2IAMD

Structural basis for recognition of mutant self by a tumor-specific, mhc class ii-restricted tcr
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
239
structure length
239
Chain Sequence
b'AGVTQTPKFRILKIGQSMTLQCTQDMNHNYMYWYRQDPGMGLKLIYYSVGAGITDKGEVPNGYNVSRSTTEDFPLRLELAAPSQTSVYFCASTYHGTGYFGEGSWLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 52
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2006-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iamD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iamD02
1DBKH 1FFPB 4FN0A 4AK1A 4D0CA 5LXGH 1A0QL 3BI9X 8FABA 3V7AE 2Z9TA 3KPSE 2Y9RT 1YEKH 4XCNA 1E27A 5CGMA 1MWAL 5I71C 5KVEH 3CFJB 2X4QA 5D7JD 2MPAH 3GSUB 3IKKA 5F9OL 1IJ9A 4WHYH 5HHXL 1A02N 5DEGB 3CVHB 4O00A 1U0QA 3QYCA 2NTFB 3OB0H 5IROC 4R26L 1QLRA 3UO1L 3GK8H 5KVFH 5DO2D 3S6CA 4UIMB 5MEQB 3KLHD 1HK6A 1GGYA 1C5DB 5IMLA 1SYSA 3C60C 4OFKA 5E00B 3RIAF 4L29B 3VGFA 2YPLE 1BVKA 2B1HL 2W60B 3TBWA 1LHZA 3AFLA 4P99A 4YXKH 1ED3B 4P5TB 1FLTX 5DJXA 1WIOA 3OXRA 1Z9MA 5GQBA 2V5YA 3QEQD 3OBAA 2EDWA 4QHUA 3NZHL 3PGCB 1HSBB 1JYVA 1MJ8L 4TUOB 3CFCH 3NBNA 1BQUA 3OKDB 4CJ0A 4JY6A 1A6WH 3LZFH 3U7WH 4OLVL 4P46B 2EKSA 5SX5H 5CD3B 1FNSL 2H2SC 3ZDYE 4F37F 1UXSB 4PJIA 3T65B 5JNYB 1M6OA 3PWVB 3WFHB 3RJQB 5DQJB 1CD9B 3RVXD 1P1ZB 3ZDZE 3L7FA 5F7DB 1FL5B 1MREL 5D96B 2GTZB 2I9LB 3NIGE 1CTNA 4JFYB 6FABL 2YD9A 4YGVA 4H25A 3ROLA 5HDQL 4Z77A 2R8SH 1BBJA 4R4FL 2HLAB 3RDTB 1CD1B 3ME0A 4AL8L 1S7RA 1NDMA 5C9JB 2YSSB 1C5CH 4RA3A 4P5TC 3VCLB 3KLAB 4N1CA 2VDMH 3MNVB 3O4LB 1HOCA 5JR1L 4J1UA 2IANB 4RMUA 5ISZD 1MCLA 3SQOH 4TNWK 4G7YH 3IDJB 4P46C 5DXWA 4BH8B 4ETQB 3WJJA 1ZEAL 1CE6A 3MUZ1 5HYJA 1WWBX 4L4VD 4TSCH 2CLZA 1E28B 2UWEA 4GUPB 4LCWE 4IHOA 3TP4A 3FQRA 4MJ5A 1U8OB 2MQCA 5IT2H 3LCYA 5EN2A 2CK0H 1IGCH 1IE5A 1FORH 5FUCE 5D96C 1E6OL 4XAWH 1B0GB 3CX2A 2O5ZL 3MUY1 4HFUL 5HHMB 1Z3GH 3HA0A 4FZEL 1I85A 3FAXA 1QEWB 3H0TA 4X5LA 1G7HB 1BJMA 2QEJA 3RNKA 5I17B 4K94L 3VGHA 3JV6A 5MHSE 4NWTL 4LSPL 5I1LA 4KGLA 1MRCH 4GXVL 5E0QA 3N0PB 5EFIB 4PRHD 4Q0XL 4XMPH 3QQ4B 5LG1A 2NY2B 2Y72A 4PY7A 2PXYD 4NZUH 2F9BT 2GSGA 3BUTA 1EEZA 1D5MB 1AKJA 1S7UA 2BSRB 2V17H 2OTUB 3RPIA 3FO2A 2B2XL 1DVFD 4YDKH 3VXUA 1IEBB 1ZK9A 4HIEB 5DRZB 1QBAA 5J89A 2HVJB 3S37H 1DP0A 1GHFL 4MSWB 4LRIA 3MYZA 4KTYA 1MWAB 3WIIH 5E4EB 1INQA 1AY1H 4NKMB 3HPLA 5DK0A 4RIRA 4DZ8B 1INEH 3I50L 1YA5A 4IS6B 1LEIB 5SWSB 3RTQB 4Y4FA 4WW2B 32C2A 4HWBL 3HB3D 2GY5A 4EOWH 1KIPB 3F7VB 2ZSVB 3RWDA 1JPTL 4L3EB 3ZSTA 1NANH 5IB4A 5E7BA 5E2UL 5E8DL 1T0PB 1JMZA 2NY2C 4Z7UB 3O8XD 4MDIB 3MLZH 2H8PB 5JTWA 3QIBB 3TT1L 5TDOA 5DURD 4M3KB 1PD6A 4X9HA 4JZNB 1RZIA 1JFQH 4JGUA 4LFHG 4OF7A 5MEND 4KROD 3ARBB 4XPBH 4U0RB 5E4EC 1I75A 5ICXB 3X3FL 2CPCA 5DK3A 2CK2A 1X5JA 4XP5L 5HHOE 2HFTA 3NCCB 2B7DT 3RVVC 2P46B 5ADOH 4WW1A 3VFPB 3SHSA 2CO7B 1DN0A 2CLRA 1AXTL 1X5AA 4NQSB 4JZJB 3B5GA 1IC7L 4ODUA 5DYOB 1R3LA 3NA4A 3RTQC 4UUJA 5JOFA 4WW2C 3L3DA 3OKKB 3L9RA 2P8PB 1L6ZA 1QSEA 2EDDA 1B6UA 3LEVL 4JFFD 5JW3L 3OXSB 5F7HA 3SE3A 1B2WH 4PJGA 4OZHB 1LEKB 1QNZH 5EO1A 5AUMA 3EJZC 1X44A 5I16B 2YUXA 1NSNL 4DKAA 1JHKH 2OJZL 3LEXA 4RQQA 4ZTPH 3VXTB 3HR5B 4W4OA 4XP1L 5ANMA 2WM0A 1D5XB 5DUBA 1LO0H 3QIBC 3L5JA 3CCHA 1SM3H 4PTTB 5SV3A 1F2QA 1UJ3A 1J8HB 4PGDB 4NNPL 4OFDA 5KS9E 1TFHA 3ARBC 1DBJL 1K2DA 4U0RC 3PJSB 4JFHE 3MV7D 1YEHH 4Z0XB 4YXLL 4CDGC 4Y2DA 3MXVL 1I9IH 3GM8A 3MV9A 1CBVH 4B5EA 4EDWH 4R2GB 3LS4H 4JZJC 5ACZA 1YMMD 1KJMA 4PRBA 5C0JB 3BFOA 4WI6A 4YBLB 3JUZA 1MI5E 1RSFA 2D7TH 5GIRB 5D5MB 4JANB 2R2EA 5ERWB 5JHLL 5HHPB 5B39B 4ZO6A 4LCUA 1ZWIA 2X4SA 3CVIL 1WZ1H 3TA3D 1EO8H 4N8VB 1HKLL 4NN7B 3ILQC 4P2CG 5EB9A 2ILLA 1EJOH 2FO4B 2OR9L 3HRZB 4ZAKD 1LD9A 1IGMH 2GI7A 5A2KH 4K2UL 3VGDA 5E94B 1S7VB 5C09A 5IMMA 1JPSL 4PLKC 1PVHA 5D2LA 5EZLB 2YKLH 2HTLD 5L88L 5IK3A 5LCVH 1WBZA 4G8IA 5I74B 3OJ2C 3LRHA 1UWGL 3D5OF 1XR9B 2QSCH 3CNKA 3BIBX 3LQAH 1RZGB 1I7ZA 1MCKA 4CJ1A 4H1LA 2XRAH 4F2MA 1MNUH 2J88L 3WHE1 2M26A 5BVJA 3RHWK 3GB7A 4XC3H 2ZG3A 1S9VA 1T66D 4R2GC 4NQCB 5D7IB 3TCLB 4Z8FL 3MRCA 1CDGA 2EIZB 3BMWA 3DTXB 4LNRA 5IG7A 4YBLC 3L1OL 1DBAL 4K94C 4X4XB 4F80A 1XIWD 5KSAD 4L9LA 4M7JL 1L7TH 5K33A 3QULA 1G7MA 1DCLA 3OPZH 3FZUD 4NN7C 3FOLA 5T3ZH 2AXFA 4JAMB 4ORGA 1I1AC 2B1AL 4QYOB 3IJHB 1F45A 1T0NB 2J7LA 2PW2A 3HUJE 4QTIH 3U1SH 2ITCB 4DUXA 4TYUA 1P7QB 5I1IL 3FMGL 4UIKL 5GPRA 2N7BA 4KWUA 4EXKA 3EIFA 2YMXL 2ZOKB 1KACB 3NABL 3IJYA 1I3UA 5I74C 4WGWB 2UUDK 5ESVB 5D1XB 3Q1SH 4G8GD 3HI5L 1W2KT 2KZWA 1T1YB 4J23A 3FRPG 1T4KB 3MLTA 5T3XD 1JRHH 4LSUH 5I8EB 3TYGH 1A9BA 2C7UB 4QRPD 1S8DB 4XPHL 1HQRB 5C08E 3CZFA 4DFHA 4QOKA 2WBJD 3HI1B 5I18L 1BF2A 3RY5A 4FOMA 3K7UA 5D72H 3CMGA 1DUYB 2E7CA 4KDTC 4ZUUB 5D2NA 1MLBA 2IPUK 4EJ1C 3SDAA 3DSNA 3PQYB 3N1FC 5E9DD 1YEIH 5C0BA 5J1AB 2DQTH 5KN5B 1NGWA 2VR5A 4DKFH 2EECA 2G5BB 3EOBA 1U8KB 1LP9B 4KQ3L 1RIVL 4K7FB 2P8MB 4Y19D 5JOPD 5DZLA 1EGJL 1ZT4A 1OGAA 4MGXA 1FGVL 2ESVB 5JHDA 3BGMA 2MOVA 1PZ5B 2ZUUA 2VNCA 2HMID 2DMBA 2ZNWA 1FNHA 4BKLA 4CL7A 1YNLH 2Q86A 2HRPH 4JPIA 5D1XC 4Y4KB 1DQQA 3LAFA 4J3WA 3NCJL 1V3KA 4U6XB 4XPGL 2BHZA 1PBYA 2AJVH 5L8JB 4MLIA 2A77L 2HA1A 4F7TA 2CMRH 4ZG1A 2IH3A 1HH6B 3WJLC 5I66A 5K9OA 1IKFH 4P48A 5KVGH 4ZFZB 3BKCH 3DXAE 1ADQL 3QRFM 3PP3K 4QXGH 2HH0L 4PJ9A 5DTFB 3HE7D 1XGPB 3JXAA 5IHLB 1XF5A 3GI9H 3NAAH 1FL6B 1NMBH 4EDXB 5C0CD 1JBJA 3GBNH 1JGVL 2F8VA 1AHWA 4X0KB 5T33H 2ZKHH 5DFVD 1JN6A 5DVOA 4X6CA 4A6YA 5IJVB 3O2WH 5E8NA 5F8RC 5C0IA 2OL3L 3WV0A 3E3QC 3PE9A 1X4YA 4Z18A 5F3BB 3SY0A 3QWRD 5IVNA 1TTGA 1JPST 3B2VH 3FT2A 4Y4KC 4P2RD 1VFOA 4W6XB 3U46A 3MC0A 3GMQA 1PSKL 3QPQD 5F7NC 4MQXD 3OG4B 3VFVB 1UKSA 1HI6B 4NM4L 4XWGH 3P30L 3EOTL 4HLZH 3QIUA 1F90L 3P4NA 2ZCLL 4G8FA 1G7PA 4HXBL 3VE0A 3A67L 4GT7A 5JZ7D 2BZDA 4XI5D 1K5NB 3OHXB 5LWYH 3FT3A 3SPVA 4P2OB 4NC1C 2Z0BA 3SDCB 4FABH 1DL7L 2A0LD 1YC7A 2YUVA 5CBEA 4TULH 4X98A 1VEMA 3K81A 1HH9B 3QCVH 3CLEH 3UCRA 5ISZE 1T89C 2PO6A 5C0GB 1RURH 2GJZB 4O2EA 1SBBA 4ODXB 4J2XA 5DDHB 5ICZA 5EU4B 2X09A 3ALPA 3H8NA 4U1IB 5L2KE 1I4FB 3E6FB 3VXMB 1IAKA 4GQ9H 1AGCB 4QHLA 4IRJB 5I1AA 3H9SB 4NKOA 2GAZB 5ELIA 5DD6A 4XHJD 2X5PA 3KPSB 3HC4L 4NDMB 4ZQKA 4EIZC 5GGRA 2F15A 4HPYH 4C56D 1AXSB 3RP1A 3W0WB 3DX8B 4A6YH 4BZ2H 3EYSH 2AXGB 2BMKB 3L3IB 1WZMA 1RIUL 4Y1AA 2FGZA 2X9WA 3EO9H 4XPTH 1KJVA 2NY3B 4BK5A 4P2OC 1BGXL 3SDCC 2WINB 4PRHE 4P23A 4LLDB 3C5JA 3W9DB 4U1SB 3TNNA 4UILH 2YPLB 5IB3B 1WIUA 4JQXA 4ZPTA 4JPVH 2K7QA 1XMWA 1JV5B 4OD3H 3VXPA 4O4YL 5I76B 1MFAL 4RX4D 2EYRA 2CDGB 5CGYC 5FYKH 4Q9CA 3SKJH 5BXFB 1YPZE 4OF6A 1RD6A 1YY8A 5F7MC 3V5HB 4OLZH 3MRLB 1WCQA 1HEZB 2EDBA 1S5HA 3MOBL 3PG2A 4LVOB 1HHJB 4HC1L 4IRJC 2AERT 2VXUL 2A6JA 4WUUA 2HWZH 5HJ3B 2AQ3A 3U4EA 3C5ZB 2X44D 1ORQB 3V6BR 4NZDA 5I1HL 1VEOA 5I1EH 3JV4B 4AG4L 1HQ4A 4M8QB 1FV1A 5EOTB 1T2XA 1SJHA 4BFEA 4P49A 3VG0L 5F7FA 2DRUA 4DEPB 2BC4B 1T21B 2NY3C 1LK2B 5BO1L 4PV9A 4X6FB 1DBML 3RWJB 1R24B 2V2XA 3EZ8A 3EJJX 3RZCB 3T1FA 4U4BA 2JELL 2ICCA 3GNMH 4W70A 5CKAA 3RGVD 4KKBC 4WV1A 2RHEA 2BNRA 4NM8L 3EDKA 4JM2B 4IMKC 3VW3H 4R6UA 4ZFGL 5E70A 1XGRA 5KSUA 4I3RH 2Y06L 4FMKA 5I1DB 1ACYL 4LIQH 4OZFB 4LVOC 3V0WL 1UC6A 5JXEA 43C9B 1OP3K 3NCFB 4YBQC 4I48B 1KPRB 5EZOL 3H9YA 1RUKH 2SEBA 5HVFB 1HE7A 3BT2L 4XTRC 4PJBF 3C5ZC 4OCLC 4I0KA 4LCWB 5DUMH 4XRCB 4KV5F 3HMXH 3DSFL 4S1DC 2HJFA 3DX7B 1NGYA 1QACA 2XKNA 3H42L 3NPZB 3SGEI 4NJAL 2DTML 2VZTA 4JFFE 3KYMA 4K07A 4G9DA 1S5IH 1UXWB 2FGWL 3QO1B 2BOBA 4GW4B 5CIPA 2JCCE 4DEPC 4IRSB 1R0AH 4NHCH 2N56A 2AJZA 3OAUL 4NIKB 1HHIA 1P69B 4TSBL 3GGWA 4HK3N 4FXGB 5F1OB 3RZCC 1PLGH 5J9PA 1RMFL 2YD2A 3MODH 3O3AB 5ID0B 2NY4D 4P2QA 4AIOA 3TFKD 1IGFL 3MUGB 3RWGB 5L7XL 2ICEB 1IFHL 4Y16D 4HHAB 5DC4B 3EOAA 2DIJA 3KXFE 1UJTA 3TPUB 2ARJA 4LPTA 5B38B 3HKFA 3T4AB 3D3VD 5T1KD 4AEHH 5E00A 1KG0B 3PGFL 1RY7B 4LQ1A 1DQDL 4DOHB 4J4PD 1E0OB 1BFVL 2CIKA 1D5ZA 3QRGH 3QCTH 3VXOB 1YMME 4MB4A 1BFOA 1N4XH 1ORSA 5TH2B 2WLYA 1QBMH 5HSFA 1I3VA 4LLQA 1WBXB 4V1DA 1MEXH 3MJ9A 1IM9D 4IRSC 2G2RB 2WUBL 4AH2B 1G7IA 1BIIB 4F33A 5KVDH 2UY7A 1MF2H 1EEYB 2GT9A 3H6JA 4QGYA 4JO2L 4X99A 4RGND 3T65A 1KN4L 4NZTL 3O3BA 4Z78A 2HFEB 3MCG1 5IB1B 4NKDB 1JYWA 3GJEB 1YQVH 3P0VL 2R1XB 4RISL 2ZCKL 2F54D 1P1ZA 3H7BB 4CVUA 1FVEB 2W9DL 2GKIA 4FQHB 5C07B 5CIPH 1NAML 4PS4H 2P4AB 4JFYA 1F5WA 2KPNA 4JDVB 4HKZA 3PWJB 4JFZL 1T2JA 5I8OH 5EWIL 3DRQA 5ICYA 3RDTA 5C0DA 2XICA 2GY7B 3O6FD 1BD2A 3E6HB 3G5ZB 2YSSA 4MB3A 4UDTB 5IFHL 1JE6A 1ZAGA 1C8PA 3MBXH 4L3AA 5DJ0B 3CVHH 1SY6L 4EIGB 3DV6B 4QRUB 2Q87A 3MRMA 4PGCB 3GHBH 4B53A 3ARDA 3OJDB 4M6NH 3TJHC 1OPGH 2BSTB 5ECJE 2I9TB 1QYGH 4UV7L 2AEQH 1N6VA 1T7XA 4FHBD 4I3SH 5F9AC 2AJUH 4KTEL 2KL6A 2I5YL 1DANU 1LMKA 5CWSA 5FUOL 1ZT7A 2DBLL 5C70A 2BNQA 1IBGH 5FIEA 5FGBC 3MXWL 1IAOA 4L5FH 4XP6L 1G7QA 5J6HB 3CIQA 4G8GE 4NC0B 3H9ZA 3TZVA 3W39B 2RBLA 4L8SB 1F4YL 4D0BB 5T3XE 4HXAL 1A6PA 5KS9B 2OP4H 3FN9A 4R0LA 3IFPB 4OCSH 5EFIA 4JHWL 2APWA 1H8NA 2ICWI 1U8LA 5F88A 2A2QT 4G7VH 4Z7VF 1VACB 1FIGH 2N1KA 4G43B 2P8LA 5GS1B 1GAFL 5J1TC 2BK8A 4LF3B 3GFUA 1MFEL 5E9DE 1D5MA 5GGQL 5JW4M 1JNNL 3ABZA 1HDMB 3MROA 1MI5B 4GG6E 1FYTA 5DRZA 8CGTA 5ALBL 4TRPH 2M2DA 3BO8B 3WDHA 4EKXA 4Y19E 2VLLB 3BKYH 3TBYB 5IVZB 4ELMA 1F3RB 1LNUB 4XCFH 1T03L 1ZOXA 1A4KB 4QCIA 4FS0A 3BP4B 3VFSB 4HUUA 1ITBB 5FDWB 3MZGB 1ES0B 1M71B 4N90E 3QISA 5F6HI 5AZ2H 4P9MH 3P4MB 1NFDF 2V2WB 3W82A 1Z5LA 2XFXB 3IDUA 1C7SA 3U0WL 1J0HA 3H3PL 2YRLA 4L8SC 3QFJD 1GGTA 4HKBA 1EHXA 4YHNB 3VGEA 4RGOH 5E1AA 3QI9D 4D0DB 4L3EA 2RAMA 1CYGA 3PNWA 1F6AB 4R96A 3JV0A 5JQHC 3B9KB 3A6OA 1XCQB 3UBXI 1N0LA 3GMNB 5FECA 3A6CH 5GS1C 1RUPL 5BZDB 5F7UA 2R15A 3RY6C 2VN4A 4X6EB 4G9FE 3I6GA 5C0CE 1J8KA 3T2PA 1OSZA 1R3HA 4QNPE 4N8PA 3EYVA 3PWPA 1XFPA 3TN0D 3LS5L 3U36B 1MHCA 5IWLC 3G6AB 5ID1B 1SJXA 4FNLH 4H88L 3JVGC 4UU9B 3HUJB 5DZNA 3UJTL 5C0RH 1NAMB 4HBCH 3T0AA 1EFXB 2R1WB 4K7PL 5HI4C 5D7SL 1MCRA 4P2RE 5EU3B 5CHNA 5DRNA 5H8DA 5KAQG 4KY1H 4X6BA 3IKCA 4EN3A 1S7TA 4S11A 1NDGB 4K71B 5GGTL 2HFGL 2VXVL 1MWAH 2HJKA 5IR1A 5C0FA 2AABL 4NQTA 4NZRL 2QR0A 1CLYL 4M9OA 4R7DA 3IU4L 1A1MA 1HZHL 3B9KC 1RZJL 4MA8L 1DQLL 4U1NB 5F9OH 3QUML 1E4JA 3HR5A 5HHXH 2Z93B 1Z6JT 2OBGA 3G6JB 4R26H 1BBDL 4XXCC 3ARUA 5IMKA 3EO0A 3FQTB 3RGHA 2C4FU 1URLA 3CH1A 4BM7A 4PLOB 4JN1L 3T2NL 2P43B 3SJVA 4D9RD 1MFNA 2X1QA 1CU4L 4P5MA 4C58B 3DO3A 4HJGA 5C2UB 1ZTXL 4Z7WF 5EC2A 2DBJA 5E03A 1AE6L 5E2WL 3QB7C 4CVXA 3N1PC 4PRIB 1MJ8H 1CR9L 1X6NA 3C6LA 5F9JA 4WHTB 1T6WA 4EUPG 3P77A 1DLFL 4ZDHB 4OKVA 3L5HA 3K4ZA 1KBGL 5LGKA 4OLVH 4JGMA 5HGHA 5E5RB 1FNSH 4C56E 1LO3L 4JANA 5F72S 1G6RA 5D7JB 3WLBA 4I0PD 4K71C 3I3DA 5FYJD 2UY6A 2CLVB 3NIDE 2YK1H 3C6SB 5L8LB 4E41A 5I2IB 2ZWLT 5J12B 1Q0XL 4F9LA 4LGPB 3Q6GL 2E27L 3AROA 6FABH 1OTUC 5HDQH 1OGTA 3T0EA 4APQC 4R4FH 4TNWF 2VLRD 3HE6C 4AL8H 1YMHA 3QEQB 4FFYL 3DETC 4KRMB 3QNZA 1A2YA 1YNKL 3EZJB 4M1CD 1RJYA 3KR3L 4MD5B 1SMOA 5DD5L 5JR1H 4LGSB 1Q9KA 3NFPB 3T0XA 1QP1A 4Z0BL 5J1SC 2AKRA 2DQHL 2D0FA 1JIBA 3GMPB 3BD4A 2X4TA 5DF0A 1WWCA 3GIVB 4MNHB 5JW4Q 5D7JC 5DQ9A 5C8JA 4NQVA 4J3OC 1ZKAA 1T20B 4JCMA 3ARSA 5D4QA 4LU5L 4DCQB 4NRZB 5ESAA 1G9EA 1GGBL 5DO2C 1CG9B 1E6OH 5J12C 3KLHC 2NCMA 1NFIB 2O5ZH 5IEKA 4QXTA 4FZEH 4BSWB 3MLUL 1T7YA 3R0NA 4GAYB 3AREA 4K94H 2ZOKA 3VFNB 5ESQA 4NWTH 2HFFB 3AAZB 4LSPH 3VH8G 4U33A 3REWB 3LKSB 4GXVH 4A2MA 4DKEL 5TGBB 2OLDA 1HHKA 4Q0XH 1Q9LA 5ISZB 2AEPL 4HCRA 1ZLVH 1EK3A 3B83A 5I8EA 5EIQA 3C9NA 3U30B 3U83A 2B2XH 2V6HA 4OI9A 4YE4L 4OZIE 1MUJB 1WAAE 4L4VB 5BJTA 1Z9LA 5KOVC 1H3XA 1KTDA 1DDHB 1GHFH 4HQQL 2YD3A 3RVXC 2QADD 2I26N 1JPFB 2BY3A 4BH7A 3BP6A 5IF0B 2FBJL 3VMOA 2R2HA 1ERNA 2IMNA 1KCVL 1IARB 1OW0C 3QUMB 1JGLL 5JW4R 3WHXA 1U8KA 3HAEG 4N9OB 3T3PE 4K7FA 3IDNB 3WO3B 3I50H 1O0VA 5HYJD 4LHQB 3WLWD 4NOBA 1NBYA 4HWBH 5J4MA 1J12A 2AJ3A 2Y6SC 12E8L 1JPTH 4PRHB 1ZS8A 2PXYB 5E2UH 4ZSOE 2H32B 4PJAA 5E8DH 4HULB 3GMLA 1MHHB 4U1KB 4AEEA 4L8CB 3L3KB 1DVFB 2GITB 1DEDA 1FC1A 5E99L 4YZFE 3U30C 1KN2L 3TT1H 5INCB 3R8BB 4JO1L 4NCDA 3BWAB 3MPCA 3MA7A 4LLMB 1OTSD 2Y7QA 3CLFL 5GRJH 3FT4B 3X3FH 3CXDL 4M6OL 4XP5H 5H37G 1AKJD 1RZJC 1K8DA 1PY9A 1XF2B 2HKHL 4HCRH 3VXUD 2PCPB 4KHTL 1IC7H 3UX9B 2GJ6A 3HZVB 5HYQB 4RGNE 1UACL 3I84A 4F58L 4Q6IB 4MCYA 4C83A 3LEVH 1DQML 5JW3H 1UZ8A 1WF5A 5EH1A 4ZS7L 3D1MC 3G5XB 2J8UA 1JWUA 2PXYC 4WNQA 1NSNH 2Y5TB 3MSPA 3O8XB 5L9DL 2OJZH 3HPJB 4XP1H 2AAVA 2QQNL 1CLCA 2R23A 3BESR 5EU5A 4Y4FD 1DVFC 5DURB 2G9HB 1KTLB 2DLGA 3S35L 3VFVA 2GIYA 4OI8A 1B6DA 3LEYL 5MENB 5MEPA 4KROB 1NLDL 4NNPH 3A6BL 4KAQL 3UPCA 3OR6A 3OHXA 1RVFL 1DBJH 2ZUTA 3PXJA 4YXLH 5T3XL 3MXVH 2CUMA 2QTEA 1HH9A 2ZUSA 4AIZA 2CRZA 3SKMB 3SO3B 2DIAA 1R3IL 4ZODA 2XI9A 3GSWA 5DQDL 2ICWJ 5J6GA 3ZYZA 3X12A 3HB3C 4LHJB 4JFFB 4WTZG 3QH3B 3D18B 5A2IH 4ZTOL 4Q6IC 4WTWA 2JCCB 2VDKL 4PY8J 5JHLH 3H9SA 3CVIH 3SN6N 4PG9A 1HKLH 1I7RB 5CAYB 3O8XC 2OR9H 3HZKB 4K2UH 1W0VB 1GSMA 1AXSA 4Q74A 4WTXA 1JPSH 2LAAA 1QSED 1X5XA 2R1YB 1I1YA 4KROC 3MMEB 4LHUA 1JHTA 4X9BA 1E4XI 5FO8B 1IEAB 3BH9A 5L88H 3MV7B 4OQTL 4YO0B 1UWGH 3GSVB 3R06B 4YK4B 1TTFA 1OAYH 3DROB 1P9MA 3ZSSA 2DQJL 2NLJB 2J88H 3FONA 4BQ6A 3SO3C 1YMMB 3ZHDA 3CPLA 2G75A 2KBGA 5B8CB 1EGJA 2W38A 1D6EB 4Z8FH 5EBMB 4WFHD 43CAA 1D7FA 3L1OH 4IRZL 3V5HA 4AEIL 1DBAH 15C8L 3TA3B 4Y2DD 5T3ZD 1V7MH 4M7JH 2AK4A 3MV9D 5E8PA 5CCKL 2GTWA 3LV3B 4IOIB 4ZAKB 2PF6A 1U92B 1ZHBB 4PB9L 5IV2B 1HSAA 5IIEB 5C71A 2GK2A 4NO3A 2B1AH 2V5TA 3DX9A 4N0CD 7FABL 5IW3A 1A3QA 3OKNB 5I1IH 1A1OB 3JV4A 3QFJE 5IW6A 3FMGH 4UIKH 2YZ1A 3WO4B 2R2BB 2YMXH 4NGHL 1RZFL 3DI3B 3NABH 3OZ9L 3B3IA 2ENYA 4QRSA 4KZDL 4KH2A 4WFFD 3HI5H 2IGFL 3LKQB 4YK4C 5C09D 1R24A 3TH3T 2B8OT 4LQFL 3BD5A 2BHYA 2VWEE 4HDIA 3DMMA 1RK1A 4FQ1L 3MRPB 4UBDD 4WU7A 4XPHH 3MRFB 1N3NA 4HKXB 4Y8AA 2VISB 5E5MB 2OL3A 2F53E 2EYSA 5I18H 1XIWB 5KSAB 4JM2A 2DJ4A 2W0KA 3H7LA 1OWWA 5DJ8A 4YDJA 3RUGA 4E42B 4FZ8L 4POUB 3TA3C 2E6JA 1K4DB 3LKRB 43C9A 4TNVK 1KPRA 4ZAKC 3UP1A 5GS0D 1M1SA 5IHUH 3VFWA 5JW5B 4JHAL 4RWYL 4KQ3H 3MRJB 4FTVA 5FUZL 3RIFK 1EGJH 4PJDE 2Y5EA 2W0LA 1FGVH 2DI8A 2HTLC 2IQ9L 3WO4C 1FFOB 4PJXE 4G8GB 3ULVD 2GW5A 4K55A 4WW2F 2EDXA 3WNOA 4XPFH 2X4NB 4PJHE 5MP6H 3NCJH 4FXGA 4M3JA 1T66C 4QRPB 4XPGH 1A47A 2WBJB 4KI1A 5E08L 2A77H 2R56L 3SGJC 3O3DA 1YN7A 1LO5A 2IPKB 4D9RE 1XIWC 5KSAC 4JY5L 4Z7UF 4JM4L 1ADQH 2H9GB 3OAYH 5E9DB 5SWQB 5EO9B 1EXUA 3FZUC 4GG6B 2EIEA 5IW1B 1P4IL 3KWWB 4QF1A 4Y19B 2X89A 1CVRA 3QG6B 2KQMA 1IEHA 1JGVH 4HAGA 4QOKD 4PBXA 1RK0B 2D31B 2I24N 1ZLUH 4FMFA 5TE7L 1RAMA 1KXQE 4CNIA 5A3ID 2OL3H 3SDAD 3PV6B 1S78D 2BVEA 4LPXA 4R3SA 5C0BD 5FYJE 1INDL 3PWUB 1JL8A 5DZOA 2W9LA 4OZFH 4Z7QF 1NFDA 4GQPH 5CUSL 5FF6B 3FB6A 4P3DB 1EEYA 4GMSL 4M62L 1OGAD 1PSKH 5HI5D 5JHDD 4OZHF 1QLFB 2HFEA 2WBJC 4PJCB 5IB1A 5D9SB 2EKJA 2R1XA 1JTPA 4NM4H 1N6UA 3P30H 3EOTH 3ULUL 1NL0L 1F90H 4JFXA 1FVEA 4HS6B 2ZCLH 4OZGE 4HXBH 3HE7B 4FQHA 5I6XB 3A67H 2IPTL 4R7NB 4HC1A 1KUMA 3RU8L 5GGSY 1DL7H 4E5XB 5C0CB 3H2WA 3WUWB 4KKLD 2XY2A 4PRDB 3UBXB 1XZ0B 2IH1A 4NQXB 2ZPKL 4HEME 3U6RB 4OV6F 3E6HA 2HMIC 1A9EB 3PL6B 5DUPL 3BZDA 3QHTC 2PKDA 4PJ9D 5DD0L 3D0VB 4G42A 3KS0J 2PN5A 5GSVA 5HHVL 2VYRE 3N9GH 5DJAB 4P2RB 1C12A 3FCTB 3TNMB 2UYLA 5D5MF 2PYFA 3HC4H 1S7SB 1LE9B 3DIFA 4J3UA 4F7EA 4GAGL 4LLWA 1J86A 4PJIE 1YDPB 2DWEA 3AS1A 4BUGA 4N68A 5FM8A 3VGGA 3ARWA 2DQCL 3TIDB 1RIUH 2LABA 1NGQL 5FKAA 2DN7A 3AB0B 2PTUA 1JF1B 1T5WA 3HE7C 3CXHK 5I6XC 3KPQB 1S7XB 2D03L 1BGXH 2D0HA 3WL9B 1AI1L 3UZVB 3MLVL 3MUJA 2MTPA 1R5WA 2R29L 3QQ9C 5FYKD 5DFVC 2Z91B 3SOBL 1GYAA 2H3NB 5HGDB 3QIUD 4O4YH 1MFAH 3IXTA 3CDGA 2R0WL 3Q5TA 1KULA 2XG5A 3ES6A 2MCG1 3W2DL 1UQSB 3U0TA 3QWQB 5GS1A 3MOBH 2WQRA 4LF3A 3MV8A 5D7IF 4ZXBA 4HC1H 1HDMA 2VXUH 5CFHA 4ODTL 3QPQC 2A74A 4C56B 2PO6D 4IIQB 4MQXC 3DYMA 3FB5B 2VLLA 3BXNB 1U42A 5HYJE 1BOGB 5IBTL 5C2BL 1F3JB 4ZNCD 1U8MA 2UWEE 4AG4H 2FSEB 2FWOA 5JZ7C 4XI5C 1NMAL 3UTSA 3AB0C 4G80A 4QTHB 1M71A 4GW5B 3VG0H 1CD0A 4N0FB 3HZMB 4GLRI 2A0LC 3UAJD 1FCGA 4CW1B 2VE6A 4AQOA 1QA9A 4XNUL 4PJEE 5BO1H 1UKTA 1P53A 1T22B 3QDHA 4HGMA 3QZWB 1DBMH 4GXUM 3X11A 5E2VL 1AGBA 3U9UB 4UQ3B 4JLRA 4YR6B 3MLSL 2JELH 3S88H 1RHFA 1TLKA 2IC2A 3T3MF 4CUCA 2E8YA 4NM8H 4MZ2A 1X5KA 3KPNB 1XCQA 4ZFGH 4MA7L 5IJKA 1U2CA 4P23D 2Y06H 2J4WL 1BZQK 1ACYH 4L1HA 4XHJC 5AYQA 3V0WH 2E7LC 4ZUSA 4I8DA 4M00A 5EZOH 3WFDL 5D1ZA 1MRDL 4C4KT 5D6CA 4IIQC 4DAGL 3V6OA 3ARRA 3BT2H 1T6VN 4J6RL 3VXUE 5DGRA 3MBEA 2VQ1A 2FIKB 3DLQR 1Y0LB 3DSFH 3X13B 1R6VA 2DKSA 3H42H 1RULL 4NJAH 5JOEA 1LP9F 3MGOA 2NMSA 4WUUD 2FGWH 3SKNB 3EHBD 3KPPA 2ZSWA 2K3TA 3I6LD 1YJDL 4EZMA 4RZCA 3EFFA 3OAUH 4TSBH 3ZL4L 1NEZG 1TPXC 3UTZA 3RGVB 1EJ6A 2BVQB 3U4BL 1RMFH 1MRFL 4DVBA 2RJMA 2C26A 4Z9KB 1DR9A 1DN2A 1IGFH 5L7XH 3ZE1F 3STLB 1IFHH 2YD5A 4LDEB 1QBLL 3H9HB 4WGVB 1MCFA 3ZE2E 4BELD 3LN4A 4LKCA 1H15A 4OZIB 3PUCA 3VFUB 4KRPD 4GRWE 3PGFH 3QR2A 1DQDH 3L5WA 4MJ6A 1FZMA 4RMTA 3UPAA 5F96L 1BFVH 2BNRD 4G3YL 2LVEA 3IF1B 1U3HD 3CK0L 5BCAA 4UDUB 4UINH 1GGIL 2KDGA 4LBEA 3UTTD 1ZHLA 3DBXB 5JXED 3L3OA 1E4XL 3PIQA 3T0WA 3CSGA 1FFNB 3K4DA 3F7RA 1D9KA 4LLUB 1PG7H 3OGCB 5EZJB 4JO2H 2NY4B 3GSRB 3RGVC 1KN4H 3BW9B 4NZTH 3F6LA 4X4MA 5SWZE 5JPNB 1AD0B 1QSEE 4MHHI 3G04A 1DE4A 1JGDA 25C8L 3P0VH 4Y16B 4RISH 2ZCKH 4LLAA 1T2QL 5CEYA 2EDJA 2WK2A 3S4SA 3L3HB 2W9DH 2R0ZL 4EI6B 1NCBH 1T3FB 4MMZC 3TYFB 3D3VB 5T1KB 2A6IB 1NAMH 5ANME 1N59B 5HDBE 5GISL 1BZ7B 4JFZH 2Z31A 4P2QD 1DTUA 1N8ZB 2P42B 3PHQB 4JKMA 4HWNA 1FZJB 4F15B 1LE5B 4ZPVA 5I1JL 3W11D 4F8QA 3QXDB 2YD4A 3LB6D 5DHVA 1HHHA 1HKFA 4MD5A 1IM9B 5TDNA 3BVNB 4X8JA 5LVEA 5T3ZE 3QPXL 5A16B 1SY6H 5IHZA 2CIIA 2R0LL 1JWSB 3X14B 4RGNB 3FN0L 1X4XA 2XKSA 3F7YB 2VIRB 4UV7H 1EVTC 2NY4C 1B4RA 3GIVA 4MNHA 2F54B 4ONOA 3BPOB 4KTEH 1JRHI 4ODSL 2I5YH 4Y16C 1KNOB 1S9YA 2DBLH 4V1DD 3LQZB 5E8EB 3MXWH 3FOMA 4ISVA 4MD0B 4UTAL 3DVNB 3FO9A 2Q7NA 4M48L 5C09E 4J4PC 2WUCL 4G5ZL 3DO7B 5HGGS 1F4YH 3P73A 1NPUA 4M6AA 3O6FB 5D2LE 2KH2B 4JFQA 3AAZA 1ZE3C 2AV7A 5DHYB 4IJ3B 4J3SA 1I7TB 2Y25A 3HNSH 2VXTL 4F15C 2V2TB 3WS6A 1TZIA 3IB4A 3B43A 4JHWH 2LTQB 2YN3A 3LKOB 4M02A 1JNHB 1A7RL 1GAFH 3SBWC 1EAPA 1MFEH 5GGQH 5CEZD 3VXNB 1JNNH 3L3JA 4KVCL 2ADIB 4KDWA 2X9XA 3RDTD 1QFUL 3Q3GA 3Q5OA 5AZEL 4RGNC 3RFZC 1BD2D 2K7PA 4MD4A 5ALBH 4OCRL 3VFMB 1DDHA 2JKXA 1KEML 1T03H 3BPOC 1NJ9A 3FO1A 3RIAK 1X3DA 3ZDYF 3U4AA 2DAVA 4HMDA 4OD1L 2X4PA 4HIXL 3QO0A 2Q7YB 4ZFFB 3ULVE 2HVKB 3ARDD 1MCBA 3ZDZF 3IXAB 4PD4K 2MWCA 1PDKA 2YUZA 5MEOA 3IDGB 2PYEA 3ETBF 4QHNB 2ZOLA 5FA3A 3MOAH 3NIGF 5IBUG 2GYSA 3U0WH 3H3PH 3NZ8B 2CDEB 1QTYT 2OM5A 3O6FC 2VDRL 2XWJB 5FYJL 2GCYA 1CDYA 3DX6B 1H0DA 3DURB 2AI0L 2BNQD 4I5BB 4IJ3C 4PJFB 2AP2A 4PV8B 5HYSB 2H32A 4O51B 2LTQC 5K9QG 1MHHA 1P4BL 3RWCB 1RUPH 1KF9B 3TO2B 3TZVD 5L2JA 2GITA 2AJXL 3I6KB 1YJDC 3L7EB 3NFSL 3P0YL 3MREB 3G5YB 5BW7C 5DVKA 4JFEA 3BWAA 5DJCB 1ZLSH 2MFNA 4QOKE 4W6YB 2DWDA 3GJFB 3LS5H 4I18C 1RJZB 5D2NE 3O0RL 3FT4A 4PRAB 1I8KB 3MRNA 3SQOL 1V7NL 3D0LB 5IFAH 4H88H 3CU1A 1QFHA 5C0BE 5F7LB 1U95A 1DZBA 3ZT7A 5IB2A 3UJTH 1MCWW 2PCPA 1BLNA 1FYTD 3ZZ1A 2CO6B 3QFJB 1MJ7L 4K7PH 5D7SH 5T1DL 4DUVA 1U58B 2VDOL 3CZJA 4FA8A 1PKQB 2RFXA 3QI9B 2VITA 1A6TB 5JHDE 3VRJA 4W6WB 2BVOA 5GGTH 1K3ZA 5EO0B 2HFGH 2VXVH 5DLML 4F7CB 2AABH 2AJSL 2V5SA 4NZRH 1QSVA 2BP3A 1CLYH 1ZANL 3IU4H 4PREA 3O8XA 1HZHH 4HUVA 1RZJH 4MA8H 1DQLH 4E0RB 2GK0B 3QUMH 4QHMB 3MLWL 5EOQL 5KSBB 5KG9B 1BBDH 4MAYA 3BDXA 1WUNT 5E8OB 2IMMA 2YD8A 4JN1H 4F57H 3TN0B 1UWEL 3OKYA 3EOYG 3T2NH 5IMOA 3O41B 4BFIA 1S9WB 1DQJB 1A1NB 3ZKXB 1CU4H 1VGKB 3V52H 1ZTXH 1KYOJ 4OV5A 5IEHB 3INUL 1AE6H 5C9KA 2EDLA 1TVHB 4HLZG 4XCYA 1G0YR 5E2WH 2A83A 2AV1A 2H32H 2OQJB 4AENB 1CR9H 4UQ2A 3S37L 3L5IA 5IGXL 5D1QD 1DLFH 3RL2A 3MRGA 1KBGH 3PWPD 5IKCA 1WT5A 4X6CE 3QI9C 1LO3H 1IT9L 4PJXB 3C8KA 1SYVB 2FR4A 4YHZL 4JB9L 1G9NL 4P5KB 1CZ8L 1ZSDA 4KQ4L 2IQAA 5I8KL 1KT2B 4LP5A 3QUXA 3WXWL 2CRMA 1YEDB 1A7OH 4MQSB 2VAAA 2VWEC 1UB6B 5BZWA 4EOWL 1W0VA 1GOFA 1BP3B 3Q6GH 4O02L 2ATPA 2E27H 3S5LB 4NO5B 5DS8B 1Q72L 2OMBA 2ORBL 4EN3D 5FYKE 4PTUB 3MMEA 3TN0C 3VFRB 1L7IH 3ARPA 2W65A 2VL4A 3CFBB 1QRNA 4X6DE 2NPLX 5LAXA 1W72A 1F4XL 4FFYH 3VXQB 1FO0A 3GSVA 1MHEA 1OT2A 5DD5H 4PBWD 2JB5L 4Z0BH 5B8CA 3CFKB 3LRSB 3MCKA 2DQHH 3DYOA 3CD4A 3BDYL 3SJVD 4YJZL 1R3KB 4I0PB 2FJFB 4LPWA 4PP1D 1K4CB 3VD9A 4LU5H 2QKIA 3SKUD 3C6LD 4IOIA 4K9EL 4D0CB 5CZXD 1EAJA 2QQKL 1FVCA 8FABB 4YHKL 1GGBH 1EMTH 1LO2L 4I9WD 3F58L 4XB8A 1E27B 1PW3A 4GFTB 2X4QB 3MLUH 5EORL 2VLRB 4PR5A 4LL9A 1ND0A 2BSSA 5IOPA 4Y1AE 2JTDA 4OIBA 5HY9A 2MKLC 5GGVY 1M7IA 1WK0A 4E41D 5GRYA 3IS0X 1QLRB 5J57B 4DKEH 1EEUA 3SGEH 2D7NA 5KS9F 2IEPA 1SM3L 2JK5A 3QAZC 4TPRL 1FL3A 1TZHA 3O6KL 2AEPH 1AD9A 1BVKB 4XNQA 1ZT1A 4HD9A 3TBWB 3T0ED 3TVMA 4AEFA 4DGVH 5CZVL 5DJXB 4YE4H 4HKJA 3OXRB 1QSFB 1I9EA 4I0PC 4QHUB 4HQQH 1A6AA 1KPVA 4JVUA 2FBJH 1DSFL 3MGAA 4JY6B 1FO0H 2P24A 4GRLD 2EKSB 4JVPA 4WUUE 1HXYA 2EE6A 1JGLH 2VRAA 2D7TL 4HIJA 1E4WL 3I6LE 4PJIB 3IVKA 2C3GA 1M6OB 2FJGA 4UNTA 3RA7L 4K7PX 2H26B 3ZMRA 2V9RA 3NCEB 1EFQA 4D2NA 1QLEL 12E8H 2CJUL 2R4SL 4M1CC 3MJ8A 3PDOA 2R69L 3KAAA 4YGVB 4H25B 3ROLB 4Z77B 4X4ZA 1BBJB 2CR6A 4U1HB 4DW2L 1KCLA 5E99H 1S7RB 3ARED 1UH4A 4GKZA 5CJXA 5FGCB 4JO1H 1F4HA 5I30L 4IM8A 2XN9D 2QADB 2BNRE 1HOCB 3S34L 4J1UB 3CLFH 4YFLI 3N85L 5DRWA 4M6OH 3E1F1 2VLMD 3KWWA 1CL7L 4HBQA 2HKHH 3QG6A 1CE6B 4KUZL 5HYJB 3O11A 1J05A 1RK0A 3GMMA 3IFLL 2CLZB 4KHTH 4XNYL 2UWEB 4KJQD 4X9IA 4IHOB 4WJ5A 2IADB 3FQRB 4DQOL 4MJ5B 3ZKQD 1EHAA 5HVHB 5D70L 1XAUA 4KFZC 1TIUA 3HUJF 5EN2B 1UACH 4GAJL 4F58H 1DQMH 3S3SA 4NUJA 4KVNL 1GC1L 1YN6A 3GJFK 2MHAB 4W4NA 4ZS7H 2CD0A 2VLKB 1CGTA 5L9DH 3H0TB 4O5LL 4OF8A 2Z8WC 3RNKB 1C1EL 4BSJA 3ECBA 2QQNH 3JV6B 4PJCA 1EO5A 3FQUA 3D48R 5I1LB 3LSOB 5ABDE 2VMFA 5F70A 3LEYH 1Q8MA 4HAFA 1UM4L 2HT3D 4PYHA 4P2QE 5LJYH 2QADC 3ARVA 1NLDH 2O93L 4IOFD 3A6BH 4KAQH 1LVEA 2BXZA 4PY7B 1MCWM 5CSZA 2GSGB 1RVFH 2ADGB 1EEZB 1S7UB 1AKJB 4TQEL 2VQUA 3RPIB 4HF5L 3FO2B 3FFCD 4E5XA 5BVPL 2BNUB 5T3XH 1RI8A 2NXYD 4J8RA 3WJJC 4XGZA 3WLWC 1R3IH 3U6RA 2ZUQB 1IGTB 5DQDH 4FQCL 5DGQA 5FB8A 3PL6A 1ZA6B 1ZGLA 1INQB 5HVHC 3IFOB 3HPLB 2VDKH 4NN6B 5DJAA 5DK0B 1R3JA 2JJSA 2O5XH 3KYNA 3DVGA 4RIRB 5GS0L 1KJ3L 4V1DE 4FFWD 5J3HC 1KELL 4MS8D 4LSVL 1I85C 5L6YL 4Y4FB 1S7SA 32C2B 3M1BB 3B2UD 1VB9A 2WW8A 2GJ6D 3RWDB 5CSGA 5C92A 4KK8C 2NXZD 5IB4B 2YPKA 5FCSH 4OAWA 4JN2A 1OTSC 3ULVL 2Y4SA 3V95A 3SDXA 4Z7NE 5DD3L 4LOUD 3EKCA 4JPKL 3DGCR 4OQTH 4KPHL 1FDLL 3PABA 4XCCL 3OB0K 1NQBA 3P4LA 5L0QC 4GRWB 2Y36L 1MHPL 2HAZA 2OR8A 3GBML 5AD0B 5TDOB 5KVGL 4WHCA 4K3DL 3WUZA 3UDWA 2DQJH 3WFCL 1RZIB 2P5EA 4HUNB 4LCYB 4LRIC 2ZUQC 1JYNA 2BSED 1TXKA 4KJYA 1CDUA 3C87A 1FNFA 1BD2E 1VDGA 1GPOL 4AT6B 1CT8A 4IRZH 1HXMA 2DLFL 4OCMC 1NMBL 3BSZL 4WEMB 4WW1B 15C8H 2VO5A 5EUOA 1ZHNB 3L5XH 1DN0B 1XF3A 2CLRB 3O4LE 4NN6C 4NCC2 5FFLA 5CCKH 3QDMA 4JJ5A 4ODUB 4S0SD 1R3LB 3NACL 2C4XA 4PB9H 4UUJB 4Y4FC 5JOFB 3L3DB 4BQ9A 3L9RB 5SX5K 1QSEB 1W8NA 3HLAA 3VI3E 4JQIL 1T80A 7FABH 4PJGB 3DYPA 1M05A 3G08A 5K59E 5EO1B 5AUMB 5ITBL 3LEXB 4NGHH 5E7FA 1RZFH 4RQQB 5IVXB 1NCAL 1ONQA 3HZMA 3OZ9H 5ANMB 5DVNA 4JO4L 1N64L 3PWNB 3KYKL 1YEFL 4KZDH 2IGFH 3CCHB 2DYPA 5IP4A 5HHME 1UJ3B 4Q58C 4LQFH 4TNVF 5FYLD 4P4RA 2ZP0T 4FQ1H 5J56B 4D94A 4LHUD 1K2DB 2APTA 1FJ1A 1OLZA 3RIFF 4Y2DB 4I2XA 1QFWH 3MV9B 1YYLL 4FZ8H 2NYYC 3RL1A 3QXUA 1RQ5A 3JTTA 5ACZB 4YX2L 4RDQG 1KJMB 5FV2A 4PRBB 1LO4L 3BP5A 2H6PB 3A0OA 4JHAH 4RWYH 4RMRA 1FYTE 2NR6D 2R2EB 1NUFA 1WJ3A 5FUZH 1KCUL 4ELME 3SE3C 1N6QL 4LCUB 1ZWIB 2X4SB 3LQAC 5CZKA 2IQ9H 2AK4D 4AMKL 2IPUG 1JI2A 3JWOL 5DMGD 3EDDA 1LD9B 3SKNA 4W4OC 2X4RA 4MCZA 5C09B 2PETA 3F12A 5IMMB 4Z7OE 3HI6L 5TFSL 1P6AB 4BZ2L 2BY2A 4HZLA 3RAJL 3KPMB 1UJ3C 1CLZL 1X5YA 1T04A 2BVQA 1L0XA 5KZCD 5IK3B 4HG4J 5E08H 2R56H 1WBZB 3LKPA 4NQUA 4L3EE 3S35X 4OM1L 1QR1A 1Q38A 1I7ZB 3STLA 2ADFL 4JY5H 4Y2DC 3TBSA 4JM4H 4H1LB 4LVNB 4WCYL 1SEQL 4F2MB 4F9PA 3SCMA 3RVWD 1YPZF 4TUKL 1GC1C 3VRLE 5BVJB 2E7MA 3WDJA 3GB7B 3M8OH 3DMMD 5FYKL 3MRCB 5F21B 4N0CC 4LNRB 5IG7B 1DFBL 3GMRA 3PWPE 4L9LB 5TE7H 3F7QA 1C5BL 1G7MB 4MMXC 4LLVB 4WI9A 4MJ4A 2AXFB 5A40E 1U8QA 1INDH 4ORGB 2P44B 1O5DT 2PW2B 5BOPA 5I8CA 5EU6A 4QWWD 4IEFB 3DUSA 5CUSH 4FTVD 4UBDC 4GMSH 4M62H 3GSRA 4QLRA 4AJ0A 3IJYB 2XQBL 5JORA 4JY4A 3ULUH 1JNLL 1NL0H 3L3HA 2FO1A 2HT2D 4LVNC 3MLTB 2IPTH 1B0RA 4L8DB 3TYFA 3D3VA 1KIRA 1A9BB 2FEDD 3RU8H 5GS0C 5M7QA 5FO9A 4J4PA 3CZFB 3VRIB 1ROWA 4QOKB 1SQ2N 1N8ZA 3FB8B 2ZPKH 1GOHA 1MLBB 3SJVE 3ZHKA 3FFDA 3G6DL 2F5BL 4QGTA 4JJHA 3SDAB 3TWCL 3E2HB 4L9LC 3V2AR 5DUPH 5C0BB 4KJWD 5DHXB 5DD0H 1ZLWH 3ULVC 2HT4D 1NGWB 1IM9A 2E8ZA 1U6AL 1QVOA 5HHVH 3EOBB 4GJTB 3QJFA 3JBG7 4MA3A 1ZT4B 2X89D 1OGAB 3X14A 5JHDB 3N06B 1IQDA 3BGMB 3W81A 2VIRA 1HILA 2JCCF 4K23L 3ARXA 4I9WE 4ERSL 4GAGH 4R8WL 5D8JL 1AR1D 1WGOA 4BKLB 1NH6A 3LPFA 4Y4HA 2Q86B 2X40A 4JPIB 2DQCH 2ZJSL 1NGQH 1DQQB 2OTWB 4U1LA 5MERA 4HMCA 3C5SA 2D03H 2XNAA 3ELAT 1G7JA 3M45A 4F7TB 2IH3B 3S98A 3MLVH 2C9AA 5I66B 5K9OB 2DKUA 3P2TA 2R29H 1VENA 4JGJA 5CJBA 3K46A 2X4OA 3SOBH 3T0EE 5D2NC 1OSPL 3WNLA 4PJ9B 3SDAC 3E2HC 1OAXH 3VXSA 1XF5B 1S78C 2DLEA 3UMTA 4NRXA 3VFOB 5CBAA 3W2DH 1I1FA 4QKXB 1JNHA 3DRTA 4F3FA 1P7KA 4S10A 1AHWB 4A6YB 4X6CB 2W0FA 4ODTH 3KLDA 3ZTJH 5E8NB 5HI5C 4N8VG 5C0IB 4NYLA 5E6ZA 3SY0B 3F5WB 5IBTH 5C2BH 2RB8A 2RGSA 1J11A 1NMAH 3FT2B 1NC2A 4PFEA 3GMQB 2BVUA 4XMKL 5H35B 4XNUH 1S3KL 4KKLC 3HFML 2E3VA 3SQBA 4M6ML 3P4NB 3NCYS 4G8FB 3VE0B 3MLSH 3HNVL 4ZUVA 3M07A 3UEZA 4PJ9C 3TV3L 1I9RL 4PGBA 3RJDA 1DEEA 4MQTB 4X98B 3BJLA 3OMZA 4MA7H 5IFJA 4UZGA 2C3XA 3TO2A 2J4WH 4JEGB 1AHWC 1CFNA 2PO6B 4DWHA 4O2EB 4Y5YA 2VLME 4JHBA 5IQ7L 1J9CT 1BQHB 3GRWA 2V9QA 1MRDH 3WFDH 5ICZB 4DAGH 4J6RH 2FYYA 3ROOA 1IAKB 3BN3B 4QHLB 5I1AB 4Q9QL 4NKOB 1RULH 1GZQA 2WAHA 3MV8D 2GEEA 5DD6B 3RWEA 5FAAA 4MA1B 4ZXBD 4ZQKB 1ZA3A 5GGRB 3Q0HA 1Y6NR 1YJDH 4I77L 1VA9A 4ODHL 3MFFA 1FFQA 1KCRL 2OSLB 3KJ6L 3ZL4H 1PKQA 4LVHB 2QLVB 3MO1A 3PXHA 3QIUC 3J7HA 3U4BH 1MRFH 2YEZA 3AUVA 4F7CA 1VEPA 3UTSD 1KJVB 3MJ9L 1GGCL 2WSKA 4TVPD 3DGGA 4P23B 5F89B 3C5JB 3TNNB 1QBLH 3WSQL 2GK0A 4PJAE 1BECA 3AS0A 3P0GB 4ZPTB 5KSBA 2ZNXA 5DK2A 3VXPB 2PO6C 1JK8A 1P84J 1W8OA 2YWZA 2EYRB 1I1CA 2J6EA 1A6ZA 3SE4A 1YY8B 3NN8A 5F96H 3AXLA 3CUPA 3LVEA 4H0IA 5JXAL 4G3YH 4GG6F 4YHYB 3CK0H 3VXRA 1TVHA 3FQNA 2A6JB 4WUUB 1GGIH 4JHZA 5BRZD 3UAJC 4MA1C 5CEZL 1CXEA 2VDPL 5DMYA 5D1ZD 2LU7A 3AS2A 2BXYA 4X7TA 4X7EC 3MBED 4LVHC 2GJ6E 1SJHB 4R90L 4LARL 4XXDA 25C8H 1XH3A 1T2QH 1PGRB 1T7VA 4P23C 2V2XB 2J8UE 5KANI 1M7DA 2WIIA 2R0ZH 3T1FB 3ARZA 4JQXC 2XIDA 4KRPB 1N5AA 4WV1B 2XTJD 5DS8A 2LU3A 5GISH 2BNRB 5CP7A 4PTUA 1AFVL 1U3HB 1WSST 1MPAH 4N9GB 1XGRB 5KSUB 5DA0B 4WWKA 4YHYC 5I1JH 3UTTB 4QNPF 3LD8B 3ZLQC 4BUHA 3VXQA 3BUYB 3O2VL 2DMKA 3O6LH 5TE6L 3EHBC 4XVUD 2SEBB 3QPXH 2R0LH 2HJFB 1NGYB 1R3KA 2XKNB 3FN0H 1AC0A 1HHGA 2B20A 2C5DC 2N4IA 3KYMB 4G9DB 2QHRL 2Q76A 4ODSH 3TEUA 1ZVSA 5CIPB 3Q6FA 4HBCL 5T1MA 2AJZB 3NPSB 1HHIB 1P4LA 3H9SE 3WCYA 1Y6MR 3GGWB 1Q0YL 2Q8AL 4UTAH 3KHOA 1D9KD 3L95A 3OAZH 4KY1L 4LASL 5J9PB 3OKOA 5CINL 4KRPC 5CEXA 4Y0GA 4M48H 4HW6A 4NP4L 4RBPH 3ARGA 4P2QB 3W0WE 4WV1C 2WUCH 4G5ZH 1CDIA 4HT1L 2VLRA 3MNWA 3S96A 1U3HC 2NY1D 2PUQT 1L9MA 3D69A 4TVSa 3EOAB 2VXTH 4U7MA 2ARJB 3QHFL 3AY4A 3MRHA 5JXEC 4UTBL 1F58L 2C1OA 4CMHB 4JZOA 1BZ9A 1A7RH 3V8OA 2CIKB 2D4FA 5T5NG 1D5ZB 4KVCH 3T4YA 1BFOB 2Z31D 2JF1A 1QFUH 5AZEH 1AP2A 1ORSB 1WQVT 3MFGB 3V7AG 2EDEA 1QSFA 4LLQB 4OCRH 1WCBA 2A73A 1G9ML 3QNXA 1WITA 1KEMH 4V1DB 1RZ8A 2L7UA 3N50A 1G7IB 4F33B 2AK4E 3NPSC 4OD1H 1VSCA 3WNNA 4HIXH 2GT9B 3BYTA 4X99B 3NIDF 1SJEA 4P57A 3O3BB 4Z78B 1VPOL 4DGYL 4MJID 3RI5K 1PFCA 2H26A 2YK1L 2Z8VC 2I27N 5D7KD 2VDRH 5FYJH 4HS3A 3W11C 2AI0H 3TH4T 3LB6C 4CVWA 3ILPA 1IGYA 2ZZUT 4HKZB 4CMHC 4QHKI 1P4BH 3DRQB 5ICYB 4U1HA 5C0DB 1FZKA 4M7LL 2L4OA 2AJXH 1J87A 3EJYD 1BD2B 2DI7A 3NFSH 2EO9A 3P0YH 1TQCB 4Y89A 4HG4K 5JLZA 5TQ2L 1B90A 4OCNC 5F3HA 3SE9L 4BSVA 3QG7L 3O0RH 3RUGE 3MRMB 3PV7A 3ARDB 5F6IB 1V7NH 4NO2A 3NIFE 2VABA 4RMSA 5CP3A 3CX5K 2E9JA 4UNUA 4M61A 1MCPL 4GOSA 4LSSL 4RAUA 4CADA 1MJ7H 5T1DH 2CSPA 4FTVE 2IADA 2YA2A 5CWSB 2VDOH 1ZT7B 2IG2L 3IRZA 2XWTA 2OZ4A 1RUAL 2BNQB 1IAOB 1CFSA 2WNGA 5DLMH 1G7QB 2AJSH 5LBSH 1KPUA 2MHAA 4ZUWA 2VLKA 3IAQA 1ZANH 3C08L 3TZVB 5HPOA 4KZEL 3SGKA 2PYED 3MLWH 5EOQH 1W0WA 5A2FA 3RDTC 1G6RL 2EZ0D 4R0LB 2VJXA 1HNGA 4OZFG 3V0AC 3LSOA 3T04D 1R5VA 1K85A 1TQCC 1UWEH 1AGFA 5BMFL 3NFNA 4NJ9L 1NKOA 1U8LB 5F88B 2P8LB 4OZIF 2NZIA 2ADGA 1WAAF 1XGTA 2FHFA 3INUH 2WBWB 3H3KA 1NUNB 2DB8A 2D7MA 2BNUA 3ARDC 3MROB 5F6IC 2YC1B 4LCCA 1FYTB 4N5ED 4YHOL 5IB5A 4LP4A 4ELMB 4DOHE 2XV6B 5IGXH 4FXKA 1IGTA 4JFED 4WEUD 3AMLA 3DECA 1JGEA 1KLUB 2NX5A 4QCIB 1ZA6A 3T3PF 5H2BA 4IDJL 5MI0B 3IFOA 4HUUB 1IT9H 2BDNH 1MAJA 3DUUA 1BIHA 3OJVC 4YHZH 3MLYH 4JB9H 1G9NH 1CZ8H 4GKNA 2XQYK 3QUZA 4KQ4H 1Z5LB 4U6VL 5I8KH 3WXWH 5I19L 2W59A 3TZVC 3M1BA 4PGEA 3RZWA 4HKBB 5E1AB 1P2CA 3V8CA 4R0LC 4O02H 5B38G 1TVBA 1QHOA 1Q72H 2XZAL 2ORBH 3PNWB 4OM0L 4YHPA 2M8XA 3SDDA 3I3EA 2FHBA 4R96B 4BJLA 5D7LD 4YZFF 4BFGA 2Q20A 5KJRL 1C08A 4OCYL 4HV8B 1FBIL 5FECB 5IM7A 5C07E 1F4XH 1HYRC 3BEWA 2F19L 5AD0A 1FG2A 4TSAL 3I6GB 4MAYD 5D1QB 2VKXA 5F71A 1OSZB 1R3HB 4A2LA 2JB5H 1CFTA 4GLRH 4NKIH 3MACL 4LCYA 1H3PL 3EYVB 3PWPB 1ACZA 1MHCB 4YEEA 3GZKA 3BDYH 5CJOL 1DJSA 5GRJL 3BHBA 5JIPA 3BIKB 5ENWA 1X9QA 4AT6A 5MI0C 2NNAA 2YRPA 3O81A 3VWKD 4MDJB 1ZHNA 4HCRL 1S9XA 3IJSA 4LLYA 2Q6WA 3GSXA 2DI9A 1FIEA 4K9EH 1CQKA 5EU7E 2V7HA 4HZAA 3GM0A 5F44A 3UTPD 3ZDXE 1FHGA 4GKSA 2QQKH 4G6JL 3Q5YA 4YHKH 1PZUB 5CHNB 5DRNB 4X7SL 1LO2H 3G5VB 4X6BB 3IKCB 4EN3B 1S7TB 3NCYP 4Q9RL 3F58H 2HJKB 5IR1B 5C0FB 1XGUA 5LGJA 2QR0B 5GRVK 4CN1A 5EORH 4MQ7B 4R7DB 4TUJA 1ZGLP 1A1MB 1X5FA 5HI3D 4ZO9A 4HK0A 1G9MC 4MLSA 5IVXA 3QUXD 4M5ZL 1P5UA 2NW2A 4HS8L 4POYA 1KB9J 3PWNA 5IMKB 1DUZB 3EO0B 1J1OL 1CFVL 3CH1B 4TPRH 2IBBA 3O6KH 1PX3A 3SJVB 2EE3A 1JVKA 1X7QB 4P5MB 4HJGB 1OVZA 5CZVH 1TCMA 5EC2B 4R4ND 5B3JE 1QRND 1KCSL 3I02A 1U91A 1Q1JL 3BZ4A 3KPRD 4CVXB 4MXVE 1I3RA 1H3UA 4GH7B 4LMQI 4YHLL 3C6LB 5F9JB 1G1YA 1LGVA 3HRPA 1DSFH 3P77B 5JO5A 4OKVB 3MV8E 3NA9L 2J12B 3LPWA 4GRWH 1IVLA 1OLLA 2H6PA 5HGHB 3J8F7 1E4WH 3DPBA 2O61B 1G6RB 4LMQE 3WLBB 4EN3C 5DEFA 3RA7H 3X17A 2X7LB 4LCIL 4U1JA 4UI2A 1RZKL 4E41B 3GHEL 3DVFA 4XVTL 1QLEH 2KUTA 4RRPG 2CJUH 2R4SH 1SVZA 1AQDA 3OL2A 4TVPE 2R69H 4FFZL 1M4KA 3EAKA 3KPMA 1OGTB 3T0EB 4HPOH 4DW2H 3VMPA 4L1DA 1YMHB 1FNGA 1R5IA 1UGNA 1WWWX 4PJ7A 5I30H 3QNZB 1A2YB 3CU7A 5BV7H 4PP1C 1OQOA 1RJYB 1EPFA 3QT2A 1OAYL 3TGXA 1O7SA 4RNRA 2EH8L 2OCFD 2DD8L 1Q9KB 4WRLA 3S36L 3S34H 3C6LC 3IDMB 5CZXC 4GRLB 3N85H 2AKRB 5FOBA 5TPWL 4LGRB 2D7PA 3TO4A 2QJDA 1CL7H 2X4TB 4C57C 3TVMD 4OGYL 4KUZH 3EO1A 1P84K 1QHPA 5DQ9B 3IFLH 3S37X 4NQVB 5C8JB 4XNYH 3K2UL 1V7ML 3QDGA 3RX7A 4DQOH 5D70H 4POZD 4S2SA 4LLVA 4GAJH 4FG6D 5ESAB 4KVNH 1GC1H 1QKZL 4PJ8A 5HXMA 4F9LC 3OJMB 5IEKB 1CF8L 3QUKA 4QXTB 1ZHKA 3O9WA 4O5LH 2OTPA 1C1EH 3AREB 3D85D 3T0EC 1B9ZA 4XNMA 5ESQB 2XN9B 2XZCL 3IDIA 1CN4A 3DHMA 1YY9D 1OOAA 3FRUA 5F1NA 1UM4H 5CKGA 5E95B 4B0MM 3JV5A 5F9WB 1HHKB 2MCPL 1KC5L 1Q9LB 3EDFA 1FPTL 1UWXH 2AGJH 2GHWB 4L8DA 4NO0B 4MNGA 1S7WA 3C9NB 2VDQL 4TQEH 4HF5H 3G6JE 2EDOA 2ATKA 5BVPH 4UV4L 1Q9WA 3VRIA 4ZNEA 3PF2A 5FYLL 5C0ND 5BJTB 2FL5A 1WFUA 1KTDB 3FB8A 4CKVX 4BH7B 4FQCH 3BP6B 4OFVA 3C8DA 5TE4L 2R2HB 4MAUL 4IBLT 4CMMA 1X6LA 4NRYA 4PJDF 4M03A 4H1LH 5IHUL 3MR9A 1W0YT 2NY5L 4S1QL 4PRIE 4MXWL 3K8LA 2OXGA 3WHXB 5I73B 4ZOBA 4GBXA 4KUCD 5GS0H 1KJ3H 1KELH 1NBYB 4LSVH 4B50A 5L6YH 1LDPL 1LEGB 1YUHA 4J7RA 3U2SA 3AREC 3TJEH 3IU3A 4YHIB 2AJ3B 2BVYA 4PJHF 1X5GA 1ZS8B 5GS2D 4XPFL 4PJAB 3W5MA 5LKNA 5MP6L 3ULVH 5F9WC 2OTWA 3GMLB 1MFCL 3OKEB 5DD3H 2BX5A 5C0EA 3FFCB 4JPKH 4HJJL 1CFBA 2NXYB 4KPHH 1MLCA 4U31A 1FDLH 4XCCH 3IGAA 1SVCP 1MIML 1MHPH 2Y36H 1VCAA 3C09B 3GBMH 3QWOA 2NW3A 4K3DH 3HG1A 3WFCH 1TENA 3MA7B 4KJQC 4LPUA 1CFQA 2BRRL 3TBTA 2Y7QB 1RUQL 5FA4A 1A21A 2FECI 3QEQE 1GPOH 1JPGA 1TNMA 3VFOA 1IM3A 2DLFH 1K8DB 3BSZH 5KSVA 1G1CA 4FQPA 5I73C 3RKDD 2AXHA 4I1NB 4Y5VA 4FP8L 3NACH 2GJ6B 1B88A 2NXZB 4MCYB 4C83B 3PL6D 2VL5A 1UZ8B 4JQIH 4JRYA 2HT3C 3F5WA 3WNPA 2NY0D 1UB5A 2VXQL 5ITBH 3BAEL 2HLFC 5D7KE 2J8UB 1JWUB 1E6JL 4WNQB 3HMWL 4HGKC 4RA0C 1NCAH 4XBGB 5H35A 2R23B 5EU5B 4JO4H 2K9UA 1N64H 2NXYC 5DFWH 3KYKH 1YEFH 5FYJU 3WKML 4OZGF 2YN5A 4U05A 4HJ0D 1WBYA 5MEPB 3ZT5A 3O3EA 2MSPA 2QHLA 3OR6B 3PGDA 3VI4E 5I1KL 2WANA 5BQ7A 5EG6C 1NC4A 3EW3B 4B7LA 2V5MA 4YUEL 1YYLH 4AIZB 4QRRA 3WHE0 4FFWC 3TBVA 4MS8C 1FQ9C 4PJBB 3GSWB 2P5ED 4YX2H 5J6GB 3B2UC 1YECH 1BQHA 4HSQA 1LO4H 1D5IL 2AJYL 4RAVA 3X12B 1T83A 4M1DL 4L4VE 2NXZC 2AK1L 3KPOA 3N9GL 1KCUH 1Z0NA 5DI8B 1N6QH 1Y18A 4PG9B 4PB0L 4LOUC 4PJIF 4AMKH 3JWOH 3QDMD 4RFOL 1AIFA 4EUPA 2WV3A 4X5WA 3HI6H 5TFSH 2OSLA 2BY1A 4LKXB 2PYEE 5JDSA 3RAJH 1I1YB 1CLZH 3IDXL 3L3GA 4LHUB 5HDOA 1JHTB 3Q2CA 3RVTD 3BH9B 3KJ4B 2YRZA 1C16A 3GIZL 4FXLA 4OM1H 5F89A 4M1GL 1U9KA 2ADFH 4OLXL 4WCYH 1SEQH 1IAIL 3FONB 1KLGA 4TUKH 2DYPD 5K9JL 1CK0L 3CPLB 2G75B 2VOTA 2DKMA 1ZLVK 2JJVA 43CAB 3MRRA 1TJIL 4OGAC 1DFBH 5TDPA 2AK4B 4ODVL 5E8PB 1C5BH 2GTWB 5GRXG 1HSAB 1KENL 4NO3B 3DX9B 5J11B 2QSVA 1KB5A 1MAML 4H8WL 3VJ6A 5E1HB 4ONFL 5DJ6A 3UPRA 5KZCB 5IW6B 5C6PB 1E4KA 4OUOA 2IAMA 1CDHA 4PJEF 3ULUD 1QQDA 4N0UA 3KJ4C 5F97E 3DOSA 3B3IB 4JKLA 2XQBH 4QRSB 2DQFA 1JNLH 2J2ZA 4YAQA 4PLJD 5HYIA 1LK3L 2XACC 1TMCB 1P9MC 1EERB 2R4RL 4NBZB 1J0IA 1EUUA 2BVPB 2NY5C 4HDIB 2F74A 3DMMB 1BHGA 1SHMA 5FKPA 1RK1B 4R97B 3S88L 4WU7B 4EUPH 2WLZA 1B3JA 1N3NB 4P3WA 2NR6C 1CD8A 2OL3B 3LPGA 2EYSB 1U3HA 4OBRA 3LRGA 3WXVL 2HJLA 3O2DL 5MENE 4N9GA 1P6FA 5DJ8B 4C59B 4YDJB 3RUGB 3G6DH 2F5BH 3VH8A 4WO4A 3TWCH 3OX8B 1A6VL 3UTTA 3SCMD 3BUYA 5EC1A 5DMGC 3GKZA 1VKXA 3UYRH 2W9EL 3KHQA 5DSCA 3VFWB 1U6AH 3OGOE 4MNQB 4UOW1 5J11C 4HGWA 4FTVB 2J3SA 1A14H 4K23H 4I0CC 4Z76A 1CGYA 2FX7L 4JKKA 4ERSH 4R8WH 5D8JH 1U8PA 4XNZB 4JDZA 2ZJSH 1DLHB 3N1MC 1TCRA 2GFBA 4P4KA 3RVWC 3QDAA 5EU6D 2HKFL 3HAEA 1MCOL 3DMMC 5BS0A 1NKRA 4BZ1L 3O3DB 3VA6A 1YN7B 1LO5B 1UCBL 3ZE2F 4JM2C 2YHGA 1OSPH 4HFWA 4TVPL 3MA9L 4GRWF 1EXUB 4WVRA 3FQXA 1QRNE 4H26A 3MV7E 4ZFOL 1EH9A 5EUKA 4QF1B 3MRKA 1KB9K 5A2JH 2YR3A 3EGSA 4QWWC 5E5UB 1A7QL 4UB0L 1RIHL 4P2YA 1A6UL 1PY4A 4XWOD 3L6FA 3QIWA 1BVZA 2IALA 4JQVA 4G6AD 4OFYA 2IBZX 4UINL 4CNIB 5K9KA 4HWEL 3DUHA 4R4BA 4R3SB 5FM5O 3BZFA 3WD5L 1K6QL 4XNZC 4AZ8A 2G60L 1JZ8A 1NFDB 1JUFA 2F8OA 2HT2C 1I7UA 5C0AA 1PG7L 3EFDH 3FB6B 2FEDC 2UV3A 3T0DA 3HC3L 4DTGL 4XMKH 3U48A 1NCDL 4S0TD 1S3KH 4ZSOA 3HFMH 1UFUA 3AMKA 4M6MH 3RWFA 4JFXB 3JSSA 4Y4HD 1MFDL 1KJ2L 1NCBL 1Q94B 2FHCA 3HNVH 4OT1L 4URTB 2Z35A 5HDBF 3W9EA 5EIIA 4KJWC 4KK5D 1HIML 3TV3H 1I9RH 3KYOB 2HT4C 4PGZA 4XP4L 4ZUTB 3MNZA 4ZMAT 2IH1B 4S1RH 4XVSL 2VQTA 2FJHB 5EPMA 5IQ7H 3X3GH 5F7WC 1AR1C 4G42B 2ID5A 3VXSD 2ZUWA 5GSVB 3V5DA 1EUTA 4Z95L 4OCWL 1C12B 5EA0L 4Q9QH 3TIEA 3UXFA 4UMGA 1QSZA 2UYLB 1UKQA 1T0MB 2ED9A 2V5RA 3WN5A 2PYFB 5GZOD 4HK3J 2YOCA 4Q2ZA 3DIFB 2AQ1A 3F62A 4ONHA 4NNXA 4GS7B 4F7EB 4LLWB 1NCTA 4YXHL 4I77H 1AGDA 4ODHH 2Q3ZA 4OD2A 2DWEB 1NGPH 3C2AL 1KCRH 4LFHD 3KJ6H 1OAKL 3OKLA 4NWUL 1NGZA 4RSVA 5FKAB 3D39A 2LE9A 3TJHD 3B8YA 4HUXA 1T5WB 4PJ5A 4M8VA 2E5EA 2AEIT 1NC2D 3MJ9H 5D2LF 1GGCH 3VFTA 1VADB 1TZGL 1GH7A 2ARJQ 3WSQH 1R5WB 4QRPE 4H8WC 3HNSL 3IXTB 3CDGB 3V0VB 2YWYA 3ULSB 4NKQB 2JJTA 3ZO0A 3ES6B 2RQ8A 2W92A 5JXAH 3U0TB 5FOJA 3MV8B 3P11H 4M4PA 4ZXBB 1BX2A 1QFOA 1V8HA 2WP3O 1FVDA 2B0SL 5EU7C 1PEZA 4BQBA 3GMOA 2YC1A 2A74B 1CGSL 3TH2T 5CEZH 3I75A 4JE4B 5HHOD 2VDPH 1MJJA 5EULV 5JOPE 3N1QC 4GS7C 4J3XA 2LQRA 1F8TL 1CIDA 5EBLA 4I4WA 3ULVF 1KLUA 1FSKB 4XMLL 1U8MB 2FWOB 5D6DA 4Y8DC 3KNBB 3UTSB 4Q9BA 4R90H 4G80B 3HNTH 4LARH 4NSKB 1AXIB 3FTGB 3PHSA 3BN9D 1UENA 2VE6B 4ZFOB 1QA9B 4XAKD 3GKWL 3CSPA 2FECL 1GCFA 4Q7DA 1T1XA 3MOAL 3X11B 1AGBB 4U2YA 4JLRB 1SEBB 1A3LL 4KHXL 5I1GL 4NOFA 3D25A 3S3PA 4U3CA 3KPTA 4LEXL 4YIQA 3VDBA 5HGBA 1FH5L 5HVWA 4PJCE 1U3ZA 4E9LA 1AFVH 3T3ME 3Q48A 1U8HA 4HV8A 3O3UN 1EA9C 3OAYK 2IFFH 4G6ML 5BRZB 2UZXB 4ZXBC 4KK6D 4ZUSB 3O2VH 2WMPA 5EBGA 4MWFA 5TE6H 1UM5L 5D1ZB 5D6CB 2DDQL 5D1QA 1ZLSL 1FLRL 2RCSL 4WIQA 3MBEB 4P59L 5FHBL 2VQ1B 3S3JA 1ZLUK 1FSKC 3BIKA 3T2QA 2P7TA 5IFAL 1XR8A 5GZND 1KJ2B 3VXRD 2QHRH 3MGOB 4MDJA 4OUUA 3KPPB 2ZSWB 2MNUA 4LNVA 4RZCB 3B9DA 4L4TA 2VZOA 3EFFB 4MX7B 4PP2A 5HGAA 1Q0YH 2Q8AH 3UTZB 1QFWI 4LASH 2XTJB 3G5VA 5ACMA 3F8UB 5CINH 4DVBB 2D3VA 1I8LA 2DM2A 3RWIA 1U8JA 5J7CC 4NP4H 4WEBL 4L9DA 4HT1H 3WUWG 4MQ7A 5TQ0L 3HZYB 3UBXG 3U7AA 3TC9A 1MCHA 5IJKC 1U8NA 3GUTA 4YDIL 3SDXE 5DD1L 1MH5A 1DUZA 3LN4B 1N26A 3QHFH 4LKCB 1H15B 4HX1A 4D8PA 4UTBH 1F58H 4F57L 5D1ZC 4H5SA 3L5WB 4KGJA 4MJ6B 1FZMB 3V6OC 3MBEC 3MRIA 1X7QA 1UVQB 4LDOB 2P5EE 3V52L 3S9DB 3QA3A 4ZD3L 1B4JL 4O9HL 1S7QA 4WWKD 5EBWA 3T8XA 4LBEB 3RI5F 1ZHLB 1G9MH 1F4WL 3L3OB 5ILTL 3GO1L 3PIQB 4PJDA 5EOCL 1Z9SA 2A1WH 4X6CF 5EUOE 4ESKA 2Y07L 1D9KB 3QDME 2VERN 3RBSA 1MCQA 3JUYA 3THML 4Q97A 2O61A 2XTJC 4Y5XB 1VPOH 4DGYH 2APFA 4KK9D 4N5UA 3G04B 1DE4B 1JGDB 1MJUL 4MJ2A 2NY1B 2X7LA 3NCBB 3STZA 4PUBL 4FQXA 4M93B 5CEYB 3S4SB 3ARFA 1A7OL 3DNKA 3B9VA 3BWUC 1A22B 4MXQD 2F58L 5JW4N 4QRQA 2D9CA 2B5IB 4XVUC 5E56A 5GGVL 4KKAD 2XWBB 4X6DF 1I8IA 1OTTD 1L7IL 3ARGD 2Z31B 4WHDA 4M7LH 3B5TA 1HCFX 1FNLA 4ZPVB 1CWVA 4MB5A 4NUGL 5C08D 1V05A 5DHVB 1HHHB 5FYKU 5TQ2H 2CXKA 5TDNB 4P3CL 4X8JB 4Q6YA 4JR9L 3SE9H 1UZ6E 5IHZB 3IDMA 4APQD 2UVEA 3QG7H 4GRLA 4MYWB 2CIIB 2DQDH 3HE6D 1J5OL 4G6KL 1D9KC 1XF1A 3WIHL 1L4IA 5E6IA 3CFEA 4MJIB 1HN1A 1MCPH 4LSSH 5GRZA 4Y5XC 1QSFD 4CU6A 1MVUA 1LILA 3CXHJ 2NY1C 1HINL 1QD0A 4DK3A 3QZWG 4M93C 1S9YB 2IG2H 3ULUE 1RUAH 3QEGL 4BQCA 2FZ3A 3FOMB 4ISVB 1EMTL 4WI8A 3FO9B 2CDFA 3IFNL 4FQLL 1OL0A 2B5IC 5FV1L 3C08H 4OZGA 3M17B 3P73B 4KZEH 1G84A 2Z31C 4JFQB 1G6RH 2XN9A 2AV7B 4F8TA 5C6TL 3GSNL 1FG9C 1TZIB 3GSOA 5BMFH 3DARA 4NJ9H 4OLWL 5IESL 4NO0A 3DXAD 1EAPB 5CLTA 5E2JA 4K3JL 5GXBB 4ODBD 3L3JB 5FK9A 3Q3GB 4DGVL 4LVEA 2ZUYA 4BK4A 4O2FA 4YHOH 4MD4B 3R4DA 4XH2A 3ZYIA 2YPVL 4OIIL 1NJ9B 3FO1B 5F93C 1W72L 4F7MB 1UG9A 1CXIA 1FO0L 4IDJH 2EXYD 5DRXA 2X4PB 3QO0B 3QJHA 5JPMA 2DLIA 4L8BA 1H8SA 3CDCA 4U6VH 5MEOB 1FN4A 2PYEB 5I19H 2ZOLB 5EU6E 5FA3B 1IGJA 3AVEA 1LEGA 35C8L 1UCTA 4O2CA 1TETL 3EJYC 2VLJA 2C3VA 4JG0L 2GCYB 4YHIA 1H0DB 2Z8RA 4U1GB 2R9HD 4HIIA 4PG2A 4WI5A 2XZAH 4NQDA 4XZUB 5J13B 4OM0H 3WS6C 2CKBA 5KJRH 4OCYH 3OKEA 1FBIH 1OF2A 2VLKD 2QQLL 3QDJA 3FFCA 3EYUL 5L2JB 2FH6A 3KGRA 5AYUL 3SKOA 3D3VE 2F19H 2Y6SD 1GZPA 4TSAH 1NCWL 3TLRA 4JFEB 4L3CA 4NQEA 3D6GA 2DWDB 3MACH 3BRDA 1H3PH 3MRBA 4U1MA 2RR3A 1IILE 4GO6B 5CJOH 2EO1A 3MRNB 1JZ4A 2EE2A 2WWKO 5F1KC 4EI5D 2LFGA 4YFLF 1U95B 1QUNA 5IB2B 5L2KD 1JGUL 3MJ7A 2ZUVA 1BLNB 2GSIA 1ETZA 3RRQA 3UTQB 4G6JH 2EZ0C 2RFXB 1TQBB 2VITB 2Z4QA 3VRJB 3CJJA 4X7SH 2NX5D 2BVOB 1VFBA 4PJEA 4Q9RH 5HD8D 4C4KO 4U1GC 2OJEA 5D7LB 2F54E 1F42A 3VDAA 3ZTJG 5J13C 1V3MA 2KZ1B 4PREB 5DJYA 4HUVB 1OD9A 3QUZD 1GXEA 3WE6A 3BX7C 3BH8A 1VFMA 2VTFA 4XBGA 4M5ZH 4HWZA 4HS8H 4MAYB 4Z5RA 5C3LD 5ITFA 2CR3A 4N5EC 1J1OH 1CFVH 1NEZA 4FQIL 4BFIB 5IMOB 2VZ1A 3SDDD 1FP5A 4JRXA 2PW1A 3RX8A 4ZYKA 5H94B 4OV5B 3VWKB 1KCSH 4XCYB 1Q1JH 1WTLA 2A83B 2AV1B 3VXSE 5FEBA 2CKBH 4YHLH 2J1KA 1PG7W 4UQ2B 1VFAA 4PJBA 2BJML 2DLTA 1IQWL 3RL2B 3NA9H 3R1GL 3MRGB 4ZOCA 1RHHB 5IKCB 4LK4A 1TQBC 2D2OA 3BJ91 3C8KB 5F1IA 3D2UA 2FR4B 2HN7A 1KCKA 1T1ZA 2O5XL 2GUOA 3GSNB 5DI8A 1ZSDB 2DM4A 2IQAB 3UJIL 4LCIH 5CJ8A 3WIFA 3QUXB 1RZKH 3GHEH 2VAAB 4XVTH 5BZWB 3SO5A 3ZYJA 4YPGA 4OGXL 5JIKA 4XB7A 3UYOD 5FM4A 2JE8A 4FFVD 1UM6L 2Q8BL 3P4OA 4MAYC 4PPTA 2ATPB 4Z7NF 4FFZH 3QEHA 4LKXA 5F6HJ 5GRWA 3LIZL 1TJGL 3NCMA 1WICA 2W65B 1J18A 1AGEA 1OCWL 3V6ZB 1QRNB 4PRNA 3HS0B 4EQ2A 2ED7A 3KPRB 3CFIC 5LAXB 1W72B 3FN3A 4PJFE 1RZ7L 4IOSD 2A9NL 4WDIA 5T1LA 3VWKC 1FO0B 4LEOA 2IF7A 1MHEB 2EH8H 1HWHB 3SE8L 2DD8H 3S36H 2R39A 1MELA 2R0KL 2VUYA 3RWHA 5TPWH 3MCKB 5IUSA 1PEWA 3ARYA 1WT5C 3LH2L 4OGYH 1XF4A 3NH7L 4TN9A 4NHUA 3L5XL 4K3EL 3DV4A 1OM3L 3BQUA 3K2UH 5HI3C 2QKIB 2LAGB 1QO3A 1WC7A 3VI3F 3HHRB 3QUXC 4ELKA 5SWZA 1FVCB 1TJHL 3FQWA 2EDTA 5HTSA 3MTRA 5K59F 1H5BA 1QKZH 3QUYA 4XAKE 2DLHA 4RDQF 2Y23A 1CF8H 5HYSG 5GGSA 4AM0A 4PR5B 1ND0B 2BSSB 1PKQE 5IOPB 5I75B 2OX5A 5HY9B 1UH2A 3S97C 4R4NC 2MJWA 1M7IB 5DMIL 2XZCH 1AR2A 1EDQA 1OAUL 5I0DA 3MRQA 2XYCA 1BWWA 2MCPH 1KC5H 2JK5B 1FL3B 1TZHB 1FPTH 2BVPA 1IGIL 4F7PA 1AD9B 1ZVHA 1H3TA 1ZT1B 4XNQB 3PDDA 5B8CC 2VDQH 3P40A 5KSBE 3TVMB 3KXFD 1UEYA 4UV4H 5FYLH 4HKJB 4FQQA 3O45A 1QFWL 1YEJL 1A6AB 1EVUA 1KPVB 1IAIM 1U8IA 3OX8A 4UAOB 1Q9OA 5TE4H 3CSYA 3FKUS 4HMEA 4MAUH 3UC0L 4PD4J 2P24B 3HC0A 1D5BB 4XNXL 3VXRE 4ELMF 1HXYB 2XXMB 2NY5H 4S1QH 4MNQA 4HIJB 4MXWH 4CGTA 5HHNA 3TO4D 3IVKB 2K1MA 2A6DA 2FJGB 3MX0A 5DVLA 3D85B 5FCUL 1LDPH 2VSDA 2ZUXA 3KYAA 4Z7OF 4OBSA 3VGBA 3QDGD 1I1AB 4M7ZB 5I75C 5FDYA 2YBRA 3MJ8B 3PDOB 1DLHA 4PJ8D 3IYLW 4QT5A 1MFCH 2BFVL 4U6HA 1QPXA 3O9WD 4HJJH 5E2TL 3SGDI 4EVNA 4HUMB 1MIMH 3TVMC 4GKZB 1IKNC 3EYQD 3BP7B 2D9QB 3VRLF 4X5XA 2BRRH 3CC5A 4POZC 4Z7VA 1RUQH 4UAOC 3M8OL 5DRWB 4FG6C 3BKJL 5B22A 1KIQA 5DMKA 4LAQL 4WHYG 4OI7A 5FHAL 1F3DH 3O11B 2MQ0A 1BMGA 1J05B 3GMMB 3ARQA 2DMCA 4WJ5B 4FP8H 1IC4L 3B6SA 1JYXA 3PP4L 4XCEA 3CGTA 2FEEI 1YY9C 4M7ZC 4NUJB 3WFBH 1YN6B 1EBAA 3B4NA 1IL1A 4O58L 2VXQH 3S5LG 3BAEH