3FB6B

Kcsa potassium channel in the partially open state with 16 a opening at t112
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody fab fragment heavy chain
publication title KcsA Potassium channel in the partially open state with 16 A opening at T112
rcsb
source organism Streptomyces lividans
molecule tags Membrane protein/metal transport
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fb6B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fb6B01
4M1GL 3VXUD 3RWCB 2B5IB 3Q3GA 3DURA 5CIPB 3IFOA 3DVNB 3VWJA 1CK0H 1RUQH 5D72H 1VDGA 4PG9B 1ZHNB 2R15A 1N4XL 3S34L 1T7YA 4Z8FL 2XQBL 3T2NL 1QHOA 4S1RL 2ZJSL 1HDMA 2DLTA 3V0VB 4F58L 1QSZA 3L3OB 3QEQD 1ERNA 3RNQB 4KXZH 5JHLH 4M7LL 1ZHBA 3ETBF 4NHCL 4HAFA 3RZCB 2JJTA 4P2OC 4R90L 2JF1A 1HHHB 2ED9A 2FGWH 2YBRB 2CKBB 2YA1A 1XH3B 1HEZB 4J2XA 3VGAB 4UNTA 1NCTA 3PWNB 5C07B 1IC1A 1K85A 1F4WL 4TNVK 3WKML 3HE7B 1KN2L 5CP3A 2XKNA 1S7TA 4LP5A 1YEJL 3IJSA 3L7FA 5TQ0L 1NBQA 4P5TD 4J4PD 2BXYA 4MD0A 1RAMA 1UENA 2XACC 4XHQA 2R0ZL 5EDXA 3VXUB 4YZFE 1DQQA 3LRHA 5ESVB 5C0JA 4YHYB 3ABZA 3R1GH 5F88A 3IU4L 2YA2A 3GBMH 8FABA 1JPFB 5LVEA 2XTJB 3H9SE 4WU7B 4GKSB 5C0CD 3AU1A 5F89B 3EDKA 1VKXA 1MLCA 1QFWL 5L2JB 4YUEL 5CJQH 4HS3B 4MS8C 2NY4B 3S6CA 1G7PB 3QEQB 3HAEG 5I8KL 4BFEA 2AK4D 3OHXB 5KSUA 2D4DA 1U3HA 1S7XB 3HC0A 1A6WH 3G5VB 4HWBH 1PY4A 2VIRA 4P2OD 1VPOH 1JGLH 4L8DA 1H0DB 1T3FA 5HYQA 1XIWD 2WQ8A 2ILLA 4JY6B 5CZKA 1ZS8B 3MRQA 4KKBC 3CU1A 1MSPA 1ZT1B 4RGMB 3RIAF 4M5ZL 2M2DA 2X5PA 1ES0B 1FCGA 3VD3A 4WGWB 4BUGA 2ZG2A 5E8OA 4F7PB 4NPYA 5FYJU 1N6QH 2XZAH 5DJXB 1PLGL 5B39G 2B4CH 3EOTL 2Z93B 4ODXA 1MRDL 3IJYB 4P5KB 4WFFD 4LVHB 4DUXA 4JJHA 4QRRA 4K7FA 3SE8L 1FL3B 1U6AL 3G6JF 3QXAB 3SHSA 1YEFL 4LSPL 3X13B 4WFED 3DX6A 4ZTPH 3MRRB 3A6CH 1J18A 3BH9A 4Y2DC 1NKRA 1S5IL 2AK4B 2J6EH 1SEQL 5GGSY 1OAQH 2R56L 4QRPA 4WI8A 3V5DA 5GS2D 2WMPA 2A9NH 4DVBA 2HMIC 1XIWB 1AI1L 4KKBD 1OVZA 4HT1H 4XPAH 1N3NA 3PJSB 3MA9H 2UY7A 4UINL 2X4TA 2IQ9L 3VRJB 2HT3C 3ARDB 1J0KA 4Q9QH 1ZA3A 2X9XA 2WIIA 4L4JA 4MD4A 4X5WB 4JPIA 4PGEB 5C0BE 4GUPB 2J8UB 3LZFH 3V6OA 5IV2B 1YMMA 2NY5L 3E3QC 2I9TB 4DKEL 3GEWB 2M1KA 3TYFB 4JG1L 4XXDA 3BIBX 4DKFH 4Z9KB 1T7ZA 1S9WA 2VDRL 3U6RB 4K2UL 4Y2DD 1A1OB 5I30L 3TBSA 5C9JA 3MRNA 1QR4A 3QUYA 1INDH 1VEMA 4JFHE 1H8NA 1A0QL 3T2QA 4PJBA 2XY1A 5HGHB 1AY1L 4QRSA 2X7LA 3SQOH 3QG6A 2X1QA 3FO2A 2HMID 1AGCA 3BRGC 1RK1B 1OARL 4C83A 1FL5A 2IANE 5T5NF 3SKJL 2O26U 1R3IH 3HMXA 3OJMB 5IW1B 3CFDB 4NUJB 5DDHB 3WFDL 1QPPA 3VGGA 1DP0A 2HT3D 3PGCA 4YBLB 2B4CC 1OP9A 1A6ZA 5DD6B 3OQ3B 1FYHB 4LHUD 3QJHB 3OKOB 3A6BL 2BOCB 1RV6X 1N64L 5FO9A 4I18A 1Y6NR 3OJDB 4OI8A 4YHLL 3BPLC 3RUGF 1ZGLB 4EN3A 1T66C 3WS6C 3O4OB 5DD3H 3W81A 4MA7L 3B5HA 2EZ0C 5CBAA 3C6LC 4HWEL 1GZQB 1Q9LA 4PV8A 1E6OL 3QCUL 4GRWH 3PHOB 1F4XH 1U36A 3FQWA 5BJTB 4ZOAA 4LVOC 4OZHE 3T4YB 3W0WA 5FXCH 5MEND 4PJEF 3T3PF 1EJ6A 1R5WA 2H2PC 5FUOL 4K9EH 3VRIB 5T1DH 4NT6A 4OQTA 1DLHA 2FX7H 3MUGA 2JCCE 2UYLA 2HP4A 4UB0H 3OGCB 3JWOL 1J8HE 2DQCL 2IH3A 1I9EA 3QI9C 2OL3B 4WNQA 3OX8A 4GW5B 5GRZA 1S9KC 4DCQB 4LHUB 1NGPL 4PB0L 5E56A 1KC5H 1QSED 2PYEB 1L7TL 3AY4C 2CLVB 5JXAL 5ISZA 2ZCHH 3EO1A 1T66D 1EBAA 3QEUA 4KI5E 4N8CH 1F97A 3CFKB 3VH8B 1ZLSL 2ZCLH 1JTPA 1PG7H 2DI9A 1K4DB 3MV01 3WSQH 3C6LD 4PREB 4CVWA 3LOWA 5FO8B 4I3SH 4ERSH 5IJKC 1YDPB 1DQDL 4KWUA 3QDGD 1MFBH 3ZTJG 1HQRA 2AJUH 4N0RA 3AS0A 3FMGH 1SYSB 1PZ5A 3QUZC 3GNMH 2Q20A 4UNUA 4C56D 5MENB 2H2PD 3VWJB 1L0XA 3T0BA 3IXTA 2BJML 4QRUA 4FQXA 4NQSB 5IM7A 3T1WA 4NJAL 1ND0A 5HVHB 2EXYC 1J0HA 3O3UN 4C57C 3QULA 3BW9B 1IC4H 3VXUE 4U6TA 3BP6B 3SCMC 5DC4B 3QI9D 4ZOEA 4MMZC 4OI7A 3P4OA 4X9HA 1BQSA 1BIHA 1FNEA 1N6UA 1JV5A 3OR6B 5F8QC 1QSEB 3JWDH 3E6FB 3P9LA 3QCVL 3OAZH 7FABL 3LPGA 4JFZL 3LKPA 5D9SA 3S4SG 5DHXB 2XXCB 3TBVA 3RAJH 1DBMH 5K59F 2XKNB 3QXVA 1QSFD 2JE8A 3IF1A 4XBPA 1JNNH 3QDGB 3G5ZB 2VXVH 1QFHA 4MD0B 4OB5L 2BNQA 5F9WC 4I0KA 5KSAC 3VXQA 5C0JB 1JGVL 1CICD 1CYGA 1UH3A 4BFIB 5ID0B 3B9AA 8FABB 4L4VA 1HQ4B 4F37F 5E99H 1N8ZB 1VKXB 3SCMD 3LQMA 3DVFA 1CZ8L 3MRGA 1IGCL 3QI9B 4YDLC 2CSPA 4NUGL 1YQ2A 4JN2A 4WI4A 5E8PB 5D8JH 4KUZL 2APWA 3B9KA 5KSUB 9CGTA 3MOAH 4W4OC 3HC0B 2VIRB 1TJIL 5C0CE 5CSZA 4NBZB 1WGOA 5JO5B 4UT7H 2D0GA 2Q8AL 5ADOH 4MXQD 4WENB 1GIGL 3VWKC 4DVRH 4CRPA 1EO5A 2VUOA 3VFWA 4APQA 3QIWA 1N59B 5HDOA 5CWSA 1IAII 3RP1A 4BELD 1U8MA 3LHPH 2C3HA 2GUOA 4XMPL 3W2DL 4M7JL 4FS0A 5EUOA 1ROWA 4Y2OA 2AABH 1CGUA 4Y0GA 4YDKH 4Q7DA 5F3BA 1CICB 1V3KA 3D39A 4J6RH 2W9DL 5IMLA 4M62L 2R23A 2E8YA 5D1XA 1T1YB 4QRRB 4K8RL 1Z9LA 3T77A 4G6ML 3QH3A 3MV8A 1FIGH 2OK0L 3SKOA 3JWDC 3F58L 1OD9A 3DX6B 4DN3H 3OXSB 5CGYC 3TN0B 3LS5H 4KHTH 3MRKA 3BH9B 1KTRL 3MGTA 3DECA 3BZEB 3ZE1F 1B4JL 1X5JA 4WFFE 3CJJA 5GISH 3T2PA 3NA9H 4QRPB 4OD2A 4U6HA 4JFXA 4N0UA 4WFEE 4DVBB 5E24E 3QYCA 3HRPA 2YRZA 4G6AC 3VWKD 1MAJA 2IBGA 5AEAA 4KJWD 2X4TB 1T2QL 1MJJA 5AYUL 1LD9B 4YNYB 4PD4J 4GKZA 1Z0NA 4HUUA 3O0RL 5DSCB 2WIIB 5EA0L 4HAGA 5HHXH 4N5EC 1OAXH 1QA9B 1X5AA 4M00A 3RPIA 1G0XA 4GRLA 2DBLL 5LCVL 4MSWA 3EHBD 1V7ML 4RFNC 3EW3B 2Y6SD 4AG4L 1R0AH 1YMMB 4PJAA 3MLXL 4D3CH 4ZUVA 3ZKXC 3VJ6B 5J1SC 1CGWA 1A4KA 3IU3A 5JNYB 2HN7B 1IMHC 1BMGA 4IS6A 4UTAH 5CGYD 4OCRL 5KTEH 3SDCC 2V5SA 3TBSB 2VWEC 5C9JB 3MRNB 5IK3A 1CTNA 1SMOA 5IMMA 4PTUB 3WXWH 1UACH 4D8PA 4PJBB 1KJVB 3UBXA 3O6FC 4QRSB 1X5LA 2X7LB 4LIQH 3ARSA 5E8EA 2APVA 4TUOB 3VXRA 1AGCB 1FJ1A 2L7UA 5I75C 1JZ7A 4C83B 1CBVH 1FL5B 4G6AD 3J8F7 1J0JA 3TT3L 4Y4HA 4NKIL 5J12C 2BCKA 3PGCB 3CIQA 1A6ZB 1J1OH 3BHBB 4JG0L 4N5ED 3MNVB 2HFGH 4Z7UB 3NAAH 5FO9B 4FQQB 4I18B 3NCYP 5HHVL 1UGNA 4XVTH 5DQDL 2D0HA 1G0DA 1L7IH 1CFTB 5D2NC 1MWAL 4W68A 3PNWA 4P4KC 4H20L 2A77H 3LD8C 1E6JL 4LAQL 5CBAB 4KQ4L 3SDCD 1Q9LB 4JFDD 2Y5EA 3E3QE 1S7QB 3MPCA 5BW7C 3OKEB 5CSBA 4PRNA 1NEZG 3ARGD 1ZVSA 3O6FD 3SGJA 3P2TA 1FSKB 5JDJA 3U7WH 1RUPL 3MA7A 5L88L 3TH2T 1LEKA 1AE6H 5TFSH 2HT4C 3ZSTA 1I9IH 4AEFA 3X11A 1UM4L 1DLHB 1YYLH 3RWDB 3MUGB 5I1GL 3U4BH 4BA8A 3P30H 4X99B 5I1AB 3ECBA 3MFFA 1JYNA 5DZNA 1GCFA 2D31A 2NXZC 4GG8B 4RAHA 3QUKA 4Q6IC 2QADC 5GRXG 5HHOA 4X8JA 2AV1A 2ZUUA 3S96A 1KTKE 4IDJL 3EO1B 3ESUF 2P8PA 4U0RC 4XP4L 4P4KD 1QFPA 3OAYH 3VCLA 5DHYB 1GZPA 4ZAKD 1L9MA 1QSEE 1HHIA 1RZJH 1OTUC 5A40E 3LMJH 5EBWB 1HQRB 4L9DA 3UYRL 5D6DC 3ARGB 2Q1EA 2V17L 3O6FB 4RFOL 2VC2H 1OP5H 5DJCA 2HT4D 4GAGH 3G5YA 2EO1A 4OFKA 3EOBA 2MMXA 4LASH 1NGQL 1TVBB 3MLUH 3S5LG 3UBXI 3P40A 4PJDE 3HNTL 4HXBH 3UDWA 1NAKL 5IW3A 4C56E 1DBBH 1GGBL 1UM5L 2A83A 1E4KA 3VGFA 3WBDA 3RRQA 1IGFL 3LKSA 4UT6L 2NXZD 3S36H 3V4UH 3P4OB 1AO7D 2QADD 2ADIB 3DMMA 1FNEB 1JV5B 2YRPA 1UM6L 4HWUA 3FRPG 3WJJA 2XFXA 2F74B 2F5AL 5DS8B 4XVJH 5D2NB 3LKPB 2CUMA 1ONQA 3U30B 4YXHH 5C0BA 4JFED 1UEYA 4WW2C 2YD2A 1UYWL 4ZAKB 1OTUD 3KYOA 3ZE0E 1SBSH 4OD3H 2BNQB 3DSNA 2A1WH 4PJIF 1VFAB 3WHXB 4KK9D 3QDHA 5DMKB 2ARJA 3VXQB 1JI1A 4Y5VA 4NBXB 4FQPA 5T1KA 1QSFE 2BDNH 1UB6B 2Y25A 4L4VB 2NY3D 3BKYH 3KR3L 4JEGB 1I3RA 4MNGA 4YHNA 1JF5A 2YZ1A 1CLZH 1C1EL 3UTZA 2KH2B 4HXAH 1URLA 2VTFA 3CAFA 4MJ6B 3N85L 3C60A 4N68A 2ZCKL 4WUUA 5IBTL 5D7KD 4Q9RL 3R06A 4XB7A 2OLDA 2NXZB 3B9KB 1A6VH 1AO7B 4UTBL 2BSRA 1FYTE 2XZZA 1ZSDA 5CSZB 1RZJC 4L3AA 2P44B 4BQ6A 4NSKA 4OZIA 2NXYC 5E8NB 3RKPA 1X5IA 1DVFB 2FJHB 3QCTH 4PJHB 4XCYA 1BREA 2V6HA 4JFEB 3LQAH 1Q9WB 3VFWB 4APQB 5C0FA 4JANA 2QSTA 5CWSB 3P0VL 4GRWE 5I1CH 4HBCL 4PG2C 5EOCJ 3GI8L 1TQCB 5JHDD 2GUOB 1N0LA 4LSQL 3FZUC 4KJYB 4NKOB 3U9UB 2BRQA 2R4SH 4JO1H 1DTUA 2ESVA 3LRSB 3MODL 5EUOB 4XC3L 2VL5A 5KAQG 5F7EL 4MD5B 3OZ9L 4M9PA 3C5ZA 2R23B 2LVCA 1PEWA 4LLWA 5D1XB 4OZHA 2H32A 2RCSH 3MJ8A 4G9DA 2NY3B 1H5BC 4KRMB 4JZOB 3QH3B 3MV8B 3SKOB 3VFNA 5BVPL 2J88L 4FQJL 4P5MB 2PYFB 5I17A 3QUXC 3SEPA 3MRKB 3MV9D 3OAUH 4XCNA 2MWCA 4ODHL 5D7JD 4FOMA 3CPLA 5IFHL 1NFDB 4PRBB 4X7DC 5LWYH 4PUBL 4OD2B 1J8HA 3BDYH 4JFXB 4U6HB 1H3WM 5CINH 5FB8A 1CE1H 4S1SL 3C09B 3GI9L 2F54D 3L1OH 1BFVH 4XP1L 2W59A 2WP3T 5EBLA 5CFHA 4XP5H 2HWZH 1GGIL 4Y89A 5IW6B 1PKQE 1MJJB 1KCRL 3PP3K 5ICYA 1OD7A 4KKLD 2FX8H 4TSBL 4DFHA 3HNSH 1MAML 4ZUSA 2R29H 3FZUD 1F8TL 3BUYA 2VH5L 5JHDB 1B0RA 4H0IA 5E03A 4GRLB 4X9GA 5B3JE 3TWCH 3LKRA 2QTEA 3CFEA 4HFUH 4XPTH 3W11C 4ZUVB 4KMTL 3SOBL 1A4KB 4V2BA 4E41E 1LEIA 2PO6A 1YA5A 3MRHA 4PLJC 3SE4A 4IS6B 3CK0L 1A3LH 2VDPH 4PJCB 1CD8A 1JNHA 1OF2B 4Z18A 2B1HH 3O2DA 5IK3B 3MV9B 4PGDB 1FZMA 5D7JB 2F15A 3NIDE 4D8PB 3GO1H 1A9BA 3GSNL 4Q58C 2Z8VC 3L3GB 4LQFH 3VXRB 1T5XB 5BV7B 1UQSA 4S0TD 5F96L 1A6PA 3WNMA 3RWEA 2FHFA 4X7TA 4C59B 4O9HH 3D0VA 1CR9H 1NMBL 3BN9C 1G0YR 4PJXE 4Y4HB 5JUEL 4CU6A 3BRFA 5SX4I 5IB2A 3FT3A 1AJ7L 3MROA 5JPNB 1WAAF 1ORQA 1A7OH 4ONGL 5LBSH 4TTGA 2XZCL 1LP9F 1L6ZA 1AP2A 4RGNB 3W11D 3WN5A 5HPOA 3D2UD 1SY6H 3V9FA 3LH2L 2JJSA 5GGUA 4N8VA 5EU6D 3MNWB 5JMOC 2EEDA 2NY7H 3ELAT 3PNWB 4JO2L 1G7HB 1G9MH 4PLJD 4OQ1A 4S2SA 4RISH 1FLRL 3QWRA 2NY6B 4P5TA 3MRIB 2OR9H 4PRNB 1WZLA 4JO3L 4XPHL 4XWOC 5TH2A 3DSFH 3G04A 3MGAA 4EVNB 1MI5D 4PJGE 4PBWD 2QBWA 3CMOL 2B20A 4X4YA 4Z7VE 1VACA 4JFDE 1H3PH 2VWEE 3BN9D 4BKLA 3WIHL 4G8EA 4EQ3A 1NDGA 5L8LB 1RZ7L 4WEMB 3ECBB 3RY6C 2DWDA 4GMTH 5GS1B 4WO4A 1ZV5A 2AK1L 4A6YB 2D31B 5EOTA 5DMIL 5HHOB 3FQNA 4X8JB 4TSCL 4WFHD 1YY8B 3LB6C 2G60H 2DQHL 2YD4A 2QKIB 3VGEA 1K5NA 1NAMB 3TZVC 1FZKB 2DLFH 1S7SB 1R5VA 1ZEAL 1PBYA 1FAIL 4JZJC 3I2CL 1GZPB 2QSQA 1C12B 1FFNA 2C7UA 2FO4A 1HHIB 4JDVA 5LXGL 4B5EA 1KEML 1SJHA 5D2NE 4XWOD 4RNRA 4AM0B 5EORL 2Z8WC 2YD3A 5E2VH 1MHPL 5KVFH 3QHFH 4LPUA 1MVUB 4OUUA 1IKFH 1SM3L 3G5YB 3EOBB 4W6XB 3T0XA 35C8L 4HJGA 5C08E 2ZNXA 1IM9A 5KSBB 3D85A 2EEAA 1ZLUK 4P23C 5GRYA 4HS6A 4WWKA 3O3BA 2GHWB 1U8LA 3RBGA 2QQLH 5DUPH 5DVOA 1SBBA 5IEHB 1RURL 4JRYD 2BY2A 3DMMB 1QNZL 2DWEA 1PYWA 2IGFL 2XFXB 2FYYA 1WBXA 4OGYH 3TZVD 1ONQB 5I71B 1MCLA 2XTLA 3IFLH 2R9HD 4K7PL 3OF6D 3KYOB 4I2XB 2W0KA 4M1DH 1OSZA 5CBEA 2W0FA 1SMAA 1LGVA 3FONB 1OGAD 3BGFB 2JJUA 2VZUA 1KPRA 4PJHE 4J7RA 1FFRA 4LIQE 1GRWA 5I1JL 2FR4B 5DRNB 2FLBT 1PD6A 1MQKH 1OM3L 4JVUA 4JJ5A 2VLRD 1I3RB 1HINL 4P23D 4XNZB 1T6VN 3QO1A 3E8UH 5F7UA 4KVCH 4WUUB 2DJUA 5DO2C 1D5BA 3FFCD 3CH1A 5EC2B 4HV8A 2BY1A 2PTTB 3VRLF 3O3EB 5DK3A 3ZLQC 1KCKA 1QR1A 4R0LA 1U8HB 2VZ1A 4OBSA 1ZKAA 3FTGA 1D6EB 1BJ8A 2CLRB 4QXTB 1CLCA 1PLGH 5D7KE 4I13B 3GHEL 2IMMA 1MRDH 3KYNA 3G6AB 5FKAA 2HJLA 3KJ6H 4QTIH 5C0FB 5KJRL 1T22A 4JANB 2VITA 1WUNT 1I75A 1QYGH 3U82B 1UCTA 3TV3L 3W5NA 3I85A 4M61A 3VI3E 3SDAB 1OGAB 4XP9L 3ZYOA 4CDGC 1OSPL 2ESVB 4B7LA 2OSLB 3PV7A 1U92B 4O2FA 3TPUB 1ZWIA 4LLWB 2H32B 4GQ9H 1EMTH 2VDQH 1IILE 5ICZB 4YDJA 4BUHA 1WC7B 4JE4B 2ZUSA 1RJYB 3RBSA 4FP8L 3IDYC 4X6DA 5GJSH 1UZ8A 3BE1H 1Q1JH 1I3GL 1V7NH 4D0BB 5DQJA 5C92A 1X3DA 5KS9B 1MCBA 4BH8B 4Y1AD 5JW3L 1RULL 3SGKC 2ARJQ 4PJCE 3RL2B 1XCTB 5IEKA 4K55A 3UCRA 1P7KB 2HRPL 4LLQA 3TBYB 3SJVA 4TRPL 4PFEA 3L5IA 4HPYH 5E9DA 5EBLB 4YR6A 1BD2D 5ICYB 4NO0A 3IAPA 3H42H 2FD6H 4ZUSB 4JN1L 1MREH 2X4RA 2AJXH 2F54E 4MDIB 1MIEH 3QRGL 3TNMA 3T0VA 1G7JA 3CCHA 5DVNA 3CFEB 3ARUA 3NN8A 15C8H 3WS6A 4U49A 2DS4A 3QQ3A 4LLVB 1JHLL 4WJ5A 1IFHH 2PO6B 1IEBA 1IZKA 2OP4L 1UJ3B 4OCSL 2XIDA 3ZL4L 1TVHA 1FZMB 5HGGS 3K3QA 4C56A 1A9BB 2OTPA 1YN6B 4NN6C 3I02A 5F72S 5I16B 5EOCH 3NABH 4Y1AB 2P47B 1NGWA 2X10A 4JFQB 5C0AD 5F7LB 3A6OA 3D0VB 5HYSB 3EYUL 2W9LA 3KPSD 5GZOC 1UCBL 3S3PA 3PDOA 5DC0A 1BD2B 1FV1B 4O4YH 4EDWH 5IB2B 4UUJB 3CD4A 3MRJA 5FYLL 2A6KA 3Q6FA 2C1PB 1DN0B 3U0WH 5FKPB 5FUZH 4DGIH 1LMKA 3O81A 2XNAA 4NRXB 5E6ZA 2PKDA 3WN5B 2WBKA 2AQ1A 1KJ2A 1M7IA 1FVCB 5GGUB 2ICWA 2VZSA 2F53D 1BFSA 2E9IA 5CKGA 1ACYL 4OFYD 5CILL 2FH6A 2R39A 1AHWC 2JIXA 1J11A 3TF7C 3VH8G 3G6DL 5TF1L 4LL9A 5CZVL 3QUZA 2UWEE 5GGTA 3SDDB 3QPQC 4EEEA 4ZFFA 3EYFA 3EZJB 5EU6E 3MV7D 5TH2B 1I7UB 4U1HA 3S36X 4MNQD 1X4ZA 2O5XH 4X4YB 5DJYB 1I85C 3BDBA 4TSAL 1G6RH 4YDVB 2P7TB 4UU9A 4YXKH 4L8SC 5AZ2L 5GZOD 1FYTA 4PP1C 1X6NA 4BKLB 3KPSB 1YY9C 3WXVL 5HHPA 2EIEA 2EECA 5EZOH 1MRFH 1MI5E 4Y16C 1JZ8A 1HZHH 4BSVA 3OPZH 4G9FE 4P59L 1XT5A 2KL6A 4G6JL 4Z78A 1I8MA 4BFBD 2BVPA 4FNLL 4WO4B 2IF7A 4XWGH 4BZ2H 3U36B 5LGHL 1B0GA 4QCIA 4JHAL 3U79A 4P2RA 3HRZA 1WFOA 2J5LB 1FCCA 1TZGL 5GHWH 1K5NB 3FCTA 2B1AH 1I7ZA 2XN9E 1R5VB 1U58A 4OM0L 1J5OH 2OX5A 1QBLL 2E8ZA 2GIYA 1FFNB 2C7UB 2FO4B 4ZFOL 1K8IB 2HLFC 4M6NL 1FO0H 5BO1L 3ZDXF 4NP4H 4I9WE 5HYJA 1JMXA 2HG5B 3HG1E 2MPAH 5L0QB 4RNRB 4G7YH 5KSAA 3MV7B 4NN6B 5FYJL 3RPKA 4J3WA 1JYXA 3UC0H 4YO0A 4OUUB 2H3NA 3D25A 3MNZB 4F9LC 4PP1D 3X3GH 1OAUH 4HBQA 3JVGA 4HJGB 1IGIH 1QP1A 1IM9B 4Y5YC 4MLSA 5IHUH 4HS6B 2OI9C 4WWKB 3V0WH 4M43H 4Y16D 5KANI 1W72L 1UKQA 5KN5A 5TDNB 3DRQB 1HSBA 1NC4B 4FFYH 5MEOA 1PKQA 4YE4H 5EO1A 4EXPX 5INCA 4KV5F 2ZPKH 1WBXB 4LPTA 5E2UL 3PWUB 4OGXH 4DJMA 1GOHA 1D6VH 4WHTA 3BSZL 1TJGH 1KNOA 2GK2A 4QRTB 1CL7I 5ILTH 5CD3A 1H9VA 4JRYE 4YAQA 4AQOA 4NZJA 2JTDA 4Z5RA 5EULV 2HLFD 2P5EA 3ZTNL 1I9JH 5CBEB 2D2OA 4TUJB 2W0FB 3HR5B 5HGBB 4DTGL 4E41A 2ICWI 1A5FL 2A0LC 3BRDA 1I8LA 5IFAL 2CRZA 1KPRB 4POYA 1S9YB 4WCYH 2V5RA 1OP3H 4KKNA 5DFWH 5D7IE 4NZRL 2HLAB 4U1KB 2DI7A 1J1PH 3NTCH 5IVOA 3GRWH 2NW3A 3AAZA 2PW2B 4RMSA 3BUTA 5BQ7A 1OGAE 4F80A 4F57H 4KK5C 5J57B 1ZLWH 1AXSB 3TNNA 3VA6A 2BSTB 3QIBC 1D5BB 3CH1B 2R2BA 3IDUA 4PJXA 3KXFA 3EZ8A 1AXTL 3UO1L 2E7HA 2VLRE 1QFWM 2L0DA 4DGYL 4R0LB 1M7XA 4JY5H 4QHNA 4J23A 5E94B 5IIEA 1N0XL 1KT2A 3FFCE 3EO0A 5JPMA 4CAGA 3A67L 3UZEA 1CE6A 2NY1B 5IR1A 3WDIA 1TZIB 5KS9E 3ARFB 2VITB 2A0LD 4M61B 1U8OA 4OLZH 3RNKB 3HNVH 4ALAH 2R0LL 5L2KA 2GEEA 5J4MA 4JO4H 1ZWIB 1JRHL 5CJBA 5AZEH 1D3CA 4YHKL 4KK5D 2OI9B 1QUNA 1TNMA 3T08A 4JKWA 5ABDE 4JFDA 4ZNEE 4QWWC 1WBZA 3IAQA 2PTUA 3MBXL 1MUJB 4X6DB 4UV7H 2GCYB 1JN6B 1UZ8B 1WVZA 4PLOB 3JV5A 4MCYB 1EFQA 4D9LL 4TPRH 2OJEA 2VLKE 3MLVH 5KVEH 2GTZA 5DD1H 4WTWA 4RMWA 1IC5L 4LLQB 3SJVB 4JR9H 5ACZA 1XGPA 5IB3B 3FB7B 4U3CA 1BQLH 1INEH 1G7LB 1I1CA 8CGTA 1T20A 2FECL 1WT5A 1MCWM 3UTOA 5LJYH 4Y1AE 3WD5L 3O6ML 3P4NB 2OZ4A 4L4TD 4OV5B 2X4RB 3FN3A 3WNNA 5KAQF 4Z7WE 3ZE2E 4JLRA 5FHBH 5ANMB 4O58H 2R8SL 4RIRA 3NN8B 4H26A 1UWEH 3QQ3B 4V1DA 1CF8H 4WJ5B 4K3DL 5LQBL 1IQWH 5GGRB 1XZ0A 2VKWA 4QWWD 2MQ0A 4QGTA 5BW7A 5FYKL 5C08A 5FHAL 2XI9A 3FHQA 4HZAA 2AAVA 2HFFA 4KZDL 5TF0A 3F12B 2X4UA 4KRPB 3SDXF 1A6TA 5IBLD 1NGWB 1NCDL 3TJHC 3HUJF 1OHQA 1LO4H 3FRUA 3REVB 3UJIL 5E00B 4JAMB 2DQFA 4LF3B 3PDOB 4EBQL 5D7SH 1LDPL 4M48L 2ERJB 2YD8A 3LAFA 3MRJB 2A6KB 3Q6FB 4XNUL 3ZKNC 4M8VA 3SKNB 4L4TB 4OV6F 5C0AE 4IOSD 2Y06L 1Q0XL 1LO0H 4KJQC 5HYIA 3GBNL 2R69H 4MJ5B 1KJ2B 5H35A 4YFLI 1RMFH 2E6QA 3V95A 1VFBB 2AEPH 1NSNL 1CFNA 1DBJL 2JIXB 3HN3A 4JY4A 5L9DL 1EEZB 5H37H 3V4VH 3QNXA 3UPRA 4HULB 3T65A 3NCJL 4MVBC 1WBYB 4ZFFB 2ICCA 2UUDK 2OTWA 3VXMD 2F53E 1YPZF 4Y5XC 3P73A 3Q5TA 5HXMA 2XWJA 2ZKHL 3TJHD 1IAOB 4UU9B 4OZGB 3EO9L 1PY9A 4QYOA 4LSTH 5HTSA 5JW5A 1KLUB 5CGTA 5HHPB 3MBEC 4HJ0C 4OTXH 1D5MB 3MLSH 3GSUA 4MNQE 2GI7A 1I8MB 3ZKND 1C08A 1EZVY 1U8KB 1AKJD 5KVDL 3MREB 5F71A 4HFWB 5DVKA 2P42B 3ULUF 4TN9A 4HEME 4KJQD 3IDGB 5EZIH 3DOSA 4P2RB 4UZGA 3HRZB 1DQMH 4ORGB 3GHBL 2V7NA 4AEIH 1I7ZB 1U58B 4XHJC 4WW2A 5TPWH 2QHRH 5IQ7L 3N1GC 4L8BB 3DX7A 5EWIH 1NUDA 4XNQB 1DQLL 4MVBD 3GGWA 3RKDC 3MLWH 4HCRL 1HH9B 1BQHA 4PGZA 2DQIH 4RWYH 3UTTD 5T1LA 3G08A 5DQ9A 3IETA 2F9BT 3G6JE 3EFFA 3AVEA 2BNRD 5D5MA 2DL2A 5D1QC 3L6FA 4K23L 4DOHE 2VLJA 1KELH 5AG9A 3MBED 5F7MC 4XP6H 1KB5H 1C5CH 2VXUL 2QSVA 5F1OB 2CDFA 2DTML 4FABH 3E2HB 1HSBB 1FZOA 3HPJA 3Q6GH 1UXSA 4TYUA 4IMLA 3HE6B 4RCAA 5HBBA 5JIKA 5INCB 3ZDYF 1QLFA 5FECA 3S8WA 5D4QA 1YNTA 4NQED 5DYOA 1PG7W 1OAYH 2FEDC 3GBLA 3IDXL 2EDDA 3MOQA 1KLGB 4HC1A 1FORL 1KNOB 3VFTB 5CD3B 1YC8A 1HCVA 3OG4B 4YAQB 3VFOB 4U7KA 4BSWB 1GPOL 3LEYL 3KPTA 1AR1C 1A22B 3RKDD 4EQ2A 3WFHA 2CUHA 3BMWA 4MGXA 4AH2A 4Q9RH 1SHMA 3OKMB 4BZ1H 4OCMC 2Y36H 1KB9K 3GJFK 2BSED 3UX9B 1HKLH 3W9EA 2YN3A 3GMRA 4U6VH 5F9OH 2WUBL 5JOPD 3VXSD 4G8GD 5JIPA 2EIZA 4XBEH 1CG9B 5D1QD 2BVQA 2NW3B 1CDGA 3AAZB 3PE9A 2BNRB 2GFBA 1UVQA 3MBEB 3D0LA 4XT1C 3U48A 2ZNWA 5SWSD 3TNNB 4GW4A 2EH7H 3QUXA 3UTQA 3QXDA 5F7NC 3MFGB 2F19L 5DWUH 2ZUXA 3KXFB 2P1YA 2F58H 5F1NA 5L7XL 2CKBL 1B0WA 4PRAA 4LCYB 1LO2H 5IGXL 3JSSA 1GC1H 4N0FA 4NQEB 4U1IA 1J88A 2FEDD 4OCWL 5IIEB 2E27H 1KT2B 4WV1B 3EOAB 3HC3H 2CMRH 2A6IA 3DV4B 2PXYC 2C3XA 3P0YL 1RIHH 5EO9A 1AR1D 3NCEB 1WTGT 2GSGB 3BQUB 4KTDH 4UILL 1U8OB 5CMAB 5EU5A 5KVGL 1MFDH 2RJMA 2XZQH 4WUKL 3RUGE 4ODSL 2MCPH 1OCWH 1LEGB 1T1WB 1UEMA 2UWEA 3D2UA 2B0SH 4U1SA 5MEPA 1I8IA 4G8GB 5LG1A 1UJTA 2HKFL 2VN7A 3HI6H 1ADQH 1A7QH 1CQKA 3I50H 5D1QB 4M1CC 3UROR 3HZMB 2RGSA 4YBQC 4XCEA 2D7OA 1OQXA 2E3VA 2EDTA 4ONFH 4U1NA 1GGIH 1I8KA 3WE6B 1DDHA 3MCKB 1FH5H 1S3KH 4NZTL 4PJEE 3T3PE 1UA6H 4R7DB 4Y4KA 3S98A 5JR1L 1DQJB 1S7RA 2ICEA 3LCYA 3OXRB 4G9FA 2GTZB 1LNUA 4HIXH 5GSRB 4OJFH 3SPVB 5J11C 3GSRB 1FDLL 2PXYD 4FQIH 3MRCA 3HAEH 1D9KD 1T20B 1EX0A 5F7HA 2XN9A 1MEXH 1ZANH 4NN5B 1S7VB 3HZYA 2QQNH 2ZSVB 4IRSD 4HLJA 4PR5A 2MFNA 3VXTA 4YC2C 3LS4L 4JGUA 2J8UF 3OJ2C 4RIRB 3HG1A 5AAMA 1FE8L 4HIHB 1MCOH 2AEIT 4V1DB 4M1CD 3UTPE 4KQ3L 5ADPH 4B41A 5MI0C 4L4TE 4ZUUB 4PRHA 4YBQD 1D7FA 2IFFL 4RGOL 2R0KH 2CKNA 3IDIA 2CJUH 5I73C 5F6IB 4LSRH 3TBWA 4JRXA 3CH8A 4HH8A 2GKIA 1YEDA 4EJ1C 1BVZA 5I0ZA 1A9EA 2OQJA 3DJ9A 3DO7A 4XRCA 3NOIA 3EYSL 1A6TB 2CO6B 5EZJB 5D1ZA 3QIUD 1JPTL 3HFML 4UQ3A 3LH2H 2PXYB 2DQFB 3GDBA 3LN5B 1E4XI 1NGZB 1R6VA 1D9KB 1GOFA 1KBGH 4OM1H 5D7LD 3RY6A 3SO3C 1CIUA 4LCCC 3S88L 1W0VA 3QXUA 4NZDA 1KB5B 4KC3B 3PWVA 4IRSB 1Q94A 2Z35A 3PWPD 3O3AA 2VSDA 3L95B 5IB1B 2QQQA 4HJJH 5EIVA 1FG9C 3L9RB 5IWLA 3NCBB 5H35B 5K59E 3RVVC 2YMXH 5BRZE 2ZUVA 1S9XB 4QXWA 3HKFA 4YEFA 1CFNB 1YEEH 4CL7A 3NZ8A 3OF6A 1RHFA 3F7VA 4JY4B 4KTEH 4RA3A 3MRMA 3QNXB 3RWGA 1CFBA 3GKWL 3FHAA 2EE9A 1KIRA 4P3DA 2X44D 1WK0A 5T1MB 3BVNA 5I74C 3O9WC 5C6WH 1FVDB 4BQCA 5D96C 3T8XB 2VLRA 3QIUB 1RUQL 4P23A 3TM6A 5D72L 4GRMB 5JW4R 3VXME 1T0MB 3QFDA 1FAIH 2VABA 4QRQB 3QZWB 4H1LH 3GSUB 3N06B 4GS7C 3FFCA 5D7LB 4X4XA 1C08B 4AENB 3DETC 1UWGH 4I0CC 2EC9U 1EXUB 1PKOA 1QKZH 2V2XB 3AREA 5DUMH 4FQHB 1J7VR 2P5WA 3QUMA 1WF5A 5I2IA 1RIUH 3RVVD 2FGWL 1IT9H 1G84A 1F6AA 3GGWB 3FQXB 5SX5H 1MCFA 4G7VH 4CADB 1KCSH 5J7CC 1BQHB 1QQDA 5EB9A 4ZNEA 1YECH 3DVIA 2VQ1A 3LPFA 3FO1B 1JWMB 5EZLA 1KENH 5DEFA 1J0YA 1ODAA 5T1LB 2E5EA 5DMGD 1HCFX 5DVLA 5JOFB 3QWOB 1KTDB 3EFFB 5D5MB 3R1GL 2JK5A 3L6FB 2VLKA 2VLJB 4AYFA 3GBML 3BD5A 4U6XB 1JGDB 4L3ED 3H8NA 2CDFB 3UTTE 3ZE1E 1EFXD 3DETD 5SWZD 1VEOA 3RIFF 5JTWA 5CJQL 6FABH 4IMLB 3LN9A 4LCUB 4GG6A 2ATKA 5FECB 2K9UA 4N0CC 4HWBL 1A6WL 5DYOB 1IKNC 3SQBA 3TO2A 1VPOL 5HD8C 1JGLL 4Z7WA 2O93L 5C70A 4DUWA 1CLYH 1PAMA 3BKJH 4P57A 1KPUA 4OKVB 3O41A 3R8QA 1UB5A 4X4ME 2X4PB 5HHNA 2XYCA 4GH7B 4AH2B 1CT8B 3CUPA 3HAEB 4HUWA 4KUCF 1H15A 3W9EB 3QJFB 1VB9A 4MAUH 5K9JH 1YNKH 1EDQA 3GMRB 3JUZA 1N6QL 2XZAL 2EIZB 2BVQB 3ORJA 1XF5A 2B4CL 3CVHH 4TTDC 5HYFA 3ZTJH 1T89C 3VFRA 3D0LB 2BFVH 1KJMA 4GW4B 1TTGA 2H41A 4GS7B 3UZVB 1Q8MA 3UTQB 5JDSA 3T2OA 5JOPE 1BEYH 1Y0LB 3VXSE 2I9LA 3QNYA 3KPLA 1G7QA 4G8GE 4ZTPL 1VGKA 3A6CL 4CMHC 4ZFZA 3D3VA 5F1NB 3VI4F 1MY7A 3RDTC 5E0QA 2J6EL 1OAQL 4U1IB 5SWSE 2YD5A 2J7LA 3UYPA 5B39B 5F6HI 2A9NL 2A6IB 1NBYA 1A3QA 3DTXA 3EFDL 4HT1L 4XPAL 5EO9B 5E08H 2YPLD 3FOLB 5D70H 3MA9L 3P9MB 3O8XC 1B4RA 3CFBA 5B22A 1A2YA 5EU5B 1WFNA 3IDNA 1TETH 4Q9QL 5GJTH 1P53A 1KPVA 5E95B 4ZPTA 1X5FA 4X80H 1NFKA 1I8IB 2F53A 3LZFL 5DK0B 1LO5A 2YXMA 4NYLB 2YUWA 1JF1A 1MF2H 2BZDA 5DR5H 1I8KB 2XA8H 4DKFL 1K6QH 1DDHB 2WINB 3RFZC 2XOTA 3BOVA 3M1BA 4O2CB 1S5HA 3RWHA 1EZVX 4Y4KB 5HDBF 1S7RB 1INDL 2ICEB 3RDTD 3JTTA 3DUSA 2Z91A 1DANT 1LNUB 2JJWA 3SQOL 4EI5C 5BMFH 1MFAH 2XWTA 4Z77B 4J1UB 4PJ8C 2LAAA 5B21A 2Y4SA 3PP4L 4HMDA 3BPNB 1JHLH 5F7FA 1R3IL 3O45B 3DX9B 2YPLB 3O8XD 1DSFH 5I15L 3RGHA 5LGJA 4OCSH 3HZYB 4MHHI 1RVFH 3FQUA 5IHLB 3K1KC 1INQB 4H1LB 2DICA 5J6GA 4NFCA 5DA0B 4JKKA 4OBRA 1FNGA 4U1GC 3TCXA 5DJ2A 1AHWA 2A38A 4PRHB 4YH6A 2UZYB 4PIRF 4O5LH 1JYVA 1LK2B 4WHYG 5DD3L 2G2RB 3IDIB 3G6JA 4AY0A 2OM5A 1K8DA 1T7WA 3TBWB 4HUVA 1MLBA 5C09A 1DEEB 5EPMA 4CMHB 5HY9B 3CX2A 1F4XL 1A9EB 3G5XA 4PJBF 3Q1SH 1I85A 2EDRA 5GRWA 1EGJL 4EI5D 3A0OA 5K9OA 5KZCB 4HUKB 3WO4C 4RZCA 4PJ8D 4MA1B 3GMNA 4LMQI 1DJSA 4JHZA 1OGTA 1JE6A 3QFJA 3F62A 4K9EL 3TCLA 1WIPA 4HKBA 2BVUA 3OR7B 5T1DL 4Y16A 5CILH 4CMMA 1QFWI 2FX7L 5IBUB 3B9EA 4DK3A 1K2DB 4UB0L 1Q0YH 5F7YC 4Y7MA 5CHNA 1W0VB 1CFQB 1DUZA 5CAYB 2C26A 4Z7UF 4UOW0 3T0DA 2EIDA 2Z35B 1PDKA 3MLZH 1E27B 3NIGF 2C4XA 2Z31C 1KC5L 1PJ9A 1CVRA 5J6HA 2ZCHL 1ZOXA 2P8MA 1U8IA 3CSYA 4DKAA 1A4JA 3WFCH 3I6GA 4N8CL 3NZ8B 4LEXH 2ZCLL 3DROA 1PG7L 3PWPE 4FZEH 3RWGB 3WSQL 4PJIE 4MNHB 3CX5J 4PJ7A 3ZKMD 1ZTXH 4QNPF 4I3SL 4ERSL 1KIRB 4LCWD 1MFBL 4G8IA 3O6LH 5IVNA 2H2SC 3BVNB 2AJUL 1YEGH 3FMGL 3GNML 1ZK9A 4K71B 1FFQA 1E28B 2MHAA 3BP4B 3CXHK 4MAYA 3S35H 4PJ8B 3CFCH 4Y5YA 4X98A 4LRNH 3EIFA 1CFSA 5DMJB 1MCDA 3BKMH 5C0GB 4X4XB 2V2WB 1IC4L 3CVHB 3TESA 5EH1A 1EO7A 1D5IH 5MERA 3AREB 4X0KB 2Z31D 4IRJA 2P5WB 3QUMB 4HG4J 5I2IB 3JWDL 3GKZA 5EN2A 4ZUTB 3RUGA 4WW1A 3THMH 3CZJA 3WJLC 3JV0A 2VE6B 2CLZB 1G6RA 4XI5C 1F6AB 5TE4H 4Z0BH 1DBML 5EUKB 3RAJL 1X44A 4UMGA 5D2LA 1GJIA 2GK0A 4A2MA 5J56B 4JRWA 2H2SD 4LCWB 1JNNL 4ZFGH 3WL9A 2VXVL 4XPFH 3L3KA 3PF2A 5HSFA 1AD0A 1JWUA 5DEFB 4PB9H 4PJEA 5C86A 1VESA 3BPOB 4OCNC 4JHBA 4YHPB 5DJ6B 1PQZA 3QIBA 1A1NA 1KGCD 2MNUA 2V5YA 4P0DA 2FGZA 4X6BA 5E99L 3W9DB 5FF6A 4ZTOH 4HKJB 5TJWK 2V2TB 4G6KH 3IS0X 4L1HA 3INUH 2FHCA 4HPOH 1MCJA 3PG2A 3TYGH 3CDCA 3CC5B 5FK9A 4GG6B 5D8JL 1RUAH 5BZDB 2KZWA 3H6JA 3MOAL 4L3EE 3TO2B 4GQPH 4DW2H 1DFBH 4MJIE 4UT7L 3P3YA 3UTSD 5SWZE 1LDSA 3E0GA 3AMKA 4P57B 5ADOL 2ZG3A 1KPUB 4GLRI 3O41B 1BZ7A 2G5BB 1UB5B 4FQCH 4HUNB 3V2AR 1DEDA 2NMSA 5HHNB 4DVRL 1TTUA 3QDMD 4ZO9A 4NO2B 4F33A 1TTFA 1XGQB 3CUPB 4IJ3B 4HUWB 3LHPL 3KWWB 3DARA 4YIQA 2I07B 5IT2H 2MTPA 2AABL 3GMLA 4YDKL 5TGBB 3EYQC 2X4QA 4MXVF 1CIDA 4S0SD 4J6RL 3PDDA 1FC1A 1N0XH 6CGTA 2GSIB 4RQQB 3VFRB 4X6FB 3VG9B 1FIGL 2PW1B 4NWTH 4DN3L 2I9LB 3QNYB 1RJLA 3LS5L 4KHTL 2H6PA 4P2QD 3D3VB 1IBGH 3KPPB 2JB5L 5CCKH 5HVWA 4FQLH 5GISL 3NA9L 2VLLA 4NOBA 1K9TA 3BEWA 3WEXA 4YQXH 3RGVD 3DTXB 1GGYA 5ACLA 2AXGA 1MHEA 4P3WA 1WAAE 2DDQH 4DEPC 5B4MD 5T33H 5BRZA 2HJKA 3L3DA 1IZJA 5FUCC 1BZ9A 1LP9E 4FTVE 3N1QC 5F7WC 3IDNB 5I1DB 2X1XR 2X9WA 2VLMD 4U1JB 5J13C 2NX5D 2R4RH 3NFPA 1SJEB 4O51B 5EUOF 1KPVB 5HHXL 1OAXL 3GZKA 1CS6A 3MV11 2V5TA 4IIQC 3BZFB 4LSVH 3UJJH 3EYQD 3L3JB 1MCNA 1PZUB 1R0AL 2DYPA 1LO5B 4NQDA 4TOYH 1FGNH 4D3CL 1AIFA 1SEBA 2IH1B 1KSRA 1FL6B 4I0PC 4NNXB 1JF1B 1I3VA 2CXKA 1RZ8B 2YC1A 4UTAL 3DBXA 3DXAA 5KTEL 3FKUS 1S5HB 3RWHB 1HK6A 4P2QB 4RAUB 1M71B 4NJ9H 1A6AB 1NFDF 4P9HH 3WXWL 1UACL 3DUSB 1IM3B 4UI2A 2CIKB 3MLTB 4P46A 3GMQB 4PJ5D 1X5ZA 3VD9A 4LIQL 3FO0H 4NNYB 4NO3A 2H26A 3LKOA 3RGVB 1XF4A 1CBVL 3I6LE 4YFEA 1V5JA 4XAKD 2D03H 4ETQB 5LQBH 3OAZK 3P4MA 1CLOL 1T7VA 4X6CA 3NVQA 5DHVA 4L8CB 5I1HH 2EDOA 5FAAA 3ULVF 3KPQB 3B2UD 3MXVH 1J1OL 1EUUA 3F5WA 4YDIL 5C1MB 3NH7H 1U3ZA 3WUWA 3UAJC 1QZ1A 2H8PA 3HI1A 2HFGL 3ARYA 3VFGH 5J6GB 3NAAL 2EDKA 3BPCA 1ORSA 4XVTL 1T0NB 2P8LA 3V6BR 4GXVH 1L7IL 3CDGB 3SGEH 3BXNB 5FCUH 3STLA 5E6YA 1M05A 3MRPA 4QEGA 3WLBA 2A77L 1G1YA 3P0GB 4HUVB 1MLBB 5C09B 5EPMB 4IDLA 4Y5XA 1OTTC 1ZT4A 4L9LA 1N5YH 3V5HA 5AWNH 4NQUA 5K9OB 2GT9A 3U7WL 4YHMH 1AE6L 3B8YA 1MCRA 3TA3B 2IQAB 3TCLB 5JQ6H 5TFSL 1EHLH 1IAIM 1KV3A 3MOBH 1I9IL 4YK4B 1O7VA 3BJLA 3HZKA 1YYLL 4LHQB 3GMPA 4KKCD 3U4BL 1DBJH 2IPUG 2WNGA 3P30L 5FGCE 2WBJC 3HS0B 4NQCD 2J12B 5CHNB 3NCJH 5DJ0A 3GMMB 5J13B 2BMKB 1NEZB 3UAJD 4ZUWA 2DKUA 3NACH 5DJAA 1VEPA 3RWFB 4JDZB 1IEAA 4QOKD 4F7TB 4RDQG 3KLAA 5J6HB 3LEXA 5TDOB 2P8MB 4U2ZA 3V7AE 1U8IB 2VAAA 4LRIC 4P9HC 4LDLB 5GIRA 1U8NB 1XR9A 3PL6A 3MMEB 5I76A 1AGFA 4AEHH 1MWAA 1I7TA 1RZJL 3BO8B 4D0DA 1OTTD 3LMJL 4JFPA 4Z7QF 2AKRA 4G8IB 1BLNA 3FT2B 2IMNA 3IT8D 1WITA 5FIEA 5I9QC 1P7QD 5DRXB 4XNMB 5T3ZH 2VC2L 2EYSA 3LY6A 1NMCB 1P6FA 4NN7B 1CFSB 4GAGL 1D5ZA 5AUMA 4LASL 2PUQT 3MLUL 2WBJD 4HXBL 3UZQA 3VRLE 4CUCA 5FM5M 1DBBL 4NQCB 4JQVA 1KYOK 2CIIB 4OCYH 5BZWA 3CLFH 1A6UH 5MERB 4Y19A 3S36L 3WNPA 5HHME 4Z0XB 4IRJB 4OLYH 4QOKB 3RWIA 1AQDA 3IDMA 4YPGA 3K81A 4D94A 4OCXH 4JM2B 5EN2B 2XWBA 3KPRD 2EDHA 4XVJL 4CVXA 2OJZH 4YXHL 3S5LB 2DQTH 4K3JH 4OZ4B 4J3TA 2I25N 4HF5H 5CP7A 3ULUH 4ELMA 1SBSL 1KOAA 4OD3L 2WLYA 3V6ZA 2Y07H 2XKSA 3GSQA 2A1WL 3KHOA 1JWUB 1P7QB 4JPWH 4YHOH 1X5XA 3QHZH 1EAPA 2R1YB 4HZLB 3QSKB 2BDNL 4PJFA 1BOGB 3IDJA 2HFEA 1HWHB 2FL5A 3BKYL 5KSBF 1CI5A 1PQZB 4X6BB 1A1NB 5FA4A 1CLZL 4A6YL 4RAVA 4UT9H 5FF6B 3QG7H 3OB0H 3AUVA 1R5IA 2GAZA 4TUKH 4E0RA 1F2XK 4AT6A 1LWRA 5CJ8A 5FK9B 5CIPH 4NO5B 1QLRA 1NAML 4NRYB 1A6VL 1V3MA 2ADGB 3ULSA 3QQ9D 1KGCE 4XX1G 3GB7A 5HGAA 4NCC2 1IGJA 4BFGA 2K1MA 1M6OA 1B2WH 2EXWC 3QCTL 3SBWA 2EE6A 3NCCB 1DZBA 3LQAL 1AC0A 4F33B 5FYLE 2CDEB 2FIKA 3IGAA 5I1CL 1G6VK 4OFVA 4M7ZB 1BBDH 3UTSE 4YIQB 2X05A 5GQBA 1JYWA 2R4SL 4JO1L 5CEZH 1C16B 1HOCA 3TO4C 3ESVF 4EI6A 4PGCA 1BP3B 3QDME 5EOQH 3Q5OA 4JPVH 4OF6A 2RCSL 3I3EA 4MYWB 1MHCB 2H9GB 1RK0A 3HCVA 2NY0C 3WNLA 3F65A 3NIFF 1KF9B 1NGXA 3GIVB 4ZPVA 3OAUL 1X6LA 2Y7QA 5I6XC 1JNLH 1T1XA 5LWYL 5HGDB 1FFOB 4LARH 2DQDH 3BDYL 3ULUC 4OZIF 3WEXB 1U8PB 4ODTH 1CE1L 1P4LB 3DX8B 1Z2KA 1I1AB 3L1OL 3MRBB 5T3ZD 1BFVL 4R97C 4OZFA 1XF3A 3M8OH 3FN9A 4QO1A 4XP5L 3L3DB 1IGYA 1TZHA 2HJKB 2HWZL 1VHPA 2ZZUT 1BZ9B 1JBJA 3OAYK 2FX8L 3HNSL 1QFUH 5B8CA 3NFPB 2R29L 3O2VH 2GITA 1EERB 3EYOB 3DUHA 3MR9B 3CZFB 2LABA 3PV6A 3TWCL 1OB1A 4GO6B 4WVRA 4HFUL 4NQDB 4XPTL 2B5IC 3M17A 1OL0A 1AIFB 5I1EH 3ET9F 3ME0A 1SEBB 1KN4H 2VLME 3PGDA 2NX5E 3HUJB 1HHGB 3I9GH 3TH4T 1AD9B 1AQKH 2NY0D 2EYTB 1A3LL 3DBXB 2VDPL 3DXAB 1GGTA 4G3YH 1ZT7A 3SGDH 5DRWA 4X5LA 2B1HL 2VO5A 3VFUB 3VFVB 1FLTX 1X5HA 3GO1L 1JI2A 3RTQA 4P46B 2CR6A 3O4LB 3ZYZA 3ULUD 3VFSB 2OBGA 4NO3B 1XGUA 2HVKA 4LQFL 3RZCC 5ALCL 4O9HL 2OTUB 1CR9L 3VGAC 3VD4A 5EC1A 1IL1A 4X6CB 2JKXA 4LCCA 1Z5LA 5DHVB 4PJ5E 4N1HB 3HE7C 1I4FB 4AL8H 3ARZA 5F9AC 5CD5D 4JQXC 2VZOA 1A7OL 2H8PB 1F11A 3GSWA 5LBSL 4XAKE 2D9QB 4HIIA 3BPCB 1MCHA 5D6CB 4PJ9A 4B7IA 2P8LB 5FUCE 2NQCA 1SY6L 4OAWB 4H5SB 4AIZB 4YHYC 3PWJB 4QXGH 2ADFL 2NY7L 4CVZB 1XF2B 4IMKA 3ZDXE 5FEBA 4ONHA 3VFMA 2GTWB 1G9ML 1M05B 3WLBB 2PCPA 2ZOKB 4RISL 3VXOA 2XTJC 2NLJA 1XGRB 2BX5A 4I48B 4MLIA 1IQDB 3O9WA 4R96B 1GHFH 2OR9L 1ZT4B 1F13A 3V5HB 4ODUB 2NY4C 1JK8B 1NJ9A 1D5XB 2A6JA 3DSFL 2K7PA 2IBZX 4GKOA 4MDJA 1CTOA 2GT9B 3VFPB 3RZCD 1YNLH 5AD0B 1UXWA 1VFUA 3GSNA 1H3PL 3MUHL 3HZKB 4R2GB 5DJZB 3U46B 5CEZD 3GMPB 1EFXA 4MJIA 3L3HA 3IXAA 5SWZA 3HE7D 3UJTH 4LEOA 3X12B 4RGMC 5DJ0B 2Z92A 4YGVB 4GMTL 4KV5E 2FLRT 3FB6A 4GJTB 3FOMA 4U1LA 3EYVB 3IKCA 1Y18B 3KLAB 3RI5F 2M8XA 3L5WA 3H9ZA 3N50A 4GAYA 2G60L 4NQCE 3TBTA 1EHNA 1N5AA 1NH6A 2DLFL 4S1QH 3DWTA 5AAWA 4QHMA 1QVOB 3X3FH 4LVHC 5GIRB 1FPTH 2XTJD 1XR9B 5ESAB 1BBJA 2FJFA 3DGGA 3VDBA 2O5YH 4D0DB 2AKRB 1BLNB 1HKFA 1R24A 1JPST 2NY4D 1IJ9A 1LE5A 1XEDA 3F7YA 1BQHG 5E2VL 2VB5A 5ERWB 5KVFL 2NPLX 3QHFL 3F7RA 2AJ3A 4NKDB 3EGSA 1IKFL 4PY8I 1DANU 1D5ZB 4QF1B 1XIWC 4XVSH 5EFIB 3GIZH 1UZ6F 3EDFA 2QJDA 3HLAA 4QHLB 1KEGH 3P9WB 1JWSB 2QQLL 3WIHA 1U2CA 5DUPL 2EKSA 1WAAA 4ELKB 2A9MH 3ARDC 3NPSB 1IKNA 2A73A 5IHZA 4FTVA 1AQDB 4ZXBC 3O6KH 4I4WA 1EEYB 1PGRB 1CXIA 4M8QB 4OGYL 3ARPA 4U33A 4CVXB 4K3EH 4MA8H 4HIEA 2VRAA 2OL3H 2Y5TB 3IFLL 4I5BA 1LQSR 1I1RA 5CP7B 2C3VA 4M1DL 1WZKA 4QY8B 3V6ZB 3KPRE 1RQ5A 3BEVA 4UAOB 3RJDA 1JPSH 2WWKO 2CK2A 1U95A 1EAPB 4ZQKA 1OW0A 1IAKA 3SY0B 5F70A 1MQKL 4PJFB 3IDJB 5DJDB 5FCSH 5FA4B 1W0WA 3CNKA 3E8UL 2OXHA 1A7RH 2E7MA 4KVCL 1JFQH 5FYKE 5SV3A 1R5IB 2GAZB 2YD9A 5DI8A 4E0RB 1C5DB 2X41A 4AT6B 5DVMA 1NLBH 5EU4A 4YBLC 3ARDD 4G42A 4JGJA 1YEIH 5E5MB 4ZXBD 2YZ8A 1F6FB 3RX7A 3ULSB 1MQ8A 3AXLA 4U2YA 2AEWA 1ZHKA 3JUYA 4HIJA 2GJZB 1FFPB 5DMYA 3T0ED 2WBWB 2NZIA 4HS8H 3KJ6L 3WFZA 2AJYH 3O4OC 2BXZA 4QTIL 1JZ5A 4R3SA 3AM8A 1NL0H 1QYGL 4L3CA 3HPLB 3PQYE 5C0IA 4GT7A 4CN6A 1HOCB 1HYSC 3EJYC 4PD4K 5CP3H 4GQ9L 1EMTL 4U1MB 3NCMA 1C5BH 1UT9A 3EFDH 4IHOB 5A1AA 2VDQL 2IAMC 3EDJA 3SDXE 1NGXB 4ZPVB 1KCVL 5FO7B 5GJSL 4HGWA 3IVKA 1J8KA 3BE1L 1Q1JL 1FG2A 2W60A 3HUJE 1V7NL 4LKCA 4ZXBB 5GGQH 3IRZA 4BK4A 2EH8H 2NNAA 4Y8DC 4U3XA 4XPGH 3TC9A 3F6IA 3U2SA 5CEXB 3I75B 3T0EB 3GSXA 2ID5A 4HPYL 3PDGA 4OGZA 2J8HA 3LDBB 1TZHB 1IGYB 4KAQL 4NQXA 5D71H 3BGMB 3H42L 5K9KA 2FD6L 1NCWH 4WDIB 5B8CB 1XF1A 1MREL 4PRPA 1EK3A 2AJXL 1OWRM 3PIQA 1ZHLA 5IMKA 3H0TB 1MIEL 1S7WA 3CSBA 3PV6B 2AJSH 4RSVA 4H1LG 1OB1B 2FHBA 1HYSD 1R3KA 1OT1A 3EJYD 3TIEA 15C8L 4HDIB 4HQQH 1XCQB 2KDGA 3VWJC 4LLUB 3PGDB 3GJEA 3PP4H 5BS0D 5CJOH 1IFHL 4WFGD 1N6VA 1QRNE 3LV3B 5ESQA 5HVHC 5GRUH 1YPZE 2P43B 3MUZ1 3PWLA 1BF8A 2IAMD 5I15H 5C2UB 1ZT7B 4X6DF 1E0OB 1PEZA 4EUPA 3KPMA 4E5XA 4Y4FD 5BVJA 4BQ8A 3MLPA 4EDXA 4X7SH 1IC7H 2HVKB 3B4NA 4M7KH 3NABL 5EOCL 2PYED 4ZO6A 1U8QA 1FVEA 1SJVA 4QHUA 4HH9A 5IKCA 1VA9A 1IL1B 3LKNA 5EC1B 2LAGB 3FQRB 2DD8H 3ULUE 4O4YL 4EDWL 5IBUG 1JZ2A 2G9HA 2IPKA 5IF0B 3QDJA 3U0WL 2SEBA 5FUZL 4DGIL 3BP5A 2Z31A 4D0CA 4ZYKA 3GSWB 1S78C 1V8HA 5EU3A 4JDTH 4ZSOB 5J1AA 1EGJH 4PJ9B 4UDTA 4F8TA 2D7NA 1SYVA 3VWJD 1NC2A 2D7MA 5BS0B 4G43B 5C0RH 3ILPB 4NHUA 3WFBH 3ROLA 2YPKB 1J1XL 2OXGA 2IAMB 2WV3A 1SVZA 2G75A 4MWFA 2DMBA 4Y4FB 4MB3A 2LV4A 2A6JB 2AGJH 4M4RA 2O5XL 1U3HC 1I1FB 1G6RL 5B3NA 1KB9J 2RB8A 3GSNB 5FM5O 4YXKL 4IOIA 3IXAB 5EZOL 1MRFL 3SKMB 3ARQA 3ZDYE 1HZHL 3OPZL 2Z92B 1T1ZB 5FYKU 4XWGL 1QLEH 4BZ2L 1S78D 5T5FH 4KUCD 5CEZE 3SO5A 3MSPA 2VN4A 4XCCH 5C07E 3HMXH 3WJLA 3Q3GB 3DURB 3IFOB 4W81A 4K07A 3TBTB 5GHWL 43C9A 4LSSH 1CICC 2B1AL 1J5OL 1BBJB 2FJFB 4JKPH 3RIAK 3BYYA 1AGDA 1FO0L 1OAZH 4JHWH 1MPAH 1WEJH 4JCMA 2Q86A 1HDMB 4NP4L 3TN0C 2MPAL 1LE5B 4UIMA 3HA0A 1FQ9C 4G7YL 3MLRH 4XTRC 1ZHBB 2C1OA 1U3HD 2XTJE 3UC0L 3K8MA 2AJ3B 4JFFA 4OZGF 1A14H 3BKCH 3X3GL 1OAUL 1IGIL 4JKLA 5IHUL 4W6WB 2RAMA 4MXQC 4H25A 3QEQE 1XGTA 3V0WL 4M43L 3K1DA 4OF0A 1S7TB 5CLWA 1YEHH 3IJSB 3L7FB 4K9EC 4RDQF 3EDDA 2YWYA 2XV6B 4FFYL 1ITBB 3GK8H 4YE4L 3ROOA 5IHZB 1CXKA 4OQTH 4LAJH 1KLFA 3BIAX 3T3MF 1DQQB 4MCZA 2ZPKL 5E6IA 3WIIL 4OGXL 3MXWH 3V6OC 5F88B 1D6VL 1TJGL 2DQGL 5ILTL 4HEPG 4QRRD 4XAWH 2Q76A 4MHHG 2VDOH 4Q2ZA 4I5BB 4C58B 3KDMA 4RMUA 3AU1B 2GJ6A 5IVXA 1I9JL 2NX5A 1MLCB 5H94A 3TN0D 1YEKH 3W39A 4ZFOA 1IAIH 2BERA 5IESH 4XTRD 4WCYL 1O5DT 1NANI 1U3HB 2DMKA 4QRPD 3D9AH 2EDXA 3IFPA 1IAKB 1Z3GH 3DRTA 1J1PL 4L8DB 1T3FB 5HYQB 3NTCL 3C6SA 3GRWL 1MOEA 2Q6WA 2H1PH 4F57L 3MRQB 4J3UA 2BC4A 3TVMA 1JL8A 2AK4E 4NFBA 4KJWC 5EU4B 2FJGA 3GUTA 1GVIA 2Q3AA 1W72A 4CW1A 1FIEA 2NYYD 5E8OB 3MYZA 3MRLA 1LO3H 2CRYA 4NPYB 5HHQA 4I18C 4KU1A 3GSVA 5F93C 4HIJB 2DLGA 4JY5L 3EHBC 4RFEA 1YMMD 3VXPA 2Y6SC 3MJGX 5HJ3A 4ODXB 4WHDA 1HXMA 3SDYH 4K7FB 3MZGB 4R3SB 3V8OA 2J8UE 2X89A 2AS5M 5JXEA 4IIQA 4OLZL 5FDWA 2JB5H 3HNVL 4ALAL 3IS1X 4AK1A 3MC0A 1FSKC 3JTSA 4I0PA 4JO4L 3V5DB 3TT1L 5AZEL 1KJ3H 1G9NH 5FGSA 3HC4H 5TE6H 2VISA 4ISVA 4MXWH 4PRIA 1N3NB 1B6UA 3U4EA 3QHTC 3IVKB 1J9CT 1F4YH 1ZA3B 1IVLA 4UV7L 1JZ3A 1U8JA 1FG2B 2W60B 2ZWLT 1CWVA 4MD4B 1NLDH 4JPIB 4DN4H 4TPRL 3MLVL 3RVXC 5KVEL 4OLVH 1QFOA 5DD1L 2DLHA 4JR9L 3ALWA 1ZA6A 3LKQA 5F44A 4EN3D 2W91A 1QEWA 1BQLL 1INEL 4FZ8H 5I8CA 1J12A 4NQXB 4FRWA 4XXDB 4HX1A 4YFLF 1P5UA 3N1PC 4BH7A 5GGVH 1S9WB 4PRPB 3GFUA 5JOEA 3QUYB 2I5YH 5IMKB 5FHBL 2OR7A 3H3PH 1S7WB 1L9NA 4NCC1 3W0WD 3ARGC 4O58L 1GH7A 1NGYA 1F45A 1S9VA 1R3KB 1R3HA 3QG6B 1Y6KR 1UWEL 3FO2B 3RY4A 3MRDA 1CF8L 1YYMH 3GJEB 2APBA 4PV9A 1IQWL 4ZSOE 1CLOH 3ALXA 2HKHH 4HHAA 3WYRA 2X1WL 3C8KA 3FN0H 3ARVA 2ATPA 4EUPB 4ZS6C 3KPMB 5HDLA 4WWID 4LFHD 4ODVH 4YDIH 4E5XB 1DUYA 4U6YA 3D69A 2P24A 5BVJB 5BS0E 3S37L 3RVXD 1R3LA 1KIQA 1U8QB 1FVEB 5ISZD 3B6SA 1LO4L 4R4BA 5ACMA 4EN3B 5IKCB 3U30C 4D2NA 2JELL 5D7SL 1VADA 4GBXA 1L0QA 1NCAH 3MTRA 4KJPC 3MGOA 2G9HB 2CQVA 5TE7H 2PYEE 4ZAKC 3QDJB 1G9NC 4PV8B 3H9SA 4D0CB 4F7EA 2GY7B 5CEYA 3FQWB 5J1AB 1NCCH 3W0WB 1LO0L 5A2FA 4UDTB 2VL4A 3KPRA 4LRIA 5A3ID 1SYVB 2R69L 3PXJA 1R5WB 1OP3K 1FRGH 1YQVH 1RMFL 2COQA 2AEPL 3OTTA 3ULVH 4NT6B 4A2LA 1WWAX 5IQ9A 2E7LA 2UVFA 4WI7A 1ED3A 4S11A 3B3IA 2UYLB 3V4VL 1EEQA 3S9DB 1EPFA 4ZS6D 1ZLWK 2X9YA 5MENE 2IH3B 1HNGA 4WNQB 5I66A 1KCUH 3OX8B 4HWZA 4M9OA 1KACB 3ARXA 4IM8A 2R0WH 3CFIC 3GJFA 5I8EA 3B9KC 5F8RC 5IB5A 4KKAC 3P11H 2DLIA 4F15B 5ISZB 1QOKA 4LSTL 3BT2H 3QEUB 4F37K 1DVFC 4WI6A 4OTXL 4KJPD 3MLSL 3BD3A 4FHBD 4APQC 3TIDA 2VDNH 4CDHA 5BV7H 4I3GA 2BNQD 1I1YA 1TQCC 1PZ5B 2APFA 1ETZA 2E6PA 1RZFH 5EZIL 1GGCH 2B39A 4KK9C 4XB8A 1DQML 4O2EA 2PETA 1FNLA 3PQYA 5E5UB 3SE9H 4AEIL 5DK2A 3IXTB 4L4VD 4QRUB 5D1XC 4FQXB 5TPWL 2QHRL 3QA3A 2DM3A 3QDGE 5IM7B 2NY3C 1ND0B 1KTLA 5EWIL 5IJVA 1AGDB 1WWBX 3QULB 2Q86B 3MLWL 2XRAH 3BWAA 2DQIL 3B9KD 1JRHI 4RWYL 3SDXA 2C1OB 4YPJA 3P4LA 4KKAD 4L1DA 4JFFB 3QNZA 1JP5A 3P9LB 2KKQA 5D9SB 1KELL 1DVFD 5F9JA 3C09C 1KB5L 1C5CL 4XP6L 1P2CA 1XGTB 2CUIA 3TBVB 2CO7B 3VI4E 3QP3A 4APQD 4FABL 3QIWD 1T83C 5GZNC 2HTKD 2AXFA 3Q6GL 3IF1B 4XBPB 3RVUC 2VXQH 3OWEA 2BOBA 3ULVC 3ROOB 1B88A 2J3SA 1P4IH 2FIRT 4GRLC 4MCZB 3BJ91 5E6IB 1OAYL 4O00A 3D39D 2KPNA 3ZT7A 4QHKI 5E70A 3U0PA 5D1XD 5JIHA 2FECI 2Q76B 4NKQB 5F1KC 4A6YH 3JV6A 3MV8D 2GJ6B 5C6TH 5BCAA 4HKZA 4EKXA 2IANA 4MQ7A 3MRGB 2NW2A 2IG2H 4MQTB 1QRNA 4BZ1L 4ZFOB 2Y36L 1YPZA 4JN2B 3TO4A 3C5JA 5A2JH 1NAMH 4QRRE 5D7JC 1HKLL 4B0MM 4HCRA 5KG9A 4U6VL 1PX4A 4P2YA 5F9OL 3DRTB 2YN5A 4RX4A 5D5MF 1RUMH 1ZAGA 3C6SB 4MJ2A 4XBEL 2Q6WB 5AYQA 5BV7C 3ARBA 3B5TA 2FZ3A 4LU5H 5DD5H 3TVMB 2EH7L 5HDBE 1QBMH 4Y4HC 5GZND 4QRPE 2FJGB 3QIWB 5DWUL 3RVUD 1EJOH 3GUTB 3ULVD 3UMTA 4KKLC 1HIMH 4GSDH 1U8MB 2F58L 4OT1H 4CW1B 2VXTL 4JM4H 3MRLB 4GRLD 1QO3A 1LO2L 5GS3A 1GC1L 4RFEB 5F3BB 2E27L 4RGNC 3VXPB 5DC9B 3D39B 5IMLB 2XQYK 3HC3L 4KGLA 2CMRL 2ENYA 4FA8A 4WRLA 1RIHL 4LKXA 3T77B 3VGHA 4NRZA 2J8OA 5EO0A 4G8FA 2NY6C 1MCPH 2DMCA 4CN1A 3HMWH 4KTDL 3V6OE 1NMAH 1YMME 2FBOJ 4N0YH 1MFDL 3N1FC 3MGTB 2XZQL 4M02A 2JCCA 3BI9X 2MCPL 3RWCA 3EJZC 1OCWL 3SGJC 4EXKA 2DF3A 2B0SL 2NY2D 3JTSB 4LPWA 4N0UB 3VXRD 3HI6L 1ADQL 4PG9A 4M5YH 1ZHNA 1A7QL 3I50L 2AQ2A 1UADC 1AC6A 3LIZH 4PRIB 3BD4A 1A64A 4Y4HD 4ONFL 1CU4H 4PJBE 1DBAH 1WIUA 4DGVH 4OSUH 4GKZB 1FH5L 3U4EB 3V0VA 4HUUB 1S3KL 5FOBA 3L3OA 5GS1C 1U8JB 1UA6L 3RPIB 1EVTC 4MSWB 4HIXL 4RGND 4ZD3H 4OJFL 2CKBA 2RQ8A 1XH3A 4PJAB 1HEZA 1ZA6B 3LKQB 3PWNA 4DKDC 5C07A 4FQIL 3TH3T 2FRGP 1QEWB 3IU3B 4M93B 5JORA 5I8CB 4MJ4A 3HE7A 3CXHJ 5DRZA 4Z7UE 4BJLA 3C08H 2NY6D 1TXKA 3QWQB 3NIGE 1MEXL 4BH7B 1ZANL 1X4YA 5SX4H 2QQNL 1CN4A 5IMMB 5J0BA 3WUWG 3EJZD 3VXUA 1S9VB 3LQAC 5F1IA 3UBXB 1R3HB 2NY2B 5E8EB 1MCOL 1FJ1B 3BFOA 4NM4L 5ADPL 1JPFA 5ALCH 4I3RH 4WU7A 4QNPE 5F7DA 2R0KL 1WLHA 3CGTA 2CJUL 3M07A 1H8SA 3TLRA 3UDWC 5L2JA 2BCKB 4LSRL 4HS3A 1PG7X 4KDTA 4JQIH 1G7PA 3QEQA 1DUYB 3D69B 3DI2B 3Q2CA 3H3KA 2H32H 3CDFA 1S7XA 3SE3C 1R3LB 3DMMC 1MVFA 4LVNB 4HK0A 4LCIH 5HHOD 1H0DA 2HT2C 1KIQB 1CCZA 2J2ZA 3WJJC 1EO8H 4JY6A 4R4BB 5HDQL 1ZS8A 3KLSA 2ADFH 4C4KO 2YUVA 4I77H 4ONOA 5I71C 1ZT1A 1VADB 4GBXB 1KBGL 4OM1L 5I1IH 4S1DD 2ICWJ 3WCYA 4KMQA 4C55A 1ES0A 1EHAA 1CDUA 4J4PA 5IROC 3H9SB 1CDBA 4F7PA 3BGFC 3QR2A 1ZVSB 2BVEA 4JVWA 5DJXA 4HJJL 4OLEA 3U4AA 3MA7B 2Z93A 1LEKB 3IJYA 2YMXL 3OGOE 4OGAC 3X11B 1HNFA 1FL3A 2FO1A 5C0CA 1YEEL 5IQ9B 3NA4A 3MLYH 5FGBC 4KTEL 4XNZC 5DGRA 3X13A 3MRRA 1OLLA 3N9GL 1JGEA 3O2WH 3U1SH 4AIOA 3MFFB 5I66B 2AK4A 1WV7T 2R2EA 2Z4QA 3DMMD 1NKOA 3GJFB 3QUKB 2FX9H 2HT2D 1CGYA 4P2OA 5IB5B 2AV1B 1XIWA 1T7XA 3S96B 1J10A 1JVKA 2P8PB 1KIPA 5C0BD 3O2DH 4KY1H 2Q7YA 1IGMH 3VCLB 1OWWA 2R9HC 4P48A 1UWGL 4X5WA 2QQKH 1QKZL 4MQXC 4HMCA 4NM8H 3SDAC 5DUML 3MRFA 3B5GA 4O2EB 2FBJL 5IV2A 1RIUL 2I9TA 5DJCB 2VR9A 3MZTA 4OGAD 5DK2B 2VQTA 3NZHH 1F42A 2FH8A 5E4EB 3V6FA 1B6DA 5CJXC 5T3XH 1IT9L 3D18A 3VGDA 1KTLB 2BNQE 4J12A 3QAZB 5IJVB 4XCFH 1AGEA 4K94H 4TNWF 3C60D 1P84J 3D5OF 3F8UB 4WUUD 3U6RA 2A83B 4G7VL 1A1OA 5HVFB 3ZYJA 1KCSL 2K3TA 3LKSB 1ITCA 4MXVE 1A7NH 4L4VE 1YECL 1G9MC 4R4FH 4WHYH 4HGMA 1UWXH 5HGHA 1KENL 3QNZB 1RK1A 3G9VA 5K9QG 5HVGB 1DL7H 5F9JB 1QBAA 5C0BB 3CFDA 5IW1A 3KVQA 1P2CB 5DDHA 1TENA 1AO7E 3K2UH 2UV3A 5DD6A 2BHYA 4CU7A 2BOBB 6FABL 3QJHA 4MQXD 3SDAD 3OKOA 5C2BH 3KJ4B 2ESVD 3RU8H 2ARJB 1F3JA 3OJDA 5SWQA 4Y5VB 3AB0B 4JFEE 5J9PA 3C5ZD 1BFTA 5T1KB 1CGXA 2WM0A 2O5ZH 1CLYL 1T04A 4OD1H 3BKJL 4O02L 1CVSC 4YHNB 4MNGB 3MO1A 2PO6C 3UTZB 5EUOE 3SE4C 1GZQA 3C60B 3MYJA 2IANB 1UJ3C 4Y2DA 3IRPX 1LVEA 3D39E 3R06B 3C5JB 2AEQH 3T4YA 5ITFA 4MAUL 5K9JL 2BY0A 1MJ7H 1YNKL 4F7MA 1J8HD 5KG9B 2BSRB 3BDXA 3MV8E 1ZSDB 1QTYT 2CK0H 5E1AA 4NSKB 4OZIB 3ARBB 3CVHL 3MJ6A 3VRIA 1B3JA 4FQ1H 4XCYB 4X7CC 2BFVL 3OGCA 1NFDE 5C8JA 2LFGA 4C54A 2VSCA 4KI5D 1BEYL 4N0UE 4GG6F 3LN4A 3P77A 4TVPH 4DCQA 4LHUA 5A43C 2YD6A 1QO3B 4K94C 2PYEA 3NGBB 3IAGC 2CLVA 2VL5B 2N7BA 3FO9A 1NCUA 3WN5C 3C5ZB 5GGSA 3T09A 2JJSC 3CFKA 4OZHB 4G9DB 3MJ8B 4LPVA 4HWBA 3VH8A 3ULVE 3ZHLA 5E08L 2PO6D 3PGFH 5JHDE 5D70L 4OZFG 4PREA 5FO8A 3VFNB 4KROC 1YDPA 5I17B 1TETL 5GJTL 1KCVH 3EAKA 4TQEH 4XCNB 5ALBH 2ZUTA 3SDDC 2JCCB 4M6AA 4XC1H 32C2A 3CPLB 4X80L 1RZGA 5MENA 1J8HB 4QKXB 2QSCH 3LEVH 1HHKA 5I18H 5ELIA 5FB8B 5HI4C 4NQSA 1PFCA 2UZIH 1IARB 3MV9E 1BECA 1FP5A 3TJEH 1MF2L 3BW9A 4KAQH 5DR5L 2XA8L 1BJMA 3BP6A 3JBG7 3MJ9L 1K6QL 4P9MH 5T3XD 5FOBB 1N7MH 3VXRE 3E1F1 4WO4C 3BUYB 2HH0H 1B0RB 3OR6A 1QSEA 4ZO7A 4JPKH 3BYTA 1HI6A 3H2WA 3E6FA 3LKRB 5BMFL 1F58H 1MFAL 2ZG1A 2J5LC 4Z7OF 2WANA 1HE7A 4FFWC 3U9PH 2J6EA 2AXHA 5JORB 1GOGA 1LEIB 5DRZB 2V7HA 3MRHB 3C6LA 3QWRD 4N1EA 2E7BA 3BAEH 4KROD 1DSFL 3JZ7A 1TPXB 5KW9H 3QDGA 3G5ZA 1JNHB 4G80A 4KXZI 4RGNE 4PS4H 3SDDD 1RVFL 5DEGA 5SX5K 4PJDA 5L0QC 5F1IB 3STZA 3FB5A 1KYOJ 4OIAA 5HI4D 4BFIA 5ID0A 2WIMA 1UQSB 3CVIH 1HQ4A 3C8DA 3RWEB 2AP2A 4X7TB 4O5LL 1KXVC 1N8ZA 5F7DB 4Z7QE 2YEZA 3AFLA 2DQUH 4WWKC 2AI0H 3QI9A 3FT3B 2ZUYA 3MROB 4WO4D 3QEGH 1OLZA 1C7SA 5E8PA 1ORQB 5DT1H 2UZXB 2P46B 3Q1SL 4HK0B 4WTZG 3AY4A 3MUJA 2VR4A 5JO5A 1AP2B 3OJVC 2CH8A 2EKJA 3FFDA 4FFWD 1X5KA 4N8VB 4NZUL 1F3DJ 1RU9H 1FBIH 4TNWK 4S2SB 5CUSH 1QSFA 5IJKA 4KROB 1N59A 1Q0YL 2WK2A 3B43A 1J1XH 5HHOE 4P5TB 1FNFA 4IBLT 2B2XH 2HAZA 1BHGA 2J4WH 2VYRE 2A74A 2ADJA 4DUVA 3MLZL 4L5FH 4F7CA 3V4PH 3G04B 1CICA 1L6XA 3O3DA 1CXLA 1F2QA 4TVPD 3V8CA 3WHE1 1T1YA 1VACB 3HR6A 3QPXH 1YJDH 4F9PC 2PTVA 3WFCL 1IM9D 5C0CB 3D85D 2MQCA 4LEXL 4G8EB 1NDGB 4FZEL 1WIOA 4WWKD 3OXSA 3SCMA 4IRZH 4MS8D 3TN0A 4QXUL 1W8OA 1ZTXL 5E2JA 1JGEB 2DWDB 3BZEA 1BF2A 3O6LL 1NC4D 2KUTA 4XMKH 1YEGL 2R2EB 2Z4QB 5EOTB 2ZUWA 5F7KC 3MUY1 3L3IA 4P2OB 4XVUC 5KSBE 3FQNB 1R3JA 1QG3A 4R0LC 3S35L 2WW8A 3CFCL 3WFEH 1CFVH 4LRNL 1CGSH 1EGJA 4OF3A 1KIPB 5SV4A 2Q7YB 4R7NA 3BKML 4X83A 5IUSA 1LD9A 4YNYA 2NY1C 5ECJE 4CJ1A 5DSCA 4JDVB 3ARFC 4WFHE 1H3VA 2Y72A 1QA9A 3C5SA 1D5IL 1SJHB 3CLEH 3RWJA 3S3JA 4DQOH 3MRFB 4OLUH 1OY3B 3Q0HA 2FATH 1EH9A 3PABA 2WZPD 1MRCH 3VJ6A 2X4NA 2DBJA 3V6FB 4I2XE 5CS7A 3THML 5JNYA 2HN7A 3D18B 2QEJA 3LSOA 4KZEH 3ZKQD 2EDLA 3D85B 4NFDA 1AGEB 1CL7H 5TE4L 4PJ7F 4Z0BL 4YEEA 3O3BB 1U8LB 4H8WH 4YHIA 2PR4H 5JW4Q 4ZFGL 4PTUA 4XPFL 1WSST 1KJ2H 4W4OA 1KJVA 4MNGE 4XVUD 2DWEB 4PB9L 4OLWH 4TUOA 1PYWB 1UC6A 2FYYB 3I6KA 4FMKA 2YD1A 4WUUE 2PN5A 5GGRY 3WIIH 3K74B 3QDAA 5BOZG 3NIFE 3VWKA 1X4XA 2DQGH 5GGTH 4F2MA 2ORBH 4QLRA 4ZTOL 2NY1D 3C2SA 4G6KL 3INUL 1BAFH 2I60H 1ZLVH 3ARFD 3BHBA 4HPOL 1OSZB 1U3YA 1YJDC 3MNVA 4OZIE 2DIBA 3TYGL 3TEUA 4KDWA 4Z7UA 4WEBH 3GM8A 2W9EH 3KGRA 4FQQA 1RUAL 1FHGA 1F3JB 5SWQB 4JM2F 1I7RA 5L8JB 5J9PB 4DW2L 1DFBL 1CFTA 1T04B 3KAAA 4JJ5B 4KK8C 1RPQA 3MO1B 1A7PH 1EEUA 4FQCL 3QO1B 2ESVE 5D2LF 3H9HA 3MYJB 3K8KA 4NC1C 1S7QA 4Y2DB 3OKEA 2GW5A 1DQTA 3EKCA 4HV8B 5ITFB 4F7MB 5IT2L 1MIMH 1QR1B 4KRPC 3WHE0 2EIBA 3IJHA 5E1AB 3FTGB 1ACZA 2D7TH 2MKWA 4LHJB 3SJVD 5I1KH 3RWDA 4R26H 4QT5A 5E9DD 2VNCA 3KYNB 5FKAB 2HJLB 1TJHH 4X99A 1TLKA 5C8JB 3ARWA 4XXCC 4NO0D 4NWTL 5I1AA 1T22B 4AQ1B 2ERJC 3LN4B 3P77B 2LVEA 4GG8A 1IBGL 2I26N 4G6FD 5CCKL 4ESKA 4FQLL 1CQYA 5EIIA 3KLHC 3MX0A 3ZKSD 4H8WC 4O2FB 4UQ2A 3FO9B 2ICES 4YHZH 4YQXL 5GGSB 1CD1A 4KK8D 3TT1H 3CXDH 2EZ0D 4PJGA 4OLXH 4LLDA 5DURD 5DHYA 2DDQL 4Z7VA 1BWWA 5T33L 4YDJB 3SDCA 1BPVA 5EBWA 3V7AG 5C9KA 1V3LA 3F6LA 2R4RL 3ARGA 2XY2A 32C2B 3O6FA 1RZGB 4RA0C 4KRPD 4LSDA 4LSVL 5DQJB 3UJJL 1HHKB 5IBLC 4TOYL 1M4KA 5IEKB 1FGNL 2EDBA 4LSUH 1TVBA 1PVHA 3AMLA 5E9DB 3S7GA 4YR6B 2E6JA 4NO0B 4OI9A 3DI3B 2JB6A 4TVSa 2XICA 4EUPG 1GSMA 2ADIA 4NJ9L 2EDFA 1OAKL 4G6FB 4P9HL 3KLHD 1TQBC 3M45A 3TNMB 3BPLB 1G7JB 3CCHB 1HI6B 3FO0L 2F74A 5DS8A 1BD2E 5D2NA 5I8OH 3QRFM 3VDAA 4P4KA 5T3XE 1BQUA 2D03L 1IEBB 2V7HB 1DE4A 3C6LB 5DURB 1VGEH 2JIXD 4ZAKA 1WZ1H 5TQ2H 5I1HL 2VDLH 4G80B 3MXVL 1TVHB 3QUZD 5DEGB 3NH7L 1VFAA 4LVOB 4PJDB 4LOUC 3WHXA 1EAJA 5DMKA 4C56B 3VFGL 4JZNA 3STZB 1CGTA 2YA0A 3FB5B 3S37H 3I02B 1BGXH 1JMZA 1MJUH 1UB6A 2DL9A 4GXVL 2EXYD 5FCUL 1FYTD 3JVGC 4MJ6A 2YEZB 2LU7A 2JELH 4P3CH 2R1WA 4NNPH 3E2HC 1DLFH 5I19H 1NBVL 4Q6IA 4AMKH 1AO7A 1QBBA 1N5YL 2XNAB 5AWNL 3HE6C 4LFHG 3KPSE 4P2RD 3K2MC 3C2AH 5IVZA 5E8NA 3FFDB 4YHML 1UZ6E 1M7IB 3C87A 2ICWB 1DVFA 2FJHA 5JQ6L 1EHLL 4PJHA 3MOBL 4X6CF 4JFEA 1FC2D 1Q9WA 4AEEA 4UV4H 1QSFB 4Z7NF 1RUKH 3K4AA 2DAVA 5INDA 4EOWH 5HYJD 4LOUD 3QUZB 4KJYA 2A74B 4NKOA 5D6DA 2AXJA 3NACL 2ADJB 3U9UA 1I8LC 3EYFB 3LRSA 4RMVA 5KSAD 4DFIA 4F7CB 4MMXC 5F97E 4U1HB 4MD5A 4NWUH 3O3DB 1CXEA</