2IAMD

Structural basis for recognition of mutant self by a tumor-specific, mhc class ii-restricted tcr
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
239
structure length
239
Chain Sequence
AGVTQTPKFRILKIGQSMTLQCTQDMNHNYMYWYRQDPGMGLKLIYYSVGAGITDKGEVPNGYNVSRSTTEDFPLRLELAAPSQTSVYFCASTYHGTGYFGEGSWLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 52
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2006-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iamD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iamD02
1OOAA 4GMTH 1HDMA 4NT6A 1PGRB 1NEUA 3KYMB 4MHHI 3ZTNL 1S7WB 4Z7NF 2OL3B 1N6UA 3F58L 3NCJH 4QRSA 4HXAL 4I3SH 4S1RH 3EO0A 4X6EA 5EC2A 4J8RA 3LZFL 5E7BA 2Q3ZA 2JCCF 3MRDB 4J1UA 4Q74A 3RWEB 1VSCA 1NAMH 5KVDH 2V6HA 1OAKH 1VDGA 2XA8L 3MZTA 4CVZB 3P73A 1NL0H 4JKPL 5DD3L 1SJVA 1WBYA 3BKCL 4GXUN 5E8EB 3VXQA 4R6UA 1LO0H 1C08B 3ILPA 1DUYB 1ETZA 5KSBB 3X14B 1WFUA 5IB3B 1BFOB 5EBLB 4JZJC 3ALXA 4ORZC 1BVLA 3G6JE 5E2TH 1HHKB 2X40A 3D9AH 3FQUA 4GFTB 1F11B 3K0WA 4Y5VC 3BGMA 4AK1A 5I1LB 5KJRH 4MA1B 4Y4FA 2GSIB 1GOGA 2UV3A 5ANME 1TENA 5IVXF 4NC1C 1OCWL 2H8PB 2FR4B 3FKUS 1I7RA 1X4ZA 2FZ3B 3P0VL 4ZODA 2ESVB 5D1XB 5AD0A 2M26A 2NTSP 1DL7H 3T09A 3H9SB 3CLEL 1QEWA 4OI8A 1X6LA 2P49B 3MRHA 4KK6D 3QUZA 2HJLA 3MLYL 2IH3A 1T20A 5I1AB 1T4KA 4TQEH 3H3BC 4OQ1A 4EQ2A 4MAUL 2DD8L 1YEJL 1F3DH 1MFEL 1YPZA 2JIXD 3C60A 4XBGB 1ZLSH 2A6KA 4AM0B 1RY7B 2VUYA 1CFBA 1UKQA 2Q8AH 3MZGB 3TO2B 2DL9A 1U95A 3CSYB 5ITFB 3T0XA 5JQHC 1B3JA 4H88H 3FQNA 4E41A 1KB5L 1KJ2A 2P5EB 1U6AH 1V3MA 2A9ML 3KPNA 4PP2B 3FFCB 3HG1E 1MQKL 3FO0H 4M7ZB 3VRLF 3VE0B 2W9DH 4S1DC 3P3YA 3DMMA 5F9DC 5EU7E 4K3EL 4RRPG 5IM7A 5HVWA 1WCBA 3UO1H 3B2VL 3MQIA 3WFHA 4U1NB 3ECBB 5LCVH 4AMKH 4K3DH 2QQQA 3UYOD 2UYLA 5JOEA 3WHXA 4TSCH 3ARPA 3QUKB 4QRPD 5JA9A 5KSBE 3IYLW 4K23L 3DRQA 4ZPVA 1RZKH 3OKEB 3RY4A 1IAMA 4RAHA 1VPOH 5CBAB 2RCSL 4XAKD 4D0BB 5D7KD 3LSOA 4XMPL 1N2RA 3HE7A 1MRDH 1Z5LA 3L5IA 3S37X 1T2QH 5HPMB 4F58L 4F7PA 4ZUUA 4EN3D 1H15B 5B4MC 1G7HA 5CEZL 1I3GH 2X1PA 5BVJB 2WMPA 3RHWF 4LLQB 1GGYA 4LCUA 4K3JH 4FQHB 4CADB 4ODTH 1NFDF 4PGEB 4U7KA 4DK3A 2KZWA 3SDAC 4P23C 1QHOA 4KTDH 4CDHA 1P7HL 1EFXA 3NZ8B 3GSRA 4XPFL 6FABL 4MCZB 3DIFB 2EYRB 2PTTA 3D69A 4AL8H 5HHNA 3ZTJH 5F7UA 4ERSL 5FO8A 1AXSB 4NC2B 5HI5C 1MH5B 4DGYH 5CUSH 4L3EA 4JFFA 1AO7B 1QLRB 1UWGL 5DUPH 4LDOB 3NFNA 1E6JL 4OCYH 4P3DA 4JHAH 3VI3E 3QXUA 3WJLC 4GJTB 2X4OA 1ZVSA 3O9WC 3KNBB 2J3SA 5IBLD 4RAUB 3BP5A 2YRPA 1HK6A 1FNSL 2VXUH 3PABA 4X8XA 3FFCE 3GSOB 1LEKB 3T0EC 4LAJH 3T2QA 1T7WA 1XIWC 3MBED 1N5AB 1P4IL 4U1LA 5ID1B 2R0LH 3PUCA 5ISZB 3WUZA 4FG6C 1BLNB 4HQQL 3TGXA 1JWUB 1KCSL 1MNUL 5SX4I 2YZ1A 1HI6B 2EDQA 4YLQT 1DBAL 2ICEB 5GGVH 3GSUA 3VGFA 1IE5A 2I60L 1SVCP 5T5NG 1U3ZA 2YEZB 4NQXA 2IBZY 3GMNB 4KMLB 3VD9A 1MJ7H 3LRSB 4FQIH 5ITBL 4FFYH 2HVJB 3RI5F 2ATPA 3BAEH 3KPTA 1RZ7L 3RUGF 4ODSL 5I8OH 2W38A 1J1PL 4M61B 3F62A 3B9AA 3PWUB 1XGUA 3GIZL 3SOBH 2ZWLT 1OSPL 4POZD 4FXKB 2OR9H 3ZKND 5HPOA 4DVBA 2P7TB 2ED7A 4NN5C 1UWXK 2Q7NA 4JM2A 3E2HC 3FN0H 3BIKA 4ZO7A 1RULL 3VH8A 2BSSB 3DTXB 4ZO6A 2G60H 3V9FA 5F96L 4PPTA 3BZ4A 5TDPA 5ILTL 4X6DB 1FO0A 4OLYL 4PJ5D 4U1JB 1PYWA 4QRPB 1JI2A 2R4SL 5I16A 4E0RB 1KELL 4JDZA 3WFDL 3SDYH 3S8WA 2Z0BA 3OR6B 1NKRA 1LDPH 3QI9D 4PRNB 4LMQI 5C9JA 1DQLH 2V7HB 3MRIA 5JW4R 3IVKA 2D2OA 4MAYD 1UZ6E 3FZUC 4KDTC 3VXNA 2GW5A 2Z8RA 4EN3B 2L7UA 4J7RA 5I15L 2EE6A 1AO7E 1EAPB 1KJ3H 4GKOA 4HCRL 1F4YL 5JMRA 2XWTB 1FP5A 5HYJD 3LKOB 1YN7B 5J0BA 2WZPD 1ZXQA 3TT1L 3HE6D 1T04B 1DQQB 4N0CC 1E28B 5I74B 5T1LA 5LAXB 1AIFA 3BN3B 2P46B 4PJ9A 5C0FA 3ULUL 1MF2L 2DYPD 5F7DB 2N7AA 1WAAF 5ISZE 2CUIA 4QGTA 3WD5H 3SDXF 1WBZA 2J8OA 1E4WL 4XTRC 4JJ5B 1MCRA 4RFOH 1RZIA 5E5MB 1N6VA 2FX7H 2HP4A 1S9WA 5BZWB 2MMXA 3ISWA 1X7QB 3S5LA 3RI5K 4HZLB 4M6OL 1JYVA 4JFXA 3OJDA 3WIHL 3PGFH 3G6JA 3M17A 4XHJC 3BESR 1TETL 3U46B 3K2UH 4O02L 1GGBH 4DKEL 2B5IC 5CJXA 3NOIA 2AEIT 3MBEB 3CFBB 4HFWA 4MVBD 3R4DA 1A2YA 1KYOJ 2HRPH 3PDGA 5FFLA 2EEAA 5ANMA 2W0PA 3IDJA 2X6MA 2WAHA 4TUKH 1G9NC 1Z0NA 1F45A 3HAEH 1NGPH 4RGOL 1OTTD 1RIVL 3SEPA 5ICZB 1MHHA 3CPLB 1D6EA 1FBIH 1PAMA 5IW1B 2MCPL 4W6WB 1QUNA 4X6DE 4X7TB 2IADA 2C3VB 3V5DB 1ND0B 4NO3B 4MQ7A 1IGYA 1ZA6A 5JTWA 5EOTA 5JOFA 4QRPE 4ZUWB 5A2LH 4RAVB 1T7VA 3RA7L 1GHFL 5EIIA 4XNQA 5CCKH 4HH9A 4QRRD 2I07A 1CDJA 2O5XH 2Q3AA 4AJ0A 1FZKB 2EDDA 3GI9L 1TCMA 3ESUF 1FFOA 3ABZA 1FFNB 3FT2B 5AWNH 1LEIA 3HAEG 5DJYA 1YEGL 3MUGB 4LLAA 4PRDB 4HLZH 7CGTA 5J11C 1XF5B 2FO4A 4KRPC 3FL7A 4LFHG 5CZXC 1KCVH 3DGGB 5CS7A 4WEUD 4I2XE 3VRIB 4OSUL 2QKIA 4PJ5B 4K9EL 1MFBL 2BOBA 3RRQA 3NMEA 5IB2A 3QCTH 1T21A 5JW5B 3VCLA 1CLZH 1O7VA 2P8PB 2WP3T 4LSVL 5F3BB 2YD1A 3ARBD 1G0YR 2GIYA 3KYMA 3QI9B 3EOTL 3WLWD 1IC7L 5K9QG 4AG4H 1S7WA 2GCYB 5MI0C 2OL3A 1YNTB 4M1GH 2X4TA 3QXVA 2FYYB 3MRDA 3RWEA 1S5IH 3QRGL 4I0PD 4XNZB 4Z77B 4FQ2L 4CVZA 5GS2H 4S11A 5C2BH 5E8EA 4LFHD 1C08A 1DUYA 5HDBF 4P5TC 2PO6B 5FB8A 2R1XB 3KLSA 5FHAH 5HYJB 5KSBA 3X14A 4HWBL 1BIIB 5IB3A 5EBLA 4EXKA 5GQBA 2VDLL 4NCC1 1QNZL 1HHKA 1K4DB 1FORH 1YNLH 4LVEA 3PWNB 5FKPB 1CZ8H 5I30H 4LGSB 1EGJH 1F11A 3PP4L 2YWYA 5I1LA 1KN4L 4JHWH 3WUWB 2DYPB 3STZB 2V2TB 3EDJA 2X9YA 5I0DA 3X13A 5I71C 2GSIA 3RX7A 3N0PB 1X5AA 2C4FT 2H8PA 1FVCB 2Q1EA 5C3LD 4YHKL 4ALAL 5AZEH 2FZ3A 5DJ0B 2ESVA 1YDPB 1OTSC 2AJYH 3IXTB 5D1XA 3TZVD 5KSUB 3O6KL 1CXKA 1H0DB 1MCSA 3O8XD 3H9HB 4PLNC 2DQDH 5CMAB 4DK6A 3EYSH 1QLEL 5I1AA 1FG2B 4HUKB 1N4XH 3NACL 4HULB 4OLZH 3SBWA 3BOVA 5GSRB 4XBGA 3DROB 3MXVL 1G7MB 3V6OA 4AM0A 3T04D 5E08L 4GKZB 1CICD 2WSKA 4KK5C 3TO2A 4YO0B 5J57B 3CSYA 5ITFA 1BFVH 3B9KB 1N0XL 1Z9MA 3I6KB 1NLDL 4P99A 3QNXB 4DUXA 4PJ5E 1JZ8A 4PP2A 3FFCA 1IC4H 3ESVF 2J5LC 4EUPB 4G9FE 5HVHB 5DZNA 3GK8L 2BZDA 4V1DD 1F90L 4YBQD 3VE0A 4HIIB 4QRRB 5KBNC 4JFZH 2NZ9C 2PW2A 2HH0L 5C08E 5F7WC 4XH2B 1U3HA 4V2BA 3BT2H 4GH7B 4U1NA 3U82B 5AYUL 4ONGL 5HSFA 3IF1B 3RWFB 2VDPH 5DJ8B 3M45A 3QUKA 4OGZA 4OIIH 2B2XL 1FYHB 5FYJU 4H0GA 1T89C 1NGQL 1WZLA 3ZHLA 5L88L 2IAMD 3ARBB 5GS0C 1DSFH 3OKEA 4FQQB 4UBDC 5CBAA 4D0BA 2EZ0D 3QIWC 1P2CB 5FCUH 2VC2H 4PLJD 4ETQA 5HPMA 4I0PB 1M71A 2I9LB 1RUKL 3PL6B 2EE2A 1H15A 3GO1L 25C8L 3GI8L 3IT8D 2VDRL 4FQJH 3MNZB 2FBJH 3BWAB 1QR1A 4LLQA 4FQHA 5FEBA 4TUJB 4PGEA 5JA8B 1JPFB 3N1MC 2YOCA 3INUL 3RZCD 4PY8I 5JW4M 5JXAL 3VWJD 3NZ8A 4JR9L 4C4KT 4MCZA 3DIFA 2EYRA 1NUNB 5CZVH 2P42B 1YEKL 3UXFA 1SJEB 5IBTL 1AXSA 5E70A 1J0YA 4Y5YB 1AO7A 1QLRA 2VXQH 5IV2B 3HPJA 3TZVB 5L7XH 2NY2D 1KUMA 3MTRA 1BVKA 4QHNA 1YNKL 3DGCR 3O8XB 1ACZA 2PR4L 3KNBA 4RAUA 3EFFB 3HMXA 5GS1C 3GSOA 1LEKA 1N5AA 3L1OH 3T3MF 4YDLB 4LQFH 4QRRE 5ISZA 1A7RH 2EE3A 2VB5A 4FFVD 4A2LA 2YUZA 1JWUA 4R26L 4HD9A 1CICB 3HC0B 3QHZH 4ZNEE 5J1AB 1S9KC 2EDOA 1PFCA 2ICEA 2R0WH 3AM8A 3GGWB 1HHHB 4XP6L 2EDKA 1W0WA 2ADFH 4WI9A 1S5HB 4QXUL 4AEHL 3LRSA 4TVPD 2OM5A 2BRRL 3JXAA 3ZE2F 4JRXE 4NNPH 4P4KD 4OTXH 1GAFH 3KPOB 1FAIL 4NUGH 1AXIB 2HT3C 3MJ8B 4IMKC 4V1DB 1OAQH 4UAOB 1NSNH 3PWUA 5IFAH 4KVNH 2MKLC 2P7TA 3GMMB 1N7MH 4X5WB 3N50A 4UINH 4QLRA 3UJIL 4MNHB 3TT3H 3DTXA 4Q97A 4I77L 4HBQA 1P84K 4M7KH 5EOQL 3LS4H 4YAQB 4X6DA 1VFMA 4OZHF 1UEYA 4XWOC 4U1JA 1I9RH 4QRPA 5D2LB 1QZ1A 1MCIA 4E0RA 4LSPH 3MLWL 4LSQL 2IEPA 5HD8D 4L8SC 2IAMB 5JIIA 4D3CL 2MPAH 4GQ9L 5CSBA 4YXHL 5EO1B 4KUZL 2R4RL 1JHKL 2K7QA 2DMCA 2DIJA 1CD0A 2V7HA 3MRLB 5I6XB 3VA6A 4RRPA 1U2CA 5BS0D 4GOSA 4XI5D 4EN3A 5TQ2L 4WW1A 2ERJC 4LK4A 1T7ZA 1N59B 1NCDL 1MIEL 5F21B 1UA6L 2IQAB 4M5ZL 2XWTA 1OHQA 5DD6B 2R2CA 1YN7A 3FAWA 5FYKD 1G6RL 4EZMA 2XOTA 3RZCB 1Z3GH 4MXVE 3VWJB 1T04A 1DQQA 3RNQB 2VZVA 1E28A 5F7LB 3T4AB 5IQ9B 1EH9A 2HWZL 5GJSH 5LAXA 2UZIL 1QYGH 4NPYB 5DRWB 5DVLA 3BH8B 2DJSA 2CKBB 4RBPK 4JJ5A 4BKLB 5E5MA 1JGDB 5JHLH 1JFQL 2P1YA 4HFUL 4OM0H 4M6AA 3H7BA 2YRLA 3NA9H 4UB0H 4HZLA 1RVFL 5D71L 5JXEC 2NY2B 1NCCH 3IAGC 1GRWA 1A14L 4LIQE 2I24N 5J6HB 3HMWL 4AEFA 2ADJB 1BD2E 3R8BB 2ARJB 3OXRA 2AGJL 5E9DE 4U3HA 3WNPA 3MBEA 3CFBA 3QEQD 1HQRA 2ZUWA 1I3RB 1A7NL 1NQBA 3LH2H 2BY1A 2WBWB 3KS0H 3OB0H 3RVTD 1MWAB 5I17B 5CLWA 4TSBL 1NBYB 4P49A 2A74A 1DQMH 1KACB 3RPIB 5I75C 5ICZA 4MX7B 5GGUB 2DQGH 5IW1A 1UWEH 4X7TA 1F2XK 1ND0A 4NO3A 4POUB 3V5DA 1HXMB 1OAXH 4P4KB 5D2LE 4RAVA 3LEVL 3HA0A 1WWBX 3O2VH 3ZDYF 2VLKD 1FZKA 3SKOB 4DZBB 5T3ZD 1DFBH 5MEPB 3F7RA 3FT2A 1B0RA 1FFNA 2EDHA 2VLLB 5FDYA 3U9PL 1DE4A 3D48R 3MUGA 4PRDA 2G75B 2AI0L 4FZ8H 3E3QC 4S1SL 1MJ8L 1XF5A 2QHRH 5L9DH 4UI2A 1NANH 1LP9F 3VRIA 3GSWB 4G6MH 3QUML 4PJ5A 4BFGA 5JW5A 1ZGLB 2P8PA 2VLJB 5F3BA 4I3RH 2GI7A 3QI9A 2YD6A 3B2UC 4PGCB 5D7JD 5D8JL 1LK2B 2GCYA 1YNTA 3JWNC 2ICWI 2FYYA 4XNYL 3G5XB 5DEGA 5BS0B 3EOAB 1ZWIA 2QQLH 1B4RA 4QKXB 1A6WL 1FGNH 2ZPKL 2IMMA 5FM5M 2PO6A 3UDWC 2R1XA 4N8VG 3WJJC 4LSSH 3WS3B 5HYJA 2OK0L 1NAML 3MNWB 3UC0H 1BIIA 3FTGB 1OAKL 4PJEF 1NL0L 1SYVA 3T2OA 2DAVA 1LO0L 4NZRL 2YPKB 3PWNA 5FKPA 3QIUC 3NCEB 4UQ2B 3WUWA 2V2TA 3STZA 5ALCL 4H0IA 2GTZB 1S9XB 1S7QB 5E2TL 3D9AL 1MAKA 3Q6FB 1FVCA 4J4PD 3UJTH 1HH6A 3N1FC 3QUYC 5DJ0A 4JO4L 2BFVH 1YDPA 2EEDA 3ES6A 3RVXC 3H9HA 4NJ9H 3LQMA 1FSKB 1JUFB 2G9HB 4Z7WE 1BAFL 1BF8A 3G9VA 4TVPE 5CMAA 1FG2A 4NFCA 2BNQB 3W11C 2OI9B 3QEQB 4BYHA 1DL7L 4XB8A 2AVGA 1QSED 1EJOH 2ZKHL 3QRFM 5GSRA 1W8NA 2Z91A 4FP8H 3ME0A 3DROA 4ZXBD 1G7MA 4KHXH 4OJFH 5LGHL 4YO0A 4GMSL 1NCTA 3B9KA 2MHAB 4U33A 3WHE0 3JV4B 1ZLSL 1EPFA 3I6KA 4PJGE 5F93C 4YQXH 2FNBA 1IM3B 3QNXA 1QRNE 1OAUH 2MWCA 4KI5C 4EUPA 3E8UH 2VLJE 5KAQF 1U6AL 3L3OB 3D39D 3GSQB 4HIIA 4QRRA 2VLKB 4PRHD 4WO4C 2CR6A 4LSTL 2X1WL 4XH2A 5J13B 1GXEA 4YHOH 4ZNEA 4PFEA 1NC2A 3FO0L 1OT1A 5T3XD 4BUGA 5IFJB 3QAZB 5FYLH 3S36X 4PS4H 3ZE1E 5B8CB 2W9DL 4FN0A 4M43L 2XPGA 4NQED 4YHZH 3IF1A 4XCNB 2IQ9H 1RUQL 4M02A 5DJ8A 1JYXA 4JRXA 3UO1L 4KRMB 4IMLA 4LSUH 3SGKC 2FGWL 3GSXB 1UB5A 4JCLA 1BMGA 5LCVL 2XYCA 4EOWL 5F9JB 3NPZB 2NY7L 4FQQA 4TSCL 5D7JB 5SWQB 3TBVB 4XXDB 1U9KA 4GG6B 1P2CA 4UDTB 3MV9E 5KSAD 3KLHD 4I0PA 1RZKL 1OWWA 3WN5C 3PL6A 3ULUF 1EERB 2WP3O 4NO0B 1VPOL 5ID0B 1INEH 3MNZA 3BWAA 2IPTH 1PEZA 3MGOA 2G2RB 4BSVB 4TUJA 1DVFD 1T2QL 1JPFA 5D9SB 3MXWH 1I3GL 3SPVB 4X4YB 2R8SH 2DB8A 2CMRL 2IG2H 4K3JL 3BJ91 1HOCB 2RFXB 5SWZD 3RY6A 2IALB 2DL2A 2BNQE 4R4BB 3QEQE 3IJSB 4LHUD 4H8WH 1IM9D 3CU1A 5E6ID 1KGCD 3I2CH 5JW4N 4U7MA 3CFKB 3IU3A 1I4FB 4Y5YA 3O2WL 2F5AH 4AL8L 2FJHB 3TBSB 2QSQA 5IV2A 3VWKB 4XVSH 1QP1A 1AKJA 3TZVA 1ES0B 1HIML 4N8VB 3B5TA 3ARWA 4FABH 4DGYL 1ZTXL 3O8XA 2OCFD 5CUSL 1D5ZB 3EFFA 2AEWA 5DUPL 4LEOB 4OGAC 2F5BL 4FQXC 4NIKB 5HHVH 3BZEB 1QSEB 2KPNA 4PRID 3QT2A 4YBHA 4ZXBB 4AIZA 2VXUL 4K3HA 5T3ZE 4HKJB 4JZNB 1CICA 3HC0A 5J1AA 4XVUD 2OJZH 5E4EC 2R0LL 3EO9L 3ALPA 4HUUB 1AD0B 1X5GA 1KLUA 2RGSA 1JHLH 3GGWA 1HHHA 1KTDA 4PJBB 1NBQA 3ULVD 1ADQH 2SEBB 3QSKB 3WFBL 5BO1H 4XP9H 1S5HA 4KK8C 1HN1A 3K46A 1ZLUH 5GGVL 1EGJA 5L6YL 2NY3B 4JREB 1TQBB 3FN3A 3MJ8A 2FIKB 4V1DA 3D39B 3LPGA 2APTA 4PRHB 3PE9A 4GRWB 1MJ7L 3KPRD 4FQIL 4XCCL 2QSCL 4KJPC 5GXBB 3U30C 3LKPB 3GMMA 1X5KA 4X5WA 3BAEL 4GG6E 4W4OC 3AAZB 3W5NA 4B41A 2E7HA 5HHXH 1VFBB 1A7QH 5M94B 3VA2C 3O0RL 4MNHA 2YRZA 5C1MB 3SOBL 1Y6MR 2R9HD 2JJVA 3I84A 3FAXA 4NQEB 4M6MH 1BBDH 2OR9L 3TWCH 4YAQA 1YY8B 5EIVA 4ZFGL 1CFNB 3W39B 4R4NC 3MRBA 5D2LA 4U4BA 5C09D 4U1IB 2VERN 1CG9B 4BUHA 2IAMA 3FCTB 2VN7A 2R56L 4XPBH 5EO1A 3BRGC 5CP7B 2D0FA 4LRNH 4O00A 5F7YC 5TE6H 2I9TB 3V4VH 3MRLA 1YMMD 5CGMA 2FEDC 2VDMH 1LDPL 1IKFH 1JTPA 4K9EC 1N59A 2JE8A 3CMGA 5KSVA 2BK8A 3U7WH 2IQAA 4JAMA 4LLVB 1UH3A 4ZS6D 1DVFB 2XTJC 1MCOH 2VDNH 5DD6A 4Y1AD 2Y36H 3KPPA 3RVUD 1DBMH 5I73C 4K94H 3VWJA 3Q5OA 3RNQA 4DN4H 1KJ3L 3GMPB 5A16B 4U6TA 4BH8B 1JZ5A 1UM5L 3T4AA 1FFPB 5SWZB 5B3NA 2DTMH 3V4UH 1S9VB 3P0YL 4NPYA 2DS4A 5DRWA 3BH8A 5E8PA 2CKBA 5HGAB 1IM9B 1H3XA 5E6IB 1AE6H 3JTTB 1X5FA 4IDJH 4BKLA 1VFUA 1JGDA 5C0CE 5C6TH 3TIDB 3MRMB 4BSWB 4DW2H 3HZYB 4ZQKB 5D1ZC 4C4KO 1GGIH 1B9ZA 3RWDA 1YC7A 4PJBE 3WD5L 4TRPH 1NBZA 1R0AH 4RFOL 1SY6H 5J6HA 3BVNB 9CGTA 5HHMD 3GJFB 4URTB 1OAZL 4NQVB 2ARJA 3DXAD 5E8DH 4LVNC 4O2FB 1NEZG 2X1XR 3D39E 3K8LA 3O3DB 3PGFL 3P4OA 4PRIB 4GRWE 3VFUB 3K2UL 4JPVH 1MFCH 3MFGB 1MWAA 5DZOA 2XXMB 5I17A 4GAGL 5C8JB 2ED9A 1NBYA 2R29H 2HRPL 2AK4E 1W0YT 3RPIA 4OZ4B 4MX7A 4NWUH 2ARJQ 5GGUA 1J8KA 1IEHA 4OQTL 3EFDH 4ZAKC 2NY1D 1H3PL 1NGPL 1HXMA 2WW8A 1FBIL 1NCBH 2DQIH 4EJ1C 2EDJA 1HKLH 3KPRB 3SKOA 4DZBA 3OWEA 5MEPA 2VLLA 4FXGB 5EA0H 5DK0A 4KDVA 5CCKL 1IEAA 2G75A 3QZWG 4MXQD 3ARTA 4AT6A 1P9MC 4PJGA 5AWNL 5I1IH 4MA3B 1K6QL 3GSWA 3GSNH 2QEJA 1FL5B 1CE6B 4G7YL 1ZGLA 2VLJA 1G9EA 4NN7C 5GRUH 1FGVL 1KCVL 3TF7C 4PGCA 4U6XB 1LK2A 1BQHG 2WLZA 1N8ZB 2AJSH 4NYLB 5EO0B 5TE4L 3WXWH 1JGVL 4MA7L 3G5XA 4RMRA 1KGCE 5BS0A 1IT9H 3EOAA 3CFDB 5JQ6L 1UT9A 5LWYH 4AG4L 2AJXH 5CP3A 4HUNB 3LD8C 4M1GL 3WFEL 5HYFA 1S5IL 3DSFH 1A0QH 3MX0A 3MNWA 4R7NB 4Y1AB 3FTGA 4K7FB 3B5GA 3TNNB 2D7TH 2APBA 3MLPA 4C83B 2EC9U 3C6LB 4ODXB 5C2BL 4C56D 3BIBX 4CU7A 2L4OA 1TPXC 2AJZB 1MI5D 3LIZH 2X41A 4OF7A 2HLFD 5HGHB 3G04A 4FTVD 3GM0A 1DQDH 3CX5K 3IGAB 4UQ2A 5FHAL 4NHUB 3DYOA 2GTZA 4HIXH 1S9XA 1S7QA 4YBLC 4PRIE 1YNLL 2YPVL 5FK9B 5JMOC 5IBUG 4YWGH 4U6HB 3Q6FA 3RVVC 4JHWL 4CJ1A 4P5MB 4LNRB 3HR6A 1HKFA 1URLA 4W6YB 2F74B 1JUFA 4OFKA 3E1F1 5EORH 2G9HA 2EIZB 2VUOA 3GJEB 2V5TA 3TVMD 3VXOB 3BHBB 5A2IH 2AP2A 2BNQA 1OWRM 1JTTA 3QEQA 3WEXB 3QH3A 3EGSB 1KOAA 1RZJL 4MS8D 2DQDL 2GJ6D 4CMHB 1AI1H 2X4NB 4OLZL 4NWTH 2MHAA 4MA8H 3JV4A 3VD5A 3MOAH 4X0KB 1EBAA 4Q9QL 4PJFE 1CI5A 2NY1B 5KVGH 1IM3A 1GOFA 5D1QB 4NZDA 4PGZA 4F15C 3ILQD 1BF2A 3ZDZF 3EOBB 3UTSD 2C3HA 3L3OA 3MRCB 4P0DA 2EC8A 3GSQA 2VLKA 1NMBL 4X9GA 4L3AA 1U8KB 5IFJA 1BBJB 2UY6A 2X89D 1EA9C 4ZPTB 2CJUH 4HGMA 5L0QC 2HFFB 5B8CA 3E0GA 4FQ1L 1GIGH 1J18A 5C0DB 1PLGH 1TITA 1I1AC 2O93L 3STLB 1FNAA 1AFVH 4MCYB 4XCNA 1VCAA 3WS6C 3BPOB 3GFUA 5C0BD 4NBXB 1NPUA 2MJWA 4Y1AE 4Z5RB 5F9JA 2BDNH 2VDPL 4HWUA 4Y4HD 1LO2H 5D7JA 5HI3C 5SWQA 3FRUB 3TBVA 4XXDA 1A64A 4GG6A 5LG1A 4ESKA 3LKQB 4UDTA 5JIKA 1U8JB 1XGRB 1KSRA 4QWWD 3VI3F 4NO0A 2XRAH 3QZWB 3GRWA 4UT9L 4X83A 2FX9H 5FCUL 2G2RA 2CDEB 5D9SA 3QJHB 2DQUH 3ZYZA 4ONOA 5CJQH 2QV2A 3SPVA 4C56B 4X4YA 3V8OA 2JJTA 1MI5B 1DLHB 1CGYA 1I9JH 2Z9TA 1O7SA 4FTVB 1HZHL 4R4BA 3ZHKA 1K2DB 3IJSA 4YK4B 1BQHB 3EUUA 1UCBH 4WWKC 3CFKA 2WM0A 1TZGH 4Z7QE 1I4FA 5D93B 2FJHA 2HKFL 4XZUB 3TBSA 3VFPB 2I5YH 3RX8A 3VWKA 2DI7A 5E5UB 2QBWA 1ES0A 4JQXA 2VQ1B 4N8VA 4MHHG 4A2MA 1D5ZA 3DUUB 1B90A 4TUOA 2EKSB 5MENE 1JNLL 2VXQL 2FB4L 3TVMB 3AC0A 5I8KL 5L7XL 3BZEA 1QSEA 4ZXBA 5J89A 1MY7A 1J88A 2GJ6B 2M8XA 3B9DA 3VDAA 5D6DC 4JZNA 5TQ0H 5IBUB 2YS4A 3L1OL 3QCUH 1F13A 1NDGB 4PIRF 1H3WM 3JSSA 1AD0A 4LQFL 1A7RL 4PJBA 3MRGB 3CVHL 4WTXA 2OJEB 2SEBA 2VZSA 4M7LL 3QHZL 1O0VA 4G7VL 4CBPA 2AXJA 4LOUD 3CFEB 1XGQB 4U3XA 3UTSB 4P48A 5DD0H 4C54A 1X5XA 4AQOA 2C4XA 2FIKA 4HG4K 1RIHH 2ADFL 3D39A 4JG0H 5IR1B 5JPNB 4MJ6B 1UZ6F 1JYNA 1JRHH 2XQYK 3VMNA 5GGVY 1GAFL 3VXRD 4N90D 4YXLH 3AAZA 2YZ8A 2ICCA 4NUGL 2AK4A 3K7UA 1PZUB 3OB8A 4HUXB 2DQCH 5IFAL 3L3KB 3S3SA 1FHGA 2A77H 4KVNL 3OJVC 4NQEA 3ZL4H 4K3GA 2WBJA 1RUMH 4Y4KC 3NIFE 3FMGH 1CFNA 1J8HD 3UROR 3W39A 4H26B 4KJQC 1LEGB 5C0BB 3BXNB 4OT1L 4JEGB 3GBLA 4NQCD 2YMXL 5F7EH 4JZJB 4NQDD 1CG9A 5JW4Q 3LS4L 3FCTA 2AEQL 1HH9A 5L8JB 4Y4HB 2LTQC 5CP7A 5CJBA 1I9RL 4KI1A 4Y5VB 5F72S 4LSPL 3BPNC 3CK0H 1REIA 4M7LT 2I9TA 3BPLC 5E6YA 4JFDE 4J3TA 3ELAT 2ADGB 1UEMA 3UBXB 4HPYL 4N0FB 1DJSA 2JK5B 4LLVA 1GGCL 4U1HB 5AAMA 1DVFA 3CC5B 1CXFA 1JNNH 2JCCB 4GT7A 4X9BA 5FOJA 5GZOD 3OAYK 3GMPA 3DPBA 4BH8A 4HJGB 5FCSH 3T0ED 1KCRH 3BGFC 1FFPA 1NUFA 3VGBA 1OF2B 3P4NB 1S9VA 4TSAL 4HPOL 2JTDA 3LKSB 4J6RL 1IM9A 1AQDB 4MB3A 3JTTA 1B2WH 2FJGB 2GJ6E 2BHUA 3TO4C 4KKLC 3TIDA 3MRMA 4BSWA 4X6DF 3HZYA 4ZQKA 2VAAB 1QYGL 2HTKC 1T2XA 1XGPB 2DM2A 2Q76B 5JPMB 5SX5K 5IVXB 2KDGA 4P4RB 1JYWA 3GJFA 3O2DA 4NQVA 1U8NB 2E6JA 4OM0L 4R3SB 4XC1H 3PXHA 1HE7A 3NA9L 4UB0L 4PY8J 2JELH 3UTSE 3TN0D 4O2FA 4YUEH 5E6ZA 3TH3T 3G5VB 5HGBB 4PRIA 1DCLA 3VFUA 4N0UE 3WSQL 1U3YA 2YK1H 1SVZA 4OD3L 5C8JA 2B1HL 1S7RB 3O6FA 4RGMC 4OZ4A 3LH2L 1CLYL 1L9NA 3RWHB 4I8DA 3SE9L 3CXHK 4OM1L 3ROLB 5EULV 1DQML 3X12B 5C0BE 3T65B 2EEBA 3P30H 2F8OA 2DQGL 1UWEL 1C5CH 5SX4H 3ARXA 3KGRA 1KN2H 3KPRA 3QHFH 3ULSB 3MCKB 5FGSA 5IEKB 1RURH 4X9HA 3VXRB 4FXGA 3R0MA 4G6FD 4OGYL 3O2VL 4R97C 3FONA 5C7XL 2YD3A 2HKHL 3QUXC 4KKCC 1G9NH 1DFBL 4JY4A 2VZOA 4NOBA 4PJFA 5KOMC 4MA3A 1J8HB 3UEZA 3SQOH 2P8MB 2O5ZH 1FL5A 1CE6A 3QPQD 1KIRB 1ZS8B 4FZ8L 4NQCB 1KV3A 1J1OL 4WI7A 4NQDB 4NQUA 2HT4D 4JN1H 4U6XA 1ITBB 2CIKA 3L3JB 1N8ZA 3L9RB 1T7YA 4BZ2H 4NYLA 2C5DC 3I50L 4I3RL 5EO0A 1T7XA 3S35X 2CD0A 1EO5A 3CFDA 1LE5B 4YHLL 4LSRH 1ADQA 4M6NH 5F9AC 4OUUB 2LVEA 4M7JH 5ENWB 4QRQB 1KEML 4R7NA 4XX1G 3JWOC 4Y1AA 4K7FA 2VNCA 5D96C 1TTGA 5DXWA 3TNNA 5IVXE 2QQLL 4RQQA 4JY5H 3C6LA 2MFNA 1FGNL 5LGKA 1VHPA 5DTFB 1L0YA 5HGHA 3T0EB 4LNVA 4LSSL 3IGAA 4NHUA 2OS7A 3UC0L 1NFDB 2FH8A 1D7FA 1EHLH 5I19H 3KPLB 5FK9A 4N9OB 3BYTA 4U6HA 1JNJA 5T5NF 3O11B 3PP3H 3ZYOA 1YY9C 4LNRA 2VLME 3K74B 4LSDA 1ZLVH 2PXYC 2F74A 2H26A 2DWEB 4PJ8C 5E0QA 2EIZA 2AJ3B 4YFLF 4L8DB 3RJDA 3CFIC 4R9HA 5GRYA 5CEXB 2BFVL 3VXOA 4HZAA 4JFPA 5T1DL 3T1FB 3TN0B 3WEXA 1MCCA 3BEWB 5B22A 4NJ9L 1KTLB 2C9AA 3MV8D 3S9DB 4R4FL 1PSKH 5I18H 4NN5B 3VXRE 5A3ID 4N90E 4KWUA 2BVPB 1I85C 2UZYB 5DQDL 3R8QA 3CVIL 1EJOL 5HY9B 2W9EH 1M05B 3E6FB 4FP8L 5JZ7D 2B39A 4X0KA 4KHXL 1T6WA 3LN4B 1J8HE 3BD4A 5D1QA 4OZGB 4XPAH 3BKYH 4X7SH 1G7IB 3EOBA 4NQDE 1RUPH 4K7PH 3PWJB 3MRCA 2VDQL 3SO3B 4GXVL 1NEZA 4YC2C 3SCMD 5BV7L 1WGOA 4G6FB 1R24B 4ZOCA 1U8KA 1BBJA 5D5MF 4ZPTA 4XPGH 3RUGB 1HHJB 2HFFA 5C0DA 4Y2DA 3RU8H 1SY6A 2CRZA 4YHOL 4OCSL 5EDXA 5IHLB 2NX5B 3AREC 5FYLL 4PS4L 3GB7A 2WK2A 1ZAGA 4P46C 1YUHB 2MNUA 3RVWC 4EBQH 3VDBA 1X3DA 2NY4D 4L9LC 2IQ9L 4R8WH 4HWNA 3T4YB 2H45A 3FRUA 3T0EE 1V3LA 4UOW1 3LKQA 4X6BB 3AS2A 1U8JA 2BVQB 3F8UB 1HEZB 3LPFA 1DQJB 3QZWA 1UM4L 4HWEH 1F4WH 5IJKC 3ZHDA 5FA4B 2DJUA 3V0VB 2CDEA 5K9QI 4YX2L 4IRSC 3QJHA 1B4JH 4WIQA 3QIBA 3PV6B 1INEL 5L8LB 1DLHA 2B5IB 2IPTL 1MVUB 4FTVA 1U92B 5E5RB 2BSRA 3U48A 4F7MB 1CQKA 1DP0A 1K2DA 4WUUD 1BQHA 1FVDB 3MXWL 4LLYB 4LEXH 5GS0H 4JFDA 4OKDA 2IG2L 2ICWJ 3HFMH 5GIRB 5F70A 3GHEL 4KRLB 5DD1L 3VFPA 4XZUA 4UUJB 4H8WL 2LV4A 3KJ6H 1HYRC 2VQ1A 4GW5B 3UZQA 1CK0H 4NZTH 4OLWL 1TIUA 2H41A 3BX7C 5F9OH 4WV1C 2PTVA 3DUUA 3NABL 1OL0A 5FUOH 2F5AL 5CD5C 2LU7A 4OZGE 3NCYP 3TVMA 4XVSL 3MV8B 4TTDD 3OKOA 5IMMB 2GJ6A 1ERNA 3G5ZB 3SQBA 3ZE0E 1NDGA 3UPAA 1CD1B 2WANA 1MFNA 5J11B 1MRCL 3VDCA 3BIAX 3D2UD 2OJEA 2YUWA 1IGCH 3MOBH 4I5BA 2OJZL 2NX5E 4JO1L 3S98A 1XGQA 1A6ZA 1JHLL 3CFEA 5DO2D 3UTSA 4IRJD 5DA4A 3SGJC 5IR1A 5JPNA 4MJ6A 1ZHBB 4N0UA 4GBXD 3SCMB 3T2PA 3MJGX 3P11L 3QULB 5EUOB 2X89A 4HS6B 4PLKC 12E8H 3KG5A 4HUXA 2APXA 4N1HB 4N0RA 1LDSA 5BMFH 3L3KA 1WFOA 3CZFB 4F9LC 1YEFH 4Q6IC 4MXVF 3MROB 4ELMB 4D8PA 5HHXL 4HC1H 1A7QL 5IVNA 3CDGB 1LEGA 5C0BA 5DR5H 3ARSA 3BXNA 3K3QA 4JZJA 4DCQB 4M6ML 4MLSA 3Q3GB 2NY4B 4Y4HA 4NKIH 3QO1B 1I7ZB 3D87B 4Y5VA 4PV9B 4HS8H 4YGVB 3QDJB 3T0DA 5I71B 5IB4B 2IBZX 2BJMH 1D5XB 1SEQH 2VISB 4QRTB 2LU4A 3AY4C 2F19H 4LRNL 4OIBA 5TE6L 3MMEB 1FRGL 2UUDK 5EZIH 4RWYH 2JK5A 2H9GB 4M93C 4U1HA 2VDML 3CC5A 2X9XA 3QEGH 4QOKD 1BM3H 2VWEC 1C5BH 4XX1E 3VXUD 4LDLB 5J4MA 2L0DA 1G7JB 4HJGA 1JN6B 1OF2A 1LMKA 3P4NA 1Z9SA 5E8OB 4MJIB 2Y36L 4TVSa 4WUUB 3LKSA 1DBML 3NTCH 4K8RD 4YHYC 3MV8E 4K94L 4EDWH 4DN4L 1G1YA 3WBDA 3BRFA 2FJGA 4N0YH 2NY6D 4HIHB 1YYLH 5TF1H 3V4UL 5GHWH 4QHMA 5KVEH 5DMIH 4X7CC 1CGVA 1AE6L 4J3OC 4WI4A 4IDJL 1XGPA 4CN4A 3F7PC 2X09A 5JPMA 3MBXH 3KHOA 5IVXA 5C6TL 3SE4A 2DLIA 1DEDA 1QKZH 4LMQE 4DW2L 4XNXL 4P4RA 1IGTB 2YD9A 2DIBA 1T83A 3BMWA 4YZFE 1U8NA 4ZFOL 1GGIL 3OAZH 4R3SA 2J5LB 5H37H 1KIPB 2HT3D 4TRPL 1R0AL 1A3RL 2EDFA 3G5VA 5HGBA 3LZFH 1MHPL 5D7LD 3FN9A 1OTUC 3K8KA 5E8DL 4BK5A 1B0GA 1R5IB 2XA8H 3BGAA 5DD3H 1S7RA 5EUOE 3BKCH 2FWOA 2JB6B 2VXTH 1IL1B 2NW2B 3D2UB 3H9YA 4JPVL 8FABB 4HGWB 5J7CC 5J56B 4ELME 3ARDC 1A6VH 2R29L 3ROLA 2Z8VC 2GJZB 2NXYC 5EZOH 4NWUL 3T65A 1RZJC 5A2JH 4IRJB 1VERA 2NY5C 4G3YL 3QQ9D 1YEIL 3EFDL 2AEPL 5JDSB 4RA0C 4KUCF 1PG7W 4GBXB 3ULSA 3MCKA 2ZUUA 5IEKA 4MJ5B 3VXRA 3HC4L 4WTZG 1NCBL 3I75B 3QDJE 2DQIL 3IDIB 3P0VH 1UJ3C 4H20H 2ICES 5H94B 1CL7H 5EA0L 1J8HA 2P8MA 3UPRA 4KFZC 5IF0B 1KIRA 1CVSC 1ZS8A 4NQCA 5T33H 1IKNA 4HUMB 4NQDA 2DD8H 1YEJH 5J1TC 3CAFA 3GSNL 1CR9L 2V5YA 2FIRT 3L3JA 5HDBE 4MJIE 2E3VA 2GT9A 3L9RA 4X80L 3C08L 4RMTA 3VFWB 1LE5A 3VD3A 3FRPG 4OUUA 4Z7WF 5ENWA 2AJSL 4QRQA 3WXWL 3AU1B 1MLBB 4QOKB 5T5FL 1IT9L 3WJLA 3DECA 1JF1B 3DURB 4Y8DC 3DSNA 3FB8B 5LWYL 1BZ9B 3PIQB 3GDBA 4RA3A 5EUKB 1U2HA 3QEUB 4WI8A 4HSQA 5GS1B 2AS5M 2XKNB 5DTFA 1RPQA 4PP1D 3T0EA 3FQWA 1XIWA 1SBBA 3BN9C 1A0QL 3EHBC 3MV7E 2YD4A 5GJTH 4D9QD 5C86A 2CLZA 3OKYA 3B2VH 4I18C 3KPLA 3LIZL 1C1EL 2NY6B 4PJGF 3QUZC 2LVCA 2P5WE 3TLRA 1S78C 3O11A 4GUPB 4J3SA 1T1YB 4HIXL 1FVEB 5FO9B 2DWEA 3IU4L 3ZLQC 3C60C 1NAKL 2AJ3A 4L8DA 5DHVH 3VFMB 2DQJL 3SY0B 2RCSH 3T1FA 3TN0A 4XMPH 1F8TH 1MELA 3BEWA 5EWIL 1QLFB 4YHMH 3ZE1F 1KTLA 4FS0A 4QCIB 4BA8A 2K9UA 3HR5B 5DUBB 4L4TD 1AC6A 4LAQL 1T1WB 3WL9B 4LKXB 2BVPA 3VG9B 4D9RD 4PLOB 5EU6E 5HY9A 2HA1A 1A47A 1M05A 1P5UA 1AI1L 4OD2B 3LN4A 4LLWB 4OZGA 4R2GD 4NWTL 3REVA 4XPFH 4MA8L 1G7IA 1NMCC 2FLBT 3DRTA 2RAMA 4I3GA 3MOAL 5GZNC 3PWJA 3RTQD 3KXFD 5HVGB 1GZQA 1R24A 4PR5B 1HHJA 2GKIA 4KDTA 1E6JH 2ERJB 3SDCD 2RBLA 3QEHB 5C07D 2Y9RT 1HXYB 5MEOB 3FT3B 3OR7B 4APQD 1AGBB 3UAJC 1CGXA 1L7TH 2NX5A 2D9QB 4DOHB 1VEOA 2PCPA 1FNSH 4FFWD 4QOKE 2VSCA 4YDJB 3HE7C 1GIGL 4L4JA 5BW7C 1PLGL 2Z8WC 3R0NA 1YUHA 1AFVL 3U83A 2Y5TA 3T4YA 5IOPB 6CGTA 5JNYB 3QIUD 4WY7H 4OZHB 4JRYB 4LVOC 5CEZD 4CW1B 4X6BA 1DBKL 2BVQA 1DBAH 1HEZA 2BDNL 1X5IA 3MACH 1IMHC 1DQJA 1ED3B 2EXWC 3O3UN 4QTHB 3EDEA 1OLZA 1XF1A 3QUYD 4RX4D 5JIHA 4UZGA 5DMGD 5ITBH 3V0VA 2G5BB 4KH2A 3PJSB 3KPSE 4YDVB 3BE1L 3PV6A 3QDGD 3PWVB 4KKAD 3NCMA 4RMUA 2FX9L 4MMXC 2X4PB 1MVUA 3C5ZD 1U92A 1NANI 2MCG1 4F7MA 1FDLH 1FVDA 2EH7H 4LLYA 3EYQC 1RULH 2OR7A 1U8IB 1I9JL 2OBGA 2X2YA 3BUYB 4Z0BH 5GIRA 5F96H 1WC7B 4UUJA 5I75B 4X4ZA 4KROC 1UCBL 2R4SH 4LPTA 1KELH 1CGTA 3WFDH 1DANT 3IDGB 3QYCA 5E94B 5EU4B 1LO3L 1FG9C 4OI7A 2J6EL 3GEWB 5KG9B 2I5YL 1QA9B 2XIDA 2Y06L 4GG6F 3LS5H 2CDFB 2E9BA 3TCXA 3CLFH 3WO3B 3UYRH 3MV8A 4ZMAT 1WZ1H 4EEEA 5IMMA 4L4TB 1KB5B 2OZ4A 4JZOB 1Z6JT 5HJ3B 3G5ZA 5I15H 1SJXA 1CD1A 4HCRH 1F4YH 4F33B 5FAAA 5TQ0L 2H2SD 3DNKA 3QCUL 5ACZB 1EK3A 3TP4A 4MNGB 4C57C 2P8LB 1VESA 5J06A 1JZ7A 3RAJH 4JM2C 1MF2H 3RTQB 3KXFB 4ZOBA 5ICYB 1ZHBA 3UYPA 3VFTB 1TNMA 4JRYE 1MRFH 5EZLB 1OQOA 4W6XB 3QBTB 4PGBB 4G80B 3QULA 5EUOA 4HS6A 1RIHL 4JG0L 4H1LB 4Y4FD 5DRNB 1A7OH 1JRHL 2JB5L 3CZFA 3SDCB 4LDEB 5C07B 5EG6C 1K8IB 3WIHH 3MROA 4YXLL 4WW2B 4APQB 4ELMA 4G8GD 3CDGA 3VW3H 2DQCL 2A77L 3ZL4L 4DCQA 5IP4A 3TA3D 3QXTA 3Q3GA 1KLFA 3FMGL 3QO1A 3QIUB 1I7ZA 1LP9B 4IIQC 2DBLL 3B5HA 4PV9A 1KYOK 1MHCB 2FECL 1JVKA 5FIEA 3C6SB 4UT6H 5F7EL 4YGVA 3QDJA 5DYOB 3BQUC 5IB4A 4D9QE 4RGOH 4PJBF 1D5XA 3DOSA 1CN4A 1V7NL 2VISA 4YHIB 4DFHA 4DUVA 4QRTA 2QHLA 5ESVB 5F1SA 1A21A 3CK0L 3MMEA 5C0JA 2CSPA 3QUYB 3A67L 2H9GA 2QR0B 4PJ9C 4P9MH 3DARA 3DX8A 3G6DL 3ULUD 3RA7H 3QDGB 1F3JB 4GRWF 1HILB 2AQ2A 4KVCH 5F6HI 4L4VE 1G7JA 1JN6A 3C5ZB 4TULL 3GI9H 3RGHA 1CXIA 5E8OA 2G5RA 4MJIA 4NJAH 1JNNL 4RDQG 3ZDXE 1YEGH 4PJEB 1P4BH 3RWIB 4L4TE 3EIFA 4HIHA 3KAAA 4P2YA 3DMMD 3IDYB 5CJXC 2Z31D 4K9EH 1QPPA 1B2WL 4KXZH 4LSVH 4HLJA 4KMQA 1IGTA 2VE6B 1BJ1J 4MNGE 3EOTH 1IC7H 1MCBA 1RU9H 4WDIB 1KIPA 1BZQK 4OAWB 2D0GA 4NT6B 3LMJH 1JZ2A 4WFFE 3QRGH 3I9GH 4FQ2H 1R5IA 2HFTA 3OHXB 4YUEL 1CE1L 3FOMB 1XGTB 5EC2B 2JB6A 3EO0B 2XFXA 1I7TB 2A9NH 3MNVB 3QCVH 8FABA 4HGWA 2GUOB 1FZMB 1U0QA 2GJZA 1FNHA 1T89A 2ICWB 4YPGA 1P7KB 3PP4H 1QD0A 1KN4H 5JR1L 2E7LA 1IARB 3NVQA 4BK4A 5JDSA 4JDTL 5FGRA 2N4IA 3MLVL 1E6OL 3QIWA 4ODBD 4MJ5A 1G7QA 3TNMB 3P30L 5DEZA 3I75A 2NXZD 3CIQA 4OV5B 3IDIA 2EXYC 5D4QA 4I9WD 3WN5B 1WZMA 1KN2L 4Y4FB 3MV01 4WI2A 3QHFL 1OSZA 3GMRA 5H94A 5I8EB 3SJVE 1PW3A 2GY5A 4G8GB 1QLEH 5IF0A 4ZYKB 5BV7C 5AD0B 1G9NL 3NACH 4NBYB 4OF3A 3TA3B 1MVFA 3MRKB 1QFHA 4JG1H 3LDBB 3SQOL 2CKBL 1V3JA 5E08H 5GGTA 5F1KC 1F02I 4BQ9A 4WRLA 4M48H 3VFWA 3CNKA 3DVNB 3LRHA 1RJYB 2EDRA 3Q2CA 1N0XH 2A6KB 2YSSB 1D9KC 2V7NB 3BO8A 3O4LE 1NLDH 1PX4A 2M1KA 3AU1A 1F3DJ 1MLBA 4QOKA 1G1CA 2AJVH 4MA1C 1JF1A 1KJ2B 2FD6L 3G6AA 3GK8H 1BZ9A 3PIQA 5EUKA 3TPUB 3QEUA 4M7JL 5GS1A 3PWPD 2XKNA 4Q6YA 3D3VD 1T66D 4FQXB 2NMSA 3KPNB 4UIKL 1MWAL 3V52H 5D1XC 5CHNB 1VADA 2D7QA 2X4RB 4K71B 3ZSTA 5CGYC 5AYUH 4PJFF 2Y6SC 4GUPA 4RSVA 1IBGH 1T1YA 2Z31B 5EFIB 1WCBB 4U1GB 1R3IL 4A6YH 1EHLL 1FVEA 5FO9A 2B2XH 3SBWC 5I19L 3BPCB 1ZVHA 2IWGA 2YR3A 1DN0A 4NP4L 3DI2B 3V6OC 4M3JA 3VFMA 3UTOA 3WHXB 4XXCA 3SY0A 1RFDL 2XWBB 2ZG1A 4IMKA 2Q86B 5A2FA 1QLFA 5DZLA 1UADC 3CCHB 3HR5A 5DUBA 4H8WC 3VXPB 2A6JB 1T1WA 3GI8H 4LKXA 4JGUA 3GJFK 1IILE 1GYAA 1H3GA 1WF5A 4H25B 5I18L 4D0CB 4NN6C 4OD2A 3HB3C 4LLWA 5F44A 2OP4H 2AQ1A 4LLMA 4UV7L 4KQ4H 1B6DA 1D5MB 1A6TB 1T22B 4FRWA 4GS7B 5FGBC 4XPAL 2XY2A 3BKYL 3NPSB 2Y7QB 3AS0A 2NXZB 2PTTB 5HBBA 1RUPL 2BHYA 4K7PL 3MJ9L 2DMBA 1UWXH 2YWZA 3QEHA 5MEOA 1HXYA 2PR4H 3FT3A 1INDH 3OR7A 5FYKL 1AGBA 2RR3A 4JFQB 4XPGL 4YDJA 2WINB 1EMTH 2AW2A 5I73B 1ZANL 2IPUG 1MJUH 5HDOA 5IOPA 5JNYA 4JRYA 4Z7QF 4R26H 2AJUL 4CW1A 3H3PH 4U1LB 3HZVB 4WTZA 3IKKA 4BQ6A 4CKVX 3O4OB 4R8WL 3P77B 2E8YA 4QTHA 4XP6H 3TYFB 5B39B 2COQA 4BFEA 4DZ8A 4QXUH 4JLRB 2D7MA 2GTWB 4G8EB 1YEEH 4AEHH 3T08A 2G5BA 5JXEA 4YDIH 3BYYA 3GSUB 4YDVA 1F4WL 3TJHC 1SJHB 2XACC 3PWPB 2X4PA 1Z2KA 3D3VB 4MD4A 4PG2A 1CDGA 2DLTA 5LBSL 2ATPB 1B4JL 4OCXL 1TVDA 3UJIH 3SDDC 1TTUA 2B20A 2VH5H 1U8IA 3BUYA 1DZBA 4KK6C 3FRPA 2W07A 1QQDB 4DEPB 4ODUB 1WC7A 2GY7B 2J8HA 3PHQB 3BIKB 1WIUA 3VH8B 4XCFH 4FQCH 3MLWH 3IDGA 3HFML 4KRNA 1U3JA 2FX8L 5E94A 4L3CB 5KG9A 4L4VA 3KJ6L 1QA9A 2VZUA 1JHKH 1PYWB 4JE4B 2OTUB 1CFSB 3HG1D 1CK0L 2R1WB 4S0TD 5F9OL 1GVIA 3OQ3B 2NW3B 3VFGL 4L4TA 1LVEA 1KB5A 5GGSY 4JZOA 5HJ3A 3LY6A 4XPTH 1NCDH 3GZKA 3MJ7B 3T0WA 4M5ZH 4F33A 3IVKB 1D6VL 3TPKA 3BKJL 4CRPA 4EIGB 5TPWL 1N64H 5ACZA 2EDYA 4MNGA 3WO4B 2P8LA 5TGBB 5EOCH 4NN7B 3QHTC 3HHRB 4KY1H 3RTQA 3KXFA 5FYJH 5ICYA 3CDCA 5GRVL 5HI3D 3WYRA 2PYFB 3VFTA 4L1HA 5EZLA 4PGBA 5CINH 1JFQH 3M07A 4UNVA 5F89B 1YC8A 1PKQB 1IJ9A 4H1LA 4IOIB 4M1CD 2EYTB 3RL1B 5DRNA 4FXLA 1RVFH 3P0GB 5D71H 1EUUA 3SDCA 1WBZB 3VFSB 4P59L 1M7DB 4U7SA 3DJ9A 1A14H 1K8IA 1C5DB 2VZTA 4WW2A 4R7DA 3HMWH 3V0AC 3QNYA 2XICA 4P2QE 3WJJA 1CXLA 3I6GA 4GRLD 3MC0A 2ZSWB 1H8OA 2APWA 1YEFL 3S36L 4EN3C 1A7NH 3M17B 2F54E 3QIUA 3NH7H 4HC1L 3WHE1 3D3VE 4TTGA 4DQOL 1MHCA 3W9EB 1WFTA 4YHIA 3K2MC 4NKIL 5JDJA 1PQZB 2NYYD 3IDJB 5ESVA 2E9IA 1A22B 4HS8L 5I74C 3IXAB 3QUYA 3GMLB 1A3QA 3MJ6A 2QR0A 5BQ7B 2V9RA 2BJML 3OMZA 1SEQL 1BP3B 2F19L 1T5WB 3FO1B 1F3JA 5C9KA 1HILA 4UOW0 5EZIL 3HNSH 3C5ZA 3QEGL 1BM3L 3U9PH 1HYSD 1C5BL 4NO2B 5EIIB 4PJEA 5HGDB 3RWIA 2HT2D 2AI0H 4S1SH 5IBLC 1MJ8H 1A9BB 1FFOB 1UH4A 3O4LA 2J8UB 1U3HD 3IS1X 1BJ1H 3MBEC 4MD5B 3NTCL 3QUMH 4EDWL 1IEBB 1GSMA 2BP3A 3CJJA 4Q9CA 4JQIH 3RY5A 1WFNA 3CSPA 5TF1L 5KVMC 2VE6A 1J5OH 5GHWL 4WFEE 3QQ4B 1IAKB 5KVEL 5IGXL 5D8JH 2YN5A 4WDIA 3HG1B 4OV6F 4OF0A 5KN5B 4OAWA 1QKZL 1QVOB 2A0LD 4XNYH 5T3XL 2OTPA 1EBPA 5HHPB 2YHGA 3OHXA 2WUCL 4UOJA 3JTSA 5L0QB 3FOMA 3I85A 1XGTA 1A6WH 4D0DB 2ZPKH 3QB7C 1G6VK 2X4TB 1PKQE 1KB9J 1I7TA 2OK0H 3MNVA 1UFUA 2DI9A 1JE6A 2GUOA 1ZT4B 5HGGS 2BC4A 5IHZB 2BERA 3ZKNC 1FZMA 1FNFA 4NZRH 4NQSB 2VXTL 5FB8B 2ICWA 4NC0B 1P7KA 2AERT 5HYSG 5ALCH 3I6LD 3QWRA 1A6VL 1NCWH 5EZOL 3TNMA 4HHAB 3L5XL 4X7DC 4OV5A 4LASL 3WN5A 4JO4H 3X13B 4AEIL 3IDUA 1CXHA 3QI9C 3B43A 3WV0A 4WEBH 5I8EA 2O61A 4G8GA 5HDLA 1BAFH 1AO7D 5H2BB 4XNMA 1WTGT 4GRLB 3T3PE 1I1RA 1I8IB 4ZYKA 4H20L 5DF0A 3RQ3A 4MAYC 1Q72H 3TA3A 4XNZC 3MRKA 4JPWH 1CL7L 2ZKHH 3N9GH 3WDJA 2PUQT 5T33L 4O51B 5LGHH 3ET9F 1NBVL 4GMSH 4HCRA 3OXSB 3DVNA 5ISZD 1RJYA 3L5JA 4JHZA 4KKLD 3OKKB 1CLCA 3ARFD 3HE6C 4TPRL 1DBBH 2YSSA 4OGXL 2V7NA 1G6RB 1NC4D 1JRHI 2J8UE 3BKML 2H2PD 3D85D 4KZEL 1L6ZA 1ZT1A 4I0CC 3RWJB 3TPUA 5F6IC 3JV5A 3F12B 1CGWA 4FQXA 5F71A 4LSTH 3VGGA 1FIEA 3OKMB 5CHNA 2X4RA 2FECI 5TJWK 2PW2B 3CFCH 4M43H 4CGTA 1TZHB 3ULVL 1U3HB 1FNLA 2Z31A 1RUQH 2HG5B 2VLRB 5EFIA 4LP4A 1VEMA 4MVBC 5GJTL 4MMZC 2GFBB 3BPCA 2FGWH 3VJ6B 1NGZA 4EOWH 2ZUSA 3TEUA 2NY7H 3HKFA 3JWOH 2VRAA 2XZAL 2XWBA 1OTTC 2Q86A 4S0SD 3DLQR 1F6AB 2AAVA 4J3UA 3CCHA 5BRZE 4NNXB 5EBMB 4X6FB 3VXPA 1CCZA 2A6JA 1FV1B 2P45B 2Y72A 4W4OA 3ZDZE 4EQ3A 2P48B 5C0RL 1F8TL 5DQ9B 2KKQA 4YHML 5HYQB 4NKOA 4ETQB 1ZOXA 3FJTA 4H25A 1M71B 4D0CA 4QO1A 4ZDHB 2CMRH 1QR1B 3H7LA 2DICA 4PJDB 3SGEH 1AGFB 1DR9A 3D0LB 3C87A 1D5MA 1IC1A 2PTUA 1HSAB 1KC5H 1A6TA 2XWJB 4KJWD 2YKLL 1T22A 2MKWA 2Y7QA 3P4LA 1TJHH 4RGND 4KAQH 3O2WH 4XP1L 5BVPH 1E4XH 3H2WA 1PBYA 4PV8A 3QUMB 5FA3B 5AEAA 5DWUH 1S7XB 3OF6A 4IRZH 3ARBC 3LEYL 1HIMH 5DFWH 3WLWC 1ZTXH 5FDWB 4JFQA 2EO9A 4K7PY 1HWHB 5CKAA 2WINA 2F5BH 3HPJB 1KT2B 1RZFH 4I0PC 2GK2A 4QHNB 1BVKB 1QFWM 5HYSB 4GAYB 1L7TL 3C2AL 4MQXD 2DDQH 2IH1A 2FHFA 3HZVA 3ZTJG 3EO9H 1NCUA 3P77A 4YEEA 4NUJB 4WY7L 3ARFB 1NAMB 3FB7B 4HWBA 3TYFA 2UWEE 3JV6A 2BXYA 3B8YA 3WFBH 5B39A 5C71A 4DUWA 1NC4B 4OZGF 4DTGH 4JLRA 1LWRA 4G8EA 1ZHNB 2GTWA 2V5SA 3D85B 2VLRE 3KPQB 3EDKA 3MACL 2P44B 5L6YH 1MUJB 1RK0B 3Q1SH 5CLTA 1W0WB 1SJHA 3PWPA 2IPKB 1VGEH 1PG7H 2F54A 4WCYL 1Q1JH 4U2ZA 3D3VA 4XCCH 2QSCH 3ZE0F 1J10A 1TLKA 1CBVH 4EI5C 1CD9B 3TZVC 3EO1B 3TCLB 3O0RH 3O8XC 3V8CA 4HUWB 4X5LA 1YEDB 3OGOE 1QQDA 4ODUA 1FDLL 4ZFGH 3RHWK 2EH7L 4RBPH 3PHQA 1GJIA 1S7SA 5JOPE 1P4LB 1WIOA 4Z0BL 2WWMD 3VFRB 1AHWB 2IANE 4N9GB 4L3CA 2R56H 4JFYB 1CICC 2VQTA 5IVOA 4PJDE 3P40A 2OTUA 1CFSA 2XG5A 2R1WA 4G9FD 4Z7VB 3I6LE 1QFUH 2NW3A 4KV5E 5C08D 4EVNB 4OBSA 3LS5L 3MJ7A 3A6OA 2BVUA 4R97B 2D4DA 3NZHH 4BH7B 3CLFL 1GPOH 1TMCB 2J4WL 3UYRL 4PD4J 1WZ1L 4YBQC 4UAOC 4YDKH 3WDIA 2CK0L 3B8SA 4WW1B 4R0LB 4I2XB 5TGBA 1NMAL 1UM5H 2PO6D 5ERWB 3P0YH 5DD5L 4JFEE 4WENB 1XGYH 2PYFA 4LVHB 3REWA 3R1GL 3RAJL 4RGNB 1N3NB 5F89A 1RJZB 1PKQA 1ORQB 4IOIA 3RL1A 2EYTA 4HJJH 1V8HA 2IAMC 3VFSA 1M7DA 1MRFL 4RIRA 1NDMB 1C5DA 2E7BA 5K9KB 2EZ0C 1CDUA 1P7QD 1OAZH 4G8IB 3H7BB 3T77B 2ZNWA 4YE4H 5D96B 5I6XC 1A7OL 2ZSWA 4JQVC 4PLJC 3EYVB 4CN1A 2RB8A 4MXWL 5K59F 2W0LA 4M62H 2A38A 4IBLT 2ZUQB 1J86A 3VW3L 4PREB 1W72L 3OXRB 1CU4H 3W9EA 4H0HB 4GAGH 1WIPA 1F42A 1HQRB 3SKMB 2VL5B 1PQZA 2J1KA 3RZCC 1AJ7L 4OQTH 4YZFF 4UT6L 1B0WA 3IXAA 3GMLA 4KC3B 5BQ7A 3ZMRA 1H3PH 2A74B 4OI9A 3B9KD 4G9DB 1MY5A 2PXYB 2E9WA 3KS0J 4F9PC 1MCLA 1T5WA 4M8VA 3FO1A 1R3JB 3BWUC 4MNQD 1JZ6A 5ADOH 3SE3A 1G0DA 4Z7UF 1T0PB 4P9ML 4OB5H 1CS6A 3P4MB 5EUOF 1BFTA 4Z7VE 4NO2A 2VSDA 1KEGH 3MRRB 3NGBC 1ACYH 2NY2C 3PGCB 5HGDA 4KVCL 4MB5A 1HWGB 4OLUL 1A9BA 3CH8A 4WNQB 4NJAL 4ELMF 1B0RB 2J8UA 4NCC2 1NC2D 4QHKJ 1K6QH 1DE4B 4MD5A 1P4BL 1IEBA 4YFDB 4G7YH 4FFVC 3DO7B 1FZJB 1FGVH 3QQ4A 1IAKA 4Y8AA 1WT5A 4JRXD 5E1HB 3HG1A 4O2CB 4G9FB 3EJZD 4W81A 5KN5A 5LQBH 1QVOA 5TE4H 1JGVH 4MA7H 1ZGLP 1HHGA 1Q0XH 5INDB 1WICA 5HHPA 4L8BB 2QADD 3C5SB 1RU9L 4X7FC 5C08B 4RGNE 4QHUB 5JQ6H 4MD0B 4P4KC 3B3IB 3SE8L 4BZ1H 4D0DA 1XCQA 1GCFA 5J3HC 5D7IE 3LMJL 4YH6A 4HLZG 3S4SG 3WFEH 5DEGB 4F7CB 3PL6D 1ZWIB 3I9GL 1KIQB 3W9DB 1ZT4A 3EDDA 5IHZA 3VD4A 1IC5L 3WS6A 2XQBL 3BEVB 4NQSA 3EJYD 4JB9H 4MJ2A 2A9NL 4QEGA 3THML 5B38G 3QCVL 3CFJB 4G6AD 4KKBD 4IHOB 1M1SA 3QG7L 2CLRB 1SYVB 2YPVH 1UM6H 4FFZH 3H3KA 4HHAA 1YQ2A 4GLRH 1Q9KA 5DMKB 4XMLH 2C3GA 3BISA 3MRNB 1XEDA 3OL2A 4LCCC 4Y5XB 3HNTL 1P7QB 1HH6B 5D5MB 5H2BA 4GRLA 1I8IA 1AKJD 3PP3K 4MB4A 3ES6B 4XI5C 3DHJA 1U58B 2E8ZA 3P9WB 1RZJH 4UNTA 2NY5H 4WJ5B 4KTYA 5FM4A 4O51A 1WWWX 1RQ5A 1Y18B 1ORSA 4LQ1A 3OXSA 4JG1L 3N06B 1YJDL 3OKKA 2Z91B 1QFWH 3H8NA 3ZYJA 4HW6A 2Z4QB 1G6RA 4Q9QH 3QFJD 5GS2D 1L9MA 1MCJA 4M48L 5FUCE 4J12A 4W68A 1YMHB 3IJHB 3RWJA 1OP3H 3PXJA 1AR1D 4MNQB 3UCRA 5KS9F 3F12A 1NMBH 1A5FL 1BD2D 5E9DD 2AJVL 4O2EA 3BDYH 4NM8H 3OKMA 2C26A 2VR4A 3CSBA 1T80A 2L7JA 4NKQB 3P9MB 2HVKB 4FQ1H 1UZ8B 1ZT7B 2UWEA 3WMSA 1TZHA 3BDBA 2X7LB 5JORB 4NSKB 1NC2B 3V52L 2HG5A 2VLRA 4LARL 4HIEB 2OI9C 2GFBA 3HPLB 4OZIB 2EDBA 5JUEH 1H8SA 1PJ9A 2XPGB 4X4ME 3VJ6A 3KJ4B 3RVTC 1ZA3B 1IBGL 1RMFH 4NO5B 4JRXB 4A6YL 5F6HJ 4IMLB 1UB5B 1F6AA 4ZOEA 4NNXA 5EBMA 4X6FA 2QADB 1FV1A 2HLAA 1CWVA 4KMTL 1I1CA 1E4KA 5IW6B 4UT9H 5DQ9A 3H42L 2XY1A 4BFBD 1Y6KR 5HYQA 3HAEB 1T2JA 3MCLH 5EO9B 1P6FA 4ZDHA 3VG0H 5J13C 1N26A 5D5ME 3MGOB 4PJDA 1LO5B 1AGFA 3QAZC 1HZHH 3D0LA 5B8CC 1HSAA 4QHLB 2XWJA 2ITDB 2CK2A 2A2QT 4OFYA 2O5YL 2CUMA 2OP4L 4M3KB 1K9TA 4KQ4L 1JGUH 3PDOB 1ZV5A 2HKFH 5MHSD 3AXLB 3QUMA 5FA3A 3GHBH 3B83A 1S7XA 4MLIA 4JN2B 2V9TA 1J05A 3S4SB 4KUCD 1BZ7B 1QTYT 2Q8BH 5D7JC 3IU3B 5FDWA 1OP9A 4HBCH 3EZ8A 1JNLH 2PYEE 2FB4H 1AKJB 1F4XL 4KQ3H 5I8KH 1KT2A 5C2UB 3PF2A 5HYSA 4MNQE 4GAYA 5F1IB 3GSVB 1INDL 2EECA 1OQXA 4JFEA 5GS3A 1BEYH 3EHBD 4OFVA 1EMTL 2RQ8A 4MSWB 4YHYB 3OKLB 4PBVC 2ZSVA 1MJUL 1GL4B 1UG9A 4NUJA 4DN3H 3ARFA 1NAMA 3AB0B 3FB7A 3CVHH 4AIZB 2ZOKB 1X6NA 2JJTC 4WI5A 4M7LH 1NC4A 3QFJB 1ZHNA 3H3PL 4NRXA 3D85A 4G7VH 3KPQA 4OZIE 1KLUB 1MUJA 1KTDB 1RK0A 5KW9H 2ZUTA 2IPKA 2DKUA 4HAGA 5DDHB 1YEEL 1BD2B 4J4PC 5JLZB 5E9DB 4NGHH 4YDIL 1CL7I 2B4CC 4X7EC 4JQXC 4U49A 3DBXA 2Z92B 3EO1A 3TCLA 2DTSA 4HDIB 5EU3B 1OLLA 1EEUA 4HUWA 5FGCE 3U7YL 1YEDA 4DJMA 4OIAA 1A3LL 1P4LA 2VH5L 3JV0A 4OT1H 2YMXH 1DBJL 2VZ3A 3VFRA 2NY0D 4ZXBC 1AHWA 4N9GA 2AEQH 4OCNC 4IOFD 4JFYA 3RWCB 3QA3A 2WWKO 1G9ML 1QRND 3MRBB 5IHBA 5AG9A 4Z7OE 4XCFL 4PJIF 4FQCL 3ZKQD 4Z7VA 2CRMA 2HTLD 2VLJD 4LF3A 1A4KB 1GGTA 3KR3H 4P9HL 5L2KD 3MREB 4EVNA 4PTTB 3QXDA 1CVRA 2IC2A 3R06B 3K4ZA 4HPYH 2X70B 4BH7A 5ACLA 3RKDD 4JREC 3L5HA 1TQBC 5DQJA 1GGCH 1S9YB 3MLRL 2FH6A 4AENB 3LB6D 4XPTL 3F6IA 3OGCB 5KSVB 4R0LA 4I2XA 1KPUA 2F15A 2VWEE 5EZJB 4JAMB 5MP6L 5ERWA 2VDKH 3DX7B 4U0RB 4TSAH 3KPPB 4HPOH 4J6RH 3QNZB 1YQVH 1N64L 3RPKA 2DBJA 5BXFB 5EOCL 3U4BH 5I1GL 3CXHJ 1N3NA 2EDLA 4KY1L 3SKJH 2LABA 1RJZA 5DA0B 3MV9D 1ORQA 5E8PB 5FYJL 1J7VR 1VFAB 4OFPA 5GISH 5I1CL 1NDMA 5I2IB 5CINL 5K9KA 3QFJE 2XKSA 4D9LL 3EDFA 3RWDB 4G8IA 3T77A 5C0GB 2K3TA 3VXME 1MOEA 4JFHE 4M03A 5KSAC 3EYVA 3KLHC 1NBZB 3ZDXF 4JPKL 1IZKA 3M8OH 5BZDB 3L5WB 2QQNL 3WIIL 4HV8A 2CQVA 4PREA 3WSQH 3J8F7 3CMOH 5E24E 4OD3H 2BNQD 1DVFC 4ZSOE 2B1HH 1SQ2N 2W65B 3VCLB 3OAZK 3MODH 4I18B 1DLFL 1TJIH 1FO0H 3SKMA 3P4OB 2VL5A 3NH7L 1EV2E 1I3VA 1CLYH 5ALBH 3SE9H 5A40E 3C8HA 4HAFA 4OM1H 2H1PH 4G9DA 2MQCA 2AKRB 2PXYA 4EIZC 5E6IC 1C7TA 3CDYA 1R3JA 1I8LA 3CGTA 4Z7WB 4XAWH 4AZ8A 4Z0XA 5SV3A 2A6IA 1OT2A 1Q0YH 3P4MA 5C6WH 4OGYH 3MRRA 2CPCA 3PGCA 5C7XH 2N1KA 1FIGH 2DM4A 2HKHH 4QXTB 3HNSL 2B1AL 1VKXB 4WNQA 3OG6B 4KK9D 4WW2F 3RDTC 1DUZB 2IGFL 3BP4B 5DK0B 4WU5B 4OF6A 1IEAB 3EJJX 3RGVD 3ZKMD 4GAJL 1SEBA 1J1OH 4AT6B 4B50A 3DV4B 2NY0B 3DO7A 1FZJA 3LQAC 4PJGB 4QXGL 3IJYB 2PETA 1QRNB 4XVUC 2XKUA 4O2CA 4G9FA 4JQIL 3I50H 1J5OL 1MCEA 3ULVC 5INDA 1PY4A 4L8BA 5L2KB 3C5SA 5C08A 4YHLH 4QHUA 4MD0A 4HS3A 3B3IA 1M7XA 5MHSE 1KEMH 4F7CA 5E2WL 4NO0D 4X4MA 1KIQA 3AS1A 3W9DA 3AREA 2YBRA 1UKTA 3BEVA 3ARUA 3MRJB 1JL8A 4HXBL 5FF6A 2WLYA 2YUXA 3CFJA 2R9HC 3ARGD 3QWQB 4L9LA 4IHOA 4W70A 3ARQA 1IRAY 2CLRA 2WQ8A 1T0MB 3G04B 3L6FB 3X3GL 3MV9B 3ZT7A 5DMKA 3QDAA 2WQRA 3MRNA 1NCWL 3U9UB 4XT1C 4Y5XA 4UDUB 1P7QA 5D5MA 3WNKA 1MCHA 3ETBF 3VWKD 1YPZE 5T1DH 4J23A 1U58A 4Y2OA 5F8RC 3ZO0A 4WEBL 4YXKL 4QF1B 4R4FH 1QO3B 2JKXA 4WJ5A 4ZS6C 1Q72L 5DQDH 1Y18A 3QH3B 4JPWL 2V5RA 3CVIH 4ZTOL 3RVUC 5FKAB 3N9GL 2VZ1A 4LHQB 1X44A 2Z4QA 5C0CD 1OARL 4PJAB 2DLFL 4BQ8A 3FFDA 4J3WA 3HI6L 5GRJH 3JWDC 1YMHA 1DBBL 3IJHA 4LL9A 4MNQA 2VDQH 1L6XA 1INQA 4GXVH 2OL3H 5BV7H 4M5YH 4CVUA 2NY3D 3KWWB 4TNVF 3P9MA 2HVKA 4P2RB 3HN3A 4POYA 4Z76B 5I76B 1CIUA 1UZ8A 1ZT7A 5DVNA 5L2KE 2NLJA 4H5SB 2FO1A 1KPRB 2X7LA 5JORA 4NSKA 4OCSH 1Z9LA 4HIEA 5GGQH 2AK4D 3HPLA 4OZIA 2VIRB 3RGVB 3CFCL 1XH3B 2WBJD 1M6OB 1ZA3A 4CMHC 4N5UA 3WFCL 4NO5A 4PY7B 5DJ6B 3W81A 1KLGB 4QYOB 3SGJA 1KJMB 5DFVD 5F7MC 1CDCA 2GJJA 4TNWF 1F5WA 4G43A 3JWOL 2NY1C 2AK1H 1UM4H 5IW6A 1UYWL 1Y6NR 4OQTA 3K81A 5CBEB 3VGAB 5GGRB 3HAEA 4F9LA 4YX2H 5EO9A 5E1AB 4PUBL 5H8DA 2DQHL 2D03L 5C0NC 1LO5A 1S7TA 2D4FA 4MXQC 5CKGA 3ARGB 1JGEA 5E8NB 4QHLA 4JFFE 2XA3A 2ITDA 4XP5L 4IIQB 2RJMA 4KXZI 1RJCA 3ZSSA 3GHEH 3BPOC 5DD1H 1IGMH 1TVBB 3PDOA 3V6BR 1KC5L 3AXLA 5FYLD 3AY4A 1X5YA 2DQEL 3P9LB 4JN2A 3S4SA 1MCKA 1BZ7A 4OLWH 1TJHL 1QBLH 4KAQL 2AXHA 4PJAE 3NABH 1IQDB 1CDYA 5BVPL 2EDNA 1E4XL 1H3VA 2VL4A 5DWUL 4IRZL 3UTQB 4PJHE 4TNVK 2ID5A 5F1IA 4RDQF 5B38A 3GSVA 1ZHLB 4N68A 3D6GA 4TUOB 5LVEA 1P1ZA 1O5DT 4IOSD 2DM7A 1RZFL 4MSWA 1K5NB 3OKLA 1CT8B 1U93B 3RFZC 4P2RE 5CIPH 2ZNXA 3DV6A 1MRCH 2DDQL 2ZOKA 5C0CB 5TFSH 3UBXI 2HLFC 3QFJA 3D25B 4P57B 2VMFA 3O6FD 4JO1H 4WFGE 4ZOAA 4YK4C 3VXMA 3L3GA 4U1MB 3TYGL 1DDHB 1RAMA 4TNWK 4HKBB 4DTGL 5DDHA 3DYMA 3W5MA 5D93C 1BD2A 5JLZA 5E9DA 4OKVB 5HI4D 4ZSOA 3OAYH 3P11H 2Z92A 3Q1SL 4YEFA 2OXHA 4HDIA 5EU3A 3LHPL 1VGEL 1PG7L 43C9B 1Q1JL 3DYPA 1FH5H 4HJ0D 1WISA 3TBWB 3TVMC 1CBVL 1X5LA 3VI4E 1WVZA 2AK4B 1BWWA 5TH2B 3AMLA 4EKXA 1BIHA 1XR9B 1UH2A 2WBJB 3HB3D 1W2KT 1KCLA 3ORJA 5IMLB 3RWCA 3DETD 1C16B 1KENH 1PX3A 3IDNB 1MCWW 1XF2B 1A4KA 1X4YA 2ENYA 5IW3A 1HH9B 4PRAA 4WFHE 3NCBB 2VQUA 1ZLWK 3SN6N 3MREA 4G5ZH 4PTTA 1ZEAH 1OW0A 3UX9B 3R06A 2LQRA 2X70A 4XWGH 1FRGH 1CGSL 3STBA 3N1QC 4I48B 1UJ3A 1CFVH 1QFUL 1S9YA 4WHCA 3HMXH 3L7EB 1V3KA 4XBEH 3SKNB 2MQ0A 4AENA 1C12B 3OGCA 3S37H 1TXKA 3NZHL 3ZKXC 1GPOL 3JUZA 5EZJA 4CL7A 5BV7B 4U1SB 1SMOA 1VA9A 3DX7A 2ZCKL 4YDKL 2ZG2A 2GQHA 3HTLX 3TESA 3QNZA 3C6LD 5AYQA 4LCIL 5BXFA 3QJFB 1WQVT 1TFHA 2DLGA 2NPLX 2FRGP 1XGYL 1VFAA 4HK3N 3KYNB 1D9KB 4Y4HC 5I2IA 4L29B 3TFKD 4XNXH 4U6VH 1XR8B 2UVEA 5C0GA 1TTFA 4HJJL 4QWWC 5D2NB 3L3HB 3TJHD 1A3RH 2LE9A 3MYZA 5BZDA 3L5WA 1FFQA 1MHPH 1TCRB 2R69H 4NDMB 3FB5B 4YE4L 1U8PB 2W65A 3SDDD 4I18A 2VAJA 4M62L 1A9EB 2PN5A 2EO1A 1JGLH 1CU4L 1R3LB 2YUVA 4ENED 3O6FB 3TH2T 2AKRA 4UTBH 5C3TA 4G3YH 4MJ4A 5DEFA 1YEIH 4P5KA 2AEPH 3GUTB 4Z7WA 5MEND 5D1QD 5BJTA 5I9QC 1YJDC 2I26N 3HC4H 5EIQA 3I02B 2NZIA 5ADOL 3SE4C 4QXTA 1VKXA 1T83C 4CDGC 4OB5L 4JKLA 1DUZA 3BP4A 4WU5A 4X8JB 1KEGL 1HQ4B 1ACYL 3FONB 1D5IH 3F5WB 4GG8B 4Y2DD 3DV4A 4NN6B 4JY4B 4PJFB 3IJYA 1FPTL 1QRNA 4HEPG 1CR9H 5DHYA 4S2SB 4CVXB 1LO4H 4X80H 3C08H 4BFIB 2BSED 1KF9B 4ISVA 5CIPB 1N5YL 5L2KA 3CVHA 1A4JB 4WUKH 2CIKB 4LOUC 3GMQB 5LQBL 3MV11 3DO3A 3T3PF 4JO2H 5FYLE 5T5FH 1Q0XL 3W82A 4EI6B 3AGVA 5LJYH 1IVLA 2WBKA 4BZ1L 4WWID 1KG0B 5FUZH 3MRJA 3QXWA 5BW7A 2OTWB 3VXSD 4N5ED 5D2NE 4ZUSB 5K33A 5H35B 1QSFD 4RQQB 3QIBD 1RZGB 1C1EH 4UV4L 5JO5B 1H5BC 1T0MA 4JB9L 2ESVE 2J8UF 2ORBL 3L6FA 2OSLB 1BHGA 3MV9A 4LPXA 3H9SE 1IKNC 3I3DA 4JFDD 4XC3H 3I3BA 1UM6L 3U9UA 4AIXA 4FFZL 3DWTA 5E2VL 3IU4H 4XCYB 4UDUA 5F9WB 4LU5H 4U6YB 1NAKH 2FL5B 1NJ9B 5D6CB 2DQJH 3DX9B 4XMLL 5DK2B 2CDGB 3QR2A 5DUMH 4XVJH 5EWIH 2H26B 3V6OE 2JJSA 1GZPB 1EDQA 3QPXH 2NR6C 4QF1A 3T0BA 5EN2A 1QO3A 4LAQH 3DVIA 4JFPB 3OKNB 5D72H 3LEXB 2Q6WB 2P5EE 3SDDB 1UVQB 4NRZB 2DMKA 2UVFA 5FKAA 5GZOC 1UCTA 2NY5L 3QISA 4KU1A 4PJAA 1BGXH 2E27H 1WTLA 5FOBA 2R0KH 2QJDA 1ZHKB 4NHCH 3MRFB 2JIXB 2F53D 1QFWL 1RD6A 4PJHA 5MENB 5TDNB 2C4FU 5IWLA 1AY1H 1NFKA 1P69B 4XP4L 1WK0A 1RK1B 2J7LA 2B0SL 5TDOB 2RIKA 3KWWA 5E2UH 4Z76A 4P2RA 5I76A 1NEZB 1EEZB 2QQKH 4H5SA 3DVGB 1KPRA 3BDYL 4NM8L 1JWMB 2IPUK 5F7NC 2C3XA 4NZJA 5CJOL 3TN0C 4ZFOB 4XBPB 2VIRA 3RGVA 3U7AA 3IAQA 4Y2DB 5EB9A 1XH3A 1M6OA 5K93A 4PY7A 5DJ6A 4HIJB 1KLGA 5JUEL 4QYOA 1KJMA 3GB7B 2GEEA 3MLUL 3HC3H 1DBKH 3IAPA 1RMFL 1UJTA 1SM3L 4TYUA 5J12B 1KFAH 4D94A 2IF7A 3C5JB 5CBEA 5DI8B 5GGRA 2NTFB 2PW1B 5C92A 1G9MC 3SO3C 1S3KH 2ZOLB 3WUWG 3BE1H 5E1AA 1CDHA 3ZT5A 5J6GB 1JTOA 3RL2B 4ZTPL 3VXSB 5ESQB 2H3NB 4P9HC 3MCLL 4Y89A 3ARGA 1QSFB 5E8NA 3QIBB 3OKDB 3NA4A 3VG0L 4QT5B 3HZMB 4IIQA 4PJ7F 4M1DH 3AVEA 3OBAA 2UWEF 1MLCB 2CGRL 3CUPB 5IB5B 2BSRB 3BQUA 1TVBA 3QPQC 1H8NA 3OTTA 4E9LA 1QSVA 4JFDB 2J88H 1SBSH 3P9LA 1OPGL 1X4XA 2HT4C 3GNMH 4U05A 2A1WH 1KJ2L 4FNLH 1LO3H 4EUPH 1IQDA 1JGUL 1YECL 2J6EH 4WVRA 1EX0A 3OPZH 3GHBL 2Y06H 3GSNB 1WEJL 3UTQA 4GKNB 4Y19D 2Q8BL 2E6PA 4M9PA 1MFAL 4WI3A 1ZHLA 4Z95H 2D0HA 4HBCL 1ZGLM 4QRUB 5DLML 4LRIC 4KQ3L 4JRWA 1K5NA 4XVTH 1CT8A 4U2YA 2JJWA 1U93A 4S1DD 3OKOB 4U3CA 1BEYL 1SYSB 5IROA 3RBSA 4EUPG 1KBGH 5C0CA 1Q9OB 4OLVH 1CFQB 3D25A 4P57A 3T8XB 3MLZL 4PJDF 4FMKA 2R23B 5I1EL 2VLMD 4AH2B 4OCMC 3OZ9H 4DN3L 4U1MA 2UUDH 2F53B 1DDHA 4HKBA 5IMKA 4I5BB 3VMOA 4KV5F 1TJGH 3UZVB 3F65A 4ZS7H 4OKVA 1A6ZB 4OCWH 2P43B 5KW9L 3GBML 4O4YL 4R90H 4WTWA 1EZVY 1F6FB 1Z9OA 43C9A 5J1SC 2JB5H 4N0UB 4MQTB 5FHBH 4HKXB 4NGHL 3VFVB 3TBWA 3FOLB 5TH2A 5B4MD 5JHDD 3ROOB 1XR9A 3S7GA 3S3JA 1S8DB 1NGXA 4XAKE 5D7KE 4IJ3C 5IMLA 5A3IC 1NGYB 4D8PB 2HN7B 3VXSE 2DBLH 1C16A 3MYJB 4LCYB 1A1MB 5L8KB 3CXDH 1BOGB 3BI9X 3LKRB 4P23D 3SDAD 2EC9T 4CMMA 3IDNA 4L1DA 1XF2A 1QSFE 5JZ7C 3DUSB 1CF8H 4UT7L 1V7NH 2VOTA 3ZT6A 1C7SA 5HVFB 3KYKL 3A67H 4HT1H 4I48A 5DJZB 3RIAF 2FEEL 3KR3L 2DWDB 3L7EA 4EDXB 1XAUA 5HI5D 3SKNA 3G6DH 3SCMC 1C12A 4GRMB 4P2CG 1UXSB 1I8MB 2FCBA 4K55A 4U1SA 4TULH 4OF5A 4MAYB 1TQCC 4O5LH 2X4SB 3O9WD 1CGUA 1R3HB 4C59B 3IKCB 3QJFA 1UB6B 4AIOA 1MFDL 1XIWD 4G6KL 1KJVB 2VDKL 1T5XB 4LIQH 1BFOA 2YA1A 1H9VA 1YQVL 4FG6D 3HE6B 3KYNA 2NY4C 3U4BL 1D9KA 3W0WD 2A83B 3KYOB 4L29