1H5BA

T cell receptor valpha11 (av11s5) domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
113
Chain Sequence
GDQVEQSPSALSLHEGTDSALRCNFTTTMRSVQWFRQNSRGSLISLFYLASGTKENGRLKSAFDSERARYSTLHIRDAQLEDSGTYFCAAEASSGSWQLIFGSGTQLTVMPVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MURINE T CELL RECEPTOR (TCR) VALPHA DOMAIN
publication title Crystal Structure of a T Cell Receptor Valpha11 (Av11S5) Domain: New Canonical Forms for the First and Second Complementarity Determining Regions
pubmed doi rcsb
source organism Mus musculus
molecule tags T cell receptor
total genus 24
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2001-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h5bA00
1R5WB 3LKNA 1RMFL 3KXFE 3RWDB 3SDCB 3CH1A 5DC9B 2WWKO 3RZWA 4IOFD 5DK0A 1CLZH 1V3KA 4TSBL 4HJGA 1P4LA 5SWSA 2WLZA 3ZE0E 2R2HB 1RZ8B 3CFCL 4XXDA 1ZA6B 1LNUA 2F53E 1EGJL 1L6ZA 3VXRE 4NUGL 4ZS7L 1UM6L 3WIFA 3N85H 1EVUA 4CVUA 4JPKH 4HUUB 4IS6A 3MV9A 4Q58C 2NY0C 4QHUA 4IDJH 4G8GE 1RIUL 3O4LB 4YAQA 4R2GC 4R4FL 5J13B 3EO1A 5DYOB 1JV5B 3GSNL 2X4PB 1DSFH 3F7VB 4M1GH 3VXUE 5I1DA 1EJOH 1AGCB 2C7UA 4U49A 2IFGA 4OFVA 1F6AA 2VH5L 5IMMB 3DO7A 1CF8L 1HQRB 1SJHB 1S78D 4JHWH 3VA2C 5MEPA 5DQDL 3RJQB 1GZQA 4TVPL 1N5YH 5C0DA 3MFFB 1R3JA 3OKLA 1TVHB 5EOCL 2HLFC 2PYFA 3P0VL 2VB5A 3V7MA 2AJVL 2J5LC 5CILH 5FK9B 2VDLH 4MB5A 4JFEE 5D5MB 1C16A 4FP8H 1T83C 1WZMA 2MQCA 3DVGB 5L8KB 3IFLH 3LDBB 3T77A 4LLQA 1I1FA 3GGWB 4ONHA 3BKYL 3FQWB 3MLYL 3OKOA 3VFNA 2Y6SC 3KPSA 3ET9F 3TN0C 1U8MA 3P73B 4Z7OE 5JOFB 5INDA 4HPOL 1UJTA 5I1AA 2AXFA 2ATPA 4U3HA 3HC3H 4ODUB 2Y07H 1GGUA 5IHUH 4XX1E 2ADIA 1MUJB 4GAFB 3VFOA 4ISVB 1PG7L 1GHFL 1KYOJ 2LTQB 5FYKL 3MRBB 3HS0A 4R97B 5F6HI 1ZLWK 1KEGL 3D87B 3B2VL 4MLSA 3MJ7A 4N8VB 5EOQL 3EJYD 4P59L 1U8NA 3IU4H 4MS8D 3GKWH 5TPWL 3MC0A 4DW2H 5JTWA 3QIWB 4L8BB 3HCVB 2Z4QA 5DEGB 2LV4A 2XFXB 2E27L 3MACH 4NFBA 5A16A 5IFHL 5L2KB 4WU7B 3H3PL 4N8VG 5JOPD 3GSRA 3E6FA 1J1XH 4NKMA 5C0CE 3JTSA 2HTKC 4KKLD 1S9YA 5TQ2H 3FHQA 3MBEA 1H8OA 2A74A 3QNXB 3LSOB 1T21A 2OXHA 5C70A 3DVNA 2D9QB 1UB5B 1T7VA 4B7LA 5HYEA 2EO9A 3U0TA 2WANA 2H2PC 2QSQA 3U9UB 4GRLA 1IEBA 1AI1L 3IB4A 2Y7QB 4Z7QE 2JTDA 4DJMA 4O5LL 5JO5A 5IQ9A 1F6LL 3V6OC 1KTDA 2AJZB 5GRUH 4KVNH 2AVGA 5HI5D 2Y5TB 5F9AC 4OF7A 1LO5B 3TPUA 3L3KA 4L4VD 1KJ3H 2NLJB 1UH3A 4WW2C 4QRQA 5GJTH 1ED3A 4LCWD 2F54E 4LHUB 2PYEE 3LY6A 3I6KA 3T8XA 5E8EA 1FL3B 2G60L 1CL7I 3K46A 2JB6A 4X6EB 3IFNL 3T0BA 2V2TA 3RNQA 5J89A 1SYVB 3B5HA 3O2VH 3RTQA 4OF8A 3GB7A 3H9SB 1U58A 5ICXB 1NBZB 4LHUG 3PV6A 4OZGB 3T0VA 2YOCA 5F89B 1NQBA 4DUWA 3Q2CA 3BEWB 1HH9A 3PGFL 3DETC 2E8ZA 4WCYH 3W11C 1EBAA 1Q72L 1MY5A 1WT5C 4LLMB 4ODTL 3IKCB 3ARGD 5GRJL 1NCAL 3QDGB 4LCCC 2FJHB 3CIQA 3M8OH 5EOTB 2AKRA 3IXTA 5KN5B 1LO2L 2XTJE 3TIEA 2DDQH 4ZO9A 5IT2L 1BEYH 4GKSB 3FZUD 2IMMA 1QYGH 1JCKA 1VCAA 4P2OD 2A6KA 3MLZL 2VRAA 4G8FA 4XNQB 3UX9B 1BLNB 3N1PC 3DX7A 4NQCB 5KVDH 4QXTB 1BD2D 1U8HA 4BFEA 1YEJL 1C5CH 4ELMA 4YEFA 5HI3D 4MAUH 4I2XA 1VACB 1MJUH 3KYNB 1D6VH 3KYMA 4U3XA 3SKNA 3C08H 3ZSSA 2X4NB 4P3DB 3A6BH 4PG9A 1ZVYA 3IJYA 5DI8A 3QUZA 3PP3H 3FFCB 1NC2B 3ARDB 1MHEB 1Q1JL 4XH2A 1MWAB 4OGYH 1JPGB 2NPLX 4YHOH 2X2YA 4FTVE 2BC4B 2W07A 5F21B 1S5IH 1IC5L 3PUCA 3PL6A 3Q3GB 1GRWA 2D9CA 2EICA 1MFBH 3B9KC 1H8NA 3BGMB 4NO2B 4QTHB 2FHBA 1PKQA 4YPGB 3VA6A 3P9LA 3DROB 3KPQA 3W82A 3T2NH 5E9DD 4EDWH 4XP4H 4P5KB 4P5TD 1D5XB 3KJ4B 4UBDC 5E2TL 1NEZB 4AEIH 2R8SH 4PFEA 5DVKA 1YEIH 2A6IA 4RGNC 3UDWC 5JHLH 5DQJB 2FR4B 3S37L 5J3HC 3QQ4A 2FB4L 2K1MA 4XHQA 5HDOA 1NEZG 4GW5B 1IJ9A 5GRYA 5ILTH 5DA4A 3VWKD 1OW0C 1LO4H 1MREH 4S0SD 1JK8B 1FYTD 4UT6H 2YWZA 5B38B 4NGHH 5FYJD 3BP4A 5J12C 1MH5A 3QUMH 5K9QG 1IQWL 4F9PA 1LO3H 3I02B 3BVNB 4NN5B 2X9YA 4PJEE 5B38G 2XA3A 3IJSA 5IMLB 4DCQB 3SPVB 1Y6NR 4JO4H 4LARH 4JCLA 2BHUA 2MCPH 1HSBB 5ESAB 2X5PA 3FONA 5E8OB 2XZCL 1EEZB 5GZOC 1GOFA 1JWSA 1Q9OB 1YEDB 3MLVH 3IJHB 2PXYB 4KRPD 3STZB 1J0JA 3VWJA 3QUMA 4FXLA 3FAXA 4K3DL 3NIGF 5JA8B 5CJ8A 5CWSB 4J6RH 4L1DA 4XMLL 1Z9MA 5JORB 1QNZH 3LKQB 1BM3L 3O3AA 4JRXB 4XT1C 5D1QC 2ADGA 5FKPB 5IJKA 1SHMA 4D9LH 5IB2A 1CK0H 3EOBB 4FZ8L 4KJPC 3CXHK 2D7QA 4L8SA 4KQ4L 4NO3A 2EIDA 5AUMA 5LGJB 2YA0A 5L8JB 1K4DA 3GI8L 2ZWLT 4LEXH 4CN4A 3GMMA 4M61A 5DJ8A 3TF7C 4KK9D 5IB3A 5IP4A 5GGRY 1J11A 3G6JB 1RZKH 4RGOL 5DHVH 4TULL 1WGOA 2IPTL 4FXKA 4DN4H 3ZKXB 3D39D 4D94A 2R9HC 5C09A 1NCDL 1J18A 3D25B 1O7VA 3CDCA 3QQ3B 4XBEL 4YHYB 4YH6A 2NY3D 4EDXB 1JMZA 1YEFH 1SJEA 1FC1A 3MA7A 1Y6MR 2MPAL 4NQEE 5GRWA 3FQTB 4Y5YA 4AH2B 4QNPE 3KXFD 2ARJA 4LKXB 4Q2ZA 1PZ5A 2AV1A 3BSZH 5I8EA 3S88H 5I30L 4FFZH 4M3JA 5C2BL 3NFSL 4R7DA 3MNZB 5DHVA 3QAZC 2BNRB 1RUKL 2O5YL 3U7WH 2V17H 3ARBA 1CG9B 4PG2A 5FECB 2ZOKA 1UA6H 4P99A 4QRRA 1Q9LB 5FO9B 1DBBL 4GBXA 1EUTA 3WFDL 5EUKA 4PUBL 2F53D 2C3VA 4V1DB 2DM7A 3VXRD 4UIMB 3AS3A 3QEGH 4QHNB 3MQIA 1FO0L 1T5WA 3S36X 1BZ9B 3G04B 2VLLB 5ERWB 3SCMD 3V5KB 4U4BA 4F8TA 3BUYB 3C8KA 5DZOA 1MQKH 4RBPK 3RHWF 4PJAF 4QHMA 5BJTB 3WSQH 3BWUC 4QT5B 4DZ8A 3UYPA 3VXUD 1YY8B 3AMKA 4WV1B 1A6VH 5D6CA 3NZHH 5JZ7C 2ZJSL 4BM7A 2PF6A 2VDNL 2RCSH 4JFXB 2ZCKL 1TDQA 1CGYA 4HULB 3X17A 5HJ3A 1P5VA 3HR5B 4XP1L 2R4RH 2VXTL 1C08B 3R06A 4MZ3A 3UBXI 1HIMH 1I9RL 1JF6A 4JREB 1OP3H 4JFED 1AP2B 1EEYB 2HJLB 3QG6A 4Y4HD 1BWWA 5B3JF 3EOAB 3QWRA 4DAGH 4PRHA 1BQHA 1U8LB 1EHXA 4PJDB 1NFDA 1UADC 1JRHI 2XKSA 4PB0L 3WE6B 2BVUA 2A1WL 1DANU 3MRIA 3O8XC 3TA3A 4GW1A 1FN4A 1T20A 1AO7B 4Y4FC 2NY1D 5KVEL 3EW3B 4OCSL 1LVEA 4FQCH 3AS2A 3MLWL 4UTAL 5IHZB 3C87A 1A6ZB 1RULL 2GSIA 1U3ZA 1XH3A 5C07E 3REVB 5D72L 4CU6A 4MD4A 4AIXA 2VZ3A 4F33A 5GISH 1AR2A 1MI5E 1KENH 1ZT4A 2VN7A 1NLBL 4BZ1H 4APQB 3ARQA 4PJBE 4K2UH 5EB9A 1R3HB 1FE8H 4JY4A 4R7NB 2I9LB 1R3KB 4X9HA 4YHZH 5C0RL 3BPOC 3CVIH 3FOMA 2DQJH 4DEPC 5IM7A 2AXHA 3P3YA 1GGBL 4OIIL 1AKJB 5CJQL 2HFEB 3THMH 5C0CD 1C7SA 2F8OA 1A7QH 5D7LA 3VDBA 4Y8AA 5D7JC 3HE7D 5CMAA 1AY1L 3ECBA 2HMID 1W0VA 4ZPTA 2OS7A 3IETA 4RFOL 4Z7VE 1JGLL 3EOTH 4JHAH 1JZ8A 3EDJA 4KI5F 3LZFH 4Y1AA 1RU9H 1F4WL 3SDXF 4LRIC 2XKUA 2VL5B 2NY0B 1G1YA 2YZ8A 5JHDB 3N9GL 3CVHB 3CCHB 2FZ3B 3QI9A 1M7IA 4JANB 4R2GB 5DHYA 3TYFB 2BVOB 3KGRA 1CICC 3SQOL 1JI2A 4HF5L 1G7LA 4P4RA 2DIAA 2Q3AA 2VDQL 2F54D 4M1DH 2PYED 3O3DB 3RI5F 5H2BA 2FJFA 3MODH 3PP4L 4QOKA 5IB5B 3RHWK 3TZVA 1FZKA 4PJ5B 1QRNE 5E5MB 3PGDB 5BXFB 3OX8B 5KSAA 5GGVY 2J5LB 3GSXA 3VXPA 1F58H 1JPFB 1WAAA 4I48A 3LKRA 1T1XA 5EZLA 1A4KB 1OSZB 3VFSB 2GTWA 5FO8A 1D3CA 2BVYA 5FUZH 2R1WB 4QHKI 2ZG2A 1CR9L 2I07B 5CJOH 5KW9H 4OZFA 5GQBA 3BP6B 3TN0B 1CVRA 2BJML 3IDJB 4AQ1B 1N7MH 5E7BA 3S7GA 2XTJD 4HG4K 3EFFA 3LKPA 2B4CH 5A2FA 2XA8L 3QR2A 4NUJA 4KVCL 1WFUA 4IRZH 1G7PB 3GRWH 3WL9B 12E8H 2X4UA 3S97C 3U79A 3ULUC 4UV7L 3RL1A 3RIFF 3RPIB 2AK4A 4NQSB 1KLGB 1OQXA 4W6WB 1AE6L 3ISWA 3S9DB 5D9SA 4C58B 4QXGH 4JPIB 1IGYB 1A6AA 1WZ1L 5EBWB 1WBXA 4TUJB 4P3WA 2DWDB 4WFGD 4Z0BL 4I4WB 5TE7L 1IC4L 2BX5A 4HMEA 3BP7A 3GRWA 5LGHL 1PFCA 5F9JB 5IIEA 1YECH 4P57A 1RZGB 5DUBB 4FTVD 7FABH 3BQUA 3IU3A 4XVUD 3O6FD 5AD0B 3HPJB 5ALBH 1A5FL 4RBPH 3SDYL 5GSVB 3N06B 5JR1L 4HS6A 2JK5B 4KKBC 3ZKNC 4LNRB 5IEHB 1MCCA 1EDQA 1LDPH 1S7UB 4L8DA 3AY4A 4WW2B 4PRIB 2IQ9H 4OCRH 3AB0B 5C1MB 3G5VA 3DVIA 1EVTC 1J1PL 4QRTB 3WFBL 5F3BB 4F3FA 4MHHI 5IMOA 5FYJU 5C0IA 4NIKB 2V2XA 2L7JA 4I3RL 5EN2B 3IKKA 4J3OC 1KT2B 1RUAH 3KPRE 3F12A 4GRWF 2EDXA 3MLSH 4JY5H 2GJZA 5E94A 2ADJB 5DJDB 4G9FB 1UC6A 4OFYD 2EYTA 1AGFA 4XPAH 1VFBA 1S7VA 1MRDH 2XNAA 2VAAB 3STBA 1KTKE 5DQ9A 4FS0A 1JZ2A 1EEQA 3ULVH 2MKLC 2GCYA 3ULUL 3L1OL 2Z9TA 5HDBE 1X4ZA 3TT1H 5EUOF 3N0PB 1AXSA 2ENYA 1SEBB 3HUJE 3S36L 3FO0H 3PJSA 2EE6A 1GGIL 1NBYA 3GUTB 1AGBA 4MXQC 1CE6A 3F7YA 1EXUA 4ZFZA 1M7DB 1NBQA 6CGTA 4M3KB 5EIQA 1MCRA 4MAYD 5E5RB 4CGTA 1XAUA 1RK0A 3LCYA 3C09C 4ONFL 3WHE0 1E6JH 3O3EB 4IEFB 3U36B 1MNUH 5TE6L 5IG7A 5CCKH 1TQCB 4KJYB 4FZEH 3V5DB 3L7FA 4Q9QL 3T0EE 3RFZC 5H37H 3WJLA 1UZ6F 2OR8A 5C0GA 1MPAH 1GAFL 4JZJB 4IRSC 1RIHH 2P24B 3AXLB 4YHLH 4NQED 3TVMA 4KJQD 3ZTNH 1XGQA 1CGUA 4LLAA 1OAUH 1IGML 2E6PA 4L4TA 3JXAA 4GG8A 4M4PA 3RNKA 3VXMD 1YNTB 4NDMA 2PO6D 5IFJB 4HK0B 3SY0A 3K1DA 4ZG1A 4CADA 4ODHH 5ITFA 1N3NA 4I3SH 3MRLA 2XYCA 4KI5C 4PP1C 2DM2A 1CXLA 2HJFA 4RGNB 5BZDA 5E2WH 1F3RB 2NYYC 5CBAB 4NHUB 1EEUA 2YD6A 1MCBA 1L0QA 4MCYB 1I1AB 3IDXL 2X70A 5EO9B 1OGAB 3UYOD 5T5FH 3T4YB 2DQCH 1EHNA 3DSFH 5GS3A 1CDIA 1X5XA 5FUOH 4OF0A 1WEJL 4OLYL 5INCA 4X7CC 5BV7C 1JUFA 3OKMA 2EZ0C 3CUPA 5EORH 2WUBH 1IM3B 3A6CL 4LDLB 1DEEB 4D2NA 5HYSA 2WWMD 1BQSA 3TNMB 3VD4A 1FDLH 2BY1A 3FHAA 4LP5A 1FV1B 5GIRB 4U1KB 4PLJC 1IQDA 2D7TL 3QZWA 1HHIA 2OTUA 4L3EB 4U6XB 4I18C 2Q8BH 3DHMA 4F58H 5I6XB 1LD9A 4KZEH 2BXZA 3BEVB 3U9PL 5KVGH 4G6AC 2IGFH 4NNXB 5DT1L 4KUZH 5H35B 5KSBA 4YR6A 2CKBH 1SJVA 1JNHA 2V9RA 5HPMB 4Y4KC 5D1QB 4AL8H 1YJDC 1GVIA 3ZDXF 4QCIB 4MWFA 4XP5L 3HPLA 4MQTB 2N7AA 4BQ8A 4Z5RB 1DBAH 1YY9D 3LKOA 4KXZH 3QIUD 3UC0H 3DO3A 1X5LA 4XNMA 1M71B 2CK0H 2Z93A 3BIAX 1NSNL 5L0QC 2BNQB 4JDVB 3OAZK 4ELMF 4CU8A 3HMWH 1UWGH 2ZUUA 1JNNL 4PBXA 4V2BA 5C07D 5DJ0B 4AJ0A 2CKBA 2JB5H 3O4LE 5FF6B 4KDTA 3C5ZA 3LN5B 2E7LC 1HZHH 3C6LD 2J88H 3EYOB 1MI5D 4QRPB 5BVPL 3NIFE 2X40A 2FX9L 1S7QB 3O4OC 5A3ID 1P6FA 5KSUA 1MCJA 4FQQA 1KJVA 3NCJH 4YNYB 2OR9L 1KPUB 2YN3A 5FKAB 2QHRH 1EFXA 2D4FA 5T1DH 1NCCL 2FHCA 4WDIB 1A0QH 2RB8A 2IBBA 2Y72A 1BVZA 3QAZB 1UJ3A 2JJTC 5HTSA 5I74C 3GIZH 3W0WB 1SYSB 2FX7L 4PGCA 1S7TB 5E8PA 3BN3B 5D5ME 3MOAH 1W2KT 1F4HA 2A38A 5IVXA 4B50A 2PN5A 3IVKA 1T89C 5A1AA 1LE5B 1UVQB 3I3DA 1JHLH 1MELA 2DI8A 4V2CB 3F8UB 1LGVA 4JQVA 3MV8A 4X0KA 2FEEI 3MLTB 3TYGL 1OY3B 3S96A 4OZIA 5D2NA 5TDNA 1OAYH 2DQUL 3PWPD 2Q6WA 3CFDA 2NY6C 3V0AC 4NJ9H 2YPKA 1RUQL 4P9ML 3RVTD 1OCWL 4LCYA 3RVUC 4JJHA 1FVEB 1L7TL 1IAOB 2VDKL 4QY8B 1MHPH 4LEOA 3LEYL 4RIRB 5I1CL 3E3QE 4BKLA 4PJ9B 2I60L 3HG1E 3LIZH 1J05B 4JHBA 3KPNA 3BHBA 4J7RA 1D5BB 3QCTL 4PIRF 3MLPA 1QRND 3MRNA 4LIQE 1QACA 3VD5A 3U7YL 2ICWB 4YHIB 3GNML 3LN9A 3HTLX 2DJSA 3T2PA 4R90L 3HI1B 1IMHC 2GY5A 4L5FH 3MO1A 3L95B 1I8KA 3MRRB 4PJHF 1FG2B 6FABL 5IBLC 2NXZD 3JBG7 4KROC 1EAPB 1IZKA 1W0YT 3O8XB 4TOYH 3I3EA 4IOSD 3WV0A 2AJYH 4NYLA 2X89A 7CGTA 4OLUL 3DGCR 3FQXB 4OCYH 3SOBH 4NZJA 4PJXB 4Y4FB 3T2OA 3SE4A 5L7XL 2D7MA 3CK0H 3K3QA 2X1QA 1U8QB 2AAVA 4XCCL 1V7NL 3TO4B 3QJFB 4YHNA 3C6SA 3WFEL 1BVKA 1Z6JT 2FO1A 5F7NC 1RURL 4HH9B 5CGYC 4YQXH 5I1EH 4Y2DA 3BT2L 1MJ8H 1KEML 1QBML 2NY7L 1HSAB 2HVJA 1Q0YH 1DZBA 1EHLH 3V95A 1JGEA 4ZTPH 4JRYA 4IJ3B 1VENA 2EIZA 4HIXH 4R3SA 4AMKH 4P46C 3BPOB 4I5BA 4XNYL 1OAXH 4DEPB 2IF7A 1I4FB 3EZ8A 3OZ9L 3QHZL 3H9SE 3QYCA 3I9GL 1IVLA 1WBYA 3BWAA 4OZGE 4X9FA 1FGNL 5HY9A 3O6ML 2P5EA 2IH1B 3MBEC 3NBNA 5ESVB 2Z91B 3ILQD 1OD9A 1MF2L 1PX4A 1YNLH 3MRCB 2KL6A 2AXGA 3NCEB 1U36A 1OTUD 1KCKA 2JKXA 4RMRA 4P5MB 2NY4D 3QDGE 1H0DB 2IPKB 2DQFA 3QCVH 1G7HB 4GRLC 4U3CA 1CLZL 1CXFA 5CINH 3C60C 2VOTA 3QDHA 5EPMB 3WJJA 3UJIH 1D9KC 3OKDB 1H15B 1KC5H 1QLRA 5AZ2H 3JV0A 4F37F 3PNWB 1HYSC 1CICB 5IB4A 3S5LA 1VA9A 1FBIH 5BS0A 3VJ6B 1QFHA 1EA9C 1QUNA 3GMRB 2I27N 3MMEA 5EC2A 3N85L 4PRPB 4NQCE 2WINB 4JPKL 4IOIA 4RISH 1GSMA 4KDWA 4H88H 3WD5H 1FVDB 4IDJL 5L6YH 4P2RE 3IGAB 5GHWL 3QUYD 2OSLA 3KPRD 5BMFH 2UZYB 5F1IA 4M1GL 1KPVB 4GRMA 5ADPH 1INEL 4QWWC 1EJOL 1JHTB 3QNYA 5T33H 1FAIH 2EDWA 2ERJC 1JGDB 4XGZA 5FV1L 1DUZA 4Y8DC 4JHWL 3RL2B 1I85A 4MJIA 2BVQA 4MNGB 1A4JA 1QLFB 3WKML 1N5YL 1QR4A 4U6YA 2PW1B 4U1IA 4JQXA 4LKCA 1Z5LB 4KY1H 3VG0L 5DRZB 4GAGH 1JWUB 1K5NB 4F2MB 3NFPA 5CILL 4JFFB 3WNKA 5K33A 2VDLL 4BSWB 3CSGA 3M1BA 3MGAA 2ESVA 2VDRH 3ZTJH 2QSCH 2YUZA 3B9AA 3IFLL 3Q0HA 1N8ZB 1TENA 4F7MA 3P4LA 4NKDA 1B4RA 3MLXH 1M05B 2HT2D 1TZHA 1B0GB 2IAMD 3U30B 3SJVB 4MJ6B 4PJGF 1KCVH 5DD0L 3EOYG 2MNUA 4J12A 2WBJA 5ESQB 3IAGC 1E28B 1F90H 3P4NB 4YDJB 3QUXB 5AZEH 4I0PA 2X09A 4ZYKA 3O9WA 5F1NB 3HC3L 1I75A 2A0LC 2Y07L 4H26A 5IHUL 3DGGB 2BVPB 3OGCA 4Y5VA 2XWTA 2F5BH 2VYRE 5MI0C 3NFNB 1RZFH 4RNRB 3JUYA 3JWDL 1ZEAH 5C0EB 5DDHA 4O02H 3FO9A 1OP5K 1U8PB 1JPSH 3GKWL 3UZQA 4DW2L 3TC9A 3T0ED 1QQDA 4DTGH 1ZHNB 3MACL 3IXAA 4JPVH 5C6WH 5J1SC 1J1XL 1Q9KB 1QRKA 4Q9RH 3WYRA 1F4XH 4LPCA 3T4AA 5TQ2L 2BOCA 1A14H 5FOBA 1CU4H 5E6IA 4OT1L 3ARTA 2X4SA 2GJJA 1E4XH 5IVZB 5E8NA 5T1MA 5A2IH 3QPQD 4JRXE 4YHKH 2P43B 4PJAB 1J0ZA 2VITB 1FNHA 4MQSB 4F37K 4MA7H 1CYGA 1DQTA 3L3JA 1BOGB 3HRZA 3UTSD 1YDPB 5GRUL 3V6ZA 4L4VA 4KVNL 3V0VB 5I66B 1FQ9C 5E7FA 1S5HB 2CLZB 5KZCD 5DXWA 2H41A 4LCWA 1KJ3L 5ISZB 3VXTB 4F9PC 5C2UB 4M7LH 2AEIT 3GMNA 1MVFA 2VLKB 4UDUA 3FJTA 4POZC 3S3PA 2DWEA 3BRGC 4NT6B 1A1OB 3UEZA 5HGHB 1CT8A 5C0JB 4BH7B 1NL0H 3O2VL 1WAAF 1TNNA 2OL3B 1NAMH 3MJ8A 3TBTB 43CAA 3OKEA 2R2CA 3GBMH 2WV3A 3NOIA 3X3FH 1DFBL 3VWJC 4WCYL 3JV6A 4EVNA 4DGIH 3CH8A 4RDQF 3NCCB 3P0YH 4OF6A 1YNKH 3S4SB 3KNBA 2BNRE 4R4NC 5F1SA 2W65A 4HWZA 5IJKC 2VE6A 3M8OL 3D18A 2DTMH 1NAMA 3S4SG 2DDQL 5TH2A 1VADB 1BEYL 2ENSA 4K7FB 1BFOB 4X98A 1NUFA 1QYGL 4TTDC 3C09B 1XF4B 2XTLA 1BD2A 1J8KA 1YMHA 5SWZB 3IAPA 2UZIH 4WEBH 3OG4B 5KVDL 3O4LD 1D5ZA 5ICYB 3DXAB 2GITB 4NCDA 5L9DH 2GT9A 3B5GA 2IFFH 3VGFA 4MAUL 5HI4C 5ANMB 5SX5H 1MJUL 4U1NA 3MGTA 3DI2B 1LHZA 3C08L 4O4YL 1O5DT 4OTXH 3A6BL 4Y5YC 4JFDA 1XR9B 3IAQA 5B4MD 5DJ2A 3TBYB 4O2FB 4TVPE 3PABA 4OGYL 1L9MA 1MHHB 4OGZA 1BFVL 2E7CA 4PG2C 4YHOL 3RP1A 1UKSA 5IR1B 1S5IL 3G6DH 3SDXB 5DD6A 2FH6A 3ARFC 4LBEA 1MFBL 1GGTA 3U2SB 1EO5A 3BZ4A 3IFPB 3NGBC 3GMQA 5I17A 5E9DA 4YXHH 1YN6A 1TVBB 2HKFH 3QEHB 4HIIB 4J1UB 3KPPB 4PGEB 4OFPA 5FYJH 3T2NL 4PJ8A 4EDWL 2BDNH 4XP4L 4GUPB 2DLEA 3GK8H 4KV5F 4D0BA 4DOHB 4AEIL 2R8SL 1FFOB 3D85A 1AH1A 5IJVA 5BV7B 1I7RA 2Q86A 1YEIL 4QO1A 4EI6A 1QPPA 5JHLL 2R0LH 4D9QE 4XCNB 1CDHA 3AS1A 4FFWD 2JE8A 1P7HL 2YA1A 1FYTA 4LP4A 2HP4A 2SEBA 4G8EB 4UNVA 1JWMA 5ILTL 2BY2A 3O2WH 1LO4L 1MREL 1XGYH 4UT6L 1U92A 5TDPB 2R0KH 4OKVB 2I26N 4M6OH 4MA3B 5M94B 3RUGA 4LOUC 1MCEA 3MRQB 4NGHL 3JZ7A 2DQHH 1FNAA 3O0RH 4I18B 3CAFA 3QIWD 3QUML 4PTUA 5HHVH 1LO3L 3ESUF 3LQMA 1RVFH 4RZCA 1KIPA 5L2KD 4WHTA 3QRGH 4J4PD 1A1NA 2J4WH 4RQQA 4WWKC 4X83A 1VSCA 3ZT7A 4JO4L 4LARL 3G9AB 1WTLA 1ZT1A 4Y4KB 2MCPL 4EN3B 1HOCB 5I0ZA 5BW7A 4DK6A 4CMHC 1A3LH 4FG6C 2VSCA 3L3HA 4MDJA 3MLVL 4O2EB 4PD4K 4HIJB 1MQ8A 4N5EC 5HGBB 1A2YA 2GKIA 4GAJL 3DX9A 3EYQC 2CMRH 5L0QB 4UNTA 1OT2A 3BP5A 3K2MC 4PRAA 4ZUTA 1SVCP 2NY2C 4J6RL 1PZUB 1IKNA 2JCCE 3FFDB 3MX0A 1QNZL 1VFAB 3VXSE 5JHDE 2HFFA 4K7PH 4D9LL 2EDNA 5JW4Q 4I9WE 5CUSL 3VFPA 1CK0L 5IW1A 3CFKB 5EFIB 3ULVF 3UCRA 3O4OB 4X6CA 4LEXL 4LHUD 4WFFE 4M00A 5DRXA 1B0RB 4UT7H 2ZSVB 1RZKL 2WSKA 5C0FB 3ZKMD 3D39A 1KSRA 3TWCH 3G5XB 1B90A 1J9CT 2HFTA 2C4XA 4DN4L 4PJ5E 3H9SD 5I74B 2V7NB 2B1HH 1T6WA 1S7SA 3GSUB 4OLVH 4XHJC 5E1AA 1YEFL 5DSCA 1LNUB 1IGJA 5DEFB 3EHBD 3BAEH 4E41A 4S1SH 5HHNA 3DURB 3BSZL 3S88L 3QDGD 4FFZL 1R0AH 4M6AA 4M6NH 3LRSA 1D6EB 4X80H 3U7WL 5JNYB 3QFDA 4WNQA 3QI9C 1QP1A 4HC1H 2NY6B 5CAYB 3EO1B 2AEQH 3L3OA 3DRTA 2LU7A 4I13B 3VXRA 4URTB 4R0LA 5D4QA 5I1DB 4G9DA 1XGPB 3TM6A 1MFDL 2H45A 3QEGL 1X6LA 5KS9B 4NQCD 4LASH 4GRWB 3TPKA 4HFWA 4OV5A 1GZQB 4N0UE 3TZVC 3IF1B 4ZUWA 1AD0B 1CD0A 1MQKL 1H3XA 2G2RB 3VXUA 4HC1A 1AGEA 3WSQL 4CBPA 1U41A 1GZPA 3DUUB 1A6VL 3LQAH 1WTGT 1G9MH 3T77B 3FFCD 5EULV 4KROB 2H2SD 1NC2D 2RCSL 3ARDD 3LN4B 4ONHB 3OKOB 2R4RL 1FFNA 1FPTH 1FZMB 2BY3A 5CEXA 1RJZB 3CC5A 5KSBF 1HIML 5EUOB 2APBA 2EYSA 4Y4HA 1OB1B 1KJ2B 3CLEH 3GIVB 1T04B 5C08A 3E2HC 1X4YA 2P7TA 2ZCLH 4HEPG 5JW4N 4DAGL 1LEIA 1ZS8B 3V7AG 3V6OE 1F8TH 1AIFB 2YD9A 1WIUA 2LABA 4XP9L 2X1OA 4PRIE 1U8NB 2W9LA 1P4BL 4FQCL 1AC0A 4D0DA 5FYLL 2R2EA 4LDOB 1WFTA 4P46B 3FN0H 1NPUA 4KC3B 3I6GA 1NANI 3BESR 3W81A 4X8JA 3QH3B 1JHKH 3V52H 3GSRB 2ID5A 5D1ZD 2EXWC 3ARPA 3X13B 1KENL 4BZ1L 3MBEB 1WC7B 4NQXA 5CEZE 1ZGLB 4K2UL 3UTQA 1FE8L 4FQ1L 1FNFA 5I2IB 3BQUC 1T3FB 3SGKC 3KWWB 4YHZL 3CVIL 3KS0H 4F7TB 5C0CA 2LQRA 2DQJL 2OR7A 3PDGA 4ALAH 4BQ6A 1KGCE 2QTEA 3C60B 3BH9B 3THML 1A7QL 1BJ8A 5IQ9B 1CFBA 1HHJA 1CXIA 5IVXF 1D9KB 3VFWA 1EX0A 2PXYD 5E2JA 1XF1A 4MJ5B 1DQDL 3NN8A 4HUNB 3AY4C 3MR9A 2BSTA 4QRQB 4RMWA 3EOTL 4JHAL 1KNOB 1ED3B 4G6FB 3DRQA 3LZFL 3N1QC 4OZIF 4JRXD 4HGMA 1RU9L 2JB6B 3L5WA 5FCSH 3UAJC 4YHPB 1IT9L 2YPLB 1S7WB 3H0TA 3GB7B 4KMTH 2CDFA 1RAMA 1XGUA 1VEPA 3PIQA 4AQOA 2PYEA 1RMFH 1HKFA 1HH6A 2HA1A 2RQ8A 4M1DL 2CUIA 3RDTA 2VXSH 4IHOA 1S8DB 2JLLA 3D0LB 2DJ4A 1E4WH 3BE1H 2UZXB 2EDOA 3IYLW 4A2MA 2HLAB 1U3HC 2JIXB 4ZFGH 3E8UH 5SX4H 3CFCH 1BIHA 2EDQA 3QO1B 3LH2L 1F58L 4ZSOA 3TIEB 4HX1A 1OAQH 4LPXA 4P2OB 4F57H 2AP2A 4X5XB 5FUZL 5IFAH 4XBPB 2GTZB 4DQOH 1FVCB 3AVEA 1R5IA 2BNRD 5CJOL 5J56B 5KW9L 2ED9A 3DX7B 5FGSA 2B7DT 4HLZH 4P0DA 4HGWB 4BUGA 4JO1H 4RGNE 1P6AB 1ROWA 1KG0A 5GS1A 1N7ML 1WZKA 5TDOA 3TESA 5FDWA 4BH8B 4V1DD 3FRPA 1OGAE 1CFVH 2UUDK 3QUKB 2B4CL 2VH5H 1K2DB 1R24A 3SE3C 2D2OA 4PV8B 3ZMRA 2KPNA 3ULVC 5KANG 2MSPA 4IRZL 3GRWL 3ULSB 12E8L 5DI8B 2J8UA 4IMLB 5MI0B 1UACH 3EAKA 1HXMA 2X4TA 2P1YA 3TO2A 4E42B 3WJLC 1T7WA 1KB9K 3FQRA 4QXGL 1BIIB 1TVDA 1P84K 2VWEC 3QG7H 1P7KB 5DJCB 2XN9A 4NPYB 5C9JB 5KJRL 1AHWB 3KPQB 3FB8A 4L3EE 4P5TB 5ICZB 4TVPD 4H25B 1YECL 4XC3H 3FB7A 3GSWA 7FABL 4YBHA 5GGSY 4GQ9H 3GSOA 5ALBL 4ZS6C 2NTFA 3FL7A 1PSKH 1X5IA 3QQ4B 3F62A 1PG7H 2G9HB 2QSTA 4UI2A 1KJMB 5A2KH 1KEGH 1W8OA 1QA9A 1SVZA 2YS4A 5EOQH 5CJXA 1U8IB 1HCVA 5EIIA 4PJFF 3QJHA 2ZUSA 1NFKA 4OGXH 3IDYC 3QIBC 2IQ9L 4OCRL 2BOBB 2V6HA 3EJZC 2APFA 2VIRA 3G5ZB 4HMCA 1X5AA 1BFTA 5GGSB 4S11A 3TV3H 2UYLB 1XZ0B 5JPNA 4P2CG 3QDMA 5FA4A 1RIVL 4QRPE 1E4KC 4R96B 3FONB 4APQD 4PJHB 1RUAL 2D0HA 3VD3A 4BFBD 4KRPB 1CXKA 1M6OB 4X5WA 3MLSL 2XZQH 3KS0J 4JY5L 4FABH 3VRIB 4M93C 4OFYA 2PETA 4LMQE 3MRJA 3TNNB 4GG6A 5C7XH 3QNZA 4XPAL 1R3IH 2EC8A 5EBGA 2OJZH 3Q6FB 2XRAH 3W0WE 1MRDL 1W8NA 4PRDB 5IB2B 4PJIB 5D70H 1F5WA 4N0YH 3CZFA 2Q3ZA 5MP6H 4ODXA 5AUMB 3GSVA 3ROOA 3GMMB 5DVMA 2FSEB 5DJ8B 5F3HB 4HUMB 5CSZA 2H9GA 5ACZA 1SBBA 3TT1L 3EFDH 1I1YA 2NY0D 3VXSD 3RZCA 5JHDD 3ZHKA 1IKFH 2VERN 3GMOB 3OKKA 3FO0L 4R2GD 4I9WD 2P47B 3X12A 2ZUVA 2VZOA 3CXDH 3K81A 4MAYA 4K8RH 3TBSB 5EU4A 3EDFA 1Q72H 1QSEB 1SJEB 1DANT 2WIMA 3KXFB 3P4OA 4LLWB 4WFFD 5E0QA 1CL7H 3QA3B 1E6JL 3ZE1F 1MFEL 1MIMH 1PZ5B 2F74A 4R8WH 1NGWB 1MNUL 1NC4D 4MNQB 4JKPH 3KPMB 4JFPB 4CDHA 5CCKL 5LBSH 3OB0K 4R7DB 3IDMA 4FZEL 2HLFD 3K4DA 4PJ5D 4HKZA 5DHVB 5EBLA 3LEVH 5FM4A 1F97A 4FN0A 3S98A 1MPAL 4NQEA 4Y5XB 4RFEA 5IT2H 3ARFB 3QHFH 3VXMA 2YD5A 2F53B 1RIHL 1G0XA 4YHLL 4YC2C 5F7LB 3V2AR 3NGBB 4X99B 3ZTNL 3RVXC 1OAUL 2X05A 3SO3C 4BK4A 5GGTH 2PO6A 1QHOA 1EV2E 1BREA 4LLDA 1MCPH 5IESH 2APVA 2FGZA 2Y6SD 2E6QA 3K7UA 4ZOCA 4ODHL 4JQVC 4G8GB 5F7FA 4I3SL 3TN0D 4AM0A 4XAWH 3CLFH 4AIZA 3RBSA 2AXJA 1JPTL 4CUCA 4H1LH 3VGEA 2ZSWA 4DZ8B 1UEYA 4DKEH 4R26H 4WEMB 5T5FL 5D6CB 1L4IA 5GGTA 4QYOB 2DQCL 3EO9L 2B39A 3DSFL 3KLDA 2ORBH 1UB6B 4YGVB 3GMPB 5FUOL 1DQQA 1XF2A 1HXYA 2QQQA 4H5SB 1U0QA 3SO5A 3DECA 4X6DA 5EORL 2WUBL 2P46B 4H1LA 5F7HA 4WWKB 5CZVH 2HTKD 1JF5A 3C2SA 1B88A 1FDLL 4HBCH 2XWJB 3IFOA 3GSQA 1Q0XH 5E2TH 1XF5A 4KXZI 2Q8BL 1T20B 3QXAA 4FQJH 3P4MA 4F58L 1WITA 3ALWA 4MSWB 3SE4C 3BRFA 5BRZB 2UWEA 4JZNA 4LF3A 1KB5L 2H2PD 4PJGB 4RGMC 5KVGL 5DRNB 5DRWB 2NY2B 2IGFL 4KUZL 4JR9H 4QEGA 2CKBL 1LO0H 3DV4A 1IILE 1IL1A 1WWWX 4YBQD 4AL8L 4N68A 4Y2DC 4UQ2A 4WTZA 1W0WA 3KLSA 2O5ZH 3QIUA 4M8QB 3WXVH 4PLKC 3BZEB 1DBAL 3HZKB 1R5VA 1FNEB 4XX1G 4PRID 1MLCA 5DFTA 3WS3B 4RAUB 3UC0L 1QFUH 3WIHL 1S7XA 4JY4B 1YC8A 5C07A 1XGTB 1G7MA 3D9AL 1DEDA 3HMWL 4KK6C 1ZMYA 3SEPA 3O2DH 4MX7A 3C6LA 4C4KO 5IBUB 3D2UB 3PWVB 2JB5L 4RCAA 1MI5A 4LLUB 1HZHL 4BSVA 2J88L 5CIPH 3HE7B 1HKLH 3I75B 4N1EA 1ZVSA 5FA3B 4FQIH 3DETD 3NCJL 5CEZD 3M17B 5MEQB 5IBUG 2QHRL 3MRPB 1VEOA 5T1DL 2FBOJ 1H8SA 1A0QL 4MNGE 5EZJA 3NIGE 3QBTB 1XCQA 1KGCD 2VLRA 3O2DA 4Y1AB 4G43A 5FHBH 3WNMA 2R0WL 3WJJC 2OX5A 3GIZL 4JFFE 3NCBB 4HUXB 1P53A 5CIPA 3WEXA 1M7IB 3T09A 2ITDA 3L9RB 1IFHH 3MOAL 4Z7VA 2W9DH 3TFKC 4C56E 3G5YA 2AQ3A 1G7LB 2W92A 4JFOB 3VD9A 3IDNA 2DD8H 2IQAB 5MHSE 1I3GH 3SJVE 4K3GA 2FJFB 2AV7B 4D3CH 1BMGA 1T66D 2Y06H 2Y5EA 5D6DC 2DI7A 1ZLVK 4CVXB 4DZBB 3PWPA 2CH8A 1QBAA 2YKLH 4LPVA 4MQ7B 2ZPKH 2W0FA 1T1YA 2EH8H 4NJ9L 4B41A 4I48B 1MHPL 1S78C 4IRJB 1IGCH 2G75B 3RUGF 4FQLL 5FO8B 4CW1A 4XZUA 5FGCB 2XG5A 3LIZL 3PWJB 4HFUL 3VFVB 1QRNA 3HN3A 3LV3B 4HCRH 1AR1C 4ENEC 4KK5C 1IE5A 1WCBB 4P3CH 5ENWA 4WVRA 3B9KD 3GHBH 2XTJB 5EZOH 3VXOA 4L5FL 1INQB 3LKPB 5CEYB 2ATKB 4RDQG 1ZHLA 5I1GH 1CLOH 5ID1A 5ITBH 3WNNA 1CS6A 4UBDD 4DGYH 1CZ8H 4TOYL 3B83A 4HUWB 3VFUA 2AJYL 5LQBH 1FHGA 4HW6A 4OCYL 5BCAA 3SOBL 4RGND 4HCRA 2HH0H 2WBJC 3CK0L 4OIAA 1JNLH 5FHAH 2A77L 5KSVA 4NRXB 5J3HD 4I0PC 5TJWK 3BPLC 1OGAD 3O9WC 2ZOLB 1R3LB 1C5DA 2ZJSH 4F7EB 1A6AB 4PJAE 4PJCA 3NCMA 2FATH 2VDNH 4YQXL 3H7LA 5I1EL 5EIVA 3FOLA 4Y5VC 1MJ8L 2GFBA 1A6WL 1NLDL 1T0NA 4J3XA 4X6CF 1FNLA 1DBJH 1Q0YL 1EHLL 2NNAA 3OGOE 4HH8A 5ISZE 2XKNB 4ZFOA 4ZTPL 5I8CB 3QXDB 4FTVB 3PWLA 2VLKE 1I7TA 5BQ7B 3O6FB 4HIXL 4AMKL 1CGSH 3F6IA 1AJ7H 2IALA 1JYNA 1OAXL 3LMJH 1LP9A 4KKLC 3WHXA 4PB0H 3MLRH 2CR6A 5B3JE 1RQ5A 4G3YL 4L3ED 4LLYA 5J6HB 4HLJA 3B9DA 2X7LB 5E6IC 3IRPX 4FQHA 1OVZA 5CD3B 2D4DA 3RKPA 2GSGA 1HILA 1I7ZA 4WO4C 2PR4H 5I8KH 3QCVL 4K9EH 1G7IB 3SKUD 5CINL 5D1QD 1OOAA 3MRDB 1JRHH 5DFWH 3NMEA 1ORSA 5EU6A 2ITCB 5LAXB 4X8XA 5C0IB 2V2XB 4KJPD 1KC5L 2V2WA 3SKOA 1G7JA 5AZ2L 1I8IB 3L5XH 2VDPH 5DFVC 1FBIL 1YEHH 5C6TH 4LSRH 2FHFA 3CSBA 5E94B 5SWZE 3LKSA 4J23A 2OBGA 1HINH 2BSRA 3BRDA 4RISL 4X4ZA 4UTBL 3C5JA 4E5XB 1DE4A 3BUTA 2R9HD 1UGNA 1AGFB 1U3HB 4H88L 4XCFH 3WD5L 5ANME 5L6YL 3F5WA 2R1YA 4QRPD 1S7VB 4NM8H 3NACL 5KAQF 4TSAH 4RFOH 2YUXA 3E6HB 5ADPL 4Y19E 3LRGA 5T33L 1FAIL 4XCEA 3NZ8A 3QFJB 4Z76A 4U1LA 4HKJB 2G5BB 3JTTA 4OAWA 3BXNB 5HHQA 1FZOA 4KI5E 3C9NB 3W0WD 2I9TB 4GAGL 5CP7B 3SDXE 3U83A 4XNXL 4KHTH 3FN3A 4OUUA 4ZFZB 3FZUC 4GKNA 3ZL4L 3TCLB 3ARWA 3MRKA 2BNUA 2QSCL 2A6JB 2R2BA 5DUPH 2IAMA 3IDUA 3SDDC 4E9LA 4Z7NF 1KBGH 3MLXL 2HVKA 3ES6A 4BSJA 4DOHE 2LVEA 3HUJA 4NHCH 2XI9A 3CDGB 3SGJA 2EKJA 3NCFB 3WUWA 4U6HA 3NPZB 5JDJA 3UTPE 4PRBA 4RWYH 3PDOA 5AZEL 1PEWA 5SWQB 5J1AA 5FEBA 1Y6KR 4PJ7F 4YO0A 4JFQA 1FH5H 5JZ7D 2RFXA 3UTTE 3BMVA 2F5BL 3MJ9A 3P9MA 4PJ9D 1RZFL 1ZEAL 4TQEH 5EO0B 4UQ3B 3T0EA 3CFEB 4O02L 2IJ0C 4P4KA 1JPSL 5M7QA 4M48L 5TGBA 3X14A 4DTGL 3BZDA 4E0RA 3GEWB 5BZDB 3UPRA 3TBWA 5DK2B 5FGRA 2XA8H 2BFVH 1BAFH 4XXCA 4JPVL 4KVCH 1XR8A 1J1OH 1DUYB 3QULB 1L0XA 4O2CB 3U46B 4Q9RL 4D9RE 4J3UA 1F4XL 3O8XD 1BVLB 1I3RA 4PJ8C 3AROA 2UY7A 1CU4L 4NO5A 2GYSA 3VH8A 3KYKH 5H37G 5TE4H 4Y4FD 4ETQA 3IDYB 4U1SB 1P2CA 3QIBB 2WLYA 1JZ3A 3DIFA 3TO4D 1T2XA 2H8PA 1ODAA 4GMTH 3L7EB 4A6YB 5K9KB 1T0MA 1TJGL 2DYPB 4YHKL 1HI6B 3UTSA 5ACMA 3CPLB 4ORGA 3G08A 4MA7L 2GUOB 3QEUB 4XPFH 2MMXA 1OF2A 4I8DA 5I8OH 2KKQA 5JIHA 2QL1A 4Z7WF 4JQIH 4M7LL 4HZAA 3WNOA 4U6TA 3MCLH 1AFVH 1FJ1A 1NL0L 5J9PB 3FB6B 5DMKB 5DGRA 3PHQB 4HZLA 4X9GA 3UP1A 5D7JD 3MROB 2HRPH 1NAML 2D03H 2FO4B 1R5WA 3DUSB 3EGSB 1RZJC 3GBML 3W5NA 1QKZH 3SDCA 5C0NC 3X3FL 2BRQA 4DGIL 3H6JA 4G8IB 4MCZB 3P0YL 2BHZA 1YNKL 1MFNA 2CLVB 1RZ8A 4EZMA 4I3RH 1G6RB 4L3AA 1ZA6A 1UQSB 3WDIA 5I76A 4OJFH 2DTML 4Q74A 4Q6IB 3UO1H 1CICD 3JWNC 2Z8SA 4PJBB 5TQ0H 1QPXA 2L4OA 5KSUB 1IM9B 2KDGA 3SE8H 2J8UF 2V5SA 5CKGA 1CD9B 1WFNA 4XTRC 3KLAB 4GRWE 3O4LA 2DRUA 4WEBL 5DYOA 1JV5A 5DMYA 1MLBB 2X4PA 5B8CA 3BZFB 3SBWC 3F7VA 1ZA3B 3HAEB 4AEHH 1AGCA 4W81A 1WQVT 1UWXH 5IMMA 1HQRA 1SJHA 3VXNA 1BWMA 4OTXL 4KAQH 1ZV5A 4DFIA 4CVWA 3LD8C 3MFFA 3SO3B 5CD5D 1XIWC 3HAEG 2GY7B 1TVHA 4OD2A 2O93L 1G0DA 5HHXH 3KPSE 3VMOA 5D5MA 5EUOE 3AAZB 1T22B 4KK8C 4JFFD 3S96B 5EO1B 2NTSP 1C12B 3G6DL 1BQLH 2Q6WB 1REIA 2VUOA 3GGWA 4JJ5B 4C56D 4R0LC 4LCYB 3FQWA 1AQKH 4OV6F 5F7YC 2QR0B 2HKFL 1UXWB 5MHSD 4HAGA 5FYJL 3SJVD 1EK3A 1TXKA 2BDNL 3P73A 3GK8L 3HZVB 2XY2A 4LIQH 5JOFA 5HBBA 5MERB 4XB8A 1KCUH 3GBLA 5FO7B 1VGEH 4ODUA 1GAFH 3HR6A 3SGDH 4G7VH 1GH7A 1MUJA 2R0LL 4ISVA 2IANA 5E00B 3OSKA 1WBZB 1K9TA 4WTXA 3GMLA 5FUCC 1ZKAA 2JJSA 1UZ6E 4N8VA 1YEEH 4LPYA 4PP2B 3O2WL 3CX5J 1XGYL 2CO7B 1KPRB 5FB8B 2W0LA 2R0KL 3QIWA 5K9OB 3HCVA 4M6OL 5HHME 2E5EA 3B6SB 2DQHL 2XFXA 3PQYB 3O0RL 4Z77A 5L2KA 4J4PA 4WU7A 5HHVL 3RGVA 2D7PA 4JZOB 4GG6F 1AD9B 5DD3H 1JFQL 2DQDH 1RVFL 1KIQA 4EIZC 3QRGL 4ZTOH 3IDXH 2J4WL 2ZUXA 4JPWH 4QHKJ 4YHNB 4RMTA 3C6SB 3BDYH 1NGZB 3QNXA 5GGQH 1ZT7B 3LQAC 1G9MC 1PYWB 1WEJH 1A3LL 1UB5A 2JJUA 4OLYH 2GJ6B 1DBMH 1JGEB 3U9UA 1CDBA 1PG7X 3GM0A 3LAFA 2Y7QA 3AU1B 2CMRL 2CDGB 4HK3N 1A9BB 4WFED 3T3PF 1MRCH 4J8RB 1ZLUK 2AJZA 3K8KA 2YPLE 4I5BB 2AK1H 5AAMA 4L9LC 2M2DA 2Y5TA 5IROA 4K7PL 1LO5A 1D5IH 3ZDYF 2EDEA 4ZDHA 2NLJA 4X4MA 3FCTA 5L2JA 2P5EB 4LHUA 5ISZD 4DKFH 1MCWW 4WW1B 2NY5H 1FL3A 4YE4H 3JWOC 4MZ2A 4X6EA 2VLKD 2WWKT 2QQLH 3VGDA 4JVUA 1SYVA 1UCBH 1HHKB 3OAYK 4UT7L 5F96H 1JI1A 3T3MF 5ICXA 3TWCL 1NBZA 4OZGA 5F89A 3T04D 4XP5H 3BEWA 4FRWA 5ECJE 3V6FB 2OLDA 1EERB 4LLMA 1LK2A 1AGDB 1MOEA 2VKWA 3I6LE 3IKCA 4YHMH 3ZDXE 3MREB 2Z8RA 1RD6A 3BAEL 4P2QB 2FJHA 3QWOB 4PJFB 3MMEB 5EC2B 4MNHB 5DJYB 8FABA 2EECA 1R0AL 2OTPA 4X80L 4ELME 5KN5A 5BVPH 4I2XE 4XNUH 3MV01 3QUYB 4ONOA 4HC1L 4GKSA 3K80A 2AEQL 1QTYT 2OR9H 4XNQA 1K8DA 4FQ2H 2DB8A 1BLNA 3KPOB 4NQCA 2OXGA 2JF1A 3GO1H 4QXTA 3RDTC 1MWAH 5SWZD 5I19H 1ZSDB 4X6DF 4LASL 3DXAD 3KYNA 4MJIB 3NVQA 3LRHA 1JBJA 1FP5A 2W9EL 2X4NA 1NDGB 1V3JA 4HS8H 5DMGD 3FFCA 5CZKA 4FXGB 1PKQE 5IV2B 1MHEA 2P48B 3LQAL 4X7TB 4FQXA 3RWIB 4F7MB 5CGMA 1MVUB 1MWAA 2EDBA 3W39A 5JQ6H 1FL5B 2BC4A 1T1WB 2BSSB 2V7HB 3S6CA 2UWEF 4KI5D 3L3GB 4PP1D 1FPTL 3L3IB 2NYYD 3BGMA 4NO2A 3SKMB 5E08L 4YPGA 3CLEL 1NJ9B 3LPFA 5KG9B 3DROA 4ZYKB 1N6QL 3BPLB 3O9WB 3QHTC 1G9EA 5T3ZD 2IADA 3O3UN 2NZ9C 2ZCLL 4G80B 4M7ZC 4P5KA 2FYYB 4DWHA 1OLZA 1F8TL 4Y5VB 5D96C 5TF1H 2P4AB 3N1FC 2OQJB 3EYFB 3R8BB 5DQJA 4LL9A 1PY4A 2FR4A 2NX5B 2WNGA 2EZ0D 1GPOH 2EIBA 2O5XH 3ZTJG 1P4IL 5D71H 3UTPD 5L88H 4GW5A 5ABDE 5AG9A 4W6XB 1JK8A 3IXAB 1JHKL 5B38A 3V52L 3UTTD 5F9OH 1UG9A 4XMKH 2YK1H 4PLJD 4PJHE 4DFHA 3I02A 2VXQH 1LK3H 2EO1A 3BVNA 5E6IB 4RAHA 4CU7A 1U9KA 2EYRB 1NUGA 1QR1B 3VGHA 5IMLA 4DCQA 5DF0A 3SPVA 3WFEH 4WO4B 5DJAA 4NQTA 2VMFA 5E8OA 1GIGH 3I85A 1EEZA 2Y1VA 4ALAL 4Y4KD 4O58H 4EN3D 1Q9OA 1YEDA 3T0DA 3IJHA 4D9RD 3STZA 3HRZB 4N0RA 1NCUA 4PY8I 1CFNA 2ICES 2MQ3A 5CWSA 5JORA 2HJKB 3LKQA 3DMMA 3BOVA 4OF5A 5FKPA 3B43A 3RWEA 2ICEB 4Z9KB 3QHZH 4BQ9A 3EOBA 3I9GH 4YFEA 3O11B 1VFMA 5SX4I 3O6MH 4WHYH 4KMTL 4KHXL 2RIKA 2F19L 4AT6B 43CAB 5HHOB 4LVNC 3INUH 4UOW1 1QSEE 3G6JA 2XQYK 2X1WL 1EHAA 5F7WC 1Y0LA 3LQZB 2P5WB 2VXSL 4EKXA 4H8WL 1GCFA 3CFIC 3OR6A 4MNQE 2EDYA 1E4WL 2C5DC 3BE1L 1TTGA 4IIQB 2R56H 3GM8A 3QQ3A 1JTOA 4ZFGL 3E8UL 1N0XH 4X6BB 3D69A 2VE6B 4TUKH 2DLFH 1OWRM 3FQTA 4AH2A 4XC1H 4RFNC 4LCUB 4OD1H 4DN3H 3FMGH 2CRYA 1EH9A 3BO8B 2YRPA 1W72B 1OAQL 5GGRA 1RUPH 3MXVL 4F57L 3MNZA 5ALCH 2BNRA 3SDDB 1G9NH 1CG9A 5IFAL 5FECA 4DQOL 1Q9LA 3I3BA 4R6UA 3RZCC 5GHWH 3O45B 4JO1L 2NY6D 4V1DA 4Y89A 4PJCF 4UDTB 4UIMA 1INEH 4HBQA 2OP4H 4HGKC 5CHNB 4QHNA 1CFVL 4NZDA 4F9LA 4YUEH 1BZ9A 3G04A 2VLLA 3V5KA 4U31A 1G7QB 3BUYA 3WKMH 1U3YA 4EUPB 1UACL 1J7VR 3WFHB 2M26A 4ODVL 5EWIH 3WLWC 3VG0H 4F15B 3RPKA 5BJTA 4QT5A 1YY8A 4WV1A 4JO3L 1LP9F 1ZHKB 3BIKB 3VD7A 3FKUS 4KJQC 4K8RC 1TQBC 4EUPG 4LBEB 5HDLA 2C3HA 3VDAA 4JFXA 5IBLD 2CPCA 3QG7L 4I3GA 4RA0C 5DJ6B 5I17B 4KROD 4AG4L 3RAJH 3HR5A 1FL6B 2DM3A 1C08A 1CIDA 3P9WB 3VRLF 5DD0H 1GGCL 1FSKB 4PJ8B 1JGUH 4W6YB 3MV11 3KPSD 4GSDL 4D0BB 2X4QB 3K2UH 1AP2A 1EEYA 4XC3L 2A9NH 2HJLA 5BRZE 3EOAA 4GQ9L 4PJGE 4EI6B 1DDHB 4EOWH 2CQVA 1HQ4B 1U8LA 4PJDA 2E9IA 1PSKL 3WE6A 4IMKC 4JDTH 2Z35A 2F15A 1A7OH 3JWDH 1AO7A 4KGJA 4DVRL 2NW2B 3HG1B 4N0FB 1IRAY 1KLUA 2BXYA 2B5IC 5IHZA 3RUGB 1A6ZA 3BJLA 4C59B 4OGXL 4QGYA 3REVA 4MXVF 1KOAA 4P46D 4EI5C 5C6PB 2P8PB 1KIPB 4GKZB 4NWTH 2CKNA 3TV3L 1E27B 2C3WA 1JN6B 1F6FB 3NIDF 4APQA 3EJJX 5D93B 4KTEH 4OT1H 3MBED 4NO0B 1R3HA 4R7NA 2I9LA 5HHMD 3L3HB 1R3KA 5I9QC 4YWGH 1T03H 3T2QA 4R9HA 2XZQL 5BOZG 4FABL 1AKJA 1BX2A 2HFEA 4OKDA 3V4PH 4LVHC 4GRLD 3CVHH 3B9VA 3C60D 4Y1AE 5C7XL 2ADFH 4HDIB 1R3IL 4HPYH 3A67H 1A6UH 3WFCH 2OJZL 2XRAL 1D9KD 3VDCA 4ZO7A 4K71C 2ZUTA 4NQDB 5HDBF 4M5ZH 3VFPB 5D70L 3UTZB 3KDMB 1HYSD 3QIUC 1C5BH 4C83B 4N0YL 3OKNB 5MP6L 4M6ML 3RX5A 3WNLA 4G6FD 4LPWA 2VDOH 1MCOH 5DRXB 1IGIH 2VL5A 5JHDA 2CIKB 1K4CB 3CVHA 2VO5A 3E0GA 3CCHA 2FZ3A 3EFDL 2YPLD 4HJ0C 4JANA 1TTUA 3QT2A 5I1LB 3TYFA 2BVOA 1IKFL 5IK3A 3AM8C 1IAKB 1OGTA 4YX2L 3CXDL 1DFBH 4K8RL 3O3DA 1WAAE 1CD1B 1UXSB 4QWWD 2KZ1B 2DICA 1A02N 3OWEA 4MLIA 2D7NA 5E1AB 3QDJA 2VTFA 1IGJB 4Y16A 5IB5A 1ND0B 1CL7L 1XIWB 5FGCE 4E41B 1MIML 2QHLA 4R8WL 5HHNB 4PJ5A 4JKPL 5BXFA 2JIXD 3L6FB 3PGDA 4NKOA 3OX8A 2HFGH 5ETUB 5LBSL 3C2AH 2RHEA 3LEVL 1JPFA 1NCBH 2YA2A 3FQNB 3OBAA 5GGVH 2XACC 1MAJA 1OSZA 1RZIB 3FT2B 3VFSA 1D7FA 2WM0A 3QHFL 4LSVH 4DVBB 3I6LD 5F97E 3WDJA 5JXEC 3T1WA 3T65B 5GGTL 2GQHA 1GYAA 5BVJA 1MCPL 3MNWB 5IESL 3BP6A 3TN0A 2AK4E 4WI3A 2EKSB 1DQJA 2CRZA 2P8LA 4NWUH 3IDJA 2H32B 4HFWB 3VI3F 1YEGH 1CBVH 3RIAF 4P2RB 1FFPB 4EXKA 3HA0A 4XAWL 3CLFL 3QQNA 2IH3B 3NAAH 4O4YH 4JRWA 1BGXH 3WL9A 1G7PA 1YMMB 2A0LD 1NBVH 5HYJB 4DKEL 1GZPB 4R26L 5KOMC 4NQSA 1KLGA 1PQZB 1N26A 3WDHA 2ORBL 4N9OB 1X5GA 1WFOA 2AW2A 43C9B 1T4KB 1BFVH 5FDYA 5C0AB 4B5EA 4F7CA 4JPIA 1IGYA 3LOWA 5CEXB 3VGGA 3CC5B 5GS0D 4TUJA 2DWDA 2EYSB 4I4WA 5C08B 2NXZC 5DWUH 5CZVL 5F9JA 1HN1A 4K07A 4HBCL 4QF1B 5E6ZA 1FORH 1Q0XL 1J0IA 1RZGA 5DUBA 5FM8A 3KLHD 4WY7L 5AD0A 3T1FB 4FQJL 3BW9A 4XBGB 2OZ4H 4KV5E 2Q1EA 2Z92B 4OGAD 2QV2A 2R2EB 5LCVL 1E4JA 4TNVF 2ED7A 4BJLA 3DWTA 2XZZA 2JK5A 4JR9L 1LO0L 4OZHF 4L9LB 4LNRA 1VPOL 5D1ZB 5IEHA 2YZ1A 4M8VA 3RA7L 4QXWA 1S7UA 5CEZH 4L3CA 4PJ7B 2O5ZL 4PRIA 3WXVL 5F8QC 5A2LH 5GS2H 5E2VH 4TPRH 1QFUL 4KUCF 2OZ4A 4K3JH 4POZD 5F3BA 4G6MH 3U4EB 4PGJA 4BELD 3CZJA 4S0TD 5EN2A 2VXUH 3O2DL 2V5MA 3RWHB 1KT2A 2VZTA 3OB8A 3LEXB 4QXUH 4XCYA 1HKLL 4HKBA 1NMAH 4WTWA 4XVTH 1A1MA 5HYQB 4FQIL 2ADJA 2HT3D 5DJDA 1ZLWH 1ZVHA 4G9FA 4GAJH 2FL5B 3OTTA 3VWJD 2AEWA 3QFJE 1YPZF 2RAMA 3MR9B 1PKOA 4MD5A 4MDIB 4ELKB 4XPTH 4ZD3H 5E99H 5HDQH 2VAAA 4R4ND 3DOSA 1TZIB 5FHBL 5CUSH 3CNKA 3GBNH 5C92A 3UMTA 3N1MC 3IDGB 2YBRA 1H9VA 3ULUF 4XVSH 1IFHL 1JZ7A 2VZVA 5IKCB 2W9DL 5J4MA 4LPTA 2BSED 2R23B 4NQVB 3WS6A 1YN7B 3ULVE 4TTDD 3MA9H 4ZUUB 2WUCH 3PGCA 3RDTB 2DD8L 1SEBA 4IHOB 1Q9WB 4NSKA 1I3GL 2CGRH 4D3CL 2Z31C 1RJYB 2Y06L 4Z7WB 4K9EC 4N8CH 1M7DA 5HI4D 2YKLL 3OXRA 5IQ7H 1OHQA 2ZPKL 3WN5B 3NA9L 4JKLA 3I2CH 3KAAA 2EH8L 4LRNH 3EIFA 1QSED 5I18H 3O3EA 3U36A 2VWEE 3UJTL 4ZAKA 1IGCL 4KJYA 4MNQD 3V5DA 1A64A 1S9XB 3HC4H 4U1GB 4HCRL 4MVBD 5HGAB 5GJSH 4JZJA 2J1KA 4PY7B 5KOVC 2P24A 3AXLA 1T5XB 4P3CL 3ARFD 3GHBL 4K94H 4U1JB 2O61B 5EZOL 4ZXBC 1YNTA 2J8OA 1MFDH 4RX4A 4ODWB 4QTIH 5F9WC 5IFJA 4M7ZB 4HK0A 4NZRL 2WP3O 5DJZB 3G6AB 4UILH 4UV4H 1CLOL 5I1GL 4HT1H 2C26A 5ITBL 3GI9H 4DGYL 1DTUA 1BBDH 1CZ8L 2F9BT 4G8GD 4M43H 5LQBL 4L1HA 4ZFOL 4NHUA 2O26U 1SQ2N 2DMKA 3JV4A 2HH0L 4MCYA 1I1AA 1JNLL 1OGAA 5D2LF 5EO9A 5FHAL 1CFQA 3GSNB 3OHXB 4ZUSB 4KGLA 3FQRB 5CBEB 4U33A 2ZKHH 1E6OH 3NCYS 2FATL 3GJFK 4WJ5B 1HWGB 4HLZG 2XN9B 1G6VK 1V3MA 1DBJL 4KPHL 4LOUD 3FT3B 5B39A 4Z8FH 4NQUA 2XPGB 4NN7C 5I0DA 3ZDZF 4P4KC 1IM3A 1X5JA 4BYHA 4BZYA 1I9JH 2I25N 1JJUA 4JAMA 1CGSL 2YMXH 3W9EB 4KTYA 4WWKD 5KSBE 1AJ7L 1FV1A 4JLRB 3LMJL 3QWRD 4U1KA 4XXCC 4L3EA 2X9WA 3MLRL 4U6XA 5MEOB 4ZNCD 1N59B 4FG6D 5CZXC 5IHBA 2VXVL 5J1TC 2YSSB 3BEVA 4XP9H 4OLEA 1CIUA 1NMCC 4Q9BA 3VXQB 4JM2F 4N5ED 4LQ1A 4ZFFB 1P4BH 3L5HA 5FYLH 5BRZD 3EYQD 4NNXA 1T1ZB 4UNUA 5H35A 4NM4H 3ALXA 5HPMA 2NY2D 5D1QA 2PR4L 4LSPH 5I8KL 2VIRB 3PDDA 1RJLB 3HZYB 1NUNB 4ZOAA 3RU8H 4K9EL 4QCIA 5GSRB 3BI9X 1FFQA 1JRHL 4HD9A 3B3IA 4JN1H 4HIEB 1XCTA 1B3JA 4JG1H 5FA4B 1Z0NA 1RHHB 1ACZA 3L5XL 2VDPL 3DV6B 1EO8H 4FQ1H 2BNQA 4JDVA 4JDZB 2OI9C 2I24N 1YEHL 3HZMB 4LSRL 5C6TL 1MCSA 5DJ0A 4B0MM 4ZMAT 3KHOA 1NANH 2AI0H 5FF6A 3LN5A 1CFTA 1HINL 1IEAB 3D2UD 3EYOA 4JY6B 4R4BB 1LE9B 4GG6B 2VR5A 4KH2A 2WIIB 4XCFL 1S7QA 4YNYA 4NM8L 1KPUA 2CDEB 5FKAA 4D0CB 5JW5B 4TSAL 2XWBB 1DQDH 4XHJD 5EBMB 4RFNB 3SDCC 4WGWB 3KPLB 3WNPA 2F5AL 4WDIA 5IVXE 5A43C 1WWCA 3QPXH 1JZ6A 1PLGH 2VL4A 5GGUB 1C8PA 3DX8B 2W60A 1K85A 4UAOC 1KXQE 5CSZB 5C0BB 5ACZB 2JCCB 4Y1AD 1SYSA 1IT9H 3W0WA 1TCRB 1S7TA 2RGSA 3VXSB 5IGXH 1CTOA 3OJDB 4G42B 1A7BA 2C9AA 4OZIE 3QI9D 1T6VN 2AJ3B 2P8MB 1H3PH 3CFBA 4KHTL 2L7UA 1UVQA 1X7QB 1BZQK 5D7IA 2PTVA 5JDSA 4Q6YA 3RWGB 3P4OB 5DUPL 4S1DD 3MJ9L 1NC4B 4OZFH 1KBGL 2DOCA 4AEEA 2D31A 3QP3A 4NHCL 4NKIH 2IBZY 5J13C 4O9HH 4X6FB 4HKZB 2GK0A 5B8CC 3LH2H 2DLIA 1FVEA 2Q7NA 4RWYL 5F7MC 5LWYL 5I73C 1TQBB 2VN4A 4RIRA 4IRJD 1FH5L 5B4MC 4PJ9A 3BKMH 3QXTA 1DN2A 1J05A 3H8NA 4XWGH 1A3RH 3VI4F 1D5BA 4LLDB 1F11B 4DKDC 4Q97A 3PQYE 4TQEL 2VSDA 2ICWA 2PNDA 3D0VB 4YHIA 1QSFB 2B2XH 1RFDH 3HI1A 2PTTA 3L95A 3CMOH 3MRRA 2P45B 1FG2A 4OF3A 2BFVL 1EAPA 3VCLB 2Y36H 4ZUVA 1BAFL 5LVEA 1J1OL 3O8XA 3MSPA 2ZUQC 3FQXA 4XRCB 1RPQA 4PJXA 4Y4FA 5F71A 5J0BA 2GJ6E 1XF2B 4B53A 3KYKL 4N0UB 1U8QA 5TE4L 3IT8D 3TO4A 3QJFA 4P23C 3TH4T 4JRYE 4Q9CA 4X6DB 1L6XA 4EI5B 3ARRA 4WU5B 4HH9A 4JFYB 1K6QH 4GMTL 2LTQC 5A2JH 4WEUD 4H1LB 1HSAA 5D1XC 4R97C 4NCC2 3ZHDA 2JJSC 3O41A 3A0OA 1BOYA 5KJRH 2XQYG 4NRYB 3G6JF 3IFOB 3EDDA 5DO2C 4XPFL 4EQ2A 2P5EE 3QIWC 5I8OL 5I9QB 1XF5B 4H1LG 4PTTA 1ZGLP 4LAJH 3MOBL 3QXAB 1B4JH 3RGVC 3BQUD 4JQIL 5DZLA 1I4FA 4S1RH 2UWEB 4LVHB 2LFGA 3MCLL 1AFVL 1IZJA 3MRFB 4BA8A 4KU1A 2FJGB 4WUUA 5IMKB 2IH1A 5ESVA 4UUJB 4K71B 3MRCA 2HRPL 1BP3B 2D03L 3O6KH 1NGQH 1QKZL 2CXGA 5BS0E 4P5MA 1R5VB 2VLJB 1H0DA 2IPKA 1G7HA 4P2QE 1NGXB 5E70A 4CN6A 1H3GA 1NCWH 1S7XB 2DQTL 4PJFE 3DI3B 3OJVC 5EPMA 2X42A 1VGKA 4PBVC 3UAJD 3OKDA 4Z78B 4MX7B 1RIVH 3P11H 3AREA 2FD6H 5IROC 1J8HA 3FQUB 2PCPB 4BSVB 3U1SH 1Q94B 4OJFL 3UO1L 4MYWB 2GIYA 3RI5K 2BCKB 2WQ8A 3G9VA 3GMRA 3R8QA 5TQ0L 1SJXA 3SE8L 3H3KA 5K93A 4PRPA 2WINA 2DM4A 1F3JA 3CFJB 4LCCB 1U95B 3QXUA 1U91B 4MJIE 1U3HD 5CLWA 2VR9A 4XP6H 4EEEA 2ZP0T 2XG4A 4ZOBA 1KPVA 1ZWIB 4AEHL 1KYOK 5CIPB 4ERSH 1JGDA 1HNGA 4O51B 5I15L 2A73A 4U7SA 2ESVE 1A6TB 3RL2A 2D0FA 2NY5C 4G6KH 4KAQL 3QFJD 1QLFA 4JM2C 2PW1A 3W2DH 1F02I 5DRZA 4LQFH 2J6EA 1JWUA 1K5NA 5HHXL 3C5SB 4BSWA 2DKSA 3EUUA 4PJDF 3MFGB 3CDYA 3SGDI 5JW4R 1N8ZA 1BQLL 1T1YB 1WK0A 2YUVA 3CU7A 2B1AL 3RIFK 1UM5L 1M05A 2EDRA 1B0GA 1AQKL 3ULVD 1MFEH 4MJ6A 5DS8B 2ICWJ 4K23H 1CFSB 5ESQA 1E28A 4XZUB 3P4NA 4YDJA 4LIQL 5DURB 3ZE1E 3QUXA 2NX5E 4EXPX 1EUUA 1KCUL 5F1NA 1URLA 1VGEL 1BJMA 4G7VL 5EDXA 3B9KB 1VKXB 2BVPA 1IAII 3CXHJ 1VEMA 3VXOB 2DTSA 3X11A 4RNRA 1NGYB 1YEEL 5C0EA 1X4XA 1FNGB 4FQXC 3HC0B 1U8PA 1ZHLB 2VC2H 1ZHNA 2HN7B 5T5NF 1DVFA 1K8IB 3OF6D 2X1XR 5DD3L 1AQDB 2DQDL 5DR5H 1JPTH 4ZS6D 3MTRA 1OTTC 1Q9KA 3MXWL 4ZTOL 3OR7B 4JPWL 1CCZA 2MCG1 3BDYL 1S9VB 5C8JB 4QLRA 4Z7UA 3EO9H 4PJCB 5GGQL 2DMBA 1ES0B 1FO0B 2GFBB 3ZT5A 3CMGA 3MCKB 5IVZA 1FLRH 5J12B 4HWEH 1DBML 3QIBD 3BN9C 2YEZB 5CSGA 3EJZD 1ZGLM 3PWLB 3HE6A 1UM4H 5BZWB 5K9JL 1MRCL 2VITA 2DYPD 4CL7A 2OL3H 1YDPA 2AK1L 3RY5A 3V0VA 5I66A 1LP9B 3WHXB 1S5HA 2CLZA 1IEHA 1D5IL 3GZKA 3RJDA 5I71C 4CN1A 5ISZA 5E4EC 3IDIB 5HHOE 3VXTA 1MJJB 4NN5C 2VLKA 4DKFL 2X10A 5F88B 2NY5L 4YE4L 1CQYA 2Q20A 3MYJB 2P5WE 4NT6A 1KB5H 1A1OA 5HGHA 2QQLL 5C0JA 4BH7A 1UCBL 2GSGB 1HILB 5F96L 2BMKB 2WK2A 5HVWA 3K4ZA 2OL3A 3TBTA 5KBNC 4NC1C 1NFIA 1Z9SA 1YUHB 3ARUA 4OZ4B 5EU6B 4CAGA 1N5AB 2Q8AH 2Q87A 2YR3A 3PV7A 25C8H 2E7BA 4PLNC 2ZCHH 3SKOB 4OSUH 4YHML 3WIHH 2BZDA 2C4FT 3UBXB 3S4SA 1KB5A 3MCG1 3D9AH 3DMMC 3OKYA 3HNSH 3U6RB 2Z31B 4NZTH 3D1MC 2OTWB 3ARSA 3C5JB 5E5UB 3VFTB 3PG2A 3UBXG 2C3XA 4XNUL 2R1YB 3MGOB 1HCFX 1QSVA 3TBVB 4CVZB 4K7FA 1BFOA 2EC9U 3MOQA 2K7QA 1IM9D 3F7RA 4JCMA 1XF4A 5DZNA 5M95B 1JVKA 4KKAD 4JB9H 1CD8A 4FQ2L 5SWZA 3WIHA 3DNKA 3TP4A 4JFDE 3GO1L 1MWAL 5ICYA 1DQML 2GITA 3DXAA 4Z76B 5I19L 2JELH 3O3BB 1VHPA 5ANMA 1UH2A 3MUGB 1U8KA 4X4YB 2R0WH 3JTTB 1I7UB 3U4BH 1CI5A 2IC2A 3JVGA 5JA9A 1ACYH 2Q76B 5DC4B 5K9QI 3MNVB 5T3ZH 4PLOB 2UVFA 4HHAB 3QRFM 1XR9A 4HS8L 1EAJA 1YC7A 3RWJB 4ZXBB 4GKNB 1MAKA 3RVXD 4CMMB 3TBYA 5I16B 4P48A 3H9HB 4O2FA 5BV7H 3V5HB 4CRPA 1MHHA 3ZLQC 2JJWA 5JQ6L 2DQIH 1J87A 3SDAA 5IR1A 4UB0H 3SDXA 3NTCH 3FO1B 4U6HB 3IFPA 1ONQB 3MV7A 2W38A 3ROLA 3OPZH 1TVBA 3QEHA 4HIIA 5I75C 4F9LC 4I0KA 1FYTE 4FQLH 4GUPA 2K3TA 4N9GB 3RY6A 4PS4H 1QEWB 4JKWA 1FFOA 3SN6N 5TF1L 2GAZB 4HFUH 1G9NC 2FBJH 3RUGE 2FEEL 5IB1B 4NN7B 4XPHH 1KXVC 4P4KB 2MTPA 2XZAH 1QOKA 4XCNA 1GPOL 2O5XL 5D71L 5L88L 4WV1C 4OB5H 4G8EA 4E0RB 1H3TA 1YJDH 5TDPA 1F2XK 1NDMB 4OKVA 2CLRA 3MRQA 3RGHA 3CSYB 5F9OL 4I18A 4XMKL 4KTDH 3DUHA 2YK1L 4F7PB 1YYMH 3PQYD 2VXQL 4JG0H 5IF0A 5KVFH 1LK3L 1NMCB 4NO5B 1QD0A 2A77H 3P77B 1N2RB 3QQ9D 4Y4KA 4EN3A 4FOMA 4FA8A 1HOCA 2ZUYA 2DIJA 1GIGL 1T0MB 4YBLC 3GHEH 2AERT 4YIQB 4O58L 3VRJB 1A6WH 1NLDH 2X4RB 4O2EA 4Y2DD 4NQDE 4HIJA 2H6PB 2GJ6D 4WWID 3L3DB 3RWFA 4TTGA 1OF2B 2HT4D 2CSPA 4X6CE 2MKWA 4JRYD 2OI9B 2DL9A 2X4OA 2XOTA 1A8JH 2XIDA 5HGDB 1DN0B 1VFAA 1CDGA 4KK6D 4RA3A 1BQUA 2E7LA 4HG4J 4JEGB 2QKIB 3CFKA 4S2SB 5EFIA 3WIIH 4G3YH 5D7JB 4HZLB 4NOFA 3JWDC 2P5ED 3B4NA 5I1HH 2A6DB 1HDMB 2RBLA 1LEGB 3INUL 1B0RA 2AJSH 3QXWA 2ZSVA 3F58L 5C0FA 4L29A 1TPXC 3G5XA 4E41E 1ETZB 4UAOB 1Y18A 5EH1A 3D3VB 3VFMB 2JJTA 2V7NA 2R56L 1OAZH 3CU1A 3GSUA 1EZVX 1N0XL 4LAQH 3PP3K 4JFZH 4TUKL 1JZ5A 2DLFL 2BRRH 4XC1L 5I76B 5DEFA 5GRVL 1T89A 1IGFL 4OZHB 3TFKD 5KVMC 4OD1L 4DN3L 2XICA 3DURA 3FMGL 4ZO6A 5BS0D 2CUMA 4GRWH 5BOPA 4P2QD 4OUOA 3GJFB 1RUPL 5ALCL 5JNYA 1D6EA 1G9NL 3H42H 4UTBH 4JM4H 1P7QB 3RTQC 1FNSH 3VE0B 1WICA 5JPMB 4LVOC 3NACH 1DBKH 1MSPA 5HPOA 5B8CB 3TJEH 2VZ1A 1XGPA 5MENB 1YMME 1LEKB 2OP4L 5EU3A 4JO2H 5FUCE 5I73B 1DL7H 5HYJE 5KS9A 4PR5B 3B8YA 4YUEL 3VXNB 1NMBH 5T3XE 4M7KH 4Y16C 4YDVB 1GC1L 3IF1A 1AD0A 1ZHBB 4QRSB 3QSKB 1J5OH 5SV3A 4MJID 3QO0B 4OD2B 5EWIL 2G2RA 2VISB 1KJ2H 1YPZB 5C0AE 3OAZH 1AR1D 2OMBA 4ENED 4KK5D 1C1EH 3ZE2F 2NR6C 3H7BA 2Q7YB 4XNXH 3DUUA 1NFDF 3ZL4H 1JE6A 5C08E 1L9NA 1HEZB 4OQTH 2FEDC 2ESVD 4WHCA 3LN4A 3UZEA 4C56B 4MHHG 4GAYB 1F13A 1CVSC 4MXWH 3RAJL 2ZUQB 1FZMA 2HRLA 1RJZA 1JGUL 1DLHB 3MRMA 5EUOA 4CNIB 3SKJL 1DLFH 1KJ2A 1OB1A 3GIVA 2Z8VC 3K2UL 4Z7NE 1T04A 2NW3B 2WBJD 4P23B 4F8QA 2A9NL 4LSSL 4GXUN 1WISA 4EOWL 4I0PD 1OPGL 4KKCC 4NCC1 1KTLB 3O9WD 1ZS8A 1CDCA 2IANB 2PW2B 2VQUA 4OQTA 3GMLB 1D5MA 5D1XB 1AIFA 4JDTL 3QUZC 1A7OL 3PXJA 2AJUH 4PJ7E 2DLHA 1MRFH 4M48H 5JW4M 2NX5D 1U3JA 4P46A 1U8JB 4Z77B 4OBSA 4ZO8A 3RWCB 3RGVB 3K0WA 5DTFB 3QH3A 3PL6C 1KIRB 2DQEH 1KIQB 4NWTL 3RKDC 4GW4B 3X13A 4NNYB 4PGBB 5T1LB 1XF3A 1WC7A 2ZG1A 4KTEL 1XGRB 1ZGLA 1P5UA 3VG9C 5E6ID 5I2IA 1T3FA 1UWEH 3KWWA 4YWGL 1T03L 4F7TA 1CE1H 4LSQH 2XQBH 4UU9B 3WLBB 4WO4D 3C60A 3BH9A 3V4PL 1TJGH 1KCLA 1QO3B 3CVHL 2VZSA 4YBQC 1D9KA 2ADFL 2IMNA 5D2LB 4HPYL 1ITBB 3A67L 1A6UL 3WFCL 2A9MH 3V9FA 2CUHA 3AC0A 4MJ5A 5D7IF 1B6DA 4M5ZL 4ZDHB 2EE2A 3FCTB 2HAZA 1C5BL 1DJSA 5DFVD 1KNOA 5L2JB 3PXHA 1P9MA 3AB0C 3MRGB 2KUTA 3MUY1 4PRNA 5B21A 1CQKA 3OXSA 5D8JH 2DIBA 4LVEA 2VDOL 5DC0A 1MCOL 4YHPA 1IGIL 2YPLA 3VGAC 1S7WA 3UPAA 4Z7WE 3QEQB 4PREB 1KIUA 2VDML 1PW3A 2WW8A 3ZKQD 2AS5M 1TMCB 3R4DA 5HHOD 4AENB 5EG6C 1JIBA 4ZSOE 1S8DA 3ARGA 1LK2B 3D0LA 2P5WD 5E95B 2HLAA 2JIXA 4JM2B 2W1NA 4NJAH 5DHXB 1ZANL 5J6GA 1KFAL 2A83A 2AGJH 8FABB 2HFGL 3QO1A 3C2AL 1NCBL 1JF1A 5B3NA 5GGVL 4L8SC 4P2OA 3BISA 4KJWD 4LSVL 1RI8A 4X5XA 1FCGA 4PJXF 4XBPA 2GTZA 3WS6C 4C55A 1K8DB 1FVCA 3SDDD 1F4AA 1OP3K 4G7YH 1T66C 2EE9A 1NCTA 2J8UE 4HGWA 5FV2A 4QRUB 4NWUL 1YEGL 5GS0H 1CBVL 4BH8A 1X44A 3QUKA 1K2DA 4MMZC 4IRSB 3NAAL 4PV8A 1NAKL 3VFRB 1BGXL 4WFGE 5FOJA 3ULSA 2DLGA 4Y19B 2YXFA 1NBVL 1A6PA 4IMLA 4A2LA 2XN9E 4JFDD 1TQCC 4ZAKC 2BK8A 3T0AA 1RZKC 3DYMA 3BH8B 4FQXB 5IW6A 2UVEA 3W39B 4K55A 4LFHG 4ZPVB 4E42A 3ARBC 3ZYJA 3WHE1 4RAVB 2M8XA 1BIIA 3EYSH 4P49A 5K59F 4JZJC 1OP9A 3DBXB 4GBXC 4NRZB 1P7KA 4FMKA 2FIKB 5DJCA 5EC1A 4NPYA 5C9JA 1MCLA 2ARJQ 1AHWA 4Y2OA 5DWUL 4WI4A 4P5TA 2IADB 5ICZA 2H26B 1ORQA 5FIEA 2MHAB 3RVWC 1FORL 4H25A 4PJ8D 2K9UA 5F7DA 2VQTA 1I8MB 4OI7A 1BBJA 3NABH 4MD0B 3D85D 1Z9OA 1UYWH 2F8XC 1M4KA 2C1OB 4QKXB 1CDJA 4LLVB 2OZ4L 1TJHH 1I1AC 2G9HA 4BFIB 2FNBA 1KJMA 2FRGP 4YDKH 3LHPH 4JN2B 3VWKA 5KTEL 4U1HB 4K94C 3W9DB 3U0WH 3DTXB 3ILPB 1U8IA 3EYUH 35C8H 5FYKE 1X5HA 3QDME 3UTTB 1RSFA 4NN6C 5I71B 3HG1D 5CEZL 1F42A 5E4EB 4AYFA 2BOBA 1A9EB 3G5ZA 1JFQH 3RX7A 5IBTH 5GGSA 5E2VL 2UYLA 4TPRL 5J11C 4K3JL 1XZ0A 4G6ML 4HKXB 1J12A 1YEKH 5DJAB 4GG6E 1TJIL 3PWUB 2VXUL 4R96A 2C1PB 3DVFA 5IUSA 1GXEA 4PJHA 4XAKE 1FRGH 4NO0D 4QXUL 1M6OA 3TA3C 5I6XC 1NMAL 5T1KB 4GKOA 4XVTL 5C0ND 3VRIA 1BZ7A 3BD3A 3KYOB 4YPJA 1CLYH 1U93B 4JVPA 1CFNB 1NGPH 1S7RB 3VW3H 3TNNA 2VQ1B 1KCRH 4NZUH 5H94B 5C9KA 3FT4B 3DMMB 5C0BE 3EYVB 1OP5H 3Q6FA 3TLRA 4XPTL 4PRDA 3RWEB 3W5MA 4ZD3L 5E99L 5HDQL 1IGTB 4PJIA 1UZ8A 2W59A 3T3PE 3GBNL 4NQDD 1VESA 1OLLA 2CIIB 1QFWM 4OLWH 4XVSL 1O7SA 2FSEA 5F3HA 3ZDYE 4QHLB 4PGDB 3EZJB 1J86A 3LKNB 4XTRD 1Y0LB 3MA9L 3CH1B 2WUCL 5IEKA 5DD1H 3GMOA 4N0CC 4NBZB 3OR6B 5DK0B 2CGRL 3ARVA 5DGQA 4HJGB 4J2XA 4N8CL 5FM5O 3TBSA 1P4LB 2NXYC 5SWSB 2YPVH 3T3ME 5IQ7L 1N6UA 4YDIH 3D69B 1QSEA 3P0GB 1OQOA 2D0GA 3KXFA 4LLWA 3I2CL 4XXDB 3FRUA 3VXME 5HYIA 3QA3A 4LRNL 4F80A 3JSSA 1TZGH 1OWWA 1H3UA 5I18L 1QFOA 1NGWA 4MNQA 3KPMA 4JFPA 1XIWD 4E41D 5GGRB 3WIFB 4GH7B 5HHPA 3STLA 4U2YA 2LU3A 4IS6B 4WHYG 5JW3H 3HC4L 1QSFE 3MV9B 4QHUB 1S9WA 4OCNC 4Y5XA 3ARFA 4KK8D 5GJSL 4YAQB 2F53A 4OI9A 4X99A 4Z7UF 3BX7C 4U0QB 4K94L 2J8HA 5I75B 2C7UB 1KN2H 2FWOA 4MA1C 3RVVC 1F6AB 4QTIL 3SCMA 3DO7B 4Z18A 3T0XA 4G8GA 4UILL 4UV4L 4HT1L 5MEPB 3GI9L 3HI6L 4H20H 5C0DB