3FB6B

Kcsa potassium channel in the partially open state with 16 a opening at t112
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
b'DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody fab fragment heavy chain
molecule tags Membrane protein/metal transport
source organism Streptomyces lividans
publication title KcsA Potassium channel in the partially open state with 16 A opening at T112
rcsb
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fb6B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fb6B01
2G5RA 4M6OH 2PO6C 4KPHL 1HCVA 4KQ4L 1KJ2H 5TE4L 2X9XA 2QL1A 1BGXL 4KKLD 2XI9A 1CVRA 5T1DH 1OAKH 3EYSL 1J7VR 4HIXH 1B0GB 3RWEA 5E2TH 2OZ4L 1J0IA 4LOUD 5BZDB 2YR3A 4MA7H 3RZCB 2EDWA 3LSOB 3MRQB 3TPKA 1WGOA 5I15H 4OCRL 3BGMB 4P2OD 4ZUVB 2BX5A 3HB3C 3MREB 2XNAB 4LSUH 3PABB 4F9PC 1NLBL 4BK5A 1A6VH 4Z7UE 5IVXE 1MVUB 4ZUTB 5FDWA 5C6PB 2HTLD 1PDKA 3VDBA 5HI4C 4PRPE 3QIBB 3PF2A 4D94A 4NNPH 5ESAB 4AT6B 2ZCHH 4QY8B 3EFDL 4QOKD 1JF6A 2CKBL 3HC4H 1KLUB 3NVQA 4MJ6B 43CAB 1KCUH 1NGQL 4YXHL 4AEFA 1AGCB 5EU4A 4L4TE 2CXGA 5IVNA 5DUPH 4P2RE 4XVTH 1JFQH 1KB9J 1VPOL 2V5TA 2BC4B 3MLZH 2NW2A 1O5DT 3SKOB 2D7TL 4N0YL 4JM2F 4NFBA 3WFCL 1DANU 4U1LA 5FK9A 4HS3A 3D87B 4ACPA 3CCHA 4YBLB 4QXUH 4Q6IA 1XGYH 4XP5H 5ITBH 1XCQB 5DWUL 3IF1B 5C0ND 4GT7A 1FL6B 4NBXB 4QRPB 4LEXH 1KSRA 4M03A 3DVIA 3B8YA 1C7SA 4PFEA 1CLYH 4X6DF 5A1AA 2IH1A 4JZOB 5IHZA 5A16A 2F54D 1BOGB 3LQAC 1YNKH 2DJUA 4ZFOL 5ANMB 4CVWA 5HHXH 3LKQB 1J86A 2R2BB 4K3EH 1XIWC 3U0TA 3G6JE 1P7QA 4S1RH 2R29L 4TSCL 4BSVA 5E2WH 1CFSA 3ULSB 3FKUS 1T7ZA 5C92A 4KUZL 5EZJA 2XTJC 1P84K 4OCWL 5BV7L 2BNQA 4XNUL 5FKAA 1BBJA 2PYFB 5JZ7D 3RWJA 4XWGH 4WHTB 4OZIA 3S3JA 2GAZA 2PW1A 1NFDA 5TE6L 3S98A 4L4TD 4P2RA 1KJ3H 1V7MH 2PO6D 5F44A 1QOKA 4YHNB 4PR5B 4Y4KA 1MH5B 4CUCA 2V2XA 4NRYA 2MJWA 3EUUA 3RUGE 3GSXA 1C5DB 1INDH 1MJ7H 2G2RB 2I07B 4UMGA 1Z0NA 5JHDB 3K46A 4EI6A 2ARJA 3FFCD 3REWA 5D70L 2VQUA 5C0CE 4Z7VE 1TIUA 3G6AA 3E0GA 1RUML 1BREA 3I50H 3Q2CA 4HWEL 4YDJA 5EOTB 1JHTA 4EXKA 3KAAA 2FO4B 1XF5B 3MV9E 5DFVD 2E9JA 1CDBA 5BVPL 4I48B 5E4IA 3SY0A 1PKQB 3QUML 4OIIL 3RX5A 4MA7L 4WO4C 4Z7QF 2EYTA 3ARTA 3WS3B 4RDQG 1JZ5A 2NTSP 3PQYB 4LLUB 4FRWA 5F9JB 4MQXD 5AZEL 1NLBH 2V2WA 1SMAA 3G04B 2VZ1A 5FYKL 4L3ED 1R3JB 3T3MF 2WV3A 1FO0L 3PWPA 4J8RB 2Z0BA 4M8VA 4OGXH 2B4CH 4HUWA 1UXSB 5J6HA 5DJ2B 3HR5B 3OV6A 3KPRA 4K7PY 4RRPG 4PJCA 1FC1A 3QXAA 3IDUA 1QRNA 1P7KA 5BXFB 3EYQD 1KLGA 3GMPB 5D2LE 4PJEB 4EN3B 4HJJL 2EIZB 4HUXB 5IFHL 2IPKA 4GRWH 4IRZH 3T3PF 3GZKA 4PJ7E 1MIMH 3RRQA 1EUTA 4ERSL 4XWOC 4Y5VB 4JAMA 1ORQB 3MFFB 3PNWB 4NN6B 5MEOB 4KKNA 5F1OB 4NN7C 1JZ7A 4Y19B 4RX4A 4Y5YB 4BH8B 2R0KL 2WAHA 1IAIM 1JPGB 1Z6JT 4RQQB 4P4KB 4FQHB 1F4YH 1AJ7H 1SYVB 3BGFB 3VH8G 5CINH 1PLGL 4NSKA 1IGIL 5EOCL 2Q6WB 4PG2C 4JRYA 3W0WB 4NHCH 1I9IL 1XEDA 3LKSB 3ORJA 1NMBL 3GFUA 3WIHA 4QRQB 2J5LB 1YY8A 1CGSL 5JXAL 4F37F 3H42L 5KSAA 4F58H 1OAYL 2E5EA 3F6LA 4JFQA 4FFVD 4U7MA 5GRXG 4KZDH 3NZ8B 4FNLH 3A6OA 3EGSB 3M1BB 1A1NA 4YNYB 1ZA6A 3ARDB 4XXCC 2VLMD 3LOWA 4M5YL 2VAAB 1BQLL 2VQ1B 3RWHB 4QRRE 1EV2E 5E0QA 4MQSB 4A6YH 1T22A 5C6TL 4FTVB 4Z7WE 3GSNA 4DGVL 2HP4A 1BFOA 1BM3H 1EERB 1VKXA 2ILLA 2X4QB 4M93B 4C4KO 2BHUA 4U3HA 2WIMA 1JTOA 4JZNB 4PGEA 3PXHA 1HSBA 1ZVHA 5LGJB 3MRPA 4NM8L 3WNKA 4NQCA 4OCSL 3WD5L 5D9SA 2UZXB 5E6YA 4LKXA 3MUZ1 1I9RL 4X6FB 1JV5A 1A1MB 4LSPH 4XNYL 3IU4H 4W68A 5T5FH 3C6LD 3LDBC 2LVEA 1H8SA 1IAKB 1K8IB 5BV7C 5GGTH 4UOW1 3HC0B 1KTLB 1DQQA 1CK0L 2EKJA 1DQDH 4D8PB 4IMLA 4YHMH 1MRCH 4TNWF 4W4OC 5MENB 4NQDA 4YDIH 4MA1B 4X98A 3O0RH 2AGJL 1JNNL 4ZFGH 3DPBA 1LK2A 3O3AB 1MI5D 4RGNB 4M6OL 5HHQB 4R90L 1MJUL 1HIMH 1MAJA 4LCWE 2E7CA 1A4JB 3MRIA 4GAYA 1XGTA 4F7TB 3WJLC 1G9ML 2FBOJ 4QTHA 1CZ8L 5GXBB 3CH1B 5JIHA 1MIEL 3O2VH 4XP6H 3IAGC 2YMXH 1CR9H 1TVDA 4GXUM 5DRWA 3VGBA 4G42A 1S7WA 2VLLA 2ZOKB 3HG1E 3S88L 1JNHA 3L3KA 5EIIA 4I8DA 3CJJA 4KGLA 4MNGA 3DSNA 1MCKA 4PPTA 3U6RB 3K8LA 1CL7H 5HVHC 4LSUL 1SYSA 1UZ6F 2D31A 3SKJH 1EAPB 2VE6B 4NNXA 5FB8A 4XXDB 3U2SB 1KXTB 3BYTA 1NGYA 3DHMA 4R0LA 1IBGL 1DFBH 1FNEA 2DM7A 4GRWF 4X98B 5CJ8A 4U6YA 2ATPA 1AC0A 1TMCB 1PQZA 5AWNH 2D4FA 4ELME 2Q8BH 2APVA 3GEWB 3M17A 5AZEH 1OLZA 2NX5E 1FN4B 5BRZE 3NIFF 2DI8A 3F7YB 1EJ6A 1RIVH 5SWSD 5ADPL 3FFDB 2JB6A 1R5WA 5KVDL 5C7XL 3JWNC 4NQTA 1L0XA 4CDHA 2H26A 4KRMB 4QXTB 4IRZL 3ESVF 1N7MH 1M7DB 1PYWB 1QSFE 3REVB 1A6WH 4OGYH 5GGVH 1AGEB 1G7IB 4XXDA 4XXCA 4EIZC 1HK6A 1A3LH 5E6ID 5C3LD 2O26U 4MS8C 2EC9T 5GS1B 5CGYC 1JPSH 4KJQD 5EIIB 1RJYB 5MENA 3OXSA 5EOCH 1DQQB 4Z7VA 2KL6A 4Z5RA 1UCBL 1K8IA 4JFDD 4JFQB 4ODUA 4YHZL 3QFDA 1TQCC 1MHEB 4GKNA 3AS2A 4PD4J 4QYOA 5MI0B 3G6DL 3VWKD 1I9JL 4OAWA 1PKOA 4GMSL 1U92B 2G75A 1QKZH 5TDPB 4RFEB 4NT6B 4BFGA 2MNUA 2D0FA 3CZFB 4OLYH 1U8LB 3VU2A 3O3AA 3QUZD 3AREB 1IL1A 5LBSL 1D5ZB 1C5CL 5GS2D 1H3UA 3H9SD 2BMKB 3RX8A 3S97C 4P99A 1I3GL 3CD4A 4P3CH 4ZOAA 4UNUA 1BZ7A 2AJYH 2R0LL 3HE6A 4WU5A 4Y4KD 2FX9L 1KLGB 3GMPA 5JR1L 3SEPA 4OZFA 3WN5A 5IQ9A 1EPFA 4YFDB 3TFKD 3WJJC 4FMKA 2QKIA 4HSQA 2EC9U 2WZPD 4JZNA 3QG7H 4PJAF 5D5MA 1EX0A 2NZ9D 2EE3A 2X7LA 5EULV 3NFSH 4JHAL 5DJAA 1M05A 1RZGA 5E2TL 3CSBA 3UTSB 4HMDA 4GXVL 4H8WH 3SDYH 1J87A 1QVOA 5DD6B 1F8TL 1JNNH 4JKLA 4ZD3H 4I48A 2C1PB 1TVBA 2GITB 4R2GB 2CLRB 3S37X 3IGAB 2MKLC 4LIQH 2FO4A 5D8JL 3NZ8A 2HLFC 1A7RH 4Y5VA 5IKCB 2GQHA 2VLJB 3Q5YA 2Y5TB 4OGAD 4ELMB 4AG4L 3G6AB 2QADC 2CK0L 2EIBA 1KYOJ 4I0CC 1S7TA 2VDNL 4M8QB 3B9DA 1HEZA 3QXAB 2VAJA 5GGQL 4IS6B 1VHPA 3HR5A 1AP2A 5J6HB 2Q6WA 5I30H 3D2UB 3G08B 2ESVA 1RUQH 2E7MA 3GMOA 3NIFE 3ILQD 4UB0L 3B2VH 4YHNA 4P3DA 3TZVB 3E3QE 1AI1L 1RIUH 2K7QA 4U1IA 1UJ3C 1KCVL 4AK1A 4LSRH 5D7IA 12E8H 4L4TA 4P2RD 5E8DH 1WK0A 2FJHB 3OKNA 5LXGL 1G7LB 3TCLB 1YEGL 1LD9A 3T0VA 3PL6D 5J13C 1FH5L 5CBEB 3BH8B 3TJEL 4AMKL 2AKRB 4QNPE 3WUWG 2VXQH 1FFNA 3MZTA 4J8RA 4LHQB 1H5BC 1U8NA 4JGMA 4LIQE 1FL3A 5JPMA 5HYEA 2BSED 4WFED 2W91A 3O2DL 1RUAL 5CZVL 1UB5A 5FA4B 3MRBB 3WFHB 3MX0A 5JHLL 4KJYA 1N0XL 2E6QA 4CVXB 2OQJB 4HKZB 2DKUA 5DDHA 3BGFC 1YEJL 4J6RL 5CWSB 1XF5A 4KPHH 1X4XA 4OUOA 3G6JF 1EVTC 4KROC 2GJ6A 3UTTE 5I1AB 1JRHI 5EN2B 1XCQA 4BQBA 3REWB 3KPLA 3VXOB 1IM3A 5T1DL 4DN4L 2IAMB 4XTRD 2HJFB 5EZJB 3ZDXE 2A74B 4L1DA 1BBDH 3JV5A 1T1XA 5GRYA 1P7QB 4WFHE 4Q9RL 2FECL 1I9JH 3DO3A 3MV8D 3ZE0E 5HVFB 3QZWG 3ARGA 4L3EE 4P2RB 5HYIA 5ANMA 4TUKL 3ZTNL 1CICC 5L2JB 5E8OB 4APQB 5E9DE 1A7NH 4H0GA 2YK1H 4YX2L 2B1AL 3PGDA 5BRZD 4AQOA 3WNNA 4XVJL 5I1HL 2K3TA 3UBXA 3HNTL 1IJ9A 3DMMA 1YEKH 2AK1H 4OCSH 1J8HD 3GUTB 3F7VA 2F54A 3A0OA 4PS4H 5T3XL 1CLOL 4JFEE 1EO8H 1CU4H 4HDIB 1FRGL 2VDPL 3WFEH 4BFIB 5KSBF 3IDMA 1XF3A 5C0DA 4FQCH 1U8KB 3QPXH 1E4XI 3HAEG 1JUFA 3SDCB 1R3HB 2HTLC 1BD2B 5D1QC 4D0DB 3TBSA 3L5IA 3C8KB 1D5MB 4ZPVA 3DV6A 4OZFH 2VLKA 3AM8C 1J1OH 1VFMA 2WW8A 2ZPKL 2HH0H 3T3PE 4KHTH 3RWDA 1YJDC 4YHLH 1LO3L 2NW2B 5JLZA 4WO4A 4OGAC 2IJ0C 2X70B 1RUQL 5A2FA 5EU6D 3AS1A 4LCCB 4JREC 3J7HA 4PUBH 3RUGA 4O02H 2GY7B 4U31A 3LS4L 4UU9B 3S96B 4LSRL 3TO2B 2O5YL 4LHUB 3LSOA 3HKFA 3D39A 4NO3B 3S3PA 3VGGA 3PV7A 1QYGH 4ONOA 5CGMA 1NFDE 4JDZB 1QSEE 2FIKB 5DHVB 4PY7A 1F90L 1QLFB 1ZE3C 3TT3L 3CMOL 3AMKA 5KOMC 5K9OA 3HC3H 4EN3C 1I7RB 4UTAL 3S6CA 4I4WA 4XCFH 4F58L 2X4TB 5ITFB 3ARQA 3IDXL 5F21B 4OCLC 4JANA 3FO2A 3OGCA 2K1MA 1A6TB 1OF2A 5JMOC 2AI0H 4QRRB 2B39A 3MREA 3UP1A 2E7HA 2JJTA 3MLXH 4NOBA 2IQAA 4YUEH 4WWKA 4ZUWB 3VG9B 3VXRB 4LLDB 4DVRL 3CX5K 4QXGH 4D9QE 4ZFZB 2OTUB 5E94A 1BM3L 1EXUA 2QQKH 2V17H 5HJ3B 2XWBB 4QT5B 1AO7B 4Y88A 3H9SE 5F9OL 4JHWH 3P73A 4F7PA 3WHE0 3H3PL 3ULUC 1MY5A 1T89C 1D6VL 1C1EL 2GSGA 1U58B 2ADIB 3X3GH 4XMKL 5C8JA 3DTXA 1ZA3B 4MS8D 4ZMAT 1E4WH 5FHAH 1CDHA 3QI9C 1GVIA 1KENL 4PBWD 3PV6B 3I2CH 5K9QI 1PY9A 3MUY1 2BSTA 4PJHF 3VXPA 2D7PA 3VWJC 2GUOA 1JWUB 5DRXA 4HC1H 2R2CA 2AGJH 1JF5A 4DZBB 1ZT4B 2HKHH 3MV8E 4GJTB 3N1PC 2VYRE 4FQLL 4N1CA 1IC1A 5DHYA 1ZT1A 3M07A 2P46B 4JN1H 3L95B 1S9YA 4LCWD 2J8UE 3U30B 5T3ZL 3LQAH 3U4BH 4GRMA 1G7QA 4AEEA 2PXYB 2W9DL 4NN5B 5HDBF 3TWCL 4M4RA 5BO1L 3R8QA 4C83A 4E42A 1FFPA 1VERA 2NY4D 2NY5H 2DQEH 3OX8B 1QSED 3QUKB 2J8HA 3FAXA 4G6AC 4K9EL 1ZWIB 5SWQA 1N59A 3BSZH 4GBXA 2OL3H 3WFEL 4OLVH 2WLZA 1XIWB 5IBUG 3VXUE 4N90D 1QUNA 5D7LB 3CUPB 1P5VA 3WFZA 1A6AB 1MCSA 1ORSB 2HFEA 3V52H 1F4XH 3X12A 4HPOL 2QSVA 4CMMA 5ESQA 4K8RD 3RL1B 5TH2B 3T0BA 2PUQT 1Q9LB 2LTQB 3AROA 3NFNA 5B3NA 4UQ3B 1GHFH 4GW5B 1T0MB 3BIBX 2A9MH 4CJ0A 1E4XH 4ONGH 5EC1B 3BD3A 4IOSD 5IBLD 5ACZB 5HI5D 5LAXA 2HH0L 1SQ2N 1QSEB 2EDQA 5I75B 4U7KA 3B2UC 2XTJD 1FNLA 3PP4L 1UACH 2ED8A 1MHHA 2D2OA 4OFKA 3GHBL 4U3CA 1RULH 4RGNE 1E6JL 3QRGL 3ZE1F 4JPVL 1BQHB 3ZKXC 1KTKE 4DKEH 5ADOL 3GBMH 4M6MH 4NM8H 2AVGA 5F93C 4EXPX 4OM1H 3MZGB 4ELKA 5AG8A 1GAFL 3KPSA 4LCIH 1F4AA 1DQTA 2W9EL 4J1UB 4MJIA 1K5NB 1HNGA 1PY4A 3D18A 3VFSA 1HHKB 4B50A 1OP5H 4LNVA 4M5ZL 5EUOA 4KK9C 4PRIE 3SCMA 4N1EA 3WIIL 3C6SB 5DVNA 3C60A 3L5WA 3T3ME 1LEKB 5HGDB 1J88A 5E9DA 1AO7D 5CIPB 1IKNC 1V3LA 2IGFH 3QDGD 3QQ3A 5DJ8B 3A6CL 5IW1A 3IDXH 3FQNA 5KVMC 1NAMA 3MV11 3SKMB 3G6JB 1XGUA 3UTZB 3SJVB 43C9B 1BQHA 3QUXC 4G6FD 1SJEB 5SWZE 2CKNA 4TRPH 1MCNA 4P46A 4ZODA 2P24A 2OP4H 3B9VA 1HYSC 2NY2D 5E95B 2VZVA 1IGCL 1HXMA 3JWOL 1ZK9A 3TYFA 4PJIE 4X6DB 5IEHA 5C0EB 2OMBA 1UT9A 2AEIT 3DROB 1V7NH 3DETD 1JNJA 2BY2A 4LASL 4M6NH 3CFEB 1FZOA 5I19H 5E00A 1SJVA 4HX1B 3LQZB 3QWRD 1KBGL 1TETH 1IZJA 4ODSL 4KI5E 4WEBL 3HZYB 1TJIL 3VE0B 1FBIH 1I4FA 1BJMA 4CMMB 4M7JH 3MRFB 1OD7A 1IGYB 1P6FA 1MCHA 1Q9OA 4M61A 4ZUSB 4R26H 3P30H 4BYHA 4HIHB 4HUKB 4I18C 4OCXL 2X4OB 1H9VA 4E0RB 5KS9E 1FGVL 3P0YL 4WUUB 1X7QA 5C3TA 5HI3D 5L2KD 2ZUVA 1G7QB 4HC1A 5CJXA 1HHHA 3EJYD 3L95A 1T66D 5GGQH 2QADB 1NCUA 1X6LA 5IW6A 4F3FB 1IC7L 3GJFK 3PWVB 1M71B 4U1KA 5DO2D 4P5TA 3VRJB 3RGVB 4N0FA 2A6IA 5JW4M 1EMTH 1RIUL 5DD1L 4LLVB 5A2LH 3BZFA 4PB9L 2BVOB 5IBUB 1LO5A 1E4XL 5C0GA 4TVPD 1U8IA 5DVKA 1ZGLM 3KYMB 3EIFA 4S1SH 4GKSA 5L8JB 3LV3B 4IDLA 2Z31A 1MCPL 1RY7B 5FHBH 4YFEA 3TO4A 1JMZA 5D1ZD 2WP3O 3QQ4A 1A47A 4XPFL 5D5ME 4X4YB 1NPUA 3ZHKA 2EDNA 5J57B 3BE1H 5TDOB 2YUXA 3SDAC 4NM4H 4O2CB 2JLLA 5D2LB 1GPOL 2BY3A 1INDL 1MJ7L 4E9LA 2QSTA 4K7PL 1MWAA 2GJZB 5DQ9A 5JW3L 4G6ML 2NY3C 3LKRB 4B5EA 3OAYH 5IF0B 3GMNA 1FQ9C 3U82B 5DD5L 3V5HA 3Q6FB 2I9TA 2AJZB 1T7VA 4KKAD 1JYNA 3CFKB 2OR8A 1Q72H 1W72L 4X6CE 4XP5L 2DJSA 1J0ZA 4LDEB 2HTKD 4OIIH 5T5NG 4JRXA 1A7OL 5L2KE 4ZD3L 1SBBA 3TBVB 4OLUL 3T1WA 2BJMH 1FL5A 1WF5A 1J0HA 1CYGA 3FFCA 4QGTA 1EEQA 5FYKH 3OR7B 4RMTA 2R4SL 3O9WA 1EJOH 3LCYA 4FG6D 2IADB 1LO0H 4M3JA 3WJLA 2P4AB 4ZXBC 3P4OA 4F37K 4OQTH 5I16A 2I5YH 3MCLH 5GSVA 4D3CH 1YN7B 2AEQL 5JOEA 4KXZH 4PGDA 3QNYB 4V1DD 4W4OA 5FHAL 4J23A 1RZJL 1CGXA 4XP4H 5FGCB 2Q1EA 2FATL 4R7DB 5DTFB 5B39G 3OSKA 2E9WA 3AU1A 4MX7A 4WHCA 5I19L 2UUDK 2GHWB 5E8DL 4Y5XB 2CJUL 4HC1L 5FKPB 2O61A 3NCBB 4YHKL 4N5UA 3QNXA 2G5BB 3QO1A 3W9EA 1MCCA 4KXZI 2DQGH 5EU3B 5FM4A 1FNSH 4JFPB 3P30L 5CKAA 3BPOB 3DX9A 3GSRA 5DGQA 4N5EC 3VFMA 4AH2B 4EQ2A 4DVBB 5FYKE 1OAQH 2AJ3B 1ZLSH 5C9JB 3PP3K 5I74C 4WIQA 3AC0A 2AJXH 4S1DC 4LCYB 1KXQE 4JFPA 3RVUC 3I50L 3V4VL 1HDMB 4NZJA 5BRZB 1JGLH 4MNGE 3SE4C 1YEJH 3KPOA 3HTLX 5CEZE 3EYUH 3GSNH 2DLGA 3BPCA 3HUJB 3ARUA 1TITA 3RKDC 1MLCA 5CSGA 4MD5B 1TPXC 4DTGL 5H37G 4APQA 4H1LH 4GG6A 3QHFL 1Q8MA 1VESA 3NN8B 2O5YH 3WD5H 1RZJC 2ZNWA 1VFUA 2DN7A 3OKMA 4ZQKB 4TNWK 1GGBH 2CLVA 4K3JH 3AY4C 2NXZB 1T4KB 1MVFA 2DTMH 2VC2L 4CJ1A 3NPSC 5EZIL 1U8HA 5MERB 5C2BL 1YYLL 4G8GB 5EWIL 4MD5A 2YZ1A 4K94H 1NJ9A 5EN2A 2FDBP 3WO3B 3E8UH 2ADJB 5CWSA 3SPVA 1YA5A 1B88A 2R39A 3K4AA 1AR2A 2ZUTA 4G6JL 5C08E 2A6KA 1RJZA 5CSZB 4LFHG 1UZ8A 4PGCA 5IQ7L 4XMPL 1PLGH 5EORH 1ZLVK 4PJ8A 4NWUL 3PHQB 1CR9L 3RVXC 3C8HA 3HE7C 3UTPE 3TM6A 4CVZA 4BJLA 4CBPA 4G6MH 3QULB 4KRPD 4L8SC 1GIGH 2NXZD 5IB1B 3OKOB 5IW3A 5GS2H 5HPOA 3FJTA 5EU3A 4KGJA 3ZKXB 3QDGE 3QR2A 2P48B 2VJXA 2RQ8A 3ARGD 3RVTC 1NC4D 2VSCA 2YC1B 4NHUB 4OFVA 2G5BA 1QTYT 4Z8FL 2I60L 2Q3ZA 3MRRB 3TCLA 1MY7A 4L4JA 1QD0A 3EO9H 3MCKA 5ACMA 1C12B 3HMXA 4BUGA 3SKNA 4Y5XA 3O4OC 3CFJB 3RVXD 4NOFA 1ZHBB 3P9LB 4GRLB 4KRPC 1OVZA 2KZ1B 1IT9H 1FFOA 2PCPB 2AW2A 3QJHA 1A4KA 4GKZB 1PZ5A 1I3RB 5IHUH 1MRDH 4PRIA 3D2UA 4GKSB 1SEQH 1KYOK 1U8JA 2E6JA 2IPUK 4IS6A 4G7VL 4NO0B 1KB5A 4XPBH 4U1SA 2A83B 3CGTA 4PV9A 2QQNH 2VWEE 3ILPB 4DKFH 3VD7A 3U7YH 1UM4H 4CN6A 1TETL 4XPHL 2BOCA 2GTWB 4Q6IC 3DVGA 1MJJB 4WI2A 4NQSA 5IP4A 1MJ8L 2X1XR 4OIBA 2OZ4A 4LU5L 3VXMA 1HYSD 2L4OA 3O0RL 3QEUA 2DKMA 4OSUH 3KXFB 3QUMB 4OCMC 1P4BH 5SV4A 1ZKAA 3IJSB 1AO7E 3PL6A 3QBTB 5F3HA 1EHXA 1I75A 1RUKL 1UM5L 3U9PL 5LWYL 1FGNH 4YHZH 4H1LA 4WWID 2HRLA 4OD1L 3ARRA 5F89A 4RZCA 5I1IH 2QADD 2GEEA 4JFYA 2BVYA 5TF0A 4XAKD 1YPZE 4OZFB 3WUWA 4CDGC 3DYPA 3FN3A 4WU5B 5MHSD 1ED3B 3OJDB 2YA0A 1ZEAL 2J6EL 5J7CC 2CIKA 2BCKA 5DYOB 2FEDC 1G1CA 4EDXA 2VERN 5DMGC 3EYFA 1EUUA 5FGBC 1CFQA 4E41B 4U7SA 3HNSH 3TGXA 4ZTOL 1UKSA 2R1WB 1JNLL 3OHXB 4XBPA 3S4SG 2PTUA 5GZND 1NC2D 1MCLA 3H9HA 1S7UA 1IQWH 1EEZB 2G75B 1U92A 2DYPD 5DHXB 1CBVL 2L7JA 4BQCA 4PRPD 1WWBX 2Y7QA 2X1PA 2R29H 4TSCH 2BVOA 1EGJA 4KAQH 3OKYA 5TPWL 1T1ZB 4Z5RB 2DTML 2VC2H 4LLVA 4I2XE 1DN0A 4Z7QE 3O8XC 1JPST 1PSKH 2NXYC 2XQYK 4R4BA 1YNTB 5DUMH 4Y1AE 4H1LG 4CVUA 4XZUA 3TIDA 1OGAB 2FSEA 2A38A 5EBMB 3FZUD 1JCKA 1KCRL 3U1SL 1VGEH 3QQ9C 4TRPL 3BSZL 3EFFB 3BX7C 2MPAH 3H9SA 2Q76B 4WI7A 3UX9B 1Q72L 4G6KL 1OAZH 3U4AA 1F3DJ 4JO3L 3KDMA 3TA3A 5ACLA 5KAQF 4JREB 1ADQH 3HMXL 1FN4A 3HA0A 1V7NL 1KGCE 4EUPG 3QEGH 3O8XB 4RA0C 1N6QH 1QFUH 3BQUB 3UTQA 2I60H 1MFNA 5F71A 4BQ8A 4ZPTB 1I85C 4OB5H 2A9ML 4MNQB 4OF8A 1NGYB 3GSOA 3V5KB 2R8SH 5IJVB 5L0QB 4JM2A 1L0YA 1QFWI 3V2AR 1R0AL 2H3NA 2VXTH 1QG3A 1EFXA 5EU6B 4NFCA 1X5HA 1MHHB 4P2QD 4UDTA 1ZAGA 5IFAH 1EEYA 4M7JL 1OARH 2W59A 1JL8A 5AYQA 5IMOB 1FC2D 4GQ9H 1I8IB 4EEEA 3SO3B 4X6DA 5IEHB 3AFLA 1EO5A 1DUYB 1EGJL 3HCVA 2Y36L 4ALAH 3PWUB 3G5XA 4G7VH 1CTNA 1QQDA 2H2SC 5C2UB 3RIAF 4ODTL 3UC0H 4JZJB 1FJ1B 1UM4L 5ALCL 3EYOB 4GAYB 5J6GA 4CAGA 1A4JA 3MRIB 1BQHG 4GS7C 5I18H 2LVCA 3SJVA 1PAMA 3NFNB 4Z76A 1ES0A 5HGBA 4WW1A 1M6OA 1T7WA 4YK4B 1Y0LA 3ARXA 3SDYL 5E08L 4YK4C 3GI8L 3B5HA 3SDXF 2VISB 4D2NA 3CUPA 2JJTC 3BDYH 3EJZD 4F33A 4IMLB 1OQXA 3V6ZA 5KSVA 2BVQA 4LARL 2HKFH 4P49A 3OAUL 1DQJA 4TSBH 1NGXA 3BKCL 3NIDF 2VKWA 2H1PL 3V6FB 2IGFL 3MBEB 4GAJH 1FFPB 4OLXH 5J4MA 2G9HB 3BHBB 5B22A 3A67H 5DEZA 3HUJF 1CLYL 4JJ5B 3AVEA 4ORZC 4KH2A 4RISL 4J3VA 1A14H 3TC9A 4NKOB 4U2YA 1S5HB 4NC0B 3LN5B 5C09A 1AI1H 4JGUA 3PV6A 3MJ9H 3SE8H 1YEFL 4AIZB 2WIIB 3MLTA 1A6UL 4LPYA 2VAAA 2VQ1A 3EOYG 3RWHA 3IJYA 1B6UA 4N8CH 4S1RL 3FTGB 1GGBL 4RGOH 4N0CC 4LLMB 2YD4A 3ZT5A 3LIZL 3EGSA 4RX4D 2PYED 1VFBB 2VDPH 4HXBL 5GGSA 2XFXA 2IG2H 4UDUA 2P49B 3DX7B 1TZGH 1SHMA 3FAWA 5AUMB 4MXQD 4MLIA 3O45A 1BQSA 1FVEB 1OT2A 4NSKB 1B4JH 4U6TA 5T1LB 2V7HB 1UENA 4JPWH 3L3HA 3K74B 5F96L 4MAUL 4KMTH 4JAMB 4R0LC 5HSFA 3WIHL 2Z35A 4JANB 5JQ6H 5I8CA 3HE7B 4DFHA 4YO0A 4L8DB 1T21A 2BFVL 1C8PA 1X5ZA 4ZDHA 2XIDA 3DXAD 1XCTB 1VGEL 1W2KT 3BPNB 4OFYD 1U2CA 2OX5A 3V4PL 3QCUH 4MMXC 2MPAL 3PHSA 1K4CB 4HH9B 2VLKD 1ZT1B 1T5WB 3VXSA 1HNFA 1YMHA 4X0KB 4FXKB 4FQIL 5AD0A 4JO2H 2HN7A 5LVEA 4PRBA 4IIQA 6FABL 1VFAB 3CVHL 4C58B 5CBAA 5INDB 5D1XC 3FQTA 4XVJH 3BEWA 2Z8RA 1H3WM 2RBLA 1TJHL 1DEEA 3MLZL 4CU6A 2AK1L 1RQ5A 4FFWC 1U3HB 2JCCE 2GK0B 1NANH 1MPAH 1R3LB 3QIUB 4X7SL 2BRRL 2J1KA 2JJVA 4WUKL 4XMLL 5DSCA 1ZHKB 4UOJA 4I5BA 2H9GA 1B2WL 5IMLB 1ZMYA 3CSGA 2I07A 1KJ2A 2MTPA 1YQVH 1U36A 1FRGH 4ZTPH 5F70A 4IRSB 4AJ0A 3T65A 3BP4A 3Q6GH 1INQB 1RAMA 1P2CB 3UEZA 1CICB 1HYRC 2FJFB 1I1FA 5HHOA 3RA7H 4K23L 2NZ9C 4RIRA 4URTB 5CEZD 3D39D 3KPRD 2WINB 3RL2B 2QQKL 2PTTA 3VXUD 2QLVB 4K8RL 3DVNB 1UM5H 4KDWA 3H9ZA 5J12C 3ROOA 2FEDD 3H42H 5KAQG 5AEAA 5FKAB 3LPWA 2DLFH 4BFIA 1CQYA 5DD5H 5TF1H 4XCEA 4QHMA 3VXTA 1ZGLP 4RAVB 4PB0L 2IH3B 4XMKH 3UAJD 1OSPH 3MUJA 3U7WH 2BXYA 2FECI 1T5XA 5KW9L 3D39B 4MVBC 3WJJA 3ARPA 2VDQL 3S96A 1KIPB 4KUZH 3V0VB 4OM0L 3AREC 4YDLC 5F1IB 4Q74A 3O2WL 1E4KC 2FHFA 4OZHE 5GRWA 2XPGA 5EOQH 3SE9L 5KZCD 5CD3A 4HBCH 5GQBA 3GMRB 2C4FT 1KPUB 1WZKA 1FIEA 2A9NH 1AXSA 1NANI 1KT2A 4MDJB 2R0LH 2HRPH 3VXMD 2Y23A 4YEEA 1T7YA 4HS6A 2IBZX 2D9QB 5DEGB 2DBJA 2HMIC 4N68A 4DUWA 1NBVH 3CDYA 5FYLH 4RFNB 1J0YA 2HVJA 1UH2A 4N90E 2C9AA 4A6YB 5DGRA 4JVUA 1ZLUK 1UFUA 4NWTL 3RL2A 3TZVC 2BC4A 2P5EE 1B4JL 5EO9A 1LK3L 4JQIL 1S78D 2Z4QA 3JUYA 2WWMC 3OR6B 5EO1B 2YUZA 1P2CA 3SO5A 1MIEH 3O2VL 4Y2DD 3INUH 1D7FA 3JTSB 1AR1C 4NQVB 4FQXC 4Z78B 2PW2B 2GFBB 4HV8A 4XC3H 43CAA 1AGFB 2EO9A 5DEGA 5D1XA 4E41D 2JJSC 2XWJB 4G6KH 3WO4C 3QIBD 3NPSB 3FOMB 3WFBH 1ZHKA 4QWWC 5D4QA 1R3LA 3QIUA 5KZCB 4AT6A 1UWEL 4BZ1H 1JGVL 3DGGB 1X6NA 2KQMA 3QIBA 1OGTA 3WO4B 5FA3B 4J3TA 3MRLA 1I8LC 1XFPA 5C0BE 3QRGH 2C26A 1WWCA 3Q3GA 1T1WB 2ZUUA 2J4WL 2DOCA 1Q1JL 3QHFH 4IJ3B 2V9TA 2FJGA 4BZYA 4CL7A 2EXWC 12E8L 5ESVA 4KK8D 3KWWB 3UROR 1WBXA 1T03H 3QQ9D 3KPMB 3G08A 2VLRB 5D2NC 4PTTA 3STLA 2E27H 1WCBA 2PF6A 5CEZH 3EJJX 4QHMB 2XZQL 4RFNC 1HEZB 1DBKL 4NZTL 4M8QA 3UC0L 4Y0GA 4ZDHB 1IM3B 5JXAH 1B90A 3LRSA 3Q0HA 4ELMA 4L29A 3MOBH 2GJ6B 4G8GE 5B21A 4DGYL 4MA1C 4N0UE 1A21A 5ISZE 4MJ5B 1YYMH 4F2MB 5T1LA 3NGBC 2BP3A 3MMEA 4XPAH 1KIRB 5IROA 3QRFM 1A9EA 1UXWA 3PE9A 4M48H 3IT8D 3BRDA 2F19H 3PIQA 1VADB 3FOLB 1KULA 5DJAB 1ONQA 4APQD 2DQDL 3HG1A 4Y5XC 4XI5C 4JGJA 1UM6H 3KR3L 5DMIH 4I5BB 3R1GH 4I3SH 5A2IH 4FQ1L 1RZ7L 4ZUUA 1RPQA 2AKRA 3O41A 4DKAA 3ULVF 1U6AL 1AXTL 4A2LA 4PJCF 3EYQC 4KDTA 3DYOA 4PJXB 2FJHA 3ARFD 3ULUF 3SGJC 3QJFB 1QACA 4LSQL 5SX4I 3P4LA 1LNUB 3ALWA 4GAGH 4PP2B 4YQXH 5KTEL 1SY6H 5IVZB 5KS9F 5FF6A 5KANG 3D69A 1SEQL 4X4MA 1UQSB 4LVNB 5C0IB 4FA8A 4HH9A 3MLRL 1OCWH 4NQXA 1IAII 2CK2A 1UB6A 3CXHJ 3GSQA 1S7TB 2PYEE 5HYJA 1M4KA 3N9GL 2A0LC 3U0WL 2NY5C 4ODUB 2GIYA 2NXYD 3GO1H 1L9MA 3VGEA 1DBMH 4WEMB 3IGAA 1K3ZA 3W0WD 3GJFA 4V1DA 5BS0B 1Y6KR 5JOFB 4L4VE 3A6CH 3DO7A 1ADQL 3HMXH 3HE6D 5HHMD 2IC2A 2WP3T 5DK3A 5K9JL 4LIQL 2CLZB 3GI9L 4P23A 1T2JA 3V7AG 4B7LA 4OZHA 1A7RL 1IAMA 2CQVA 4PJIF 4AG4H 1R24B 1DFBL 2NPLX 3BAEH 3OXRA 1OGAE 3MRNA 2VXTL 3F7QA 2NNAA 3VJ6B 3ZHLA 2VITB 3K0WA 4L9LA 2C4FU 3P77A 3PWUA 3H3BC 4GW4A 4KHTL 2JB6B 3JWOH 1A64A 4PREA 1BQUA 2ARJQ 5DK2B 1MCPH 1FLRH 4TNVF 4XNXH 4PJGE 1EGJH 2RB8A 4OT1L 4WI6A 2YD2A 3DV4B 5DVMA 2V6HA 2IFFL 1EZVX 1MREL 1U8PA 4ZPTA 5LXGH 3U9UA 3U2SA 2X40A 1DEDA 3THML 1TDQA 2NR6D 3O3BA 5DJXA 4KI5C 1D9KB 1IGTB 4R4FL 3GJEB 1QRNE 2MQ0A 3IJHA 1FSKC 4WUKH 4HZAA 1WIUA 4QYOB 4KI5F 3KPRE 1S7WB 1K8DB 1OAKL 2P5WA 1P69B 4M6AA 4UIMA 1AHWC 4Z7VB 4Z7WF 1NCAL 5F7MC 3V6ZB 4OUUB 1JN6B 4Y4HB 3R4DA 3MR9B 2JCCA 3DARA 1F3JB 2FSEB 4YPGA 3RA7L 4CW1B 2H8PB 2ZUYA 5HYSA 4HUVB 1RFDH 4WW1B 3A67L 1ES0B 4P9ML 5AAWA 3FT4B 3WNLA 2FX7L 3DVFA 3ARZA 4KQ3L 4JLRB 4KKBC 4WUUD 3REVA 4LPUA 4WNQB 4HD9A 2OSLB 5EG6C 2HJKA 4I0PB 1F3JA 1FYTD 3WS6C 2H26B 4RGMC 2APWA 4OUUA 1KIQB 5JO5A 1XF1A 4MA3A 4YC2C 1PG7W 5H2BA 2PXYC 3WKMH 3KR3H 5DMIL 5DVOA 1TLKA 3HCVB 1IZKA 5FO9A 3PGCA 1A1MA 5IR1B 5FIEA 3HC4L 4RGOL 4K55A 1KCLA 1G9NC 3F7YA 4N8VB 3QDJE 4NQCB 4OCNC 1J5OH 3MYZA 1J8KA 4P4KC 3M17B 3OG4B 4M7ZB 4CU7A 1H3PL 1S7UB 2P8PA 4XNZB 4ZYKA 4P4RB 1CDYA 2VLME 1F2QA 5I9QB 3BP5A 2DLHA 1F13A 5IV2A 1MAKA 1R0AH 5SV3A 5FB8B 3DNKA 5DZOA 4E41A 5TDNA 2P5WD 2GCYA 3O4LB 3FT2A 2ZUSA 4HULB 5DYOA 2CKBB 3MV9B 3KDMB 3TA3B 4PREB 2VWEC 4FTVD 1IQDA 4P5MB 5KSBB 5T3ZH 5ELIA 3DETC 3TO4C 1DVFB 4NP4L 4L3AA 1KJ2L 1T7XA 1JHKH 4PG2A 3OXRB 2R0WL 2XZCL 3TVMD 4QTHB 4HIIA 4QRQA 4NWTH 5F3HB 4WFEE 4YHPA 4GKOA 4OZGE 1F5WA 1X5KA 4JFDA 1SYVA 1X3DA 1SJXA 1DR9A 2H45A 3GGWB 4R4BB 4PJFA 1DN0B 2Z93A 4PLJD 4YZFF 3R0NA 4WU7A 2DIBA 4HJGA 6FABH 3BQUC 1W0YT 2R4SH 1FYTE 4XHQA 2C3HA 4X99B 1AD9A 1GOFA 1TJHH 3OKEB 4QOKB 4U1SB 2FX8L 1D5BA 4IEFB 5I75C 3FRUA 2BRRH 3RVVC 2A73A 4LSTL 2OTWB 1P6AB 1TQBC 4XWGL 1HXYA 4EI5C 3QPQC 4GKZA 3W81A 2BNUB 3QJHB 1NGQH 2EYTB 4LPWA 2XTJB 5HY9A 3WS3A 3RP1A 3WIFB 4XP9L 1NMCB 4N5ED 2CIKB 5JQHC 4N8CL 4JFHE 1JYVA 5IJKA 5I2IB 4NHUA 3IB4A 5JZ7C 5KSAC 2F74B 4PJEF 4FXGB 2B7DT 4LRNH 3CMOH 2OR9L 1DBKH 4K8RH 5DMKB 4JG0L 3WE6A 3HC3L 2IG2L 2NQCA 3STBA 4WRLA 5IB1A 5MP6H 5HYSG 5KSAB 4CVZB 4LKCA 3LKSA 3CK0H 4X6DE 4AEHH 4DGYH 1II4E 1F02I 5IFJB 4NN5C 3W9DB 4YHIA 1MH5A 3QDMB 5D1QB 3QEUB 4JPWL 3OB0K 1JGLL 3M45A 1KEGH 1NC2A 5DJ0B 1TQBB 5F7WC 4Y19A 1AH1A 5CEYA 4NRZB 1WITA 2QQLL 4CKVX 4Y2DA 4MSWB 1NCCH 1BBJB 4WFGD 1JGUH 3QI9B 1NBYB 4G6FB 4B0MM 2GJ6D 3I3EA 1P7KB 2OP4L 5BXFA 1KB5B 5I71C 4BSVB 1TTFA 3JWOC 1BP3B 4JFDE 2EDYA 4DEPC 3NFPB 1NEZB 2B1HH 2BSRB 1R3JA 2F5AL 3NN8A 3B9KD 4DWHA 3SO3C 5F9JA 3JWDC 4GBXD 4NKMA 3QP3A 5D2NE 4I3RL 3N85H 5ILTL 3HUJA 2EH7H 3OKLB 3T77B 2X1OA 4WEBH 5HDOA 5JPNB 3VG9C 4F57L 2YC1A 2X89A 3KPOB 1KJVB 3LQAL 1N5YL 3CFDB 1MPAL 2OTPA 3U9PH 5GRUL 3D48R 1WUNT 4NQEB 2DQEL 5EIQA 4Q6IB 3RTQC 3BKJH 5JHDA 3HI5H 4Z7UF 5IVXF 2P8LA 4HMEA 4XC3L 1AGFA 2OI9B 3U0PB 3FHQA 2DQJL 2DM2A 3TIEB 3JTSA 4NQVA 4OBRA 5D70H 3IVKA 1IAOB 3GIZH 1MCBA 2OK0L 4M7KL 5JNYB 4X4ZA 1KPRA 5IB5A 5C6TH 2J8OA 1JMXA 3CLEL 2GAZB 2R9HC 1QHOA 4HJ0C 3MLWH 4LLWB 5EC2B 5C0BD 5D7KD 2GTZB 4J3SA 2DLFL 2BNQB 1H5BB 1AGCA 5EU4B 1EEUA 3QIWB 1U8HB 3UYRL 4F9LA 1T04B 4HKXB 4LAQL 1CFSB 1NUGA 1JRHL 1KLUA 3L3IB 3ULSA 5HHOD 4LHUD 3SGEH 1FLRL 4XNXL 1TVHB 2R2HA 2VXVH 1OM3H 4X7CC 1EO7A 1U8OA 3BESR 4N9GB 4O4YH 1OTSC 5DQJA 4Y16C 1PKQE 2X10A 4XVSL 4DKEL 5CD5D 1F6FB 4X6EB 2XNAA 4I1NB 1N0LA 4Q0XH 1VFOA 2NZIA 4X9BA 4DZ8B 1D6EA 4V2CB 5HGHB 4QRPA 3KYOB 4OQ1A 1XGRA 3MUHL 1INEH 3MJ6A 3QUZC 1BAFL 1FAKT 1OAUL 1F4YL 2EDEA 5BZDA 4M3KB 1RMFL 2CIIA 1YMMA 4OD2A 4OZHF 3PDOA 2VDMH 4NHCL 4E5XA 2EO1A 1QP1A 4AH2A 4JY4B 5IK3B 3NTCL 3DX9B 3B9KA 5SX5H 1RZ7H 1UVQB 4R2GC 1CD9B 1MWAB 1W0WB 4Q9CA 3HS0B 4DJMA 1I8MB 2D7MA 4RIRB 2CUMA 1C1EH 5AYUH 1AXTH 3ZDXF 3OKDB 4JPIA 2ADGA 3IAPA 2FJFA 2J6EH 5FKPA 3RNQA 3JWDH 1QRKA 5JDSA 5D6CA 3BP4B 4HXAL 3VFNB 4U1NA 1KELL 2GY5A 5FXCH 1J11A 4ZTOH 1ZT7A 4YWGL 1CD1B 1GYAA 5GISL 1LWRA 1HHIB 3EO0B 4ZG1A 5EZOL 5HPMA 3IDGB 1BJ1J 5GSVB 2I24N 2GK0A 4NRXB 4ZO8A 4NQEE 1BMGA 2QR0A 5I74B 2VSDA 3O9WB 3P11H 2QBWA 4GLRH 3OR7A 2ITCA 1KXVC 5I18L 4RMQA 2CDEB 2NY7H 3BP6A 3O6KL 4OLVL 1AGBB 4BKLA 4ZOBA 2D0HA 1GC1L 4UI2A 1A02N 1JWMA 4UT6L 3WHE1 4OCYH 3RY6C 3UYOD 5ID0A 2E27L 2VUYA 4F3FA 32C2A 1MJUH 5LKNA 3W2DL 5E70A 5FGSA 4H8WC 4HLJA 5I1CL 5FYJU 4KK5C 1ZGLA 5FYKD 4MA8L 4HMCA 4PG9B 3U1SH 1BJ1H 2LQRA 1HQ4A 2A6DA 3RZWA 3QISA 4YEFA 4PJ9B 1HKLL 4UBDD 2IMMA 3HE7D 5IB4A 1Y6NR 1NGPL 4RAUA 5J13B 2NYYC 5F9DC 2VLJE 2F19L 3CLEH 3QQ4B 1I1YA 3HZYA 3DYMA 3MQIA 1J05A 3VMPA 1X5GA 2WSKA 1GC1C 3ARSA 3FQXB 4WDIB 2R8SL 2AJYL 1O0VA 3UBXG 1CXLA 1EDQA 3BRFA 4DTGH 1OPGL 5B8CB 3KYMA 1WTGT 2F9BT 1MI5A 3TBTB 1U6AH 3GSVB 4N0UA 5IG7A 2OJZH 3FTGA 3UJIL 1QEWB 1HHGA 1S7SA 1VEMA 5FCUL 3SDDC 3TVMA 3LKOA 3NFSL 4JHAH 1A9BB 4XPFH 4C54A 5JMRA 3FQUA 3ZL4H 2NY4C 4UT9H 3X11A 1DE4B 2KBGA 2YBRA 2IANA 3MNVA 3EDKA 2J88L 3D0LB 1CGUA 1Q0XL 3QO0A 5IW6B 3EW3B 1J1PH 1OTSD 3SKMA 3H9YA 4XGZB 1KN2H 2Z8VC 2DDQL 1IRAY 3F12B 3VFUA 3C6LC 5F7DA 3FHAA 3F6IA 1NGZB 5FUZH 5HGDA 4R7NB 3CZJA 3V4PH 5IT2L 4HIXL 3QDMD 5D1QD 3SN6N 2Q86B 1T83C 4G43A 4IJ3C 1DQLH 4MD0A 4XVUC 4OF5A 4U1JB 2DQTL 3N50A 3BPLC 4Z76B 1H3PH 4HLZG 4S1QL 3VXNA 4Z8FH 3UMTA 3O4LE 4MDIA 4RMUA 5D7LD 3FL7A 4X9GA 3G9AB 3T4AB 4ODSH 2XN9A 4KKLC 3TNMB 1LE5B 1YEFH 2W1NA 4NNPL 4HWUA 4OJFH 4Z0BH 3L5JA 4MXVE 3LB6C 4Q7DA 1NAKH 5ERWA 5IESL 4M1CD 5B38B 5D7JD 3TYFB 3KJ6H 2AK4A 3DX8A 4OT1H 1U3JA 3T0DA 3SJVD 4PLNC 3EZ8A 4M93C 1HH9B 3DHJA 2JE8A 3BISA 2YPLB 2XN9B 1N0XH 5E56A 2EH7L 3RIFK 4UQ3A 3H3KA 4KKCC 3VXNB 2UYLB 2DWDB 2DI9A 4J6RH 4G8EB 5DR5L 1S9XB 2FGZA 5KANI 1UWGH 1N8ZB 5J8OA 3CC5B 5T1MA 4OSUL 4J4PC 4OCYL 1P53A 4NBYB 1MQKH 3B43A 1RZKL 2Y6SC 3MOAL 1MCIA 1GGCH 4YAQA 4TTGA 1CF8H 2R56L 3HNVH 2EE2A 5L8LB 1HHKA 4PB9H 4H25A 4HK3J 3V4VH 3GSVA 4KZEH 3TBTA 1BJ8A 2VDNH 1GZQA 4ODXA 3TJHD 4LEXL 3E6HA 4RMVA 1ZSDB 4JVPA 2N56A 1S8DA 4P9MH 2NY3D 4RFOH 4KTYA 4ORGB 4WV1A 3TA3D 2VMFA 1ZT4A 2IANB 5HHME 3QAZC 3RWFA 5I1GH 3O4LD 5D7KE 4IOIB 9CGTA 1GCFA 4FQIH 4XNMA 1FDLL 5F8QC 3FQUB 1BVKB 1CGVA 1RK0B 1M7IA 4U1JA 5C8JB 5HVHB 2Y7QB 1MCJA 2DMCA 4ONFH 3D9AH 4ZNEE 1QZ1A 2WANA 2PR4L 4DAGH 3BDXA 1EA9C 1WBZB 4KV5E 3ZSSA 5B8CA 4F7PB 3GMQA 1NGZA 1JIBA 2YKLH 5BOPA 4QT5A 4R8WH 2UZYB 4AIXA 2B8OT 3VFUB 4FHBD 3N1MC 5IOPB 2HT2D 1QR4A 5HD8C 3FRPA 4I0PD 4EUPB 2R0ZL 1L7IL 4RGNC 1EBPA 5IB4B 2JTDA 5BQ7B 2J88H 5DJDA 5I1LA 1WCQA 5F88B 2UWEA 1XIWA 3WFDH 3W82A 3MRMB 1FYTB 4K9EC 2ZG2A 3MJ7A 4CADA 1YEDB 2P47B 1UJTA 4LLQB 3IXTA 3VFPB 1CFVH 3EOBA 3A6BH 4XNQB 3VRIA 4IMKC 4Y4FC 4DUXA 4P2OB 3QUZB 2WMPA 4G9DA 5C86A 4FQ2H 2B2XL 2ERJC 4PY7B 3V0AC 5EBLB 1HHIA 2YHGA 5TFSL 3IDYB 4U33A 1JZ2A 2YA2A 4WDIA 4OZGB 5HTSA 1WFTA 5DLMH 3VXPB 1J05B 4JG1L 1AE6L 4XP1L 3V6OA 3QDME 2ZCKH 2D03H 2R15A 3O2WH 4EBQL 3CLFL 4YWGH 2K9UA 4ETQB 3ZMRA 3VMOA 1MRDL 4JRWA 5F9AC 5JHDE 4G8FB 2HYMA 3FONA 4W6XB 3BOVA 1EH9A 4WY7H 4NRXA 4LVHB 4K7PX 3MXVL 4J4PA 4GBXC 1UVQA 2IAND 1G7PA 3WNMA 4POUB 2XKNB 4UTAH 2P7TA 3P73B 4OF6A 4PJ5B 3BO8A 4NQDD 2RHEA 4PJBA 2ZZUT 2JJWA 1I3RA 1T6WA 2ICWJ 1CLOH 1FFOB 1CFNA 2CIIB 3EZJB 3VFNA 2X1WL 4JN2A 3QWOA 5JIIA 2ARWA 2LU7A 1QNZL 2DQIH 4WWKB 3U30C 1CS6A 2WUBL 1N64H 2ZSVB 3NOIA 4U1HB 4DVRH 3ARBD 4O5LH 5GZOD 4M7LH 2VXUL 3QCVH 1LDPH 4MCYA 3TPUB 1V3JA 2DICA 2DQDH 2ITCB 4BSWB 4NN7B 1FGNL 4GH7B 3DSFH 3BD5A 3BDYL 3SDXA 3X13B 3RTQB 2MCG1 2DMKA 3STZA 4FQPA 5JOPE 4EI5D 4E5XB 4MNHB 4L8BB 4PJ7B 1NEZG 3ULUE 3CDGB 1FPTH 2XTLA 5D1ZA 1FO0A 1JRHH 3C5ZA 4L4VD 2FIKA 1K4DB 5CHNA 1R6VA 2MQCA 3C60C 3LHPL 1KN4L 3ZO0A 1ZT7B 3GUTA 1RJZB 2OBGA 3JVGA 3E6FB 1F6LL 2AEPL 1U91B 4TQEH 4X6EA 4MWFA 4WFHD 4QRSA 1RUPH 3T0ED 3F7RA 2KPNA 1JNLH 2VOTA 3QFJB 3VW3H 4OI7A 2J4WH 1CE6A 4QHUB 2EXYD 3S4SB 3T0EA 1S7VA 1V7ML 4H26A 1C16A 1TVHA 4C56D 3ARVA 3U0WH 3QUXD 5TGBA 3L7EB 5IK3A 2A74A 4PLKC 3KPNB 5I1EH 4WW2F 2HJFA 1J8HE 4HXBH 4HBQA 3ZL4L 3DGCR 4CN1A 3KPLB 3MJ9A 5JORA 1BD2D 3QQNA 3LEXB 1TZGL 2VN4A 1L6ZA 3O6MH 4LLWA 2W0PA 3MV8A 3OPZL 3KLHD 1KUMA 3VFGL 2QJDA 4BZ2H 3H7LA 2OQJA 1S7RA 1JUFB 3WNPA 3WNOA 1HDMA 1I1RA 2A77L 3MLUH 4K07A 3MRBA 3WFHA 5JUEH 4P9HC 5F7EL 3H7BB 1BLNB 2ZWLT 2AJ3A 4QRUA 1KELH 3B9KC 2DQJH 4F7CB 1I1AA 1OW0C 5JPMB 3KG5A 2O5ZH 3I6GA 2Q87A 5FFLA 5JQ6L 2IALA 1G6RB 2ZUQB 3EFDH 4I77H 3VFMB 2PO6B 4NQEA 4FQ1H 2Q20A 4HCRL 2HJLB 1KCUL 2F53A 3TNNB 1B6DA 1Q94B 3QI9A 4M7LT 3UZEA 4UOW0 3OKLA 4OB5L 4WJ5B 4LLYB 3I02B 2XT1B 2Q8BL 2C1OA 4I9WE 5FO7B 4EI5A 3ARGB 5IB5B 4TYUA 5EU6E 3QDJB 3CLFH 1AHWB 4GQ9L 2NX5D 4AM0B 3BH9A 3SDCC 1SBSL 2A0LD 2UVEA 3GMLA 3HLAA 1MHPH 3P4OB 4Y19D 3QFJD 2COQA 2Y9RT 2FWOA 4O4YL 5E6IA 4HJ0D 3MJ8B 1J1XH 4MSWA 3BWUC 2NW3B 2EH8H 1CDCA 5E08H 2I9LA 4M43L 2CUIA 2F58H 3FN0H 4KK5D 5KVEL 2JJUA 3GI9H 3SGDH 2I9TB 2VL5B 1E27A 3MRGA 1UCBH 3RIFF 1A6PA 2I26N 3K80A 3LKPB 4LKCB 4QHNB 3GMNB 4WI9A 2JK5B 3S34H 3NFPA 2F5BL 1K6QH 2YRLA 3IDNA 3C2AL 2V5RA 4YGAB 1MFDH 3ECBA 4JPKH 4RA3A 1CBVH 3T2NH 4XNUH 3GMMB 1Z2KA 1YPZA 4WFGE 3IDJB 3OKNB 4UTBL 4R97B 3MFGB 4GUPB 3V7MA 3SGKA 5D93C 2DQUL 4YHML 4I9WD 3F8UB 3DURA 1BX2A 1F6AA 2E8YA 3PJSA 3L6FB 4R26L 4P3DB 3QDMA 5D1QA 3OJVC 1U8QB 4P57A 1TCMA 3W9DA 4LCCC 35C8L 2EDDA 2QHRL 5F3BB 1D5XB 4NT6A 3RWGB 3UJJL 1KN2L 2XZZA 2NY6B 2GYSA 3DI2B 1CZ8H 4X8XA 2V2TA 4JFEA 5GRJL 4XP6L 3H2WA 1XH3B 5F1NB 1NBQA 2ZUQC 3LMJL 3B83A 1RJYA 3CVIL 3BZ4B 3O3EA 1RVFL 2ZKHH 4LP4A 1CDJA 3FCTA 2OCFD 5F96H 1IKFL 3ZT6A 1XF4A 1HHJA 4UV7H 1N6QL 4Y4HC 3SE4A 2YD6A 1HXYB 4HLZH 2UUDH 1S9WA 1ZHLA 1RU9L 4NCC2 2GT9A 5IGXH 2QKIB 1WICA 5DEFA 1FZMA 2YSSA 3SOBL 3MLSL 3MUGB 1UADC 3BUTA 4OZGF 1VEPA 3CXDH 1JPTH 2VDKH 3VFOA 3QDGA 2CKBA 2HT2C 3O4OB 2HFGH 5H2BB 4OKVA 4HJGB 4NUJB 4RWYL 2NTFB 3ROLB 3VE0A 2BMKA 5GGRY 4PJFB 2P45B 5DT1L 2YS4A 4X4XA 2BY1A 1FNEB 3BP5B 1KBGH 4OFPA 5FV2A 4EZMA 1RK1A 1F11B 3VWKB 5ICXB 3LQZA 1JPFA 2W0FB 1M1SA 1U8LA 4PJDA 3T2PA 4AL8H 4JFDB 4LRNL 4L8SB 3W11C 5DURD 1TFHA 1G0DA 4MNGB 1YQ2A 4OAWB 3V4UH 4F9LC 5MP6L 1AR1D 2B4CC 4O9HH 5LGKA 4FNLL 4PRAA 1F3DH 5CZVH 4JR9L 4JDVB 4JEGB 4N0CD 5J11C 2YEZA 4FFZL 2IAMC 4JLRA 2QSQA 3FT2B 4XBEH 2RCSH 3IS0X 1NAMH 5DMYA 2ENSA 1XGUB 5E8NB 4DFIA 5TDNB 2NR6C 5D7JA 5CGTA 3SGJA 2CGRL 3BRGC 3SGKC 2NXZC 4KFZC 2CDFA 1R3IL 1QFOA 4P4RA 3TH4T 4L4VB 1KTLA 4LRIC 5JA8B 1U41A 4JQXA 2FR4B 3LS5H 3QDGB 3WLWD 3VFOB 1R5WB 3OB8A 4I3SL 2GI7A 3LN4A 3GJEA 1I1AC 3C08L 4OLZH 1J9CT 3NCCB 1MNUH 1TQCB 2GT9B 3NABH 4OV6F 1RUPL 2E9BA 2VR9A 4OTXL 1OP3K 4UTBH 3UTTB 2X4QA 1A8JH 1A1OB 3GSNB 4L9DA 4FTVA 4XTRC 5ENWA 4QNPF 4MJID 3DO7B 1G7JB 1GZPA 4YPGB 5KTEH 4WI4A 5JOFA 3RGHA 2JCCB 1ZA6B 2FRGP 4MHHI 1NL0H 4G42B 4PRAB 1CXEA 2XYCA 1I7TA 1QR1A 1KACB 2P5WB 2DB8A 1GGYA 4FP8L 1HQRB 4KI5D 5TE4H 4BSJA 5DQDH 3EJZC 5AG9A 5GRJH 4KU1A 4FQ2L 3VFGH 5DJ6A 3S3SA 3KPQB 3L6FA 1LNUA 3ULVL 4X4XB 1QFPA 5D7LA 5BS0E 2AXGB 3CSYA 3PNWA 2EE6A 1XAUA 4GUPA 5HGAA 3HC0A 1GOHA 1Q38A 1IAKA 4XAKE 1ZTXH 2Y4SA 3GMMA 1MFCH 3MRDA 2X6MA 3ECBB 5D9SB 4F8QA 5I73B 3HZVA 1S9YB 2YD9A 4NUGL 3T1FB 5C0IA 4TUJA 4PGEB 4YHOH 4ODVL 2ZOLA 5IVZA 4P9HH 1S9WB 5K59E 4PP2A 4C4KT 5MENE 1AXIB 4XP4L 1HWHB 4G6JH 1IC4L 2I9LB 4K2UH 3GDBA 3IFOA 2ED7A 3BQUD 3WBDA 4QHKJ 1RMFH 4NWUH 5IBTL 3M1BA 3HI6L 1N5YH 5HHNA 3QDAA 1U3HC 2R1XB 3MJ8A 5KN5A 4EI6B 1NSNH 2Z9TA 1QKZL 2DQFA 1JWSA 5EO0B 2AI0L 4JFZH 2DTSA 1WCBB 2B5IB 4Y4FA 2JB5H 4W6YB 1WBXB 4EVNB 3VXRA 4YUEL 1C5CH 1DVFD 1ADQA 4ZNEA 3LRGA 1OTTD 3O6LH 3ARFA 4QRPD 1ORQA 3Q3GB 4L3CA 2EE9A 4PJ5D 4PJAA 2JELH 3BJLA 2PYFA 1LO2L 5FM5O 3WLWC 2X4TA 5ITFA 1NFKA 3RIAK 1R3IH 4HF5L 3TBWB 4PJEA 4EN3A 3UYRH 3WXVL 3H8NA 5HHXL 1MFDL 4PJCB 1G1YA 1WFUA 3TYGH 5D71L 4C56E 5DHVA 5FUOH 3QG7L 1MLBA 3KPMA 4XH2B 1F00I 1QLRB 3OF6A 3GNMH 2XXMB 3G04A 3LKPA 4LHUA 1EO8L 1ONQB 4MGXA 3H7BA 2D03L 1IAIH 3PIQB 1YYLH 5HHVL 1BOGA 4U3XA 1BVLB 3MMEB 2C7UB 1L7TL 1R5VA 1CXKA 1S7RB 3RVVD 2IH1B 1PKQA 4UILL 4F2MA 3SY0B 3RDTB 5F1KC 5MEQB 35C8H 4NC2B 1DZBA 5D8JH 3IS1X 1EZVY 1KC5L 1BOYA 5INCB 2DJ4A 3PXJA 4XX1G 4YDVA 2HT3D 3DI3B 1R5IB 1OOAA 4LSVL 4YXLL 1IFHL 3NCJH 1NL0L 3R06B 4LDLB 1CN4A 4Z78A 5BOZG 3B9EA 4HS6B 3HLAB 1JI2A 1LEGB 3LMJH 1R5IA 3L7EA 3I9GH 1GIGL 3VI4F 3ULVD 4MB5A 1WZ1H 1ZLVH 2V2XB 3SBWC 5A3ID 5C0CD 1UWEH 2VXUH 3QCVL 4X6CF 3QXVA 2FZ3A 1YJDL 3TBSB 4D0DA 4HG4K 4NCC1 4OZIB 3HMWH 3SGDI 1CD8A 5HI3C 1KEMH 3WKNA 1MFBH 2B0SL 1AD0A 1T66C 5TE7L 3HAEH 1TJGL 1JF1A 3HZMA 5GGUB 5BJTB 2F54B 5D7LE 2ORBL 1LP9E 1AXSB 5GGUA 1U2HA 1KB5H 3S5LA 3VXTB 1K85A 4L8BA 5D1XB 5GS0D 2FEEI 3TBWA 3FQWA 3U36A 1KOAA 4JDTL 3ROOB 2DIAA 3TN0C 3T04D 2MMXA 4K3HA 3NPZB 4LF3B 3V5DA 2OR7A 3TPUA 5E8OA 3RPKA 5C0JB 2EDJA 2FZ3B 4HK0A 5HHOB 3O3DA 3ALPA 5CJOL 4LCIL 3V0WL 4A6YA 5C0RH 2Y07H 3LEXA 5CINL 5CIPH 4JN2B 1OQOA 4FFYL 4IRSA 4UINL 1QFWM 1OTUD 1WVZA 3WIIH 1J18A 4Y2DC 2BNQD 4KJPD 5GRVK 5SX5K 2WWMD 4FTVE 2XKNA 3NA4A 4JHWL 4MDJA 1H3XA 4WV1C 4YDVB 1UG9A 4C56B 3VMNA 1D6VH 2EXYC 2PNDA 1CE6B 1WZMA 4S1QH 5DDHB 4GSDL 1NGPH 4FZ8H 1R5VB 3MLYL 5L6YL 2CGRH 3HAEB 1C5BH 4IIQB 5J1SC 2FGWH 2RR3A 1UB5B 3IRZA 3BMVA 3LN9A 4NGHH 2YWZA 3W11D 5C0BA 1KIPA 5ICZA 2GJJA 3QUYA 2GK2A 4ZO6A 1T5XB 3DUUB 3EO1B 4YQXL 3F58L 5CHNB 3H6JA 4XPGL 2BSSA 1RZIA 4KMQA 1OPGH 4HW6A 4QY8A 3C08H 4OLZL 3E2HB 3HZVB 3O11A 1IEAB 2WUCH 5CP7B 1LD9B 3GBLA 3X13A 4G5ZL 1CT8B 3VXUA 5ALCH 1ACYH 4NO5B 4G9FA 2IBGA 2WWKT 2Z35B 5C07E 4OD3L 3MRMA 3QCTL 1CGWA 2WINA 4MVBD 1WC7A 3LEVL 3GHEL 1DBML 2D4DA 4MHHG 2Z92B 4YDIL 5DFTA 3CFCH 1TXKA 1HCFX 5SWSE 4Y19E 4UQ2A 1BVZA 3QWOB 2YD3A 5AAMA 1JWSB 2H9GB 1XCTA 4ETYA 5DS8A 4GAJL 1T21B 4OI9A 1JZ6A 1LEIA 3L3DA 1QR1B 1U3HA 3K8KA 5IMKA 1KGCD 2IMNA 5EU7E 5C0AE 4PJGF 5I1KL 4PIRF 3IFOB 4X8JA 2APBA 1GZPB 5CBAB 3B6SB 2OK0H 4AIZA 4PRBB 3FB5A 4LPTA 1FVEA 3RJQB 5F6HJ 4RCAA 1A6UH 1UKTA 4GG6F 3ESUF 1MFBL 5D5MB 1WT5C 3U48A 4YPJA 3RVWD 2D7OA 1FVDA 1S8DB 3LQMA 3HFMH 4MQXC 5GGSB 4M1GL 4Y16B 5CEXA 3P9MB 3BHBA 4RNRB 4RWHA 4IOFC 3D3VE 4OM1L 3NIGE 4PGJA 3MRDB 5J1AA 4H25B 4LSTH 4N0YH 3MRKA 1PBYA 3VFPA 2AABH 3HE7A 2WIIA 3MODH 3D1MC 4LFHD 4CADB 3KLDA 4DOHB 5C1MB 4B7IA 5KSVB 1FIGH 2OS7A 4QXUL 2WBJA 3VCLA 1BWWA 5BQ7A 3CC5A 5T1MB 4JDTH 2HWZL 4LOUC 4W70A 2Y6SD 1L7IH 4OGYL 3AREA 4MCZA 4MNQE 1FCGA 1N2RA 1MFAL 3C5SB 2APXA 4JG0H 1XR9A 1HI6A 3E2HC 4NC1E 3VWJA 2XFXB 2YPKA 1I7TB 1IKNA 4J3XA 2V9RA 5C08D 3OL2A 5ABDE 2JB5L 2I27N 1I8IA 3I6KB 4UZGA 1T89A 4L8SA 5ENWB 1QSFB 4PJDB 2ZCKL 1F11A 5C07B 3VWKA 1S5HA 1EVUA 3IXAA 5FOBB 1M7DA 2EIDA 1WSST 7CGTA 1JK8B 1FJ1A 3UTQB 5DK0A 4WV1B 5D72L 3CMGA 7FABH 1U42A 1HSAA 5D71H 4MD0B 3CDCA 1H3TA 2AJUL 4XPGH 3V6FA 5IMOA 4XVUD 2FR4A 1RZJH 4O2EB 4R4ND 3PGFL 4TVPE 4R7NA 2H3NB 1G9MC 3S37L 1DVFC 4G5ZH 2CJUH 4R2GD 1A0QL 4U6YB 4JHBA 4MNQA 3V5KA 3F12A 5F9WB 3LH2L 4XZUB 3TIDB 2EZ0D 4M7LL 3VRLF 5ISZB 3MRCA 3O6KH 4NQCD 4S0SD 1W72A 4AENB 4S1DD 3FCTB 4EDWH 5LGHH 2DQGL 1YY9C 4O00A 3G5YA 4P23D 4FQXA 1JTPA 5GGSY 3X11B 2YEZB 3PWNB 5I0DA 4UAOC 2ICEA 3QNZB 4NDMB 1MRFH 3TCXA 5C0CB 3WFDL 2O93L 2YXMA 1CGTA 2N1KA 3HPJA 4M9PA 1U95B 3K81A 2APTA 2R23A 5FGCE 5ITBL 2CH8A 5D7IF 3GIZL 2B4CL 2AJSL 3SDDD 4TULH 4O2FB 3D0VA 3MGTA 4HCRA 5T3XE 1YJDH 4FXLA 4WTZG 1MFEH 2DQCH 5GRVL 2X09A 4OM0H 4XCYA 5L2KB 5IIEA 1NGWB 4TQEL 3TNMA 4ZS6C 5IFHH 3HMWL 4P57B 3KHQA 5M95B 1TCRB 4KK6C 4DOHE 4KMLB 1RK1B 3CPLA 2F53E 3FQXA 4C55A 1T0PB 1G9NL 5EPMA 2OMNA 2BDNL 4NIKB 4JG1H 5DMGD 4HGWA 2A2QT 4EDXB 3EDDA 4BQ9A 1GRWA 5FGBA 1EFQA 1B0RB 1D9KD 4PJEE 3HRZA 3BPOC 5IBTH 2J7LA 2Z31C 3MXVH 2IPUG 1TZHA 2V7NA 4X9IA 3MJGX 4XBPB 5IB3A 5JXEA 5DRZB 3RDTC 1WTLA 4XVSH 3EOAB 1V05A 2FNBA 2ZG3A 1JP5A 1V3MA 3DXAB 3IJSA 1S3KH 2D7QA 5ID0B 1T22B 4JKPH 4G8IA 1D9KC 1YUHB 1X44A 2IQ9L 1OAUH 2WK2A 3PWPD 4NKIL 4XMPH 1AC6A 4A6YL 1A1NB 2CDEA 2GW5A 2MHAB 4LHJB 1FORH 4ZXBB 1HZHH 1HHGB 1S7SB 5D7SH 4JB9L 3VFWB 4N0UB 1NCWH 1FP5A 4MNQD 4LCUB 5IT2H 3U79A 4LASH 4M6NL 8CGTA 5BVPH 3TYGL 4FFWD 4P4KA 3OHXA 1PZ5B 2DQTH 3PJSB 1BFVH 3LKNB 3U83A 4Y5YA 2PCPA 1T1YB 2BNRA 5F72S 3ZYJA 3TA3C 1HILA 1CFQB 5I6XB 4YHYC 3DVGB 1FZJB 3UJTL 4O51B 5EOQL 2BCKB 2ADGB 4LAJH 5GGVY 3OKDA 4JPIB 4UV4H 4WWKD 4JCLA 4G9FE 5AZ2H 1I8MA 3HS0A 3HRPA 4KROD 5IM7B 1KFAL 2HJLA 1BZ9A 2A9NL 4XNZC 1FNSL 2O5XH 5F89B 3BXNA 3D25A 4M7ZC 4PRIB 2ID5A 5HVGB 1J1XL 3LEYH 3PWPB 1HE7A 2IALB 1FG9C 4XPHH 4XB7A 4QHNA 5CJQL 2FYYA 4PJHB 2FEEL 5IEKA 1ZHBA 3P9LA 4GRLA 5D1XD 2H32H 3E1F1 5FYLL 4RMWA 5KS9B 3WDIA 1GJIA 4YLQT 5HDBE 1P4BL 2JIXD 5E99L 3AM8A 3OPZH 1P9MC 1N5AA 5DD1H 1MCDA 1JHTB 5EH1A 4FQQA 1X5AA 2F5BH 4OLWL 3QA3B 2HLFD 5H94B 3RFZC 2FWOB 2ZPKH 4KK6D 4PLJC 2R56H 3ZDZE 4LAQH 1C5DA 1REIA 3S7GA 3SCMC 1T20A 5ADPH 3JZ7A 1DP0A 5FHBL 3VH8B 4G80A 3QDJA 1URLA 1KB5L 3RHWF 2C3XA 1QFHA 4XAWH 1MFEL 2DQCL 2Q3AA 1NFDB 1BECA 1U8MB 5EUKA 4GG6B 2C4XA 4K94L 3EAKA 4L1HA 5JDSB 1EHNA 1W8NA 1G6VK 5HHPB 1U3ZA 1X5IA 1MCWW 1A6WL 5I1GL 5EC2A 2VN7A 1Q94A 3MCG1 3HFML 1KPVB 1UZ6E 1OP5K 2X4NA 1CDIA 5E5MB 1W0WA 2YD5A 1OB1B 4G80B 1CL7I 3IAQA 1IAOA 1P84J 2I25N 2DWEA 4LCYA 2EDXA 2PO6A 3C5ZB 3OAZH 4X5WB 3EJYC 4QKXB 3TBYB 1PZUB 3FO1B 5FM5M 2VDML 1YMMB 1TZIA 1FIGL 4X5WA 1MLCB 4XCFL 3TJHC 4PGCB 5EUOF 1JBJA 4S11A 4P4KD 5D6DC 4J3OC 2WBKA 1QBAA 1D6EB 5EA0L 1CI5A 4MQTB 3UCRA 4FABH 3HZKA 3VXRD 4GSDH 4HG4J 2B5IC 2Y06L 4PJHE 5E1AB 1FL6A 1GGIH 3FN0L 2UY6A 3ISWA 3AU1B 4MX7B 1X5YA 4HFWA 5HYQB 2YMXL 2P8MA 2AQ3A 1U8OB 1F42A 4ZOEA 3IFNH 1IT9L 2NY3B 2ZCHL 2HT4D 4GRLD 5C70A 3TBYA 1YEEL 1ZANL 1IGML 3A6BL 5EZOH 4QRRD 1JYXA 4PJGA 4DN3L 4HKXA 1SVCP 3QEGL 1ZOXA 2IADA 4QHUA 1I9EA 1MHCA 4ETQA 4PV8A 5J3HD 5AWNL 4NRZA 5HHOE 2DM3A 4HPYH 1U91A 1KB9K 2LE9A 4PJ8D 3GHEH 4UBDC 3E6FA 5J06A 5FOJA 1NC2B 4LU5H 4XT1C 3IDIB 4Z0BL 3O9WD 5EBWB 2Y5EA 1D3CA 1UJ3A 4X7TB 3K4ZA 1SY6L 3V4UL 3VGAB 3IVKB 4ENED 5CGYD 5CJ5A 3KJ6L 3TIEA 1HWGB 3MLRH 4MNHA 3U4BL 4NQDE 1NCAH 5CILH 3VG0H 4JR9H 1Z3GL 3GSRB 1H8OA 5KVGL 5I1CH 5DMKA 1BZ9B 5DQ9B 4M9OA 1KJVA 2AV7A 2F74A 4MCYB 5LGHL 2XA8H 3JV6B 3MNWA 3KHOA 4Y4HD 2O61B 4U6VH 5TDOA 5C0RL 2X44D 1F4WH 1M7XA 5FYJE 3WDJA 4BQ6A 1RZKH 3CFKA 4X4YA 1MAML 1T1YA 2BNRB 5IOPA 3SDCD 4PJIA 1UA6L 4PJHA 1YDPA 5CUSH 1I3VA 3WKML 3BKCH 5KOVC 3RUGF 2IPTH 1NEZA 4PJBB 2V7NB 4BUHA 1UC6A 2XV6B 4F7EA 3OKEA 1HOCA 2ICWA 3NABL 4QF1A 4AMKH 4H88L 1J8HB 3QI9D 2MHAA 3BZFB 2FL5A 3ZE1E 1WZLA 4XNMB 1QBBA 3O2DH 4IOIA 1FL5B 3MLPA 3T8XA 5GSRA 1PSKL 3WDHA 3RVWC 1ZVSB 3R0MA 2ZG1A 5C09D 3VW3L 5IIEB 1L0QA 2EC8A 1ZSDA 2AJZA 4G9DB 4W81A 1AGDA 3C9NA 2Y1VA 5T3ZE 3GSWB 4TSAL 1H15B 3MV7A 5KG9B 3RWIA 1QSFD 1NC4B 3PG2A 1TNMA 3NH7H 5E8EA 2IANE 5DXWA 4IM8A 5HHMB 1AIFB 2UWEB 3QNZA 4NDMA 3SDAD 3QIUC 2A6JA 2A6IB 1Q9WA 1PJ9A 1AKJA 1CWVA 2LV4A 5JXED 4FQXB 2X42A 1DANT 4HGWB 1ZHNB 4MD4A 4TUKH 3ZTNH 3QEHA 5DJZB 3RHWK 5DRZA 1ZTXL 3ALXA 1TCRA 2BFVH 3HR6A 3GMQB 3Q1SL 2P8PB 4PYHA 4ZYKB 3LV3A 4ODBD 2QHLA 4FFVC 3MGTB 1AD9B 4X99A 3VD3A 1IGCH 4HJJH 4BELD 5JDJA 5ECJE 4HQQH 1FLTX 3HRZB 4DKFL 4UB0H 2KDGA 3SQOL 1G0YR 4ZUSA 4ERSH 3OGOE 3VWKC 1CU4L 4IDJL 5E6ZA 3L3OB 5I8EB 2ICEB 4PRDB 3T4AA 1I7ZA 4POZC 4X5LA 2OSLA 2AEWA 3QPQD 1FE8H 3IXAB 1Z5LA 3NAAL 3WXWH 1M71A 4FS0A 1SY6A 1KCSL 3PWVA 4U1KB 5EZLA 4N8VG 4KJQC 3MSPA 4HPYL 4NPYB 4AENA 3C09B 4JRXE 5L2KA 4Z6AT 4EDWL 1OTUC 1KCKA 2YWYA 1FAIH 1GZQB 1CGSH 1OD9A 2EXWD 4ODXB 3GI8H 2OJEB 4P59H 5CIPA 5DZLA 1NSNL 5E5UB 3O3UN 3S8WA 4C59B 5BW7A 2R23B 1SBSH 1DVFA 4KZDL 1DL7L 3UO1L 3SBWA 4K3DH 1FGVH 3SCMB 4JFZL 4YAQB 1CXFA 2P24B 4DUVA 1IQDB 4P5MA 4TSBL 1T6VN 1V3KA 1OY3B 3V6BR 2LTQC 2Q8AL 3V9FA 4PJDE 3RPIB 1SJEA 4JFFD 1IGTA 1DQMH 5DO2C 1HSAB 5SWSA 3MRFA 43C9A 3C60D 4KVNH 2GCYB 3MRCB 2UYLA 3MNVB 4Q9QL 5IB2A 1DE4A 3EOTH 4RDQF 4Z7UB 5IVXB 2WBJB 4LVEA 2BDNH 2M26A 1N6VA 1EMTL 3MRHA 3TF7C 4EIGB 5KVEH 3GSUA 1FDLH 4POYA 1HH9A 2NYYD 3BZEB 4O2EA 2NY6C 2MFNA 3N1GC 3BVNB 4BA8A 3QEQB 4JM2D 3T0EE 5B38A 2LAAA 1MCFA 5FYJD 3U7WL 2VDQH 5CEXB 5J1TC 2PR4H 5HGGS 4DAGL 3MBEC 3VWJB 1OP3H 1MELA 2XOTA 3EYVB 4YR6B 3U7AA 3HNTH 1KNOA 1JGDB 4UT7H 4G7YH 4HUVA 3QHZH 4HT1L 4JKWA 2OYPA 3G5VB 1NAMB 3MLXL 4AEIH 4LEOB 4RAUB 2R0ZH 5J9PB 3VI4E 3JXAA 3X3FH 4RSVA 3QZWB 5F6IB 4G3YL 1LEKA 4I13B 2ZNXA 3UJJH 1UYWH 2RJMA 3QUKA 3S88H 3ARED 4NQUA 1LGVA 3VFSB 3K2UH 1BGXH 4E42B 1CFVL 3QPXL 1UB6B 1NDMA 3BPNC 1PEZA 2YD1A 3C5SA 3RTQD 5DVLA 3P0GB 4HIEA 1CLZL 2NCMA 4F7MA 2J12B 5F7HA 1K2DB 2B0SH 4PRPA 5IWLC 5GJSL 1NBZB 2AS5M 1WC7B 3L1OL 3QJFA 2IEPA 4ZSOB 3TVMB 5E7FA 3UJTH 2DLIA 3ULUL 2E8ZA 1ZA3A 4I2XA 3MRKB 2VR4A 1JGUL 5CP7A 1LP9A 5T33L 1OM3L 2BY0A 4L9LB 4PRNA 3L3DB 5HPMB 3MCLL 3MV9D 4D3CL 3JUZA 3FQRB 2CMRH 3CXDL 3KPTA 1AO7A 3V6OE 4L9LC 3SQOH 4WHDA 1JWUA 5DRXB 2DI7A 1W0VA 2DQHL 4PUBL 2Z91A 4KY1L 5H35B 3LS4H 1LDSA 1A22B 3VXME 4GLRI 5DT1H 3TVMC 3RNQB 1LO4H 5IMMA 3B6SA 3RWCA 1QYGL 1T03L 4XHJC 4HPOH 1A6AA 1BIIA 1C7TA 4JFXB 2XZAH 4O5LL 4PJ9A 1P4IL 3OZ9L 1KC5H 4LMQI 3RGVD 4D9RD 1N59B 1MUJA 3KPPB 3PWLB 4GBXB 3TFKC 1ULVA 4DGIH 4PG9A 4Q97A 3B9KB 4YIQA 1I1AD 3OX8A 3LRSB 1CT8A 4K3GA 5TQ2L 5GGRB 3VXUB 1WAAE 2GSIA 4C83B 4LSVH 3KNBA 3I3DA 3S36L 3QXWA 5E94B 1DLFH 4ZFZA 4LHUG 3FO0H 1UQSA 3BT2L 4UQ2B 4R96B 4YE4L 2VLRA 1QRND 1CFTA 4LLDA 1UWXK 2OLDA 3NZHH 3D85B 4IRSD 2VH5L 4M7KH 2J6EA 4B53A 4DZ8A 5ICZB 2BSTB 1PGRB 3GRWA 4EOWL 5C0JA 4NGHL 4P2YA 4PY8I 4AZ8A 4KK8C 1A6TA 1OF2B 4G9FB 2VQTA 3NIDE 3K8MA 5MHSE 1X4YA 2X4UB 4HBCL 3DTXB 5TE7H 4BH7A 1IEAA 3GBML 5JLZB 3QUYD 3RDTD 5GJTH 1JJUA 4PYGA 2VDLH 1ND0B 4C56A 4JY5L 2WUCL 3DRQB 1IC5H 4PBVC 2A1WL 2J8UB 1EBAA 5FYLD 2QV2A 3ILQC 4NO3A 5E2WL 2WLYA 2AQ1A 4K71C 3B3IB 1QLEL 3QIWD 3QUYB 2GFBA 4HV8B 3LEVH 2HVKA 4YBQC 4ZO7A 1Q9KB 1AD0B 1A9EB 5EO1A 1A3RH 4ZUWA 4QTIL 3HI1A 5EO9B 3Q5OA 2X1QA 4HK0B 2V5SA 4JVWA 4MAUH 5L0QC 4NO0D 3LZFH 1RIHL 3P4MA 3D3VD 3B5TA 4G7YL 1KPRB 4MXWL 3FO2B 3OGCB 3V8OA 4KJPC 2O5XL 1INEL 1I7RA 1CDUA 1KIUA 1OAXH 3U0PA 3R06A 4JFOB 3QXUA 4OD2B 2DLEA 2FCBA 3UTOA 4KROB 5C0AA 3STLB 2ADFH 5BJTA 1RZ8B 4HUUB 1EK3A 3KWWA 3DV6B 3EDFA 1QSZA 3TO4D 4WWKC 5MEQA 2PYEA 3K7UA 3T77A 3VGHA 4LCCA 4LF3A 3V5DB 2MCPH 4Z7WB 1CLZH 4FZ8L 3MLYH 4KRPB 2XPGB 3ZLQC 1U8KA 2F53D 1YEGH 4JO4H 2FGWL 1XF3B 5C0DB 1YECH 2PYEB 1TJIH 5F1SA 3B4NA 3BIKB 1AQKH 4QWWD 2BSRA 3TJEH 2DS4A 4LVHC 4Z0XA 4J4PD 3VA2C 3VGFA 5EFIB 4OZFG 1T1XB 1LEGA 1OLLA 4AY0A 4ZXBD 1GGUA 3LRHA 3DMMB 3HE6C 2FBJL 4X80H 3QIWA 2C3GA 3NACL 2VABB 4L3EB 5SX4H 4Y2DB 4MJ4A 3OR6A 4LQFH 2GTZA 2X4PA 3DVNA 4L3CB 1U3YA 1JZ4A 5CEYB 2X9WA 3ARFB 2EDTA 3KLHC 3RDTA 2DDQH 1BD2A 4HKZA 2R0KH 5HDLA 4FZEH 4PP1D 5LQBL 3WLBA 4M43H 2W9EH 4OF0A 1INQA 1Q9KA 2BVTA 3T65B 4Y4FB 4ZS7H 1WLHA 2R4RL 2HVKB 5TF1L 1FFRA 4K3DL 3WV0A 1I9IH 5DJYA 5IMLA 4HAGA 2IWGA 1RUKH 2W60B 4OGZA 2IPTL 1NLDH 4X7FC 1MLBB 4XH2A 1DQLL 3S34L 1XIWD 3DRQA 1DDHA 5FGRA 5CBEA 1SVZA 4XBEL 3SDXE 5DD0L 1I85A 1KPUA 4JFFE 4D9RE 4X6BB 5JW4N 1DUZA 4JPKL 5JPNA 4YE4H 2Y06H 1G7LA 2X4UA 3N0PB 5CD3B 3OJ2C 2C7UA 1BVLA 4L4TB 5TQ0L 5I1HH 2EEAA 3AB0B 4NKMB 1NCNA 2F8XC 4K3EL 2AXHA 4XPTL 1FNGA 1YZZA 3IFPB 4KRNA 4F9PA 2ED9A 4TUJB 1J0KA 5C9KA 4WHYH 3KLAB 4QLRA 5EO0A 5HDQH 4XCEB 4LVOC 3K1DA 4TSAH 3VXOA 2WWKO 5ISZD 4YIQB 2UWEE 1S9VA 2AABL 3O8XD 2JJSA 5IKCA 5CS7A 2PTTB 2Z93B 3QHZL 1W72H 3C5JB 2C1PA 4UT9L 2V7HA 3GGWA 3H0TA 4GRLC 5DD6A 4QTIH 5E2JA 3P4NB 1V8HA 3QHTC 4LPCA 4UILH 2ESVB 3WL9B 3INUL 5DJ6B 4IIQC 2NY6D 3P0VH 4WCYL 4NJAL 4R90H 4D9LH 1W0VB 1CF8L 4MXWH 1S5IL 5CILL 5EDXA 2E7LA 4U2ZA 1ZLUH 3C87A 2P5EB 2JF1A 2XQBH 3CFBA 5J89A 5C07D 2YPVL 1LP9B 2X5PA 4LLMA 2NY1B 2I5YL 5T3XD 4JHZA 4AYFA 4Z77B 4I2XB 4TP