PJLA 1FFNB 3HB3B 4NFBA 1IEAB 3O3EA 3VA6A 1S2EA 2VSMB 4H8UA 4JFDD 1SDYA 1ZPLA 3GMMA 5E8EB 4UT7L 1TZ8A 5F9JA 1BJMA 2QTVA 2CKBB 3KXFB 3ZN6A 1YY8B 4OLVH 4TLTA 4KMLB 3S3BB 4M6NL 5A2CA 1UB6A 2CDGB 4QLWA 1NCNA 3L4CA 2HT4C 2P1YA 2ZX7A 3CFKA 3Q6GH 4QOKB 2A6KA 4WFFD 3JWNC 2F0CA 3W37A 1UQSB 5FUZL 1R5VA 3PHQB 2I5YH 4Y7MA 4D9QE 2VABB 1S7WB 1OPOA 3H2PA 3DJ9A 4K71B 4RZKA 1QBLL 4UZUA 4UT6H 4M4RA 2ZJSH 1NLDH 2EO1A 5D70H 1GYWA 2APSA 5AVSB 4AGNA 4CMMA 2YD2A 1U3YA 1G7MB 4LE8A 3T0EC 2Y9RT 5IJCC 5K9QI 1FCGA 1OAUH 3BUTA 3CLWA 3BZ4A 3P4OB 4TQEL 2K3HA 1TIUA 3MRQB 4LP5A 1YECL 1IV8A 3OF6D 4F7PB 2HUEA 5IMOB 3CLFL 1OTUC 2J4WL 5DJCA 3PL6A 1UT2A 1RZFL 3P73B 4O5LL 1OE1A 1R5IB 4XVUD 2O61A 4XPFL 3EIFA 5EU4B 5K1VA 3U0PA 1FL6B 3C6EA 5E2TH 5MI0C 3NEXA 4PMFA 1B4TA 1T7ZA 5H2BB 1N0LA 3OLIA 1ECYA 1BGXL 3LY6A 3NSYA 3CFDB 2KLTA 3EGXB 4L9LB 3ZKXB 3LDBB 2YD0A 3VI3F 3QP3A 2CRIA 3WENA 4NQXB 2OXHA 3MSPA 3FPYA 2WQVA 4JY4B 4XP6L 2A0LD 4I7ZC 2BNQE 5I8CB 1IBGH 1EHNA 4EKXA 3WHXB 5A3ID 4ZNEA 2MNWA 1ORSA 1WAPA 4PJXA 2G3ZA 3HMXH 3BQUA 3GSQA 1U33A 3HVDA 5A2AA 4GW4A 2P5WD 3BD4A 3FBKA 4NQCE 4NRZA 4GS7B 5GGRY 1G7HB 4K2UL 1I8KA 2EYRA 1OPGH 5AVYB 2PTTA 4DESA 1A4CA 2D03H 3PAZA 2YMOA 3OXSB 1MCFA 5KZCD 4BUHA 3KM1A 2AC0A 4PBWD 3KLHD 5AALA 3MLSL 5CP7A 1GAFL 2W5PA 2R69L 1FORH 4ALAC 5ESVB 2MCG1 3UTSB 3WMQA 2H7WA 1M57B 5DWUL 1T2JA 1IKNA 1G6RA 2GJRA 2Z91B 4LXFA 4L0ZA 1PZ5B 3F7PC 2A2QT 2WOBA 3P30H 4OTXL 4XO8A 1LNUB 5DVNA 5EC1A 3KJ4C 2UY7B 3NCYS 2K78A 2GT9B 4L05A 3CZJA 4PJ5A 3ULSA 1JE6A 1ERNA 2YPVA 3MYJB 3OHXC 2VDMB 3SKMA 1RUKL 3QJVB 2XTJB 1QABA 3ISWA 4J1UB 2LR4A 5C0ND 4MB3A 4DFIA 1YCSA 4KK5D 1MF2L 8FABB 5LLIC 1SXAA 1NFAA 5JHDE 5LXGH 3D39E 3GXFA 2C4FU 3H42L 4EBQH 4M62H 3BAIA 1NEUA 4YHZH 3TT1H 1P5VB 4KROB 4FG0A 4MXWL 3VXSA 1K6QH 5JIIA 2E7CA 2N7BA 5BOJA 5TE7L 2NZIA 2A77L 2ZKXA 3D8MA 2VUKA 3QR2A 4HCFA 3ULUH 3HCVB 3EO1B 3ZYJA 1KGUA 2H1LM 2D9CA 5F7HA 5FDWB 3Q8AA 5DJZB 4U1GC 1C5CL 4MJ6B 5ACMA 3N1MC 1D5BA 3O0RH 5KVEE 1BW8A 2UY6B 2MPAL 1GC1C 5DUML 1KPUB 4B9KC 1MHCA 2YD6A 1FNHA 1YDPA 2BXZA 3KW7A 5E6ZA 3RZCB 5C9KA 3BFOA 3LH2H 5T33H 5LBSH 3ZSSA 4P2RB 5GS0D 4KKRA 4LOUD 4WI9A 2O26U 1TYJA 5ICZB 1LE9A 3QO0B 4TUOB 1TO5A 1MFCH 2HFTA 5FX3A 3ORJA 3MLUL 1JNHA 4EN3C 3MJ8A 3HBGA 1JN6A 4BCYA 4GAJH 4QRRE 1TFPA 3IJEA 4Z7UB 3HC0B 3D85A 3QCTH 4ES9A 4FFVD 2DQEL 2W1NA 1OGAE 1AQ8A 5EU3B 3U1SH 5PAZA 3WJJC 4N1CA 4P04A 4FFWD 1EEYA 2IQ9L 1SJHA 1NL0L 1DVTA 1BVZA 5IG7B 3WLBB 1CGWA 4PVNA 3QGVA 5I18L 3BO8A 4GQ9L 1XGTA 3T08A 1DQLL 3JWOL 3K2UH 5D7IE 2VLLB 1E27A 3BPLB 1KCKA 3C6LD 4D0DA 5C0EB 3GJEA 3X1BA 1RHFA 4ERSL 4R97C 1RPKA 4U2YA 2D3NA 2WO4A 4OCNC 2XG4A 1ZWIA 5DK2B 5BMFL 4PYHA 1U8MB 5EORL 4X0KB 5DJAB 5CILH 4QUOA 4PJIF 3BUBA 3QUYD 5TTRA 3QWNA 3GXNA 5FYLL 1KGXA 4XC1L 1U8KA 4JM2A 3GMOA 4N2LA 2OR9L 3QZMA 5GGSB 2FEDC 3EJZD 1A25A 4LPTA 4JVPA 3VFNB 3WEXA 5J1SC 4NAJA 4QAWA 4APXB 1LE5A 1FPTL 4K8RD 2K0RA 1F4AA 1F45A 5J6HA 3W0WE 2VQTA 3VXPA 3I6LD 1NSNL 4YEEA 5D6CB 4BE5A 4F1ZA 3FTWA 4PRHA 1FAIH 2AJYH 3M1BA 5DZVA 2ZCKH 5AVZB 3LQMA 4I5BB 4HJIA 1FC1A 5I6PA 5T5NF 3WELA 5LDUA 4PMEA 4GBXD 3N41F 2N1TE 4HUCA 4O58L 1W16A 3OD3A 4K5NA 4RAVB 4X6DF 4L4TA 3ZRFC 3QSKB 4O2CB 1FVDA 2EXYC 3TVMD 1S5IL 3G5ZA 3MRRA 4NUJB 5L4IA 4EDWH 3ILDA 3UBXG 1QR1B 4YE4L 4UTCA 4MLIA 1N3NA 4R84A 3UZEC 1NPJA 2L04A 1Z3GL 2Q87A 1OP9A 1FVEA 4R26L 4DCQB 4FI7A 4Y4FD 3AREB 4D0BB 4WF7A 2WNKA 2ADGB 5EULV 4DP6X 4PI2A 4QJ3B 2YRBA 4RGOH 2WNGA 3NESA 5HJGA 3RWGB 2AJ3B 4O00A 3GMLA 4JGJA 4QTHB 1JZIA 5I1IH 4XVTL 2CLZB 3WAKA 4IKIA 3AADB 3B5GA 5JXED 1CLCA 2XG5A 3FHQA 3L48A 1B2WL 4M61B 3SKJL 5I8EA 4WLCA 4N2DA 4U6XB 4OFYA 4YBQC 2F58L 2VDRL 1MZZA 2LQRA 2QBWA 1BBDL 5D7LA 3V9EA 1L4IA 4PJGB 3DV4B 3GD1C 3VFGL 3ZHDA 4U05A 5AYUH 3QIBC 4MNGA 5BVJA 1ED3B 2P44B 3RI5K 4BQBA 2VNCA 3NJJA 3VXTB 4ZG1A 5E1HB 3P3RA 3ARGD 2CUAA 4HV8B 2R2EA 1BX2B 3DX2A 2MSPA 2CLRA 3VXOA 5I74B 1ET7A 3WLWC 5B8CA 4PJIE 4ZMYA 1I7ZB 2NR6C 3UROR 1E5CA 2R1YB 4ABQA 5HY9A 2GUYA 2LHAA 2CUMA 2PCFB 1XH0A 1AXSA 2EIKB 2OMWA 2J5WA 4PD4K 3PHSA 2FX9L 2YC1A 3LKOA 1BPLB 3KS0H 2F8XC 3PFQA 3MA9H 5JXAH 2HJLB 4HGWB 1WCBB 3RL2B 3WUWG 2HVKB 3QULA 1BFTA 3T1FA 1BSIA 1A02N 4FQXC 2LLLA 1J9SA 1AHWA 2X1XR 4KPHH 1T7YA 2R1XA 1QNZH 2OV0A 2UV3A 2YUWA 4ZAKB 4GJTB 2Y3AA 4RWYL 3MHZA 4X6DE 3QJOA 3PP3H 4Y5XB 1GIGL 4PI0A 3DUSA 1CU4H 5EEVA 25C8H 5DK3A 4Y2DD 3TBYB 4U1JB 5DURD 3SO3B 5I8CA 5IQNA 3ARVA 1HE8A 4KVCL 5KANG 5B1CA 3LEYH 4M3HA 2HKFL 3HS9A 3RWEB 4JO1L 3GUTA 1RMFL 1SJEA 4U7KA 4U0QB 3V0WL 4OD1L 1OSPH 4Z7WE 1QTSA 1JF5A 2YGQA 3MV9D 4ZXBB 1FFRA 1SYSB 5DVPA 2NY7H 2WZ0A 1KT2B 3EXLA 3SKNA 2F2HA 3LPWA 1HHHB 2FK9A 3GKWH 3H4HA 3K74B 4EJ1C 5KYUB 4OLZH 2IALA 1ZHNB 2V5SA 3OPZL 4C4KT 4AIZA 4C4BA 1QD0A 1SLUA 2VMJA 4GI9A 2BVOA 3VO0A 2FX7H 4KFMA 4B41A 3KDPB 1YPZA 3X14A 4GYBA 2WKGA 3AB0B 5IB2B 3HB3C 4OJFL 1NDGA 3R0NA 4OIBA 1RKRA 5HYJE 3GINA 1UWXK 3RY6C 4JUTA 4W9JC 1VPOH 1WZ1H 5H94A 3QXDA 1WCQA 3T6QC 4C55A 1G43A 5E5MA 1P5UB 3RKPA 1JCVA 1CGYA 4GRWH 1QASA 3QNZB 1JGUL 1YJDL 2H6OA 2O6PA 2ENQA 3O9WB 2XHNA 3M6DA 3U46B 5EN2B 3MRCB 2V17L 3GMQB 4KQ3L 2R0WL 3HG5A 4GKNA 1BMGA 1FGVL 1S4IA 4L37A 5KVGH 4LASH 2AK4E 4JE0A 1BZ9B 2D2OA 3L9BA 1ZHKA 2XNAB 4X42A 3TO2A 2W92A 1BVKA 4P4KA 1K4DB 4F33A 4XCYB 1UWGL 4K71C 5GJTL 2FECL 2CHDA 1G9NL 3N44F 1PZAA 3VFSA 1SPDA 1RIUL 2GC7C 2JB5H 3PG2A 1EPFA 3FOLB 2QVFB 3WHE1 4UM9D 3QJZA 3VRJB 5AVUB 2GITA 4FHBD 2DPKA 5B1BB 1DQQB 5F6HI 1CIUA 3E1ZA 3LNDA 3KNBB 3BH9A 2X4QA 5AW2B 1CTNA 1JI2A 3S48A 1FNSH 3EYUH 5ICZA 1PG7X 1FLRL 2FQFA 3O3UN 4XB7A 4M7KH 1NBCA 2RA1A 1M3IA 4XWGL 3MRDB 4ZFZA 1BD2D 2ZWZA 3PDDA 4V2BA 1O0VA 2IOMA 2ZQKA 3AAZA 4M48L 1UB5A 2DYPD 2VIRB 2EVIA 5L88L 1FG2A 3MBED 3ZKXC 2F68X 3LDBC 2CR0A 3WIIH 3LS4H 3INUH 4HT1H 4G8FA 2V2TA 5IK3B 5JLZB 2PWGA 4MFHA 2Y6TE 4G59C 4PP1D 4RSVA 4R4FH 4WEBL 3FOMA 1JD7A 2RCSH 3VFUA 1UD4A 1INDL 3JVGA 1XTLA 4P23A 4XP1L 2VW4A 4O2EB 4HS8H 3TWCL 4GS7C 3DBSA 2BNRD 3V0EA 5JMRA 3L81A 4UBDC 2KZWA 4OI7A 4NHUB 3QQ4B 5TFSH 4ZOEA 2RGSA 3V4PL 4A6YB 2UZXA 3FUIA 2ZPKH 5IMLB 1U92A 3ATBA 1LD9B 2DM3A 2IAAC 2MJWA 1S7XB 2OR8A 2FSEA 2VRAA 2E7LA 5I6NA 5D4QA 1A6VL 1IGTA 3ZKMC 3DPBA 4RFOH 1MAJA 5CCJA 1JK9B 3C2AL 4WEMB 3OMNB 5ITFB 3E1F1 1I7UA 1YC7A 3ZL4L 3OSKA 1NCBL 1NQBA 5CLZA 5IBTH 1E5UI 3WG7B 2G75B 4NJAH 1E5YA 2EIEA 4W9EC 1XZWA 4Y2NA 1OANA 3T3MB 4JNXA 4P0DA 2ZOLA 1E9QA 2AJSH 1QLEH 1MG2C 1CTOA 3TFKD 4XHJC 4QHUB 2NY0B 3H6AA 5A7BA 5F1OB 3RB5A 2J5LB 2LFGA 4R7NA 1UCBL 1OQOA 3FZUD 5F88A 5GGUB 2BVPB 3P0GB 3HKFA 3DX0A 4JFSA 3DOSB 1U3HD 2EEAA 2XKSA 3BP7A 4IIQB 1E0OB 3O4OB 4RWHA 4WI2A 1DBJL 4KROC 2WAQA 3OXRA 5GSRB 1CK0H 1HDMB 3MDJA 4GMSH 3WV0A 4MBRA 3T77A 4U31A 5I17B 2FBOJ 2VDRB 1GCFA 3RIKA 1TVBA 2B4CC 4RA0C 2CM6A 5CLXA 2BHFA 3COOA 3LH9A 2AJUL 4FAAB 2ODIA 2Y0SA 3CQFA 3IDIB 5I16B 3BW9A 4Z7IA 4OR1A 1X5ZA 2NW3B 3FUHA 1G4MA 4ODSL 3WIHH 2GHZA 2VZTA 3VWKD 2CCVA 5CGYC 3RZCC 5DA4A 3TBSB 2PXYB 1MEXH 3FB6B 5EC2A 5BRZB 4N8CH 4M5ZH 3BDXA 1UXWB 4QKXB 3GBLA 3K2IA 3VACA 5I5JA 1NCUA 2C3GA 2XY1A 5ALCL 2HSIA 3RVUD 4O4YH 4NP4L 1HOEA 1PYWA 3ARDA 4PGDA 5E6RB 3VSVA 2IGFH 4NKMA 1ZLWH 4ZMNA 4FL4B 2Y06L 3ISRA 1VFOA 3SDYH 4RMBA 1PJWA 4M61A 3MRMB 4P2QA 5CSZA 1MLCA 3LJ3A 3UP1A 4ZX4A 1J5OH 1I9IL 2IPUK 2NY2B 3BDYH 1CO1A 3U7YH 2BSCA 3DVFA 3MMEA 1UENA 3RI5F 4BFIA 1DDHA 3H3PL 3VA2C 3KVQA 4JO3H 3U0TB 4P5SA 4UNIA 3HAEG 1GKOA 1BZ7B 2Z35A 2BK8A 5EBMB 4IEFB 4PG2A 3SHSA 4XXCC 4YAQA 4S0SD 3QQ9D 4PB9H 2Y36H 1HYSD 2VR6A 1PF3A 3QR1A 5ISZA 3H53A 1PBYA 2ICCA 2JJTA 2Z8RA 4P3CL 2WV3A 1XFPA 2Y7SA 3B6SB 3BPLC 3P02A 5TF0A 1ZT7A 4AG4H 5A1AA 3IDNA 3DECA 3W5NA 1G9HA 1HXYA 2X4RB 2HFFA 3B7SA 2DYSB 4J3SA 3RGVB 15C8H 1R3LB 2BSSA 4G43A 2R4RH 4HWBH 1B6UA 2IANB 3F7YB 3E8UH 2GJZB 3ETSA 3IDXH 2AAAA 4JRYA 3S8FB 3SPCA 2YPKB 4BSWA 4YO0A 6FABH 3N91A 4B53A 2PPFA 3QUZB 4OGXH 5DUBA 3K80A 4DPAX 1B3JA 2HWZL 3BAJA 3GMNA 1IGFL 2BP5M 1ZHLB 1MFUA 4JHWH 4WI0A 1Q0YL 5HSFA 4KHXH 2V37A 3SOBH 5CZKA 3WGUB 1SLVA 4AT6A 5HGDA 3KPRB 1KOAA 4JO4L 1KLGA 5MEPA 1KJVB 2B3IA 2EDDA 4HUWA 2Y2YA 4NIKB 1AMYA 5C0IB 5SV4A 3CZFB 1DYZA 2R0ZL 3B83A 3NCJH 4PJHF 5FHBL 5L2JB 4GIPD 1FSKB 3NTCL 3L6FA 1RZ7H 5SWZB 4M6OH 1J05B 4YSDA 4PJEA 5IB3B 1I4FB 4F9LC 5GZOC 1Q1PA 1QUNB 5ANHA 5E8PA 1ZLSL 4ODVL 4UV4H 4W9DC 5HDBB 5J7CC 1WIUA 4TSCL 1DBBH 3CBRA 4MXQC 4UI2A 3MLTB 4DVBA 3MRKA 3KPLA 1HESA 3LIZL 1DSFH 3BWUC 5F9WB 2W95A 2IQAB 3AREC 3HR6A 2WWKT 1MHEB 3QHFL 4GI8A 5D1XB 4QJ4B 3S88H 1WEJL 4OD3H 4ZFGH 4RLDA 1KBVA 1N8OE 3HPJA 4I13B 5AB1A 3RP1A 5C6TL 1KELH 2FQEA 2ED9A 3ZKSD 3UBXB 3SYCA 2AQQA 3OJDA 2R0LH 4KJYA 3STZA 4KXAA 1A1NA 4BSJA 2DD8L 2O6CA 1INEL 1M6OB 4FZEH 4KJWC 5E9DA 1J86A 2FB4L 2KQNA 4N9GB 4EVNB 1IM9B 3PQYD 5AOJA 3R4DA 4AXWA 1KIPB 2ZUWA 1YNKH 1RJLA 4AK1A 1Z3RA 2EEBA 1RZKL 4XPGH 4Y9EA 5IKCB 2ARJQ 4KJPD 3THMH 3NH7L 2W81C 3O2DL 2E86A 4R5TA 4ELMA 4XPAL 4NI6A 4RRPM 5EV7A 1OB1A 2NNFA 1BQHG 3KJ6L 5KVFE 5AW7B 4WHDA 3LZFH 2X2UA 4FXGB 2WB7A 2QMJA 1HEHC 1T1ZB 4HXAL 1OAQH 2VDQH 4V1DD 1LO0H 2V2XB 2HT2C 1J5DA 4A67A 4OKVA 1CR9H 2VDOB 4PWFA 5CSGA 5I74C 3BRDA 2YEZB 4Z8FL 1G5GA 2ERJB 3K91A 4W6YB 3ARWA 1DZBA 1S3KH 5HJ3A 4Z0BH 1YN7B 1TPXB 2WXGA 2CRYA 1I85A 1T5XA 4MMZB 2N59A 3HC3H 2GK0A 2YSSA 3L3IB 2FIRT 1IQDB 3HKZA 4WUUD 5DEGA 2Z8VC 3EOYG 5JDJA 2K6YA 3UTPE 4FHKA 1KY7A 1JHLH 2QELA 4HKZA 3QZWG 1KYOK 4FMKA 2CWRA 5DMGD 3GWJA 3QEHA 5KS9F 4PJHE 2YLHA 2LAGB 4LDLB 1L0XA 5KJ7E 5HDQL 1F00I 4F37K 3EZ8A 4ZAKC 4FADA 4FQCH 3AWEA 5KAQG 1W8EA 3I9GH 1RY7B 3TV3H 4F8TA 4G9FD 4Y5XC 1NLBH 2VXTL 5LO7A 1RK1A 2C3VB 1I1YA 1JMZA 3T4AB 2BZ7A 1X5KA 5C0AA 4WO4B 2CDFB 3DUHA 1VZIA 3SGEI 5HHQA 5IB5A 3EJPA 4KTEL 4OFPA 4YXHL 2Z7WA 1C1EL 3Q2VA 5FHAH 5TE4H 1QRKA 4HWBA 2BHZA 1C08B 2WXFA 1I3GL 4UM8B 3UZVA 1CYXA 4XAKD 4TNFA 1UXSB 4X4XB 5H35A 2V4LA 5FYKD 3EBHA 1B0WA 3MRIB 1E8WA 2VLRB 4ZXBC 2E8YA 4FQ1L 1TLKA 2O5YH 2Z8SA 4AUJA 4PGZA 4BUQA 3WFCL 2XWXA 2GY7B 3CDFA 1UD8A 3FQTB 1BWWA 4XO5A 3CN3A 4UQDA 5FA3B 2IH3A 3T0ED 4DK5A 3CPLA 3LHPL 3NAAH 4ZZFA 2A9MH 3AB0C 4M7LT 4LHUD 4XBGB 4Q9QH 1EVUA 3LKRB 1E9OB 4U1NB 1OTUD 1TJHL 1WAEA 4XX1E 1VCBC 4JFYA 1OCRB 2Z64C 1N59B 3L2MA 4HOWA 5JQIB 5DJ0B 1BIIA 1P5UC 1HCFX 3IMVA 3KBEA 4ZO8A 5DQDH 1WFMA 1IAKA 1GZHC 3IFNL 3O9WC 1D5MB 1GY1A 4R3SB 3RIAF 5E99H 1OCWH 5HHOA 4WSGA 4OZFG 3FYEB 5K9OA 4DTGL 2VH5L 3HVNA 1NGYB 2BMKA 4GAFB 3WNOA 1UH2A 4OLYH 2PR4L 4LSRL 4KTDH 1VKXB 3KPNB 1N4XL 4H0LC 3N50A 2A7BA 4PU2A 3ARZA 4PS3A 3KBPA 3FU7A 3G5WA 4LVOB 4G8GE 2AJZB 5ACZA 2DDQH 2BVQA 3D2UD 3JWOC 4H1LB 5ANMB 4ZK8A 4CADA 5C70A 2HPOA 1U8LA 4ORZC 1Z32X 2UYLB 2QGEA 5EBWB 5CU5A 5DEFB 3GSXA 4G80B 3CHQA 1A64A 3NIDB 3CHPA 3LH8A 4L4VA 4Y9FA 5BQDA 4AIOA 2CO4A 1FP5A 2WCSA 3CHRA 3VB8A 2GEQA 2DICA 2B9BA 3ARPA 5AQ0A 5LG6A 2IEPA 4JFZL 4LPCA 4NI3A 4H0HB 4ONFL 3QEGH 1IAOB 2AJVH 4LFHD 1ES0B 2JB6A 4KTYA 4XNQA 5DJ2A 2I07A 1A3LL 1UXMA 5FYJE 3FNKA 3NJGA 4JE4B 2X6MA 2G5BA 2XWTB 3DYOA 3A6CH 1LO5A 2ATPB 1LHZA 3QIWA 2H45A 2Q6WA 4ELKB 4K3EL 4JPQA 1RU9L 5AOIA 3TIEB 1CB4A 3IWUA 1PL3A 4FNLL 1O6SB 2APFA 3P2BA 2WLIB 4G83A 1D6EB 1OKEA 3WCYA 3KE0A 3MV7A 4LOEA 5AZUA 1LILA 2HUHA 3IK2A 1AE6L 3SE9H 2A74B 2WQWA 3CE1A 3F6IA 3P9LA 3Q5YA 2PCPA 1C5BL 1HX0A 3AZUA 4YR6B 1BV8A 2FTAA 2DQDL