2IAMD

Structural basis for recognition of mutant self by a tumor-specific, mhc class ii-restricted tcr
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
239
structure length
239
Chain Sequence
AGVTQTPKFRILKIGQSMTLQCTQDMNHNYMYWYRQDPGMGLKLIYYSVGAGITDKGEVPNGYNVSRSTTEDFPLRLELAAPSQTSVYFCASTYHGTGYFGEGSWLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2006-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iamD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iamD02
1EZVY 1MJUL 3SPVA 3O8XB 5HJ3A 2VSDA 3U36A 1IT9H 3L9RA 3T1FB 4ZFOL 1S9KC 4QXUH 3EZJB 4C56D 2BXYA 5FEBA 3CXHK 4GRWB 4QCIB 1EO8H 5D7SL 2EIDA 4KGLA 4HXBL 3FOMB 4Z0XA 4N8CH 1UACH 5DJXB 1QFWI 3DSFH 4D0DA 1U8OA 4PJCA 4R2GC 1MFAH 1FFNA 2E3VA 3MOQA 3H2WA 4U05A 2R1YB 1D5MB 1S9XA 4DN4L 2VABA 4IMKA 2FD6L 4FQ2H 1DDHA 3ZDZE 5F1IA 3CIQA 4LASH 1IFHL 2FYYB 1XZ0B 3F7VB 1XMWA 5EZIH 2BERA 5HI3C 2A1WH 5GJSH 1J0YA 4PBWD 1I8MB 5F9OH 1A02N 4PJ5D 3MRLA 3QUXA 3P3YA 4ZTPL 3ZKXB 1TETH 5TPWH 2C7UA 5C09A 2Z31D 3NCCB 1FO0A 2RJMA 3BAEL 1DEEA 3EO1B 1V7MH 1AY1H 3IS0X 3L95A 4C54A 2WBJD 3CFDA 5IEHB 4EN3D 5I16A 1F90L 4HGWB 1KNOA 2AABH 2IMMA 2XACC 4HWZA 2DWDA 3BW9A 5E2TH 1PKOA 3FCTB 4JDTH 5E8OB 1G1YA 4YDIH 3WYRA 1MF2H 2XXCB 1HKFA 1C1EL 3STLA 1AC0A 5DURD 1HCVA 3QH3B 1H9VA 1K8IA 2FB4L 5FYJU 1D5IH 3B5GA 5HGDA 5FDWA 4WWKC 3WNOA 4ZMAT 1QSFA 4XB7A 5CJBA 4YE4H 3T4YA 2Q7YB 4I77H 1NSNL 2A9NL 2P5ED 4LLMA 1QR1B 3JV5A 5KVGH 4HUWB 3VGDA 1BBJA 5CCKL 2R1XA 3CSPA 4Q6YA 3U4EA 2CH8A 1F6AA 3VXQB 1ND0A 2EE2A 1NGPL 5EC2A 3GRWL 5E6IC 4YHML 5JXED 1UYWL 3BDYH 2AXGB 4ZXBD 2Z9TA 5JW5B 3T0XA 3BO8B 5CFHA 1A3LL 3MRIB 4NQXB 5DJDA 4NJAL 4I48A 3GJFH 4RGNB 5IUSA 4LIQH 5ECJE 2XN9D 3QJFB 1NCUA 5HYQB 4MJID 3UTTD 3ZYIA 1BFVH 1II4E 3F65A 3K7UA 4ZFOB 1E4JA 3T4AB 3FRUB 4AEHH 3X17A 2YXMA 2NZIA 2P8MB 2D0FA 4OF7A 4ZNEA 4ZAKD 2IGFL 2VLJD 1I7RB 4PRNB 3WEXA 1ZA3A 4MJ4A 1BVLA 3TZVA 3PGFH 4L3CA 1XR9A 4LCYA 1DLHB 3CCHB 1MHPH 5DDHA 4G80A 4NFCA 3QCVH 1AR2A 2WP3O 1E28B 4LHUD 2FATH 2BC4B 2CRIA 4BSVA 3I3BA 4FMFA 3ME0A 3VXOB 4NT6B 5JR1H 1CFTA 3X12B 4ZFZB 1S7UA 1RQ5A 2IQ9L 1C16A 3MOBL 2C3HA 1J11A 1UFUA 3QNYB 4GRLC 4ONOA 4MLSA 1ZTXL 3RI5K 3TPKA 1NGYB 1ZV5A 4YAQA 1VFMA 1KGCD 4UT7H 3C9NB 5B3NA 4MHHI 4DEPB 1AXTL 1NC2A 4XNYH 2IH3B 5GGRA 4JRXE 4LCWE 2NY4B 4PJ9A 1YYLH 1Z9MA 3CMOL 4HIIB 5I17B 3HLAB 5BZDB 32C2A 2M2DA 4OQ1A 3RPKA 4WHCA 1T89A 4P2YA 3BOVA 2VITB 4LSUH 1KYOJ 3WUWA 4NO0A 3EO9H 4RWHA 3QZWA 1AQKH 1HDMA 4IMLB 4MXQC 5DJ6B 3F58H 2X4RB 3CJJA 1I3GH 4Q9QH 3QYCA 1IEBA 3HPLB 4XNUH 1QSEB 4QOKA 3MUGA 2SEBA 1I85A 2LABA 3RBSA 1UQSB 2AEQL 5JW4M 1CXEA 1E27B 2W9DL 3OQ3B 3IYLW 4XNQB 2I24N 3S9DB 4XZUA 2MTPA 2EEBA 2XXMB 1EFXB 3VW3H 2CDGA 5KVFH 4CW1B 2CQVA 1L7IH 3QIBB 4JHZA 4YGVA 3VXTB 4CVZA 4MDJB 4JGUA 4NO5B 3LS5H 4NHUB 3SDXE 2Z92B 4M7LH 1A0QH 1PZUB 3ZDZF 3M17A 5BV7H 5F7EL 5GRYA 4GW5B 4MA7H 1A8JH 3LEXA 1U8HA 1H15B 3MRDA 4O4YL 3CPLA 4YFEA 4RMWA 5D1QD 5DJ8B 1K3ZA 1INQB 4M6AA 4NQDB 4F33A 5EFIA 4U1GC 4OCXL 2ADJB 3Q2CA 4PJ8C 2WV3A 4G3YL 3VI4E 5D96C 1B90A 3IB4A 4LP5A 3REWA 2XZCL 2WNGA 4WFFD 5EG6C 4Z6AT 3RTQB 2D7PA 1CF8H 2QHLA 2OZ4A 3U79A 4WUUD 2VZ1A 3KDMB 1CL7H 4RMRA 1IAOB 1P9MC 1UA6L 1PY4A 4F9LA 1LE5A 4ZQKA 5D72H 1AGEA 4Q6IC 2Q20A 3OGOE 5JLZA 1EK3A 1N4XH 1FORL 3G5YA 3L6FA 3QXAA 4PJEB 2IC2A 4PJIA 3ARDB 4GBXA 1ZHBA 1BLNA 5MENE 4JM4H 3QWRA 5ISZA 4L4VA 3QPXL 4TNWF 5EBMA 3MJ7B 2B1AL 3V0VA 3EYSH 4Y4KC 4MA3B 4Z76B 3WFEL 4Z7UE 4YBLB 3GSRB 1DR9A 2V2TB 3NOIA 4NNXA 4OZHB 3SKJL 5HD8C 3O4OC 1U8NA 2XFXA 5HYIA 4X4YA 2YPLE 2OXGA 2FWOA 5SWZB 4K23L 4PP1C 4EIGB 3KJ4B 5D2NC 4JDVA 4I0PA 4UQ3A 4XRCA 1HXYB 4KKBC 3QPQD 4KC3B 4XCYB 1I8KA 2AERT 3DOSA 3HE7B 2VLKE 4YNYA 2VOTA 4P23A 3CH1A 2ED8A 1Q9LB 2OP4H 3WHE1 3G6JE 3MA9H 5EOCL 2BVQB 1X5AA 4H1LA 4PRPB 1I7UB 4UQ2B 3QXTA 4HDIB 5SX4H 3FO0H 1FYTE 1D9KC 1ZT1B 2VZTA 3DPBA 3WNKA 4LAJH 3IKCA 5CJQL 2R56L 1JZ3A 3SOBH 4N0UE 4QRPA 3VFNA 5LKNA 4HGKC 4JY6A 3TYFB 1G7MA 5BVJA 3HNVH 4IS6A 4YDLC 4WCYL 1S8DA 2BNRA 4HIEB 5DA0B 5FK9B 3ARFA 2VAAB 4Z7WB 5FYLD 4BSWB 3QWQB 3GMOB 3NGBC 1BECA 1RJLA 3NAAH 4YPGB 4R97B 1YEEL 3BX7C 3IGAB 2EE9A 4PRHA 5DMKB 5I8CA 4GRWE 1RULL 3LPWA 1G6RH 3LZFH 3PV6A 3EYUL 1M7XA 3OKOB 3LEVL 1Q38A 5IB2A 1RIHL 1R3KA 3DVGB 3VD3A 1VPOH 3Q6FA 1F97A 2YN3A 4LU5H 4J3XA 5E03A 3SDDC 5E2JA 3H0TB 5F96L 1DSFL 1W2KT 5DJAB 1LEGA 1F4YH 4FQQA 1TQBB 5C0RL 4HFWB 4EI5B 4CDGC 2BOCB 1T1XB 2VLLA 5IWLA 5L8KB 1WFTA 1RIUH 2GUOB 2FHFA 5BVPH 1ODAA 1F02I 1P4IH 4BQCA 5I66A 4I4WA 3FB6B 3SGDH 4G8GB 5I1DA 5I1IH 4DZBB 5GHWH 4UV4H 4RAVA 4NRZA 2BRQA 2BHYA 3BD3A 5DD5L 5FFLA 4LCUB 3NABL 3T0VA 4F7CB 2AJXH 4L5FL 1AD9B 1RUAL 4QY8B 4E41E 2NNAA 4XNMB 3MCKB 5C0DA 3KPTA 4IRSC 4NM8H 3SDXF 4GS7C 3D85B 4ODHH 1U2HA 5E5UB 4RFEB 4Y4FC 3OKEB 1WCBB 1G84A 1RZ8B 3D3VA 2FBJL 3T2QA 4B50A 4GAYB 2VDRH 4S1SH 4MAUH 4MD0B 4P2OD 3B4NA 2F54D 5L2KB 1A1MB 3VFTB 3VI4F 1NGXA 3KLHC 4P9HH 3PWJB 2R0KH 5D4QA 4MVBC 2HMID 2P45B 4PG9B 5L6YH 3GUTA 2OXHA 3VGAB 5L8LB 4N1EA 5TE7L 2R69L 1BF8A 4HCRH 3V6OC 4PRBB 3DWTA 3MCG1 4JFXB 5TFSH 5I76B 4HXAL 4PJAB 1ZGLA 3T8XA 5EU3A 4YEFA 4WV1B 3T0BA 2OM5A 5IEKA 3QULB 4Q74A 1JTTA 1UC6A 1YMHB 3FQUB 3GSQA 2APVA 4XP6H 4I0PD 1JCKA 1QO3A 1A47A 4QHLA 5C0BD 3V4PL 2NXZC 4LAQH 1P84J 4Z7UF 5T5NG 3LMJL 1NLDL 1WC7A 4LCIH 2VMFA 4PS4H 3GSXA 3IU4H 5F72S 1LEIB 1QOKA 1R3LB 5CBAA 1XF1A 3FZUD 4KVNL 1JN6B 1JRHI 2OJEB 1N64H 5H2BB 3V0WH 1GGBL 4XAWH 2FNBA 3GJEA 4NN5B 3OXRB 3SJVA 2H9GB 4TRPH 3EFFB 3JV6B 5GZNC 2EH7H 3PP3H 3MRQA 1SBSH 1CG9B 4B5EA 3RWHA 3LQZA 4PV9A 1NDGA 3QIWD 1AO7D 3GBMH 3PNWB 1EBPA 2OR9L 4Y2DA 3KPRB 3G6JF 2IANB 2HJFB 4YIQA 4Y16D 3S6CA 3WN5B 2VLME 4QHNB 1ZLWK 4YXHH 1JYXA 1LD9B 5IVXA 5LXGH 1B4RA 1OB1A 4U0RC 2GSGA 1QFHA 4O2FA 4L8BA 4I2XA 1N8ZA 2K3TA 4NP4H 1CS6A 1A7RL 3G9VA 2DKMA 4X5XB 2EXYD 4QTIL 3LS4H 4JANA 1A7PH 4KJYB 5HVHC 3JVGC 1F4WL 1GOGA 3O11A 5T1LB 1NGQL 1NUDA 3O45A 1Q72L 5L9DL 4NKMA 1QSEE 1QLEL 1LK2B 3CVHA 3M1BB 4MD5A 5B3JE 2EDHA 1IGIL 1CT8A 5IW1B 3SDCD 1FSKB 4GRWF 2FR4B 5LJYH 3H42L 1JGDA 2IFGA 4HKBB 4GSDH 5GGSB 4OGYL 5FA4A 4B7IA 2F74B 2ITDB 1HXMA 4OLXH 1INDH 4UAOB 4KAQH 1K2DB 4MDIA 5DHVA 4ETQA 3R1GL 1NGZB 3WXWH 4WVRA 1VACA 5JO5B 2JJVA 3GSNL 4HWBA 1J8HB 5IF0B 4MCYB 2VRAA 4ZPTB 1F4HA 4ZFGL 3VRIB 3WLWD 4GKSB 1F3JB 3BKYL 1T1YB 4EUPH 1JHKH 2DQFA 1ZA6A 1FL6A 4Z8FL 5DT1L 1QFWH 1KLUA 4NQDE 4X9FA 2FL5A 1OTSD 1U91B 4PTTB 2VIRB 3BIBX 4EKXA 5CILH 3T09A 4TPRH 3WIFB 1ZVHA 4QGYA 3OZ9H 4GQ9H 4G7YH 3P4MA 1HHKA 4HMEA 4P2QA 2VWEE 4JRWA 3WNMA 5LGHL 1LILA 3RVVD 1NCAL 1D5ZA 3P4NB 1DQQA 1CDBA 5I1EL 5DK0B 5GIRA 1X6NA 5IBUG 1GPOL 4NQSA 4PJEE 4FG6C 4YWGH 3DGGA 3QUYB 4HMCA 4QRQA 2NY1D 4NUGL 3UC0L 5CGYC 5CP7A 2DL2A 3DX7A 1O0VA 5HHOE 2C1OA 4OZ4B 1XIWB 4FFZH 4YX2H 5FV2A 4P5MB 2NY5H 4LVOC 4OZHE 3VD5A 3P77B 3SO5A 4WWKA 3VXUB 2RFXB 2YUWA 2BSRA 4HIJA 2V17L 3TVMB 3RAJH 1Z3GL 5F88A 3HA0A 3HRZA 1DZBA 2PF6A 4M61A 1INEL 5I19H 1RUML 3UPCA 4EDXB 1OAKH 4TSCH 5SWZE 3GMNA 3O3AB 3I6GA 1IC7L 1BQUA 5EN2B 3HZKA 3C5ZB 3ARBD 5IESH 3MLSL 1R3HB 3ZO0A 2WBWB 1RJZB 5HYJD 5E6IA 1GOHA 4M62H 5D8JH 4P5TB 3QI9D 3D6GA 1QRND 4FXGB 4DKFH 3LN9A 5KJRH 3INUL 3LHPH 1Q9OA 4Q58C 3U7WL 1MREH 2V5TA 2QL1A 2W0FB 1U8LB 3QO0B 4XAKD 2DQHL 1IC5L 2X40A 1BX2A 5T3XH 3WS3A 4OZFG 2X7LB 1HI6A 4MMZC 2P47B 3GSNB 1J8KA 5EUOB 4JFDD 4JO4L 1Q0YL 3OJVC 2HT2C 2Q8BH 1WCQA 3D5OF 3RVXC 4WI7A 4PV8A 3MGTB 2APBA 2X4SA 3MA7B 4K71B 1ACYH 5ADPL 3VFSB 2APTA 3OR6B 3W39A 4AH2A 4PG2C 1CYGA 3QEQA 3BEWA 2IAMD 2GTWA 1NBQA 5BRZA 1WWWX 4U3XA 1RZGB 5C0AB 5C07B 1Y6KR 5HGBB 3CXHJ 5FV1L 1GGTA 3GJFA 4HUXA 4P2RA 4KKLD 1T3FA 4U6XA 2A83B 1CDYA 5D1ZD 3ZMRA 1TVBB 5D7LB 3O3BB 1BVZA 1IEHA 4OLYH 2E27L 4RGOL 4W68A 5JOPD 4F7EB 3FONB 5ALBH 4UINH 1MFBH 2PXYD 5EZOH 1OSZB 4JZOA 3DX9A 5B3JF 4ZDHA 3D2UA 4J3OC 4G8GE 1GGUA 5I30H 3CNKA 3NN8B 4P3DB 4HWEH 5ETUB 5DMGD 3ZTJG 5IT2L 1UGNA 1GVIA 5ICZB 5IW6B 4H88H 4IOIA 4C56B 5B4MD 5FUCE 5E94A 5T3ZD 1GIGL 3RWDB 5E8PB 4D9RD 2DI7A 3V7AE 2BSSA 3G5XB 4KDVA 4P57A 1JHTB 3T0EC 5SWSD 4K3GA 2VDLL 3DX8B 4NWTH 1U92A 1TQCC 3MFFA 4MA1B 4X7TA 4UTAH 2ADFL 4K9EL 1QNZL 4YBQD 4Y89A 4JG0H 4U6YB 5I1GL 5L2KE 4C4KT 1VFBA 3DUUB 1CIDA 1PW3A 3IJHA 5GGVY 4LHUG 4Q9RL 3RVTD 1U8IB 3U4BH 5HYEA 4U1SB 4OD3H 4PJ5B 1ZLWH 1OCWL 1JMZA 4M1CD 3GKWL 1QHOA 2DQIL 2YEZA 4CN6A 4K7FA 2YD1A 2Z31B 2Q86B 3S34H 2NW3B 2V5YA 4J3SA 3BD4A 2G75A 4G8IB 1U2CA 4PJAE 4DKDC 3IDNB 3OPZH 2WBJB 4CUCA 1ZHLB 3T2NH 5CJOL 1JNNL 4JCMA 4UUJA 3BE1L 1P9MA 2F53A 3SQBA 4PJEF 2O93L 2CR3A 2WINA 2JIXA 5CLTA 3WDHA 2DBJA 1B2WL 3QR2A 5IFJA 3KYKH 1I1AC 2Y06L 43CAA 5IIEB 2FIKA 4MNQA 3KPMB 2FJFB 1MNUH 4LMQE 1OLZA 3RU8H 1BFTA 4UNVA 1IL1B 5JQ6H 5HVGB 1M4KA 1MI5D 4ODWA 3WKML 4G6ML 1IZKA 3RGVC 1MFCL 4DGYL 4A2LA 5FM5O 5E99H 4CBPA 4OZHF 2W0LA 1L0XA 1FL3B 1C5BL 4JY5L 2P5EB 4Y1AA 2FRGP 4KZEH 2GT9B 4Y4KA 5C6TH 1QSZA 2VZOA 2VB5A 2V6HA 4LSTH 5C0JA 4LKCA 1L7TL 3CZFA 5ADOH 1A4KA 2YMXH 1YPZA 5C0IB 2X09A 3OAUH 1MAMH 4ZXBB 1KCRH 3WHXA 1YYML 4ODXA 2WUCL 1JPFB 2FSEB 4H26A 3QNXA 4RRPG 1KIRA 1BQHG 1AHWB 5L8JB 4JAMB 5D2NA 1S7SB 4YDVA 5EU7E 1BF2A 4A2MA 1FNGB 5C0CE 5IBLD 3KPRE 3C08H 2EC8A 1OGTB 2OX5A 4TSBH 1I8LC 5ERWA 1UJ3C 3PGCA 4MJIB 4TNVK 2XT1B 4DKEH 3UTSA 4DVBA 3I75A 5C0NC 1MCNA 5C9JB 5EB9A 3RIAK 1YNLL 2R29H 1FJ1A 4JFQA 4GRLD 1VFAA 4GRMA 4MNGB 4XTRD 2PYEB 4ZAKB 2DI9A 2J5LC 1UH2A 2AP2A 2OL3H 2VLJB 5HI5C 2JELH 4XH2B 5LCVH 1D9KA 4OF8A 4DZ8B 1JI2A 3X14A 3BZ4B 5D6DC 4N0CC 2M8XA 4J3UA 2BNQD 3BUYA 3P4OA 2DQJH 1TZHA 1AFVH 3GSOB 5DFVC 5E9DB 4LLYA 4XP4L 4NC1C 3H9ZA 2ZUWA 5E6YA 4HKJA 1UXWA 4LKXA 4ZUWB 2YD9A 5LVEA 4HJJL 3IRZA 3TNNA 4FA8A 3RWIA 5SV3A 1QA9A 5IMKA 5EA0L 1U95B 3SPVB 4FQJH 1NFIA 5LBSL 3O3EA 4MSWB 1OSPL 1BOGB 1QBML 3R06B 5HHMB 3U36B 3L9RB 4HIHB 2BMKA 2WIIA 4ZUVA 2HVKA 2MKLC 4GXVL 1HSAA 4YHNA 1AGFA 4J23A 4AQ1B 5KN5B 1J8HE 4Z0XB 4EZMA 4X6DE 2IF7A 2APXA 3VA6A 3IAPA 4PTUB 4MWFA 4KJQC 4HV8B 2BOBB 1S9XB 3IFLL 3QFJA 1KTKE 3VFOA 3SDDA 5ELIA 3MV8D 1DDHB 4IM8A 2CK0L 2X4UB 3Q48A 5F1IB 3SCMA 4N8VG 3TJHD 2EDLA 2V2XA 1CD8A 4EOWL 1S7XA 1FL5A 4LDEB 2EDBA 4D3CL 1WBYB 1NMCB 4DTGL 2YWYA 4RMTA 4KI5E 3IJYB 3MRLB 1WBXB 1KTDA 4LQFH 4YHPA 3PP4L 4NGHL 4PJ8D 1FO0B 4OI9A 5HI4C 3L95B 3IFPA 1Z9LA 4JDZA 3CFDB 3FRPG 3X11A 4OZGA 1IGCL 1NH6A 5FXCH 2F53D 43C9A 2DMCA 1G6RA 3KYMB 4IRSA 1HQRB 1DL7H 2P1YA 5KW9L 4XHJD 2ICEA 5F89B 4MNQD 1BVKA 3BXNB 5D1QB 4H8WL 5DJCA 4Y4FA 1G7PA 3STLB 4FNLL 1A9EA 3EJJX 5FYLL 3QFDA 1K8IB 4UDUA 5IBTH 1YNKH 4NJ9H 3VXUE 3DVNB 2ZCLL 3BKJL 5HGDB 3FOLA 3VXSA 1QSFB 4UDTA 1ETZA 5TE4L 3RIFF 3UP1A 4QXGH 2YPVL 3KJ6L 4PJAF 4XPGH 3MJ8A 4WUUB 3WFBL 4LLMB 3ES6A 3MROB 1BBJB 4IRZL 4Y4KD 3LRSB 5T1DH 3ARXA 1A6UH 2XTJC 3V6OA 2IJ0C 1E0OB 2R1WA 3LSOB 3U4EB 3N85L 2I27N 1SYSA 2VNCA 1LO3H 3AVEA 4OAWA 1EMTH 3QXVA 2QR0A 3CFBA 3VD9A 4EQ2A 1S3KH 4N8PA 1ZSDB 4XBGA 3O6MH 5I15H 5DJDB 4J7RA 4MXVE 5EIIA 3QQNA 5B38A 3VWJC 3DBXA 2EIZA 3VXMD 1W0VB 2IPKA 3CDYA 1NCCL 1HEZB 4HH9B 4YO0B 2JE8A 1ZEAL 4U6VH 1T21B 2XQYK 4GW4B 3RNQA 5EZLA 4V1DE 1UM4L 4ZS6C 5F9WB 1YEDA 2RBLA 1OTTD 3ARRA 5EUOE 1S7RA 1KBGL 3UPRA 5MHSE 1OTUC 2LV4A 5DHXB 2DWEA 3VFRA 1ZA3B 1GAFH 5FYKL 1B0GA 1LO4H 5K59E 1IKNC 1PZ5A 3V5KB 2RHEA 5DDHB 4G80B 3FT4B 1EJOL 3AS1A 1DQJB 5EU4A 3V0AC 4EDWH 2YBRB 1OVZA 5JQHC 3G9AB 4WUKL 3KPNB 5C0AE 4DAGH 2G9HB 1PYWB 5C07E 3VD7A 1FCGA 2N56A 1IE5A 4LLDA 4ZPVA 1JNJA 3CC5A 5K9QI 1KCSL 2Y36L 1FRGH 4R4FH 3ZHDA 1R5IB 2VLRA 1A6AA 4P4KC 4PGDA 5GGRB 3ULVH 2R0LH 4I0KA 2UY6A 1QBAA 1A22B 5DK2B 1N2RB 3HAEG 1CXFA 1PSKH 4JGMA 1NEZG 4Z7NE 1MHCB 1FNSL 2Y1VA 2QHRL 4UMGA 2ZUSA 3DYOA 2V5MA 3BRGC 3O2VL 4NO0B 3MO1A 2ZG3A 5DC9B 1RVFL 2B4CL 5J11B 3JVGA 5JHDD 3UO1L 5JMOC 4UTBH 3L3HA 2G60H 3UJJL 3MLYL 4RFNC 3PJSA 2UZXB 2R2BB 1IEBB 3O41A 5GQBA 4NC2B 4APQC 5EOTA 5F7UA 2HTLC 1T22A 4QXTB 4UBDD 4C56E 1CXIA 4QOKB 2P7TA 5TGBA 3UX9B 4IRJC 1CLYH 4EI6A 1BZ7A 2K9UA 4M48L 4XZUB 1OF2A 1XT5A 1GOFA 3EYQD 4X6DF 1BMGA 1EV2E 4DVRH 5EORL 3MXVL 1V7NH 5HDLA 3Q1SH 4YGVB 3W0WA 4HKXA 3O8XC 2DQGL 3ULVC 3M17B 5KG9B 1HNFA 3DVIA 3EOAA 3WL9A 1U8HB 3CPLB 4URTB 1MQ8A 4X0KA 1XAUA 1BOYA 4XP9L 3MNWA 1C7TA 4KI5F 5CEZE 4AZ8A 4X6FB 5FO7A 5E8DH 3WE6B 5GS1C 4R0LB 1XGYL 4NO3B 5MI0C 4OF0A 1HKLH 4JFZL 1Q0XL 3A67L 3UJTL 5J7CC 1JIBA 5I1HL 2A9MH 5CGMA 5I18H 1WFOA 1RHHA 4K07A 5ACMA 4ZQKB 4RZCA 5FF6A 3D69A 1IC4H 4JEGB 2XA3A 3S35H 3ZKXC 1AGEB 5D2LB 3G5YB 2N1KA 4K94H 4DWHA 1AIFB 5TDOB 2YC1B 3LEYL 4PJIB 4GBXB 2CLVB 2F54B 1BLNB 3MUJA 3V2AR 4W4NA 3H3KA 5ISZB 4L4VB 3H9HA 4ZUSA 2P5EE 3EKCA 3OHXA 4U1KA 2X10A 3V0VB 1FE8H 5FECA 1CBVL 3CDCA 3ARUA 2VDML 1X44A 4OLZH 4DGVL 1MJUH 4NNXB 1BPVA 3I6KB 3TEUA 4EVNA 2DQEH 3CLFH 1U8JB 2CXGA 4XXDB 4WU5B 2A0LC 3AS0A 5HYSG 5BQ7B 2KQNA 4G6JL 3D39A 2NPLX 1MPAL 1BZ9A 4G9FA 4I0PB 4MXVF 3PXJA 4LSRL 5FHBL 1PLGH 1I8KB 3EDJA 5C0BB 5LG1A 5F7WC 5J56B 2PW1A 5F3BB 1LNUA 5T1KD 2DM7A 1IFHH 1VCAA 2IMNA 4LDOB 2X4TA 3C2AL 1A6VL 2OYPA 4MNGE 5IB3A 1R5WA 4XC1H 2XTLA 4WNQB 2PYEE 1FAIL 5GXBB 4OLVL 3C6LC 4XVUC 3KWWB 5E95B 3BQUC 4OQTL 1OP5K 5EUOF 1XGUA 2J4WL 4DUVA 4RGNC 4XT1C 3UTZA 4OKDA 3IKCB 1T7WA 5IB5A 3BAEH 4KWUA 4FFVC 3RKDC 5IMMB 3NPSB 5E9DE 4DCQB 3MQIA 5K59F 2COQA 1FYHB 3OKDA 4HT1L 5BVJB 4HK3J 4IS6B 3P11L 4MXWH 3MRGA 5L2JA 3WD5L 1FP5A 1S8DB 1MRCH 3QIWB 4TTDC 1AO7B 4XP5L 3HI1A 4HMDA 1P2CB 2Z8SA 5HDOA 1KGCE 3NCBB 2Q7NA 5HHME 1C1EH 5CZVL 5J6GB 3O6FD 4Y16B 3Q5OA 4PG2A 4BZ1L 1MRDH 4WI3A 3F5WA 4G6KH 1NCNA 2FB4H 3B8SA 4BQ6A 3MRHA 4ZYKB 2YS4A 5C71A 4K3DL 3TN0A 1HHJA 3B3IA 3O6KH 5F1SA 2A9NH 4U2ZA 2QKIB 1CIUA 3L3OA 4Z7NF 1J1PL 2DLIA 3LB6D 2XWJB 4UIMB 5JTWA 1CGTA 1LEGB 4FQQB 5B39G 4OCLC 2DOCA 4PGCB 4U33A 3R8QA 5GISL 4GW1A 5KVDL 4Q97A 2ZWLT 1FVEB 2MPAL 4YHMH 5IHZA 5DEGB 4P46D 3SDCB 1MVFA 4YHYB 5KSAC 1RZKL 5HHVL 1VGEL 2P24A 5IJVA 4PGJA 4TVPE 5C09E 4OI8A 5I66B 5I1DB 1L0QA 1PQZB 4RAVB 4DKAA 4HWUA 3G5VB 3RDTD 1S7QA 4BZ2L 3SDAD 1PEWA 3FQRB 4B41A 1KJVB 4XBEH 25C8L 3OXSA 4YLQT 5C0DB 4EJ1C 1JGVH 5KSBA 5C2BH 1G9MH 3LKRA 4L8CA 1GRWA 1FVDA 3T0EA 4XPAL 4QTHA 3UBXG 4OTXH 3D3VB 3T0WA 1FLRH 2R4RL 1NFDB 4LNRA 3VXRD 3MOAH 5JW4R 5LWYH 1QSFE 1AD0A 1MIEH 1L0YA 4KRPD 2KDGA 4WFFE 1I4FA 3BKCH 2HLAB 4Z18A 1KIUA 1NGXB 5EBGA 3B9KC 2AV1B 1MCEA 2GEEA 3U2SA 4WUUE 3RNKB 2D4FA 2F58L 5BO1H 3EDDA 3PIQB 4P99A 3RZWA 3GUTB 3MOBH 2Q76B 5I1KH 1TJGL 4AL8L 2D2OA 2DYPD 5MP6L 3KS0H 2GAZA 3NZHH 1I75A 5GS0H 5EU6A 4LF3B 1EGJH 4LLAA 3CMOH 5F1OB 1WFNA 1I1AA 4NKQB 1G9MC 2NY0C 3NFSH 4I9WE 5AYQA 1CZ8H 4R8WL 1R0AL 2H6PB 4YHZH 1EHXA 2VWEC 5FO9B 3O0RL 1MEXL 3QO1A 1OGAD 3PWLB 1W72A 5KSUA 3ZKND 5DQJB 3RGVA 4F57L 4UT9L 3PG2A 1WC7B 2NW2B 4ZNEE 5T3ZL 1Z0NA 3GSXB 3CK0H 1FNLA 1FCCA 3ARDC 1KCVH 1NAMA 1RV6X 1B0RB 3ILQD 4FZ8H 5C92A 5CBAB 5JIIA 1HHHB 5JIKA 3LKPB 1IT9L 3S3JA 5EOQH 3QXDA 4QXUL 3JV4A 3SJVB 5HYJB 4X99A 3L3DB 1EO8L 1FLTX 3QI9B 4NKDA 5FGCB 1AI1L 3PABA 2NZ9C 4KDWA 4HUUA 4N8CL 2PTVA 1ZT7A 5DRXA 3VWKD 1BREA 4S0TD 3DSFL 3RBGA 1LK3H 1MFAL 1XF2B 4LLQB 1JTPA 3EOYG 1A9BA 4TN9A 3T3PE 2FGWH 3EJYC 4O4YH 5GJTH 4FQ2L 1U8KA 4YIQB 3KPOA 1I8LA 1UJ3A 4BFGA 5DC0A 3KJ4C 1KPRB 2R2HB 2ARJA 4OIIH 4OCXH 4PGZA 3F7YA 1WGOA 1OP9A 2A1WL 3TFKC 3I6LD 1FNEB 1GGCH 5C1MB 1OB1B 3QEGH 3WFZA 5HVWA 3PQYD 2GSGB 3HE7C 5F9OL 4O2FB 5BXFA 4L8BB 1B9ZA 4I2XB 4JFDB 4HZLB 4R4BB 4PD4K 5TPWL 3VRJA 1VEMA 1VGKB 5D6DA 1V7ML 4JN1L 5JPNA 4MQ7A 3O11B 2V9QA 4OGAC 3NZ8B 5T3XD 2NTFB 5I1JL 5GGTL 5FUOH 1FORH 4NKMB 4D9LH 2EH8H 1KG0A 1IAIM 1R6VA 4QOKE 4MD5B 2KUTA 4Y19D 2MQ3A 2AABL 3RQ3A 3MGOB 2I5YH 5E2TL 2HFTA 4YDIL 2H2SC 5A3ID 2JCCB 3EOTH 2YR3A 5I75B 1MF2L 3F6LA 2GJ6A 4WU7A 3UTPD 4X4ZA 1HXMB 5D1ZB 5B8CC 4JO2L 4WEUD 4L9LB 4DK6A 4LFHD 5DHVB 1FFOA 5LAXB 5D7JD 1VACB 2ATKA 2AJZA 1IGJA 5TQ0H 3IXAB 2OBGA 1SBBA 3BIKA 1H8OA 3PHQA 4I77L 4U6HB 2AEWA 1MVUA 4R2GB 2FJGA 4AENA 2PXYB 2DQFB 1NMAH 2AEPH 4TSAH 3ROOA 3O3DA 4X6CA 5I73C 5H94A 3RL1A 2HTKD 3S97C 5D93C 3BDYL 3OAZK 5FGSA 1OP5H 1CLZH 3MNZA 4LCWA 2EYSA 3NVQA 5HXMA 1TQBC 2PYFB 5J12B 4KQ3H 1TZGH 3P4MB 4ISVA 1HHKB 5BMFH 2ZSWA 4P2QB 1N6VA 2NX5D 3G6DH 4CU6A 1P7QA 4S10A 5FYKE 1ZHNA 4EIZC 2V7NB 4G8EA 2ENSA 4BH7B 1BFVL 2CKBA 2W9LA 4NM4H 3U1SL 1JWUA 3ZYOA 4AEHL 4CJ0A 1ONQB 4HZAA 1U3YA 4QRQB 4FFYL 4PJIE 5KS9A 4MJ2A 5MERB 2WP3T 3LKOA 4JLRB 2GY5A 1AGBB 2YHGA 3MLVH 5CP7B 5ISZE 4L4VE 3DX7B 2DQCL 2W91A 1A1OB 2FO4A 4WCYH 4HKZB 5E8EB 5D7IA 4LHQB 1XGRB 4M7KL 3WXVH 2ITCB 1MHPL 3QCVL 4WWKB 2FATL 4JM2D 2MQCA 4Q2ZA 3HMXL 3ARPA 1YEEH 3BWAA 5JR1L 3GM0A 1G6VK 1RULH 1JUFB 3BN9C 4LVHB 5IB4B 4MB5A 3BMVA 1IGFL 3SO3C 3LEVH 1GGIL 4TNWK 1I3UA 3HCVB 4ONHA 3IDMA 4UT7L 2HVJB 4F7TB 1IM9A 4XNYL 4OM0H 5C0BE 3OKKA 1UZ8A 2PN5A 4ALAH 1YYLL 2BJMH 1KJMB 5KOMC 1MI5B 4OBSA 3LKQB 1MCQA 4ELKA 5CSBA 4X8XA 4WV1C 3VWJA 3MLWH 3LCYA 2R15A 3DIFB 4ODUA 1DQMH 3MJGX 3MLTB 4IHOA 1QVOA 2CDEB 4ODTH 1WLHA 1T7XA 5TDPB 2DM4A 1AQKL 5IVOA 3VXNA 4F37F 1F00I 5DVMA 1I3GL 1BX2B 4MQTB 4Q9QL 3DO7A 2DDQH 3C8KA 4OCYH 3BPOC 3NABH 3VGEA 1NAKL 4L5FH 2YN5A 1TPXC 4KHTH 4WO4D 2BNRE 4NQVA 2HFGH 4Y8DC 4PV8B 1IKNA 1H3GA 2X4SB 3WDIA 3VW3L 3N0PB 5KVFL 3FB5A 1L7IL 2XKNB 2VXQL 3LQMA 5DRNA 3T3PF 3W39B 4M7LL 1A0QL 2GTWB 5BV7L 1VADA 4NN5C 5BRZB 5F93C 5F7HA 5ID0B 4MA7L 4GRLB 3GJFB 3H9SD 1E4KC 3SE9H 4P2RB 2YPLA 4YGAB 2FZ3A 3EGSA 3TBTA 5TDNB 4N5ED 3T0DA 5EU7C 2X42A 2ZCKH 2VERN 5F7DB 5TE7H 2R69H 3HZMA 3RVWD 2BNQB 3N1MC 2XPGA 4HXAH 4EXKA 5IM7A 4N9GB 4XCNA 1CF8L 1CL7L 2EYRA 1HWGB 3HE6C 4M43H 3BH8B 3AROA 2VL5B 4G6AD 4QF1B 3G6JA 5CJ8A 3PL6D 2A6KB 4ZUUA 2GW5A 1B6UA 3D2UB 5JNYA 1X4ZA 3E2HB 3FN9A 4KK5C 2BFVL 3BP5A 4NN7C 1N4XL 3BZFA 4NIKB 4APQA 1OAYH 2FJHA 4N0FB 5ICXA 3GI8H 4YBHA 1FG2A 4IOIB 3RX5A 1RK1A 3CZJA 4HW6A 2HFEB 4IRJA 5E94B 4JM4L 3ZT5A 3VH8A 2X89D 1NLDH 2CUMA 5TE6L 1CFNB 1QUNA 1KN2H 4P57B 4JRYD 3EYSL 3CDGB 3D3VE 1NGWA 2R2EB 1U92B 3MFFB 1NFDE 4X7TB 3O8XA 4HJ0D 1ZGLM 2ESVD 5I1AA 3T1FA 4UAOC 3LKSB 4TULL 5IFHH 2HRPL 3A6CL 4K8RD 4JGJA 5GRZA 3UYRH 2L0DA 3FOMA 3I2CL 5DJXA 1FIGL 4AJ0A 1G0DA 3IU3A 1NCDH 2UY7A 4PJ8B 2R1YA 2OR9H 1D5MA 1DLFH 4GAJL 1JBJA 3AMLA 2FX8H 3V6FB 3M8OH 4XPFH 4RA3A 1P5UA 3W81A 1CGWA 2FYYA 2F8XC 1XZ0A 2F53B 5E24E 5IFJB 2NYYD 4PJIF 1I8MA 2XTJD 43CAB 2FIKB 4MNQB 3RWJB 3FO0L 3VDBA 1I9JL 3GM8A 2F8VA 4Q6IB 4WEMB 1BIHA 1I1YA 3HG1D 3SOBL 5GGQH 2L4OA 1YC7A 4QTIH 3RZCD 3MJ9A 4I18C 5BV7B 3HNVL 5L9DH 3AS3A 3VWJD 1RFDH 3IXTA 4Z5RA 1QLEH 5IEHA 3NA9H 3QUZC 1FV1B 2GY7B 3D0VA 1IGIH 1YMMD 4Y4KB 4P2CG 5EBLA 1QYGH 5E8OA 3OJMB 3NAAL 1J9CT 4LEOA 4MJ5B 3WNLA 5C0JB 4LKCB 4GH7B 3CZFB 2A77H 1A4KB 3SJVE 4MNHB 3QH3A 1YPZB 3C60D 3LZFL 3WHXB 4J2XA 5CD3B 3FB7A 3GSNH 5E7FA 1K9TA 2Q7YA 3OAZH 5D2NB 2DS4A 5KSVA 4FQCH 4LU5L 1QR1A 3VXMB 4HUWA 3O2DA 4KROD 1AC6A 4YFLI 5DT1H 1UENA 2H8PB 4NRYB 4WHTB 3ZKMD 3MLZL 3C5ZC 5J3HC 3RRQA 3VXQA 1KIPA 3TGXA 5IVXE 1BHGA 2AXGA 3VFVB 2VDKH 3PDOB 5JW5A 4P5TC 5HHPB 4KUZH 1VFAB 3BO8A 1RIUL 3C6LA 3MRIA 4KJWC 4I2XE 4JFDE 1C12B 2IBZX 5BVPL 3BQUA 1P4IL 1A5FH 1D9KB 1L6ZA 4P4KD 3MV7A 4QRRA 4S1QH 5I1IL 4HSQA 1R3IH 3QXUA 3TNMB 5GHWL 3HR5B 2DLGA 4UV4L 2CXKA 3MLRL 5F7NC 5E5RB 5F7YC 3S37H 1YEJH 1MRFL 3PUCA 1A14L 2WWKO 1NCAH 3BUYB 4U4BA 4BKLB 3KS0J 2P43B 1TZHB 3THMH 2AJXL 1NJ9B 1JI1A 5E70A 3FRUA 1BAFL 3DRQB 4YDLB 4BFBD 4NM8L 5DUML 1KPUB 3TNNB 2P8MA 2PETA 4ODHL 3GKZA 4XWOC 5T1MB 1I7RA 3NGBB 4KTDH 4LEXH 3HC0B 1NFIB 4OFDA 4HG4K 1WZKA 3O3EB 3IDUA 3VI3E 1EH9A 1DBBH 4L4JA 5ITBH 2BMKB 2VDRL 4ZUVB 2HVKB 1DLHA 1EEQA 2VSCA 3CCHA 4S1SL 4MAUL 1AGFB 4YHNB 2EKJA 3V4UL 3OBAA 5JOPE 2BC4A 4GFTB 1RURH 4CN4A 3K8LA 4P9HL 3VXOA 4NT6A 2R0KL 3X12A 4ZFZA 1INEH 1RUMH 5L6YL 4M5ZH 2W0PA 2FEEL 3SE3C 3VFOB 2HJLB 3QNYA 4HGMA 4I3SL 4OV5A 3QNZB 4HCRL 1EERB 1NQBA 5ESAB 2V2XB 4O00A 3VGFA 2J8UA 1S7XB 4X6EB 2IH3A 1QRKA 4W70A 4R7NA 5KSAA 4HIIA 5I17A 2H2PD 4FQ1L 3INUH 4PRAB 4P2QE 1DCLA 1KTDB 4YZFE 2EC9T 4D9RE 4KI1A 5DR5H 3U7WH 2BVPA 2VITA 1X5GA 4UOJA 1CDCA 1T2QH 3IFPB 1AQDB 1IC5H 1NUGA 5F21B 1IAKB 1V8HA 5H37G 3X11B 2X4RA 3QCTH 3QXWA 4X5WB 4P5KA 1NFDF 3HPLA 4LCIL 3IU4L 4YQXH 4JZJB 3VFPB 2MWCA 1UQSA 1YEFL 1A4JA 1Q0YH 3DV4B 4U7KA 3V7MA 1G7PB 2V9RA 1N64L 4XNQA 3V0WL 3QFDB 4XAWL 4UDUB 5ADPH 4CW1A 4OLEA 1I1CA 4TRPL 3FOLB 3VXSB 4WRLA 4UDTB 4Z7OE 4MDJA 4MA1C 4NHUA 2Z92A 3GRWA 5MEOB 4N90D 3ES6B 4GW5A 3GBML 2IPTH 5DJ8A 4Z7VB 1MCJA 3L5JA 3LVEA 1YUHA 2GFBB 2Z31C 4OAWB 1TCRB 4YXHL 2A0LD 3CFBB 1I8IB 1MI5E 5CBEB 5LXGL 3QIUD 4RGOH 3S4SB 4KUCD 2WBJC 2J2ZA 3GIVB 3KDMA 4EN3C 1IAOA 1NCBH 2EIZB 4NP4L 2IPKB 1P5VA 1GGYA 3LS4L 1A7PL 3ZTJH 5DVKA 2KPNA 4O51A 1WQVT 4PJEA 5IT2H 4XI5D 1QPXA 2HLFD 1JYVA 4XVUD 2FX7H 3UPRB 3BQUD 3ARDA 1T83C 4FZEL 5EO1B 5DQDH 3MRCB 5M7QA 4JJ5B 4PGEA 3PHOA 4HK0A 3G04B 1OWWA 1FC1A 1N7MH 4CVXB 4GG6A 4OLXL 1K5NA 4KAQL 5EU4B 4MA3A 4Z76A 3WXWL 3GSRA 1EEZB 2NMSA 5T1KB 5DFWH 1SJEB 3KGRA 4JFFA 4K9EH 5BRZE 1SM3L 5ANMA 4JZNB 1EGJA 3KVQA 5JXEC 4XNZC 4ZXBC 1JHKL 1NUFA 3LY6A 3ULUF 4TTDD 3JUZA 5IVXF 4P2RE 4Q9RH 5SWZA 1OCWH 1YEKH 4LIQE 2DQIH 4OFKA 3NBNA 2HN7B 2QQKH 4XCYA 1A7OH 1A3RH 3AU1B 5CILL 4NQTA 4U0RB 3HE7A 4TPRL 4PJFA 3MC0A 3OZ9L 1A64A 3HS0A 4G7YL 4HX1B 3BE1H 5MEPB 4JKPH 5HVFB 1Q9LA 2EDFA 2BVQA 5EIVA 3WUWG 5SV4A 4PRPA 1B2WH 1CDUA 4ZAKC 2VZUA 3QZWG 2Y06H 4JFHD 4HDIA 3S5LB 1CGYA 5J1TC 1J86A 3PJSB 4YWGL 3PWNA 3O41B 1F4XH 3MRMA 5EOTB 1T80A 3VI3F 2HRLA 4UNUA 2A6DB 2P7TB 3FL7A 5KSAD 1MFCH 4K9EC 3F12B 4YC2B 3TYFA 1TTFA 3S36H 4JR9H 1OF2B 3QRGH 3MUZ1 4FFZL 4YX2L 1ROWA 4QT5A 5FK9A 5B8CA 2R9HD 4R4ND 2EEDA 1A1NB 2NY5L 2VAAA 2VTFA 4PY8I 3W0WB 4Z7WA 2P46B 4G7VL 1IAIL 4BSWA 3GMOA 4PP2B 5DS8A 2NR6C 3RAJL 4OFIA 3IGAA 2GK0B 2XKUA 5DMKA 3DURA 5KAQF 3EOAB 5I19L 1OAKL 4TSCL 2XQBL 4P46B 5DI8B 2WUCH 2EIBA 4Y7MA 4MB3A 4POYA 1IVLA 3DVGA 1TLKA 5C6WH 5BJTB 2V5RA 4PUBH 5IP4A 5IESL 5JDSB 3VXPB 1YZZA 2XWBA 4YZFF 1WSST 3RDTB 4M62L 5D8JL 2JLLA 5F3HB 3B9KD 3SDAB 4DKFL 5KJRL 1KC5H 1CD9B 3LHPL 2F53E 1YNLH 1KEMH 2Z8RA 1MREL 2BOCA 3ARVA 3QAZB 3V95A 1T1XA 1J88A 1NMCC 3QT2A 4RZCB 2GUOA 2OQJB 3MRJB 4MNQE 5IQ7L 5AYUL 2EEAA 3D69B 5IMOB 3IF1A 4D9QE 5T5FH 4DZBA 5T3XL 4P9MH 3S96B 1AXIB 1IQWL 4LCUA 2EKSB 4F7CA 1J0HA 2KZ1B 1CTNA 4KRPB 4P4RA 4XVSL 5DMIL 2NY0D 1AD9A 3MCKA 4ZUSB 4EUPB 2HA1A 4Z7OF 3O2WL 1BJ8A 5FECB 3D85A 2X4QB 2ZUYA 1ACYL 1FZOB 5D1QC 5FOBB 2ARJQ 4DUXA 3OKEA 3GBNH 1WCBA 3MPCA 1RZ8A 2YSSA 1OSPH 1GCFA 1YPZE 5CJ5A 3MMEB 1MIML 1JZ6A 1BBDH 3TA3D 4LFHG 4H20H 4LOUD 4L3ED 2K7QA 3QG7H 4Y5YC 3VGHA 4MD0A 4ZFFB 1A1MA 3VFTA 4OUOA 2YD5A 5D2NE 4O58H 3PWJA 1BZ9B 3VXME 4PG9A 1ZLSH 1QKZL 2E9JA 2WWMC 1TZIB 1OGAB 4PRBA 4OLYL 3RA7H 4LGPB 1JTOA 3KXFD 5GS0D 4E5XB 5I76A 4PJAA 5IROC 5DSCA 5ALBL 2X4TB 4EOWH 12E8H 4K2UH 1MFBL 4I8DA 1KTRL 4WV1A 1R5WB 3QULA 5EZOL 4H1LG 1DQLL 1AGCB 2R2CA 1ORQB 3HHRB 4NDMB 4K7PH 3FQUA 3GB7B 1XGUB 2K1MA 4Y4HD 5I30L 2XA8L 3B5TA 2XZZA 5C0FB 4A6YH 4HWEL 1VDGA 5I6XC 4LSVH 4H88L 3O9WD 3OKDB 4LSPH 1JGEB 2UWEB 1IGCH 3WS6C 1GZPA 3VWKB 5L2JB 5F9WC 4MJ6A 4M9PA 1J10A 1JGLH 3TH3T 1X5XA 5FA3A 1JWMA 1R3LA 2I26N 4FNLH 4GOSA 4NWTL 4TYUA 5F7MC 2KZWA 5H2BA 3HKFA 4NNPH 5FYLH 4UTAL 1KJ3H 2P5WD 3HI6H 4JG0L 3OXRA 5C08D 3MRHB 1MJJA 3QPQC 2A73B 4L8DB 2HT3D 2YA0A 3PQYB 2JK5B 2X4OB 3U4BL 1E4KA 4HIXH 2FBOJ 5A16A 3S34L 5J4MA 4AEIL 3DETC 2IANA 3WV0A 2VXTL 1IBGH 3OPZL 3N85H 3T2NL 4QHNA 5IHZB 2C4XA 3HE6A 4PB9H 4KXZH 1LD9A 3K1DA 4Y19B 1SEBB 5L88H 3T77A 3BZDA 3HR6A 5IJVB 5ABDE 3ZYZA 1MNUL 2Y5EA 4CDHA 4MS8D 5IGXH 2WSKA 2FO1A 1CU4H 2DAVA 4LSDA 5JQ6L 4WFGE 2VL4A 3QJHA 5J11C 3T2OA 1W8OA 5E99L 3P0YH 4RA0C 4RX4A 4KMQA 5KSBB 1LK2A 2R8SH 2KBGA 4NO2B 4L8CB 5IW1A 2VC2H 1V3JA 4KZEL 1KBGH 3T0EB 1D6VH 3H7LA 5C6TL 1K85A 4LSTL 5LGJB 1F11A 3JWDL 2F74A 1G7JB 2YMXL 5ADOL 4KQ4H 3VXSE 1K2DA 3EOBB 1AD0B 1MAML 1KCRL 1NGZA 1JZ2A 1I4FB 5CJXC 4WEBL 3MGAA 5JO5A 5GGSY 1NBVH 5FUZH 4MCYA 4AMKH 4ZPTA 5E8NB 3IFNH 5EBWB 3WFCL 2NX5B 2VQ1A 3C08L 4HK3N 4Z7VE 5ENWA 1KCSH 4TSBL 3EYFB 2LU7A 3DUHA 2D4DA 4DKEL 3WUZA 3FB8A 3FT3A 1GZQB 1XH3A 4OSUH 1LO5B 2R29L 3HAEH 5EU6B 3AM8A 4N5UA 4PTTA 1CL7I 4E42B 4UZGA 3IDJB 2CO6B 4PYHA 2OL3L 3WIFA 3NIDE 2JELL 8CGTA 5LCVL 3ISWA 1OP3K 2YZ1A 2QHRH 3TO4C 5FHAH 1DBKH 3B9VA 3QO1B 3ZSTA 3CVIL 2W65B 3P4NA 1RVFH 2DQJL 1AFVL 3NFNB 1V5JA 4I18A 4HS8L 3E0GA 4ZTOH 1CTOA 1YPZF 5ESVB 1U3HC 4P2OC 2LVEA 4LPWA 3C5JA 4FQJL 4OZ4A 5FKPA 2JB5H 2ED9A 2HMIC 4XP1H 3QXDB 3MXVH 4NKDB 4YHIB 4HUUB 1KJ2H 2EDOA 5KVEL 4K8RL 4WTWA 2D3VA 1CN4A 3C5SB 3N9GH 2LFGA 1A9BB 5DD1H 1FZJB 1YN7B 4EDXA 2QBWA 4WFED 2UZYB 3O3AA 3X3FL 4Q7DA 5EN2A 2VLRE 3KPOB 1UT9A 3CFEB 1UWEH 3QHZH 1S9WB 3C5ZA 3F7YB 1XGYH 1RJZA 2B4CC 3ZLQC 4JFZH 4U1NB 4P5TA 1Q0XH 2P48B 4O2CB 4JFPB 2XV6B 4FXGA 4XHQA 5BXFB 4LQFL 5SX4I 2X2YA 2F5AL 1YEGH 2PCPB 2W0FA 1CR9H 5JPNB 3QO0A 3SGJC 2X4NB 3DXAD 5L7XH 3FZUC 2PR4H 2CRZA 3HE6D 1QBLH 4JPWH 1MQKL 4Y88A 2X7LA 3NPSC 1DL7L 3GSNA 4KPHL 5EUOA 5JHLH 4KK5D 3H9SB 1TVDA 5KANG 4ZSOA 4QRUB 2LVCA 3D48R 3MGTA 3QIWC 3W0WE 2QTEA 3MA7A 5IBTL 4NJ9L 3VFSA 1DP0A 1HN1A 2ATKB 3OR6A 4LLVB 4RX4D 4QXGL 3U7AA 4XPGL 4AENB 2OCFD 4ELMB 1RZGA 1X5FA 5T1DL 1KV3A 2OL3B 3J7HA 3SE3A 5IVNA 3U82B 4KRMB 1RJYB 3ROOB 4HLJA 4X6CB 1MPAH 1RZIA 1RHFA 3L5XH 4ACPA 2A83A 4RBPK 5ILTH 1LO3L 1EMTL 5D7LA 3O3BA 2EXYC 1S3KL 3VD4A 3CFIC 1B0WA 5I15L 1B6DA 3BP6B 2D9CA 4F7EA 2AGJH 4NN6C 2ZSWB 4OZGF 3VGBA 3SGDI 3SDCC 1ZHNB 4JRYB 1OSZA 4G8EB 4U6VL 3WO3B 1JWUB 3QP3A 1KELH 4PRID 5ETUA 2ESVB 5KS9B 3LKOB 1VENA 3HFMH 2DI8A 4TVSa 5IW6A 4C56A 1D3CA 4JQIH 4HT1H 5IHUH 4F7PB 3C87A 3RWDA 5E8PA 6CGTA 1GAFL 2HH0H 1LO4L 5D7IB 4POUB 4G43A 5FCUL 2EDXA 4XNXH 2NCMA 3ZT6A 4Q2ZB 2HFFB 1OTSC 5HDQH 2AK4D 3QUZD 4ODSH 4HEME 4DAGL 1HH9B 1TCMA 2MMXA 2WQRA 4U6YA 5DGQA 1OAXL 3O4LD 1S7VB 4KK6C 2FEEI 1U8IA 1CGUA 2XTJB 3PWPD 4ONHB 4PJ5A 4R4FL 3IDMB 3NH7H 4CKVX 1MJ8H 2Z31A 2Q86A 2NW3A 1UZ8B 3HG1B 4KZDH 2R0LL 3RZCB 1ORSA 4J4PD 1BP3B 3IDNA 1YECH 3AY4C 4ZG1A 2WBJA 1MCOL 1PSKL 1ZHLA 4EXPX 5KVDH 3VWJB 5I2IA 4ODUB 4EN3A 5DF0A 2NY1C 4IHOB 1QVOB 4HAGA 2KL6A 3SGEH 1P6FA 2FJFA 1P7KA 2QADD 3IKKA 1RZJH 4MZ2A 1V3KA 4BZ2H 4ZOCA 3G6AB 25C8H 1F58H 3BP7A 2XZQL 1OD7A 2B2XH 4W81A 2OS7A 1H8NA 2P5EA 3CFKB 4DVRL 3FB5B 1V7NL 3Q1SL 2GT9A 4XPAH 4KROB 1T4KB 1MWAH 3KYOA 1Y18B 2D7OA 4HG4J 4PFEA 2HWZH 2WM0A 3ARBC 4I0CC 3ZDXE 1VADB 3I6LE 5C0IA 4QHKJ 1FZMA 5GSVB 5JXEA 4ZXBA 1EBAA 3QI9C 3BI9X 1X7QA 4C83B 1JPFA 1RPQA 5JXAH 1LEKB 3ZKQD 4JG1H 4JAMA 1S7SA 3RY6C 5E5MA 1FNGA 4P4KB 4Z9KB 1RZKC 5E8DL 5F97E 4HPYH 1HKLL 1TJIH 2ZUVA 1QEWB 1ZOXA 4AL8H 2PTTA 2XN9A 2CSPA 1E4XL 1OP3H 5T3XE 3V5DA 4MJIA 2XPGB 4F7MB 3UTTA 3GMMB 4PR5B 5CUSL 5F1NB 5FKAA 5FYJE 4LBEA 5C9JA 4Y19E 2A9ML 3WKNA 5IFAH 1M71B 4NCC2 2EECA 2QQQA 4BFEA 1TMCB 4MNGA 1S9YB 4AEFA 1W0WA 4ZAKA 4H5SB 2CDFB 1K6QH 4J8RB 1SY6H 3S35L 2VLJA 3ZT7A 4AIOA 1DE4B 2HKHH 3SEPA 1I1FA 3UTPE 2DQDH 4DZ8A 3K4DA 1T2JA 2FJHB 4K94L 3BZ4A 2ZUXA 3WIHH 3GSOA 1RK1B 1JZ7A 3BWUC 4F57H 4IRJB 4LHUA 1GC1H 5AZEH 1J0JA 5KSBE 5DRWB 4I5BB 2IAMC 3JWOH 1G9EA 2HT4D 4ZUWA 5T3ZH 3RFZC 2OI9C 1T5XB 3T0EE 1FE8L 3V8CA 5HSFA 2EDYA 4OLZL 2E8YA 1NGWB 4WY7H 1U95A 5I75C 4KKLC 4LRNH 4MSWA 1BOGA 2DQEL 3CLFL 3R06A 4UV7H 1BEYL 4UIKH 4HIHA 5D1ZC 5I1AB 1T0MB 2JB6B 4L9LC 5EC1B 4AIZB 2XWTA 1UJTA 2RGSA 1Q9WA 3GO1H 1AI1H 5KN5A 1MCPH 4LCCB 1ZANH 1WT5C 3R0NA 3IU3B 2DM2A 3OV6A 2NX5E 4PTUA 2PXYC 1N6UA 1YEIH 5GS1B 4HV8A 2BOBA 5MI0B 1PLGL 4U3CA 1IJ9A 5D6CB 2X4UA 1F6FB 4NKIL 5EU6E 4RDQF 5DMGC 1F8TH 1G7QB 3NTCL 1T03H 4XC1L 1WBYA 4IDJH 4X98A 2YPKA 5B4MC 5J12C 3IJYA 1WBXA 2YXFA 3MBXL 5FO8B 3X3GH 3HI5H 5E1AB 1GH7A 3U6RB 1I1YB 1OM3H 2GCYB 3MLXH 4JN1H 1BQLH 4U1MB 5I1JH 1N3NB 1AP2B 5GGTH 1M7DA 3G5ZA 4HAFA 3U0WH 4RRPA 3IXTB 4Z5RB 4MXWL 3RL2B 4YBQC 4PLJC 3KYMA 5FDYA 3D0VB 1HQRA 1BQSA 1MRCL 2BSED 5I1CH 1NCWH 5F89A 5EBLB 1ZS8B 5I8EB 1FFPB 3BXNA 5D1QA 3RVTC 4QEGA 3W5NA 4LEOB 5DEFB 4XGZB 1IAII 4M1CC 1BJMA 3VU2A 3BUTA 1EHAA 1MRDL 4G6KL 4JO2H 3OX8B 1X5IA 5JUEH 3X14B 3DVNA 3U0PA 3PGDB 3IRPX 4Y5YA 2F8OA 1IGYB 5GGUA 3FB7B 3QIUB 3PHSA 1FG9C 3O6KL 2MHAA 3IS1X 2DLTA 2VJXA 2GITB 5KSVB 4WUUA 5EUKB 5BW7C 3JTTA 4LVHC 4M5YL 3MROA 3T2PA 5J8OA 3B43A 3LRSA 3DRTA 2AJVH 2VUOA 3LSOA 4Z77B 4XMLH 4X9GA 1KIPB 3WJJC 3F8UB 1WZLA 5TF0A 1IKFH 2H3NB 1ZSDA 4KMLB 1CLCA 3C6LB 1EO5A 3FHAA 2NXYD 5I1LB 3BQUB 3RHWK 2Z0BA 1RZFH 3CFJA 3MV7B 1SMOA 1AGDB 4QRRB 2XQYG 1W0VA 1F2XK 2Y23A 1HEZA 4HH9A 4YO0A 1S5IL 4NC1E 2JJUA 1E6JL 3U1SH 1T21A 4GW4A 1XEDA 4XBEL 3CFCH 2XZAH 4LPYA 1JGVL 4FFYH 5C2BL 1CGXA 1G9ML 1WZMA 2DTMH 3ZDXF 5HGGS 3H9SE 2GJ6E 4OTXL 2DQCH 3RJQB 4N8VA 4YHLH 4HULB 1DN0B 1FLRL 3VMPA 4AM0B 1MCFA 4S2SA 5DQ9A 1DVFD 5IBLC 4M7KH 1A6TA 3V5KA 3MOAL 4GJTB 3FT4A 5LWYL 1DQJA 1MIEL 4MX7B 3BKCL 4P59H 2YBRA 3HMXH 4GAGH 4FHBD 1UB5A 5BO1L 4ELME 3KPNA 2G9HA 1PYWA 4TUJB 1IGFH 5I1KL 4X6CE 2K7PA 4XTRC 4ONGH 4OV5B 1GGIH 1JPGA 1UM6H 1F45A 2NR6D 1R5IA 2J8UB 2QSCL 3FRPA 2QEJA 3KLAB 3NZHL 4LLWA 5GS0L 2BX5A 2J8HA 1EGJL 4R7NB 1OAUH 5KSAB 5DK2A 3WNNA 1N2RA 3B6SA 1K3IA 3IFOB 3QHFL 3NFSL 1LDSA 5GGRY 1MHCA 2BVPB 1CZ8L 1X9QA 5KSBF 4JRYE 4YHZL 3WBDA 2JJWA 1MFEH 3E2HC 2LE9A 4F15B 2ESVE 5CKAA 2H32H 4P5KB 5CIPH 5KS9E 5MEND 1XF5A 2R2BA 4R96B 4RWYH 4QXTA 2BSTB 3CK0L 1RUPH 1T04B 4WI8A 4MAYD 1NAKH 5F6IC 1KCVL 2VR9A 4FZ8L 1A4JB 4BK4A 3BRDA 2AJYH 2WLZA 2HP4A 5D7IE 4OFYD 4QHUA 1WK0A 3BPCB 4MLIA 4NHCH 1PKQB 2YD7A 5E4EC 5EOQL 1T0PB 3QISA 4W6XB 5CEXB 2VXQH 4X7FC 2D03L 1W0YT 1YDPA 3JZ7A 3OJ2C 5CJXA 1Q94B 3B9KB 1VSCA 3TJHC 3BJLA 3UPAA 5KG9A 1LK3L 4O2EB 1KACB 1Z2KA 2FGWL 5GJTL 1OD9A 2XTJE 3CD4A 5ESQB 3TCXA 4DOHB 1S7WB 4OIIL 4X6FA 1YUHB 1PDKA 2VLKD 3QDMD 1PX4A 1VESA 4R0LA 3WE6A 4NO3A 1GGCL 2IFFH 1I1RA 3QEGL 3QDJD 4XVJH 4LVEA 2RAMA 5B38G 2NY0B 2ICWJ 2J6EH 1HHGB 1FYTD 1H5BC 3TO4A 1TITA 3T08A 1CLOH 4XHJC 2WWMD 5TH2A 1AKJD 2NY3D 5HHQB 5IHLB 4H0HB 2BFVH 5D2LA 3NCJH 1HH6B 3ZL4H 1DBMH 4O51B 5FUOL 4D9LL 2EH8L 3SN6N 2LAGB 4G6FD 3TA3B 1AIFA 5TDOA 2YC1A 4L3EB 2I5YL 4KRLB 4P2OA 3FN3A 2CLVA 2F54A 4S1RL 5BV7C 4CADB 5DMYA 3LRHA 3IAGC 4PGEB 3GMRA 3EOTL 4M02A 5D9SB 3PHOB 2Y07H 4HK0B 5TE6H 5CSZB 5I74C 3N50A 1U8QB 4GG6B 4QXWA 1K5NB 3D18B 1KCLA 1G9NH 2C3XA 1CQKA 4LPUA 3I6KA 1QFOA 5TQ0L 4JFFB 3KXFB 2E7BA 1SJHA 5GRJH 1ADQH 3OAYK 4FABH 1UVQA 3OF6D 1U8JA 5ANMB 1NEZA 4XXDA 4TULH 3TYGH 4WU5A 2HRPH 3A6CH 1NMAL 2AEPL 3QDGD 5BQ7A 1D6EA 3I2CH 4TSAL 1D5XB 3KYNA 3B2UD 1FIGH 3IDIB 35C8L 3PWVB 4G8FB 4Q9BA 1QP1A 1MH5A 4GAJH 5C0BA 1CLZL 3SHSA 2ICES 5F3BA 3O9WB 1A2YB 4KQ3L 4NOBA 4PJFB 1TZGL 3HS0B 5BMFL 3E6HB 2X1WL 4WNQA 3G6DL 1J05B 1OTTC 3DETD 3K1KC 1OT2A 3KWWA 4M8QB 3SGJA 3U9PH 1I9JH 3BH9B 4NM4L 5D71H 3PWNB 1AR1D 3MRMB 4E41D 5C8JB 3GEWB 5IMMA 4U0QB 4DCQA 1VA9A 5C08B 1TIUA 4F58L 5ID1A 3TF7C 3MLVL 3BVNA 2C26A 3FN0L 1KIQA 4KVCH 5IKCB 1TJHH 4M03A 4QT5B 4B7LA 5B8CB 1KT2B 2W59A 3QIWA 3WXVL 1AO7A 2E9BA 3CGTA 1P2CA 1RZ7H 5DS8B 3OGCB 3ULVE 1IILE 3QA3B 4X6CF 4Z7QE 5J6GA 4Y16A 3CLEL 2JKXA 4PPTA 3DURB 4RNRA 2O5YL 2XRAL 4ZYKA 4YDKH 4NBYB 1MHHA 4PGBB 3G08B 5I73B 4QRSA 2D0GA 3BEVB 2IG2H 2QKIA 3RWEA 3N1GC 2XWBB 4OM0L 5D93B 3MRBB 1ZK9A 3VGGA 2XWJA 4CU8A 4UIMA 4ALAL 2BJML 2PO6D 3R8BB 3MLZH 2I07A 4PGCA 1FVEA 2ID5A 3MLWL 1DQML 1OPGL 5DEGA 4JN2A 4UBDC 1BGXL 2DIBA 5KS9F 1U8PA 2WBKA 3SDCA 2ILLA 4ODTL 1TXKA 4JVUA 1KPVA 3IF1B 4NCDA 1P4LB 1T5WB 3EYQC 4FTVD 4P0DA 1JPSL 1PQZA 3MLRH 1YEHH 5K9KB 3G5VA 1MRFH 1A14H 5D7IF 2DDQL 4OCYL 1OAQL 3FQNB 5HYSA 4ORGB 2Y9RT 2XYCA 4P4RB 3FQRA 4OIAA 1KJVA 4KHTL 1BAFH 2ZUQC 4NQEA 4N90E 3TO4D 5DUMH 2HFGL 5C0EB 4JZJC 2ICWA 2MKWA 3EHBC 3MBEC 5C9KA 4BZYA 2YSSB 3HB3C 2GJJA 4ERSH 1NFDA 1WIUA 2ZNXA 1U3HD 3V4UH 1UKTA 3ZZ1A 2HLAA 3SO3B 1HYRC 5JZ7D 2AV1A 4AEEA 4LGSB 3SE9L 3RNKA 3NIGE 3PIQA 2ZCKL 4OQTA 2Q76A 4I3SH 5FGRA 4PY8J 4F80A 3O81A 4KV5E 5DSCB 3AY4A 3DTXA 4NPYB 4KY1H 4LF3A 2X41A 4M43L 3JBG7 1AE6H 2PW2B 1NEUA 3FT2A 1CCZA 1V3MA 4FQ1H 4JE4B 4RGNE 3MV7E 2VR5A 3H7BB 4QRRE 4GT7A 5JORB 1T20B 4JKWA 1DQDL 2V7HB 2H6PA 5KZCD 4PY7B 1OAYL 5FO9A 5H37H 1QSED 1CXKA 3GI8L 3PWLA 1H3UA 2RQ8A 3BPOB 1IZJA 5DQJA 3QQ3A 5E7BA 2GK2A 1TPXB 1GZPB 4MJ6B 1ZMYA 2LU4A 4KK9D 2NW2A 1N5AA 1KN2L 4P9HC 4R9HA 2OTWB 5FA3B 3J8F7 3QIBD 1B0RA 1JWMB 1YEFH 1HHHA 5B39A 3VG0H 3NFPA 3ARBA 3LKPA 4JFED 3BKML 4BH8B 4M6OL 1KYOK 1MJJB 5HYJA 5IFHL 5AAWA 2FEDC 3BRFA 3L3DA 1EZVX 4J6RL 2DTSA 3QI9A 1QRNA 3UYRL 3L3IA 4NQDD 1NCDL 2VO5A 2IALB 5A16B 3RY6A 3ARED 4LLQA 1XF2A 1C5DB 2HG5B 4MQXD 1CICD 1DLFL 3ARGD 3K80A 1CDIA 1JK8A 2FX8L 2J8UE 1KPRA 2R2HA 3DXAB 3RTQD 3S88H 4NBXB 3M8OL 4XPFL 4AQOA 1KEGH 3UYPA 4OB5H 5DA4A 4LSSH 3HE6B 1T1ZB 1FNEA 2VISA 3T77B 3GZKA 3IETB 2VZSA 3KPSD 4BQ8A 5E1HB 4JFDA 3ZHKA 3GI9H 5F9AC 1ACZA 4HZLA 4R4BA 4NN7B 2NLJB 4N1HB 5GGQL 1VGKA 3QJHB 2YUZA 2DLEA 3NZ8A 2NTFA 1A7BA 3O6FC 1RFDL 5HHOD 3NA9L 2IAMA 3ULVF 5HY9A 5I0ZA 1F42A 4GXUN 4ZNCD 1J5OL 3MGOA 3LN4B 4YC2C 4FZEH 3OAYH 1QYGL 3SBWC 2CRMA 2JCCA 2P44B 3K4ZA 1PKQE 1F11B 2A77L 5D1ZA 3E3QE 4L9LA 5JOEA 3LB6C 1AXSA 4XC3H 1NC4D 2EYTB 5LAXA 5CP3A 4OLWH 4U1JB 1JV5B 1H3VA 3IXAA 4NQED 1GL4B 1N59A 1WT5A 2V2WB 1SM3H 3W82A 3X13B 4U6HA 2UV3A 1NMBH 4FQCL 4WFHD 2PXYA 1T66D 2DF3A 1SVZA 2VQ1B 3FTGB 5ENWB 4P46C 4U7SA 1SY6A 4DOHE 2IADB 1N5YH 1NLBH 3FB8B 1E4XI 3FT3B 4HHAA 1XH3B 3BT2L 3SKOA 2WWKT 3WIHA 3RDTC 4KK6D 4U49A 2VDKL 4KUZL 2WANA 4IBLT 3SDAC 2PYFA 3K0WA 3P30H 5DVOA 3BFOA 3BSZH 5TJWK 3D1MC 1A5FL 2EIEA 3QAZC 4S1QL 3TZVC 1R3IL 3R0MA 3TESA 2AXFB 4TNVF 3S37L 1YEJL 1DFBH 2V7NA 4ODVH 3PDGA 3RIAF 5E2VL 3THML 3I02A 4FQHA 5SWSA 4BH7A 4I18B 4X7CC 1EEUA 3UDWC 3M07A 5E6ZA 1ONQA 2DMBA 3QUZB 5DFTA 1DN2A 5MERA 3AFLA 4JLRA 1AGBA 3O4LB 4KRPC 3C5JB 3QG6B 1VB9A 1A6WH 4KTDL 4LEXL 5FKPB 1A1OA 3ZDYE 4GG6E 1DBBL 1IM3B 4WGWB 5ITBL 5K33A 4HKZA 3NIGF 5E8EA 1XGRA 4PJ9C 2ITCA 4U31A 4LQ1A 5DUPL 4G7VH 1IAIH 4OKVB 4JFFE 3KXFE 2BVEA 2CLZA 1RURL 5ANME 5F8RC 2X6MA 4KV5F 1JUFA 3IDYC 5BW7A 4M5ZL 5IB4A 2AXHA 2XQBH 3C8DA 2R23B 4XCEA 5A2LH 3RWCA 4WW2C 3GIZH 3OKMB 3HCVA 3EAKA 2Y7QA 3HC4H 5F71A 2HVJA 4N9OB 4F7TA 1Z9SA 3WJJA 2QADB 4EI5D 1JNLH 4H0GA 1F3DH 2OZ4H 3WSQL 1M7IB 1KJMA 3ZKNC 1MI5A 5GGTA 4PJFE 3LKQA 4G9DB 1HHIA 1MCHA 2BY2A 4JHBA 4Z78A 4M4RA 1V05A 2OSLB 4JB9H 4G8GD 5DR5L 3DIFA 4M7JH 4PRPE 3RP1A 5E00A 1Z9OA 3MLTA 4LSQL 2CDEA 1T2QL 1UB6A 3B9DA 5AYUH 5IQ7H 5TDPA 3ILQC 1DUYB 3HRPA 3HUJA 3QCTL 2NY5C 1SHMA 1H3WM 1SJVA 4JY4B 1IQWH 2FLRT 2B1HH 3D0LB 4YQXL 5EDXA 4XVSH 5DMIH 2D7TH 1KXVC 3VWKC 2DBLH 3O2WH 3K4AA 4ZSOB 1MY5A 1L6XA 3K2UL 2D0HA 3TT3L 2VYRE 4Z7WE 3VFWA 4R90L 2FECL 5DTFB 2XKNA 1PG7H 5L2KD 1MHEA 1WAAE 1VEOA 1WBZB 2E6PA 1MIMH 2J8UF 2X5PA 4X7DC 2Y6SD 1ZAGA 1J1OH 5ID0A 3VDAA 2IPTL 4GRLA 5M95B 3MRNA 4GKNB 4DK3A 1OL0A 1RZIB 4HS6B 4E9LA 1XGQA 1UCBH 2DJSA 5IBUB 1ZGLP 5TDNA 2AJ3A 4Q9CA 1B4JH 5F7DA 3SDYH 2GQHA 1X5JA 2WQ8A 4I3RH 4F9PC 1QKZH 3LKNA 2EO1A 2BNQA 4WIQA 4H1LH 4N9GA 1UM5H 1NCBL 3BH8A 4PLKD 1DQLH 3PE9A 2VL5A 4QF1A 4ETYA 2A6KA 4BA8A 3MUY1 5A3IC 3ULSB 4AYFA 2XA8H 3KHOA 3LQAH 2UVEA 3QSKB 4N0FA 3MREB 4HFUL 4ZO7A 5BS0D 1TTUA 3HMXA 3BHBB 5D7JC 2FX7L 4Y8AA 2HFEA 3ROLB 3C8HA 3QDAA 5DQDL 1FH5L 4QRTA 3E8UH 1YY9C 4Z95H 2E6JA 1CFNA 1HINH 1KB5L 1I3VA 1N7ML 3MV9A 1ZE3C 3C6SB 3OTTA 4G43B 3CDGA 3MV8A 2R2EA 5D7KE 2BHUA 1NCTA 1H3PH 2HTKC 2BVUA 4U2YA 4PLJD 4MD4B 2A74A 5J6HB 3LKSA 3BP4B 3I3EA 5F8QC 3BIAX 4HJGB 3Q5YA 5C0CD 1X4YA 2HYMA 2YD8A 3U30B 1CFVH 3CU7A 1YEKL 3FFDA 1LO2H 1ZLUK 2QQKL 4PJ8A 4OZFB 4AEIH 1FHGA 2QSVA 1EA9C 1A7OL 1ORSB 2FH6A 1FNFA 1A3RL 5CZKA 2VXTH 3DLQR 1UXSB 2H32A 1R3JA 5CIPA 3V6FA 5I2IB 4O5LH 4EN3B 4JKPL 4P48A 1H5BA 1JL8A 2APWA 3QEHB 3P9LA 3U48A 3RWJA 1Q9KB 4BQ9A 2E9IA 1P7KB 4Q6IA 1F4XL 4RAHA 5DURB 4CNIA 1CXHA 4M1DH 3ZDYF 4GG6F 5ACZB 1HE7A 2BVTA 3RPIB 4JHAH 4JM2C 2AQ1A 5T33H 1UKQA 3BP7B 1QZ1A 3S36L 4JR9L 4XMPL 3QRGL 1FV1A 5JW4N 4NQCA 3DUSB 2RIKA 3DNKA 3VFGH 1YNTA 5FOJA 3H8NA 4OCWH 5DHYB 1QLFA 3KYOB 4MJ5A 1J8HD 3VE0A 2A6JB 1J1XH 3JWDH 4MNHA 2V9TA 3K46A 1FZMB 4XNZB 3I3DA 1JFQL 2CIKB 5IWLC 1X7QB 4WEBH 2XY2A 5CD3A 3TH4T 4OUUB 2R39A 4M6NL 1FAKT 1PY9A 4HWNA 4PJFF 3NCFB 5E5MB 4PUBL 3WFCH 1CGSH 1HK6A 3VXMA 4WW1A 2IANE 1RU9H 1YJDH 1ZVYA 4WHTA 2H8PA 4NRYA 2PTTB 2XN9B 2W9EL 3RJDA 3V5DB 2VUYA 3UTTB 3CUPB 4KI5D 1KC5L 5FKAB 4LBEB 2ED7A 2MCPH 1KEML 3VFVA 3PDOA 5HHPA 2YRZA 1W0WB 4Y5XB 1C12A 3BMWA 5T5FL 4WO4C 1I1FB 2YK1H 1KF9B 4X9IA 1A7NH 3QUYD 3HR5A 3TNMA 4POZD 1X5LA 4P9ML 1DVFB 4BKLA 3CVIH 4HF5L 3TLRA 4NZUL 4G5ZH 4IEFB 4Z7WF 2GI7A 3JWDC 1NJ9A 4LHUB 5DJ0A 3TPUA 4HS8H 1MCBA 3VH8G 3DRQA 1WAAF 1XIWD 3JTSB 1Y6MR 2CK2A 2X9YA 3SE8H 1KPUA 4N68A 1SYVB 3H6JA 4AY0A 5T1MA 5BOZG 3VXUD 2DRUA 2O5XH 4AT6A 3GBNL 1EO7A 3HC0A 4HS3B 3ARYA 1X5YA 4N5EC 5FM4A 3TC9A 3TBSA 2XWTB 1BBDL 4X4XB 4H20L 2R0WH 1Q9WB 3QG7L 3RVWC 1M1SA 4U1HB 1KSRA 5KVEH 4K8RH 4O58L 4L8SC 2AKRA 3A0OA 4E0RB 4NNYB 3SQOH 5K9OA 3MV9D 2HJLA 4RAUB 3TWCH 4G6AC 1ZLSL 3X3FH 3PL6C 3QNZA 3ULUH 2BNUB 5ESAA 3RA7L 4UB0H 5GRUL 5JHDA 4X6EA 12E8L 4K2UL 2XY1A 3WNPA 1RJCA 4X98B 5J13B 2YPKB 4U6TA 3BPNC 4K7PL 3CX5K 4PRAA 5F70A 5I9QB 2F5AH 4OCRH 4A6YL 3B83A 2BVOB 4V1DD 2Q87A 4LSVL 4YUEH 4KHXH 3CVHH 1AQDA 5HBBA 4LSPL 1U6AH 4NUJB 4CRPA 1IAKA 1M7DB 3G5ZB 3GMLA 1U36A 4HJ0C 4X5WA 3W9EB 5MHSD 1BQHB 3SKMB 1MQKH 4C58B 1JGLL 3TBYB 2CPCA 4K3EL 4JZJA 4KPHH 4K8RC 3VFPA 3WCYA 3DV4A 2C4FU 3STZB 4LP4A 4NNPL 4JKMA 1KJ3L 2VLKB 4HWBH 3HI6L 4NRXA 3QDMB 5C0AD 3U0PB 4Y5YB 1KLGA 5GGUB 1QQDB 2BDNH 3QDJB 4JKKA 2CJUH 2Y5TB 3U7YH 5MEOA 2C4FT 2MHAB 4HIXL 1EVUA 4LPCA 1JPST 4OGZA 4NQCD 3JTTB 1FYTB 1FGNH 5JIHA 2P8PA 2FGZA 3DRTB 2NYYC 4Z7VA 2L7JA 3RGHA 2NY3B 1IBGL 1MCWW 4JHWH 4WHYG 3LRGA 5LQBH 2GFBA 5DK3A 1TCRA 1XF3B 4PB9L 4DGIL 1I8IA 2YWZA 5CBEA 1ZHKA 3RZCC 5L88L 2GYSA 4G6FB 4OF6A 3S4SA 4L4TD 3JV0A 3GIVA 4QGTA 4W6WB 2APFA 3CFJB 5DJ2B 5IGXL 3P73B 4RFOL 4CGTA 1CU4L 4ORZC 5I6XB 1U93B 1IGTB 1E4WH 1MCKA 3P0YL 3KHQA 1BWWA 3UZEA 5FM5M 2R8SL 4M6MH 4JQVC 3C60C 2VC2L 4FQLH 3JXAA 3QDGB 1D6VL 3STBA 4X8JA 4XX1E 5EO1A 5IHBA 3MRCA 4JJ5A 2ZOLA 4N8VB 4ZSOE 1PGRB 3G04A 2HKFL 4S2SB 5DQ9B 1A6TB 4CVXA 4HCRA 4KQ4L 4FQXD 3RWGA 1UEYA 4KROC 4RIRB 1CI5A 5FCUH 3ZKMC 1EEZA 4MMXC 5DZNA 5T1KA 1ZLUH 1SJEA 3KPPB 1Y0LB 1NBVL 5FUZL 1UB5B 2BK8A 4AMKL 3IFNL 5DD3L 4JZNA 5MEQB 1OAXH 3CSYB 5A2IH 5CEZD 2X9XA 3QCUH 3DMMC 1JPGB 2DMKA 2CIIB 4YR6B 3IDXH 4A6YB 3V9FA 4OSUL 5D7LE 4TQEH 2OJZH 4LLWB 2HN7A 3BYYA 3KPLB 2B0SH 4E41B 2AJUH 4KTEH 3GK8H 1EAPA 2ZCHH 2NY6C 3AU1A 2CMRH 4U1LA 2AQ3A 3B6SB 4MZ3A 1MCOH 3FMGH 1N6QH 4HX1A 1IGMH 4Y5VC 5MEPA 5FCSH 5FHAL 4RMVA 4OFPA 1DBKL 1WF5A 2NY7H 1I9IH 3S5LA 2D31B 4FQPA 1F3DJ 5DYOB 4KK8C 4BUHA 3O6FA 1XF5B 1EDQA 4KH2A 3P40A 4ZTOL 2A6DA 2CGRH 3F12A 5GZOD 5D5MA 5AZ2H 1PEZA 4HQQH 3SBWA 4UNTA 4JREC 2XZQH 4QHUB 4UT6H 2JB5L 3QWOA 1RI8A 2XICA 4XP1L 4XPTH 2R4SH 1A1NA 3DI3B 1YDPB 2PO6B 1G0YR 4PP2A 1KJ2L 2DL9A 4M7ZC 4QYOB 2GK0A 4FOMA 5T5NF 3N9GL 5DD1L 3TIDB 3N06B 3EHBD 3MBED 3OKYA 4P46A 5DI8A 4PJ5E 4KRNA 4LCCC 1UG9A 2H2PC 2W07A 3TIEA 1UWEL 3HB3D 3QHZL 3WJLC 5DO2D 5BJTA 4PJBA 3UZVB 5JDSA 4FTVB 2E8ZA 5CZXD 3VXPA 3RDTA 4KGJA 2X9WA 4JO1L 4WI9A 5SX5K 1E4XH 5F3HA 2PYED 3SDAA 4MQSB 5CUSH 3S3SA 1I9RH 3TO4B 1YEGL 4PB0L 5FB8A 4YK4C 5HGHB 3MJ6A 5TH2B 5A2KH 2OQJA 3MRJA 5K9JH 1CR9L 4M93C 5E9DD 5IMOA 5L7XL 2PR4L 5HGAB 3FFCD 4OCMC 3UDWA 1QBLL 4JPWL 4PJXB 6FABH 2C3WA 3CH8A 2AEIT 2X70B 3S96A 3VXRA 1U3HB 1RD6A 2EKSA 4P2OB 4Y0GA 5JHLL 3GMRB 4QLRA 4EUPA 1PD6A 2P8LA 3ET9F 5GGVH 5HHMD 1F3RB 1MCWM 2X4QA 3GSUB 4JFYB 1FZOA 1KCKA 5FOBA 2Z35B 3HAEB 1SJHB 2DYPA 1UVQB 1BEYH 3MMEA 1NEZB 3DO3A 5CINH 4ZFFA 1UWGH 3QIUC 4WW2A 4OM1H 1D6EB 1KXTB 3KYNB 3MRRA 1MFNA 3L5XL 3UXFA 4M1GH 5GSRA 5ILTL 1MH5B 3E6FA 5KZCB 2XN9E 2FEDD 1QLRB 4MJIE 1QFUL 1TZIA 3UTTE 1OGAA 3FQWA 2Q8AH 3TH2T 4K94C 3QUXD 4NKIH 4E5XA 1ZVSB 5A2FA 2AGJL 2AV7B 3NCMA 1XCTB 2FX9H 5ITFB 4JVWA 4TVPD 5C09D 3NTCH 4XI5C 5CEYA 4FP8H 3WO4B 2HLFC 1AGCA 2VDNL 1ORQA 2VLJE 3KR3H 3L1OH 2ZSVB 5F6HJ 4NDMA 1JGUL 3GB7A 1S5HA 3MBXH 2P49B 7CGTA 4OJFH 2W92A 2EDTA 5C0FA 4KJPD 1KELL 3TBVA 3F7PC 4JFEB 3VFUB 5ID1B 3HFML 1KJ2B 1GYAA 1I7TA 4JQIL 5FM8A 3BVNB 1T7VA 1JGEA 5IHUL 3CSBA 2UWEA 1KIQB 3VWKA 2X1XR 1HILB 2HH0L 3AB0C 3AREB 1YN6B 1TNNA 3PP3K 1CICB 1SQ2N 3ARGB 4XNXL 1QSFD 3GMPA 2VH5H 4NZRH 1ZT4A 3WFHA 3I50L 5HDQL 1KN4H 4ODSL 4RNRB 3S35X 1CGVA 2A73A 3BGAA 1MHHB 4QWWC 2H1PH 5TF1H 4L8DA 2CUIA 3PQYA 2JK5A 1MELA 2X4OA 1B88A 3KPSB 4QRSB 1HOCA 3NH7L 5BZWA 4W6YB 1J0IA 3RWEB 4M5YH 1MJ8L 3UTOA 1CE1H 4F9PA 4KZDL 3ALWA 1CFQB 3QUML 2I07B 3VA2C 4H25B 4OCSH 4BFIB 4O02H 1YECL 4W4OC 4NN6B 5KOVC 2X1PA 5HHOB 4I9WD 2EDDA 1OARH 4JN2B 4Y19A 1SEBA 1E6OL 1U8PB 2I25N 3ZE2E 4FN0A 3P0VL 1KPVB 4IIQC 2XOTA 3MRKB 1VHPA 4PJ7A 2G2RB 5GRWA 4TTGA 5DWUL 1RZJL 1WZ1H 2GSIA 2R9HC 3DV6B 4R4NC 1JZ8A 5HYSB 1XGPB 1S5IH 1IARB 1NC4B 3C09B 5D7JA 1E6JH 5GRXG 4XCFH 5EO9A 4F15C 1F58L 4NQEB 5A40E 1UCTA 4J1UA 4V2CB 2BRRL 3TZVD 2B2XL 2ZNWA 1P1ZA 1LVEA 4NO2A 3GMQB 2ICWB 5EU5B 1AJ7H 3OKLB 3V7AG 4ZO8A 1QPPA 2FECI 1HIMH 1MWAL 2AK1H 5LGJA 2HWZL 4LPTA 3QDME 1G7JA 3MYJB 4UOW0 5IOPA 3EOBA 1OAZL 3E3QC 3QDJE 1N0XH 4HPOH 5JXAL 4KMTL 1PG7W 4JG1L 5E8NA 5EBWA 4NZDA 1NC2D 1EFQA 2NX5A 3QQ9D 4PJ9D 4HPYL 3MR9B 1TJIL 4XPHH 1UWXK 5DJZA 3MRPA 3EYFA 2ZOKA 2VE6B 3MACH 3REVB 1NL0L 1GZQA 3DTXB 2QSCH 2WIMA 1LO5A 3SGKC 2NY1B 5IFAL 1NANH 4E42A 1T2XA 2PTUA 4NO0D 2QQNL 3IDJA 3ORJA 2I9TB 3T3ME 3FT2B 3NACH 1K6QL 1SY6L 3QHFH 1YY8B 1X5HA 2HKHL 4J3WA 3EFDH 1BJ1H 2DQDL 1LO0H 1M05B 2OMNA 1NBYB 4KKAC 1P6AB 4QOKD 4QO1A 3WIHL 2W65A 1RUQH 3QQ3B 3NFNA 2YRPA 1GC1L 1U42A 4FQIH 1K4DA 1U9KA 4JM2A 1MLBA 4N0YL 5AZEL