2OZ4L

Structural plasticity in igsf domain 4 of icam-1 mediates cell surface dimerization
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
214
Chain Sequence
b'DILLTQSPAILSVSPGERVSFSCRASQSIGTSIHWFQQRINGSPRLLIEYASESISGIPSRFSGSGSGTDFTLTINSVESEDIADYYCQQSNVWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intercellular adhesion molecule 1
publication title Structural plasticity in Ig superfamily domain 4 of ICAM-1 mediates cell surface dimerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 47
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2007-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oz4L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oz4L01
3UBXI 3QUMA 1XCQB 1XH3A 4QRTA 2CIIB 1J86A 4NO5A 5HYQA 2IC2A 4IRSB 1P4BH 3QCUL 5FOBB 4P2RD 3GSNL 5EPMA 5FB8B 5E6IA 4Z77A 4FQPA 3U0WL 1P69B 5DRXA 1WC7A 5GRYA 5D2LB 3OV6A 5IB1B 4UINL 3H0TB 3QPXL 2DD8L 4HGWB 1R3KB 5EA0L 1DEEB 4LCCC 1JPFB 5C7XL 2KZWA 4FQCH 3NPSC 1NCAH 1NC2D 5F72S 4ZUUB 1JPST 1MCLA 5EC2A 5D9SA 2NY6D 4NRZA 5DJZB 4XP1H 1A1OB 2VH5L 5GGUB 3VD5A 4ELMF 5J6HA 2JIXB 3MRBA 2DI7A 1XGTB 5GZOD 2FGZA 2ICES 2FNBA 3VG9C 5ILTL 3IJSB 2ZUTA 5I16B 5D7JC 1SY6L 3LV3B 1D7FA 3KDMA 3M1BA 4YHIA 2VITA 5JTWA 4HIJA 2BCKB 4XTRC 2FSEB 4LK4A 5MERA 4F2MB 5J1AB 1RFDL 1WIPA 1OAYH 3D2UD 2EC9U 4CUCA 2DQTH 4OFYA 1NUGA 1AFVH 1NEZA 2XACC 3C8HA 2HRPL 4KQ4L 2ENSA 5F3BB 4MA8H 1VADA 4H0GA 1NGPL 2OR7A 2BNRE 2EKJA 4OCRL 1Q38A 2YZ1A 4BSWA 4PP1C 3VFTA 4QT5A 4DFIA 5KN5B 1BD2D 2DF3A 3O8XD 4R96A 4XNQA 4Y4KC 1I7ZB 1BQLL 3ULVE 5HY9B 1M7DA 2QL1A 1JZ5A 4E9LA 1I1AC 3MBEA 5IB5B 4GW1B 4POYA 3FO1B 5IBUB 3TZVD 2NTFB 4N1EA 3PQYD 4Z76B 1M05B 1HSAA 1FIGH 1WFNA 3S36L 1RV6X 2C3WA 4IOIB 1JFQL 1U91B 4Y19A 5C0BE 2V9QA 1OF2B 3MV7B 3MLPA 1R3LA 5KSVA 1D9KD 3B2VH 3K80A 2YD4A 4WFHD 1T0MA 2VXUL 2GCYB 1QSFA 2CKBA 3RTQD 4O58L 3RWEA 2KKQA 3G9VA 4X7EC 4Y1AE 5LBSH 1Z2KA 3GSUA 1KCUL 2IH1B 1NJ9B 1I8MB 4HQQH 2XKNB 2IANE 3U30C 4JFEB 1K3IA 3LHPL 1G7PB 5KSUB 4Q9RL 4ENEC 4GRLD 4JO4L 4MXVE 4APQC 3QCUH 3GSNH 1IC7L 2DQDH 3U0WH 4MDJB 5CEXA 1MJUL 2AEPL 2ZKHL 3VG0H 4WWKA 3KYNA 1A3LL 5C3LD 3BD3A 3QPXH 2DD8H 5EA0H 4ZAKC 2MJWA 1L9MA 5MI0C 3MUGB 4LEXH 5EZJB 2CDFB 3FQUA 2OQJB 2GITA 2AKRA 1QLEH 4PJ7A 3DVGA 2VH5H 3TBWB 1FZOB 3TO4A 1H8NA 3TV3L 1HQ4A 4PGEA 2VE6B 1U41A 2FBJL 5IFJB 1Q8MA 5ILTH 4BH7B 4OD2B 3BESR 1SY6H 4N0UA 3KYMB 3QIBA 3N06B 1MJ8L 5IG7A 4MWFB 3R4DA 3MRRA 4MS8C 3IDNB 3MV8D 5DMGC 1UQSB 2BK8A 5DZNA 2PTTB 2Y9RT 5TDPB 4K3DL 4GG8B 1A4KA 1QVOA 3ARUA 3DV6A 4C4KO 4P2QD 3JV0A 3BUYB 2YUVA 4JZNA 4MD5B 2HRPH 4KQ4H 3RVWC 2WM0A 4N90D 1IEBA 2ZSWA 3AAZA 4L8CA 5C0BB 1XF1A 3UZQA 4OCRH 1N7ML 4HKZB 1CGSL 4LGSB 5DURD 4MLSA 3T1FA 4WRLA 2BVPA 5F8QC 3W39B 4YDIL 1T1XB 5GHWH 3ARQA 1CGTA 4WFGE 5A2JH 1EGJL 5FA3B 1JI2A 4Y1AB 5B4MD 1UH4A 3V0VB 4ZFZB 2IANB 4MCYA 3VMOA 5DK2A 3H7BA 4KI5F 1YNKL 3H9SE 3S36H 1OP9A 1IAOA 1WWCA 4JFDA 4TVPL 2VR4A 1JFQH 5I8KH 2DIJA 2DWDB 2XTJD 3OL2A 4FS0A 1BJ1H 4P46A 3ARSA 4NN7B 1UXWA 1DDHB 3BJ91 3SGKC 2WQ8A 2VXUH 4FQXC 1IGMH 4C56E 4OV5A 3L7EA 5T33L 4JRYD 3X12B 1LK2B 1ETZA 3QQ9D 3NIGF 3VFNA 3IF1A 3GGWA 4V1DA 3CUPA 3LKRB 5L8LB 4XVUD 1EJOL 4GRMA 4I4WB 3LHPH 3EYVB 3S37L 4G6JL 2KQNA 4JN2A 4JO4H 1QRND 4H5SA 2GI7A 1IC7H 2OJEA 4HX1A 3KHOA 4CBPA 5CKGA 1MJUH 2YEZB 3NFSL 4PRID 4NBXB 1HDMA 4OCLC 4FOMA 4BSJA 3G6JE 3BIKB 4DZ8B 3A6BH 3N85L 4O51B 2UV3A 4PJXA 2E7CA 4HGMA 4U0QB 4YR6B 4JFFE 3HLAA 3WKML 3TV3H 1U8IA 3GJEA 3LH2L 3TESA 5E56A 1KCSL 5EWIH 5ITBL 1OPGH 4AQOA 3BP6B 5J1TC 2FBJH 5I8CB 5MHSD 4JDTL 3C5ZC 3KWWA 5CSBA 3TBSB 1W0VB 1NMBL 2MQ0A 2XA8L 5ALBH 3FQRB 4DCQB 4WHCA 2CKNA 2C26A 3RKDC 2VISA 1K5NA 2Z92A 2WBJA 1CYGA 1OAQL 4LCUA 3S4SA 3UTPD 1JMZA 1ZLSH 3UMTA 2DQGL 5T3XL 5LQBL 4K3DH 5DJXB 2P5ED 3U4EB 3M17A 1VFUA 3EYQD 1MHCB 4Z7UE 2J4WL 4HS3B 1SMOA 2XOTA 1MRFL 3WN5C 3A6OA 3BHBB 3O0RL 2PN5A 4X7DC 2XQBL 4EN3B 3QDMD 3S34H 4MVBD 4WI5A 4XPFL 4YDIH 4CMHB 1KTKE 5MEND 2A6IB 1FNGB 1EGJH 3RGVB 2NX5D 4GRWE 3V6BR 1M7XA 1D5BA 5ICZB 2ZG1A 3IVKA 3A0OA 1WZ1L 5D7KE 5HI5D 4EXKA 5F9JA 2YR3A 3ARGC 1PY4A 1N26A 1GC1H 4TVPH 5HHVL 4IRJC 3DRTA 3KYKL 3RU8L 1B6DA 4JFXB 1DQQB 1JK8B 5ECJE 2P49B 4OJFL 1FVDB 2E3VA 1T04B 1AD9B 5DGRA 3HI1A 5BJTA 2H26A 5T33H 4X6DA 4X9BA 3SDCB 2Z35A 1EHNA 5DK0B 2EE2A 1MJ7L 2D0HA 2VQTA 1EJOH 1NCCH 2YN5A 3S37H 4G6JH 4L3CA 2MNUA 3GUTB 3GBML 2FHFA 3OPZH 2GEEA 3NFSH 3QO1B 1NKRA 4DQOH 2CLVA 2PETA 4KRPC 4GMSH 1A6VH 4JKPH 4GBXC 1LEIA 5HYJA 3L3KA 5D7LD 3WKMH 5CUSL 1B0WA 4Z7UB 5ITBH 1DVFB 3O6FA 4M1GH 1N0LA 1LO3H 4HUVA 1NMBH 2J6EL 1JTPA 1FAIL 2XA8H 3QIWA 3WIIL 4M93C 3LKOB 1IAMA 3GO1L 4LP5A 3IAPA 1F5WA 1JGVL 2DS4A 4GRWB 4LF3A 2M2DA 2X5PA 2DQEH 2FO4A 3V5DA 4JPIB 2B2XL 1CDHA 1FHGA 3WNOA 3TP4A 1IM9D 1GAFL 4X80L 1JZ3A 3ARBB 1ZVYA 3IKKA 4QF1B 1CE6B 3ARRA 2V2XB 1PEWA 4M5ZH 4HSQA 1Q9WA 4P4KC 4BFIA 3O0RH 1KPUA 2FWOB 3SGEI 3AFLA 3RI5K 4HDIA 2YPLA 1HEZA 5CLWA 4XPFH 5BV7C 5HDLA 1AJ7H 3ARFA 4KK9C 4GLRI 5JMRA 2R4SL 3TWCH 1J5OL 4LVEA 2PR4L 1WZ1H 4TTDC 5CBEA 4XI5D 5ERWB 4KK8D 4U3XA 1AXTH 1OARH 3L3JA 5C0DA 5HHVH 4P5TA 3MODL 3KYKH 3RU8H 5HSFA 3VWKC 1YDPA 1M4KA 4OGAC 4DGVL 1H15A 5CMAA 2XN9A 4OJFH 1G0DA 3D18B 4CVXA 1OTUC 3PJSA 1J18A 3HE6C 3O4OC 4ZUSB 3MNVA 3VE0B 1U3JA 3KJ4B 4IJ3B 3W9EB 1MJ7H 4DGYL 4RZCB 4MQSB 4ACPA 2D31A 4M7LL 2V5YA 2Z91A 3CVHA 3MJ6A 4XRCB 1MFEL 5CILH 3O9WD 2VAAA 3U4AA 3WEXB 3DX6B 2IBZX 4OCWL 5ACZB 2OL3A 3NPSB 4X5XB 3IDYC 1PJ9A 5EIIB 5CEZE 3AM8A 5A2KH 1FSKC 4XVSH 1T7WA 3IETB 4KK6D 3QXVA 3V6OC 1I9EA 5FUZL 3VDAA 4NKIL 1INQB 1S7UA 4HAFA 3SBWC 3MV01 4PJ8B 4NC2B 2BDNL 2J5LB 2J6EH 5TFSL 3JUYA 4FXLA 4U1MA 12E8L 1FAIH 2VC2L 1TNMA 3M8OL 3QUKA 3X3FL 4HBCL 4KVCH 5IFHH 5K9KB 1J8KA 5E24E 3HI5L 3DX8B 2B1AH 1JGVH 1E4KA 5DHVH 4PJDA 2NYYD 3KXFD 2NW3A 2OMBA 3ZKNC 5ETUB 2VABA 3T0WA 5CIPB 4QRPD 2ZUXA 4NKMB 2XWBA 3TJHC 2G2RB 3NN8A 2YWZA 3B9AA 3ETBF 3GZKA 5F7MC 5KS9B 1I8KA 3QG6A 4KH2A 1AGCB 3IU4L 3Q2CA 1U8KB 1K6QH 3BDYL 4P2OB 2XG5A 1RIUL 4XP6L 1V3LA 4YK4C 2R4SH 1XGUB 2FECI 4LVHB 5E8EA 1LEKA 2PR4H 3RL2A 1A1NB 4LNVA 4J4PD 1HXMA 3VXTA 1VHPA 4IBLT 4NQSA 3BE1L 4ORZC 4ESKA 3ZT6A 5CJXC 4FXGB 4PS4L 3G5VB 1RJLB 5J11C 2ZOKA 4BFBD 1DN0A 4DGVH 1JPSL 1A21A 1Y18A 1HNFA 2IQAB 5I17B 5F3HA 4Y16B 1YMMB 1ND0B 1U2HA 1EV2E 3U30B 3MOBL 4APQB 3O4LE 2F74B 3WS6A 5I2IB 1FAKT 4Z5RA 2JIXD 4C55A 4NKDA 3DYPA 1QLFA 3QHFL 5BS0D 2KPNA 4OCWH 5D8JL 3LKSB 3EHBC 1NKOA 1IC4L 3QSKB 1UCTA 3GSOA 3VXOA 4TNWF 1LVEA 2DBLL 5FUZH 3L3IA 2BVUA 4L4VE 5JHDA 2VLRA 5FYJL 4GKSB 3QULA 3SKOB 5JO5B 3EOTL 2BDNH 1MCWM 4GAGH 5A2FA 4MCZA 2VC2H 3AY4A 3M8OH 2D0GA 3Q5TA 4IOFD 3ZZ1A 3X3FH 3VGAC 3ZTNL 4ZPTA 5HGBB 3HI5H 4JDZA 1XR8B 1S9WB 4MJIA 4JKWA 4LPCA 4HWEL 4HULB 4DUVA 1YA5A 3CLEL 2HT4C 4NYLA 3BP7A 4PRHA 1UGNA 1E4WL 4LNRA 3VGEA 5CWSB 3IU4H 3MV7D 4Y5VC 5CZXC 4BUHA 1RIUH 4BSVA 2RIKA 4FP8L 5GIRB 3VXNA 3VGGA 2HT3C 4UIMA 1Q9LA 2I9TB 4N8CL 5D7SL 3B6SA 3NTCL 4GXUN 1YQVL 5GS0L 3O4LB 4KUZH 3QWRD 2IQ9L 2IAMC 5BVJA 3U46B 2GUOA 3OSKA 1C08A 4PS4H 1A7QL 4JFED 1BQHA 1FFNB 1ZT7A 1G9NL 1SBSL 1QBAA 5IVZA 4FQXB 5D6DC 3X13A 2P8PA 1TPXC 1JTTA 5CGYC 1JN6B 4N0YL 4N9GA 4KTEH 3L3OA 2XICA 4RSVA 4OGYL 4KJWD 3FRPA 1YEHL 3RIFK 1W72B 2BSTB 3FO9B 1SY6A 3DO3A 3WJJA 2BSRA 3O6LH 3D2UA 4MJ4A 5GGSA 1MAMH 3I50H 1RZKL 3QHFH 4HT1L 1EH9A 1VGKA 4MNGA 2NY4B 3C6LC 2MCPL 1NH6A 3QBTB 3SKMB 4YPGA 5IVOA 3FOMA 4PGDB 5ENWA 3CZFB 3QEQA 2EE9A 3L5IA 5DTFB 1RU9L 1MRCL 3R8QA 1LE5B 3ULVD 3RWHB 5FDWA 1H3WM 3O3AB 3C5ZB 1INDH 4JDVB 5FEBA 2RCSL 5FYJH 2ZNWA 3P4MA 3BGMA 3EOTH 2FATL 5DJCA 3TZVA 2EO9A 3N1GC 2ATPA 2XPGA 3ZTNH 5C08E 4NQXB 2OXHA 2CXGA 5D2NA 3E6FA 5JQ6H 4LRIC 2ID5A 2ITCA 1SM3L 4LLWB 2K9UA 1D9KA 4EUPB 3BW9B 1I8LC 1UM6L 4FG6C 2L0DA 2X4SB 1HHIA 3WN5B 2V7NA 5BZDA 3WS3A 3RTQA 3STZA 3F65A 2VXQL 5BQ7B 2FJGB 5FGCB 1A7RL 4CADB 1HQRB 5FHAL 3ULUF 2Q86A 1JV5B 3CDFA 3DETD 2AEWA 1MCWW 3VI4E 4NO2A 1F6LL 4PJDF 3MRLA 1IAII 4JO3L 3B43A 4FP8H 4RA0C 1KJVB 1LDPL 2CDGB 15C8L 2NY5C 1QEWA 3IKCA 4QNPE 1RZGB 3ARGB 2GY7B 4WO4A 1AGDB 2HA1A 1FJ1B 4Q0XL 5DJ2A 3QT2A 1MCKA 1Q0XL 4JRXA 2Q8BL 3PIQB 4OTXL 1BBJB 2X09A 2VIRA 5AUMA 5TH2B 5B8CB 4FQQB 1G9NH 4LPXA 1F11B 1T20B 4Y5YC 4LSVL 1I9JL 1UG9A 5C0FB 4OLZH 4N0YH 5IR1A 3MLRH 2BRRH 3MMEB 2A74A 2VKXA 5EU3A 1H3TA 3MSPA 4J1UA 1U6AH 1GGBH 1R5WA 4PJIA 1N0XL 1YEHH 1A64A 4U1IA 1ACYL 2CLZA 2PTUA 4J3WA 4KV5E 3OHXA 1RZKH 4HT1H 1T83C 3CFDB 4P2QA 3VMNA 2MCPH 3WDIA 4ZPVB 1DQJB 2DIBA 4KRPB 5EH1A 2YC1A 2EIEA 3O3EB 4U7KA 1IL1B 4U1GB 3NH7H 5IMKB 5JW3H 1RU9H 5AYQA 1MRCH 3MRDA 2Y36L 4RWYL 2ORBL 1T22A 5C0ND 3CPLA 1N64L 4X9GA 2FATH 1GPOL 1BFTA 4M93B 1HHKB 3I6GA 1HXYB 4U1KA 1E4JA 1EGJA 2F54B 2X1PA 1DQMH 2PTVA 1QG3A 4OQTH 1T1ZA 1RZJC 4EN3D 3ZHKA 5DJAA 2PXYD 3G08B 1BHGA 1SM3H 3S36X 1YEDB 3O3BB 3PDGA 4P9MH 1UM6H 2AW2A 5D1XB 3RNQB 5MEOA 2Q76A 5DDHB 2ENYA 1QHOA 4Z7QF 3OWEA 3U1SL 1A7RH 2C4XA 5FHAH 3HC3L 4OT1L 4WV1A 3TCLA 1B4RA 3RX7A 5A16B 1QRNA 1M7IA 3ZKXB 4JO3H 5GPRA 1U8MB 1LDPH 15C8H 1FG2A 3MXWH 2EDJA 2IF7A 4I0PC 1JPGB 3UX9B 3SDCD 1OP3H 5E70A 2ESVE 1NBZA 1Q0XH 3BZDA 4HKJB 3O11B 2Q8BH 4OTXH 3THMH 5KVEL 1SMAA 4HIHA 1CFSA 1I1YB 4I3GA 1V7MH 4M1CC 1KPRA 1L7IL 4FXKB 3EJYC 4LSVH 2AS5M 2GK0A 4G80A 4P23D 1MFCL 3WUWB 5D1QB 4ZTPH 4EDWH 2WIIA 2QSCH 4ZFOL 4YHYC 4PBXA 3BP5A 5E9DB 3O6KL 3PV7A 5C71A 4L3EB 3KHQA 4RGNE 1E27B 1NUNB 4TUOB 1DVFD 2QQNH 1S7WB 4GAYA 3PWVA 3GI9L 5CHNB 3LQMA 4LSUH 3PGFL 4Y2DA 5GRZA 5DMYA 5L9DH 1F45A 5EU6A 3ZTJG 3KPNA 4F7EA 4N5UA 1A6TB 4M43L 3T04D 3W11D 1GGTA 4DN3H 1QSEA 2OTWA 2ORBH 1QR1B 2BRQA 3F7YB 3QNYA 3RRQA 4CU7A 1J7VR 1N64H 1GPOH 2R0LL 3QAZB 1WV7T 5IB2B 3PGCB 4D3CH 3RZWA 5HI3C 4C83B 1J12A 1LO2L 2QV2A 4KZDL 3TA3B 5I8EB 3SY0B 1FYTA 3H42H 5C0IB 5EC1A 4NGHL 2OCFD 3W2DL 3RY6C 4X9IA 3TBVA 4FQHB 1MHEB 5GRXG 5EUOB 1BZ7A 2HJFA 1U8LB 2XZQL 3U6RA 4PV8A 1UJ3B 1RK1B 2YSSA 1OGAA 1YMHA 2VQ1A 3IJHA 2AJSL 4Z8FL 3U1SH 4FZEH 3V95A 4QXUH 1KEGL 3MLVH 4OT1H 4HWZB 2RJMA 3IFPA 4NCC1 1T1YB 1KLUA 1TTFA 2VRAA 2V2TB 1RUKL 3OB8A 1IGCL 1NANH 1YYLL 5E1AA 4LCIL 1NAMB 3S37X 5M94B 3RUGA 1DL7L 3HUJE 4RNRA 3B9KC 4N0FA 4KXZI 3C8KB 2X6MA 4HH9B 4RGNB 3S98A 1J05A 4F15C 1KOAA 4GS7C 5SX5H 2BVQA 4F8TA 4JGMA 3ZYZA 5JIIA 4PRAB 1BVZA 1BOGA 5L2KE 4F7TB 4IIQB 1MFCH 1PGRB 1WGOA 5SX4H 5B38G 4LVOC 4AK1A 1ZHKB 3VFSB 3WFBL 2Y6SC 3KPMB 3MV9A 5IJVA 1FL3A 1N5YL 3O6KH 4W81A 5DRZA 3P4NB 5FGBC 4DOHB 3CFIC 4JLRA 4ZDHB 2EYTA 1G84A 5E6ZA 3OB0H 1T0PB 3PGFH 4MDIB 1IM9A 4PJ8D 3TVMA 1ZS8B 5DHVA 3BKML 5EBMA 2FGWL 1WEJH 1WBYB 4XTRD 3W0WE 3DUUA 1KIRA 3ZDYF 4XNYL 3ABZA 4M43H 4X4XB 4PR5B 4PJIF 3CFBB 4CMMB 5DYOB 1JWSB 3IXAB 1UXSA 1LK3L 4EIGB 1NGXB 4D0CA 2OLDA 1U93A 4QCIA 4OFIA 3HNSH 3UBXG 5BXFA 1GGUA 1GOGA 5TGBA 4HUWA 4K94L 2HFEA 1JF1A 5F6HJ 1NFIA 5GS1B 1LP9A 4PP1D 2J8UF 3ROOA 3SDAB 3AU1A 3LQAC 4ZO9A 4ZUWB 1LO2H 4DTGH 5DEGB 1F97A 3MQIA 4M8QB 2DM7A 4P2OD 4ZSOE 1I1AD 2BHUA 4ZTOH 4NGHH 2Z31C 2ICEB 1PG7L 3HUJB 3V7MA 5FF6A 3TJEL 1KCKA 5HHOE 1I3RB 2XZQH 3T08A 1E6JH 4MA7L 4I77L 3MLZH 1MVUA 2AJSH 4Z8FH 1HWHB 2AK4E 5F7WC 3PWUA 1T0NB 3D85D 4NJ9L 5DFVC 1KEGH 5DUPL 4JZJC 1F2XK 1NL0L 5IESL 2ARWA 2HP4A 3O9WA 4ZS6D 1J11A 3JV5A 1FN4A 3CD4A 3RWDB 2E9JA 1YMMD 2IAMB 3NAAL 1DL7H 1CGUA 1HYSC 3I6KA 3WD5L 5H35A 2QHRH 3DVNA 4ENED 5TE4L 4FTVA 4APQD 5I1LB 1BQUA 1Z9LA 3FFCD 7FABL 1ADQA 4PJFF 4MSWA 1F02I 4JPVL 4W6XB 5CSGA 4ZAKD 3F58L 2AV7B 1RIVL 4LLQB 1FE8H 4OZIB 3KS0J 4U49A 3VFMB 3WFBH 1PZ5A 5DEZA 3TLRA 2UYLA 3UTOA 3BWAB 5CGMA 3UROR 4NNPL 3BP4A 1ZVSA 4HWUA 3GI8L 4ETQA 4YHLH 3VRJA 3UJTL 4K23L 1R0AL 1JHTA 1ODAA 4MS8D 5B3NA 4E41A 5I1AA 1I3GH 2DKSA 2CH8A 5DMGD 2Q6WB 2SEBA 4ZSOB 3VXSE 4BQ9A 3MREB 2W0FB 1LK3H 4KRLB 4LKCA 3LY6A 3NFNB 4Z7VE 5HHOB 2EXYC 1GCFA 3RVWD 3ARPA 1G7IB 1ONQA 3H9HB 2XI9A 1WUNT 2AK4B 2FEDD 4J4PA 3IXTB 5ID1B 3AC0A 4JM2B 5DXWA 5ELIA 1ZTXH 2VOTA 5EU5A 3NZHL 1RJZA 2E7LC 1NPUA 4JQIH 3HR5A 2DLIA 1KTLA 2JTDA 3SDXE 3UTZA 4NT6A 5FKAB 3TJEH 4PJGE 2DQFB 2N1KA 5GQBA 4B7IA 4ZNCD 4MA7H 4G42B 1QQDA 1I9IH 4MJ6A 2ADJA 5E08L 1RY7B 4NJ9H 5DUPH 1NL0H 2VLME 5FHBH 5F88A 3WYRA 5E2UL 2H32A 4FQXD 4HUXA 5C0GB 1WWBX 1JNLL 5BS0A 1NGWA 2EDDA 3NAAH 1K4DB 4LCWA 2YUZA 4ZXBA 4JANB 3WD5H 1BBDL 4UIKL 5IWLA 5F9AC 1KNOA 2DLHA 5TE4H 5JW4R 2CDEA 1MNUL 4JHZA 1I1FB 4Y5YB 7FABH 2WLYA 3BZEA 5F7DB 1R24B 5DJYA 1BQSA 4D9QD 1VEMA 4WTXA 4J6RL 2COQA 9CGTA 5F89B 4DKEL 3C9NB 5EBLB 3RUGF 3TFKC 1R3JB 4JFQA 2DQIH 2Q7YA 3QJFA 2OSLB 4Z7VB 4HUKB 4S1DC 3JWDC 1E4XI 1EZVX 4K8RL 4G7YL 1K4CA 4KI5C 1N59A 3C5ZD 4NNPH 3HMXL 4MJ5B 3B9VA 3GI8H 5SWQB 3UJTH 2VDNL 4K23H 3BSZH 5C6TL 2W59A 3T09A 1S7VA 1ZT1A 2FBOJ 1AP2B 3K7UA 5IB3B 3RKDD 3O2WL 1S78C 1A7PH 4DAGH 3WIFB 3TEUA 3MCLL 3SDXB 2CUHA 3PP3H 4PJGB 3U36B 3OJMB 1WZMA 1Y6NR 5KSBE 4JQXC 2PCPA 1CDYA 5HGHA 3MRQA 5HYSB 5BO1L 5JOEA 1P1ZA 3W9DB 1G6RB 3HI6H 3NZHH 2M8XA 2YUWA 4MAYC 4XCYB 1CK0L 4AJ0A 1B9ZA 5FGSA 3DRQA 4PRBA 3NZ8A 4QY8B 1TJIH 3EO1B 3MOQA 3ARGD 3EW3B 5D4QA 5JW5A 4IRJD 3LKQB 1F4XL 3KG5A 5E08H 3MNZB 5CZVL 1A9BB 1SJXA 4KPHH 1NFDA 3OKNA 1OL0A 1UVQA 5I18L 4HJGB 2XNAA 3HTLX 4R4FL 5SWZD 1JNLH 5IOPB 4I0PB 3SJVD 1MIML 2H8PB 4LMQE 5IKCB 3BYTA 3G5XB 1BBDH 1EO8L 1MELA 4LRNL 2RFXA 1MNUH 3LN4B 2CMRH 2A73B 5D1ZC 2EKSA 3KPOA 5E8NB 4WUKL 5DMIH 3C5JA 1MCCA 2Y5TB 1E28A 4JE4B 4J6RH 4QRQB 1ZLUK 3HN3A 3G6AB 3LPFA 4KRPD 1FFPB 1F4HA 4GBXD 5FYKL 2NCMA 3MJ8A 3KPSE 43CAA 3WDHA 4YDLC 5FFLA 5I1CL 5F9OL 4Q7DA 4G7YH 5KSBB 2BSSB 3C6SA 3IDXH 4AH2A 3VH8A 1FL6B 2OTUB 3HMXH 3F6IA 4ODSL 3ZO0A 2VDNH 4OQTA 5C6TH 2H3NB 1HHHB 4Q6YA 1S9YA 1HI6B 1SVCP 1J0JA 3O2WH 3V6FA 5FYLL 2F54D 4Q6IB 3PWLB 1U8HA 4P9HC 3WJLC 2W65A 2VAJA 2A6KA 4XVTL 4YPJA 4EI5A 3MCLH 2R8SL 1IBGH 1K85A 2WV3A 5ABDE 3OJDA 4I1NB 4XC1L 1ZLUH 3MRPA 5D1XD 2EIZA 5ICYA 3CFJB 4UAOB 5D6CA 1CICB 3VXRA 2UWEE 5BO1H 3PHOA 1CR9L 1S7QB 4YC2C 4HUNB 4FABL 4F3FA 2ICWI 3OJ2C 4ZO7A 1F6AA 2VZUA 1CK0H 2AGJL 3D5OF 4TTDD 3RDTA 1UKTA 4QTHA 5IVXB 4F33A 1YNTA 4ZUVA 1PG7W 3O6ML 32C2A 3SCMA 4ISVB 3RZCA 4F7MA 5CZVH 4M00A 4ONFL 2YZ8A 4P5KB 2ILLA 1MY7A 1IGTB 3KPLA 5I18H 4HHAB 4U05A 1OTUD 4IS6B 5FYJU 4KROB 1MIMH 5LAXA 4XXCA 2V9TA 4YHZL 1NQBA 3KPSB 5D1QD 5E8DL 4LDLB 4DWHA 4ONGL 4OF8A 5KSAB 2H9GA 4GS7B 1CL7I 3VWJB 3RY4A 1CXKA 5E9DD 4I5BB 4L3ED 2YPKA 3RVVC 2HVJA 1KB5B 3R06B 3PWPE 1CXLA 1TCRA 4JY6B 4R2GC 3WFDL 2ZUQC 2QADB 4YIQB 5DK3A 5FYKH 4RGOH 1MHPH 4F9PA 1HH6B 5I1CH 5DF0A 4PJAA 1AGFA 1V3JA 3L3DA 3ZL4L 1YEGL 2PXYA 3UTQB 4EXPX 4J8RB 1U58A 3HAEB 5JPNA 1KN2L 4ODSH 1C12A 2UWEB 2YK1L 2WMPA 1MCHA 1NGYB 1V5JA 5I1JL 3C5SA 3FB5B 4D8PA 1WCBB 5FYLH 2HG5A 1MWAA 4GG6A 3WIHH 4XVTH 2R8SH 3K4AA 3ZKND 3MLTA 4F7PA 4LMQI 3SPVA 1A0QH 7CGTA 3RIFF 5BV7H 5F6IC 3DSFL 3AREA 4M4RA 1RI8A 4XAKD 3U4BL 3V5HA 3AXLB 5DMKB 2OK0L 3TGXA 5HHNB 3ARYA 3IFLL 2NXZC 1X5AA 4OCYL 4KMQA 1XIWA 1GZPA 1QUNA 4FABH 5E2WL 2JJTA 2Z31B 2PW1A 4G9FB 5I9QC 5CJBA 3ULSB 2AGJH 4HK0B 3LQZB 1CG9B 5DUBA 4P23A 5DMJB 3IYLW 1G7JA 5FGRA 3MRKA 3TPUB 1OW0A 3O41A 3O6MH 4J3TA 3DVFA 3HG1D 4JZJB 1KIPA 4RGND 5FK9A 2F53E 5F7NC 1T1WA 2MMXA 2XXMB 4ZFOA 2IADA 1BIHA 1JVKA 2BVTA 4WFED 5I1KH 3KYOB 4YHZH 2X9XA 3HC0B 5E8DH 4A6YH 2FIKB 4ONGH 2HRLA 3ARDC 3OKLB 4KJYB 3GMNB 4PJ5A 4I18A 8FABA 1S9KC 4UU9A 3FQNA 1AH1A 4M61A 3DX7A 4ZO6A 3ZE0F 2K7QA 3ZTJH 3EHBD 2WBJC 4I2XA 1SYSA 3S3PA 3JWOC 5AZEH 4X98A 4HXAH 2R1YB 4DGIL 5IMOA 4LPWA 4XC3L 4NM8L 4NO3A 3RWGB 5CS7A 1NCDH 3ZL4H 4BFEA 1YEGH 4AIZB 1OB1B 5E4IA 1Z3GL 5AD0A 5DJ8A 4JKKA 4L5FL 3A6CL 3MRMA 3WBDA 5K9QI 4X6EA 5IGXH 35C8L 1DLHB 3SDAD 2E6QA 4UZGA 3QUXA 4YGVB 1AC6A 4FQLL 2XWTB 3O81A 3UTSE 2AABL 3HE7C 5ESQA 2HT4D 4R7NB 4HGKC 3SQBA 3DSFH 2O61B 4JFHE 4QO1A 3U4BH 2OK0H 1SBBA 2F53B 4ORGB 4RIRB 3BPOC 4OCYH 2X42A 5CZXD 4ZFFB 3EFFA 1OQOA 4U6VH 5DJ6B 3F5WB 2HT3D 1FNEA 4RWHA 3WFHA 4I0CC 4LCCA 5EZIL 1CT8A 3MUZ1 2IAMD 2YXMA 3BRDA 5HXMA 4F9LA 3KNBA 5E1HB 4R7DA 1BVKA 3ISWA 1YUHB 4R3SA 4QTIL 3FFDB 1BWWA 4Q74A 3BH9B 3VD4A 3MFFB 3KLSA 5D7JA 3QJHB 4UQ3A 3MA7B 3S6CA 1JWMA 3TCXA 2B4CL 3O6FC 2BMKB 1LEGA 1IMHC 4NQUA 4GSDL 3MRHB 5EBWB 3BYYA 1UEMA 5B21A 2Z93B 3QIWC 5JMOC 3FN3A 4Y7MA 4NNXA 3KPTA 4YWGH 3AS1A 4YXLL 2C4FU 5MEPB 2O5XL 4DGIH 4Q9BA 1Q0YL 2VSDA 4NM8H 3UTSB 3BXNA 4Y4KA 5CEYB 3OR7A 1SJEB 4PJBA 2BY2A 1J0YA 2C3XA 3NCJL 5HHOD 3T2NL 2GFBA 1IGJB 3AUVA 4L5FH 3A6CH 3ZE2F 2AK4D 3VCLB 1IFHL 5HPMB 5I76A 4ZNEA 2GSIB 3CSYB 5ESAA 2WBWB 5JOPE 3LMJH 5ALCL 1QBML 3D85A 5IBLC 3GMOB 2G5BA 1ZSDB 1BAFH 2Z0BA 1ZGLB 1KBGL 3P77A 4NRXA 3X3GL 2ZPKL 3WSQL 1AO7B 4P5TC 1WBZB 5K59F 2W0LA 3T4YB 3KPRA 4TSAL 4F7CA 3GMQA 1ORQA 2IFFL 1VFMA 1S7TA 5LWYL 5MEQA 3QUMB 2XQYK 4PJHA 4TSBL 4YBLC 1UWXK 1XH3B 4QRTB 3FFCA 5HYQB 4NO5B 4UV7L 3PWJA 4H88L 5EPMB 5EZIH 4Y19E 5E6IB 4Z77B 3LS4L 5DRXB 1WC7B 4HUUA 1WAAA 4XBEL 2QJDA 1W8NA 1QSFE 4YLQT 5E0QA 3AM8C 2OXGA 5EC2B 3E1F1 5D9SB 1I85C 2BNUA 1A02N 4NRZB 3FTGA 2X4UA 5J6HB 3QH3A 3MRBB 3MRJA 3CXHJ 3MGOA 1YPZF 4Z7NF 2E8ZA 4HC1L 4HZAA 4GSDH 4JFPA 25C8L 2IH3A 2P1YA 3KDMB 4NRYA 4XPAH 3M1BB 4YHIB 2VITB 1NDGA 2J7LA 4HIJB 5K9OA 3H3BC 5MERB 1YN6A 4NC0B 4YNYA 2Q87A 3ULUC 2QLVB 1BM3L 4G7VL 4YXLH 1E4KC 4PJ7E 4Y2OA 2P42B 3QI9A 1SQ2N 3V52L 4B53A 1NEZB 3OKOA 3K3QA 1VADB 4ZS7L 3CFCL 5J3HC 4BSWB 3VFTB 1L6ZA 4QT5B 3T2NH 4R96B 4WI3A 4XNQB 5D70L 4BJLA 1M7DB 4QYOA 3MBEB 1IFHH 4Z6AT 4BA8A 1I75A 3EIFA 3DHJA 5ALCH 1QBMH 1NEUA 4D9LL 1HSAB 2JK5A 1M71A 3UP1A 1CDCA 2WSKA 4Y19B 3V0WH 4LQ1A 3GB7A 3WSQH 1R3LB 5KSVB 4KRNA 1FORL 1B90A 4ONHA 4RISH 3V7AE 3VFUA 5TDNA 1UM4L 1T0MB 1QSFB 2NY2B 3P4LA 2CKBB 3RWEB 5LWYH 1XR9A 3GSUB 1FCCA 2BNQE 1EK3A 3GHBL 4S1SH 3ZKSD 3NIDE 2VO5A 5HHPA 1F3RB 4UV7H 4H88H 4XBPA 4PLJC 3BEVA 4I0PD 4JFDE 3DROA 1GH7A 3LS4H 5CEXB 4YQXL 4WWKB 3KYNB 4R90H 4M4PA 4JREC 4YO0A 4F8QA 3N0PB 2VDPL 4U1JA 4M1CD 3FQUB 5HHXL 4EVNA 3EJYD 5ITFA 1LGVA 2GITB 2AKRB 3MLWL 1DBBH 4PJ7B 3DVGB 4EUPG 4V1DE 3TO4B 2H6PA 2EEBA 2D4DA 1KJMA 4EQ2A 1HQ4B 4PGEB 1ZAGA 2VYRE 3DXAA 1BVLA 1FGVL 3T3PF 1MHHA 4HC1H 1N6QL 3HMXA 1PKQE 4N0UB 1JMXA 25C8H 3QRGL 5C0RH 1XGPA 4AMKL 5DUML 3QIBB 4PJCE 5IG7B 3MRRB 4M6ML 4R2GB 1MCIA 4U6HA 1BM3H 4PJXE 4YAQA 2HTKD 2X4QA 4G7VH 3IGAA 1A4KB 5J1SC 1LO0L 1QVOB 3DV6B 3UAJD 1N6UA 1X4YA 2QQLL 2WWMC 3EO9L 4JZNB 1K9TA 1IEBB 2ZSWB 3AAZB 4L8CB 3OXRA 2J3SA 4KU1A 5JA9A 5CCKL 3CFCH 3T1FB 2BVPB 2EDHA 3LD8C 3UJIH 1Y0LA 1T80A 2VLJA 1MREL 5BZWA 2P7TA 4IRZL 1N6VA 3DIFA 2R9HC 3WE6A 5ADPL 5HI3D 5IHZA 1VKXB 1CU4L 3FOLA 1PD6A 4IRJA 2BC4A 1CICD 4AYFA 4MCYB 3RBSA 3IFNL 1KELL 4D9LH 5DK2B 2EZ0C 3H7BB 1UEYA 3CH8A 1IAOB 2QQKH 4JFDB 3RVTC 5F6IB 4NPYA 5FXCH 5BMFL 5SWZA 1GGCL 1FORH 1H3PL 4P46B 3SJVA 4H20L 1A3QA 4J12A 5I74C 5DRWA 4GXUM 5IHUL 1UXWB 3Q5YA 1UM4H 3OG6B 2MSPA 4OV5B 4BQBA 2ARJQ 3L7EB 5I9QB 1JGEA 1ETZB 4XT1C 2F8VA 4ODHL 3VFNB 3IF1B 3GGWB 4V1DB 6CGTA 3CUPB 3GHBH 4OUOA 4TULL 4GRMB 3Q5OA 1MI5A 4MJ2A 4JN2B 4WWID 3ELAT 4H5SB 1JP5A 3QQ3A 2OJEB 4HX1B 1KUMA 2GW5A 3KPSD 1HDMB 2J88H 2HLFC 4OZ4A 5KSAD 3VWJD 3P9WB 5A3IC 1KYOK 4C57C 1Y6KR 5K59E 1CXEA 1GHFL 2V9RA 1D5XA 4PJXB 1QTYT 4X6DE 3MLWH 1A47A 3HLAB 4HF5L 1MCFA 1U8IB 3GJEB 4LSSL 4ODXA 5KVGL 4X0KA 1RIHL 4FHBD 4PUBL 2Y6SD 2QADD 4PG2C 3KWWB 4HUMB 1FGVH 1WAAF 3T0DA 1FLRH 2ADGA 5GGQH 2FCBA 1FVEA 1KJ3L 2VISB 1K5NB 2Z92B 2WBJB 4LCUB 3S4SB 2V7HA 3QFJA 4UT6L 5AYUL 3TIEA 5D2NC 1G0YR 4OGXL 5FCSH 3WIHA 5HYJE 4P4KA 3M17B 1MLCA 2ADFL 2QQLH 1LD9B 3BPNC 4HCRL 2GJ6A 1FDLL 4LLUA 3TYFA 4HFUH 3V79C 5F7LB 4WI7A 4UB0H 3TT3L 4UDUA 3MV11 1QOKA 1MREH 4IRZH 3LRGA 5ADPH 1N4XL 1D5BB 3IVKB 1XZ0A 2PYED 3QUYC 1ERNA 3B9EA 3IFNH 3VWKA 3ARXA 5F9JB 3P11H 1Z0MA 5GGRA 2Z31D 5IQ7L 1I1RA 1QO3A 4G9FD 3DRTB 1CCZA 3EJZC 3QUZA 4EBQL 5J89A 4FNLL 2Z9TA 1FC2D 3HE6A 5BVPL 4LSDA 3QZWG 1DEDA 3N9GL 2LQRA 1FFRA 5IHUH 2DL9A 1WWWX 5DFWH 3HI1B 4JKMA 5DFVD 2H26B 5AG9A 4X6DB 2Z35B 2XZCL 4ODHH 4QOKE 5T1MA 4A6YA 2BHZA 1HHJA 2VR9A 2ZZUT 4L3CB 2H45A 2EDFA 4XX1E 4POZC 1HYSD 1R3HA 3NCFB 3OKEA 2MHAA 5D5MA 2X44D 1RUPL 2CLVB 1DBJL 3SDDA 3RWCA 2AJVH 4YDJA 1CFVH 3PP4H 3P2TA 1RULL 2VWEE 1LEIB 2BXZA 3SGEH 3SBWA 5EZOL 5HYJB 3L3KB 2ZCKL 2G75A 3TN0C 1PBYA 5KVGH 3O6FB 2CO7B 1RIHH 4PUBH 5F1SA 2Z8VC 1HOCA 4GLRH 3QDJA 3RA7L 2FECL 2D03H 3UZEA 4HUVB 4RRPG 3BH8A 1A7BA 5IW6A 4K2UH 3ZHDA 3QIWB 4HFWB 1VPOH 1KJ3H 3ZE1F 4TYUA 3UDWA 5AYUH 4LF3B 1EEZA 5D7IA 2FO4B 1Q72L 4HLZG 4OGXH 3V5DB 1NCNA 1FYHB 2ADFH 2ZCHH 4PB9L 3VI3E 1HSBB 2NY1C 3K46A 3B9DA 4LU5L 4ALAL 1B4JL 4EEEA 4HCRH 4OB5H 1Q9WB 4BFIB 1KPUB 3MLXL 2EDNA 2EXYD 1QSZA 5B22A 4DJMA 4FA8A 4HDIB 2YPLB 4N8VA 5HPOA 1HEZB 2D9QB 2VZVA 3TIDA 3EDJA 3TT3H 1CTOA 3ARFB 5C2BL 4Z7WA 4G5ZH 1H0DA 5I75C 5CJQL 4L29A 3HG1A 5CBEB 5CJXA 5E95B 5DD6A 1A9EA 4ZUTA 3HMWH 4ZOEA 3L3JB 5C0DB 2FJFA 4P5TB 3UYRL 3GHEL 3L5XL 1YDPB 1O7VA 4LEOA 1H15B 5BVPH 5CMAB 2PYFA 2XN9B 2IFGA 2CK0L 5B38A 1XFPA 2W38A 5FYKU 4CVXB 3PJSB 3PABA 3MNVB 4KVNL 1S5IL 2VN4A 3UXFA 2D31B 4NO0A 2MCG1 4LHUG 2Z91B 3CVHB 1WZLA 2VAAB 1AHWC 1RUPH 1UWEH 2OL3B 4QHUA 1DBJH 1A6PA 1WSST 4G3YH 2WWKT 4XB7A 1JHKL 3PHQA 4Y2DC 5EZOH 1Z0NA 1WWAX 1PLGH 2ZCKH 1ZLWK 4XAWL 3UBXA 4PLOB 3P3YA 3TFKD 1S7UB 4PB0L 3HS0A 3RA7H 1R5VA 3CLFL 4U1MB 2KBGA 5CEZL 1FNHA 2LFGA 2XA3A 3QUKB 4X6CA 2QSQA 5F8RC 1BMGA 3RX8A 4JHWL 4XCCH 3BVNA 4J3OC 4LQFL 4JFHD 5AEAA 4PJDB 4X7SL 1Q72H 2NW3B 2C5DC 2VABB 5CBAA 1S78D 2VLRE 4LU5H 2XWBB 1B4JH 3NN8B 1R6VA 3MACH 4W4OA 3NPZB 4Z95H 4WENB 4WHYG 4WU7A 3MLXH 4JY5L 1LNUA 1I8KB 1JF5A 3QG6B 2VDMH 2NY3C 1ZLWH 1AO7D 5C0CE 1YEJL 3V0AC 2Z8WC 5HVHC 5E8EB 1LEKB 1P2CA 3VXUA 5CJQH 1A7OH 4K7PL 4WHDA 4MJIE 3RL2B 3MLYL 5M95B 1HXMB 3VXTB 4LIQE 2GIYA 3RQ3A 1O0VA 4K3JL 3CFEA 2JCCF 5EOTA 4KFZC 2CLRA 2W92A 2ZOKB 3UYRH 3GHEH 3L5XH 4JGUA 1DN0B 1Y18B 2VZTA 4BYHA 1X5ZA 2VDKH 4P2RE 2IEPA 5F3HB 1CGWA 1DTUA 3DO7A 2BJML 4MX7A 5C70A 4NWTL 1A1MA 4RMQA 4LVNC 4KVNH 2FLBT 5DHYA 5I1IL 3MUJA 5JXEC 3C6LA 1RZIA 2ERJC 4Z5RB 1OSPH 4NKDB 3JTSA 1QLFB 5BRZA 4JREB 3FQWA 1MCNA 4Y8DC 1DCLA 3IDIA 4P57A 1C7SA 3E0GA 3KLHC 3OJVC 1JHKH 3L7FA 1ED3A 4N0CC 4AQ1B 3F12A 3GSOB 3PDDA 5JXAH 3VXOB 5T3ZH 3LEVL 5DRNA 4XAWH 3L3IB 5JHDB 2VLRB 5E2VL 1DJSA 2CUIA 1IAIL 4OFYD 4KGLA 5JOPD 1Q1JH 5D5MF 1MCPL 5I6XC 1F90H 2R29L 3QULB 3REWB 3VGBA 1H8SA 4MCZB 4NZUL 5CEZH 2QKIA 1UACL 4MNGE 4P4RB 2WK2A 4LRIA 4NUGL 1HH9A 4ZPTB 3I3EA 5C0CB 4D2NA 1I4FA 1I8LA 4LQFH 3MUY1 4JDZB 4X7SH 3X11A 2YHGA 2P46B 2X89A 3VGFA 4MJIB 1BD2E 4PJEE 1QP1A 3MBED 3ZDXE 4FQ1H 5BW7C 1G0XA 4NYLB 4OM1H 2X41A 3BP7B 4PRHB 3EOAA 1G7HA 2R56H 4JY5H 3C08H 3LD8B 4I3SL 4AEHL 4LNRB 4Y19D 4S11A 3SE9L 4YBQD 1AIFA 1IM3A 1YEJH 5D2NE 5D7IF 1AXSA 4BSVB 1V7NL 3VXNB 4UIMB 1Q9LB 2YN3A 4K7PH 5C6WH 3B6SB 1QSFD 5C0AD 5IBTH 3VFOA 4RFNC 4WFHE 5C8JA 5BVJB 1JL8A 2AQ2A 4K3JH 1W0YT 2GUOB 1C08B 3LRSA 3RWIA 5C92A 4NM4L 1C1EL 4DUWA 1BQHB 1ZT7B 5I74B 1R3IL 5IVZB 4Z7WF 1FZMA 2Y07L 3X13B 2N7BA 2P8PB 2HWZL 1GOFA 4NWTH 4XB8A 1TMCB 4N9GB 2YPVL 3L3OB 5TE6L 4UTAH 3WNKA 5I1IH 3UPCA 3CXDH 3EYOA 4ONOA 4S1QL 4JG0L 2AERT 1A7NH 4JRXE 4JB9L 5EN2A 2BSRB 3TO4D 4WCYL 1JGLH 3D2UB 5GGSB 1RUML 4MNGB 1VGKB 4LSPH 5F96L 2OS7A 4PTTA 4YPGB 3FOMB 2VL4A 4Y4HC 5E8PA 3RVVD 5ENWB 2VDRL 3QEQB 3LS5H 4XPGL 2OMNA 4R2GD 4NC1C 5J12C 4C59B 5FKPA 5FDWB 3MV8E 1KB9J 1IAIH 3P4MB 2R29H 3HZVA 4PGJA 4XPBL 3BGMB 5DJCB 4NP4L 3TZVB 3EYUL 1UACH 4P2QE 4NUGH 4Z18A 2ATPB 2XPGB 1YYML 3NABL 5GSVA 4N90E 1PQZA 2I9LA 5EUKA 5D2NB 3HZMA 3E6FB 2H1PH 4P9HH 4ODWA 3SO5A 2BNRA 4GW4A 2ITCB 4RAUA 5GGSY 4B7LA 1D9KB 1Q94A 2DQUL 1H5BA 1RUQL 1HHIB 3OXSA 3DBXA 5BZDB 3WS3B 3RTQB 1WVZA 1AGBA 3STZB 4UV4H 4UT9L 1YEEL 4X6CF 1HYRC 4NNYA 3ROLA 4AEHH 3O45A 4ZG1A 2Q86B 3SE9H 4OZGF 1MRDH 4NO2B 4PY7A 4I48A 3MRLB 3CCHA 2I60L 2NXZD 1T4KA 5IIEA 1QEWB 4N1CA 3IKCB 2AJXL 4WO4B 3GBNL 5DJ2B 4V1DD 4JRXB 4ZXBC 4NM4H 5IWLC 5AUMB 2VIRB 4XPTH 4LPTA 4NWUH 2W0KA 3MJ7A 2IANA 3VFVA 4AG4L 2XYCA 3PHSA 1J87A 4G9DA 1QRNE 2HWZH 4XPHL 1IAKA 5FECA 3TYGL 5IR1B 2K7PA 2A74B 4JFYA 4PRIE 5EU3B 3G6DL 3BWUC 2OM5A 5IQ9A 5TE6H 4J1UB 1R5WB 4PJIB 5ICXA 4U1IB 4JG0H 2HT2C 3WXWL 3BKYH 3WXVL 2CLZB 4NQCD 1TDQA 1TVHA 1N8ZA 1RUMH 4R97C 3X12A 3MCKA 3H3PH 4P2QB 5F96H 2Y7QA 5MHSE 2YC1B 1UZ8A 4OZHE 4OFDA 5C0JA 5L88L 4OIIH 2WBJD 3MRDB 2IPTL 3R1GH 3UTPE 1T22B 2D0FA 1TVDA 4QXTA 3CPLB 4JO1L 1PX3A 2P5EE 1VEPA 4NP4H 3EYUH 1VDGA 2Y06L 4YFLI 3I6GB 1X5YA 4U1KB 4UOJA 4LGRB 1YYMH 3LCYA 1T1ZB 5DEFA 5EU6E 5DJAB 3J8F7 5DQ9A 2A83A 2HH0L 5D2LF 5DA4A 3RVXC 4M1DH 3BISA 1OQXA 4MLIA 2NY1B 5I0ZA 2DQUH 3UC0L 1QSEE 4AEIH 5MENE 5FM4A 5MEOB 2ZUSA 2Q76B 4ERSL 2DTSA 1D6VL 1G9NC 1A6WL 1XF2A 4HLJA 2X2YA 1G7LA 1OHQA 3HE7D 3EZJB 4WV1B 1MQKL 3TCLB 2VZ1A 1JPTH 3FJTA 1QRNB 1M7IB 3H9SA 5I75B 3B9KA 4C4KT 3MRNA 1FYTE 1EFQA 4Z78A 4LHQB 1FG2B 2AJXH 3DSNA 4I9WD 2KUTA 3GBNH 4XNUL 1NBZB 5HJ3A 4C56A 2DQJL 1G1YA 1RZKC 2G5RA 4HIHB 1OGAE 1CFSB 1KPRB 1T66C 2NY7L 4AG4H 2GK0B 4TOYH 4G80B 4OZHB 4XPHH 1UCBL 3RP1A 4CVZA 2XIDA 1P7KA 3G6DH 3PWNA 2WIIB 1ZHLA 5J56B 3BP5B 4JPKL 3D3VD 2AVGA 2MOVA 5IFAL 5HYJD 3G6JA 2DRUA 2V17L 3BEWA 2NTSP 3E2HC 3O6FD 1FG9C 3ME0A 4OF3A 4GAYB 4M7KL 3LKPA 3PWVB 5D7LE 5F93C 3B2UC 4G8FA 4JFFA 4Y2DB 1C16A 1OSZA 2DLFL 2P4AB 5MP6L 5EU6B 3QIWD 1NAML 3BKCL 2XKUA 2P43B 2Z8RA 3JBG7 4F7EB 5L88H 4JM4L 2B0SL 2ZCLL 3MV9E 2IPTH 3OGCA 1QSEB 4HCRA 3EOBA 3LDBC 2OTWB 4EI5C 3V5KA 5GS2H 3QNYB 5DVMA 5FO7A 2PYEA 2YRZA 2Y06H 3LN9A 1U95A 1ROWA 2OX5A 2O5ZL 4KXZH 5IB4A 2YPLD 3LIZL 3EO0A 4ELMA 2HH0H 1SYVA 1FYTB 4LAQL 2W07A 5EC1B 1F4WL 3TBVB 3PDOA 3L3GA 1BZ7B 5IBLD 3RDTC 1CDUA 2HJFB 1ZHBA 2E9WA 3U6RB 1NLDL 4PV8B 4GT7A 2FB4L 2YSSB 1A6WH 1OGAB 4FQ2H 3UJJH 1YMHB 5EBGA 2EEAA 3IJHB 3SCMC 4M7ZC 4P5TD 3QXWA 5TQ0H 1LP9E 3IFPB 4RBPH 1KLUB 3GRWL 2XN9D 4W68A 1IJ9A 1CGYA 3L5JA 5E1AB 2HTLD 1Z6JT 1GOHA 1OTSC 3RUGB 1FBIL 4RNRB 5AZ2L 3NA4A 4XXCC 1EHLH 4WEMB 4N0FB 3ULVF 4XNUH 3WO3B 1J05B 2DQJH 3ES6A 4NCDA 2FR4A 4LHUD 3P0YL 2BVQB 4QRSA 3VFRA 1FZJA 1LWRA 1T03L 3RWJA 1BOGB 5FIEA 1DBMH 4XXDA 5LCVH 3HCVA 1UCBH 1P6AB 3S88L 1YY9C 3MV9B 4L9LA 2FRGP 5IJVB 3ZMRA 4PGCA 4QEGA 1HIML 1FL3B 2EC9T 2HLAA 3C2AH 5DRZB 4DVBA 3IJYA 2V17H 4M7JL 4JLRB 2EYTB 1DQTA 4M7KH 3U7YL 2EE3A 3BD4A 3FB7A 5JIKA 2E6PA 3PNWA 1IM9B 4X99A 4MXVF 3TVMB 5DHVB 5EBMB 3O2VL 4L8DA 2DLFH 5MP6H 3HKFA 2VSCA 3DUUB 4HLZH 1MLBA 1KIRB 1A4JA 4XP9L 5ISZA 1IGIH 4CKVX 3ULUD 1AC0A 2Y25A 2ZCLH 4Z0XA 1UXSB 5SWSA 1BWMA 4D0CB 4QHLA 1U93B 4QCIB 5T1DH 4LP4A 4WDIA 5BXFB 3KXFE 4NZTL 5TGBB 4HUWB 2HFEB 2BXYA 1NFIB 1GRWA 2E7LA 3AREC 4HPOH 4L1HA 4QRPE 1GL4B 1LP9B 3FHAA 5J3HD 2O5ZH 2X1WL 3ROOB 3AU1B 4E41E 4WVRA 3QEHA 4LSTL 1ZT4A 3QXUA 3LIZH 1QBLH 1F4AA 1XIWC 4LAQH 3VRLE 4YH6A 2JJTC 1EERB 4BZ1L 3BPLC 4N1HB 4OCSH 5FF6B 4RAHA 4P59L 5K9KA 2D9CA 2O5YL 1NLDH 1DQLL 2FB4H 3ZT5A 3E3QC 1MVUB 2ZP0T 1OW0C 2CSPA 2VDQL 5I8OH 1FH5L 3PWUB 1TQBB 4RMUA 1QYGL 2DN7A 3FQXA 2Q1EA 4P99A 4LLYA 3O9WB 4DK3A 1FN4B 1MFAH 4RFNB 3QXDA 3RBGA 3V4VH 2ITDA 2X4TA 3I6KB 5AZ2H 1KEML 4KUCF 2HKFL 4HIEA 5H35B 1L7TL 5E2TL 3DVNB 4FTVB 5D96C 3S35L 2XZAL 3P0YH 4I18C 1OD7A 3DV4A 2YD9A 5C1MB 1T03H 4MSWB 5IMMA 3P73A 5KAQF 5IV2A 4UBDC 1F3JA 3SE4A 2LV4A 4R9HA 4I0KA 5BS0E 1OLZA 4TSCL 1PZ5B 5LGKA 2CGRL 1HIMH 4LCWE 2UYLB 5DQJA 3NIFE 4GFTB 5JHDD 2IQAA 4FQJH 4M7JH 3BP4B 1ZVSB 1F58L 3U7YH 4ETQB 5IJKA 3Q6GL 4F58L 3P30L 3VRJB 3I75A 4K3EL 5JHLL 5FCUL 3SKJL 1JHTB 2PO6C 2DMCA 1NMCC 4E41B 5I1AB 4KDWA 4XP9H 2SEBB 3FN9A 3RWFA 1B2WL 3G6JF 1L0XA 4GAFB 4LKCB 1AR1C 1IEAA 2AJYL 4G8EA 4MJID 4WHYH 4NHUA 3L95A 1ONQB 2DQCL 4NZTH 1ZMYA 1MJJA 4G6FB 5JW4Q 3ZDZE 4PRPD 4MAYA 4PRHD 1ZLVH 4GKOA 1I7UA 3J7HA 5EO1A 2QHLA 4AY0A 5EU5B 1EZVY 1RJZB 4CGTA 2VZSA 2R9HD 4BK4A 3F7PC 2IPKA 3HR5B 3EZ8A 4JG1H 4HIIA 1KTLB 3UTZB 3MV7E 3PGDA 4NT6B 5EB9A 4P59H 2EZ0D 1T5WA 4YHKL 1QQDB 4U33A 4MJ6B 3RVTD 4OCXL 2ADJB 2VDQH 2DM2A 2JJWA 4Z7UF 1FH5H 3EFDL 4HS6A 1QYGH 4F9LC 2RBLA 3RY5A 4CW1A 5F88B 4E42A 1VERA 1E4XH 4NFBA 2H32B 5F1KC 1JYNA 1BX2A 4JFEE 4LLDA 4HUXB 5BS0B 1NGWB 4IM8A 4N8PA 2FL5A 5I19H 4LCWB 5D1ZA 5EDXA 1KEMH 4ZXBB 2HKFH 2PW2A 3SGDI 1L7TH 5E2TH 1KNOB 2EDOA 4GRWF 2CDEB 4POUB 3S35H 2XZAH 4OLXH 3BZEB 1G6RL 5DJYB 2HLFD 5KW9L 3O2DH 5A3ID 4QRRD 4U0RB 3V6ZA 2AJ3A 4TPRL 4JFQB 4QRUA 1F2QA 3QEQD 2Q7YB 2CGRH 3QJFB 4J3UA 1C5DA 1YN7A 4H1LG 1KCLA 3U7WL 1H3UA 1K4CB 5H94A 1X6LA 1N59B 4K94C 1EJ6A 4C54A 3Q6GH 4F58H 4K3EH 3SKJH 4L4VA 3WJLA 1ZA3A 1S7VB 1ZT1B 5CD3A 4YHML 1E6OH 2WINB 2UZIL 2X4NA 2OI9C 1AD0A 2M26A 5F1NA 3TF7C 3BIBX 1J1XL 1B2WH 1DANT 1K8IA 1KLGA 3HPLA 4YHNA 5JNYA 4U1HA 3JUZA 3CSPA 1F13A 1KJ2L 4KMTL 4J7RA 2AJYH 3FB6A 4B0MM 2DQCH 2PCPB 1BLNA 1NBYA 4OZFG 5C0AA 4ZD3L 5I30L 2CD0A 5HGHB 3MRQB 3AB0C 5DVOA 2VXVL 1P7QA 1P1ZB 2JJSA 5DD3L 1CL7L 4K7PX 5F6HI 4TQEL 4GOSA 5TQ2L 1S3KL 2CO6B 4EDXA 1LO4L 3DRQB 4PRBB 2I25N 3NZ8B 4UINH 3B4NA 4YHKH 4LKXA 2BOCA 5C7XH 5JW5B 3BKJL 3QDAA 2MTPA 4WO4D 3EJZD 1NUDA 5KJRL 4JRXD 4I13B 3QDGA 3EFDH 2FZ3A 3OKNB 1NFDB 3VXRE 1UVQB 2ADIA 2DYPD 4UI2A 4NOBA 3OG4B 1JGDA 5E5UB 2XNAB 2AXFA 3GK8L 4B41A 1N3NA 5JPMA 5JIHA 2C7UA 1W8OA 2B1HL 1U92A 2BY0A 3FZUD 2RFXB 2FEEL 1MH5A 5L8JB 4POZD 1RFDH 5D93C 3V7AG 1X6NA 2EKSB 2ZUYA 3KPOB 5FM5O 4O2FA 3C5JB 2NXYC 1E28B 5KW9H 1X3DA 5KS9F 3NA9L 2DJSA 4TPRH 1F3DH 3QI9C 1NGPH 3MJ8B 2Y72A 43CAB 2FIRT 4RQQA 3TN0D 3E2HB 2DLTA 2ZSVA 1WFTA 1U36A 2NY6C 3H6JA 3C6SB 2NZ9C 4AH2B 2F5AL 3VH8B 4ZMAT 1BQLH 5HDBE 1JWUA 1ULVA 1EFXA 4KTDL 4NDMA 4YHMH 2UZIH 3GMRA 1S9YB 4CU6A 5EOQL 4YXKL 1LO5A 3V6FB 1U8HB 4IHOA 3S96A 1J1XH 1UA6L 2W65B 2A6KB 4EI5B 2F15A 5FUCE 3OJDB 3KR3L 1KJ2H 5C08A 4KMTH 2NY1D 4PJAE 4OSUL 2CXKA 1KB5L 4TVPD 5GJSL 1J0IA 4LFHD 3MRPB 4X6BA 2EIZB 4ZD3H 2FYYA 4O58H 5I30H 4OQ1A 5ICYB 5ACMA 1KCUH 5D6CB 3VXRB 2VXVH 3PHOB 3NCYS 1CL7H 3BDBA 1K2DA 4TQEH 4Q9RH 1LE9A 1F6AB 5TQ2H 5EOCJ 1IC5L 3U2SA 1S3KH 2WQRA 4GG6E 5I0DA 4WHTA 3U9PL 3RDTB 2AEPH 2ZKHH 1LO4H 4OD1L 1A3LH 4QTHB 3MRIA 4F33B 1YNTB 4ZUVB 32C2B 3BKJH 2PUQT 3SCMB 3WUZA 4TUJA 3RZCB 4Y4FC 4F7MB 3X14A 1KB9K 1BIIA 3VDBA 3DOSA 3KPLB 2IGFL 3ZSSA 4AZ8A 4NQCA 5DVNA 3ARDA 2X9YA 1S8DA 5LAXB 5E03A 4LAJH 4DZBA 4K8RC 1XF3A 1MJ8H 4XNXL 3IU3A 4XP5L 2H9GB 3SDYL 1UH3A 2YPKB 4GRLC 2HVJB 1QACA 1TCRB 5J9PA 1EO5A 3VXPA 3NA9H 4Y2DD 5EU6D 1N7MH 1P5VA 1CGSH 4PJAB 1AGFB 3L3DB 2FD6L 4PJ5E 1QSED 2PXYB 2F5AH 4MA1C 1C8PA 1U58B 5JPNB 1C7TA 1XGYL 4HG4J 1E0OB 4DFHA 1C12B 5EU7E 4KTDH 3C5SB 4D8PB 4I2XE 5EOQH 1F6FB 1YNKH 1T6WA 2VUYA 3HE7A 2HG5B 1MWAB 1UA6H 3R0MA 4GG6B 3F62A 3D0LA 3Q1SL 4RFOL 3STLA 1FYTD 1HN1A 2D3VA 3KR3H 3MLTB 3QZWA 2HMIC 4F7PB 2E7HA 3SPVB 4HJ0C 1KB5H 5GJSH 3AREB 3I3DA 3V5HB 1HNGA 2WAHA 4LPUA 1OGAD 2NY3D 1T7ZA 1XIWB 1GZPB 5FA4A 5DC4B 1OT2A 1DSFL 1IC5H 1QSVA 3S3SA 1UJTA 4IMKC 5INDA 4BZ2L 5DUBB 1SHMA 4P23B 1G7JB 5B4MC 1U8QA 2Q3AA 3MRKB 3HC4L 2W9EL 3O41B 3LOWA 3L9RA 3TA3A 3SO3C 1KIPB 3N85H 5FK9B 3D3VA 1T1WB 3VJ6A 2GJZA 3LH2H 1KCSH 2ESVA 2XTJC 3KLDA 2IADB 4ZFOB 1B0GA 4Z0BL 4JDTH 3LVEA 4RRPA 2D2OA 5GGVL 3FB8A 3MV9D 3QQ9C 4PJ5B 4I18B 8FABB 5JXED 5C07A 5F7EL 1OAQH 1UENA 4UU9B 3Q6FA 3FQNB 2DQGH 4M61B 1IQDA 5T3XH 5LQBH 4TN9A 1NAKL 3DX7B 1RZ8A 4U4BA 4I2XB 5EO0A 3KLHD 4K55A 2J4WH 1SYSB 3TVMD 4X98B 1MRFH 3BUTA 3QNXA 1D5MA 5IMOB 4XX1G 4MXWL 4NO3B 2XQBH 1ORSA 4JQVA 3B8YA 5E4EB 4H8WL 2AAVA 2X4OA 5AD0B 5DJ8B 1XGYH 3VFSA 4UT7L 3BAEL 3MRMB 4WI9A 5LKNA 2V5MA 3LEXA 5F1IA 4X6EB 1CD1A 2Z4QA 3T77A 5FO9A 2D7QA 5JDJA 1MAJA 3QUXB 1RD6A 4DEPC 1ES0A 5KS9E 4RFOH 1HINL 1CFQA 2ZG3A 5ESQB 3WLWC 3QUZC 2EXWD 3T2OA 4H0IA 2UVFA 4WTWA 4X4XA 4P2CG 1QBBA 1WJ3A 3HPJA 4NZJA 1FPTL 5FUOL 3EFFB 4ZNEE 4RX4A 1RURL 4LHUA 1DSFH 3GBMH 1CDIA 2XY1A 2IBGA 4MQ7A 5J6GA 1FNEB 4GMTL 4BZ2H 3WFHB 4LCCB 1ZHNA 1CT8B 1UB6A 3DLQR 4M6AA 3JV4A 4YE4L 5HTSA 5HI5C 2EO1A 1I85A 1YMME 3PF2A 3KPRE 3KNBB 4FTVD 4R7DB 5JR1L 3GSQA 1BVKB 5L6YL 1EVTC 3SDDC 4R3SB 5CUSH 1I1CA 3VG9B 4Z0BH 3GKZA 3FFCE 5D7JB 4UQ3B 1JWMB 3TNNA 3VI4F 5GGVH 5A1AA 1ZANL 4YZFE 3IDMA 2V2WA 4OFVA 1UZ6E 3WIIH 5L2KA 3OKMA 3GO1H 3VFPA 4AIOA 2NW2A 1X5KA 4QNPF 5KVFL 4V2BA 4U6TA 1NAKH 1PYWA 3MO1A 4LSQL 4NNXB 2B2XH 3BMWA 2LVCA 1GAFH 4X80H 3UDWC 4Y4HD 4D94A 4E41D 3RHWK 4HKXA 3BGFC 5L2JA 4N0RA 4FMFA 1SJVA 1RHHA 3BXNB 1D6EA 4Y4KB 4KHXL 3OR7B 1NDMA 4PJBB 3W0WA 1I1AB 2P47B 2GFBB 4FMKA 1J5OH 3BAEH 2BSED 1INEL 3DUSA 4G6FD 2JB5L 2OI9B 3GMPA 2EECA 5E94A 5I76B 4KV5F 4O5LL 5ESAB 4BQ8A 3QCTL 4NKOA 1UT9A 3D85B 3MODH 5I71C 2G5BB 2ZOLA 4KHTL 1HINH 2EDKA 3P77B 4NRXB 4U6YA 5AWNL 3I02A 2WZPD 2QTEA 4E5XA 3GSXA 3U9UA 3KPRB 4F7CB 1ORQB 1P53A 3GMQB 2H2SC 3T0VA 1S7TB 2OTPA 3WNPA 5EG6C 4F37K 4JHAL 1FPTH 5MEQB 5FUOH 4DGYH 4PJHB 4XZUA 4DKDC 4P49A 1TZHA 4JVUA 4M7LH 3TO2A 3FFCB 1MFEH 4OIAA 3PWJB 4K3GA 4GMTH 5MI0B 4ZAKB 4W6YB 5FV1L 2A6DA 1RAMA 4HUUB 4LCWD 4AENA 1OOAA 4ZXBD 3IDUA 3H7LA 5E99L 4UTBL 5JR1H 5HGDA 3O2DA 3C60A 5L6YH 4KJQC 1M1SA 2CUMA 2HJLA 2BNUB 1CWVA 1TZIA 4NKIH 2O26U 5HYIA 1Q9KA 3FTGB 2X4UB 1N5AA 3QH3B 3MRJB 2YD8A 1BJ1J 2P5WA 3MGOB 1CLCA 5TFSH 2EYSA 4JO2L 4HS8L 12E8H 1ZANH 2N4IA 5HDQL 2N56A 4D9QE 5IW1A 4R26L 2YWYA 4JFPB 5FYJD 4HBCH 5D93B 4DVRL 2IH3B 4NRYB 3C09C 2MKLC 4U31A 1NDGB 2NXYB 5EUOF 1YN6B 1KIQA 4LSQH 2D7PA 3BMVA 3S5LG 3MOAL 3QI9B 2W9DL 2DWEA 4R8WL 3RJDA 4Q9QL 4PRPA 4MAUL 3OKOB 1D3CA 3OF6A 5B39G 4KHXH 4R6UA 4ODUA 4W4OC 4OLWL 3BDYH 1RJYA 4XP6H 1I7RA 4F80A 3JTTA 3VXSA 2APXA 1CXIA 4QYOB 1CXHA 5IUSA 1TJHL 3GSNA 4O5LH 3BN9C 4K9EL 2A6JA 3BE1H 3QCTH 3QQ4A 2NR6D 2JK5B 1M71B 4KHTH 4DKAA 4WIQA 1JPSH 1JYWA 5FGCE 2EH7L 3GB7B 1CFBA 2VXSL 3KLAA 3P40A 4ONHB 3EYFA 2OP4L 3U82B 1A5FL 1HZHL 3VFUB 4GQ9L 5TDNB 4HPYL 3NVQA 1XR9B 4JHAH 4NN6C 3MOBH 2IALA 3L6FA 1GZQA 5EU4A 1ZGLM 1JNHA 4GJTB 5HHPB 2B4CC 1GGIL 4XBPB 1XF4A 1YY8A 3BEVB 3S35X 5D8JH 3DROB 1L4IA 2EICA 3D69A 5EORL 4QRRA 5SWZE 1IC4H 3UTTD 3SJVE 4YO0B 4UTBH 5E99H 1W0WA 2RGSA 1JI1A 2DBLH 3HFML 5ITFB 4EVNB 4IRSC 4WGWB 4PG2A 4ZODA 1FFOA 2H6PB 1KJMB 4KI1A 1P84J 4JFOA 2R4RL 1ZV5A 4H1LH 3UCRA 5DT1L 3RVUC 4AL8L 3DXAB 1BVLB 1EXUA 2ICWA 5HDQH 4MA3A 1MHHB 4GUPA 2APTA 3CC5A 4DVRH 1XGPB 3IS1X 3VXMD 2CR6A 3GIVA 3HUJF 5IM7A 1IGYA 2R0KL 2I07A 3D48R 3MRGA 1RK0A 4QHMA 3B2UD 4U6HB 4TTGA 1TTUA 4HWEH 1QPPA 4YAQB 2X4QB 3IGAB 3MOAH 4HEPG 3CLEH 4R8WH 4Q9QH 3DUHA 1KJ2A 1A2YA 1OCWL 1L0YA 4L4TA 5F1OB 3UEZA 1E4WH 1JNNL 3QO0A 3OXRB 4OZFH 4EI5D 2F54E 1FRGL 2GAZA 3MRFA 3BQUA 4OLWH 4YFDB 5J4MA 4OD3L 2VMFA 4H25A 1WITA 3VXQA 1Y0LB 2VLJB 3QUYA 4N8CH 5BZWB 3QFJE 2P7TB 5D7SH 3NTCH 3DIFB 3WE6B 1YQVH 5GS0H 5IHZB 3FOLB 2IQ9H 2F19L 4IRJB 2BC4B 1BREA 4X4MA 5T1KA 3VXRD 4K9EH 4IOFC 3HNVL 3OKDA 1A7QH 5ID0A 1D5ZA 2DYPA 2P24A 2GJ6E 1SBSH 2CK2A 4NPYB 1U3HA 4WFFE 5SWZB 3RDTD 5HHQA 2VXSH 3L5WA 3SJVB 2ATKA 3FL7A 1KENL 5DRWB 2DDQL 5DWUL 1A5FH 1B0RA 4G8IA 4FFVC 4HZLA 4XNZC 3SCMD 3AVEA 3D9AL 3RZCD 2OYPA 4RDQG 4OGYH 1JGEB 3HZYA 3GSRA 3FCTA 1MI5B 1OTSD 3B8SA 4NKQB 3MYJA 3QQ3B 1T3FA 4NIKB 4YUEL 4WUUD 1EUUA 3SO3B 1DLFL 4GBXB 4KAQL 2HVKA 2J8UA 4OZ4B 4HH8A 3TN0A 2C1PA 4RA3A 2IG2L 4P5MA 3HFMH 1D5XB 3ALXA 4OLEA 2AQ1A 5E9DE 2RCSH 3FQTA 4L3EE 4MQTB 1X5GA 4ODXB 3CFKA 1PW3A 4X0KB 1YY9D 5JDSA 5DT1H 4JM2F 3CVIL 3OAUL 3DGCR 1HKFA 1BFOA 2ADGB 2K3TA 4K71C 4OF0A 3CJJA 4IS6A 1BFVL 3VD9A 1FVEB 3V6OE 4OI9A 2R0KH 2V7HB 3QFJB 5INCA 3ZKMD 2AXJA 3TIEB 3P0VL 1QA9A 2APBA 3GM8A 4P4KB 3BFOA 1MLCB 2YS4A 1CQYA 4KKCC 3VD3A 1MIEL 2Q20A 2VXQH 3SE3A 1H5BC 5EIVA 2GJ6B 5BV7B 1WCQA 5HBBA 1JNNH 4LLUB 3TYFB 5CFHA 4PJFA 4UDUB 3QFDA 3ARED 2OR9L 2F19H 1XZ0B 4J3XA 5EUOE 4XAKE 4Q0XH 4DEPB 3HNVH 3VWKB 2VLKA 1XIWD 5GGRB 43C9A 5E8OA 1MCDA 1QO3B 3QUZB 1Q9OA 3MGAA 3HE6B 1O7SA 1I9JH 2L7JA 3O4OB 3CX5J 5F7FA 1VESA 1KENH 1AGEA 1J1PL 4Z7VF 1EDQA 3DHMA 1N0XH 3HG1E 5T1MB 4A6YB 1ACYH 1AHWA 1HHJB 2YBRA 3IDYB 3ZT7A 2LE9A 4NN7C 1R3HB 2JB6A 2CJUL 2R23A 3PUCA 3OKEB 1JGUL 1FSKB 2MHAB 4YUEH 5D5MB 3JZ7A 2WWKO 4O2EA 4WFEE 2MKWA 3RNKA 4KAQH 3SDXF 1G9ML 4PJ5D 2FH6A 4PJGF 3RWCB 4YDJB 5GGRY 1MFDL 2IG2H 2Y36H 1H3GA 4RWYH 4UBDD 4WNQA 2G75B 3FAWA 4Z7OE 1MCSA 4DOHE 4MNQA 1RZFL 4PIRF 1HOCB 3QDJB 3PWPA 3BH8B 1OAKL 5IW6B 5JLZA 2HFTA 4HXBL 5C86A 1YJDL 1BFVH 4NZRL 1UM5L 3D25A 3U0TA 5KG9A 4P3CL 3MTRA 2PO6D 1EEZB 5D7IB 3B5TA 3WNLA 4FFWD 3CVHL 3DURA 1MIEH 3ECBB 1DZBA 3QNZA 4U3HA 4NQED 2P45B 3HC3H 3QUXD 2UUDK 1AR1D 3D1MC 4YK4B 4CRPA 3AGVA 4N8VB 3AS3A 1T2QL 3TIDB 1DUZA 4R4BA 2R2HA 1CXFA 2R1XA 1LHZA 2OR9H 1H0DB 3CX2A 4R0LA 4L29B 3HG1B 5I71B 1T7XA 2QEJA 1A9EB 4KK5C 5DD6B 4ZUTB 4A2MA 4U1NA 5J11B 1GJIA 1KLFA 3QA3A 1MPAL 1IE5A 3D39A 5KVEH 2FJFB 4JFZL 1L7IH 2LU3A 4CMHC 4UQ2A 1FL5A 2A38A 1I9RL 1IZKA 4LEOB 4X8XA 2PYFB 4KGJA 3RGVC 5B38B 3FT4A 5IT2L 2UVEA 1SEQL 5KSBF 3PABB 5KVMC 5JXEA 3VXUE 2UUDH 1NCWL 2J6EA 4HG4K 3DTXA 4LLMA 1BJ8A 3HB3C 3EDFA 4NO0B 3GI9H 5D7JD 2CJUH 5F71A 4QHUB 4JGJA 4WY7L 1U8NA 1M6OA 4OZIE 3O3DB 3PHQB 1MFDH 5KANI 1IRAY 4GKZA 3UBXB 1RZFH 2PNDA 2ED7A 2IMNA 3HS0B 2R0LH 5F7HA 3VGAB 1R5VB 1LMKA 1OAKH 2XZZA 1PAMA 4Y4KD 3DVIA 4X6CB 2YD6A 4KZDH 4WTZA 4NZRH 1SVZA 3BVNB 1UM5H 4GO6B 3W2DH 3DMMA 5BW7A 1DVFC 4X5WA 1PSKL 4KWUA 5CBAB 1TVBA 3CVHH 4XBGA 4EIZC 3BPCA 1CQKA 1J88A 5DJDA 1CIUA 2B5IC 1OP5K 4Y5VB 4BK5A 1OAYL 1FO0L 4WU7B 1LNUB 1NC4D 2DB8A 4U1SA 1T2QH 2DQTL 4EI6A 1RUKH 3LRHA 1IGCH 1YYLH 1GSMA 2AQ3A 2R69L 4YHPA 3VD7A 4LCIH 5FM8A 2X70A 5AG8A 5BOPA 4MA8L 1NBVL 5HHMB 3KPRD 4OKVA 1VENA 1P2CB 3ARBC 3VXUB 1YEFL 1MPAH 1X4ZA 2AXGA 2X7LA 3CFEB 5EOTB 3VFGL 2CLRB 1X7QA 4JFZH 4G43A 1TPXB 3OQ3B 1X5IA 3IFOA 1MCRA 3QXAA 3F6LA 3RPIA 4NN6B 3BZFA 3DO7B 4MD4A 1OP5H 3WCYA 2PF6A 4MX7B 3FO2A 4LIQL 1A1MB 1NCWH 1PDKA 1N5YH 1S7RA 4WI6A 5DHYB 2BVYA 3MRCA 4L9LC 2UWEF 3C6LB 1RZIB 2XQYG 3LN5A 4JY4A 3JTSB 5BRZB 3FQWB 4KC3B 3S7GA 4Y4HA 2LU4A 1ZA6A 3BKMH 5LBSL 2FGWH 3IDIB 4P57B 1QFWM 3FT2A 4HQQL 4PPTA 4WY7H 4NUJA 3KJ4C 4XNYH 4IJ3C 3L7FB 2FJHA 3RAJL 1ED3B 2EE6A 4M5YL 3F12B 2NXYD 2DQDL 5DRNB 3VG0L 3EGSA 5HGAA 2WIMA 3QI9D 4K94H 2O93L 3K8LA 4LEXL 4XCNA 2QKIB 1KXVC 5KVDL 1QLEL 2UZXB 2YD7A 2NZ9D 1HH9B 3I6LD 5B3JF 4H26A 1XGRB 1I4FB 1T89A 3RPKA 5F21B 1PG7H 3X11B 1IARB 4PGZA 2FX7L 1PSKH 3QXTA 4PJ8C 3TC9A 2J5LC 1X5FA 4I77H 4S0SD 5DD0L 2VKWA 6FABL 3EOAB 4PP2A 4BKLA 1G7HB 5HD8C 1FO0H 2NPLX 5IESH 4PTUA 1MFBL 4HKBA 1AIFB 1IM3B 1OGTA 2R69H 1UFUA 3P9MA 1AXSB 1NBVH 1CTNA 1TITA 1FC1A 1LQSR 1I3UA 3K8KA 4UNTA 1YEFH 4RMSA 4GAJL 3VFOB 1KCRL 5C8JB 2R2BA 5GHWL 2V6HA 3BX7C 3VFGH 3LRSB 3RWIB 1XF5A 4G8GD 4P2OC 4JPVH 2A77L 1UWGL 3F58H 5HDOA 4LVHC 4XNZB 5IBUG 2EDXA 1RIVH 1FZMB 4IEFB 4Y4FD 3IT8D 4IOSD 3B3IA 3SE4C 5I8KL 1F00I 4LIQH 4JKLA 4H1LA 5C0EA 4RAVA 3EYOB 2VQUA 1QRKA 1OAXL 2KQMA 5EN2B 5IEKA 1IGML 4ZS6C 1MF2L 4XGZA 4RFEA 5TE7L 4K8RD 1I8IA 1R0AH 1AI1L 2JKXA 3DXAD 5FDYA 4Y16C 3MROA 3HR6A 4DKFL 2EYRA 5IJKC 4PTTB 3T0EA 1FFQA 4CDGC 3HHRB 5E8PB 3RAJH 5T5FL 4M5YH 3FONA 3F7VA 1FIEA 1HHGA 1S9VA 4YX2L 5FKPB 4H0HB 3OKKA 4BUGA 4OZFA 1VACA 4NQDD 1J8HA 4HD9A 3HZVB 3A6BL 4YXHL 1KCVL 4K71B 1FZKA 4E0RA 3LB6C 5KVDH 4KKBC 2LVEA 3BO8A 5GSVB 3CDYA 1PQZB 5EWIL 1OPGL 2I9LB 5EUKB 2R2EA 2X4RA 4MNHA 3HZMB 3TH4T 4MGXA 4ODWB 2VLJD 2BNRB 4GW4B 4RAUB 5ANMA 2FX7H 1Q94B 4U6XA 5ALBL 4JZOA 1H5BB 3OXSB 4OLUL 3DBXB 1NSNL 5I1DA 4CVWA 5DD0H 1AGBB 6FABH 1KT2A 1ZLSL 2OR8A 2HMID 4NNYB 3ROLB 5E2UH 4YDKL 3O45B 3PV6A 1MFBH 4HJ0D 5LVEA 3T8XA 4PY7B 4I48B 3CCHB 1II4E 1T4KB 3UTTA 5IIEB 2FEDC 5IVXE 4UIKH 3WHXA 4GAJH 1KCRH 3S34L 3FT3A 3V9FA 4ZQKA 3RHWF 1KN4L 3VH8G 1MCJA 1MI5D 1CGVA 5DJ0A 1VKXA 2A77H 1UWGH 1Z5LA 2BNQA 3MJ7B 3VFVB 3IS0X 4DKEH 4YHYB 4G9DB 3NFPA 5DVKA 5CSZA 1IAKB 1GC1L 3N1MC 5FECB 2P8LA 5LGHL 1A3RL 2MQ3A 4JFYB 3VXMA 3E6HA 5IQ9B 2MQCA 4K8RH 1MUJA 4ODVL 5FYKD 1MAKA 5ICXB 1OAXH 1DFBL 2E5EA 1U2CA 1MF2H 2BVOA 5TE7H 1TVHB 1N8ZB 1AI1H 2YMXL 3MCKB 2F8OA 2ARJA 4DKFH 3UPRA 4OIBA 1ACZA 2Y7QB 1NCCL 1UZ8B 4DK6A 5T5FH 5C0JB 3OPZL 1TETL 4NHCL 4YX2H 1PKQA 1EBAA 1I7TA 3QFJD 5FYLD 4F37F 5GS3A 2VERN 4PJCA 2P48B 4DQOL 5DLML 4Y8AA 2NY4C 4P4KD 4QXTB 4YXHH 1KCVH 4ZFGL 4GMSL 1A6VL 4JKPL 2OZ4L 1A6AA 4D0BA 1DE4A 2GJ6D 4KK9D 4WFFD 4NCC2 1GVIA 4M1GL 5DEFB 1VEOA 2JJSC 5DQ9B 5T1LD 2A83B 1LO3L 1P9MA 4L8SA 1FNLA 4XMLL 4OLUH 1NSNH 2HFFA 1F4XH 3Q3GA 4YBHA 3VWKD 4OGAD 1CBVL 3WL9A 1XF2B 2EDYA 2PYEE 4ELKA 1G7LB 2DQEL 3WLWD 4YDKH 1P84K 3QUZD 4R4FH 3OAZK 3QWQB 4MXQC 4O9HL 3SEPA 1LD9A 3HE6D 4G9FE 3H9SB 3B9KB 2LABA 3L5HA 3GNML 3K74B 3MRNB 5KAQG 4ELME 4WUUA 4M5ZL 1QLRA 2CIKA 2W0PA 4Z78B 5B3JE 4NQVA 1EO8H 5FO8A 4LOUC 4F15B 4LRNH 5DA0B 1AJ7L 5HJ3B 1KN4H 1XCTA 4L8BA 4C56B 1VGEL 4V2CB 2HJKA 1ZGLP 1DANU 4WUKH 4CNIA 3TWCL 4LVOB 3QIUA 1R5IA 1Z9OA 4N68A 4X8JA 4OLVL 1AXTL 1OARL 4P3DA 5CGTA 2GTWA 3K2UL 3SDDD 3MPCA 5LGHH 4CVZB 1A3RH 1P7KB 3PWNB 3WHE0 1ZHLB 5F9OH 4X7FC 2VDLL 5CJOL 4ODVH 3L3HA 5B8CC 3CAFA 1W2KT 3OAZH 3G6JB 2C4FT 5JQHC 1DFBH 5E5MA 1BJMA 3BEWB 5IMLB 4L9DA 1B88A 1WIUA 3LKPB 4M3KB 2YMXH 5HYEA 2APWA 3G5YA 3QDJD 5CP3H 4G8FB 4JFFB 3V8OA 2NLJA 1C16B 1OSZB 2FEEI 2JJVA 3MNWA 5C9JA 3PL6A 4W70A 3JV6A 4JCLA 1JRHI 1FP5A 5CILL 1TETH 3IRPX 4NHCH 3GJFK 4PGBA 5EFIA 1YECL 3OGCB 3EOBB 3TJHD 4XC1H 3V5KB 5DLMH 3QWOA 4XVSL 1SJHA 4ZFGH 1IVLA 3BZ4A 5FO7B 2PYEB 3NCCB 2OZ4H 4U1GC 1CR9H 1U95B 2GTZA 1CFTA 2V5RA 2ED9A 5IB4B 3MJGX 1HILA 3EO0B 1RHFA 3IDJA 3V8CA 4ELMB 1SYVB 5ISZE 2R0ZL 1YPZA 4XMLH 3LKNA 2G9HA 3PDOB 2B5IB 4HFWA 5SWSE 4KVCL 3L3GB 5IFHL 3FHQA 1ZHBB 3GMLA 3GDBA 1CBVH 4PJ7F 2B1AL 3DPBA 4ONFH 2ED8A 3GJFH 3REVA 3TBYA 2VLLA 1HSBA 4O9HH 3QEUA 3HZKA 2H2SD 3GNMH 2JELL 5D1XC 3EDKA 4QHKJ 4S1RL 1K6QL 5F7YC 4P2YA 4X7TA 1VGEH 1MEXL 3ES6B 3K4DA 2FR4B 1AKJA 1KIUA 4NO0D 3ZKXC 4QRSB 1L9NA 5DI8A 3VFRB 1FZJB 5H2BA 3RKPA 4QOKA 3WFDH 3RWJB 2DI9A 4OLVH 4XXDB 3GSWA 4N9OB 3HCVB 3V4PL 4KJQD 4AM0A 3K2UH 4UUJA 4L9LB 5IEHA 2VDLH 5CJOH 4TVSa 1KTDA 4D0DA 4PGCB 2HLAB 4HK3J 4GKNA 4DVBB 3D0VA 4HEME 3IJYB 3NBNA 1KN2H 2PO6A 2QR0A 4AT6A 2DQHL 2YK1H 2C3VA 3NIDF 3TBTA 5E00A 5I1JH 3FB7B 5D1QC