2OZ4L

Structural plasticity in igsf domain 4 of icam-1 mediates cell surface dimerization
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
214
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTSIHWFQQRINGSPRLLIEYASESISGIPSRFSGSGSGTDFTLTINSVESEDIADYYCQQSNVWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Intercellular adhesion molecule 1
publication title Structural plasticity in Ig superfamily domain 4 of ICAM-1 mediates cell surface dimerization.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2007-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oz4L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oz4L01
3G5YB 3O2DL 1SHMA 4DN3L 4S0TD 2A6DA 2CIIB 4OD2A 1S9YA 1J5OH 5C92A 4GW4A 1OQXA 3FQUA 1WWBX 2WIIA 4NUGL 3ES6B 3NACH 4ZTPL 3RWEB 3MV7B 4HK0B 5DQDH 1U3HA 4D8PA 2FRGP 4WU5A 4A6YL 1UWEL 4FABH 3CDYA 3VD3A 4IRSC 5FO9A 2F19H 4O2EB 3OKYA 5CKAA 3SE9L 5CD3A 2V7NA 3U4BL 4HF5L 3OR7A 3G5XA 3T0VA 1CD1A 4U3HA 5DFTA 4B0MM 3VXPA 3NN8B 1TNNA 4OZIB 4RIRB 4XI5D 4QNPE 4Y2DC 4BZYA 2HG5A 5E4IA 4XPHL 1MJ7L 3DV4B 2IANE 4PB0H 1OAKH 4PBWD 1T2QH 1CYGA 4FXKB 2FR4B 2ZCLH 4GXUM 4HDIB 2AEPH 3QQ9D 5LQBL 4XX1G 1FE8H 1P4IL 3VFRA 3UJJL 4EN3D 1LO2H 1TJHL 2WUBH 2NY0D 4LVNC 4TSAH 1MJJB 3O9WA 2GAZB 2D0FA 4U1JB 5CMAA 4LLYA 4OZGB 1E4XL 3IDJA 2CO6B 4RAVA 1KGCD 2NY6D 4GUPA 4Q97A 4PRAA 5F44A 4GG8A 3ARGA 5CLWA 1I7TB 2KUTA 4P0DA 1EVTC 3QPXL 3BKYH 5F97E 5ICXB 4M6MH 4PJAE 1L7IH 1NDMA 3QZWG 4GS7C 5F9OH 2AJVH 4XCYA 2AJSL 2JB5H 5D2NE 4FQJH 1ZGLM 4OCRL 2A77H 3EOAA 5IHUL 2EYTA 3FFCB 3WIFB 1XIWA 4QOKE 3T1WA 4K23H 2BOCB 3UPRA 4OF0A 1JNJA 1XGRA 5C0CB 3KLSA 3WHXB 2A6JB 1ZANH 5F7LB 1Z3GH 5EUOF 5IV2B 3D69A 1L4IA 1J86A 5ITBL 5D70L 3C2SA 4J8RB 3SKJH 1X5IA 3QUML 2YC1B 3RA7H 1T0MA 2Y36L 3WNPA 2CKBB 1NCBH 5B8CC 3CX2A 3UYRL 1CLOH 1OD9A 5D93B 1E28A 3IDXH 1P1ZB 1NUFA 5E6ZA 3QWRA 5C70A 3QDME 5FF6B 4G7YL 2AXGA 3Q0HA 4TVPD 2G60H 4KH2A 3EYUH 4B50A 3HC3H 2M1KA 3O3EB 2AK4A 1GZPA 4N8VG 5D7JD 3U2SB 5KG9B 1J9CT 3HG1E 5JUEH 3BIAX 2BY2A 1XAUA 3MOQA 1QBLL 5JW4R 4URTB 1CR9L 1UM5H 5KSBB 3KJ4B 1HHKB 3QUZB 4Y5YA 4JDTH 4P3CH 4HIEA 2C3GA 2SEBA 1A3RL 3G6DL 12E8L 1FN4A 1OCWL 2W07A 4EDXB 4IBLT 4FHBD 1HE7A 1J8KA 2CUHA 3MV8D 4U1IB 1TMCB 2DQGH 3OXSA 5B39G 1DUYB 4MD4B 4U6VL 4XCFL 3DXAB 1OARL 2X9YA 1X7QB 4KXZI 5SX4I 2B2XL 5EWIH 2YHGA 3AU1B 3WXWL 1U8NA 2AK1L 4NDMB 5DI8B 4OD1L 1YMME 4I9WD 4WWKC 2X09A 5I75C 3JTSA 1FL6B 1TVHA 5DEGA 5TGBA 3NCJL 4IEFB 5IWLC 4GAGL 5CJ8A 2C3VB 1IC1A 4WTWA 4DZBB 3D25A 4XXDA 4DVBB 1G9NC 3K8LA 4M8QA 1OAUL 5GGRB 1DBAH 3RWIA 5EIVA 4EI5B 4P46D 1ZTXH 4NO0A 1CIDA 2NY2D 1FJ1B 4W70A 5L2KB 1ZT7A 4X4YB 5F1SA 4JM2F 1R3HB 4M7LH 2VLJA 4KK9C 3IAQA 5KTEH 4QGTA 5ILTH 4Q0XL 1F45A 4HK3N 1XR9A 1I1AA 2F54B 2R9HC 3PWNA 3BQUD 1RURH 2ZSVB 4R4BA 1DQML 4YR6B 1KT2A 4UDTB 2JK5B 1YJDH 3TVMD 5FGBA 4MCYA 3OJDB 4TSCH 2P8MA 1CQKA 5CJXC 4AIZB 4PJ8D 3QO1A 5EA0H 1YEDA 4WFGE 3RWDA 1DCLA 2IH3A 4XMLL 3BE1H 4EKXA 3GSXA 5IJKA 4ORZC 1QO3A 1AGCA 2XI9A 5ADPH 4K3HA 4EQ2A 1MFAH 4XNMA 4H25B 1CK0L 5ACLA 2DMBA 5T3ZH 3JTTB 3KPQB 3A6BL 5C9JB 3TEUA 4WHTA 4NWTH 3UTZA 4IJ3C 5GS2D 3BPCA 1H8NA 3MCKB 3ROOB 1CTNA 3LKPB 4ZAKD 5D9SA 2OSLB 4GAJL 3MV11 1WEJH 4KKNA 4PJ5D 3O45B 5JW4M 1CVSC 2XZCH 3P0YH 5DLML 1YYLH 1A2YA 3CLFL 3NVQA 4W6WB 5CZVH 5EZIL 1ES0B 2DBLH 3QDGA 4QRRD 4NQSA 3ZYOA 1R5VA 3RWJB 5IFAL 3QIWB 2PW2A 2X4QB 2HMID 1MCSA 1UCTA 2IQAB 4WUKH 1AGBA 3K7UA 5FOBA 3H7BA 4NQUA 5D1ZC 3E1F1 3LHPL 2NR6D 4Z0XB 3F6IA 4WNQB 1NAKL 5GSVB 1J8HE 4BZ1L 5ENWB 3TBTA 2FBJH 2CDGA 3DVIA 35C8H 1U8HA 2VWEC 4X6CB 1G1CA 3QQ3A 1A0QL 4ONFH 1SMOA 5DHVH 2VAAB 2WMPA 1UG9A 4X6DA 4ZUTA 5BCAA 4C83A 5C6PB 1UJ3C 4FXLA 2EDJA 2CK2A 1M7IA 4RWYL 3MFFA 4BFGA 4P23B 3AFLA 1CF8L 3FFDA 3M1BA 2Z31A 4PJBF 4XNZC 3K46A 4OGXH 3UTTD 1B0GA 2FEDD 3VWJB 3EOYG 3GI9L 1R3LA 4J4PD 1RQ5A 3N9GH 1R3KB 4NKDA 5D2LA 3RX5A 3ARYA 2BY0A 2NY5C 1E6OL 3O6ML 3MOAH 5IVXE 4RGNC 2BNQD 2VDRL 5LGHL 4ZNEE 1OL0A 4KK5C 2P5EA 4X8XA 2APBA 5CJQL 4EVNB 4HGWB 1D5IL 3FRPG 3MOBL 4O02L 3SE9H 3FJTA 1Z2KA 1LP9B 1PZUB 3W9DB 4X83A 4MJIB 5C2BL 5I1DB 1MI5A 4XRCB 2D7QA 5SX4H 4X9BA 4PJIB 1JZ6A 3DETD 4MA7H 1NGWB 4HUWB 3OF6A 5JHLL 5ESAA 2YD6A 3VRLF 3EJYD 1JWMA 3G5YA 4LOUC 3LB6C 4P4KB 1WAAE 4HCRA 1NAMH 4ZOEA 2HH0H 2P49B 5IIEB 5F7YC 3UJJH 2ERJB 3RNKA 3ES6A 1QSFE 3DRQB 5E70A 1PW3A 3WNKA 5C07D 4HK0A 3VDAA 1TQBB 3MUGB 3B9VA 1U8JB 2V5RA 3FO1B 4KRPD 3VD9A 5LXGL 2IBZX 1U92B 3QAZB 4POYA 4Y4HA 2BMKA 1S5IL 3G9VA 4PRHE 5GS0L 2W1NA 2IAMA 2V2TA 1GC1C 5FYJU 3ZMRA 4ORGB 4NQDD 2QV2A 3VH8G 1G7QB 4OZIA 1S9XA 1IM9A 3TBVA 4XTRC 4OCRH 1UZ6E 3DV4A 2GTWB 1CE1L 4BKLB 5K93A 5FYKU 4KHXL 3MRQB 4Z7WE 1T2JA 1GPOH 3GHEH 3UJIL 5C0EB 3OX8B 3DX6A 3QULA 1A21A 3SKMB 3L5WB 4MLSA 1MJJA 2GAZA 4H88L 5EBWB 5FGCE 3VG9C 3RTQC 4ALAH 1RUKH 1CGUA 3TJHD 3O0RL 2VDLL 4OZGA 2ZCHH 4O4YH 4LQFL 1JP5A 1OTSD 4O2FB 2IG2L 3RGVB 3QHTC 3T65A 3SJVD 5KS9A 3BOVA 1F02I 1FVEB 3MRGB 1I7TA 4Z77A 2GIYA 5F70A 5JXEA 2BRRL 1VPOL 2D7MA 4LP5A 2BFVH 2CGRL 3ESUF 3SCMD 2BDNH 4P9MH 3VFMB 3FFCA 3WIFA 4JPWL 1UEMA 4K3DL 4XP5H 5FA4B 5K59F 3QG7L 5C0CA 3RZCD 1QD0A 2ZJSL 4IRZL 5DJZA 3WHXA 1OTTC 2QSTA 2I9TB 2ENSA 1MJ8L 2ARWA 1XIWD 3MA7B 4LCYB 4OZHE 2X1OA 1M71B 1OAYH 2HFGL 1MY7A 4U0QB 5J8OA 2A6KB 1K2DA 2J8OA 2VLME 3H9SE 3LD8B 5F7UA 1ZHKA 1SYSB 3OG4B 2IQ9L 4XHJD 5F9JB 2HTLC 4Z0BL 2PXYB 1P1ZA 1FVCB 1INEL 5F6HJ 4OI7A 2X41A 2IGFL 3OAZK 2AK1H 1J1XL 5T3ZE 2Y5TB 3VI4E 5IW1B 1NCCL 4PRDB 5E1AA 1A1MB 4KI1A 4AT6B 5KG9A 1FAKT 1DUZA 2OTWA 3NIGE 4WI4A 2E27L 1EUTA 1SBSL 1T21A 4LRIC 2YD5A 5MEOA 4FNLH 1HHKA 2F58L 1YY8B 1KXVC 4OFDA 5E94B 4B7LA 3C6LA 4YHZH 3HZYB 2UWEA 3OB8A 5BMFL 5A16B 4AIXA 1EEUA 4JZJC 2XY2A 4MD4A 3S6CA 2PF6A 3DXAA 2VSDA 1X7QA 2D7NA 2OZ4A 3QUXC 4WO4B 4GAFB 4K9EL 3TC9A 4NDMA 2Q8AH 3W2DL 3BPOB 1YEEL 32C2B 4KKBC 1YEKL 4JKMA 5MP6L 4QXTA 4XNQA 3TO2B 4NSKB 1FV1B 4HH8A 4RDQF 4ELMF 1NUDA 4GW1A 1YC7A 1RK1B 1ZHNB 3VFPB 4FP8L 1C5DA 3AB0C 4WGVB 4YE4L 1JRHL 3MBEA 2A2QT 3O3UN 3BAEL 1M7XA 3CXHJ 4IRJB 4K94H 4R0LB 4EI5A 3HKFA 3TFKC 4KKAC 4X4YA 3LMJL 4IIQB 3PP4L 3HPLB 1R3HA 3PGCA 4NO0D 4ZXBC 1MQKL 4TUKL 2Z4QB 1N2RA 1AXSB 4WW1B 1ZXQA 2ZUVA 2VLJD 4Y4FB 4M02A 2W0PA 5D7IF 2F54A 2Y06H 2DD8L 3MLXH 3MUHL 4UT9H 1G7PB 1MCRA 2ZSVA 5JXAL 4YR6A 1N3NB 3MRDB 3E6FA 4PJFF 4AEEA 4UDTA 2JK5A 4GAJH 1I1AD 4B53A 3V5HA 1KNOA 5C0NC 5MENB 5CZXD 5T1KB 5ID1B 3I84A 4ODSH 5K33A 3GMNB 5TF1L 3QRFM 5JOPD 4H26A 1E4WL 2ICEA 1FYTE 3LKOB 1FPTL 1NLBH 3SBWC 4MB4A 3MCLL 4GQ9L 1IGJA 1C12A 2H3NA 1ORSB 4YFDB 3UO1H 5HHVH 4C56E 1QUNA 4E5XA 2UVFA 1D9KD 3F7VB 4NN5B 5TDPA 3SDAD 5I1LB 2QQNH 3VW3L 5JTWA 2UZYB 4UV4L 2ESVA 4KZDL 1HHJB 5FYLD 3SGJA 1X5XA 4H25A 1ZEAH 4ONGL 1AI1H 3JTTA 3EYSL 1LEIB 2NY4B 2KKQA 4P5TA 2BVEA 2DIJA 2QQQA 1C1EH 4D9RD 1QSED 2YPLD 1JHKL 3ROOA 3LKPA 4W4NA 3HI1A 1II4E 3HCVA 3KPSD 4QXGH 3ZYJA 3KR3L 3L9RB 3OQ3B 1N8ZA 5IQ7L 2VXUL 2XN9B 3CIQA 4AK1A 1CF8H 1NLDL 3WBDA 2ZNXA 2VN7A 5EULV 1ES0A 4M5YH 2BK8A 1MFEH 1P53A 5EU6A 2DMKA 4LGRB 1NMAH 4LP4A 3RWJA 2D2OA 4OLWH 4XMKL 4JO1H 1MFBL 3BZEA 1RVFL 2IQAA 1FCCA 3ARQA 5AYUH 3ULUH 1PKQE 3MLYH 1Q8MA 4F7EB 1KEMH 4WNQA 3S3SA 5MHSE 4D3CH 1Q72L 1F90L 2IANB 5ENWA 1D5IH 2BP3A 5AG9A 4RX4A 3VG0L 4X6CA 2MHAB 1D6EB 3ISWA 1XZ0B 1CGVA 5HGAA 2YZ8A 5J6GB 1R0AH 3HC4L 4Z9KB 5E8PB 4EIZC 5GQBA 2EEDA 3C60D 4HFUH 1F3JB 5HDLA 4C4KT 5AZEH 3WIHA 1TVBB 4BELD 1I9JH 4F80A 4FQIH 4JN1L 1AR1D 4CRPA 2VE6B 3LKRA 1OAZH 4QTHB 5DD3L 1NFDF 5SWSE 4R97B 4KQ3H 5C08B 3ZKND 1R3KA 2Z31D 3EZ8A 3L6FA 1INQA 1EHLL 1CT8B 1V3LA 3MJ7B 4FQ2L 1NFIB 1OP9A 4PJAB 5D2NB 1OGAE 4ONOA 4QLRA 1PZ5A 4EVNA 1S5IH 5CEXB 2NNAA 2BSTB 1UKSA 4D94A 2W38A 1F4XH 5IVZB 2X4SB 3HE7D 2P5ED 5I1DA 1H0DA 3C8KA 3W39A 3WFCL 3LEXB 2X4RB 1SVCP 2CR6A 4H1LA 2FATH 5J89A 1WV7T 1IAIL 3N1MC 3JV4B 5IBTL 1JV5B 4LAQH 3WUWB 1BJ1J 3OF6D 1V7NL 3I6GA 4Q9CA 3MUJA 5B38B 3EO1B 5E99H 1HNGA 7FABL 5TFSH 1EFXB 2UZXB 1C5BL 4JPIA 2MMXA 3BW9A 3QDMB 3DMMB 1EA9C 3MUGA 4OZ4A 1H3PL 2X89A 5T1DL 5ANMA 5E9DE 1LDPH 3MV7D 5CKGA 3HG1B 1MCJA 1U92A 5CBEB 5AYQA 2IG2H 4ZFZB 1ZVSB 2CR3A 2VDML 4Z7VA 4RZCA 1Q9WB 3GKWL 3QQ4B 3INUL 1HHHB 4KUZL 3BSZL 4UDUA 4FZ8H 2AJZB 1S7RB 1G7QA 2A0LD 5DJDB 3V6ZB 1IKNC 4RAUB 2ATPB 3RDTC 3P0VH 2GTWA 2WBKA 3MRFB 4BKLA 5IMOB 4LLWB 4X98B 3QUYD 4IRZH 5D7LD 3V4PH 2B5IB 3TO4C 3TIEB 5DR5H 4YC2C 5IOPB 5IEHB 1VEMA 3FKUS 3RVVD 5CIPB 2J8HA 4LSUL 1YMMB 5I15L 2V17H 5ALCH 5EBWA 4R7NA 4ZS6D 5CS7A 3PUCA 1MVFA 5L8KB 3SKOB 2JJTC 2X40A 2GFBB 4TNVK 5BVJA 5FCUH 4GBXC 3CSYB 4F7PA 1BWMA 5HI4C 5J6HA 3IU4H 1I7ZA 1UGNA 3N1FC 3LN5B 5CBAA 2AV1B 3WDIA 5EZLA 5F7WC 4TVPL 3I9GL 4QHLB 4LCUB 5F89B 3QXAB 3CFJB 5HYSG 3MXWH 1WSST 4JHWH 4J12A 5J13B 3QO0B 4EBQH 2OJEA 2VXVH 3AM8A 1IGCH 1SBSH 5I1IH 3HS0B 2L7JA 1FAIH 3HMWL 4JFFE 3IYLW 3NAAH 4NGHH 4ODXB 3FFCD 3G6JA 4OQTH 3RFZC 3OPZH 3GB7B 4LCYA 4PJEB 2GY5A 3W11C 4JVWA 5C0CD 1LO3H 2FGWH 2YD1A 2A6KA 5F8RC 4M62H 1ZLWH 4JB9H 5J9PB 4L8SB 2HFEA 5GGRA 2BXZA 4M6OH 3X13B 1QHPA 1T22B 4XP9L 5CGTA 1HQ4B 5FIEA 4DFHA 1VDGA 1X6NA 3EO9L 2F8OA 3VMOA 4HGMA 1NDGA 4RBPK 4XXCA 1FDLL 2PTUA 5MP6H 5IW1A 2XA8L 3GMLA 1AQKL 2FX8L 4PRDA 4AT6A 1QFWL 1J1PH 5BV7C 4M43L 1AFVL 1UKQA 1G1YA 1NSNH 1F00I 3FQXB 2H32H 1H3UA 3TA3B 1PGRB 1F42A 1FSKB 4HPYH 1YY8A 1I8LC 1D5BA 1XF4B 5B21A 1FFRA 1QRKA 2NCMA 4QT5B 3QUZD 4J6RL 2I27N 5HHPA 2FWOA 3ZE1E 1DVFB 2G9HB 5FK9B 4AENA 3IKKA 1TTFA 4JRXB 1BFVH 1I1FB 3ULUE 1A7QH 1FH5L 2Q7YB 4DWHA 5J06A 3GIZL 3T2QA 1KCLA 3DXAD 1DQTA 5F21B 4NKIH 3PF2A 4GRMA 4GRLA 2YRPA 5ACZB 1HINL 2CK0H 5E5MB 3TO2A 3DX8B 1FNHA 4NSKA 3UMTA 1NCDL 3KPLB 5T5NG 4PJCF 1ZHNA 1E4WH 4Z7QE 3UBXB 1U8MA 4UI2A 1WBXA 2NXZC 3Q6FA 2QJDA 1NL0L 1LE5A 1MCDA 4R0LA 2DKUA 4HUNB 2GI7A 5KSUA 4F8TA 3PIQA 4UNUA 4X8JB 1FL5A 4EI5D 1YN7A 3HPLA 4DK6A 4NM8H 4N0YL 4QCIA 5L2KD 1KJ2L 2CJUL 3ETBF 1AXSA 4APQC 5GGTL 3REVA 3EYSH 1V7ML 3F7PC 4Y4FA 5IHZB 1GSMA 1BEYL 4NOFA 4XPBL 1A5FL 1AY1H 3KLHD 1G7PA 4Z95L 4FQXA 1MJUH 5C09A 5I1KL 3MRDA 4BQBA 5ISZB 4OFYA 5DUPL 4ZFOL 2O61B 2F54D 4KVNL 1T6VN 3KR3H 2VZ3A 1JIBA 2BJML 2K3TA 1U3YA 1JYNA 5GZOD 4N9GB 3LEYH 5EO0A 3WNOA 1U3ZA 3VRJB 1NLDH 5DS8B 1I9EA 1JVKA 1EAPB 3LKOA 1GRWA 2DQFB 1HILB 1GZQB 5CHNB 4EOWH 4X80H 5I1AB 1ORSA 3O2WH 4YJZL 5A2KH 3MJ9A 4XNUH 1RVFH 3T0EE 5I1LA 3RY6C 3RUGE 4HC1H 4EZMA 1RK0B 5EO9B 3MQIA 3TPKA 1HHJA 4WFFD 5EZOH 2VXTL 4MQTB 4JVUA 1HEZB 1KN4L 3O4OC 4ZFGH 1Q1JH 1G9NH 1ITCA 1FNEB 3QEQE 3QIBA 3STLB 4N5UA 1LILA 1QQDB 2YKLL 4NFBA 5FDYA 1N59B 4UMGA 1TJIL 4HEME 4QRUA 2WZPD 1W72H 3WLWC 2DM2A 5INCB 1QSFB 4O00A 1WISA 2DQHH 4CJ1A 1NBVL 2VIRA 3MR9A 2XN9A 1FFNB 4XVUD 5HHNB 3DUHA 1SJXA 4S1DC 5I9QC 1B0RA 5DMIH 1UADC 2L7UA 5DD6A 3CZFA 5E08L 1PDKA 4PP1C 5H37G 4OCXL 3MV01 5I8EB 4FQ2H 1WQVT 4CMHB 1FORL 1X3DA 4MX7B 4R2GB 4Z78A 2HAZA 3S36X 3GUTB 4TUOA 3QIWD 5L8JB 1MFNA 3NBNA 1CD8A 3QDHA 3NGBB 5DRZB 5KVDL 2X9WA 4ZQKB 2JCCE 2MHAA 3AXLB 2D31B 4UV7H 1H15B 1D6EA 4JGMA 3TBSB 5BZDA 5A2FA 4TTDD 1CXFA 4NO3A 4KRLB 1MREH 4KC3B 5E8PA 1BM3L 3QDJE 3V0WL 2DQEH 5DJXB 5CGMA 3ARDD 1YEGL 1BVKA 3KXFE 4CMMB 4QHKI 4EUPG 3PP3K 1V7NH 4MA8H 4QRPE 3QA3B 3AMLA 5F1IA 5IW6B 3O8XC 5C08A 1VGKB 4P23D 3FO0L 1T83C 4PR5A 1KF9B 4UUJB 1DBJL 3VWJD 3IJYA 1A7OL 1NC2B 1NFIA 1WITA 5HYQA 1I8KA 5T1LA 3PL6C 4S1SL 2Z93A 3L7FA 2BSTA 3B5HA 5AWNL 3OZ9L 1DFBH 1MHPL 2ARJQ 3A6CL 4XWGL 4AY0A 3CVHL 4KMQA 4PRIA 4OZHB 2X4RA 1S7XA 4MJID 3OG6B 3EYVB 2VITA 3BX7C 3H9SB 3STZB 5D4QA 1JV5A 5EOQL 4I0PB 3KYMA 4U6YB 4XPAL 4WTXA 4AL8H 2VZOA 5E8OB 1LO0H 2H1PH 2OMBA 3EO1A 3SDXE 5KSAA 1I7RA 2VL5A 4P4KD 1WICA 4K8RC 4PRNA 3DMMA 4GQPH 2W0FA 3BPLC 3Q6GL 5B8CA 2BVTA 4QRQA 3VGGA 1A9EB 2IFFL 1AJ7H 4WW2F 4HT1H 1ZE3C 1MPAH 5SWZB 5BO1H 2EH7H 2X4PB 3S98A 4UOW0 1EBPA 3VXTB 4F7MA 3OHXB 1HHHA 2PO6A 3EYQD 4KPHL 2W9EL 4LEOB 2DQCH 2WWKT 1DSFH 4HHAB 3RAJL 1NC4D 1U8KA 4RAUA 4PJ7E 1EAJA 1WFNA 4NIKB 1J05B 4R3SB 4UTBL 3RL2B 2NW3B 1NGQH 2DL9A 5L0QC 5LWYH 3VI3E 2DQDH 4X6EA 3MRNB 1KPRA 3PNWB 2X4TB 3GSNL 2WSKA 1H8OA 4P2QE 1MIML 1BZ9B 4F2MA 1A8JH 5DUMH 1IQDA 1YMMA 2XTJE 3Q5TA 2UYLB 2G5BB 2BVQB 1SJEB 3HRPA 4K7PX 3FT3A 3SKOA 3QCUH 1LQSR 4PUBH 5DHVB 3BT2L 4RGMB 1BHGA 3U0PB 1A7PL 3PJSA 1OAXL 4PPTA 3BH8B 1ZA3B 2FSEB 2R29L 4RFOL 5DD0L 4ZO8A 4O51B 1FDLH 4P2RE 1OW0C 1TTGA 3IJHB 3QXAA 5F89A 4Q9RL 4JG1L 2AJ3B 1QFWH 4GJTB 4PRPD 3RGVD 2G2RB 2OL3L 1JMXA 3FAXA 3HPJA 3QXDB 4MDJA 4XNYH 5BS0B 3IJSA 4KROB 3IFLH 4XC3H 4OCSH 2IPUG 5KVFL 5LG1A 5ECJE 4LIQH 3IS1X 4NUJB 4FTVA 3P4MA 1JYVA 1DTUA 4P5MA 1DQLL 1U8QA 5DJ0A 5JR1L 3GB7A 4PJEA 2N7AA 3D85A 4XNXL 3HMXA 3L3IA 2APFA 2D03H 3NFSL 1GC1H 5GRXG 1RZ7H 5C71A 3DOSA 4ZSOE 3X13A 2CLRA 1T22A 1LMKA 2H6PB 3JV6A 3O4LE 1E4XI 4ZUSB 4TNVF 1RIHH 3FB6A 2MCG1 3GMPB 4MA1B 2NQCA 4NZUL 5D1XA 5I0DA 4I77H 1HINH 2PXYD 2OR9L 5DJYA 3V4VH 4R8WH 4KV5E 4C56B 4F57L 1NAMB 4M6NH 5C0AE 2RFXB 5F72S 1KIRA 4L8BA 4LSRH 4WEBH 5EC2B 3WHE0 4I2XE 4YDIH 1AO7E 3BXNB 3HC0A 1JE6A 3WJJA 4HEPG 4JQXA 4FRWA 4DKEH 4D0CA 5DDHA 3QJHA 4QYOB 4N0UA 5IUSA 2G9HA 3H3KA 3IFNH 1XGQB 1UFUA 1AKJA 1IAKB 4JRXA 1I1FA 3U6RB 4U0RB 1V7MH 4N0RA 3PWPE 5CEZH 3JXAA 1EHXA 5EUOB 2I24N 4BSWA 4N1CA 5I1KH 1T20B 5ACZA 5K9JL 4O58H 4WO4D 3D2UA 5E5MA 1A6VL 2EDEA 1UWXH 4YGVA 5T3XL 5I6XB 2CDEA 4XPGL 4EN3C 3S35L 4LDOB 3UBXA 1UM4H 5E2WL 1PKQB 5BRZA 1REIA 5AUMA 1A6TB 4LAJH 1FZMA 1DBBL 3PHOB 3QDAA 1CGTA 4X9IA 1BFOA 3QJFA 4XVTL 4HLZG 4IRJD 4MS8C 2WNGA 1I7UA 2XWBB 5BW7C 4HUVA 2ZKHH 4JFYA 4LVOC 5FYLL 3KPMA 2Q76B 4ZFFA 4L9LA 4OIAA 4NQEE 1V5JA 4XBEH 2EKSA 3BD4A 3WUWG 3LCYA 5D5ME 3CFDB 3ULVD 5ISZA 5SWSB 4Y4FD 3TN0A 4KDTA 2O61A 1NGYB 5GGSY 1PQZA 3FTGA 2I5YH 3KLDA 5T5FH 1E4KC 4PFEA 4N9GA 1YPZF 3ZZ1A 2A6IB 1S7WB 3RPIA 5DS8A 3FB5B 4IMKA 3CFCL 4YBLB 5MEND 2DQFA 1HILA 1OGAB 1CBVL 5T1KD 1MCFA 2WWKO 3BH9B 4XB8A 4BH8B 3KHQA 4OCWL 1IZKA 3S3JA 5I1CL 3AMKA 2VWEE 5EUKA 2Q86B 2CXKA 4JRYA 5A3ID 1HEZA 1JNNH 2EDWA 2ORBL 4NYLB 3STLA 1FNEA 1WCQA 3K8KA 4EIGB 3MV9A 4OB5L 1EPFA 2NTFB 4RMWA 1DZBA 1N59A 4HKXB 1KIQB 1MLCB 2XNAB 2NY4D 3BVNA 4HWBA 4K3GA 5D7SH 1KG0B 5INCA 2Z0BA 4F9LA 1YEGH 3CFEB 3KPPA 3WKNA 5GRVK 2XACC 2HWZL 5HHNA 4Y5VA 1KTRL 4RGNE 5E9DB 4K2UH 4BZ2L 4MAYC 4X6DF 2QBWA 4KJQC 2CUIA 3V7AE 4YXHL 5LCVL 4YAQA 4KZEH 5FM5M 2XN9D 3CSPA 3MLZH 3QFJE 5I8EA 5AZ2L 2C26A 2R1XA 1MWAL 4KKCD 4KRMB 5IG7B 3BZ4B 3FZUD 1T2XA 1A22B 2XQBH 4KU1A 1GAFH 4U1NB 4YHKH 3D39E 5J11C 4W4OC 3BIBX 4PJGA 3DX7A 3LQAL 3ZYIA 5D2LF 2P43B 1H3XA 4ZQKA 1T5XB 4YHIA 5HI3D 1JNLH 5KSVA 1H15A 3LS5H 4HUXB 4JFZL 1IGFL 3CU1A 4YHOH 2IAND 2DLFL 3EFFB 4J3WA 3X3GH 1H3TA 1F4AA 1FBIH 1ETZB 5I1HH 4I3GA 3CFIC 5DD1L 1MY5A 2DAVA 1G7IA 4XPAH 1NCWH 4LIQE 1W0WB 2G75B 3CPLA 2NYYC 3UROR 4QTIH 3FO2A 1A4JB 4H5SB 4DGVH 3Q6GH 1BZ7A 1AHWA 4UBDD 3T0XA 2Y1VA 4LSPL 3Q3GA 1Q9LB 3MPCA 1B4JL 2FBOJ 5IESL 1KACB 1A64A 4JFFB 4KPHH 5IJVB 3CH1B 3HR6A 1NH6A 3B43A 4I18A 5IBLC 4QOKD 1JNHB 3GNML 4UILH 2AV7A 5LBSL 1LD9A 3TYGL 5FDWA 4UOW1 1IGTB 5HVFB 3EYVA 4HWEH 2BSED 3RVTD 4AIOA 5IHLB 4I0PA 1N64H 2D7TH 4U6YA 5ERWA 5HHOE 5BZWB 4LSSL 5E8OA 4GSDH 1HOCB 4P4RA 3HUJE 3SGKA 1T04B 2WBJB 2DLGA 3V79C 4OZIF 1ZOXA 1G7MB 3WNNA 4MXVF 4WGWB 3T3PF 2O93L 3TLRA 1EFXD 1MFCH 1EK3A 3QDMD 3DMMD 2JIXB 4NQCA 5DXWA 5SWZA 3AGVA 5HGHB 1YEJL 2XPGB 2X4PA 1HNFA 3RQ3A 1BQHA 1KB9J 2Y9RT 4PY7A 1FZOB 3VXTA 1OGTB 3OHXA 3HG1D 1KB5A 3BMWA 4QXUL 2UY7A 5C0FB 5CEZE 3IAGC 1CGXA 4MNHA 2OL3H 5ESVB 3RWHB 4OZGF 1T5WB 4Q6IC 3C5ZA 3P4LA 1RULH 1NQBA 4R3SA 2HMIC 1AE6H 1MHHA 3MXVL 4IOFC 3RL2A 4HV8B 4JQVA 4EI6A 4LCWB 3DYMA 1I1YB 1BZ9A 2X9XA 1UYWL 3SQOH 4G8GE 4UQ2B 4XNXH 2LTQB 2UYLA 4BSVB 2YXFA 1DN2A 2J6EH 3K4DA 2BVQA 3DO7B 1KCUL 4WU7A 5C0DA 3D6GA 4R4FL 5DHVA 4DGYL 5T33L 1YMMD 2FJHB 2CKBL 2HT2D 3BH8A 4L3CB 3JUYA 2X5PA 4M5ZH 4HQQL 1QFUL 3QNYA 5E0QA 3F5WB 3O2DA 4G80A 4O51A 1JF1B 3IJHA 5FHBH 4QHMA 2EH8L 4POZD 2G2RA 3QRGH 3OKOB 3MGTA 4RFEA 1U6AH 5BS0A 4J4PC 1I9IH 43C9B 3BP5B 4RFNC 3OB0K 1PEWA 2WINB 3OAUH 2L0DA 1IT9L 4P2YA 1KLUB 2PETA 4A6YA 1VESA 2HT3D 5I8OH 4J7RA 4OLVH 4KVCL 5LKNA 3KPRE 1A3LL 1NCAL 2EDRA 2FJFA 2J4WH 2HLFD 1JI1A 3CUPB 5KSBF 3QEHB 1JZ2A 1T1XB 2IFGA 3F58L 1R3IH 2Z91B 1C16B 1K3IA 3SKNA 1MCHA 1U8PB 3ELAT 3SDCC 4GW5A 5SV3A 1Z9LA 2FYYB 3U4EB 4ZUWB 4L4TE 2C4XA 1AIFB 5T3XH 4BQ6A 4DZ8A 3EYOB 4OV6F 3T0EB 5ESQB 3RUGB 3S35H 5EC2A 4U33A 3LEVL 1OAQH 2EIEA 3PV6A 4WFGD 5I73C 5GRJL 5EZJA 3T8XB 3VFOB 1F97A 3O41B 3GBMH 1EJ6A 1BLNA 4ZS7H 3TA3D 4U6HA 2YUXA 1QBAA 4KTEL 3WIIH 1U3HC 2C4FU 4PG9B 3FONB 2A83B 3WN5B 2OXGA 4QY8A 4KJPC 4IDJH 3TZVD 1CD0A 2BVYA 3U6RA 4Y1AA 1DVFD 3U82B 5HI5D 3BKMH 1EHAA 3GIVB 1G6RL 5EUOA 2H2SD 4JRXD 5IROA 4HUMB 5IK3A 4P2OA 3VFVB 3OXRB 4POUB 5K9KA 4P59L 4J3OC 4NC2B 4XMPL 3WO4B 4Y2OA 3LKNB 3U9UA 1BGXH 4NZRH 3MUY1 2XKNB 3QUMA 3CFCH 5JOFB 3GMQA 3D18B 4KDWA 5JMOC 1WJ3A 1U91B 1A9BB 1TLKA 3AREA 4F8QA 1O0VA 3KYKH 3OAYH 4YK4C 4UOJA 3O9WC 1OTSC 2ATKA 1KUMA 1S7QA 2XWBA 3VFNB 1J8HD 2V5SA 4DTGL 5BV7H 1IBGL 2Q76A 1VSCA 3PV7A 4OF5A 2VZSA 2W65A 2JF1A 1HIML 1T80A 4GKNA 3I50H 3MGOB 3KXFB 1CGYA 3ARGC 1WBZA 4D9LL 3ARBB 1DQQA 3A6OA 2V9RA 2VDKH 1TVDA 1Y0LB 4G9DA 1D7FA 3GJFH 4HUKB 2V2XB 4IRSB 3PABA 4G6ML 1C08A 5JPMB 2A1WL 3JWOL 1XIWC 3IFOA 5ISZD 3ZHLA 2ADIA 1RUQL 1GHFL 1K4CB 2A6IA 5HPOA 1P7QA 1JRHI 2FH6A 2BSRA 4YXHH 4Y4KB 4TRPL 4AEHH 5GJTL 3DRTB 2HTKD 2W9DL 4BH8A 1GCFA 5I0ZA 1KIPB 3FQWA 4O5LL 4WFHE 1MCPH 4FZEL 1ZWIB 5DQJB 3SQBA 4JO4L 1FL3B 1RZIB 1YYMH 1Z5LB 3TWCL 5J1AB 2NTSP 2VXQH 1XR8A 4LVNB 2HJKB 1K8DA 1G0YR 1RZKC 2HJLA 2UY6A 2ZUXA 1E6JH 4WJ5A 2NTFA 1YEIL 5DC9B 1MCWW 2H32B 4QF1A 1ADQL 5B3JF 3NIDF 4ZUVB 2EKJA 1A7BA 4RGOH 4YGAB 5DEFB 2DLFH 2QKIA 1D3CA 4JM2A 3BRGC 4OCYH 1DL7H 3UJTL 2QSQA 3TPUA 4WI2A 3CFEA 4XZUB 3U9PL 5GPRA 5GJSL 4Y5YC 1FGNH 5IFHH 1RI8A 3OKMB 1QSFD 1I3GH 5B22A 5E6IB 3MYZA 5E00A 2DLIA 1I85A 2QHLA 1B3JA 3K81A 1HKFA 1IC5L 2X4UB 1LK2B 4HWZB 4HIJB 3KNBB 1CDHA 4FQ1L 4NRZB 4YX2H 5DJCB 1UXSB 3BZ4A 1X5JA 1CLZL 5IFJB 1N0XL 3H9HA 1HDMB 4LSPH 3QPQD 4X9GA 3CXDH 2XG4A 3TYFA 3QISA 1NCTA 3DIFB 3X11B 4AQOA 1EZVY 1IGYA 4R2GD 4CUCA 3P77B 2HKFL 4OLZL 2BHUA 4ODVH 4EXKA 2R69L 4P2QB 4N0CC 3GMMA 4E0RB 3UPCA 3EFFA 2G5RA 1MQ8A 1CICA 1HSBB 4U31A 5HTSA 2XWJB 1SM3H 2XTJB 3RVUD 4F58H 2X7LB 2DQUL 3DGGB 4J3SA 4MQXC 1KELL 1LP9F 2X70A 1S7TA 3DVGA 3WSQH 1T1ZB 3F8UB 4UT6L 1W0WA 4PJIF 3B9EA 2G75A 4OT1L 2D3VA 4M9OA 4JRWA 4OIIL 1QFHA 3UTQB 3T77A 4FFVD 4GMTL 1JZ3A 1A4JA 2E7LA 3K8MA 4ODHH 4FMKA 1P4BL 4L3EE 1IRAY 4S10A 5IR1B 1DE4B 4GG6B 5FUZH 5JNYA 1ZGLP 1XF2A 2BZDA 1YEJH 1Q9LA 1NGXB 1I1AC 1NC2D 1CU4L 5TQ2H 4OCMC 5CZXC 1XH3B 3VXNA 4NJ9H 4X4XB 2OJZL 2DQJH 4QXUH 3CFKB 3CH1A 4G43B 4DVRL 1VKXA 5MEQB 2RCSL 2GYSA 5FGBC 1BX2B 3L1OH 1KJVB 1WBYB 1KBGL 1BQLH 3IXAA 4MNQE 4ENEC 3T0WA 4LU5H 2YD4A 1FNLA 4GKSA 4WWKB 5I75B 1J1OH 4ZSOB 2QSCL 3O4LB 1HOCA 1NMBL 3H9SD 2QQLL 2WBJA 1OPGL 4RISL 1IGMH 4I0PD 1G7MA 4YDJA 5IJKC 1NKRA 2P48B 2BVPA 1ITBB 4RA3A 5HDBF 5EOTA 5GRWA 5LGJA 5H94A 5T33H 5DVMA 2UZIH 4LVHC 5HVGB 4DGYH 5T3ZD 1G7JA 2JIXA 2GHWB 4I3SL 1DN0B 1HH9B 2XPGA 4O2CA 4U3CA 5DVNA 3S96A 1JUFB 1AO7B 1QFUH 2IPKA 3AS3A 1FZOA 3BWAB 1TDQA 4PB9H 1ND0A 4LHJB 5SWZD 2E6PA 5C0FA 3SDDA 1IL1B 2APVA 5ESVA 4NRYB 1ZHLB 3MRPB 4WRLA 5LAXB 5IMLB 2W9LA 1ERNA 3I6LE 3LH2H 1I8MA 1OHQA 1IAII 4G8EB 4YQXL 4LF3B 5IT2L 4JFDA 5DSCB 2R23A 4LCWA 3HE6A 1BMGA 4EDWL 4JFEE 3IFPB 1BJMA 2ITCB 2VDPL 2Q6WB 3GK8L 3PWPB 3T1FB 1JFQL 4I4WA 1R5WB 4FFYH 4YBQD 5IB1B 4KJYB 3ZKMD 3QEGL 1XEDA 2B0SH 1F5WA 4PJBE 4XP4L 1N5YL 3W5NA 3DO7A 2QQKH 4HWUA 3B6SA 4I3RL 5D8JH 4PP2B 5DJ8B 1MRDL 8CGTA 4XWOC 4JJHA 3ZHKA 1HHGB 1KN2H 1XGUB 1A14L 2FJHA 2ZUQB 4L3CA 4BM7A 1AGEB 1ZVHA 1BREA 1EGJH 4LSTH 4XP6L 3I3BA 3LSOB 3OKOA 4K8RH 5TQ0L 1MIEH 1DBMH 5H35B 3ZKNC 5E56A 4IJ3B 5L7XH 5E2TH 2WINA 1ZHBB 1NGPH 2Z31C 4HH9B 2CPCA 5DRXB 3O11B 3LIZL 3N1QC 3NABH 1KLUA 5BS0D 4KROD 3VE0A 4S1QH 3T04D 2MQCA 4KTEH 4LPCA 1T0NB 4OIBA 3TBYB 1Z0NA 3QFDB 1FG9C 2YPVH 5D5MB 3HAEG 1U36A 3V52L 3DNKA 5E2JA 1N7ML 5J1SC 2P45B 3QEHA 3N1PC 4OFPA 4XH2B 1T1XA 2BRQA 5C0BE 4GKZB 1BD2E 1IGIL 4FFZH 1U8PA 1JGUL 1WZMA 1XMWA 3WL9B 3TV3L 2YR3A 1CZ8L 4U3XA 2OXHA 2HVKB 4P59H 5D1ZB 3U4EA 4ZUWA 4YXKL 1B6DA 1KB9K 2VYRE 1KTLA 4NQVB 5FO7B 5FAAA 2MSPA 4LKCB 2UV3A 4H1LG 1MFDH 4XCNB 3ZKXB 4HG4K 3KGRA 4C56D 3SE8L 2LQRA 5JOEA 4OTXH 1A1NB 1U41A 5T1MB 3T8XA 3SPVA 3O41A 3SOBL 2GJ6E 1UJ3B 3TT3H 1PG7X 4HX1B 3ARPA 2E9BA 3FONA 1XGTB 1CI5A 3E6HB 3GO1L 1JGVL 4U7SA 4S2SA 1ZT1B 2HRPL 5D7JB 1BBDH 1F2QA 2CMRH 4Y4HC 4NKQB 1EJOL 3QI9D 4D9LH 1Q0XH 4LMQE 3VXSE 2IAMC 3T2NL 4RGNB 1U58A 3QB7C 4OSUH 5CSZB 5KVGL 2DICA 3DSFH 3KVQA 3LKQB 2A1WH 2YUZA 1QLEH 2NZ9C 4XPTL 3QFJB 3ULVF 5TDOB 3B5GA 3BD5A 2XKNA 1GHFH 2EIBA 4QHUB 3MNZA 5JOFA 3VA2C 3N85H 1QPXA 1NBYA 5SV4A 2R56L 4FZEH 4GLRH 4S11A 2P5WE 4MJ6B 3VFNA 4JY6A 1UH3A 3L3GA 4L4VE 4YHYB 4Z7NF 5IMKA 3KDMB 5I1JH 4M4RA 3NCFB 3L5XH 5HJ3A 2D7PA 1JPFB 1RFDL 4DKFL 2Y6SC 3ARBA 5HPMA 2YEZB 5JXEC 2GSGB 1OSZA 5DURB 4NJAL 1A1OB 4Z7UF 3CDCA 1QLRA 3QUKB 5DQ9A 4G6JL 4Y5XA 5EORL 4ZD3L 1LE9B 4LSVL 4NPYA 1RHHA 5E8EB 2HJFA 5SWSD 3CFBA 5IVOA 3ILQD 5F8QC 2H41A 5F7EL 4Y4KA 1AR2A 4PS4L 3LVEA 1UC6A 2IPTL 3BYTA 2ARJB 1OGAD 4YUEL 1KIPA 3GRWL 3I6KB 1TENA 1QR1B 2MOVA 3V4UH 2HKHL 2AS5M 3VWKA 1CLZH 1IAOB 1ZWIA 1N0XH 3MLSL 4ELMA 5D93C 2M2DA 3CX5K 3DV6A 2F53E 4XGZB 5HHXL 4CBPA 2HJKA 2UVEA 4YHML 4HS6A 1CFSB 1Z9SA 3QNZB 3VG9B 3RTQB 5HHOB 4MNGA 2H32A 4PJ8B 3THMH 3WE6B 2DQTH 2FX7L 4G9FA 4ZUVA 3HUJB 1N26A 3CU7A 5DEFA 1EEYB 5F7MC 1GGIL 4U05A 3VU2A 1WZLA 4QNPF 5CWSA 5GZND 1I8IA 1ZK9A 1X4ZA 4XZUA 4UIMA 3MO1B 3QZWB 1KCKA 3L3DA 3OKMA 4U1GC 5E6IA 4P2CG 5D7IA 1KEGL 3Q5OA 1KJ2B 4PGBA 4OIIH 1EO8L 3C6LC 4LPWA 4NRXB 2NX5A 2X4UA 1LK2A 4GMTH 1WCBB 4HWZA 4PJFA 1GVIA 2QR0B 5E9DD 3KNBA 5C0JB 2R8SH 1LEKB 1NEUA 3O81A 4K3JL 4P3DB 4CAGA 1UXSA 3GSQA 4LSDA 6CGTA 5IFJA 1T89C 3BZFB 5E8DH 2OX5A 4AJ0A 1HDMA 1AP2B 3FOMB 5CCKL 4OZFA 1GGBL 2JJUA 4ZFOB 1CU4H 2XKSA 3I85A 5GRZA 3DIFA 1JL8A 3X11A 1N6QH 1F3RB 4DQOL 4HLJA 1NBZA 5EN2B 2BNRA 2LFGA 3KPOA 4PJAF 3KJ6H 2XZAH 1S7SB 5BXFB 3FMGL 5C9KA 1UCBL 4G8GB 3B9KB 3RKDD 2XWTA 1K8IB 1NUGA 4NHCH 2X7LA 1T66C 3W0WE 5I1EL 1IFHL 3DGGA 4MXWL 2P4AB 4PLKD 4N8VB 2QSCH 3MBEC 1QKZL 4KY1H 4EI5C 2BXYA 3O6LL 4N5EC 3I3DA 2GK2A 4Q9BA 1OY3B 4WDIB 4LLMB 3ARFA 3UTQA 1QEWA 4PLJC 3PWJB 2DTML 4WHYG 3MACL 3S9DB 3QIUA 2VABB 3JWDC 3GSWB 1DE4A 5LVEA 1FRGH 4GG6A 5ACMA 5HDOA 1FO0H 1NGXA 4YHPA 3REWA 5B39B 4G8FB 1XH3A 4OGAD 4CVXA 5J7CC 3MSPA 2EO9A 5GZOC 2IADB 4G43A 5DWUH 5H37H 4AMKL 5IB2A 1D6VL 1QFPA 3QUXB 1BX2A 4JFFD 5E2UL 1IKFL 4U1LB 1EERB 4JM4H 3BFOA 4FXGB 4FQQB 3G04B 2FNBA 1D5XA 3PDOB 5DO2C 3RVWD 3U0WH 3Q1SH 4LCIH 5F96H 4PJXE 4JY5H 1EBAA 1P6AB 2LVEA 5ID0A 4NHUA 5ITFA 1M05A 2XQYG 5HD8D 5HVWA 1QR4A 1N5YH 5A2JH 1A6UL 3FN9A 3ZE2F 4WEMB 2ZSWA 2WBJD 5GISL 4L4TB 3SGJC 3TT1H 3BEVB 2AQ2A 3S34L 2AP2A 2OMNA 4EUPH 1HH9A 1UA6L 4P5TC 4XAWH 3MRMB 1HK6A 2ZOKA 2GKIA 2Z92A 4ZXBB 1OVZA 1NFDA 2YMXL 2JIXD 3DLQR 2NY7H 5EBMA 5FKAB 3H42L 4Z6AT 4NRYA 1ZHLA 5KVEL 3MRPA 3OAZH 1R6VA 3UTSB 1A7NH 3PHQB 5IMLA 1EEZA 2PYEB 3MRRA 3SGDI 5JZ7D 4G8EA 1QRNE 3P4OB 5DFVC 3VXRE 4HAGA 5C6WH 4BYHA 5LGKA 1F8TH 2DDQH 5E7FA 5CILH 2Q6WA 2VDQH 3CK0H 4ZUUB 1R5WA 1S9VA 2J12B 4LCWD 1WC7B 2X6MA 3QXWA 3B3IB 4FQLH 1UH2A 3VXUE 4KAQL 2PCPB 4AM0A 2W91A 1UKTA 2FIKA 2CLZB 2W60A 1JF6A 1XGUA 3SO3C 4PJEF 1AGEA 1CD9B 4U2YA 2MFNA 3NZ8A 3DBXA 3OV6A 2GJZB 5CP3H 3UTPE 3TJEH 4EN3A 3AROA 3FT2B 1FNGB 1MVUB 3L3JB 5H35A 3IRPX 4LPVA 4P23C 3I75A 1J5OL 3DWTA 3DI2B 2GSIB 4H20H 5GS2H 1ZHBA 1MHEB 4HH9A 2D9CA 2ZOLB 3P9LB 3QCVL 5EPMB 4JJ5B 2FEEL 3NACL 3HI6H 1HI6A 3RI5F 5DQDL 1T0NA 2Z8SA 4RMUA 4AEIH 1G7LB 3BKJH 5D6CB 1UVQB 1UWGL 2EYSB 1B6UA 2R1WB 3VXQB 4FABL 4Z5RB 1JGVH 3STBA 4ETYA 4XH2A 2F19L 3BUYA 4GFTB 2MWCA 2WV3A 3NFPB 1A6AB 4K55A 4CVZB 1DJSA 2Y7QA 4MQSB 4NKMB 4K71B 3MX0A 4HKBA 4LPXA 4PBVC 3H3PH 4QRTB 4BJLA 2QADB 5HYJE 2QEJA 4NQVA 1MUJA 1OAKL 1NMCC 1T2QL 5F1KC 5DHYA 2ZCLL 5HDQH 2AEPL 4IMLA 3D48R 1FE8L 1JK8A 4HIHA 4HJ0D 1LO2L 1E0OB 3T0ED 2ERJC 1TZIA 2R39A 3G08A 4IS6B 2R0ZH 4HX1A 3CZJA 4OD3H 4YXLH 2XFXB 1TQBC 2DLHA 1XGTA 3E6HA 1UT9A 2VQ1A 43CAA 3GFUA 1CS6A 3D9AH 5JA9A 3M07A 3QNXB 1CFTA 5D7JA 3VXME 2OQJA 3CLEH 3V6FA 2OL3B 4DKFH 4LBEB 1GOGA 4X5LA 3BKYL 1S78C 1A6WH 4M6ML 3GSVA 1L7IL 4LASH 5F9OL 2BNUA 1U8OB 2JB5L 5CSZA 1OTUD 3QXVA 4E42B 4FQJL 2XZQH 3R06A 3G5ZB 5A43C 2WUCH 4K23L 3UC0H 4OLYH 3VFSA 4ZD3H 5TDOA 3D3VB 3TBWA 5DGQA 2Y72A 5C6TH 4PJHB 3MV8A 1ZANL 1Z3GL 4QHUA 3RY5A 4TNWK 1K5NB 2F8XC 3SKJL 4Z7OF 1O7VA 4HJGB 3MRBA 3RA7L 2COQA 3ROLB 4YUEH 5C7XH 1NCBL 1R24A 1CLOL 3C5JB 4LRNH 2DWDB 3IDXL 1QHOA 4FA8A 3F7RA 4ODBD 1SJHA 5CP7A 5KN5B 4QWWD 2R2HA 5D6DA 4ZPVB 4DW2H 4F9PA 2G60L 3EYUL 3HC3L 3QDJD 1VHPA 5GGUA 2FX7H 2GSGA 2ADJA 1A1OA 2VKWA 4C54A 3AM8C 4P46A 3KXFD 5JUEL 5FEBA 3ARBD 2VISB 4LSQH 1UM5L 5GXBB 4L3EB 4JDTL 1A47A 4X6FB 5E8EA 1JTTA 3VH8B 5K9QI 1WAAF 2FO4A 4IRSD 2WP3T 2H26B 4N9OB 5EO1B 3IXTA 1T7VA 2NZIA 2DOCA 4NN7C 2IALA 3SGDH 2F5BH 2DQGL 3I6KA 2OTUA 1VACB 2X4OB 3BQUA 1QR1A 3MREB 4Y4KD 5JHDE 4NCC1 3OKKB 4Y2DD 5EWIL 3TO4B 3TVMA 4YC2B 1AD9B 4XGZA 4BUGA 2C1OA 4MNQB 3AAZA 4FQHA 4WUUB 4XXCC 3MCG1 1SVZA 5SWQA 4PJ8A 1RZFH 3WE6A 2GJJA 1XCQB 4HLZH 2B4CL 4GBXB 4YHLH 5I71C 1YUHB 2I07B 1UZ6F 1F6FB 3U46B 3WFBH 1H3GA 1EEQA 3P9MA 4YH6A 3KLAB 1MNUH 4OLXH 4MXWH 3MO1A 3GMOA 1DBAL 2DYPD 4P9HC 8FABB 1QKZH 4PV9A 1ZTXL 2X2YA 3S4SG 4TPRH 4JKWA 1KJ2A 3KWWA 5DZNA 4NRXA 4PJCE 5GGTA 4ERSH 1WCBA 3VRIA 4M7LL 5I2IB 3C08H 3WEXB 2YZ1A 5C0JA 5MEPA 1LEKA 3D0LB 4YZFF 4P3DA 7CGTA 2DM3A 5ILTL 2GCYB 4ZAKA 1GJIA 5E5RB 4JY4B 3FOMA 3VFGL 1ZGLA 3DPBA 3X14B 4ZFOA 3MLTB 3MFGB 4PJ5A 1S9WA 1RURL 3L3HA 3ZDZE 3WNLA 3BPOC 3VDBA 4ZDHB 4GRLC 5F71A 1YJDL 3HRZB 4JFEB 5JW3H 2VUYA 3IKCB 1S7SA 4Q2ZB 4TSCL 5A40E 3B9KA 1BP3B 2R4SH 3ECBB 1R3JA 4YFEA 5I8CA 3WXVL 4P2QD 5DD5H 2KQNA 2CH8A 2BX5A 3RU8L 2XOTA 3GZKA 3L3KA 4R0LC 3WKMH 3NA9H 2XTJD 15C8H 2J8UB 4WDIA 1RZKH 4OZHF 3BE1L 4XVJL 3LV3B 3RX7A 3QCTH 3P30H 4F7TA 4G6KH 1RZ8A 5HVHC 2VABA 5T3ZL 3H2WA 3MZGB 3OKLA 1RJZA 4NWTL 4EXPX 3ULVC 4CN6A 3GJFB 1FLRH 4Y4FC 4QRRE 1GGYA 4ISVB 1K6QH 4FQXC 4UZGA 3VI4F 5CJOL 2FZ3B 5LJYH 1T7WA 3WFDH 1WEJL 1FVDB 3UTTA 3L5IA 4NBXB 2Z8VC 2ADFH 4PGCB 2VH5L 3P0YL 3NIGF 3BEWA 3HFMH 5FM4A 4LPUA 5DMKA 5CZVL 1EXUB 4BSJA 5IBUG 4U1LA 1RUML 2DBLL 3VD5A 4FQQA 2YRZA 1SYVA 2BNQA 1MWAB 1HWHB 1G0XA 3DECA 5C0BB 3HB3D 4JKLA 2FIRT 5A3IC 1BD2B 1NANI 4WWKD 4V1DE 4WUKL 3BP6B 3ZHDA 3O4LD 2H8PA 3FQTB 4LFHD 3BKCL 3LRGA 5I8KH 2NY4C 2VQTA 35C8L 3QIBC 2X10A 3MRLB 3BISA 4M4PA 3DI3B 4UU9B 3V0VA 4JO2H 2C5DC 4MDIA 3QG6A 3U0TB 2GJ6B 3VDCA 4APQB 1QFWM 3UTSA 1AO7D 2EO1A 5IEKB 3VD7A 2DQIH 3QXUA 4ZTOH 2PYEA 4OFIA 1EMTH 1KTDB 1OSPH 5C07A 4OGXL 4HKJA 1RZGB 3QCVH 4L29B 4M7KH 3N9GL 1SEQH 4YDKH 4OGYH 2R9HD 3SY0B 3DVNB 5DMYA 3VXSB 4ZUUA 3MOAL 1ORQB 4Y19B 4Y7MA 1UWGH 2OR7A 4WVRA 1WC7A 3T3ME 3AS2A 2B20A 2MNUA 1WT5A 5HI3C 2WP3O 3PWPD 3CVHA 2PTTA 3RRQA 2C1PA 4NQDA 3EBAA 5I74B 3RNQA 3AS1A 5FYJH 1MELA 2R0LL 1K4DB 3O3DB 2Y4SA 3QQNA 5KANI 3QUYB 5GSRA 5D7LB 4MA7L 2EC8A 2O26U 4YFLF 5FYKH 2GJZA 1M6OA 1K85A 4HMCA 3O4OB 4AH2B 1KCRH 3E8UH 4DFIA 3E3QC 2P5WB 3RJQB 1NAML 4G42B 4WW2A 2GSIA 4HPOL 2HH0L 5EU7C 4L4VB 2ZOLA 4C58B 1CGWA 2JJWA 5HGDB 4R97C 4RMTA 1UXWA 5ETUA 4UBDC 5IF0B 3SJVA 5D6CA 1UVQA 1T1YA 2EYSA 3JV5A 3VXQA 1RSFA 1DLHB 1YQVH 4M1GL 3OKDB 4NQED 4DK3A 5CEYB 3DTXB 4DOHE 3IDIB 4K7FB 3C87A 1P9MA 3H0TA 1U2CA 5FXCH 3SCMA 2YSSB 3NFPA 4CVZA 2DIBA 3OR6B 1OQOA 3RZCA 3RVTC 4NKMA 1CFVH 3TM6A 5IGXH 4P57B 3GSNA 3K2UH 3PWVB 4UQ3B 5KAQG 1BOGB 5D1ZD 4MAUH 4K7PY 2BVOB 1GPOL 3GHEL 3IRZA 4JANA 2GUOB 3WS6A 2XZZA 3KYAA 1YNKH 2LABA 4UB0H 5GIRB 2W59A 4HS3B 2F53B 4NO2A 2YN5A 1EVUA 4TQEH 5KSAC 1CLYH 3DURB 4YNYA 3DMMC 2CSPA 3VD4A 4ALAL 1JZ5A 1RUKL 1S5HB 3HR5A 2AJXH 2APXA 1U0QA 1YNLH 1ZLWK 2ZCHL 5F9DC 4O4YL 1PVHA 4JFXB 5F7HA 5L9DH 3O8XB 4RMQA 3N50A 2OL3A 4LNVA 3CCHB 1A6ZB 1PLGH 2P8PB 2NY3C 1HN1A 3B8YA 1G7HA 2PO6C 1BQHG 2D9QB 2ICCA 2BFVL 1CXHA 3PL6B 2BDNL 4P9ML 1CDUA 3FRPA 4WY7H 1HKLH 3MRHB 2FX9H 5CSGA 4RGND 4XP5L 3LKSB 3D3VA 4JHBA 4RMSA 4L5FH 4PJHA 2ZUTA 3R0MA 3GSRB 3FRUB 1ZSDB 3DYOA 4KK5D 5GGSB 2YPKA 3QFJD 1OAYL 2DBJA 5I18H 4HJGA 4ODWA 1MH5B 3L95B 5ICYA 2W92A 1Q9KA 1OB1A 1NGZB 4HXBH 5EIIA 1UACH 1OF2A 1ZS8A 2K9UA 2AK4E 3C09B 1V05A 4F33B 1U93B 4M48L 3DVFA 1TZGH 5B4MD 4LOUD 1NANH 3LB6D 4POZC 4HCRH 4HSQA 5KN5A 2C7UB 3FB8A 3C6SB 2GT9A 4NNPH 3BPLB 3KAAA 1CVRA 1QYGH 3HZMB 5J13C 2B4CH 3B4NA 1HZHH 2DWEB 2X4NA 4RRPG 1QNZL 5DRNB 5FA3A 5FO8B 2HT3C 1ACYH 2VDNL 5KOMC 4FNLL 5DURD 5GRUH 2AAVA 3DROB 2HLFC 1FFOA 3VGHA 4YHZL 4G6AC 4TNWF 4YDLC 4DKAA 5FGSA 2BVUA 4CN4A 5B3NA 4XCCH 3MA9H 3WS3B 3ME0A 5EB9A 3T2PA 2R4RH 5F9WB 3T4AB 1G6RB 3MREA 4PLNC 5FB8B 5L0QB 3CVIH 3OKKA 1SMAA 4W81A 3VFGH 2J88H 4JZOB 2NXYC 5TE7H 4H8WL 2FJGB 4YHNA 1XF5B 4JDZB 4Y16B 1AD9A 4JQIH 3EFDL 2Q8AL 5D1XC 5C0RH 5C0IB 1DDHA 1YEFH 3TH3T 4WUUA 4U1KB 4F15C 5JLZB 3BN9C 3QP3A 4PJXB 2GTZB 5IQ9B 3DSNA 1JPGA 5HHOD 3RTQD 3WXVH 2GQHA 1S8DA 5HYSB 1D9KA 3O6FB 3SDAA 2AJYH 3WD5H 1TCRB 4L8DB 3RU8H 5F3BB 4K94L 1FSKC 3WJJC 2VLJE 5GHWH 4JQXC 3ZL4H 1U95B 4QKXB 1FFQA 3ILPA 3JVGA 4OV5B 4XVJH 3NTCL 1GGTA 4OGZA 5I2IA 3WEXA 3D0LA 4O9HH 2R0KL 3RWCA 1QSEA 2YPLA 4RAHA 4N0FA 2GCYA 2HLAB 1IE5A 3NCCB 3KPSA 4WI5A 4JY4A 1YPZA 4WTZA 2Y06L 5F6IC 4X4MA 2K1MA 3MLXL 5CEZD 1QRNB 4OJFH 4UT9L 1SJVA 2ZUUA 3VXRB 2AXFB 4M93B 1FC2D 4MD5A 4ZDHA 5CJOH 1RD6A 5FYJE 3IKCA 1KENH 4Q2ZA 2VH5H 4ODSL 1I75A 2VXSH 4YDVB 5FYKE 4LARH 1NLBL 1RUMH 1Q94B 1VFAB 4G8GD 3B9KD 3UO1L 5HHVL 2Y5EA 2D4DA 2J8UA 3WV0A 4CU7A 4U1HB 5FHAH 2VLKB 5JO5A 2QQNL 5M94B 3CMOL 1HXMB 3T4YB 1JWSA 1TZHA 4E41B 1ZEAL 2ITDB 4I0CC 4KMTH 5H2BA 4L9LC 1AI1L 3OGCB 3BKCH 3KG5A 4U2ZA 4PTUB 2WM0A 3C60A 1ZA6B 1C1EL 3ARDB 5DTFB 4ZO9A 3RWGA 5JMRA 3TIDB 4QXGL 2FZ3A 4KI5D 3QDGE 3TN0C 4KDTC 4XP1L 4PGCA 3AY4A 1H5BA 1Q9OB 4JG0H 4M5YL 4DJMA 4IMKC 1G0DA 3QUXD 4CADA 1MFEL 1MWAA 3KPRD 1NMAL 1RIVH 4PTTB 4OLWL 1E4JA 4JO1L 1F4YH 4D0BA 3KHOA 4KK6D 3ZYZA 4KKBD 1DP0A 2MCPH 5AYUL 3VCLA 2V7HB 3ZE1F 3ULUL 5L2JB 3MLYL 2EIZB 1JJUA 3FQTA 1KCSH 3HE7A 1KEML 2FLBT 4X6DE 5KJRH 2X05A 3ARUA 5IM7B 4D3CL 4ELKA 5HYJB 1G9MC 4K7PL 1ZLSH 4JVPA 2AEIT 3HZVB 1BJ1H 2IEPA 3Q5YA 4PGZA 4F3FB 3MRLA 2R0LH 3BUTA 4L4TD 4KXZH 3IU3A 3KYNA 2EXYC 1INDL 1P84K 2ICES 3TFKD 4JDVA 1R0AL 3B9AA 2ZUWA 3U0TA 4HFUL 1UB5B 1T7XA 1I3UA 3VJ6B 5AZEL 4WHDA 3LPGA 4ZXBD 4F9LC 2DM4A 1I9JL 1D5MB 2CIIA 5D2LE 1KTDA 5EU4B 4FQIL 1X5FA 3JWDH 4X99B 3NH7L 1CIUA 1DQJB 1UQSB 2VLLB 4HPOH 1OAZL 4Y5VC 3UTSD 2BCKB 4ZNCD 2ICWB 4PGDB 2PYED 4KQ3L 3VXMB 4MZ3A 4M7ZB 3RWEA 2P5EE 3MV7A 3SY0A 3DVNA 1CWVA 2PW1B 3ULSB 2CLVB 3GBNH 4QRSB 4ZG1A 2AEQH 4Y19A 4HIIB 1TIUA 3EW3B 1CDYA 3K2MC 3QEUB 3OKEB 2R0WH 1JPTH 4R2GC 4M1GH 4WV1B 1MI5E 3IDGB 1IARB 5F1NB 2VLRB 2AGJH 2XRAL 4O2EA 4LCCB 1F4XL 1NC4B 2FB4H 5I66B 3BP7B 3O3DA 1Q38A 2JE8A 4KMLB 3S37X 4R4ND 3QUYA 2YD2A 3NN8A 2V2WB 5HY9B 4Y88A 5D7LA 5DK0B 4RIRA 1DBKH 4LKXB 2RBLA 2FATL 1TETH 1MSPA 4DGIH 2AXHA 4G3YL 1X4YA 4KQ4H 4LAQL 4FXKA 2FR4A 4PJDB 4HDIA 1JHLH 4G42A 1VFBB 2OK0H 4P49A 1J0HA 1NJ9B 5E99L 2IMNA 3B2UC 3RBGA 5TFSL 4TTGA 2YA1A 4U1JA 2BY3A 2V5TA 1FO0B 3RUGF 3S8WA 5F7DB 5FM8A 1LDPL 1AHWC 4MAYB 5CEYA 4PRPB 2KQMA 1YJDC 4K7FA 4OZIE 3LZFH 2VR9A 5ICXA 3NCYS 1C7SA 4AYFA 4FZ8L 5JIHA 4I18C 2FD6H 1RZJC 3OL2A 4ZOBA 3P0VL 4P57A 3QH3B 5CSBA 5J11B 1HQRB 2BOCA 1GOHA 2GK0B 1TITA 2VRAA 3IDMB 2MPAL 1BOGA 2A6JA 2ENYA 3FQNB 3IAPA 3V4PL 1D5ZB 2BVOA 4GT7A 4I0PC 5JHDB 5IV2A 2QADD 5DR5L 1EO7A 3MMEB 4J8RA 5GIRA 4OZGE 3SGKC 3F12B 4WFHD 5EG6C 2YC1A 3LQZB 4EUPB 2IBGA 2V17L 5ALCL 2CKBA 3NIFF 3O3BB 5KS9E 1S5HA 3MZTA 3S7GA 1PX3A 5FCUL 4RNRB 4UAOB 4JFXA 4M48H 2J1KA 3S88H 3IU4L 3WIHH 4XPFH 2DJ4A 4OLUH 2A9ML 1MCEA 5TPWH 5FF6A 3CCHA 4R9HA 1A6ZA 2P8PA 3FFCE 3ESVF 3MXWL 3O3EA 4JHWL 5C0CE 3BD3A 4EBQL 3RVXC 3U2SA 1W0VB 1YNTB 2VXVL 4HK3J 5E4EB 1QNZH 3HAEH 4FG6D 1BIIB 2AEWA 1IGCL 2O5XH 4JHZA 4CNIB 1J0ZA 1XGPB 4CDHA 5I1IL 4LPTA 3C5ZC 2VDNH 4TSBH 5IB3B 1FAIL 5KSBA 5DF0A 1PSKL 3QUZA 4OM0H 4Q74A 4YPGB 5C3LD 4U6TA 1FIEA 3NAAL 4NGHL 5EOCH 1ZSDA 1DANU 4JQVC 4OQTL 5GGSA 3OPZL 3WLBB 3ZKMC 3S5LG 1JWUB 3ARXA 4EDXA 4LDLB 1YEHH 3D3VD 1LO3L 1CG9B 2FGWL 2N7BA 4NZDA 4P99A 3T09A 4M62L 1MH5A 4U1IA 4JB9L 1DUYA 1LO4H 1J18A 2MQ0A 5CUSH 2APWA 1QA9B 4MXQC 1NGZA 1T89A 1ZLVH 1QZ1A 4M6OL 3TCLB 4H1LH 3AU1A 1SEBB 4M7JH 3RJDA 4H8WH 4F33A 4BUHA 1U93A 3S36H 5DI8A 1BVLB 3ZT5A 3EFDH 2CXGA 1ZT4B 2C7UA 4U1MB 2LU3A 3C6SA 1FL6A 4AG4H 3K1KC 3HI5H 1J1PL 1JMZA 1WVZA 1OM3H 3RL1B 5DRNA 2C3VA 3LAFA 1NSNL 5FO8A 5L6YH 4DZBA 4DVBA 4IOIB 3VMPA 5KW9H 2UWEE 5ADOH 1BZQK 2DKSA 4G8IB 2DMCA 4HPYL 3BDYH 1FJ1A 5L88H 3DXAE 4MA3B 3EGSB 5L2KA 2NMSA 1XF1A 1Q0YL 4L3ED 3NTCH 4UINH 1A7RL 4Z76B 4Q6IB 4PREB 1SY6L 2X44D 3WS3A 2FL5B 1HXYB 2R0KH 3MNWB 1G6RA 2NLJB 1BFVL 4YWGH 1A7QL 4PRBB 1IEBB 2FJGA 3QHFH 3MLRH 4HULB 1OP5K 1XF5A 4K07A 4Y16A 4NKIL 3TO4D 3BPNB 2CK0L 5F7KC 1EDQA 1IC4L 5FECB 5JLZA 3B2VH 1WWCA 2H9GB 3OJDA 4MNQD 3WFZA 5T3XD 4L8CB 1VA9A 1IEAB 2Q8BH 4WI6A 4WUUD 4V1DB 4AIZA 5JPNB 1F11B 3O6FA 1F58L 1TCRA 3PQYB 4GBXD 5BOZG 5EC1B 5HI4D 4RMRA 1B0WA 4JR9H 1QTYT 4OV5A 1JTOA 2DLTA 2F54E 4RFNB 1H3VA 4NM8L 3CMOH 4Z7UB 1X5ZA 5M7QA 4ODUB 2PNDA 3KPQA 1X5HA 2HLAA 5JW5B 1LNUB 5C9JA 3P9WB 4U0RC 3NPSB 3EZJB 1AY1L 3MCKA 4LHUG 1X4XA 1MJUL 2AXFA 5IROC 2OSLA 3TNMB 3I6LD 4P2OC 1TTUA 1NPUA 1Z9OA 3W11D 4BK4A 1QFOA 4XP1H 3O45A 4GG6F 4E9LA 5I6XC 3HNVH 1NEZG 3LEYL 1M7DB 3SDCB 5D72H 4JFED 3ZDXF 5J3HC 2HYMA 3LY6A 3IDNB 3P2TA 4EOWL 4X80L 3O2WL 2ESVE 3M8OH 3E2HC 3AREC 3HN3A 2DI8A 3QIWA 2E6JA 2X4QA 1W8OA 4XNUL 1FLTX 2BOBB 2VLKA 1CL7I 4HC1L 2A6DB 1L7TH 3MLVH 4OD2B 4Z0XA 1HXMA 1S9YB 5EZOL 5I73B 1PBYA 4E41A 5GSVA 4GW4B 3WCYA 3FQUB 3IT8D 1ADQA 4K7PH 4ZFGL 1Q1JL 2WIIB 1G9NL 3ARWA 1M4KA 1FZKB 1ZA6A 5J57B 4NWUH 2YBRB 3ARDA 2VAAA 3RBSA 1U3HB 1INDH 2FCBA 5MI0B 5KVMC 3GBLA 4WU5B 1MRCH 1W72L 3ZDYE 4KV5F 4LNRB 4EEEA 1TXKA 5EU6E 2DQHL 5FO9B 2CDFB 4IHOB 4P23A 5DA4A 2A9NH 1JPST 3NH7H 3VWJA 3FB7B 4ZPTB 3OR7B 3G5XB 5DMIL 3RKPA 3MNVB 2XYCA 3FT4B 1S7UB 1J0KA 3OB0H 2V7HA 4L1HA 4X6CE 3QXTA 2EIZA 5C0BD 1BD2D 3L7EB 4J3XA 3NCEB 4RDQG 3VFRB 4QOKB 4HGWA 4HKZB 2XRAH 3EO0B 1LP9A 2PKDA 3W9DA 3BMVA 4MJIA 3NCMA 4YK4B 4OF6A 5EIQA 3O9WB 4UV7L 4XRCA 3FAWA 2C4FT 4PJIA 1WFUA 3EDEA 4LLYB 1MREL 1NGWA 4HUWA 4X6BB 4WHYH 3IDJB 1A4KB 2DQEL 4JM2C 4GUPB 2DI7A 4PRAB 4G3YH 3BGMB 2M8XA 1PYWB 1D5MA 4P4KA 4GG8B 3ARGB 4L9DA 5EU4A 3RIAK 4X99A 2GJ6D 2X1WL 4MA8L 1DQJA 1UQSA 2VLLA 5IIEA 4APQD 4M00A 1NDMB 2ICWA 2YUWA 4PGDA 2QHRH 4XCYB 1I85C 3DRQA 2I25N 3WFHB 3U48A 5I19H 2EYTB 2PW1A 1U8JA 1ULVA 3FO1A 4HIIA 3SDYH 1IVLA 3UPRB 3QEUA 1XGRB 3OKEA 4MMZC 2LV4A 3V6OA 4WV1A 3MLUH 3WFEL 4FFWD 3VXSD 4AEFA 3D69B 1X5YA 2VLRA 4Y19D 4WWID 4LCCA 3WJLA 1NC4A 1DFBL 2X1PA 4OZFG 1Y6NR 3RKDC 1JGLH 4ORGA 4OI9A 5D5MF 2V2WA 4KHTH 4LKXA 3MJ9H 1UENA 2IMMA 2F5AH 1CICC 1T6WA 4J2XA 2AJUH 1CDBA 3BHBB 3MRQA 2MPAH 4PJDA 2ZPKH 2AXGB 2ZCKH 4M1CC 4AL8L 5C0EA 1LO0L 1NJ9A 2H1PL 2AK4B 3OX8A 1GZPB 5ANME 1X6LA 1NCUA 3SKMA 2P5WD 3L5WA 3T2OA 4L4VD 2E7LC 4Z7VE 4OM1H 3CNKA 3WLWD 4LL9A 4OGAC 1AJ7L 1YN6B 4HT1L 1MPAL 4O2FA 2SEBB 2NY1B 5BO1L 5I76B 2EH7L 1FN4B 4PRPA 3RGVA 4GO6B 4CW1B 4KK8C 2A9MH 1FVEA 3MRGA 5J0BA 1QSVA 1CXIA 4S1DD 3OXSB 9CGTA 3V2AR 3ZE0E 2DQCL 2YUVA 3A67H 3HA0A 1DSFL 2NY5L 4PP1D 3VFMA 5FA4A 1HQRA 1U8NB 3RVWC 5DK3A 3C8DA 2HT4C 2EE6A 1PSKH 4H0IA 1EUUA 3FQNA 1NGQL 2I9TA 1GIGH 1D5ZA 3UAJC 5LWYL 2DQDL 3BO8B 3BZDA 3TP4A 3MA7A 5HD8C 5DEGB 1M71A 1E27B 5TGBB 1KTKE 5DUML 2WBJC 3LQZA 4Q9QH 5DMGC 2HRLA 4N8CH 4EUPA 1SYSA 3D25B 3O3BA 4M1DH 4XXDB 3QCUL 4M8QB 2JELH 2VAJA 3WO3B 2F53D 5F9JA 4PUBL 2XICA 4RNRA 2PXYA 3RWIB 1FVCA 5TH2B 2LAGB 1W0YT 5CD5C 1DLFH 2PR4H 2Y5TA 1PFCA 3EDFA 1CL7H 2CRIA 2AI0H 4RA0C 3GHBH 5D1QB 1A1MA 2LVCA 3SDDC 1WIUA 1RIUH 2K7PA 3O8XD 2VOTA 1W0VA 1YNTA 2Y07H 2WLYA 3G6JE 4XNYL 3IFLL 3GM0A 1XR9B 4XC3L 4OCSL 2AKRB 4LIQL 1YZZA 3EAKA 4YPGA 2AQ3A 4XVSL 3U30B 3PL6D 1KT2B 1YA5A 3IS0X 3HE6C 5E94A 1JWUA 3TZVB 3HZYA 1Q0YH 3FN0H 4HD9A 3TNNB 4C4KO 5GGVH 1A7RH 3UBXI 2D03L 1GC1L 1SY6H 1WGOA 2CO7B 1AC6A 5A16A 1RZ7L 5HYIA 5DC0A 1S3KH 5EOCJ 4WO4A 5EDXA 4R96B 2YWYA 4EJ1C 1YEDB 1RIHL 1JPSL 25C8L 1BVLA 4WCYH 3S97C 2IH3B 32C2A 1VGEH 3GI8H 1QO3B 4I77L 4U1MA 1AGCB 4NQXB 3V4VL 3K4AA 2R2BB 4ZO6A 4R8WL 2DTSA 1IC4H 1VADB 1FV1A 4XNMB 2VZVA 3RL1A 4M6NL 3W0WD 4K8RD 4LVHB 4HBCH 1RK1A 4WEBL 4LSRL 4WHTB 3FHQA 3VFPA 4YDIL 1TPXC 5DRWB 3UTZB 5JORB 1F58H 4IRJA 3MGAA 3BPCB 1J8HB 4MA3A 4LEXH 3EGSA 4DKEL 5ALBH 1LDSA 3HUJF 3MLWH 4IIQA 3VGDA 1MAKA 4PREA 1A2YB 3RY4A 3LS4H 2J5LC 2Z4QA 3IFNL 1HXYA 4FQCH 3MNWA 5GS0C 3F7YB 1B2WH 3QDGB 2E8YA 4WW1A 4NQSB 1R5VB 4PRBA 1IEBA 3JBG7 1AXTH 4I1NB 4J1UB 4P5KB 4MHHG 1Y18B 5CEZL 1I9RH 2PW2B 2EEBA 1N3NA 3D1MC 4O58L 1AGBB 5FOBB 5HBBA 3H7BB 3PXJA 5FECA 4X7SH 4Y16D 5MENA 4LLDB 5T1KA 5ID1A 3GJFK 3GMNA 1IEAA 5IVXB 4HJ0C 4JKPH 2CDGB 1JZ8A 1UM4L 1RU9H 1U8HB 4NM4H 1U8LB 3PQYA 4DN4H 1T03L 2VZ1A 3F7VA 3O6FD 2Q3AA 2V5MA 4JFOB 3ULVE 4NP4H 3V9FA 2Z8WC 2ZKHL 1JN6B 4Z7UA 5D96C 3FFDB 3U79A 3EJZC 5C09E 4ODUA 1B0GB 1PX4A 3LRSB 3V95A 1LEIA 1R3LB 5JQ6H 1OLLA 4NKDB 4XBEL 3G6AB 5DC4B 2VC2H 3NZHH 3TNMA 3RHWK 1VB9A 5F88B 3L9RA 3HNTL 1QRND 3HMXH 2I5YL 3VXRD 2VERN 5T5FL 5HYFA 3EUUA 4KI5F 1RHFA 1MI5B 3GRWA 3H6JA 1UJTA 4PRHB 5ESAB 3RP1A 3SE4A 2BOBA 1JWMB 4LHQB 4G7VH 4F7EA 1IQWH 4QWWC 3PDGA 1BJ8A 4ODTH 1JNNL 4A2LA 2IANA 2VLKD 5AAWA 3RNKB 4Z7WB 2JTDA 1FZKA 2I9LB 4E41D 3ARBC 2YBRA 5HXMA 1XZ0A 2XN9E 3U7AA 3UTPD 5J6GA 5D7SL 2FHBA 2ZNWA 1F3JA 5E8NB 2BC4B 4LNRA 5DYOB 5HHME 2Q3ZA 1TVBA 4XT1C 4Y4HB 2BMKB 5FGCB 2CDFA 4Y5XC 4GOSA 4IHOA 4MCZB 3W81A 4JAMB 2VE6A 2IAMB 4X0KB 1BBJB 4K2UL 2V2TB 4QTHA 3FB7A 4ZPTA 4G5ZH 5DVOA 4Z18A 2E9WA 4L1DA 4HS8L 4KZEL 1OT2A 3MNVA 1S9XB 4Y4KC 1IM9B 3TBVB 1WFTA 4XBPB 3FT4A 1CT8A 1S7UA 3MLZL 5MERB 3BP4B 3MJ7A 4PJAA 4K9EC 5D2NA 1QVOB 3VWKC 2XQBL 3WFEH 1GAFL 4N1EA 3L7EA 4YHKL 1XF3B 1QBMH 2WW8A 5CEXA 4QOKA 1CFBA 4HKZA 3DX6B 3EO0A 5IVZA 3KYOB 3QULB 2X4SA 1WFOA 1JNLL 3LS5L 4BFEA 5EH1A 3E3QE 4YHOL 5HYJD 2H2PC 3LEXA 4PGEB 1Y6KR 4OCNC 4X6BA 5EU7E 3X3GL 4JHAH 1A4KA 4OCLC 4ZODA 4MS8D 1FBIL 5I1HL 3BGMA 3JV4A 3T65B 4UNTA 5C08E 1PYWA 3WUWA 5KS9B 5FV1L 4Z77B 1F4WH 1RUAH 5B38A 1NCWL 2AXJA 5E6IC 3BJLA 4KTDH 3OJVC 1EFXA 3QDMA 1HSAB 5D7KD 3WFHA 5C2UB 4QTIL 4DGVL 2P8LB 4YEEA 3GEWB 2K7QA 1PY9A 2VZUA 1XCTB 2CD0A 5DJZB 3VXMD 1U42A 5FKPB 3HG1A 1OP3H 5CBEA 4ZFZA 1ZVSA 4PRIE 2Q20A 1Q9WA 3QQ4A 1CN4A 3I02B 1K2DB 3CMGA 1ZHKB 3C2AH 2VLRD 1VEOA 2AJZA 1S7RA 2YRLA 2CRZA 5DJDA 5AAMA 1IZJA 2NY5H 3O2VH 4UILL 3V6ZA 2VDOH 2EZ0D 2ATPA 4NT6B 5I30H 1MRFH 3MRFA 5IMOA 4HWEL 3ZTJG 4LLWA 1YECL 4X98A 1MCOH 2XTJC 3BHBA 1HCVA 5DJ2B 1N64L 2D7TL 2EDYA 4UIKH 3TIEA 1XGYH 2EDQA 4GSDL 1G9MH 1WIPA 3RIAF 4HXAH 3U7YH 5E1AB 2R2EB 5HHQB 5IOPA 1KJ3H 3VGAC 3WNMA 5IEHA 3WUZA 3ARFC 1DUZB 5CIPA 2OTWB 3FO9B 1T21B 5MEOB 2EXWC 1KCVH 2GFBA 1PG7L 1MFCL 3QIUC 2B1AH 4HWBH 4D9QD 3CSYA 4U1GB 1YN6A 4M03A 5I76A 1ACZA 4CW1A 1IAMA 3LN5A 2AV1A 2IWGA 3C6LB 3GDBA 2UWEB 3D0VB 5J12C 4QHLA 4LCUA 3C5SB 3CFJA 4YFLI 4MAYD 3ZE2E 4B41A 2OP4H 4KJQD 3QO0A 5F3HB 3QR2A 3QWQB 3UP1A 4U6XB 3HS0A 3HNSH 1T3FB 2P24B 1RULL 1T7YA 3HB3C 4WFEE 2YK1H 1N0LA 1AE6L 4XVSH 4ODXA 4BQ8A 3BO8A 4Z8FL 1V3KA 4QXTB 4XNQB 5DK2B 3OGOE 3SQOL 1E27A 4M61B 4UTAH 4GW1B 5JHDD 5J9PA 4L8SA 2J6EL 4PG2A 1C5DB 4PJHF 3U1SH 4OAWB 1MLBB 3MBEB 1HQ4A 5TH2A 2JJVA 5BJTB 4GRWH 1QP1A 4HFWB 1JPSH 25C8H 1FYTB 4DUXA 4M5ZL 2QLVB 2KZWA 1YC8A 4KKLD 3PGCB 5D1QA 5FHBL 5HSFA 4FTVE 1WZ1H 3QRGL 1N2RB 1LK3H 2ED9A 1JCKA 2J2ZA 2NYYD 1U6AL 4R90H 3FQXA 1I9IL 5GRYA 3MRCB 4PJEE 5BVPH 3TA3A 2AKRA 4CU6A 3G5VB 3OAUL 3TCXA 3E6FB 2GEEA 1XF4A 5I8OL 3TZVA 3V5HB 1KNOB 4OLVL 4QT5A 3TNNA 3HHRB 2J4WL 3O6KL 3QI9B 1DVFA 4H26B 2ICEB 1RMFL 1EZVX 1X9QA 5IBLD 5IP4A 5FK9A 3FCTB 1RZJH 3V6BR 1IGJB 1C12B 2Q7YA 2H3NB 4R96A 1R3IL 4JO3H 4XI5C 4E5XB 1HH6B 2ZUQC 1FIGH 2XIDA 5TDPB 4S1RL 4KWUA 4PD4J 4NQXA 3UZEA 2R2BA 3DX8A 2ESVB 1VADA 2O5YH 1X5LA 3KPLA 3QQ9C 2O5ZH 3CGTA 4K3EH 2NY0C 4P5TB 1OAQL 5DRWA 1YY9D 3PGFH 2EDKA 5JORA 3K1DA 5DGRA 1J8HA 3ARVA 3HI1B 4N0UE 3HCVB 3GBML 4ZS7L 2V9TA 4JRXE 4X8JA 2KBGA 2NY6C 2XT1B 1CGSH 3BDXA 3WIIL 1N8ZB 4JPVH 1KB5H 4IDJL 3F7YA 4R26L 5EU6B 4J1UA 5IHZA 4P5KA 1Y18A 3BKML 4IOFD 1MF2H 3BZEB 5DT1H 4ETQB 5KZCD 5TE6H 4JREC 5BRZE 2Y23A 3HNTH 4LLDA 1V3JA 5IVXA 1BGXL 3M45A 4NZRL 3VRJA 3OWEA 3SO3B 3ZKXC 1EAPA 5IVNA 1U8LA 1Z6JT 1GZQA 1L9MA 1TJGH 4ZNEA 5CHNA 5I1AA 2HFTA 5HGAB 4V1DD 5DVKA 3KYKL 5F93C 4JFOA 3PQYD 3O2DH 4DN3H 1RK0A 5EO9A 3MJ8B 1FP5A 1TQCB 1JN6A 5BV7L 3LKRB 3LRSA 1DQDL 5ISZE 2FECL 5D7JC 4NUGH 4Z7OE 3I50L 4ZTPH 2MKWA 2J8UF 3HAEB 1WAAA 1QQDA 3G6AA 3L6FB 1INQB 5A2LH 2VDKL 4A6YH 3O3AB 2FO1A 1UWEH 1C7TA 1QSFA 5F88A 2WAHA 3N1GC 4IM8A 3DUSB 1PZ5B 3R4DA 3IDYB 4GH7B 2NNAB 3SE3A 4PYGA 1FFNA 5AEAA 1G84A 5F7FA 3U4BH 4HF5H 1H0DB 1T1WB 2A74B 4HS8H 3C8KB 4JRYE 3W39B 4AEHL 3BGFB 4H1LB 4PRHA 3SDCD 4XPHH 1MJ7H 3CDFA 1ZLUK 1NMCB 5B4MC 1MCPL 4X7EC 1EH9A 1SBBA 1JI2A 3MV9E 4MX7A 5DZLA 3GUTA 2UUDH 1YYML 5LQBH 3I6GB 1P4IH 2VXQL 4YHYC 2V6HA 1TJHH 5E24E 4CDGC 4LLAA 5DRZA 4JPIB 1PAMA 3BW9B 3GJEB 4Z7WA 2I9LA 3AXLA 2D31A 1E6JL 5D6DC 4F9PC 4OZ4B 3TBSA 2BHZA 3B9DA 4RGOL 4B5EA 5ANMB 1E4XH 1A02N 1FCGA 3WMSA 5E03A 4P46C 5E8NA 2BC4A 2RB8A 2NY2C 4OCYL 1DL7L 1WF5A 5DJXA 5DYOA 3RHWF 2YD3A 1U3HD 2J7LA 4CMMA 4Z7VB 3IETB 4KJPD 4RZCB 1FGNL 4MCZA 3QPXH 4JAMA 5IFHL 4X0KA 1BBJA 1I3GL 3QA3A 5J1TC 2AJSH 4UDUB 5IW6A 2OLDA 2LU7A 1VGKA 4M3JA 1MCBA 4XBPA 5IHUH