3FB6B

Kcsa potassium channel in the partially open state with 16 a opening at t112
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
b'DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody fab fragment heavy chain
publication title KcsA Potassium channel in the partially open state with 16 A opening at T112
rcsb
source organism Streptomyces lividans
molecule tags Membrane protein/metal transport
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fb6B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fb6B01
2R1WA 4LLMA 4G6JL 3HNSH 1BBJA 4GSDL 3RL1B 4H5SA 3G6DH 1D6EA 2VZUA 1FYHB 1RULH 3QXUA 2FBOJ 4NM8H 4OQTA 1SYVB 4NNPH 4UQ2A 3SQOH 1WUNT 4KDVA 1S7TA 3PGCA 1NJ9B 4UBDD 1KCLA 1T5XA 6FABH 2WUBL 4RAVB 1INQB 5E5MB 2R2HB 2RAMA 5CEXB 1WCBB 4X4YB 5ACLA 4ZTPL 3QO1A 3BDYL 5FCSH 3D18B 1PY4A 4FMFA 4YWGL 1R3HA 4RFNC 2CKBA 5EUKA 4QNPF 4OZIF 5D6DA 4RIRB 4GW4A 3JV6A 3ZKMC 2ICWI 3EJYD 3C5ZC 4EDXA 4XPHH 1FVDB 3U83A 1I9RL 4JFQA 1SYSA 1JVKA 3HMWL 5K9KA 1I7RB 1Q0YL 4HMDA 3EYQD 1HK6A 1S9YB 4JZJA 3VWJA 5A3IC 1NEUA 4CW1A 3KDMB 1CLYH 5L2KE 1TTFA 3EFDH 5HGAB 2IH1B 5I6XC 4P4KC 2YWYA 3SCMD 2F8VA 5ENWB 1RZ8A 4NQVB 2EDTA 1FG2B 1HH9A 5FM5M 2CDEA 4YFLI 5JQHC 3UBXG 3HCVA 1CT8A 1KIQA 3C8KA 3TP4A 3RPIA 1YNKL 1NC4B 4YDJB 3FN3A 1DBJH 1X5HA 4L9LC 5IBTH 5FGRA 1KIRA 1MFDH 3BWAA 4PGBA 5DRNA 3VFTA 3BRGC 4X6BB 4UU9A 2R4SL 2P8LA 2NNAB 5H2BA 3TC9A 3ZE0E 4YBHA 3LPFA 1FIEA 1NLBH 2WP3T 5D7KE 4XMKH 5DVOA 3G5XA 5F97E 3S4SA 3EYUH 5TF1L 3FT4B 4J3UA 5HHNB 4H0HB 1NAMH 4OIAA 2BY2A 3W0WE 3O3EA 2QTEA 4XNMB 2P5WE 3HHRB 4GH7B 3P4MB 2ATKB 2ZOKA 3HG1B 2L4OA 1TVBB 3V5KB 1CXLA 5AEAA 4KH2A 1D5BB 3HMXL 2AGJH 3UO1H 3L5IA 3S96B 1JGEA 4KMLB 4YGAB 3GIZL 5A2IH 4OUUB 1IAOB 3KPTA 4M7ZC 1U92B 2NY4C 5CMAB 5EULV 3KPRE 3QQ9C 3I6KA 4HUXA 4WY7H 1BLNA 2ED9A 5C0AA 2AP2A 1QRNA 3VXUE 2APBA 1JJUA 1MREL 2BY1A 3PV6A 4RA0C 3RHWF 5HJ3A 1U8NA 1SQ2N 5E6YA 2AERT 1VGKB 2K3TA 3RDTB 2V6HA 4JB9L 1LHZA 4JHBA 1IKNA 1SY6A 4HZLB 3TVMB 1ZT4A 4G8IA 1MJJA 3SPVB 4PUBL 5HDQL 5F6HJ 3U79A 4XPGL 1NBZB 3FQUA 3TBSA 4LCIH 5E8DL 1BVZA 2CIIB 5I75C 3R06B 1ZVYA 5IHUH 2UV3A 3O2VH 1IE5A 4H88H 4YXHH 3CSYA 3X11A 4TUOB 5DO2D 2R9HC 1FN4B 1KPUA 3RTQC 4HUNB 2XY1A 1X4ZA 4PJFB 1MCSA 2OJZL 2D7TH 4EI5B 4D8PA 1QSFB 3SQOL 1L0YA 4EIGB 3AS1A 5JLZB 2H45A 5EOTA 4D9RE 4Q2ZA 5FO9B 4UNUA 5DJAB 3S36H 4LVEA 5GS0D 3U4AA 2DD8H 4LPVA 2MWCA 4OKVA 3H3KA 3SDDB 2VABB 4LDEB 3EYSH 3HPLB 3L3HB 4NRZB 5CWSA 2VE6A 1KN2H 3WO3B 3SDCC 4WDIA 1F4AA 5D7IE 3U82B 1VFAB 4QRQA 4U33A 3TNNA 1HHKB 3BFOA 4KPHH 2B2XH 4EKXA 4JDZB 1JN6A 1PAMA 1SEQH 2X6MA 4NQCA 2XFXB 3BGMA 3GM8A 4JVUA 3Q5YA 3MFGB 1OL0A 3LZFH 4KTYA 3H9ZA 3TA3A 1QFWL 3MXWH 2Y5TB 4QOKD 2A9NH 2OZ4L 3QHZH 5DK2B 3FOLB 1YMMB 5E2TH 1UM6L 3GSOB 2DMCA 1KEGL 1MFAH 5AZ2L 3V7MA 1A0QH 1F3DH 2AK1L 2X09A 3NTCL 2JJSC 4NSKB 1MCJA 5DHXB 2FX9H 2IADB 2RCSH 1NGXB 4ENEC 4R26H 1FV1B 3B83A 5HD8D 4NBXB 2AK4B 1R5VB 4GRLA 3QDGD 2VLRA 1EDQA 2RHEA 1OAKH 1T22A 4GG8B 3MRCB 5EBLB 4WUUB 4NC0B 1CE1H 2F53D 4I0PA 2C7UA 4U1HB 4IHOA 1I4FB 1NBYA 2OJEA 3KWWA 5SWSE 3D48R 4KMTL 1F6FB 1TCMA 1FGVL 1AXSA 1UKQA 2IH3B 3TWCL 1IKFH 3W5MA 4IRJA 4UV7H 3SE4C 4P2RB 5HHOB 5DI8A 4DEPB 4LF3B 1O7VA 5EZOL 4PBXA 5J56B 5FDWB 1DQML 1RQ5A 3EYUL 4NQDE 1CD1B 3OR6A 1FDLH 5FUZL 4F3FB 1FBIH 4QLRA 3LPWA 5I1JH 5E1AB 1QPXA 3PWPA 5D93B 4P9HH 4RDQF 1FO0A 1IAKA 1OF2B 5MI0C 1HQRA 4V1DA 1K5NB 4LKCA 3RVTD 3TBYB 3RVWD 3BO8A 1YEDB 3I9GH 2COQA 4PTUB 4ZAKB 1G7MB 2AGJL 3QDJD 1AGFA 4A6YA 1GAFL 4OV5A 4S1RH 4U6XB 5B39G 3KPPB 3GSQA 3FQNB 4ZXBA 3QEQE 1M4KA 1CL7I 3S35L 3CZFB 4WI2A 4M1CD 4G8EB 1WZ1H 4WY7L 3LB6C 3MODH 3QH3A 4IRZL 4LSPH 2GT9B 1S7WB 3T0AA 1TPXB 1MPAH 2A74B 4F8TA 4F9PC 3T2NH 2X4PA 4PJCA 1BD2A 1T80A 1P4LA 1TITA 1U95B 4DAGH 2DMKA 2JJTA 5E0QA 3VH8A 4HWEH 4JFXA 1TZHB 1P53A 5EC2A 5ERWB 3BPCA 3MRRA 4P2QB 3BGFC 4MZ3A 3IFPA 5IHLB 3H9SD 3I85A 1BFOB 2X70A 3M8OL 2F5BH 1R3LA 4HQQL 3SDXE 3RVUD 1JZ4A 1JYVA 3RWFA 4LP5A 5FYJD 5DC9B 2AQ3A 5IHUL 4D9QE 3CX5K 1OT1A 4LFHD 3OB0K 5DTFB 4HIJB 2J8UE 1YDPB 3QIWC 4X7FC 1UH3A 1PKQB 2A1WH 3ARFC 1SJHA 3RWEA 4PJ8A 5JA9A 1B88A 4NHCH 2R0ZL 3NFNA 4JO3H 3AS0A 4JR9H 4E41B 5DGRA 4I2XA 1DQQB 2ICEB 4JDVA 4OTXH 3QWRD 3UX9B 1MCIA 1AJ7L 4Y4HA 5E99H 3AM8A 3EYSL 4KJQD 3VXTB 2CLVA 4OF6A 2MKLC 2PW1A 3L3OB 4WU5A 5L8LB 4KPHL 5DJ2A 5ANME 3DI2B 1SEQL 1RU9L 2F74B 4ONHB 3RL2A 3BVNA 1L6XA 2LU4A 25C8L 5T1LA 2FL5B 2C3HA 2C26A 5EORH 3MV8B 3VXNA 4APQA 1UKTA 5KSAC 4KTDH 1G9ML 1I9JH 5DQ9B 3JTTA 1MHEA 3WIHH 3C6LC 2CDFB 3BKMH 2OMNA 1A0QL 1O7SA 7CGTA 3IETA 4PJAB 1PX3A 5CJBA 3VWKC 3LKQB 3SJVA 2UZIH 2Z31C 4XWGH 3SBWA 3FT2B 3QNXB 4X7DC 5EU6D 2RCSL 4NWTL 5I18L 1MVUB 2BHUA 3PHSA 4R2GB 4U05A 4X4MA 3MRMA 4NT6A 5KOVC 1JWSA 3OKOB 1U8QA 2VXSH 4KMQA 4Y5YB 3H6JA 3BX7C 1NCUA 1P84K 2OP4H 2CLZB 2ARJB 1IRAY 4LSSL 1GRWA 1NCCH 2FYYA 4DN3H 2VB5A 4WRLA 4YQXL 5KSBE 5I1IL 1H5BC 5IF0A 2BFVH 2OM5A 4F33A 2JF1A 5ELIA 3CUPB 1F90H 4N9OB 2BK8A 4PPTA 5CFHA 1QUNA 3BJLA 2LAAA 3R4DA 4J8RB 2IQAB 3L3KB 5C0BE 3WIFA 4KGLA 1GL4B 3KPSA 1XF3A 3B9KA 1A9BA 3UTQB 5KS9A 1G7JB 4ZDHA 4CUCA 2R15A 1CL7H 3VXMD 3T77A 4G9DB 4MB3A 3JWOC 4HKJA 4HX1B 4P9HL 1MQ8A 2AJSL 1V3LA 4MJIB 5F7DB 2YPLB 1WCQA 3I9GL 4XP4L 5AUMA 4F58L 3ZKND 4Z76B 1UCBH 1YEHL 5EU5A 3V95A 2IPKA 2VLRD 5CZVL 4LSQL 4PB0H 4YNYB 4R3SB 4Y1AA 1XGUA 5BVPH 1CFSB 3QYCA 1J8KA 4H0IA 3FB8A 2GEEA 3QCVH 1A02N 1BF8A 2Y72A 3MODL 3WFHA 3EZJB 4J1UA 4AZ8A 4HFWA 5ICYB 3T2NL 1NCAH 5ITFB 3DBXA 43CAB 3I84A 3TF7C 2NQCA 2F19H 3HRPA 4IRJD 5EO0B 3DURA 5T33L 4BM7A 4GAJH 4LLDA 3F12B 4JE4B 5C1MB 4K9EC 5IW1B 5MENE 2IC2A 3SE3A 4IRSB 3W2DL 35C8H 4CADB 5FGSA 4JKPH 3TO4B 5D7IF 3L5WA 3G5YB 4HPYH 3Q48A 4H26A 4DZBA 5D1ZC 5GRUH 4OT1L 3AC0A 1ZA6A 2BNQE 3OBAA 5JDJA 1A4JA 3C09C 1HKLH 3MV11 4OGAC 4F7TA 1FFOA 2NY0D 5F1NB 1ZT7B 2F58H 5HGBA 2AJUH 4BSWB 3GSRB 2A6KA 1KC5H 3B9VA 3TFKD 4NO0D 5I1HL 1H8SA 3WE6B 3VFNB 3GMNA 4LHUA 3MRGA 4CBPA 1JZ2A 3GMQB 3V6OE 1YEEL 3K2UH 1S9WB 4OTXL 3MFFB 3FO0H 2PTTA 4NFCA 3FB6B 1UM4H 4X5XA 5IG7A 3QAZB 2Q8AL 4UILH 4CU7A 4GBXB 3QJHB 1C08B 1DR9A 4ZUSB 3PGDB 5FGBA 4XP1L 1E4KA 3HNTL 4LRNH 5TDOB 2M1KA 4LHJB 5HHVL 4J6RL 3C8DA 1JFQL 4WW2A 5EIVA 4P2OA 2MPAL 1I85A 4XPFH 5TE7L 1D9KC 2J8OA 4X6DA 1FNEB 1IC5L 1RJLA 1IGJA 5EORL 3WFBL 4PP1C 3UXFA 1M7IA 4UT9H 1QNZH 4ZMAT 4NGHH 4MD4A 1JGLL 5TH2A 3BKML 1CLCA 5E95B 1AGDB 3V6OC 4RMVA 1XT5A 1A7PL 4HH8A 4KI5E 1CGSH 3RKDC 3CVIH 3VXRA 5IBLC 4UTBH 4IMLA 2PW2B 5ISZD 2NY3B 3V4UH 5JXAH 4F7CB 1YNTA 1HYSD 5E8EB 1H3XA 1YN6A 1HHGA 4DGYL 2HJKB 4YHPB 1OM3L 4NZJA 2GUOA 3FO1A 3EYVB 2VZVA 5DC4B 4KGJA 2W0LA 2Q1EA 4WV1A 1NCCL 1BAFH 4Z7VA 1KLGB 2DLEA 3HZYA 5FOBA 1J88A 4X4XB 4MNQA 1T1ZA 5F93C 3ULUC 1F90L 1TQBB 5C0DB 4KXZI 4YDIL 3OL2A 4TOYH 3GSUB 3O6LH 5DEZA 5GHWH 2E8ZA 1J0HA 3HE7D 1C12B 4KI5C 2BX5A 1JYWA 4NRYA 2R8SH 2R56H 4UV4L 4X0KB 4QRPE 3BAEH 4ODUA 5B4MD 1JNNL 1U8HA 2PCPA 5CILH 1RHHB 4OZFB 1CL7L 2BY3A 5L7XL 5T1MA 4K3EL 4HAGA 4PJHA 3H3BC 3O6FC 1RZKH 1U6AH 5DSCB 4FXKB 3SJVD 1GZPA 3WS3B 3ROLA 1PW3A 3CDFA 1SMOA 1CDHA 3F8UB 3SDXF 5LBSL 2P5EB 1P1ZB 4HLJA 1H3TA 1EFQA 4QHKI 5BVPL 2XI9A 4NRXB 1BM3H 4HC1A 3VFOA 1AHWB 1UJ3C 1JNHA 4G8GD 2I9TA 3AXLA 4BSVA 12E8L 1UA6H 4UUJA 4JRYA 3T04D 3TO2B 1AGBB 4K8RH 4N0FA 4PRHB 2WP3O 3MCG1 5DQDH 4FQ1L 4GAJL 3NZHH 1D5IL 2KQMA 5F7NC 2OSLB 5CIPB 3U46A 2PYFB 3B9KD 5EBMA 1DLHB 5HY9B 4RSVA 35C8L 3IAGC 4MQXC 3VXUB 1JTTA 5DF0A 1WICA 2GIYA 2CR3A 3QUYC 4KRNA 3KG5A 1Q72H 4MQ7B 4N8CH 5BQ7A 4MNHA 5I15L 3O2WL 1ZLWH 3KYNB 1MLCA 1MIEH 1WLHA 4KTEL 4RISL 1FNLA 4M7LL 3DMMC 4XVSH 3O3DA 1HKLL 1W0YT 1RJZB 1XZ0A 5KW9L 2CLRB 1E4XL 4Y5VB 5C70A 2F58L 2AJUL 3INUL 3L95A 3VFSB 1K8DB 3I02A 3VA6A 5I8EA 1DUZB 5SX4I 3OKEA 4Y1AD 3SDCB 5ESQB 1MSPA 4L3EA 5EBWB 3IRPX 4TVPD 4YDVB 5BMFH 3BPNB 3U36A 4AL8L 4RRPA 4JAMA 4NUGH 4J3SA 3ET9F 4HGWA 5JIHA 1IZKA 1G0XA 5C09B 5F7KC 2Y06H 1Q9OA 2CK0H 1RVFH 2W0PA 4G42A 4NJAL 3BISA 4OFVA 3N06B 4MHHI 4Z0XB 1QEWB 3ARDB 1B0GA 1I7UA 2CGRH 2IPTH 3NACL 1F6LL 4TSCL 1PEWA 4LRNL 4QTHB 1HXYA 1KENH 3SHSA 5FDYA 3U7YH 3I6LE 4GJTB 5ALBL 2NX5A 4XRCA 5C0EB 1ODAA 1AXIB 5C08A 4JN2A 2XA8H 1LK3H 3BKYH 4M93C 4JM2A 1NDMB 4G6FB 3EAKA 1ZLUH 1R24A 4XPFL 2EXWD 1GGCH 5KSBF 5D96C 1I7TA 4Y19A 3LY6A 1LWRA 4HS6B 4RNRA 4BFBD 3CH1A 3MRIA 3BH9B 4M43H 1LEGB 1TJGL 3KYKH 1DFBL 5D7LB 2ITDA 2HA1A 4N5EC 5C0NC 4LSUL 2GJ6A 4AEIH 2A6DA 4LHUD 2Z93A 4OM1H 4XCCL 2HT3C 4JZJC 5BS0D 1KJVB 5EDXA 5I8CA 5D1XD 4KXZH 2GITA 3RGVD 3BXNA 3IDIA 5DMKA 2Z0BA 2NY7L 2ENSA 5F3HA 4DFHA 5GZOC 1KJ2B 1WEJH 3MRPB 4JHZA 3QDMA 1JF6A 4EUPB 4W81A 3B8YA 2ITCA 3B9DA 3L7FA 4Q9QH 4FQJH 1PZ5B 1IM3A 3PG2A 1FFNA 4R4FL 4M6OH 2BXZA 5A2JH 3QEUB 5T3XL 5BRZB 3ZSTA 4CN6A 1M7DB 1L7IH 5IM7B 3N9GL 5MI0B 3GHEH 3TM6A 2L0DA 4OI7A 2R2EB 1OGAE 2B20A 2MQ3A 5FO8A 4IIQB 3DOSA 2NY5H 4U1NB 4ELKA 4N0YH 4NM4H 1DL7L 3KR3L 4MSWA 5EIQA 5C0AE 4XPBL 2I9LA 2ZJSH 3U2SB 5DRZA 4ERSH 4BK4A 1EUUA 1F00I 3BDBA 4PP2A 4YHKH 1FAIH 2QLVB 4EQ2A 4ZS7L 3W9DB 3DRTA 3WD5L 4NDMB 4S2SB 2YKLL 2QJDA 3HZKB 3AUVA 5FB8B 1G6RB 3ZO0A 1CXFA 4PJIA 2VR5A 3BGAA 1BM3L 2H32A 1CFVL 3WDIA 1MCOH 3FL7A 3FRUA 4QGYA 4E0RB 2I26N 4ODHL 1FFPB 2Q76B 4MNQD 4ZTOH 4HPOH 1I1CA 2PYEB 5GJTL 5IEHB 4RGOH 3QFJD 1N7MH 4ODSL 3MLZH 4XMPH 3TN0B 4DK3A 1MAML 3IT8D 3QIWB 5SX4H 1F4YH 2AEQH 4FZ8H 5SWZB 5IB4B 4K3DL 5IVZB 2MMXA 5JOPE 4GO6B 2XKNB 3T65B 4OB5H 4W6XB 1IKNC 4LCYB 4L9DA 3MLTA 5JXEA 4XCYA 2NY6C 3UBXB 4J23A 2WW8A 3K8MA 2A2QT 4GKSA 4WFGD 5DWUH 2J1KA 3JVGC 1BOYA 4UDTA 1RURH 2XQBH 3ULSA 2B4CH 3QB7C 4JHWL 4DUWA 2DQCH 1A14H 2P8MB 2DBJA 2VLME 4DQOL 5BCAA 1E28B 2QADC 3HZMA 2RQ8A 4P57A 5FKAB 4P23B 3BRFA 4F7MB 5FECB 4EN3C 4R4BB 4NC1E 4LVOC 5CGYC 4NUGL 3OKLA 1EAPB 4ZG1A 2XG5A 5IEKB 4JRYD 4KI5F 5IT2H 2C3VB 1ZAGA 4L8BA 2DLTA 1F6AA 2YZ8A 3LKOA 4LLYA 1BPVA 2VN4A 4FQQB 4PRPE 1NCDH 1A1MB 2PO6A 1IGTA 1RUQL 5T5FH 5MEQA 5DJCB 5CD3A 3U7YL 4GAYA 2BNUA 1OTSC 2G75A 5FM8A 2XA8L 1LK3L 4FFZH 4UINL 2Z31B 1VFOA 3V52L 3QNYA 4JVWA 4RBPH 1OW0C 4YO0B 4FQ2L 5FYLH 1LE5A 1H0DA 1I8IA 4GW1B 3V5HA 1LD9A 2ZSVA 1PG7H 1DUYA 3KYKL 4QHUA 4X6CE 4NC1C 3VFMA 3NFSH 4XHJD 5JW5B 1P84J 3LKRB 3E6FA 4JM4H 3NPZB 3P73A 4OM1L 2O5YL 4H1LG 1N8ZB 2Z35A 5E2JA 1H5BB 3GMMB 5HI4C 2FJHB 2ADJA 5BVJA 5KANI 5BJTA 2FD6H 3SO3C 5EOCJ 5C07B 1PQZB 3FTGA 1A1NB 1R5IA 1VKXA 1WIUA 3PWPE 1DVFA 1DDHB 1Q94A 3HMXA 3MLYH 4JFPA 3HAEB 3DVIA 1KFAH 3GKWL 4FQJL 5D71H 4AIZB 4GW5B 4V1DE 1E4JA 1XR9B 1RHFA 2X1PA 2M2DA 2XA3A 1CGUA 3O4LA 4I0PC 3EOAB 1L7IL 3HNVL 3KAAA 2A73B 2FNBA 5MEPA 3GUTB 4F9LA 3ILQC 4MQTB 2J6EH 5J6HA 1HINL 3C9NB 4M7LT 2XN9B 3V4PL 1U91B 4XP5H 5CEZL 4PV9B 1QO3A 4WI8A 1T1XB 3UTSD 3TIEA 1EH9A 4KFZC 3HE6C 1BD2E 5CINH 4OLYL 1AR1C 3MNZA 4Y7MA 5LCVH 5C6TL 1YPZB 2YC1A 3O9WC 4U2YA 1HWGB 3PABA 5GIRA 1FZKB 3X3GL 3UPCA 5ID1A 2PTUA 5B38B 4Y89A 4BH8B 5IVXB 1D5XB 5EFIA 1V7MH 5D2NB 5AAWA 3HKFA 3QDMD 2FH6A 3RZCC 1B0RB 2BMKB 2W92A 4R2GD 2OL3L 4OZFH 4HUMB 1HOCA 2P7TB 3RNQB 3RKPA 1MCRA 1GJIA 2NR6C 1EMTL 5D8JL 5F1SA 5D2LA 3BUTA 1N7ML 5I1EL 2DN7A 4H25A 3Q6GL 2C4FT 3MLZL 4XMPL 3S37H 3BP4B 4QRSA 1FG9C 4TUJA 1OTUC 4WWID 4JQXA 1HEZA 1FVCA 5HHME 3UYRH 1T04A 5KN5B 4RQQA 1JGDB 4JY5H 3P4NB 2NXZD 5BV7L 5JOEA 2DLFH 3IJYB 3V6FB 4DCQA 3V4VH 2GY7B 2ED8A 1JF1B 4S1QH 4LMQE 4R4NC 3MRLB 3TYFA 4CVXB 2W9DL 5JPNB 4JPIB 4TUKH 3GGWB 2BC4B 2RBLA 4XC1H 2WBJC 5J9PA 2ZPKH 3BZEA 1S7RB 3L5HA 3DX7B 2ZUQC 3LEXB 2DQCL 1MQKL 1A14L 4JFEB 4MJID 5I9QC 1V5JA 2E6QA 4FXLA 1LVEA 4PJ8C 3P77A 4N0UA 4KQ4H 1RUAL 5IT2L 3ECBB 1OCWH 1VENA 4JHAL 5JORB 3WEXA 2WBKA 4LEOA 3MRJB 5J1AA 1H8OA 4DJMA 5T5FL 1FE8L 2AXGB 4JFOA 3U4EB 1XCQA 1A6AB 2HVJA 3ZTJG 5K59E 1AKJA 4FFZL 1J12A 3ZHDA 2F54A 2FIRT 4PD4J 1CD9B 3DXAA 4ODVH 3IDXH 3O3BB 4OZHA 5CGTA 2BZDA 4FNLH 1CK0L 3UBXI 5IK3A 5MP6H 1PG7L 4ZOBA 1OQXA 4NO2A 5ESAA 1OPGL 2VL4A 3MXVL 3LKNA 4NZRH 4M4PA 4RMUA 4APQC 3GB7B 4UQ3B 1CS6A 4BELD 3MROB 4PJEE 3LRSA 4HH9B 5HYFA 3T1FA 1BQHA 4TYUA 1RZGA 4QYOA 4JY4A 1OB1B 3HC4L 1NAMA 4KK6C 2YRZA 4Z7UA 3FQXB 3PL6C 2VAAB 1BX2B 4HEME 5DRWA 2NYYC 4M9OA 1B9ZA 3I6GB 2W60B 1XGTA 2RFXB 5FV1L 1KCRH 1QHOA 1KLUB 1QQDA 3MBEC 1ORQB 1KFAL 1BQUA 3OKNA 4IJ3B 4HHAA 3BH8B 4Z8FH 4W4OA 1T66C 2IQ9L 3O6FB 3RAJH 1KEML 2R39A 4G8FB 2AJYL 5D7JA 3QUZB 2DQJH 1XF2A 3UTZB 4OZ4A 4HKXA 1P6AB 2J6EL 5J8OA 2AQ2A 1FIGL 3GBNH 1JHKL 1C16A 5E2VL 1KJ2H 1U2HA 1CLZL 3DIFA 4KAQL 1XGPB 4OCLC 4EUPH 5BXFB 2ZCKH 4LGSB 4PJ9A 4M3KB 5CSZA 2BRRH 3ARBA 1BBDH 1NEZA 1BZ7A 1QA9B 5LCVL 2FEDD 2ESVB 1SJVA 3MJ7B 5E56A 4ELMA 3T8XA 1L9NA 1MEXH 4HWUA 3WO4B 4J3XA 1N64H 2YD7A 3L3DB 5EO1A 4GKOA 5LXGL 2P8PB 5E00A 3B3IA 1DVFD 4DVBA 4ZUVA 2XNAB 4QT5B 5TGBA 3WHXB 3BHBB 5IR1B 2XTJE 4HK3N 3O4LD 3TT1H 1X4XA 1TZGH 1ZSDB 4MS8C 5F70A 3V9FA 4YBLB 1CDYA 5EZLA 1ZMYA 3F7RA 1UQSB 4PJ7A 5F7UA 2FCBA 4Z9KB 2LTQC 3UTTB 3UYRL 3OAUH 5T3ZH 3U0TB 5C3LD 1G6RH 1RIVL 3BPLC 4YEEA 1LNUA 2C1OA 4YDKL 4NHUA 1AY1H 2B39A 3V4VL 3VGAB 4LGPB 3RQ3A 3SE3C 5F1IA 1SM3L 3QQ3B 4I18C 4NQEE 4L1HA 5DD6B 4MJ5A 3DVNA 1AO7B 1FNSH 3SDAB 3Q0HA 2IGFL 4IBLT 1U3HB 1CVSC 4ZS6D 5FF6A 1DBAL 1CICC 1T4KB 3QCTH 2APXA 2HFGH 5F7YC 4J3VA 1UZ8B 3M1BA 1VEOA 3GSNB 4D9LH 1J0KA 3SGEI 3THMH 4Y4FA 4X6CF 3LKPA 4GOSA 1SEBA 2VC2L 3U30C 3LDBC 5DHVB 3SKJL 4OGZA 1BVLA 2YD8A 2PF6A 1KJ3H 1XF4A 1OCWL 1T0NB 4NNYA 4CNIB 5IV2A 5D96B 3MRDB 4K7PL 3KXFB 1BEYH 1V3MA 1FZJB 4IDLA 5IB3A 3VXRE 4U3HA 3LEVH 3TCXA 1MRFH 1G9NC 5I76A 3FMGH 5IFHH 4JPWH 4C56B 4I4WA 1X5AA 3X14B 5FGBC 3MV9A 3GRWH 2JB5H 1B4JH 4GQ9H 3DV6A 1U3JA 1OQOA 2ZUUA 4ODVL 3IDXL 1LO3H 1MFNA 3PWNB 3QIBC 2X5PA 3P9LB 4FQXB 4XI5D 2X4UB 3FONB 4J4PC 4U1MB 1IQWL 4G6AD 1LP9E 3UAJC 3L1OH 4WWKA 2VDPH 4QHLB 4C55A 1J87A 3ZKSD 1KACB 2FIKA 1ZHBB 3AGVA 3P4LA 4G7VL 1A6VL 1G7HA 3BQUB 4DOHB 5EC1B 4YZFE 2WSKA 3VG0H 2UZXB 4CMMB 2C3XA 2QQLH 5HGHA 3W9EB 3AREA 1P69B 4PJCF 1YQVH 3REWA 2QKIB 1A9EB 4IOFC 4LARH 5TJWK 5IMOA 4WFFE 2V2WB 5GGUA 3F65A 2EDJA 1KCRL 3HRZA 2IMNA 2JKXA 4XXCC 3QIUA 2PXYC 1A6WL 4LAQL 1Y18B 3TNMA 1U41A 2CDGA 4WV1C 2NLJA 4TQEH 5DJYA 3WV0A 2MCPH 5I66B 4KKLC 1IAMA 3DXAD 4ZOAA 1S5IL 1FNGB 4QRRE 3GBNL 3SGJC 4UNVA 43C9B 3HN3A 1K8IB 3NCJL 3KLHC 5DDHA 32C2B 3EOYG 4G6FD 1T0MB 3AROA 4F57H 3Q5OA 3HAEH 1FORL 2EEAA 4X9HA 4XXDB 1GSMA 3GJFK 4M5ZH 5IMKA 2DQTH 2W07A 4NOBA 2FRGP 3JWOH 1WBZB 2A6JA 4OM0H 4WEBH 3ARPA 5D7LD 3ZYJA 4P0DA 4JVPA 3RVXD 1OGAB 3WXVL 5I2IA 2GYSA 1KTDB 2OQJB 1N64L 5KSUA 3NA4A 1XF1A 4K23H 1HHIB 4HJJH 4JRXB 2CO7B 4XBPA 1NFIB 4XAKD 3W39B 3EFFA 1KPVA 3DROA 1N59A 5CJOL 1DANU 4Y16A 1QTYT 4O9HL 1X5ZA 5KZCB 4CL7A 2VLKA 1KCUL 5TQ2H 3TT1L 4KHXH 4PG9B 4QHMA 1TZGL 4BZ1H 4DKFL 1INDH 4TRPL 2NY2B 1MI5A 4Y88A 3EJZD 5A2KH 2EZ0C 4TTGA 5DA4A 3OG4B 3T08A 3MV7D 5C0RH 4FQCL 4AM0A 1JMXA 1OT2A 4LLWB 1D6VL 4WGWB 1OGTB 3S97C 3SGEH 3RL1A 4JFFB 1YEFL 5GRYA 3PP3H 4FQHA 3MREB 4PJ9D 3T4AB 1SYVA 3ARBD 4EN3B 3KHOA 3RPKA 1TJHL 4LVOB 1WBYB 3PQYB 5K59F 2YK1H 1GHFH 2NXYB 4DFIA 5J6GB 1NJ9A 1F42A 4RAVA 3QCTL 2G60L 3IXTA 2NX5E 1INQA 1W72L 2R2HA 4PY8J 5CEXA 3K4AA 3GMLA 3WIHA 5K9JH 3D18A 5CJQH 5DUMH 2ENYA 5TQ0L 5GGTL 2YXFA 5EIIB 1BP3B 3QSKB 1T83C 4QY8B 1Q38A 1FVDA 4N68A 2FSEB 2PYED 3RNKB 1E6OL 3FMGL 4P5MB 4UAOB 1CFQB 5IFHL 2Q20A 3C2SA 4D0BB 5LAXA 1I7RA 4NO5B 4MA7L 1F4XL 2DQFB 1S9YA 4FQIL 5K9QG 4HEPG 3KDMA 2FB4L 3CSGA 5D7SL 4UIMB 5J1TC 3F7QA 1DP0A 2IH1A 5EPMB 3QZWB 3NPSC 1I1AC 3CZJA 3WIIL 5ENWA 3ROOA 5KVMC 4NQVA 3OXSB 3T0WA 3HI1B 4GAGL 1FG2A 5DVNA 1IQDB 3JV5A 4WEMB 5I16B 3R0NA 1BJ1J 1ONQB 5F96H 5LG1A 4M6NL 5KG9A 3P0GB 3VG0L 1NSNH 2X4QB 4ONGH 2QQLL 1MRDL 1A64A 1NC4A 4LSDA 4YDJA 2HFFA 4LARL 2IBBA 4P23D 2AV1B 1TJIL 3RA7H 2X44D 1JPTH 4X6BA 1IT9L 3V79C 4LRIA 5GZND 1S9XA 3OB0H 5D72H 3BP6A 3QI9C 4U6TA 1AGEA 3FT4A 1GGYA 1MUJB 1YY8B 1J8HB 4TQEL 4JN1H 3PDDA 1QVOB 3O9WB 3CCHB 4CJ1A 3ULUH 1RZJC 4DVRH 3L3GB 4XNMA 4KKNA 4PRDA 5D1QB 3P4MA 2ATKA 2D7PA 3HG1A 3B2VL 1RMFH 1TVBA 3V5KA 2IAMC 5DLMH 3QISA 3MR9B 4TTDD 3C60B 3QEHB 2VZSA 4MXWL 5F6IC 3RZCB 3S96A 3JTSA 1F5WA 2P48B 2CRYA 5HXMA 1MJ7L 4M5ZL 2BSED 1IAOA 2DQTL 1S9VA 3JWOL 1RY7B 5CMAA 5JZ7D 4IEFB 3MYJB 1OWWA 3S88H 3R1GH 2WM0A 2OLDA 1ZVHA 1X3DA 4HJJL 4LPXA 2OYPA 2HVKB 2B0SL 4G80A 1VGKA 4X80L 3FKUS 3RDTA 3FB5B 3EOBB 3BP7B 3QIUD 3FQRB 2X4SA 4YFEA 2M8XA 4HZLA 4KWUA 3TVMA 3O8XB 5LGHH 4BZ1L 3SPVA 1VA9A 3S4SG 4ODWA 1HIMH 4PRID 4WW2F 4UIKL 5GS3A 4X6DF 1H3UA 1EEYB 1NUFA 3OXRB 4NYLB 2AKRB 4X9IA 1ZHNA 3R06A 3RWJB 4Y4KA 5JUEH 3RI5F 1N0XH 3U9UA 3EYQC 3MRFB 2ZUQB 3QFDB 2DQDL 1NGYB 4JEGB 1FZOB 4XAWH 3LHPL 1YECL 1KCSL 2DQIL 5KVEL 4JFHD 4K9EL 2DYPA 5IW6B 2H2PD 3V6ZA 2G9HB 2XN9D 4EXPX 4EI5A 1OAQH 4LKXB 1P5UA 1QSFA 3SCMC 4MNGE 3WNLA 5JLZA 4KUZH 5FO9A 1BMGA 1JV5B 4MA1C 4OCYH 1JPSL 1E4WH 5D5MB 5DJAA 3ULVF 3TBVA 4HT1L 4PJXE 1NL0L 1DN0A 3LSOA 3VFUB 1MFCH 1KT2B 8CGTA 1LP9F 3SDDA 2VABA 1HNGA 4JLRB 3HPLA 3VGBA 1SBSL 3VXSB 1T1YB 3BEVB 3T0EB 2VXUL 4KKAC 3VG9B 1HHKA 4RMSA 3EO9H 1KYOJ 1LMKA 2VLKD 3RWDB 5DURB 3F7YA 3GBMH 1FLRH 1N2RB 2QQNH 2XFXA 4HK0B 5KSVB 1RZ7H 1HQ4A 4L4VB 2D7MA 2W91A 2AEIT 2Y5TA 1LDPL 5DZOA 3MRQB 2K1MA 2AJVH 5DK2A 2ILLA 3FOLA 3VFVB 2FX8H 3GSNH 4KROC 3GSOA 3PHQB 4LAJH 1C5BL 4FZEH 4RAHA 4PRBB 3IU3B 4XCNB 2V2TB 4ZFOB 3RP1A 1Q0XH 1RSFA 3FFCB 4XZUB 5DHVH 4ODTL 3G9AB 3G6JB 3IXAB 1QBBA 1T1WB 4RWYH 4KY1H 2IADA 1NMAH 1XIWD 4ZUTB 1MH5B 3A6OA 2DM3A 5AG9A 5FAAA 1FV1A 2V5SA 2AK4A 3F5WA 5EU4B 3T0VA 4LCUB 5F96L 3IDMA 1XGRB 4L8DA 5EBLA 4PJBE 5C71A 4K3JL 2DTML 4WUUA 3OR7A 1KN4L 4K07A 1INEH 4MWFB 2XXMB 2HLFD 1NFDB 4JFDA 2OTUA 2IH3A 2Y07L 5GGSA 4NCDA 1IZJA 1IARB 4OZIA 4UDUB 1OOAA 3NAAL 5HHOA 1QSEB 4LF3A 4OCMC 4MXQD 5FDWA 2X4RB 1MLBB 5FHAL 4XNXH 1RIHL 3OX8A 2UZYB 5JOFA 3IDNA 3L9RB 5F8QC 1P9MA 1JNJA 4PJGE 4JGMA 3EO1B 2NTSP 3CLEL 3IGAB 1I8MB 3HC0B 1DJSA 3D6GA 4DVRL 3CFEB 4ESKA 1OF2A 5CZKA 5EZJB 1TVHA 3KLSA 1K5NA 1RMFL 1YEDA 3KYAA 5BW7A 3G08B 4S1DD 5DLML 4PTUA 4ZAKA 1G7MA 4YHLH 3GK8H 4PS4H 3IU4H 4U6XA 3KPPA 1KNOB 4LLQA 2V2XB 1CG9B 3ARVA 1MY7A 4G8EA 2A6IB 2ZKHH 4M4RA 2E9BA 4CMHC 1X4YA 1S7WA 3QPQC 1G1CA 3IYLW 2I27N 4HXBH 4ZO8A 1U8IA 3OKDA 3RIAF 2F8OA 3SOBL 1U95A 4GRMB 3VMOA 2IBGA 5EOQH 3FO9A 4TPRH 1F4WH 1X7QA 5ERWA 3QDGE 4OFKA 4P2QA 2N7BA 5ACMA 3K1DA 5INCB 1AQKH 4JM2F 3O3AA 3QXTA 2F53E 1BFOA 2W65A 1MIMH 4HJGB 3VMNA 3D0VB 2HWZH 2F5AL 5JUEL 1Z3GL 4JQIL 2OXGA 3C5SA 1N0XL 4FP8L 1CICB 1PZUB 5DD1H 1MWAB 4QHNB 3V0VB 3D39D 3CFBA 3QUZD 5DTFA 4HIJA 1YDPA 3D5OF 1IEAA 2BJML 2HH0H 1PKQA 3U0PA 4P5TB 1XGQB 3FN9A 3LMJH 5KJRL 5EO9B 4F7PB 1U8JA 2ZP0T 3CU1A 5F21B 1EX0A 3LDBB 2DL9A 5I1LB 2JELH 3X3FH 3VFWB 5HD8C 2BHYA 5A16B 1YN7A 2G5RA 4BQCA 3EO0A 5EOCL 3G5ZA 4C83B 2WINB 2F54E 5E9DB 5DJ6A 2YPVH 2DQUL 3QDJE 2AABH 3VXTA 4JREC 4OZHE 3ME0A 1U8KB 4HD9A 3VH8G 1G7QB 4OKDA 5HYQB 1DSFL 3H7BB 4XNUH 2GFBB 4PGEB 1ZGLP 1LO0H 1FLRL 3QUML 2QQNL 5BZDB 5JHDE 3H9YA 4GKNB 4NP4H 2VR9A 4NKOA 3MV8A 3NCMA 2AJVL 4U7SA 5DQ9A 2FX8L 3GSNL 4Z7UE 4JPVL 2CDFA 2DYPD 5FFLA 4KJPC 4G9FA 1HZHL 3LV3B 3SKOB 1WC7B 2VR4A 3RVWC 3H9SE 5GS2D 5FYKL 3HS0A 5CJ5A 4IDJH 3QNXA 2CKBL 3TT3H 4RWYL 5ITBH 1XCTB 2VDKH 1A47A 2VLJD 2JK5A 2Y36H 1NMAL 4KY1L 4KVCL 2V9QA 2BCKA 2NPLX 1MVUA 2WQRA 4EOWH 2AJXL 4HW6A 3OKOA 3JSSA 4Y5YA 4M1CC 3MCKB 5IROA 3A67L 1INEL 5E8NB 2ARJA 2NY1B 1I1RA 2EYTB 5JR1H 2DQEH 3MQIA 2E9IA 4Z95H 2D31B 3DUSA 1QRKA 4W4NA 2H41A 2XZZA 2KZWA 3CUPA 4X7TA 5IFAH 3P4OA 2IQAA 3L3KA 2R23B 3PDOA 3AAZA 4XNXL 1TQCB 4Q9RH 3UTQA 1ACYL 3T1WA 3QXVA 3F58H 3RVUC 3P2TA 1YEKL 4G9DA 4HMCA 2NCMA 5IVOA 4MAYA 4HX1A 5HSFA 1JGVH 5T3XD 4MCYA 3MTRA 4X5WA 2FJFA 4P3DB 4QRUB 1JPST 2VQTA 4N0RA 2DBLH 5FHBH 4LOUD 3TPKA 4FTVD 5EU7E 3IU4L 3O6ML 1JUFB 1YYLH 1OAZH 4R3SA 4OLVH 2I25N 4BZYA 4UOJA 4JG0L 2VXTL 2YA2A 5CD5D 3MO1A 4PJ7E 2LFGA 1HHHB 4GKZB 4L4TB 2X9WA 2NZIA 5ICYA 4HXBL 4JFDD 4YGVA 5I8KL 3BMWA 4PJDB 43CAA 5I71B 1QFHA 3NFPA 3LS5H 1A3QA 4HXAL 3GI9H 2XTLA 3NCBB 3RWIA 5JDSB 1I1YB 2DDQH 2YSSB 4TNVF 1MHCA 1AQKL 4DW2L 4IRSA 4UT6L 1MIML 4WI7A 3QEGH 2FWOA 2MKWA 3TO4A 1T03H 5EU7C 3IB4A 1NGZA 4GG6E 4DKEH 2VWEE 2JCCE 2DICA 1BREA 3QXAB 5F1NA 1ZT7A 4ZFFB 2I5YL 4BSWA 3PWUB 2PNDA 1BQLH 3LMJL 3MUY1 2HRPH 4YUEH 1SY6L 1GGBL 3VXME 2X4OA 3H9HB 2JELL 5FYJU 3QUXB 5CBAB 5E24E 2VAJA 5GGRB 3AVEA 3QCUL 3GMQA 5F88B 1FYTB 1EXUA 1S9WA 3QP3A 3CVHB 3MFFA 4Y2DD 5EB9A 3HB3D 3KS0J 1T20B 3C5ZA 4WCYH 1IGCH 4BZ2H 1V05A 4NOFA 2WIIB 3U1SH 4BUGA 5C2BH 4GBXA 3QJHA 1FL3B 1C08A 2IAND 4ZUSA 1Z5LB 2D4DA 1FJ1B 3SE8H 1FL5B 2CMRH 2VWEC 4M61B 5BZWA 5GRXG 5TDOA 3WDHA 2RR3A 3D9AH 1HHJB 4X98B 5CP7B 5F3BB 4S1SL 2P1YA 4NJ9H 3L3IB 4P4KA 2GTWA 4AIOA 2EIEA 3NPSB 4OSUL 1S7XB 5HI3D 3Q1SH 1JE6A 2OR7A 4WO4D 3WNMA 1XEDA 1H8NA 4XBGB 3NABL 1OTTD 1JYNA 1AGDA 2J4WL 4QRTB 4NWUH 1KB9J 4CGTA 1YEIH 3TT3L 5ITBL 3R0MA 4FFYL 1NMBL 4LHUG 4L9LA 3WLBB 4PJGF 4F7CA 2J6EA 4O58H 1NGWA 3F7PC 2CH8A 5E8EA 2XZCH 4EOWL 4D0DB 4OAWB 5AZEH 2HJKA 4RMQA 5JQ6H 5C92A 1ETZB 1NCWH 1D5ZB 4WWKC 3RVVD 3EYVA 1EUTA 1T3FB 2D03H 1GYAA 1P2CB 1YYML 1MAKA 3QI9B 4Y5XC 2DQEL 1MJ8H 5IMLA 4F7EB 2V5MA 3DRQA 1F3JA 4YJZL 2AW2A 4X4XA 1MCQA 3T4YA 3P11H 4N8VA 2BNRB 4HWBL 4QKXB 4ZPVB 3AREC 4XP9H 3FT3B 3GSUA 3HLAA 1RUKL 1D3CA 1BWMA 1YEGL 1C12A 5FM5O 3N1FC 4ORZC 2FHFA 4Z0BL 3RY4A 3ZHLA 3QG7H 4X0KA 3F58L 3OJDA 1UB6B 4OZFA 5F9OH 5INDB 1RI8A 3UMTA 4YAQB 5I1GH 5DSCA 4FXKA 3WS3A 3FB7B 5DJ0A 2VKWA 1YNLL 3CMGA 1M1SA 2R29H 2GK0B 2P5EA 3HA0A 1S5HB 1RK0B 5CEZD 1AI1L 1A3RL 2ADGB 3NCCB 3W0WA 5ILTH 2YHGA 3ILPB 4XB8A 5HYJD 1LEIB 3A6BL 4X7CC 3QNZB 4JO2L 3S34L 3MNVB 4PY7B 4HWZB 3SKNA 1HE7A 1FO0L 3OZ9H 4PRHA 4Z78B 4R0LC 4NQXB 1WTLA 4PGCA 1WFOA 2X40A 4U1SB 3KJ4C 3IJSB 2OR8A 4OJFL 2HN7A 1LE9B 3KPRA 3RTQA 2CUMA 2PYFA 1DLHA 1BF2A 2AXHA 5DZLA 3MLWL 3LN4B 4NZTH 3QEGL 3VXUA 5I73B 1C7TA 4MAYD 3SCMB 4OZHF 3VU2A 5I8OH 4Y2OA 4HUUA 4MQ7A 2ZCLH 3B2UD 3FAWA 3KYNA 4MA1B 3TZVC 3WXWH 1J8HD 5JIIA 2CLRA 5DYOB 5JW3L 2ICCA 3VFSA 1K8DA 4PJ5D 4HJ0D 4B50A 3OV6A 3SDCA 3H7LA 4YDVA 5BO1H 1T89C 4Z7UF 3KPNB 1KXTB 2DLGA 1N5AA 5TFSL 1IGCL 4YE4H 5C09A 1CQYA 5JIKA 5JA8B 3U1SL 2GK2A 4OGYH 4QXUL 3OJVC 5C2BL 5J1SC 4ETQB 1MWAH 2VERN 3DUUB 1B4RA 2JB6B 1QEWA 4AQOA 1KOAA 2FATL 4MNGB 2LABA 4MQSB 5FM4A 3VRIB 5CZXD 1KTLA 4PJXB 3L6FA 1ES0A 4G8GE 5B8CB 2JJSA 3I50H 3L7EB 3WFCH 1AXTH 3WJJC 5C0CD 4HS6A 3MOQA 4U3XA 4U6HA 3BH9A 4M02A 1Y0LB 1FFQA 1QOKA 4EZMA 2DWEB 5E6ID 4WHYG 5CCKH 5IQ7H 2EE6A 1NDGA 3BT2H 5I19L 1EHLH 1A1OB 1FGNH 1YEIL 4PBVC 3EUUA 4ELMF 1AR2A 2GSGA 4Q0XL 4FABH 3W11D 1ZVSB 5C0JA 4BH7B 1NFKA 1JI2A 4Z7QE 2R1XB 5GSVB 4RRPG 8FABA 2ICWJ 1NH6A 4OCSL 3F6IA 1NCWL 4PR5A 4WUKL 1KJ2A 5C6PB 3SE4A 2IFGA 2OBGA 2YUZA 3MRPA 4JZNB 2D03L 4EUPA 5GGVY 1JZ5A 5D9SA 1SVZA 4G6KH 2A0LD 2AQ1A 4J3TA 4ZFOL 1OSZB 4MB5A 3P11L 4TVPE 3QEUA 5BRZA 1M7DA 4PJ7F 5IM7A 1TXKA 3EDKA 3MLXL 1XMWA 3KPQB 3PXJA 1NGQH 2R2EA 3QG7L 2VLLB 2NZ9C 3PWVB 5F7MC 3U2SA 4L4VD 1AP2A 5I1GL 1PEZA 5EN2B 1F3DJ 1KF9B 3JUYA 3NIDE 3WFEH 4LSTH 3B5GA 1I1FB 4F9PA 4TVSa 3RBGA 1YA5A 3W9DA 4NQDA 4YFLF 4S2SA 2BERA 2JLLA 1E0OB 3HZKA 2JIXD 5FV2A 4FXGB 5FB8A 3JV0A 4F15B 1CXKA 1CGWA 4DUXA 1UGNA 4OI9A 1UWXK 4Z7WB 3ARYA 5L2KD 3GHBH 3G6AB 1S3KH 2ZZUT 2V7NB 1L7TH 3DUHA 3UEZA 5DD0H 3MLVL 4E0RA 1IM9A 2W59A 1FFPA 4DZ8A 2Q76A 2R1WB 4LLMB 2DAVA 5IEHA 3OZ9L 3IFOB 4TULH 1BBJB 2J5LC 4QOKB 3LD8B 4WEUD 3MRNA 4O5LH 3TV3H 4PJFE 3DX9A 1IFHH 4AMKH 1MNUH 1P7QD 3BPOB 1W72A 5EBGA 2EO9A 3A6CH 1QSFE 2VIRA 2E6PA 3QIWA 1A5FH 3OAZK 5DZNA 3ARFA 3LOWA 1KCVH 2PR4H 2XKNA 3S98A 2EXWC 1S7TB 3TVMC 1QSED 1MHHB 4WHDA 2HJLA 2VITB 1H15A 5E8OA 3QQ9D 4M5YH 2VDOH 5DR5H 4M8VA 5M95B 3WXWL 2EDBA 3QDGB 3B9EA 5CEYB 4OCWL 3I75B 1L0QA 4LLVB 3CSPA 5ETUA 2F53B 4YIQB 2P8MA 1R3HB 1SJEA 4JREB 5FKAA 4OZGB 3W0WD 1AD0A 4F7MA 5FECA 1F3RB 4ODBD 2XXCB 5AYUL 3J7HA 4R4BA 2P5WD 4GW4B 5KTEH 1XF5A 2MTPA 4LCCB 4OIBA 1EAPA 5CLWA 5IEKA 2C3VA 2J8UA 2I60L 1YMME 4LDLB 5ECJE 1S8DB 3GMOA 3ZZ1A 4OGYL 5DK0A 5K9KB 4GAFB 2AI0L 4BFGA 2UVFA 2CUHA 2Y7QB 3G5VB 1LO2L 2R4RH 5DJCA 4CW1B 3C6LA 1FSKB 1MCPH 2MQ0A 1GOGA 3HR6A 2IBZY 1J0JA 3O2DH 1N6UA 1WT5C 4H0GA 3VWKA 3FN0L 3I50L 3IFNH 2FR4B 2Z31A 4NNXB 3VFRB 1RZ8B 3MRHA 4LK4A 5H37G 3CVHH 3PJSB 4HF5H 3TBWB 2FGZA 3CMOH 1CF8H 3HCVB 1CT8B 1KIQB 3C8KB 4UT7L 3SE9H 5ANMA 5KBNC 5CCKL 1G9NL 3RPIB 1UXSB 1A6PA 5LWYH 3LKRA 4WFHE 1UJTA 1MFBL 1QSVA 4PRNB 3WS6A 1KIRB 4RX4D 3BWAB 4PGBB 5DRNB 5FGCE 1N8ZA 4P2RE 3VFTB 3MUJA 1H5BA 3GMMA 1EEZA 3BDXA 1JHLL 5HI5D 4UU9B 3PGFH 5H2BB 4LASH 5C07A 3BSZH 2DQGH 1VACB 1DDHA 2APVA 1VB9A 3HAEA 3H9SB 5DUBA 5GGQL 1MRCL 1Y6KR 2CSPA 4G6KL 4QXTA 2QHRL 4GW5A 5DUPL 2HTKC 1NGPH 3O3EB 1Q9WA 4R90L 2F8XC 3LN5B 2PKDA 3BE1L 2ZOKB 3SGKC 4RA3A 3QQ4B 3GMPA 4TSAL 2YPKB 3CH8A 1NGQL 1XFPA 1XR8A 3FO2B 1UEYA 4ZO7A 4ENED 2QQKL 4P9ML 2EXYD 1U91A 1T1XA 5F1OB 1N5YL 2B1HL 3I6KB 5ICZB 4ZQKB 1TETH 3RIFK 3EHBD 1P9MC 3WFEL 1EGJH 2YRLA 5C0BA 4X6FB 1U8NB 4NKDB 4RBPK 1FZKA 1RZJH 4HKBB 1QFPA 5B38A 3K0WA 3UYOD 4BH8A 5IVXA 5DFVC 1K6QL 1ZANH 3C6SB 4ZAKC 4PG2C 1U8LA 1B0RA 2BMKA 1MJJB 1IC4H 1L7TL 2A38A 3REVB 3FQUB 5F7LB 2P7TA 4EVNB 2K7PA 2PUQT 2YWZA 3GSVB 3K4ZA 4G7YH 3LKSB 3CSYB 5D1ZA 4JO4H 3V7AE 1MNUL 2V7HB 4XWOD 3A6CL 4Q58C 3WKML 4F2MA 2H6PA 3DNKA 1FC2D 5D70L 5KN5A 4D8PB 1JGDA 4E41E 2PR4L 3P4NA 4CN4A 4OLWL 4LCWD 5SWSD 5EOTB 2Z4QA 3IJYA 2B1AL 4Q2ZB 5EU6B 3WFDH 1F8TL 1JF1A 3WL9A 4J3OC 4M5YL 1DQDH 3LB6D 3MRLA 4JZOA 3KYOA 4OLEA 4JPIA 4AH2B 2LVEA 3GGWA 2LU3A 1S7VB 3HI5L 2SEBA 5MENA 2P46B 1S7RA 3DX7A 4WDIB 4XPAH 3OF6A 3LEXA 5A2LH 4QRQB 3NVQA 4RGNB 5IHZA 1I9IH 3VRJA 1K85A 1J1XL 5AWNH 2R0LH 1WISA 2JCCB 2R0KH 5CUSH 2J12B 5KTEL 2BNQA 1IM9D 3MV8E 4B5EA 2HT4C 3NA9H 1MFEL 1Q9LB 4X7EC 4JQVC 4OQ1A 3ECBA 3D3VD 1D9KA 4XH2B 2E7MA 2ZG1A 1NAKH 4OFYA 4PJAE 3MRJA 3QEQD 1GIGL 5K9QI 4IS6B 3AMKA 4NUJB 3VXMB 2R4RL 5LJYH 2VISB 1MCPL 2AXGA 1RAMA 4I3SL 3U4EA 5FCUH 2DS4A 3V6OA 4B7LA 1A6AA 4FHBD 2KL6A 1ACZA 3O41B 5IB2B 1ITBB 3UJTL 4RWHA 2E8YA 3HUJB 1AC6A 1JWUA 3CXDL 3O3BA 4XCEA 1BFVL 4G43B 2VLRB 3TJEH 3ARWA 1CF8L 2E7CA 4JJHA 3SE9L 3D87B 1OAYH 4KZDL 3GB7A 4UQ3A 1BFTA 5E2UH 2DI9A 2C7UB 3O11B 4HIEB 5HVGB 2OJEB 4D9QD 2Y5EA 2KH2B 1AXSB 3BOVA 1PX4A 1B2WL 3DX6B 1OB1A 4IRJB 1MAJA 2Z8WC 2GTZB 3FQXA 2YD3A 4KVNL 5DI8B 4ZUWA 4LASL 2VAAA 3F7VA 3BSZL 2DQGL 3NIDF 4D2NA 2W60A 4R2GC 4GT7A 3OR6B 4YXKL 1KLUA 5KSAD 1ORQA 2EKJA 4LSVL 4MJIE 2NY5C 1Q9KA 3BH8A 2YPLE 3BMVA 1QR1B 3MGOB 3ARGD 1I7ZB 2OMBA 2H9GA 1C1EH 3O6FA 1WGOA 4MXVF 4LKCB 3VWKD 4G8FA 2E7LC 1JZ7A 3BO8B 1JGUL 3VGFA 3P30L 4K94H 3DX8B 4U1LB 2NY0B 2BDNL 3FQWA 3UC0L 5EWIH 3MLRH 4KKBC 4NO0B 2NXZC 4X6EB 1FRGH 2HLAB 4ZXBB 3GO1H 5I74B 5GJSL 4PJFF 1XGPA 4RGMB 2P4AB 5BXFA 4I9WE 1A7RH 3ZE2F 1UJ3A 5IFJB 3MA7A 4GMSL 1QA9A 3WUWB 4PLKC 1BQHG 3MJ7A 4DGVH 2H1PL 4QRPA 3ZL4L 3VH8B 5AD0A 4JFXB 4TSBH 4M7JH 1ZANL 3KJ4B 2P8PA 1E6JL 1G0DA 1IC4L 3GMRA 1PSKH 2X70B 1Z0MA 1A2YA 4NKMA 3JZ7A 3MRKB 4OLZH 3WHXA 3BHBA 2V17H 3MCLH 2E9WA 4LHQB 5GS0H 1R3KB 4QXGL 1A7OH 1ZSDA 5T1DH 3LS4L 5DQJA 1S7SB 4L8CA 1GGIL 3DMMA 3JBG7 5HHXH 3FCTA 1SJHB 1A3LL 1UH2A 3UTTA 3ZYOA 2EDHA 2O61B 1IGFL 5DT1L 2BNRD 1F2QA 2B4CC 5FYLE 5ISZB 3E3QE 3N85H 4I2XB 3QQ3A 4IRSC 4JDVB 1AC0A 2XKSA 3QUMA 1NEZG 2YUVA 5DD6A 3TO4C 1PFCA 3S35X 4NKIH 1U3HA 4WTZA 2CLVB 4XCFL 4XPAL 4BFEA 2PW1B 4DN4H 5ACZB 4WU5B 1T21A 1I9IL 5DJDB 2AV7B 1UZ8A 4FG6D 3GSNA 5DJ2B 2Q3AA 1VSCA 2XACC 2R0LL 1IVLA 1OAUH 1DANT 3RL2B 3BVNB 4B53A 1F58H 3NA9L 5DHVA 4OF3A 5HVHB 3HE7B 2HMIC 3VGHA 3CAFA 3IFLL 1PKOA 4P59L 4CNIA 1NAKL 1KPRA 2E9JA 2VDRL 3MRDA 4JGUA 3KXFA 3JTTB 1KSRA 5DMJB 1MHEB 1FZJA 3E3QC 3QAZC 1CTOA 5CKAA 1JRHI 1DCLA 5GRVK 4GBXC 4C56A 1KB5B 3SJVB 3QR2A 1ZLSH 3JXAA 3X14A 3WKNA 1UENA 4O02H 1WAAA 1QLRB 3CFDB 4NT6B 3PWNA 3P9LA 4FQXA 1OP3K 2X4UA 1JWSB 3TJEL 1U8QB 4Y0GA 3QRGL 5MEND 2VXVH 4PYHA 4QHLA 2VZ3A 2FYYB 2IFFL 4HV8B 2UWEB 4G8GB 2X1WL 5MHSE 3C5JA 3BQUA 1UWGL 1V3JA 5EC1A 2XZAH 1N3NB 5DVLA 5F9WB 1U8OB 4ISVB 2BNQD 3U0WH 2QKIA 4OIIH 2XRAH 1ZTXH 2NY3C 1J9CT 1J05B 4X4ZA 3KPSB 3VD3A 3B9KB 5KS9B 1A9BB 4ZDHB 1C5CL 1MCWM 4HKJB 2CJUL 3ALXA 2QBWA 3CIQA 4I3RL 1Y18A 1KTRL 2DJSA 1IJ9A 3BZFA 3V0WH 3MMEB 3K3QA 5KVFH 4PB9H 2P5EE 5C7XL 5IBLD 2HRLA 1P7KA 1S7UA 1MF2H 5EU5B 5IGXL 1TQBC 2GKIA 4KC3B 1FNGA 2XZQL 4YLQT 43C9A 5I0DA 1K8IA 4KZEL 2X4NA 4U0QB 3GO1L 4Y1AB 3ZTNH 1XGUB 2BP3A 4HS3B 2WZPD 1NLDH 2YD6A 4XXDA 4FS0A 4PRHE 3WFHB 5KVGH 4HFWB 3SY0B 2HKFH 3MYZA 1ND0B 4ZFGH 1WBZA 5FYJH 4U6VL 3BW9A 2ORBL 4ZS6C 1OGAA 3HC3H 4JRWA 1IBGL 4R8WH 2J5LB 4TSBL 2OQJA 1KV3A 5A40E 2PTVA 1HHIA 4JRXA 4TNWK 2FBJH 4KI5D 1NFIA 1A7NL 4I48B 4P46D 4YX2L 4B7IA 2FX7H 2XKUA 3BD3A 3L5WB 3MCLL 5CJ8A 4CJ0A 3TCLA 4DZBB 3V0AC 1AHWC 4PG9A 1QFWM 5T1DL 1UWEH 1UYWH 2VDNL 1WFUA 3EYOA 1A4JB 3V5DB 2EH8H 4JFZL 5HHXL 5IESH 2CD0A 4MYWB 3JVGA 4N9GB 4OD3H 2YOCA 3HNSL 1WSST 1OGTA 4LHUB 4XB7A 4XVTH 4JFFA 3MRGB 2EE2A 4QHKJ 3G6DL 5BS0B 5B3JE 1T2QH 3VXOA 1RULL 5D1XB 4LSRH 3T4AA 1FCCA 3N85L 4U0RB 5C09E 4EN3A 4NM8L 3MUGA 3RGVB 4IMKC 4NNPL 2APTA 1YEJH 1IGMH 4X5XB 1WBYA 3PQYA 4YPGB 5IG7B 4C57C 3RJDA 5J6GA 4BSJA 1CDCA 2DKMA 2ADIA 6FABL 4Y5VC 1JRHH 2YRPA 5SV4A 2EDOA 1OAUL 4AEFA 2V9RA 4MQXD 4P2OB 4XVUC 3STLB 3QUYD 3BYYA 4X6DB 4YXLH 3BPNC 1OARH 1RJLB 1IGJB 5D7LE 4UOW0 4N5UA 1OW0A 4BUHA 1RK1B 4U4BA 5C2UB 3DMMD 4QY8A 1U3ZA 5HDBE 3RX5A 4XX1E 4L5FH 4LPTA 4XPHL 4P2YA 2RIKA 2FSEA 1G7IB 4P5MA 1GPOH 4XAKE 4D0BA 1ZLSL 4NO5A 3ARDC 1N6QH 4IOSD 4LPYA 5F44A 4HKZA 4ONOA 2YEZB 4WJ5B 3WJLC 3WMSA 4PRPA 5F9AC 1YNTB 1IEBB 1CLYL 4UIMA 1YN6B 1HHGB 4HWBA 3GM0A 3EFDL 2GUOB 3QZWA 1RD6A 3MV7E 3HI1A 4Z7VB 3OMZA 5I16A 1IQDA 4R96A 1CTNA 5BRZE 3PP3K 4MNQB 2XZAL 3RVXC 15C8H 3QFJB 2X4QA 3TYGH 4KJWD 3QWOA 4M1GH 5DJZB 5FYKD 3FQTA 4EI6A 1R6VA 4X6CA 1DBJL 2XRAL 3HPJB 1VESA 1ZTXL 3UPRB 5IBTL 2AV1A 3CGTA 1MFDL 3BN3B 1U8HB 2PCPB 2OI9B 2VYRE 5FGCB 4OF0A 2IMMA 4YHOH 4PJHB 2WUCH 1NLBL 4XMKL 1NQBA 3MA9H 3OG6B 1GZPB 4N5ED 3HE6A 5C0ND 1MUJA 3EJZC 4NZDA 3M45A 5F72S 5KAQG 1TFHA 4HIHB 1PG7W 5T3ZE 5J06A 1JZ6A 3VWJD 4CKVX 1MF2L 2Y25A 1QVOA 3O9WA 2XICA 1NAML 2IG2H 5I1CH 5D1QA 5MEOA 1RUPH 4UTAH 1QBLH 4KKCC 4AG4H 2Y1VA 5GZOD 1NLDL 3MR9A 3QEHA 2PYEE 5EUOE 3UO1L 2I9TB 3RZCA 4IIQC 3AXLB 5DMIH 1LEKB 4XBEH 1UZ6E 2VQ1B 4J3WA 4JRYB 4N0FB 2AJ3A 3HC3L 3ESUF 5SWZE 4LIQH 4LQ1A 3MLUH 2Y23A 1YJDC 2FHCA 3H42H 3FB5A 3BP7A 1WZLA 3KGRA 3TJHD 5L88H 1WZKA 4FQLH 4O2EA 1GC1H 3O8XA 3CFKA 1MLCB 3WNKA 2EH8L 4LCIL 1KG0A 1F4HA 3MGTA 3RWJA 2AKRA 3U4BH 2WBJA 5SWQB 3MLSH 3VD5A 3I02B 3T0DA 3OKEB 3GI8H 3O2VL 4H88L 4YXHL 3QFDA 4MLIA 2YMXH 1FZOA 1RZIB 3U36B 3TN0C 3H3PH 1BVKA 3O45B 1MCDA 5IW6A 3WNNA 4JAMB 3MUHL 1JP5A 2D7TL 4HGWB 1IGML 1JK8A 3VI4E 1WWBX 3N1GC 3TBTA 1NMCB 2DWDB 5D5MA 4ZUUB 2VOTA 5F89B 1G9MC 5HTSA 3S36L 3IDGB 5C0AD 2WIMA 2DD8L 1C5DA 1B0GB 1F13A 1QRND 4D0CA 1HXYB 1T5WB 1KT2A 2WNGA 3NIFE 3QDAA 1HI6B 3VA2C 1J11A 2J88H 4G3YH 4ZPTA 5L2JB 1T1YA 2YBRA 3BEVA 1KN2L 1WITA 4YBQC 1R24B 1BOGB 1J1OH 3MJ8A 4P23C 2B2XL 1OARL 4DTGH 4JFYB 4RNRB 1N2RA 2P24A 3CH1B 3MRIB 1J5OH 2NY6D 1DE4B 5GZNC 4HK0A 4L5FL 5KSVA 3UTSB 4HBCH 3LZFL 3BKCH 3OGCB 3MXWL 1GPOL 4EEEA 3LEYH 2A9NL 3MRQA 2A6DB 1XH3A 3QHZL 2Z93B 4GXVH 3VFVA 5I1DA 1N6QL 3PHQA 4L3CB 5E2TL 2QADD 3IU3A 5I8CB 3DTXA 1MFAL 2GITB 1OLLA 3B6SA 5C07E 4ZFOA 5TE6H 4NBZB 3ZE0F 4XZUA 3IF1A 5F3HB 3G6JA 4PRIE 4ONFH 1AE6H 2BSSB 4R7NB 3SKMB 1T1WA 4M7KH 2D0GA 2FX9L 4LGRB 3QDMB 3PL6A 4TTDC 3V8CA 5JOPD 4R26L 2ITCB 3EDEA 2KQNA 2QR0B 2IBZX 3MBEA 4LCUA 1OAKL 4U7KA 3QHFH 1KB5H 15C8L 4JFHE 1OTSD 1CE1L 4M1GL 2XN9E 3WS6C 4RGND 2AAVA 3C2AH 3QA3A 5GGRY 5JO5B 1VERA 1R0AH 1JNLH 2G2RB 1P4BH 1IMHC 4M48H 4PJEA 4NQCD 1IKFL 4ELKB 4MSWB 4UV7L 1TVDA 2NXZB 2WUCL 1R3JA 3TA3D 1YPZE 3KLAA 4X7SH 4R7DB 3L9RA 1FDLL 1FBIL 3EO1A 5IVXE 5I1JL 1QKZH 1H3PH 3DRTB 3IGAA 5D2NE 5HI4D 3CFEA 1XGYH 3B43A 4M03A 5EZJA 2DM7A 5CP3H 4NN6C 5E2WH 1OVZA 2EDFA 4PJIB 4AG4L 1X6LA 3T3PE 1M6OB 2H32B 3UZQA 5E08H 1ZE3C 5DMIL 3JWDH 4GRLD 4S1RL 1KNOA 2NMSA 3VW3H 2AEPH 5K9OA 4I0PD 1WZ1L 4LSPL 3VXPA 2VSDA 5B3NA 4BQBA 1MPAL 5JNYA 5FKPB 4GRMA 4GRWB 3RUGB 4DAGL 1JPGB 1DBKH 4HWEL 3DO3A 5D2NC 1AIFA 4TVPH 4OFPA 5DD3H 3MLTB 3BZDA 4XCYB 4GKSB 4I18A 4V2CB 1AR1D 1UVQA 4HJGA 2F5BL 4JFEE 1LO5A 3DV4A 3PWPD 3D0VA 4UDTB 1DEDA 4KV5E 4PBWD 3GI8L 4V1DD 2V5TA 3KNBB 1CICA 1JPFB 2W9EH 4QHNA 4P57B 3V0VA 5IB5A 5IHBA 1QLFA 5HDBF 2PN5A 4ZD3H 3S5LA 2F15A 2A1WL 1JHTB 1XGQA 3OKLB 5EO9A 4F7PA 5IW3A 1CE6B 2ATPB 2BRQA 4L8BB 1F6AB 4NHCL 3LKOB 4ZXBD 1XIWC 2VDLH 4JO3L 5DD5H 4GLRI 4JR9L 2KZ1B 4Q6IB 2O93L 1QP1A 5HGGS 4C83A 1OTUD 1BD2D 4GAYB 5LQBH 4NFBA 2G75B 4NQEA 5E99L 4XC3H 4G3YL 3LRHA 2X05A 3CPLA 5TDNB 1ZHKB 1G7QA 1J1OL 4I5BA 4MCZB 5HYQA 3CDYA 3H7BA 2BSRB 5GSRB 2GFBA 2EDXA 1BIIB 4P2CG 3V5HB 2ZSVB 5FEBA 5BZDA 3QIBA 3M07A 3ZSSA 3HI6H 4J4PA 4HBCL 5GISH 2WBJD 4MXQC 3BRDA 1EFXA 4FMKA 3E6HA 1OP5K 1WK0A 2DLIA 4KTDL 1I9JL 3WSQH 3ULUE 2Z35B 3WIHL 4K2UH 1FFRA 4PJ8D 1NPUA 1WF5A 3LV3A 3SKOA 4MZ2A 2DLHA 2VDQH 1VADB 5FO7A 1OHQA 2UZIL 2I07A 2QSCH 4S1DC 4XWGL 2D7NA 3FTGB 1XCTA 1PLGH 5HHMD 1VKXB 1EO8H 4LEXH 1DVFB 1Q94B 5HYSA 2ERJB 4JFPB 1DQTA 3KPOB 5JPMA 2J2ZA 3IRZA 4ZOEA 3HZVB 4XXCA 3EOTH 2VXSL 1JL8A 3MCKA 3QHFL 5FUOH 2PXYA 4Y4HD 1KB5L 1B3JA 2AEWA 2OP4L 3O4LB 5GS1B 5E8NA 5GRZA 4OI8A 2EYTA 2GCYB 5MEPB 2OR9H 1LP9A 4DN3L 1SVCP 4QXWA 2E6JA 5J6HB 1MCEA 4RFOH 4UB0H 1W0WA 2BFVL 5FK9B 4OF7A 1UM5H 3MUZ1 1P4BL 5C0GB 5DHYA 3SGJA 1QO3B 5E7BA 5C0FB 5T1LD 2OS7A 2ESVE 3DYMA 5CBEA 4APQD 1JMZA 1FPTH 2N56A 2Q7YA 4IJ3C 2HAZA 3MOAH 4O2FB 5EG6C 5IWLC 1AFVH 2EH7H 3BZ4A 1QKZL 2K7QA 5GIRB 2BVYA 1TCRB 5ID1B 3Q6FA 5ADOH 1T7WA 4U1KB 3TEUA 3QUZC 3WN5C 4P3DA 3RHWK 3PL6D 3DVFA 1DQLH 5E08L 2MQCA 1UCBL 3QT2A 5HPMB 4U6YA 1JUFA 2AEPL 5I30H 4PB0L 4Z77B 1IGYB 4U1JB 4FRWA 5D2LB 3O0RH 4QRRA 2VL5B 3QCVL 4L4TA 2IALB 2J8UF 3UTTE 2O5ZH 2YUXA 1V7NH 7FABH 2FEEI 3CFIC 1HEZB 3DGGB 1FVCB 1NCAL 4PJDA 3GSWB 3VI4F 3UJJH 4L29B 2GQHA 4RQQB 4YHZH 3WO4C 2DF3A 2F19L 1DQJA 1I1YA 4JANA 1YZZA 4TVPL 2YSSA 4HC1H 5DD3L 4FN0A 1AO7E 3KPSD 3TYFB 3FFDB 3SDYH 5KOMC 2HFEB 1AGCB 5J9PB 4JKPL 3BZEB 1BZ9B 4O00A 4GLRH 5J89A 4HPYL 4WTWA 5GRUL 3U6RA 4YBLC 3DLQR 3QXAA 4ZFFA 2BY0A 4OD2A 2W38A 3P77B 1UH4A 2F9BT 1KC5L 2XWBB 4X5LA 3O2DA 3KXFE 4H8WH 1B0WA 3H9HA 3QUXA 1OY3B 3VGAC 5GGRA 4MJ6B 4PREA 3EDDA 4WHYH 4C56E 3K2UL 4HUWB 1T83A 3FO0L 1T20A 1CQKA 1UM4L 3SDAC 2WIIA 1XCQB 1U3HC 4XNYH 4AK1A 1WAAE 4UILL 3QJFB 1FL3A 4FTVE 1HH6A 2H3NB 3GIVB 1Z5LA 4MHHG 3VCLA 1FJ1A 5J13B 4M61A 4KQ3H 3DXAB 5GXBB 3NCYS 1RUMH 5IK3B 3UDWC 3D0LA 5F3BA 3PWLA 5ESAB 4BYHA 3L3IA 2BSTB 4U1IB 3LKNB 1FC1A 2H26B 4DOHE 1S7XA 1I1AA 5TE4H 4G5ZH 4UT9L 3MZTA 4QNPE 1BQHB 1QNZL 2XTJD 3ALWA 4NGHL 4RDQG 4AEEA 1ZLVK 3D69A 4P3CH 1UWXH 2UUDK 4NZUH 1CGSL 2QSCL 3CVIL 2L7JA 5H94B 4UTBL 5DRWB 3J8F7 4JPKH 4LOUC 3WLBA 3V4UL 5JXAL 2HG5B 4QCIA 5IVXF 1QQDB 2OTWB 4FQXC 1ETZA 5CD5C 1EJOH 2E3VA 1I8KB 4NN7B 3T3PF 3QI9A 3CX2A 1BAFL 3OAZH 4NQSB 5D7JB 3MACH 2YA1A 3BQUC 1QR1A 1WQVT 4NC2B 4P5KB 2ZOLB 3MV7B 3MC0A 4POZC 4HG4K 4ZPVA 1CU4H 1C16B 1DBBH 3FT3A 4J4PD 4TOYL 3O6LL 3N1PC 4P2OD 1EFXD 3UAJD 5GHWL 4E5XB 4PJ9B 2WWMD 2IAMA 2Q86B 2R8SL 3ARBB 2R56L 4L1DA 1NEZB 3BAEL 5K93A 5CILL 3C08H 1VGEH 4AENA 4ELMB 4JRXE 1RZKL 1U6AL 4YAQA 5ADOL 4M62H 2A83B 3KLDA 3VFGH 3VXRD 1ZKAA 5EO1B 3S6CA 4DGIH 1MCNA 4DVBB 5C8JA 3CC5B 1DQLL 1Q8MA 1RV6X 2GK0A 1S5HA 1RK0A 3WBDA 3ULVD 4KV5F 3O4OB 2H8PB 3QBTB 2PXYD 4D3CH 3D2UA 1T2XA 3ILPA 4Y2DC 5DGQA 5EZLB 3QNZA 1RIUH 1WFTA 3MNVA 4OLUH 4PY7A 1UA6L 4HWZA 3P9WB 2G5BA 4G6JH 4JFFE 4X8JB 2CUIA 4K8RL 5EUOB 2ZUXA 3IKCA 4NQXA 5ESVA 4GSDH 3UJJL 4N8VG 3WHE1 5DQDL 3KLHD 4U1SA 3IJSA 2C1OB 2H32H 3NZHL 1TNNA 3CX5J 1LE9A 3PQYE 2HJFB 2X9XA 5E8PA 3LN4A 4KI1A 4MJ5B 1JTOA 4WFFD 4YEFA 4OZFG 3SCMA 1BZQK 2FO1A 2EDQA 3HR5B 1Q72L 4N8CL 5CSGA 2BVPA 4WO4C 2WUBH 2YD4A 2NY2C 1MIEL 4XVSL 4MD5B 3M1BB 2XV6B 1DLFH 5DYOA 4ZTPH 3CK0H 4GRWH 4JGJA 1YUHB 1SEBB 5CHNB 4GUPB 4YWGH 4PGZA 1CFBA 5DMGD 1BVLB 1QZ1A 3GJFA 3ULUF 5BMFL 5IV2B 3KPNA 3RVVC 2EZ0D 3NN8A 2MNUA 1I9RH 1FVEA 1LDSA 2NXYC 5I76B 3VGEA 4JKMA 2Y06L 3HMWH 3L5JA 3L5XH 2CK0L 1RVFL 4ETQA 5DRXB 1Q0YH 2JB6A 4MNGA 3DV6B 2CGRL 4KQ3L 2IPTL 3VRIA 1KENL 4PJXA 5ALCH 3BEWB 2OCFD 3BKYL 4N0CD 3CDGB 5HYJE 1I3RA 5IQ9B 1GGCL 1QFWI 2FIKB 3LQZB 4RFEB 4M43L 1G7HB 1Y0LA 4X9GA 4CDGC 5DJ8A 2DWEA 3NGBC 3STZA 4UAOC 4M00A 1YNKH 4AT6B 5B21A 1HCVA 3REWB 2XPGB 1BQSA 4AEIL 5F8RC 1A1OA 1KIUA 5IMOB 4L3ED 2DJUA 4JPKL 2Z8VC 1ZVSA 4BH7A 3QO0A 2R1XA 1JCKA 4MLSA 5HHPA 5GSVA 2CXKA 3QIUB 3HFMH 3Q3GA 5KANG 1J8HE 3TNMB 1PYWB 2CDGB 1WEJL 2R2BB 4JZNA 2LE9A 5TF1H 2NLJB 4PRIB 5IJVA 1K3IA 4K7PX 4WI6A 3ZLQC 4EIZC 4Q9QL 3CJJA 1U58B 1OSZA 4X99B 1YC8A 5SX5K 3VD9A 2NX5D 4M6OL 5C08D 3LCYA 3AY4C 5DDHB 1DBBL 4JM2D 2Y6SC 3KPQA 1U8MB 4NN6B 5IP4A 3GHEL 4PJBA 4CDHA 1ZGLM 1I1AD 1ED3B 4Y19D 4BQ6A 1WTGT 3D25A 2NY5L 4N0YL 4NM4L 1HNFA 4O4YH 1K9TA 1LGVA 2ZJSL 5DVKA 4ERSL 5J11B 3VFGL 4QGTA 2GJ6D 5KSUB 2FJGA 4YHKL 1FAIL 2Q3ZA 1MREH 4JJ5B 4Z5RA 1URLA 3EFFB 1KPVB 3AFLA 4HJ0C 5D1QC 5H8DA 4JB9H 4PJGA 4FXGA 2GJZB 2X4TA 4D3CL 3VD7A 2VLKB 4OV6F 3C60C 3EDFA 3G6AA 2BVOB 2V7NA 4HK3J 3D85A 4XPGH 3LPGA 1MI5B 1MCOL 1VFUA 4OLUL 4S0SD 1K4DA 1X6NA 3UROR 4ZTOL 4HPOL 1UT9A 3IFOA 2X9YA 4AM0B 4RGOL 4QOKA 4IOIB 2O5XH 4FQHB 1DEEA 3S3JA 3GJEB 2IAMD 1J7VR 5CZXC 2DJ4A 3E0GA 2OJZH 1F4YL 2AEQL 4FZ8L 1CFTB 5D5ME 1U0QA 1WAAF 1G1YA 3ARTA 3GSXB 4OB5L 1MHHA 1OD7A 1XIWB 2VITA 3O8XC 3NIGE 1K3ZA 3T0BA 3IXTB 2R1YA 3VXSE 3QDGA 3T0EE 4ZYKA 4MD0A 5E6IC 1DLFL 5CEYA 3GMLB 1YY9D 5DWUL 3I75A 4Q9BA 4LLVA 3CK0L 3DHMA 2F53A 2LV4A 1RURL 2XQBL 4YIQA 2B4CL 2C1PB 2ZUYA 3FOMA 1X5GA 5CIPH 3D2UD 4CVUA 3W11C 4OZGA 4XTRD 2XWJB 3E2HB 4L4VE 3EKCA 3DVGB 4LCCA 1KGCE 4KUCF 1DN2A 1QFWH 1S8DA 3VE0B 3L5XL 5LAXB 1NCDL 2OZ4H 3G5VA 2Y7QA 3OQ3B 2EEDA 1UM6H 4KK5D 4S10A 3FFCE 2A0LC 1KEGH 3G6JE 1VDGA 5AZ2H 1S78C 1ZK9A 1MCLA 3WFZA 3PHOA 2AK1H 2HFTA 3NTCH 5CJXC 5LGJA 1HN1A 2IF7A 5ALCL 3T0EC 3VG9C 4MA3B 2FR4A 4NNXA 3VFRA 1Z9SA 2X10A 3ROOB 1AD9A 3QDJA 3X13B 4C4KT 5JXED 5B39B 1ZA3B 3PJSA 5FYLL 1QBAA 3I3EA 1J1PH 4Q97A 2XWTA 2Q87A 3TBWA 5JW4M 5KG9B 1UXSA 4S11A 1NFDE 3U7AA 3NFSL 2EDLA 2HFFB 3NH7H 4KKAD 5JHDA 4XNQB 4PRNA 2J8HA 1IGIH 2EYSB 1IL1B 3QHTC 4JM4L 3ARQA 4ZFZA 4KMTH 1P4IH 1FGVH 3TWCH 1QSEE 3N1QC 1ULVA 1TTGA 2HP4A 1FZMA 3HFML 2AJZA 1R5WB 1S9XB 4QO1A 2FD6L 5EZOH 1X5JA 3BP6B 1DQMH 1IILE 1N4XH 1VACA 1AGEB 1CDUA 2PO6D 5FUZH 3H9SA 4QF1B 3MLYL 4KROD 5D71L 3SKJH 4P49A 3FZUD 4PRDB 4RMWA 2ZG2A 3LN5A 4W6WB 2DIAA 2UY6A 4KJYB 2XOTA 3IKKA 4KK9C 3EYFA 3QQ4A 3D39B 2YPKA 3WN5B 2OX5A 3FO2A 2D9QB 4O2CB 1GAFH 3JTSB 4BKLB 4XP5L 1S9VB 3S35H 4O4YL 4OCNC 3TH4T 4IRZH 5ICZA 2BOBA 4LVNB 4ZQKA 4EQ3A 5CINL 1YC7A 1A6TA 3QWRA 4OF5A 4YK4B 4X6FA 1JTPA 1CIDA 3NMEA 1WWAX 5EU3A 4NKDA 3PDGA 4HKBA 2QL1A 2EC9U 4G80B 1G7PB 3IAPA 1W8OA 1H3WM 2D9CA 3DI3B 5HVFB 2X4SB 1W0VB 4CAGA 1V7ML 2KUTA 3C6SA 5JMOC 2ARJQ 4LQFH 4U3CA 1ZWIB 4ODWB 1TZIB 3BYTA 3SO5A 3M8OH 3REVA 2FO4A 4HQQH 4ORGB 2RGSA 4WHTB 3HAEG 5E5RB 1VFBA 4N90E 4EVNA 3AU1B 2YD9A 1ZHNB 3GSVA 4Y4KB 5HPOA 4HDIB 3LKSA 3U9UB 2O5XL 4WU7A 2V7HA 2ICWA 3S37L 1OP3H 1G7LA 2DYPB 3T2PA 2P47B 3MJ6A 3V6ZB 1AQDB 1YJDH 2R0ZH 1KTKE 4JY5L 2VSCA 3DECA 4L3AA 4FFVC 1K2DB 5EU6A 2DLFL 2VLJB 3ZDXE 5E9DE 5DS8B 3TBVB 4S1QL 1DN0B 3LSOB 2Y4SA 3QPQD 1VFMA 4PLNC 4AH2A 4TUKL 2QSVA 3WNPA 1S7VA 4XC1L 1AJ7H 1IEHA 5FA4B 4I0KA 2ZPKL 3FRPA 4AJ0A 3IS1X 3NZ8B 5B38G 5IUSA 4CN1A 3LQAC 3F7YB 4GG6A 5HI5C 2JCCA 1RU9H 4P5TC 3D85D 1OWRM 4GS7B 4N1HB 3UTPE 4KQ4L 1Q9LA 4RCAA 2AS5M 25C8H 1HQ4B 3LH2H 5T1KA 5DEGB 3RY6A 4XH2A 2GI7A 1G9MH 2NTFA 2WV3A 4IS6A 4NUJA 5TPWH 3TIDA 3VXMA 1NC2A 3SEPA 2VUYA 1UB5B 3N1MC 2VISA 2YD1A 4KRMB 5DJXA 1R3IH 2ZWLT 1TDQA 3O41A 5IB2A 2Z91A 2YN5A 4OF8A 4YHNA 1CD0A 4NWTH 5I18H 3HUJA 2EXYC 5E4EC 4FTVB 4G43A 5H35A 3F5WB 1J1PL 4FNLL 1EIBA 2FLRT 3IDMB 5MP6L 1BJ8A 2X1QA 4L8DB 2NW3B 2VZ1A 4ODXB 3OR7B 4LSSH 4NZRL 3EHBC 4WFED 4YQXH 3O11A 3NH7L 4Y5XA 1IGIL 4HIEA 5I1IH 4JFDB 4LCWE 2OTUB 1P4IL 5GGSB 3G04B 3DX6A 3WYRA 1QACA 3D1MC 4OZIB 1G6VK 1FNAA 4HG4J 2GTZA 3MJ9H 5M94B 1N4XL 3OX8B 1L6ZA 2YD2A 4RMRA 5JOFB 4JY6A 3IDNB 3EDJA 4Z8FL 1U3YA 4IM8A 2AJSH 2NY1C 3MGOA 1I7ZA 1TVHB 3QXDA 4KJPD 4NO3A 1AKJD 3RAJL 2F54D 4XP4H 4XWOC 2X7LB 1CFNA 3DX8A 4U1LA 2DQJL 4F58H 3PWJA 4MVBC 1YEHH 3D3VE 1CDGA 3L3JB 2Z8RA 3ES6A 3H0TA 2HTLC 5CZVH 1CI5A 4NO0A 4LSQH 4X6EA 4L4TE 4LLQB 2HLAA 2VO5A 1Z0NA 1KJ2L 1A4KB 4AEHH 1CD8A 5IIEB 1TQCC 2ZCKL 4PJDE 2BRRL 1ZT1B 5JHDD 3PXHA 1BBDL 5IFJA 2EKSB 4Y2DB 3WDJA 1U8IB 4KDTC 3WUWA 3OKDB 5D5MF 4WNQB 5DEFA 3VDAA 5T33H 3FO9B 3QG6A 4R0LA 1MEXL 1X7QB 3NIGF 2IANB 3QUKB 3O3AB 5F71A 4LQFL 3W2DH 2W65B 5GRVL 4PLJC 3ISWA 3MRKA 1CZ8H 4WW1B 3K80A 3RJQB 1U93B 3DETC 1DTUA 2J3SA 3C5SB 4OT1H 1R3KA 1LK2A 1FQ9C 4YR6A 4WO4B 1S7SA 5D7JD 3CFBB 1HILA 3TZVA 1IEAB 3U0PB 4F37K 5I71C 4O51B 2O61A 3OAUL 1QPPA 5T3ZL 4MMZC 1U8JB 5I1HH 1YJDL 3ARUA 1G6RL 1FYTE 4E42B 2B8OT 5ISZA 3SN6N 5GRWA 1JWMB 1AY1L 2CRZA 3BUYB 3G6JF 4ZSOB 1YN7B 1T89A 1YEEH 3EO0B 4ZNEE 3ARRA 3G5ZB 1U36A 3ESVF 5DJ6B 1E4XI 4U31A 2Q8AH 1MOEA 1FNSL 4L4JA 4KK8D 3RWGB 4MJ2A 4WIQA 5ACZA 4XP1H 4E9LA 2HFGL 5E5MA 5DJDA 2AV7A 3HNTH 1WCBA 1FL6B 1DZBA 4X4YA 4D9LL 3THML 5HHVH 2P43B 3P9MB 1NFDF 4AY0A 1JFQH 4ZO6A 2MPAH 5TE7H 3QUXC 3HE7A 1IC5H 4NKOB 2CO6B 3LH2L 4PJEF 1KJ3L 3WFBH 3WJJA 2VN7A 1SBBA 4RIRA 2YN3A 4MX7B 1BEYL 4BJLA 1JGLH 5TPWL 4XT1C 3LEVL 1A7PH 3ARGC 1MRFL 4G9FB 5GQBA 3NGBB 4JPWL 1KB5A 1R3IL 4KRPB 1NCNA 5GGVH 3HS0B 1P5VA 2B7DT 3GRWL 2JB5L 1B4JL 2JK5B 3BP5B 3IDJB 4GQ9L 2BCKB 1FLTX 1TMCB 4JK