3FB6B

Kcsa potassium channel in the partially open state with 16 a opening at t112
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein/metal transport
molecule keywords antibody fab fragment heavy chain
publication title KcsA Potassium channel in the partially open state with 16 A opening at T112
rcsb
source organism Streptomyces lividans
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fb6B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fb6B01
2WNGA 3U9PL 5DZOA 3Q6FB 3BH8B 1OB1B 5LCVL 2DICA 4QHKI 4PJ8B 3GIZH 2FJFA 3LKQB 1U3ZA 4HWZB 3OXSA 3GM8A 2G75A 2C3VB 3KPOB 2VLLB 4XCFH 4X8XA 4YHKL 1BX2B 4OV6F 4MZ2A 2YPVL 5T5NG 2VLRE 1ZLSH 3KLHC 4NKOB 2H2PC 3BQUB 3TH4T 2BC4B 3BO8B 3T2NL 4AMKL 1INEH 1J10A 2HLAB 3SKMB 2PW2B 3SDDB 1FIGL 4L8DA 5CEXB 1AI1H 1FNEB 3KDMB 1GYAA 3CFEA 3TCLB 4HKJB 2ZUYA 3CFJA 4JM4L 5A16A 3L3KA 1MCOL 3EOYG 4M7KH 3ZKNC 3VG9C 4FQJL 4XCYA 1AJ7L 3QUYB 5I1KL 3ARQA 3RBGA 4U4BA 2DDQH 1U8OB 1FNSL 4PJ8D 1Q9WA 3V9FA 4CVXA 4M8QA 3ESUF 4XCCH 4Z7UE 3W9DA 5I15H 3C5SA 2YRPA 4IM8A 1KC5H 3BWUC 5GGVH 1XF5A 4YDJB 1QYGL 1A7QH 5JPMA 4R7DB 1IM9B 2VLJB 4PGCB 1N5AA 1JWSB 4PP1D 3JTSB 3BQUD 1KN2H 5E7FA 1X5XA 2ORBL 3K2UH 1WITA 4FQ2H 3UTTA 1ZWIA 4WGVB 5CIPA 4KQ4H 5GGUB 2DIJA 5JR1H 3SDDD 1S7QA 3ZYZA 4XGZA 2HVKA 35C8L 4NM8H 1HSBB 4LHQB 3PWLB 4KKLC 3CDYA 3ROLA 1RZ7H 1NAMA 4KAQH 3MRRA 3V4UL 3BPOC 5D5MF 3BP6B 1A7PL 4G5ZH 4ZO9A 2H3NB 3WIIL 5F7HA 2D3VA 3QUYD 3TP4A 1I7UA 5E2WH 4KK9C 4GW5B 2DQJH 3RX8A 3P30H 1MCEA 4HAFA 2VDLH 5TFSL 1T0MB 2E27L 4PBWD 1F11A 4ODUA 5ID1B 2AJZB 3D18A 4M5YL 4LSVH 5BVPH 4ALAH 5I1LB 2XRAL 1KPRB 1IM9D 1DE4B 1E4KA 4HV8B 4LLUA 1T1WB 1P7QA 3M17B 2QSQA 5EOTA 1OPGL 4TUJB 5CCKL 1U8JB 4LCIL 4J2XA 5CILL 1S9WB 3RDTC 3UTOA 5HYQA 2BVQA 1NL0L 4YHPB 4ZSOE 5JXEC 3OZ9H 2Q7NA 3MJ9L 4CN4A 2OQJB 1MCDA 2R0KH 1KTLA 2O61B 2OR9H 2CLVA 4X6FB 5ADPL 5F7KC 4NFDA 4XMPL 2OP4L 5JUEL 5C0CB 4XVSL 3BYTA 4KVNH 5IMKB 3MRGA 3SQBA 3P4OB 1EXUB 1BQHB 1CD1B 5TE6H 4D9LL 5D9SA 3EBAA 3QQ4B 3I3EA 3QJHA 4JPKH 1A2YB 1IZKA 5EH1A 1T03H 5BZDB 5MENE 2H9GB 3L5XH 5JW4N 5L0QB 2J5LB 3QG7L 3IAGC 3N1MC 3WXVH 3C8KA 3BN9C 3MZTA 2Y36L 3AREA 1JGEB 1RURL 1WFUA 3V6OA 4RGNE 4U3XA 5D7JA 4ZG1A 2FECI 3BMWA 5GS1A 5C0BA 2G9HA 2BSED 3V6ZB 4YDVB 3EOTL 2DQCL 3MRQA 5CIPH 1EZVY 4QXTB 3SJVA 3IVKB 5IK3A 5C09E 4NO0A 1CL7L 1IGFH 4QF1B 3EFFB 3TT3L 5KBNC 4RGMB 3AM8C 4I18C 5C0CD 4ZUVA 1YYLL 2BHYA 3NCJL 2HTKD 3U6RA 1NLBL 1A1MB 1NAMH 2X4RA 5GIRA 4IMKA 2Q3AA 4NQVB 4XVUC 3BIKA 3OF6A 3ARDC 1JN6B 5C3LD 3VXRE 1AGCA 4AQ1B 4NHUB 1FORL 5DVOA 1AY1L 3PWPE 8CGTA 4PRIA 5FYKE 5TF0A 3PGFL 2EYSA 3RUGF 3ZDZF 1M6OB 4N0YH 4POUB 5HI5D 4XCEA 3QRFM 5IG7B 1MH5A 1QKZL 5K9JL 1AQDA 1HZHL 4RAVB 2F9BT 4OF3A 4OJFL 2RCSL 3UBXG 3Q6GL 3GB7A 5D1XC 3FMGH 2V6HA 3HI5H 1AO7B 2AQ3A 5J3HD 1JNLL 4HLZH 3HZKA 1YUHB 2A74B 4HIEA 4B41A 4OCLC 2XTJE 1P53A 4E9LA 1LMKA 2VDQH 6FABH 1AR1C 5I17B 3LQAL 4DN3H 2L4OA 1X6LA 4YHML 1UYWL 2E7HA 3MCG1 5E00B 1EPFA 5ESAB 1VFMA 1A8JH 3RVUC 3DROA 1D9KC 2DL9A 3O3UN 2ZJSL 2VUOA 1KB5B 1C1EH 3C2AH 1I4FB 4EDWL 5J89A 2YD9A 4Q2ZB 3IFOA 2X4NB 2ZUSA 3QAZB 4UU9B 1QBAA 3FFDB 5I76A 3AB0C 2Y1VA 3O11A 1V3KA 4LIQE 4MNQA 4FQIH 3O3DB 2HLFD 3H0TA 2HT3D 5KSBE 3I6KA 4UNTA 2SEBA 1AO7D 5F7FA 3ZT7A 1MHCA 4OCWH 1JV5B 4MQ7A 2F15A 5C0AA 3RWJA 4JRYE 5J06A 3LN5A 1YEFL 3IGAA 4Z7QE 5C07E 4XCNA 3VFOA 4X6DE 5T1LA 5HD8C 5JLZA 4MCZA 2W92A 1FFNB 1U95B 2VE6A 3RY6A 4G8EB 3FRUB 4JAMA 2FGZA 4J3OC 2E9BA 4R4BA 4XMKH 2C4FU 4HS6A 5DD0H 5CBEB 2IAMB 1YPZB 3QEQE 4MJ5A 4U6TA 5FGCB 3PNWA 5EZOL 3O3EB 4DKFH 2L7JA 1RD6A 1NJ9B 3QHFH 5TE4H 5F6IC 4DEPB 3GO1L 3QWQB 1EHLL 4WW2C 3LEXB 4MCYA 1VFBA 4HKXB 1DN0B 3UTSB 5IP4A 1MF2H 4QT5A 4Q6YA 4ELKB 1KIPB 1U3HA 2G60L 2NY6C 1VENA 3HR5B 4APQC 2QADB 4BH7B 1NCCH 4HIHA 4PV8B 5ISZE 2AQ2A 3N85L 2WWMD 4WUUE 5DO2D 3OG4B 4LU5L 1BD2B 3PP3H 1NC4A 4WO4C 3T2QA 4K8RC 5KS9F 1FCCA 3HE7A 5L2KE 1L9NA 5D2NA 3L6FB 1UCTA 1Z9SA 1FBIH 2H6PA 1ZHBB 3U4BL 3FQTA 5D7KD 3GMRB 3QH3B 2IAMD 2LE9A 1QBLH 1QA9A 5TF1H 3KPLB 1A14H 2WANA 3SKNB 4YGVB 4I4WA 1A7RL 4NJAH 4YC2B 4P3DB 3WKMH 1H3GA 3AFLA 3ARSA 3TYFB 5JHDE 1XGTA 5DFTA 4EZMA 1JWMB 1S5IL 2NNAB 3CU1A 4G7YH 5DMIH 3QIWB 2Q7YA 1G1YA 2BOCB 4PS4H 4R4ND 3UTSD 4KRMB 1NMBH 4Q6IC 1GVIA 3L3GA 3DRTA 4MB4A 2Z92B 3V4PL 3CVIH 4QWWC 5T5FH 4LLQB 5FYKL 4K9EC 5BO1L 4AK1A 1FL5A 3T1FA 1K5NA 4MA7H 4I5BA 2QADD 3OB0H 4MAYA 3VFNA 2XZCL 1S7TB 5E8OB 5J11C 4U1JA 1BD2D 3VWKC 1AP2A 1GJIA 4HS3A 1OARL 4WW2F 5DC0A 3KXFA 2YD7A 4KC3B 4CRPA 4JCMA 4Q0XL 5DR5H 3MRPB 2Y25A 4Y5XB 1HHKA 4HIIA 1FPTH 1I1YB 4WEMB 5EORL 3I50H 1IKFH 2W0LA 2NY0C 2OCFD 1Q1JH 3JV4B 4D3CL 2XN9A 5E2JA 1FVEB 5KOVC 4XH2B 4JEGB 4JFHD 4DAGH 3IB4A 4WI6A 5C6PB 2YPKA 3HAEA 2DLFL 2EDBA 4YGAB 5GSVA 1GPOL 1H5BA 2ZSWB 2BSTA 2GJJA 2JCCB 4OZHA 5ACZB 4JO3H 1A9BB 4ZNCD 3CZJA 1FQ9C 5IB1A 4K7PH 4DZ8A 1SQ2N 4QTIH 3O2DH 4B0MM 4XC1L 1D3CA 2FATH 3FL7A 4NRXA 2FR4B 1U0QA 1DQJB 5J1AB 3FN0L 5H94A 5I1IL 1HHIA 4NCDA 4U1SA 1VESA 3N1GC 2J3SA 4LIQL 4JR9L 4FFZH 4G9FB 4XWGL 5IHZA 1FGNL 4QRUB 2D4DA 1RJLA 4M61B 1NFIB 1I1FA 3LKOB 1N6VA 1BVLB 4ZFOB 1JTPA 3OKOB 1R3JB 3MR9B 15C8L 1UCBL 2B39A 4X4XB 4W6WB 4OLWL 3QIBA 1GGBL 1N2RA 3MFFA 3TPUB 1UM6H 4GMSH 32C2B 2APTA 5F1NB 3EO0A 3VXMB 3R1GH 3BZEA 3PXJA 2WSKA 1T5XA 2P8MB 1PG7W 3LVEA 3QRGL 3EW3B 4QRPB 1FNFA 3O6ML 2B1AL 4HWBH 1ZV5A 5IV2A 5KAQG 2X89A 2DQFA 2HJLB 5B3JE 3IS1X 4UAOC 1AD0A 3C5ZB 1G7HA 5I1EL 3D3VE 5DHXB 1MFBH 5E03A 1UACH 3O3BB 4HLZG 3DV6B 4K3JH 4G9FD 1CE1L 4S2SB 5CJOL 2EDXA 1D7FA 2PW1B 5D5MA 3FT2A 4F15B 4JO1L 4U1KA 2BMKA 1ORSB 2NCMA 4LVNC 5E9DB 3E6HA 1MQKL 5DJ0B 4R4FL 4LRNL 1NSNH 4PREB 5EULV 3P4MA 3WFCH 1BBJA 4JFFA 2WIIA 1Y18B 5IJKC 1OCWL 3MLVH 4RISH 2A6IA 5GQBA 2J6EA 5I71B 2CJUL 5J4MA 1A4JB 2CIIA 2QR0B 3KPPB 4KK5D 1J5OH 5GZNC 3S88L 1SYSB 3VXMD 1CDUA 2CKBL 4AH2A 1DBKH 3QCVL 1B0RA 4P23C 5IF0B 1P2CB 5JOEA 4O51B 3IDXL 3QUKB 2MHAB 4QRPD 3QCTL 1RJCA 5K9KB 1B6DA 2R4SL 3BKYL 2VKXA 3BT2L 1KIQB 3C5ZD 3CZFA 3A6CH 5L8JB 2E3VA 2WUCH 4L4JA 3P0VL 2GW5A 3TJHC 3QXDB 5E8DL 3RNKB 3QP3A 1D5IL 3MNZA 4G3YL 2CD0A 4DN4L 1A1OB 3MREB 1RULL 5F1SA 1FRGL 5LWYL 4Y2DB 5E9DD 4G8GE 2I5YH 4B53A 1CS6A 3KPSA 1OL0A 4MA1B 4BUHA 2F19L 1YMMB 4P2QA 4N1HB 5K9QI 1RK0B 3MLXH 1U8HB 4ZMAT 3MNWB 5BV7C 4YXHH 3MOBH 1MWAB 4LPTA 4KKBD 4PFEA 3IDGA 4PB9L 4HUWA 1QLEH 2E9IA 5CP7B 3ZHLA 4LSRH 3GSQA 5E4EC 2AS5M 5D70L 2XKNA 2I60H 2UZIL 4MNGA 3IS0X 4YAQA 5H37H 4M8VA 3THML 1X5GA 3BPLC 3HI6L 4WI2A 3MOAH 4G6KH 4N0FA 4BZ1H 1WK0A 3MLTB 5IKCB 3NPSC 5GS0C 5HJ3B 2DLTA 3GFUA 2Y5TB 3ARFB 2X5PA 3PV6B 2CQVA 3LKSB 3OAZH 3OKNB 2ZUVA 4UINH 2R1WA 3SGJC 1F58H 5EOQL 4Y2DD 5HDQH 3OKKB 5JXAL 1YMMD 1XGYL 2VXQL 1EAPA 4EI5B 4Y4KA 4ZUWB 1NLDL 2FB4L 3MV11 4L1DA 4ORGA 5SV4A 3ARBC 3RUGA 4EUPA 3VD9A 4QRTA 5ESQA 5C70A 4NT6A 4PGBA 4KFZC 1QACA 2EC9U 1ZTXH 3R0MA 3FONB 5FO7A 2X4QB 3TBSB 1LDPL 5DJCB 1BGXH 3F6LA 3CVHL 2A73B 3GZKA 4QRRB 3D39E 5J9PA 3MRHB 5I8CA 4ODVL 4PUBL 5JORA 1T7ZA 4JRXA 3X12A 3ARFD 4I48B 4KXZI 4Y2OA 1U8MB 1HNFA 3BH9A 1KPVA 2BDNL 1PG7L 1ZANH 3KYNB 2EH8L 5BVJA 2YUVA 1SYVB 4P9ML 1DL7L 5GPRA 1CDCA 1JPTH 4JZOB 2YD6A 2HN7B 3STLA 3JWOL 3KAAA 3RA7L 5LGKA 5K9OA 1ZHNB 5DJAB 4EI5D 3MRCB 3DETD 4WW1A 2DS4A 3DXAE 2NYYC 1ED3B 4RIRB 3AC0A 3MUGA 3ULUE 3GSWB 4QHUB 5KVMC 4KI5D 2PCPB 2WP3T 3CMGA 4WDIA 1BZ9A 2H1PL 3REVB 4MS8D 1B0GB 1WIOA 43CAA 2I07B 3W5MA 3AM8A 3ILQD 4QRRD 4OLXH 2J4WL 3VCLB 1FC1A 2GJ6A 3A67H 3GSNB 4HGWB 3TPKA 4TTDC 1KCKA 5EUKA 4MD5B 1XF2A 5F71A 3UC0H 3GMQB 5GSRB 4TPRH 4FA8A 4OCXL 5E2VL 2XQYK 4PGDA 5F1IA 3U4EB 3FB7B 4L9LB 1FZKB 1MVUB 2APWA 2QKIB 1XGQA 5FM8A 4X98B 3QDGE 5D1QC 1T4KB 2FSEA 4HGKC 4BSVA 5D1XA 5BOZG 1QSEA 3F62A 2F8XC 3D5OF 1ES0A 2YBRA 1HYRC 2CK0H 5IVXE 1CFNB 1CFQB 5EOCJ 1AE6L 4LPXA 4JZJB 1CICB 4YX2H 4O58L 1KXTB 2ZOLA 3UBXB 1DQML 3V5HB 4LAJH 2AJSH 1CDGA 1I8IB 1E4XI 1J05A 3L95A 4LVEA 5DI8A 5EU6E 1YMHB 3QCUL 1U42A 3VD4A 4LF3A 1M05A 2H26B 3LMJH 1LWRA 1JBJA 1TNNA 3W9EA 4DKDC 4UOW1 2BCKB 1U8IA 1UVQB 4OV5B 3ARVA 3S8WA 4UOJA 1A6WH 1Z0MA 5DTFB 3RWGB 4MLIA 4K3HA 4G8FB 4NIKB 1LEKA 2R0LH 4H25B 1J8HA 3DVGA 5C09B 2XYCA 2O93L 1CK0H 4KV5F 3O9WC 1NQBA 3A0OA 1CFBA 2I9TB 3P11H 1ZLUK 5A3IC 3I85A 4N0UB 3TNNA 5F88A 5KVEH 2P48B 2ZPKH 1T1YB 3QXWA 1CICD 1OD7A 3SE9H 1HDMA 3G04A 1C16A 4U1IA 2XKUA 1PD6A 2YPLA 5E8NB 5FDWB 1P1ZA 3HAEG 1FGVH 3PP4L 1ZLWK 2JKXA 4GKNA 1T21A 2EIZB 1B2WL 4NRYA 4TOYL 2PXYB 4OF8A 5E8PB 1SBSL 4XNXL 1G7QB 2RGSA 2ADGA 4PG2C 1CR9L 1WF5A 2FL5A 4WW2A 5J57B 1RZIB 5HHVH 2JJUA 1YA5A 4G43A 3F12A 4WI7A 1AXIB 1PKQA 2J1KA 4X99B 3SBWA 1QR1A 2YD8A 4Y4HA 3OKDA 4I13B 5C09D 4QXWA 3FO0H 2LU4A 4X4ME 2NXYB 2EDOA 2K7QA 4JFYA 1CLZH 3EHBD 4ZUUB 4APQA 5I1AB 4HK3N 2Z4QB 2YRLA 3F7YA 3VRJB 1D5ZB 4E0RB 5J13C 4WO4A 2FEDC 1XAUA 2E8YA 4KUZL 2HP4A 1HXYA 5KN5A 4K71B 1HI6B 4PY8J 3FQWB 1F4XH 3ULUL 1J1OH 3RPIA 3I9GL 1TXKA 3ZLQC 5H37G 1OP5K 2PXYD 2R1YA 2XG5A 1WC7A 3BDXA 4J3TA 2P7TA 5T3ZE 2IPKA 3B5HA 4DW2H 5T1DH 4ZFZB 3RKDC 4CBPA 1UH3A 2BY3A 4M7ZB 1BIIA 1C5BL 3DX8A 5GRWA 2GK0B 3ELAT 5CHNA 4BKLB 3QUZC 3MLZL 4R3SA 3FCTA 1W72A 4JRYB 2GITB 5H8DA 5FA4B 5GJTH 3FQRB 3DIFB 1JMZA 4PTUA 1QO3B 1KBGL 1PY9A 2IPTH 2GSIB 3QUXB 3BD4A 4HXAH 2NXYD 3GI9H 5IQ9A 1AFVL 4LEXH 1UXSB 1ZA6A 2NW3A 2AJYL 1DBMH 4LCYB 1JUFB 2EKSB 4FQPA 4QHLB 3MROA 4RGOH 2B20A 2VNCA 4MXWL 3H8NA 3VFGH 3CFCL 1U41A 3HUJA 1KOAA 4LKXB 2CDEA 4XRCB 1ZS8B 1FAIL 1DQLH 1ZT7A 5CBAA 1BM3L 5JA9A 4NN7C 5DFWH 4P3CL 5KANI 1Q38A 5FGSA 1OAXH 2HT4C 1JRHL 1T83A 3MFGB 1S3KH 1I9RH 2R39A 4F8TA 3WS6A 1E6OH 3HMXA 4JRYD 2CMRL 5A16B 1JYNA 1NGXA 4WUUB 5C0IB 1L7TL 2WINA 2YZ8A 3DX6B 4PJ7B 2BK8A 1EFQA 3JWDC 1QEWA 2FNBA 3QUXD 3IFLL 4GMTL 1XIWB 1IAKB 1DSFH 4EI6A 2YZ1A 43C9A 4TULL 2OJEB 1EHAA 3M07A 3PWNB 1TJGH 1BOGB 2F8OA 4DZBA 1H0DB 4OM1L 5DC4B 1BWWA 3I3DA 3EYUL 3G6JE 3HPJB 4GRLC 2NX5A 2CKBB 1I9EA 1YN7A 5ITBL 2ZCHH 4MXVF 3OJVC 1N8ZB 1A6TB 3IJSA 4EDXA 1YJDL 5DS8B 3LRHA 4EXKA 3H9SA 4KXZH 4ZAKC 1DEEB 5F96L 3KYKL 4L8CA 1I1AC 5EBMA 3ZKXB 1L4IA 2XXCB 1PGRB 4LLYB 1YEGL 3MRBB 2JTDA 3TJEL 1EK3A 1JGUL 3V6FA 3BVNB 3QIUC 1A9EA 2X9YA 5E24E 4XP5L 4F3FA 3O45B 4H8WH 1E4WL 5HYSG 4BH8B 1G9EA 5DEFB 4WUUD 1C8PA 5JW5A 3NFSH 4KJYA 2QV2A 4MXQC 5ID0B 5JMOC 5KSVB 4ZQKA 3UJJL 4OQTA 5LGJA 3DX7A 3FAWA 1XIWD 4OCYL 4K2UH 4N68A 4ZS7H 4GSDL 4NQDB 4K07A 1JGDA 1JNHA 1RHFA 3HC3L 3WO4B 3C6LA 3VH8G 2HTLC 1PDKA 3D18B 4JY5L 4GO6B 3LOWA 3BZDA 1KEGL 4OUOA 3RHWK 2CXGA 2VZSA 1MLCA 4JFXB 2DI9A 4HBCH 1TJIL 2NR6C 4I2XA 2P46B 2X40A 2FX7H 3MV8E 3CFKB 1B3JA 2E6QA 3L5WA 2R56H 4M5ZH 3IDJB 5CJXC 3ZL4L 1OSZB 3BGMB 1H3TA 3MRFB 2ZG2A 1ZAGA 8FABA 4P5TB 3FO2A 4C59B 1I3GL 4JY6B 5T3ZL 1MI5E 4LLWB 3RJDA 1NBYA 5ANMA 2ADFL 3KLAB 4JZNB 5E5MB 4ZS6D 1MAMH 4LLMB 4GQ9H 4NNXB 1K2DB 3ROOB 4LCWB 2JJVA 1XF3B 2X70A 3WEXA 1F6FB 4P2CG 4L4TA 1E4XH 4NQDD 5C3TA 1FVDB 1NANI 1Y0LB 1OT2A 1FYTA 4WU5B 4JFDA 2EE3A 2XA8H 3MRNA 1YEIH 3VXQB 5GGRB 1CBVH 3QHTC 3M1BA 3NA9L 3RGVC 4NPYA 1OHQA 1H3XA 5SWZA 2NXZB 4RNRA 3WLBB 4WEBH 4D9RD 4M6NH 4PJBB 2GYSA 3CXHK 4HK0B 3VG0L 2A77H 4P3WA 3V6BR 3QZWB 4P5TD 4YXKL 1G7PA 4IRSB 5C92A 3L7EA 5KW9H 5D6DC 3D3VB 4DUVA 3VI3E 4BQCA 5T3XE 5IMLA 3AROA 1FH5H 1MHPH 2BNUA 1AKJA 2YA2A 3H42H 4ONFH 3K4DA 3S4SA 2DJUA 2F53B 4LCWD 4D0BB 4JPIA 3L3DA 1KCSL 3SE4A 3L3JA 4OQTH 3WNPA 1XGRA 2EDKA 5IGXL 1F4HA 1SEQL 3KHOA 5CJQH 4NUJB 3BEVB 4Q9BA 1JF1A 2NLJA 4GQPH 4HFUH 3V5KB 1J0JA 1E6JH 1HWGB 4KUCD 1MFAH 4X80H 4EIGB 4K7FB 2NXZD 2HFEA 1P7KB 5CAYB 5BXFB 2P4AB 2APVA 3QPXH 5I1CH 3O8XA 4YO0B 3DBXA 5SX5H 4YE4H 3DYPA 3HZYB 3HFML 1OF2A 1LO5B 3IAPA 5A40E 4HC1A 4UQ2A 4P9HH 5FGBC 1RIUL 4IRSD 5K9QG 4YHLH 3QUMA 3V5DB 1WZLA 1A3RL 3D3VD 3KPTA 4RWHA 1A7BA 4AT6A 1KT2B 5GZOC 5EU7C 5F3HB 3HCVB 2YD1A 2F53D 3WKNA 7CGTA 3VE0A 1X9QA 5GGTL 1QHOA 2BZDA 3V0VA 3IDNB 1A1NA 3Q3GB 1NFDF 1OAYH 4OB5L 4TVPH 3U4AA 5CGYD 1A3LH 3IF1A 1KTDB 5F8RC 4MJIE 1A5FL 4LDEB 2HKFL 3SGEI 3EDJA 2PNDA 2V2XB 4ZOCA 2OTWB 5J7CC 2G2RA 5DA0B 3VXUB 5BS0A 1RK1B 5SWSE 1DVFB 4J6RL 3IXTA 5M7QA 2YXMA 1SM3L 3OJDB 4GG6F 1BFOA 2V7HB 3B5TA 5C7XL 1RZJC 4Q58C 3OR7A 3NN8B 4HXBL 3TCXA 5HVGB 3VU2A 1G6RL 5CEZE 4R8WL 1LILA 4G6AD 4HUXA 4YHOH 2DKMA 4Y8AA 1DUYA 2BXYA 4PJEB 2P5WB 3HTLX 5JOFB 4CGTA 1T7YA 3HC0B 1XH3B 2FD6L 1X3DA 5TDNB 1NGQL 1UT9A 3B3IA 5B38B 1YC7A 3PP3K 2FJHA 2BFVH 1JZ3A 4JPWH 2AXGA 2CUIA 5FYJE 4NQCE 1XR9B 1UM5L 5C0FB 3ZMRA 5FCUL 1R3KA 3BHBA 1LE9B 4TUKH 5D1QA 1B4JL 3VXUD 4NCC2 4L5FL 4U1LB 4X7TB 5D7SL 3QO0B 1S7VB 1DVFD 2APBA 1JPFB 3P73B 1UQSA 1KULA 1N4XH 3Q2CA 3TO2B 4PRHA 1P4BL 1RZFL 1F6AA 4AL8H 3D39B 2IH3A 2CLRA 1U91A 2BNQA 3WIHL 2UVEA 2KH2B 3RI5K 1WBZA 1U3YA 2DQDL 4KJWC 4TSCH 4DUWA 1UEYA 3P9WB 1AH1A 5DUBB 2X4SB 5IVZB 5E2UL 4HC1H 4Z7VA 3LKRB 5DDHA 3INUH 1FN4B 4OCSH 2H8PA 5TPWH 4P2RB 4BZ2L 2P5WD 3WS3A 4X0KA 5BRZE 3ALWA 3TIEB 3ZE1E 5T3XL 3H9HA 5LAXB 4H0GA 1OQOA 4AM0B 1Y6KR 2ESVA 2P43B 5DRNB 4PJ8C 2YSSA 2VAJA 3FAXA 4GAJH 4P57A 5FK9B 1IEHA 2B5IB 4KDTA 1AXTH 4WCYL 3KYAA 3BIAX 4DJMA 3OAUL 3IXAA 3VXOB 4R7NA 1A64A 2X41A 4OZGF 5DEGA 2A6KA 1I7RB 2DLEA 3ARYA 4G9DB 1U8PA 5E08H 2BY0A 4PJ5E 1UB6B 3ZT5A 2BY2A 3EYSH 3WDJA 3REWB 4URTB 4Z95L 1MCWW 3GI8L 4XPBH 3BQUC 4YHZL 5F9JB 3PGCB 3C60C 5CUSL 4NO2A 3D39D 3GUTB 5EZIH 3B6SA 3D1MC 3CK0L 1HKLH 2D7PA 3X3FH 1IQDA 2E8ZA 2ITDA 5IW1B 3GHBL 5GGVY 3TBYA 4LBEA 3UMTA 2J88L 4LAQL 1KJVA 3OHXB 4P2RD 3LDBC 4RFOH 5MP6H 1WEJH 3JWOC 4LPWA 4P4KB 4XBGA 3VA2C 4L9DA 3B5GA 5AWNL 5INDA 5H35A 2ZWLT 3NTCH 1KFAH 2XZZA 4JKPH 4M6OH 2MJWA 2W60B 5CGMA 1WCBB 1KCRH 1MJJB 4XZUB 5DD3L 4CNIA 1WWBX 3QG6A 3I2CL 5IVXB 5I30L 5BMFL 4JB9H 4YK4B 1WIUA 3BD3A 2JB6B 3QFDB 5DHVH 4C83B 4ODSL 5I8KL 4M93B 3HG1A 2CIKA 3CFBA 4V2CB 12E8L 2DQEH 3MUZ1 3MGTA 1XF4B 3W11C 3HNVL 2XT1B 1H3PL 2MPAL 2DWDA 2Q86B 5EU6B 3B2VH 3C6SA 3CSBA 1R3HA 5IFAH 4DKEL 2F8VA 1NMAH 4FQCL 5SV3A 2HWZH 1X5LA 4R6UA 4H26B 4FOMA 3K7UA 1NANH 4PLJC 5C9KA 1OTUD 4OFIA 3V4VL 4OGAC 2LABA 5DRWA 5CEZL 2A9MH 1T7WA 3BEWB 2EYTB 4P4KD 5E94B 5C0GA 4Y4FB 1U92A 5MEQA 4RRPA 3KPQB 2C1PA 3UAJD 4HH9B 4Y1AB 1JZ5A 3RTQB 2BOBA 1I1RA 2JB5H 3BWAA 1NGZA 3O2VH 4BJLA 4Z7WF 3BMVA 4NWTL 4JG1H 3G5YB 3NIFF 4YDKL 5FYJL 5LQBL 3EKCA 4X8JB 2NY5H 5J12B 3QDJB 2UYLA 1R5VA 4LEOA 1NGWA 3MRDA 4U49A 5HY9A 4C56E 5FA3B 2QBWA 5DD6B 1OAUL 3QQ3A 3TO4C 4YIQB 1DR9A 5EU6D 5JW3H 4UT7H 1CGSL 1NH6A 1VADA 4MJ6A 1UB5B 1BQLH 2UVFA 4U6HA 4ZPTA 4Z77A 1IARB 3HPLA 3RL2A 1YN6B 1GIGL 4K3DL 4X6EA 3WHE0 4WFGD 1D5XA 2HFGL 3WJLA 5DZLA 2LTQB 3HE6B 1I9JH 4JO2L 1EDQA 2LU7A 3QT2A 2OK0L 1OVZA 3D85A 4QRSB 3LS5H 1G7IB 5EZJA 3RL1B 4Y4FD 1ZGLA 1TZIA 2I27N 1N59A 3K46A 5B8CC 4Y1AD 3RTQD 1XCQA 4HWNA 5DJ2A 3UTTE 2VZOA 5F3BA 3CXHJ 4JFQB 1ZA3A 1EJOH 3D2UB 4LLVB 2HRPH 4J4PA 2J8OA 3MLSL 1YEJL 4OD2A 4DCQB 2J5LC 3WHXB 4KHXL 1D5MA 4XPTH 3QDJD 3OX8A 4LVOB 3KHQA 4G6JL 4NQEA 3SCMC 1Z9OA 3GMMB 4KY1L 3IETA 4YDIH 5LVEA 3NCEB 5D8JH 1MIMH 3RAJL 2DQTH 1HK6A 3FHQA 4ZOEA 5J6HA 1INQA 3U46A 4GRLA 2GKIA 2I9LB 3T0EB 5ADOH 4HBQA 4S1RH 5FAAA 3VDCA 4RMSA 5IMMB 4AEHL 2VXSL 3P40A 1LO3H 4PRBA 1L6ZA 2WBJA 1BQSA 2YD3A 3HE6D 4MA8L 4RGMC 5I15L 3ULVE 2B1HH 2X4UA 3LN9A 5IB2A 5CJ5A 3SGEH 2C3HA 5ILTH 3OAZK 2OSLA 4MD4B 3S4SG 4Y7MA 5ICZB 2FIRT 4O2FB 5F1OB 4P5MA 1KN2L 3D2UD 4Y16A 2AJXH 3K2UL 3VFSA 4GXUN 3BISA 1T2JA 5HHXH 4F9LC 4Y8DC 1Q0YH 5EBWB 1AGEB 1BFVH 1D5BB 2E7BA 5HYSB 3DSFH 2AEPH 3BKCH 4XMLH 2HT3C 4IDJL 5SWQA 3TVMB 1RZ7L 3WN5C 7FABH 2FZ3A 2PN5A 1VEOA 3GBML 2VIRB 3T0ED 3VD3A 4Q9QL 3ZE2F 3O41B 2Z31C 5E2WL 5CD3A 1CLCA 5L88H 5DJDB 4QHKJ 5IB5B 1QBMH 2XZAH 5FO8B 3UJTL 2P8PA 5MEPB 3VH8B 4QHMB 4Y4KB 4X6CA 5GGRY 5I1HH 3FJTA 2VR5A 4LQFL 3S37H 4M4RA 1PX4A 4U3HA 3SO3B 5BVPL 4ALAL 5CJXA 4EJ1C 2IADA 4RDQF 3DRQA 2IMMA 3VFWA 5DJ8B 3V6OE 3DUUB 3MC0A 1A6UH 1HEZA 1GOFA 1IL1A 5C0BE 5KVFH 4JFOA 1KJ2A 1I8KA 3BE1H 3NA4A 1AIFA 3G6JB 2VDPH 1QFUH 1T66D 1S5HB 2LQRA 3SJVE 4OTXH 3WDHA 4EOWH 2QHLA 3EDKA 2K3TA 1QRNE 2R0KL 4ZFGH 4IOFD 4YR6A 4F7EB 4G42B 5T33H 3TVMD 2VQ1A 2HVJA 2MKWA 5IFJB 4PJGF 3AS0A 2OI9C 3MRIB 4XNQB 5DO2C 4LKCA 3BZ4A 2W0FA 2FRGP 3EYFA 1SJHB 3EGSB 2RIKA 4PJAA 3L3IA 4LGSB 4M03A 1U58B 1IBGH 2OXHA 5E5UB 4PRIE 4I0PC 5HHOA 5HYIA 4XPGH 2J2ZA 2L7UA 5KG9B 5KSUB 1KB9K 1CT8B 1NFDA 2IAMC 1KPUB 1AQKL 4U0RC 3IU4L 4FFWD 3I02A 3S36L 2IQAB 5FXCH 2Y6SD 2X10A 3M45A 1F4AA 3ZDYE 5D6DA 5EZLB 4M6MH 3HNSH 1ZSDB 2F74A 3W39B 1BMGA 1U93A 1N7ML 4OKDA 4JHWH 1V7MH 3FTGA 4OF6A 4LPUA 1A4KB 2DD8L 1DZBA 4PPTA 5K59E 5D96B 3P9LB 3FHAA 1YEDA 1IGFL 4NKDB 1X5HA 2NPLX 2IPUG 4P2OB 4PGEA 1SJEB 1G7JA 4L8SA 1MHHB 1VKXA 4CVZA 3KLSA 2XWJB 4X5XB 1HHGA 3EUUA 3NH7H 5I16A 3JTTB 3SOBL 2FWOA 3TLRA 2JLLA 3T09A 3W82A 3C9NB 4TSAH 1IQWH 4U1NB 1H15A 4MNHB 2V9RA 3DTXA 5DVNA 4KKAC 5I1JH 2RQ8A 2Q76A 3HLAA 3SDYH 2X4PA 1OP3H 5AAMA 1FFOB 5GISL 4PLKC 5J8OA 1I85C 1TZHB 4MNQE 4OLEA 3ZDXE 4JDTH 5C08A 1JZ4A 1V3JA 2OMNA 3ULVL 2HYMA 3O81A 1JWUA 4X4ZA 5C0AE 3QIWC 1JNJA 2CO7B 2X9XA 2AQ1A 1NMCB 3QEUB 4ZDHB 5DI8B 3CH8A 5B4MD 1IT9H 3A6OA 1W8OA 4CN6A 4JVUA 5B39B 4FQ1H 3DMMC 4PG9A 5KS9B 3BRDA 4A2LA 2VZUA 1DBBL 4P2OD 1JPGB 3AU1A 2VH5H 1YPZF 1ACZA 4QKXB 5CMAA 3O4LE 3VFRB 4F57H 3UCRA 2ICEB 3PWJB 5TE7H 2J7LA 1MRCL 5BW7C 4K7PY 2FDBP 1C1EL 4ODBD 1CFTA 1RFDL 3QULB 4JANA 4Y5XC 4OLYH 3U2SA 1BWMA 1J86A 4NQSB 3KJ6L 2YC1B 4L3CB 3KYOA 4D8PB 2VN7A 5DMGD 2GHWB 4OZGA 3W5NA 1QHPA 3LQZB 3QNZA 2VABB 4WRLA 3T1WA 3GGWB 4L3AA 5E6IC 4I0KA 4PYGA 4WJ5B 4F33B 4NC0B 1P9MC 3O6LH 3EOAB 5D2NE 5EU3A 1CE6B 3PJSB 3BDYH 4OBRA 3L5IA 1F90L 5L2JB 3MO1B 4MZ3A 3RVVD 1ZT1A 1X4XA 3GK8L 2D7OA 2JJTA 2W9DH 4OUUA 1CG9A 1FL3B 2QSTA 3S36X 5DD0L 3SDCB 3IKCA 4R97B 4DKFL 2YEZB 3LD8B 3QHFL 2AI0H 1PSKL 1PW3A 1YNLH 5TE4L 1DEDA 3J7HA 1D6VH 1K4CB 3N06B 3R06A 5T3XD 5TDOB 3QI9C 1EO5A 3WNOA 4U1MA 3TIDA 1SVZA 3DARA 1G9NH 2QQKL 4ZUSA 4RMVA 1HXYB 3NBNA 4JN1L 2NZ9D 3AS1A 4KK5C 1CLYL 1P7HL 4OI8A 3L1OH 2IJ0C 4IHOA 3MA7A 4U1HA 4XP4H 1U9KA 4M9PA 3KXFE 5E0QA 3Q6FA 3BH8A 4J3SA 4ODWB 4XX1G 1OB1A 1TITA 4PJ8A 1BZ7B 3EO1B 1P6FA 1YNTB 4KQ3H 1QFWH 4N5ED 4PRPE 3LKQA 3SDCD 4A2MA 2XN9E 4HWZA 4HJGB 4U6VH 2C3VA 3CLEH 3KPOA 4F15C 3BXNB 2VLLA 3HRPA 1BX2A 4JCLA 2JCCF 3B9EA 1C7TA 4YQXH 4OZHE 1U3JA 4NKOA 4G7YL 3BQUA 4ODHL 3FOMB 2BC4A 2E5EA 2VLMD 3BO8A 4OLZL 3T8XB 3RFZC 4YXLL 2HLAA 1HH6B 2PW2A 3SDDA 3SKMA 2UY6A 4AENB 3UYPA 3W2DL 5CEXA 3KDMA 4K23H 3O6KH 3TCLA 4HKJA 4NQCB 2FBOJ 4R96B 2RJMA 4CADB 4OLUH 2X4OB 4M1GH 3FO9B 4HWUA 1MCJA 3TN0B 1R0AL 3TT1L 3CSGA 1GAFH 3QUYA 5C2BH 4BUGA 1U8OA 4PJIB 1I3RB 1TIUA 3GBNH 2V2TB 5I6XB 5ENWB 1ACYH 1PZ5B 1I8LC 3JV6B 2ERJB 2FX9L 4YDJA 4Y2DC 4DAGL 5CEZD 3HI1B 4R7DA 1IM9A 3RPKA 4PGCA 5HDBF 4TSBL 1JWSA 4NZTL 4MA1C 5F89B 3DSNA 3JTSA 1G84A 3PHSA 1PQZB 1MPAH 4P59H 1A6ZB 4J7RA 2MTPA 5GGUA 2V17L 4JO3L 4PRDB 3NGBB 3GDBA 1DDHB 4NHCL 5MHSE 1HSBA 2ARWA 3PWLA 4NQCD 4JPVH 4FABH 1IKNC 4Z7OF 1BJMA 3U36B 3LB6D 3BP6A 1C5DB 4DK6A 1RZGB 1IGML 4XHJD 4XTRC 2DJ4A 3D9AL 3TN0D 1LQSR 3EZJB 1LNUB 2H3NA 1YEEH 4OFYD 1TDQA 2OZ4L 4PJ5B 5DRXB 3O4OB 4GW5A 1MJUL 3D48R 1CTNA 1T0MA 1MIEH 3DECA 5HVHC 3ARFC 4JFFE 3MV9B 3F5WB 5ID1A 2AJZA 1MREL 3Q1SL 3WIFB 1KJ3H 3P0YL 4O5LH 5I1LA 4KJYB 2HH0L 3FFCE 4OF7A 4PB0H 5EO9B 1KPRA 4PIRF 1DE4A 4HV8A 3ZTNL 3FQNB 1T1WA 2P45B 3M17A 4FQHB 4LSTH 4YZFE 4TUJA 1KCVH 5D2LF 3U30B 4EI5C 3DETC 2FECL 1S9WA 2PYEB 4ZOBA 1TETH 4YHPA 4FHBD 2FO1A 2YD4A 2OQJA 4I0CC 3IDMB 2ADIB 3QQ9D 2HAZA 4RCAA 4TQEH 2O61A 4QTHB 4X6FA 2C3XA 1GGTA 4FTVB 5C0CA 2YKLH 1MFBL 3NABH 3ILQC 5IMKA 4K3JL 3P4OA 1EXUA 1W0VB 1BQHA 2DN7A 2CDFA 1CD1A 1GC1H 2EXWD 4PJ5D 2FX8H 1RIHL 3KPSE 3BJLA 2RB8A 3QQ4A 4P2QE 2O5XL 1A2YA 4OGXL 5DQJB 3MV9D 1KB9J 5DT1H 5DVLA 5BZDA 1IGTB 4LCCB 2VXVL 2H9GA 1NEUA 3LAFA 2D9CA 3CLFH 3MODH 3S3SA 4H20L 4M48H 3VDBA 1KCUH 3HNTL 4Y5YB 4O4YL 3W0WB 1JGEA 5BCAA 4FZEH 4QXUL 3L3OB 4O00A 4K94L 1U8LB 1WTLA 5IM7B 2YK1L 1DBKL 5ALBH 2PYED 5D1ZC 1YEHH 3V6ZA 4YDVA 2IWGA 4MWFB 3C5JB 3GRWH 3U82B 4QXTA 1VFAB 1CGWA 2FBJL 1Q9OB 3IVKA 4IIQB 3O3AB 1QLRB 4QF1A 3EFFA 3U0PB 4FTVD 1ZVHA 3B9KC 1PX3A 1EO8H 1A1MA 3LZFH 5E99H 1VERA 2VRAA 4NQVA 4PRNB 3VWJB 2Z8WC 4N0RA 4OGYL 1JN6A 3BAEH 4C56B 3DOSA 2V5TA 4NHUA 2IQ9L 3E0GA 2P1YA 3BJ91 5IMLB 2H32H 4KI5F 3MOBL 4M43L 3V52L 1M6OA 2X7LB 4L9LC 4KTYA 2AGJL 1TQBB 4PJCE 5FUOL 5SX5K 4F80A 5IG7A 3BP7B 3W0WD 4RAVA 5DUMH 2I60L 3AUVA 1AO7A 4Q9CA 4LCUB 4NN5C 4WY7H 1HINH 3MOAL 3O6FC 4N8CH 4ZO7A 4G6KL 3WSQH 1CICC 5B3NA 5IBUG 1YUHA 4JRXE 2A74A 5GRUH 3WE6B 1XZ0B 2JJSC 4WTXA 5I17A 3IDIB 3CUPB 3C87A 4OKVB 3MLWL 3V0WL 5L6YH 3ILPB 5E00A 2BVPB 5AZEL 3VWJD 1UKTA 4RFNB 4JRWA 1J1PH 2F54B 4LFHD 1CQYA 3KS0H 3WFEH 4C56D 5ESAA 1OTTD 5DZNA 1KB5A 4WHTB 1I4FA 2ZKHH 1LO0H 4LNRB 1AGDB 4KZEL 5FO9B 5F21B 4Q2ZA 1UWEL 2X4NA 4UU9A 3TZVC 2A6JB 2E9WA 3FFDA 4HS8L 2F58H 1QLFB 2FHCA 2KQNA 2J6EL 1WAAE 4YBLC 2XFXB 3O3DA 3LRGA 4KDVA 2DQUL 1JV5A 4MB5A 4ZTPH 1BGXL 3SQOH 2GJ6E 1IEBB 4AIZB 2WIMA 1QFOA 2CR6A 2Q8AH 4NM4H 1FFNA 1U95A 3FQUB 1KELH 4G8EA 2V5RA 1JNNH 3FRUA 2MCPH 4KK6C 1RZ8B 2V2WB 5CBEA 2IAMA 1YPZA 2PXYC 3O3EA 2LFGA 4HHAB 3U7WH 1NJ9A 4PJ9C 2F54D 2BX5A 3RQ3A 5CINL 2UZYB 3OPZL 1XGPB 3LEYL 1QSEE 5HI4C 3AGVA 3LEXA 5EU4B 2BVYA 1TZGH 4HKXA 1DN0A 3UTSA 1U8KB 3EOBB 1F4WH 3S35H 3HC4L 1Y6MR 4ELKA 1KIPA 4S1QH 4EQ3A 4A6YL 2NXYC 2CRZA 2OBGA 3HB3D 4Q9RL 2FHBA 3HR5A 4ORZC 5FOBB 1LEGB 4BH7A 1JPST 3ULVD 5IW6B 4PV8A 4XAWH 3BKJH 1U2CA 5DHVB 4FXLA 1RY7B 1BD2A 4JM2C 4U6XB 3QXAB 1B6UA 3A67L 4CN1A 3L6FA 1KENH 1ZT4B 5C0RL 4HT1H 1ZHBA 3ZSTA 5EN2B 3GMRA 3QH3A 5C0NC 3T0AA 2CO6B 1J8HE 1OAKL 1F6AB 1GGUA 3JV0A 3KPLA 3SKNA 5FM5M 3ISWA 5MERB 4YGVA 4XPAL 1I85A 1QRNB 4P3DA 4O9HL 4M7ZC 3TYFA 5HTSA 3RWHB 1JWMA 4FQLL 2NNAA 5JIIA 4U6YB 1J1XL 3UZQA 2BOCA 5FDYA 1FZOB 3QDAA 4KTDL 4OIBA 5DLML 3T4AB 2Z92A 2D7NA 3SE8L 2YPLE 3DO3A 4LLQA 3QBTB 4Z76B 4YDLB 1K8IB 4RMQA 1EMTL 1S7TA 4K3EL 5E8OA 3D87B 4HD9A 1JHTB 4LGRB 4FP8L 4WI9A 2B8OT 2G5BB 1DANT 1BJ1J 5EU5A 3PV7A 3O0RL 3LPWA 3OSKA 3FOLB 4ZTOH 2BRRH 2Q8BH 4ZOAA 3MRPA 3ULSB 3HRZB 4NZDA 4Y5XA 1EGJH 1I1YA 5DGQA 4ZD3L 3JV4A 1FVEA 1QRND 2X1WL 4XH2A 5IESH 4JGUA 2OYPA 3K81A 1CL7I 1HQ4B 1IFHL 1V7NH 4YWGH 5DWUH 2ZSWA 2JCCA 5ACZA 4NKMB 2VDNL 5KVEL 1A9BA 3BP5B 4Y19E 3TH3T 1VPOL 3DX9B 3TA3B 5IHBA 1ZEAL 1RHHB 1SMOA 5D72H 2FR4A 2P5EE 2WLZA 1DQJA 5J1AA 3X3GL 4LSSH 4L1HA 4UTBL 1CDJA 1QNZL 4G9FA 4M7LH 3L7FB 5DMKB 4QRUA 4XNYH 2JK5B 4LSQL 5E56A 1NCWL 3U0WH 4M61A 5JDJA 1NFIA 3LKOA 4HG4K 4CJ1A 4XNUH 1BVLA 3EDEA 2CGRL 5HHVL 5CD5D 3WFBL 4XPFH 4KMQA 4Z7QF 4ZFOA 4JJ5B 3OKOA 1IGCH 1R3JA 2ZG1A 3MR9A 1UH2A 3SKJH 4X4XA 4IEFB 1KYOJ 5C6TL 4V1DE 4UV7H 3TPUA 1DLFH 3K1KC 32C2A 2R29L 5F1NA 3VXMA 4JY4B 1MQ8A 2ICWB 3O4LB 1QOKA 2P8MA 3HUJE 1N0XH 5HGDB 1RU9L 2MMXA 3MRKB 4N5UA 4QRPA 3MOQA 3CFDB 3BPNC 5INCB 3TA3D 3V95A 3PF2A 2P24B 2HJLA 4S1SH 1KF9B 3C5ZA 3WO4C 3BW9B 4V2BA 1RVFH 3O3BA 5JW4R 3DV6A 4AG4H 4BELD 4S2SA 2PW1A 1G7LB 1J8KA 4QLRA 1UADC 5E9DA 4FG6D 5DJ0A 2EICA 4PREA 2O5ZH 4CMHC 3GNML 1ROWA 3NVQA 4PJ7F 1EA9C 3QDMB 4ERSL 1Y18A 3U9PH 3ECBB 3SGKA 1NGPL 3LV3B 1BQHG 1A4JA 4HPOH 4HXAL 2QR0A 3KPPA 1UJ3B 5EC2B 1A02N 2DBJA 4OI9A 4RSVA 4LEXL 1SYSA 4LPYA 2J8HA 3O4LD 1P2CA 2DQHL 2R69L 3MLUL 4O51A 2ADJB 3T4YB 4YHKH 3QUKA 2MHAA 3RY5A 2YPVH 3L3HB 2HT2C 5K9KA 3H9SE 1ZGLB 3SDAB 3OAYH 3WNKA 4UBDD 5GRXG 1KIQA 1NC2B 1VCAA 4HWEL 3T2NH 1Z3GH 4RDQG 3UTZB 2DQGL 1TQCC 4YUEL 3UBXI 2IFFL 3N50A 1FIGH 3QXDA 3RNKA 2Z35B 3MJ7B 4OD2B 1A1OA 3MREA 1JK8B 1NBVL 4R2GC 1MRFL 4Y2DA 5IWLC 1I9RL 1CF8H 4JM4H 1J9CT 2X4TB 3IFPB 4BYHA 3AREC 5I9QC 3H6JA 3ETBF 1YMMA 1VB9A 1MCOH 2R0ZL 4GRWH 1RK0A 3IU3B 4FQJH 3MJ8B 2AEQH 1U8HA 3QDMD 1AJ7H 4HAGA 5I1KH 3MNWA 3K4AA 3MCKB 5GS1C 1MWAA 2PO6B 1S9VB 1FNSH 2Q3ZA 5CP7A 1IC4L 3F8UB 2COQA 3AXLB 1NCBL 1IKNA 4DGYL 5FHBL 1VGKB 4PRPB 1HXMB 1VACB 4GBXB 1I8MB 3OKEB 1QYGH 5KSAB 1HKFA 3TWCL 1IC5H 3P77B 4ELMB 3D69B 2ENSA 3SDAD 3MLTA 5IKCA 1HOCB 5HJ3A 3VGAB 1JF6A 2ORBH 1NC2D 4K8RL 3T2PA 2Y5TA 4WVRA 3ARFA 1I7ZB 1UC6A 3PV6A 3CIQA 2ENYA 3LKSA 1A0QL 3OKNA 4UIKL 4ENED 3MRLB 1FSKC 4MDIB 4PBVC 2EKJA 3GJFB 1OGAE 1DBAL 3OKKA 5L8LB 4EBQL 3WUWB 4UTAL 4H8WL 4EI5A 3CU7A 4ZUWA 1RUML 3E2HB 4XWOC 2VO5A 3UO1H 5HPMB 3S6CA 1X5IA 2PO6D 2QSCL 3LS4L 3NFSL 1W72L 4KKCD 5TFSH 2CK2A 2E27H 4HUVB 2OLDA 1G1CA 4PR5B 2BSRB 2M1KA 1JHKL 4ZS7L 3ORJA 5FYKU 3FONA 4M5YH 5DYOB 1FYTE 3TBSA 2X4QA 4HFWB 4PRPD 4PV9B 2ZSVB 5DJCA 1ZE3C 4GBXD 1S7UB 2XRAH 3SDXE 5IFHL 4R90L 2O26U 5KSAD 2A73A 2QTEA 4QRRA 1IC1A 3WL9B 3MRHA 2DYPD 1OPGH 5CCKH 5SWZE 1Q94B 4LCIH 1MUJB 1NL0H 4OSUL 4I48A 4PJBF 3MJ9H 1U8MA 4WV1B 1R24B 3KYNA 1OM3L 2FX7L 1SYVA 4POYA 5B3JF 2AAVA 2E7MA 4JZOA 4FS0A 3RBSA 4KRPB 2HN7A 4XMPH 2OP4H 5JUEH 4OM0L 3P0GB 1ZHNA 5DJAA 4XVSH 5DK2B 3MRCA 5CWSB 1ED3A 4RIRA 5GRVK 5D7IE 5JW4Q 2C3GA 2XPGB 3HMXL 4QHUA 2PCPA 1T04B 1MWAH 5FYLE 3JSSA 1KGCE 3HZMB 3REVA 2PR4L 1B0GA 5F8QC 1E4XL 1HHJB 2I07A 4HQQL 3UTPE 3QG7H 1S7XB 4GKSB 3MYJB 4MAUL 4YHIB 3VCLA 3FFCB 4GS7C 2D03H 4NC1C 3TNMB 3ARTA 4LVHC 4HGWA 3GSNA 4X6BB 3F65A 4RAHA 4LSUH 3RY4A 3VGEA 2HMIC 4KGLA 2F5AL 3FT4B 3GMQA 5GSRA 1CIDA 3VG9B 1G0YR 3EOTH 1MCCA 3U4EA 3FB7A 1FZKA 2A77L 1MVUA 2QKIA 5TGBB 1CL7H 3OXRB 5MHSD 4X98A 1U3HC 4KRPD 1OP3K 4GG6B 2WQ8A 1T4KA 3B83A 1YYLH 3OQ3B 4GRMB 4FFVD 1NLBH 5ELIA 4NBYB 5IHLB 1CFNA 1MHPL 1CFQA 1FH5L 3AVEA 5AZ2L 4X7DC 4HPYL 4L4VB 2BJML 4JZJA 1CICA 3KLHD 5CZVL 4AEEA 2H2PD 4PP2B 3UBXA 3V5HA 1FORH 2JJSA 1AY1H 1I8IA 4DKAA 4OQTL 3PGFH 1PEWA 5FKPB 4A6YB 3ALXA 4HJ0D 1YMHA 3T0XA 5K9JH 3FFCD 1HZHH 2V9TA 2JELL 4HFUL 2H26A 2DM7A 4OJFH 3Q6GH 5BS0E 2AJVL 5JPNB 4I9WE 3FB6B 2R4RL 5KVDL 3M8OL 4X80L 3BPOB 1JNLH 1VEPA 3HS0B 4AQOA 2BCKA 1UVQA 3ZKND 3QPXL 4NSKB 4OV5A 5I1CL 2VSDA 3QISA 3VMOA 5DTFA 3RWGA 2EDNA 4G8FA 2OTUB 4H25A 5T1KB 1MY5A 5C09A 1QVOB 3LQAH 3FQXB 2EDHA 4YHMH 1UYWH 4KV5E 4MAYC 1OQXA 2I25N 4UNUA 2I9TA 2GCYB 4N0UA 1V3MA 2VC2L 1T1YA 4L4VD 2A0LD 2P8LB 1WT5A 4OZFB 1QG3A 1S8DB 4LHUB 2ZJSH 4RX4D 3HHRB 1U6AH 5E8NA 5FDWA 3RDTB 1WQVT 4ODTL 4EDWH 3DV4B 2FHFA 4TVSa 5EG6C 1OTUC 2EIZA 5FUZL 4LSDA 2PXYA 3DYOA 5L7XL 5E8PA 4PJCB 1XF1A 4GKZB 4KKLD 3TBTB 4P4KC 4HG4J 4PJXE 2GT9B 1YECL 1G7QA 3WFHB 4XP9H 1LD9B 2ATKB 3N9GL 3UAJC 3G5VB 3IJHB 2B4CH 1RZIA 5JO5B 1A3QA 1H5BC 4X99A 1K9TA 2BNQE 4KK9D 2DTML 4Y89A 2WP3O 4HJJL 4M93C 1I3UA 5GS3A 3JXAA 5T1KD 5BV7L 2AXFB 1JGLL 2D2OA 4Z7VE 5AD0B 4MQXD 4ZUUA 5I1AA 2Z4QA 5EZOH 2XNAB 4TUOB 2AXJA 5FM5O 1JGVL 3VRJA 1D5ZA 4E0RA 1IC7H 3GO1H 1F8TL 3SGDI 5CKAA 2W38A 1EHLH 4LHUD 2ESVE 3D25B 4FXGB 1HI6A 4N90E 3FQWA 3ZHDA 1PFCA 1VSCA 3RDTD 2BFVL 1PZUB 3MBEB 5JXED 2VLKB 2GFBB 4N8VG 5GS0L 4WU7B 3RGHA 4P99A 2E7LC 4JKWA 3UPRB 5F9OL 2G60H 4GUPB 5A43C 3ARZA 2MNUA 4ZFZA 3QIBC 1XCTB 4I18B 2GK0A 3GHEH 4P49A 4BKLA 4QOKB 3VGFA 3N85H 3W81A 5DEZA 1N4XL 1BPVA 4JRYA 2GITA 5FA4A 3ZE0F 2HG5B 3ARDB 4NQTA 3DIFA 1C12B 4OCRL 1N5YL 1QO3A 1IE5A 2GSIA 3QUXA 3U4BH 1T22B 1UXSA 4LCYA 1JUFA 1WZ1L 3QUML 2EKSA 4QHLA 5DSCB 1A7RH 1AR2A 3BN9D 4LKXA 1N3NB 1JMXA 4J8RB 1S5IH 4XRCA 1ZS8A 5ICXB 2ZUXA 4XPHL 5E95B 3MBED 3HZVB 2VLKD 4IOSD 4JLRB 5IVXF 1JE6A 2GTZB 4GAJL 5DRZB 3HE6C 1JZ7A 3T04D 5IEKB 2P42B 3V4PH 2UWEB 2QEJA 5HVWA 3HG1E 5CLTA 5EPMB 5FYKH 5BO1H 1XGUB 2C4XA 4Z7WB 5IJVB 3R8BB 3T3PE 5EBLB 2Y4SA 4QOKD 5GGSB 2DKUA 3MNVB 3MLYL 3ARDD 4WUUA 1E0OB 5C0IA 2VMFA 5FKAB 3DX6A 4PJ7A 1KTRL 3BSZL 1PYWB 1D9KB 4NO3B 3OTTA 5ICYB 3JVGA 4LPVA 1XIWA 1IAKA 2OJEA 3SKUD 3PWNA 1BOGA 4G7VL 4AEIH 3AY4A 3MCLL 4D3CH 1H0DA 5MP6L 3AMKA 4GAGL 2AP2A 3HPJA 2CKBA 4OAWB 3T0EC 3TH2T 4XC3L 2DLFH 1MCNA 3ZTJH 1GPOH 4MXVE 4X7EC 1N8ZA 1A6TA 5DS8A 2R15A 2XACC 1UEMA 1DEEA 2X1QA 3VW3L 4O2EB 2CXKA 1WFNA 4WHYH 5GGQL 3MRMB 4LLYA 4IS6B 3MRBA 4EVNB 4XC1H 1CFSB 1DFBL 5GHWH 3BVNA 2J8UE 2WLYA 2AABL 4LARH 4MQTB 3FN0H 1OY3B 2VDML 3O45A 1YNKL 4LIQH 1ONQB 4JR9H 3KPRE 4BH8A 4XWGH 5DEFA 1FGNH 1MLBB 5F6IB 3RVUD 4FNLL 4XB8A 5KSVA 5ID0A 1D9KD 1UZ8B 5IB3B 1PJ9A 3GSVB 1OTSD 3CSYB 4IOFC 4NQDA 15C8H 2H32B 1WBXB 1DQTA 5KJRH 4OLWH 4RMTA 2AV1B 1GGBH 4WFFD 5I8OL 4W4OA 2NY6B 2YWYA 1BAFL 4WGWB 2XQYG 4JFXA 3H9ZA 4LDLB 1QSFB 5DQDL 3QRGH 2AV7B 4Y4KC 3O6MH 4Y19B 3CFKA 4JG1L 3IDJA 2WM0A 4GW1B 4KJPC 1OSZA 4G6ML 2IG2L 3BGMA 3MRFA 3VFUB 2Y6SC 4P5TA 2P5EB 4FXKB 4JY6A 5HHME 4LLWA 2YOCA 2GUOB 4XBEH 4GLRI 3PDGA 3DUHA 4Z0XB 5A2FA 1I7TB 4UT7L 4Z78B 3KLAA 4JO1H 2ED8A 4JZNA 1UWGL 5E5MA 3JUYA 2DLIA 4LLMA 2VL4A 4NNXA 2CDFB 1BQLL 4LRNH 1K2DA 4R4FH 3ROOA 4LCWA 1XF3A 4KI1A 5EA0H 1I3VA 1XR8A 4MDJB 4Z6AT 4Q6IB 1FVDA 1OCWH 4KZDL 4OZIB 1Y0LA 4WU5A 5IVOA 2CJUH 4YJZL 2NY6D 3VXQA 4JFZL 5IT2L 5GGRA 3S88H 5IWLA 4V1DB 2CKBH 3VJ6B 3U79A 4CVWA 2R8SL 4R26L 1QSFD 3S34L 3WLBA 2GSGB 3IDXH 1EJOL 1UFUA 4I3SH 3QCTH 4KTEL 3VWKB 2EH7L 4PJBA 4Y19D 2R4SH 3BKYH 3QXTA 5I66A 4HK0A 4XBPB 3BT2H 3MQIA 2BERA 3QNXB 3CFIC 1AGFB 2A6DB 3SEPA 1CLOH 5F7YC 2EYRA 3QZWA 5ITFA 1RIVL 3UZEA 3P0VH 2P5ED 4IRSA 3SHSA 5E8DH 3WFDL 1D5IH 3D3VA 4G3YH 4DN4H 2NY0B 4PTTB 5D8JL 1J0IA 1RULH 1MIML 5B22A 5LWYH 2HJFB 3V79C 4HIXL 4ONGL 3RVTD 2F53A 4PJGB 4D0BA 2HFTA 1X4ZA 2PTUA 3WYRA 4DUXA 1LO3L 4X6CE 4WFED 4IRJB 4H0IA 4PB9H 5FHAL 5FUCC 4CVUA 4QWWD 1GGCH 4NUJA 3BEVA 3PDOB 3MGAA 3U48A 4H5SB 5D70H 2JE8A 5ILTL 3V5KA 4V1DD 2UZIH 3DNKA 2AJUH 3CAFA 2OXGA 1MJ8H 4K7FA 4QXGH 1P7KA 5BXFA 3HI6H 3G6JF 1JI2A 4DWHA 5FF6B 3VWKD 4YO0A 3GKWL 4HW6A 1X5AA 5HI3C 5JQ6L 4GFTB 3HZYA 4IOIB 4F2MB 4JHAL 1Q0YL 1LO5A 4HIJB 4ONHB 1FJ1B 1JL8A 1FE8L 4Z0BL 3V5DA 4L3EB 3DSFL 1ZGLP 2XOTA 3B9DA 4UT6L 2NY0D 1YQVH 1KT2A 3NZHL 2DBLL 4ZODA 3HCVA 5F3HA 5FM4A 3SGDH 4W81A 3TBWB 1L0QA 1JRHI 5CZXC 4WWKB 4G8IB 4PJAE 3PHQB 2VXQH 2H2SD 1H3WM 5HHOE 1T2XA 2LU3A 3IDNA 4G80B 1NLDH 3RVVC 3Q3GA 2OL3L 5T5NF 4IRJD 4FQQB 1KTDA 3GMNB 4KJQC 1U8QB 3S37L 3OJ2C 2Y07L 2D7QA 4UDTB 2V2XA 3WBDA 2OTWA 3RWDB 3VXUA 1RK1A 1JTOA 4D0DB 3MUJA 1DQQB 4PY7B 4E41E 3CVHH 1CCZA 1DVFA 1W2KT 4EEEA 2N7AA 1OAQL 2BY1A 4ODVH 2R2EB 4PUBH 5CP3H 3OJDA 2V7HA 2CH8A 4LVNB 1QFUL 3IT8D 1CFVL 2VDOL 3NN8A 1BBDL 1I75A 3JWDL 4L3ED 2BDNH 5T33L 2EH8H 4P9MH 3R0NA 1DL7H 5C2UB 4NKIL 4PJEA 5C0EB 2P5WA 1OGAB 4WWKD 5JOFA 3RA7H 2YA1A 3HC0A 1XH3A 5HSFA 5TDNA 5B38A 4P23B 4XB7A 5AEAA 1XR9A 3SBWC 5C0FA 3SDCC 3O2DA 4OT1L 2H1PH 5TDPB 3C09B 2VZ3A 1G0XA 4Y4HC 5C08E 3X13B 4M7JH 4DVBB 1LE9A 4O02L 3VFMB 2R2HB 3LKNB 4U1LA 1ZKAA 4X7TA 1WIPA 3QO0A 1S7VA 1RI8A 5EU7E 1JPFA 2J4WH 3P73A 4WHYG 3SDXB 3TO2A 1CXEA 1TPXC 5JOPE 1NBZB 3D0LB 1LO2H 1V7ML 3D39A 3NFNB 3MXVH 3O2WL 4YHYB 3MA9L 5DUBA 2X4SA 5IVZA 3UTQB 1B4RA 2BVEA 4Q7DA 5H2BB 1IAII 4H88L 25C8L 3LKRA 4RBPH 3X17A 1FN4A 4M3KB 3G6AB 3NAAL 1T0NB 3EAKA 4P2RA 5E4EB 3QB7C 1OGAD 3NH7L 5GZND 3QPQC 3TIEA 2W65B 3WJJC 5MEOB 5LAXA 4AM0A 4H8WC 4TSAL 4P0DA 4P23D 1IQWL 5DRNA 5EUOB 1RMFH 3BPLB 5FK9A 1AE6H 4MMXC 5D7IB 1IEAA 4F7CB 5I1JL 4XVJL 3GSXB 1ZLVH 3VXOA 4HWBA 4O58H 3SDYL 2KZ1B 4HEPG 1OW0C 1I7RA 4G9DA 1T2QL 4CU7A 1UB6A 3BP4B 3WLWD 1FO0B 1OLLA 3REWA 3TJHD 2NY1C 3KNBB 3BFOA 1LO4L 5F9JA 3PGCA 3GUTA 3AAZB 1KJ2L 3RP1A 3OKLB 5EU5B 2XTLA 3EO9L 1MY7A 1PLGL 2D7TH 2EEDA 5IW1A 1M7IB 1R5WB 4WIQA 4XXDB 4ZO6A 1ADQA 5BQ7B 1ITBB 2ZCKL 3ARBB 3OHXA 4NJ9L 3LB6C 4XNZB 3GSUB 1HQRB 1WWWX 5I19H 1MCLA 4F57L 1KNOB 4P4KA 2Y7QB 5IROC 1T83C 4KHTL 5JDSB 3WS6C 2W60A 3K0WA 1WCBA 1MJJA 3PG2A 4XZUA 3N1FC 4QGTA 5IVXA 5I0ZA 4EIZC 5I6XC 4RWYL 2AERT 4M3JA 2JB6A 3QFDA 4C83A 2GIYA 2VSCA 5FYLD 1CDHA 3PP4H 2Q87A 3CC5B 1OOAA 5KTEL 4JO4L 3CPLB 3NCCB 4ZNEA 4GLRH 1B2WH 4TOYH 2VR9A 3UTPD 1XF4A 1NFKA 2Q86A 5EU6A 1SBSH 4XNXH 1BP3B 3OKYA 3JZ7A 3S3JA 1CR9H 2M2DA 5E8EA 3VXPB 4XP6L 4GRWB 5AYUL 1J87A 3MSPA 4H26A 4B7LA 3WXWL 3QO1B 1W0YT 4KMTL 4Z7NF 4HUMB 4LGPB 2E7LA 3C08H 2H45A 3ARBD 3BDBA 3BUYB 3UPAA 3BEWA 1F3DJ 1GGIL 2EYTA 4MA3B 1QFHA 5E94A 3O4OC 4Y4FA 5IVNA 2FJGB 3DGGB 3KPQA 3MRJB 4HH9A 4N8VB 4PRAB 4Y1AA 5E4IA 3RTQA 3MLRL 5DUPH 2B7DT 1SEBB 1KLGB 1RUKH 5TJWK 3PE9A 2EIDA 4TRPL 3K80A 4KUZH 3TFKC 4QCIB 4HDIB 5LBSL 3G5YA 3ULUH 3NIFE 4X8JA 1SVCP 4F9PA 3QDJA 3I9GH 5GGSY 1EZVX 1DLHB 3PUCA 5FA3A 3U30C 3L1OL 5DD6A 4YIQA 2EO9A 2IBZY 3C6LC 3SPVB 1F3JB 2NY2C 1C5BH 4FZ8L 4PJXB 1UB5A 4PJIF 2LV4A 1MCKA 2NYYD 3MLZH 1YN6A 3V7AE 1R5IB 4X9BA 3OAYK 3NCYP 1Q72H 1G7MB 3HE6A 3CH1B 4KQ3L 3UJIL 4J12A 2E7CA 3NACL 1KBGH 1ADQH 4QRSA 5DK3A 4P9HC 1G7IA 1NAKL 3RL1A 1AFVH 2VLJE 4MJ4A 3LHPL 4YQXL 4NQUA 3OWEA 2XQBL 4JFQA 4UDUB 4HKZB 4JG0H 1CZ8L 3D2UA 3MZGB 4LLVA 4MXWH 3CFCH 5F7DB 1ZHLB 3P3YA 5D2LB 3ZE1F 2IALB 4DCQA 3WHXA 4TTDD 2QLVB 1FAIH 1JP5A 3H9YA 4J1UB 4WUKL 4Y5YC 1BM3H 2EDDA 1RZJL 4OFKA 1LP9E 3GMMA 3PQYB 1JF5A 2EEBA 3OG6B 4P3CH 1FAKT 2ITCB 1RJZB 4U33A 1JRHH 3T3ME 2XWBB 2I9LA 4I3RL 3T0EA 4HMEA 3BI9X 3O9WB 5EIVA 1UWXK 5J6GB 5IMMA 5I74B 2CMRH 2A9NL 4PJDE 3L5JA 3QZWG 3SO5A 5J56B 1OP9A 1L7TH 1WVZA 2PYFB 1EEYB 1HHHB 2VXUL 2XWTB 1CGUA 3IFLH 4GMTH 4TNVF 3VXTB 1J18A 3LKPB 4TULH 4MD4A 4DVRL 1AHWB 3KR3L 3KS0J 4C55A 5ICZA 4O2FA 1UKQA 1OTTC 4N1EA 4OM1H 3MMEB 3EYUH 3U9UB 4LDOB 5ITBH 4F7PB 1ERNA 4BQBA 1YJDH 2ZOKB 1DQDL 3K8KA 4DTGH 4MYWB 4ZPVB 5EBWA 2EZ0C 1L0YA 1AGEA 2QQNH 1D5BA 3KYKH 5F96H 3SE4C 2VLRB 3PQYD 5HYSA 4FABL 3QEHB 1YEGH 3TVMA 3B9AA 3TJEH 1UM4L 5DD1L 2GAZB 2VIRA 5I73C 3O41A 4GT7A 1YEEL 3ZE2E 1PAMA 3O9WD 1FL6B 5DJDA 1E4WH 3FB8B 5IB5A 2DQIL 4CDHA 3QNYB 5A3ID 5FO8A 1BEYL 1MIEL 4U1GB 5MEPA 3VH8A 1S78C 5J13B 4QHMA 2JIXB 3O8XC 1C5CL 5EWIH 5IBLD 1VA9A 2FGWL 5D93B 4GSDH 2EC9T 4JN2B 4RFNC 1R6VA 4X9HA 3HC3H 5DJ8A 4XP1H 3DUUA 1KLUB 1SBBA 3K2MC 4BSJA 4EN3B 4JY5H 4Z7UB 1EBAA 3RX7A 1H3VA 1KEGH 5DJ6B 1TETL 3G6JA 5GJSL 3KPMB 1S5HA 4M02A 4BFEA 4NZRL 1CI5A 1ZOXA 1HIML 3QUZB 1IAIH 2VLRD 3MYZA 3KYMA 4F7EA 4G42A 4QEGA 2BHZA 1E4JA 2DL2A 2KL6A 3NABL 5IFJA 2GTWB 3MRIA 3RIAF 1WV7T 4XNQA 2J8UB 2PUQT 1CU4H 4JJHA 1I3GH 5T3ZH 5IQ7H 1SJHA 5D7LE 3EGSA 4KROC 1U58A 5J0BA 2ADFH 3KPRB 5DT1L 5GGTA 2JIXD 4UV4L 4X9IA 1H8OA 5KG9A 3BPCB 4LHJB 5KSUA 2GI7A 1CT8A 3CLFL 1KPUA 5C6WH 1IAMA 3KG5A 5FB8B 2OL3B 1KCUL 4OQ1A 4MX7B 5HYJE 2IQAA 2A83B 2C7UB 4EN3D 1EVUA 4FZEL 5B38G 4OD1H 3RU8L 3NIGE 5EZLA 3T0VA 4GXVL 1ZSDA 1JJUA 3W39A 1A7NL 3RKDD 2A38A 4HCRA 2FCBA 3OB8A 3NA9H 1H8NA 1A4KA 3F58L 3P9LA 3QUZD 5I1GL 4NKDA 3DHJA 4P2OA 1SJEA 3VG0H 1MHHA 5A2IH 4ZSOB 2C9AA 2XWJA 3I3BA 4P46B 4X5XA 3RJQB 3JTTA 2QSVA 4NNYB 5E99L 4YXKH 1L9MA 3MV7E 3C9NA 3KPRD 4NWUL 4U1NA 2X44D 4MNHA 4BZYA 1RZKL 2Z91B 1KCSH 1FFOA 1TFHA 3MBXH 1TZHA 4ZAKB 2NTSP 5CLWA 1JFQH 5FYJU 4WNQB 1I1AB 3ULVF 4W6YB 3VXSE 1SEQH 4P5KB 5MENB 3QEUA 4ZDHA 3QIUB 1GHFH 5FGRA 4N8CL 1FVCB 4RA3A 5B39A 4BFBD 1AC0A 5KS9A 4JGJA 1LEIB 1CXFA 4ETQB 4KMLB 1JPGA 4RGNB 5FGCE 4KDTC 2V5MA 4FMFA 4P46D 5D4QA 3HFMH 3VFRA 3UYRL 1II4E 1RIUH 3SKOB 2ICEA 3CXDL 1A3RH 3PWJA 2ZG3A 3TF7C 3NCMA 1UXWB 4NP4L 4RFEB 3UTSE 1OD9A 5CD5C 3QULA 4NQSA 1WLHA 5GGTH 2YC1A 1S7RB 4L3CA 2VXTL 3QSKB 3GSOB 4D8PA 4ZAKD 2CR3A 3VXRB 1I1AD 3LQZA 4OB5H 1PG7X 2VABA 2VDRH 3GGWA 5MEND 3MX0A 3PWPB 1CGTA 1IM3B 1T1XB 1BD2E 4WJ5A 3QIUD 5HHNB 4F33A 4X7SL 5AUMB 3CDGB 1PKOA 3EOAA 5GRJL 1F00I 1KG0B 3V2AR 1CE6A 3PJSA 1CWVA 1NKOA 4L29B 4HCRH 1KJMB 3TA3C 5L2JA 4QNPE 3MO1A 1P4IL 4RGND 1YYML 3LIZL 1JNNL 4UILL 1FL3A 1LK2B 4MXQD 5C7XH 4NGHL 3VRIB 1JYVA 1KIUA 3SDCA 1RUAL 4HXBH 2IGFH 1MSPA 2YEZA 4JFHE 1G6RH 2E6PA 1MNUH 2ARJB 3U83A 5E6ZA 4R8WH 2IEPA 2XTJB 2X1PA 4QRQB 1K4CA 2B0SL 1K6QL 5TDOA 1KEMH 4L8BB 5DA4A 2FD6H 1NGQH 2VAAA 3RGVB 1I1CA 3VXRD 4UNVA 4NBZB 1UM5H 4PJFE 1YY8B 1RJYB 3PWPD 4JFEE 5FCUH 4QY8B 5FYKD 4XAWL 1EEZB 1OAZH 4D0CB 3IDYB 4L5FH 5HGHB 4LMQE 5D7SH 3WJJA 3ZDYF 4ODWA 3WDIA 1KENL 4G6FB 4NZUL 3CMOL 1Z9MA 3DI3B 4E41B 1BZ7A 1P4BH 1XFPA 2Z9TA 5KSBB 3EO1A 3WIHH 1YNTA 1WWAX 2Z93B 5K59F 2DQDH 2EDEA 1OW0A 3FZUC 2XXMB 5IBTL 5C07B 5DFVC 4HJGA 5E2UH 5E2TL 4X6DB 1FC2D 3BXNA 1N26A 2AJ3B 3RWEB 3MGOB 4JDZB 1YEKH 2JF1A 2XTJD 2W1NA 1DBJL 3VRLE 3VGHA 4BZ2H 1ETZB 2V7NB 1FFRA 3FOMA 4U2ZA 3QEQB 5IB4B 1KB5L 2CLZB 5T3XH 3T8XA 5HGAB 3RGVD 1HH6A 4AENA 3P4LA 5E5RB 4IDLA 1HH9B 1UJ3C 4WCYH 4NQCA 4XI5C 3OAUH 4R96A 4CADA 3WJLC 1NCAH 2X4OA 3E8UL 4G9FE 2N7BA 3FO9A 4PLOB 5TQ2H 3ZDXF 3Q5OA 3TN0A 5IEHB 4OFYA 5IROA 2VUYA 1CD9B 1JHLH 4Z95H 4HZLB 3GI8H 4G6FD 4YHZH 4PJIA 4E41D 1I3RA 2BRRL 5CUSH 3MV01 4ESKA 2V2TA 2IANE 5ISZB 4J4PC 3CK0H 5ENWA 1PZ5A 3JV6A 5EOCL 5C07D 5L2KB 5JZ7C 5IESL 3HI1A 5C0DB 2J88H 5HDBE 5F89A 3ARGB 4DGVL 1PQZA 2KKQA 4UB0H 1A7OL 1A6ZA 3T0WA 3QEQD 5BJTB 3RZCB 4QRPE 5DJZB 5AWNH 4PRDA 2RFXB 4LLDB 5DD3H 5IR1B 1DDHA 1SHMA 2WUBL 3I2CH 5JHDB 5BMFH 2WBJC 3U36A 5JW4M 5I8KH 4GBXC 1C5DA 4PJHE 1RZGA 5DJXB 1LNUA 1IRAY 1GZPB 2ZCLL 4PJ5A 5DRXA 12E8H 2IH1B 4XNYL 1ZLUH 4JQXA 2PTTB 1BQUA 3HNVH 1H3PH 4NN6C 4I77L 5L9DL 3MV9A 3F5WA 5ISZD 1P5VA 4DKEH 5JOPD 4Y16C 2QL1A 4Z5RB 1K85A 4FQCH 4UQ3B 3WIFA 3LN4B 2NW2B 5L2KD 5EO9A 5ACMA 4F37F 3SN6N 4UV7L 3FQNA 3ARGD 3V4VH 4FQHA 3RIFF 5CEZH 3P9MB 1U2HA 1ZVSB 3PABB 3RZCD 1GRWA 2PYEA 2OX5A 2VQTA 3IDMA 5JHDD 2ADIA 1INDL 4QTHA 2FO4A 4NWTH 4FFYH 2AK1L 4FTVA 5LQBH 5FYJH 3BGFC 1IGJB 1HWHB 1F2QA 3EJZD 1W0VA 2VDKL 1N64L 5GS2H 1EEUA 2WMPA 3V7MA 1OAUH 1YMME 5DQJA 3BOVA 1GCFA 1IGTA 1LVEA 4LCCA 1OWRM 5LXGL 1P6AB 2E9JA 2GY7B 1S7SB 1GIGH 2ATPB 3EYVB 4Y5YA 4K3DH 1L7IL 2VN4A 1OP5H 2HFGH 4HPOL 4KRPC 3FRPA 4W6XB 4JO2H 3W0WA 2B2XL 3I6LE 4KPHH 3L3OA 1FNGB 1NCNA 1XR8B 1U8LA 5IM7A 2OK0H 4FFVC 5D71H 3BZFB 4ELMF 2UZXB 4MWFA 3C5JA 4OZHF 3WD5H 1VFAA 3CVHB 1Q9OA 1MCPL 2OR7A 4IIQA 5KVGL 3O3AA 1QLRA 3C60B 1E27B 1KN4L 3MLSH 1YEJH 2HJKB 3U0PA 1Z3GL 2AKRB 3WFZA 4KHXH 2BSSB 4KJWD 2X6MA 4HJ0C 1AXSB 1GGYA 5JIPA 5I66B 1CGYA 3PDDA 4G6JH 1FLRL 4PRNA 4KY1H 3VWJA 4IRZH 2EYRB 1CF8L 1FDLL 5ITFB 4C56A 4JQIL 3RAJH 3LDBB 4M62L 1FG9C 4YH6A 1M71B 4UI2A 2AEQL 3PIQB 3UZVB 5L8KB 5I8EB 4WWID 3SY0B 4JFPB 4KI5E 4ZFOL 2X7LA 4AEHH 2VXSH 3LRSA 4M1CC 3WNNA 3BRFA 4S1DC 3BP7A 2VTFA 5F1KC 4MA8H 1J7VR 1T5WB 2HA1A 3RRQA 4X4YB 2ICCA 4QRRE 4L8SC 4LCUA 4QYOB 2DWEB 2RR3A 4HF5L 1IC5L 5IHUH 5DQ9B 4J3WA 4C58B 2A0LC 3NFPB 2VWEC 5HGBB 3L9RB 5FEBA 3WE6A 1XZ0A 1S9XB 3C60D 4ODXB 3IDIA 3CUPA 1G9NC 4OKVA 1IGIL 1LE5B 4UZGA 4GH7B 1MHEB 4LSPL 3ILPA 2BVPA 4MJ2A 2UUDH 3EYQD 2FIKB 1VDGA 2F54A 1UA6L 1Z2KA 2EXYC 1LP9B 1LK3L 4IDJH 5B39G 4NYLB 2BNRE 1JPSL 1ZHKB 2C26A 3QEGH 1SJXA 4WHTA 3GBMH 2NY3B 5F7EL 4Q9QH 4LNRA 3RVXC 1AGDA 5FO9A 3UO1L 4HEME 1DUZB 1T20B 1S9YB 5FOJA 2V9QA 4BA8A 4W68A 1QP1A 4G8GB 2A6JA 3UJTH 3DO7B 1QLFA 3ARXA 4OF5A 4PJDB 1NGYB 2MOVA 2XFXA 3P4NB 3G6DL 3EJYD 1FZMB 3KJ4C 4MQXC 4OFPA 4LQFH 3P2TA 4GG8B 3UX9B 1I9IL 4J3UA 1N6QL 4LASL 2VLJD 1IEBA 4F58L 4AIZA 1MCRA 4ISVB 5TQ0L 4YZFF 3EDDA 3W11D 2ICWI 4XVTL 3TO4B 5DJYB 3FQUA 1NCDH 4JREB 2HFFB 1RQ5A 1RZ8A 2V2WA 4AIXA 4HHAA 3PGDB 4PLJD 1XGPA 5GXBB 3X11B 4E42B 4OGAD 2AK4E 2NY3D 5EU4A 4XAKE 1MCWM 4RA0C 2R23B 1U8KA 3EOBA 5B8CB 4J3VA 1MRDH 1MFDL 4GJTB 1KIRB 3S5LB 4G8GD 1MWAL 2EIEA 2W07A 4I8DA 3FO1B 4WFHE 5DF0A 2JJTC 5FOBA 1TVBB 1LEGA 4E5XA 5IW6A 1AQKH 3L5HA 3IU4H 5DHVA 3S36H 4RBPK 4U6XA 3SCMB 2D03L 3QXAA 4XNMB 4H1LB 2N4IA 3NPZB 3TO4D 4HX1B 2EO1A 3A6BH 4LSUL 1Q0XH 1ZT4A 5GRYA 3MBEC 2NTFA 5F9WC 1MEXL 1N7MH 2DLHA 3CSPA 4ZYKB 2V5YA 5EN2A 2GJZB 2DD8H 1MJ7L 4ZXBB 5C8JB 4XXCC 1REIA 5MERA 4TNWK 4IMLB 1QRNA 1ZLVK 1P84K 5DVMA 1K3IA 1Y6NR 4PLNC 3RWHA 2DTSA 4U6YA 4N0UE 4OZ4B 3SOBH 5EFIB 1FZOA 3OB0K 3U7YL 1TVDA 4OIAA 3T4AA 5EIIB 2AVGA 2F5BH 5D7LB 4N8PA 2CRIA 2D31B 3RWFB 5ETUB 2PTVA 1YQ2A 1A6VL 4Z76A 3DXAB 1K8IA 5GISH 4PJCF 1IEAB 4JKKA 5TH2B 1IAOB 2GQHA 2X09A 1JHTA 3SCMD 3ULVH 2XZQL 2G5BA 5HYJB 2WWKT 3HMWH 3B4NA 1QD0A 3FOLA 3QFJE 3WN5B 1T3FB 1X5FA 1TCRB 4PP1C 3ULSA 3HRZA 2Z31B 4ZXBD 1JZ8A 4NNPL 5HDLA 1DBBH 3SDDC 5F97E 3G5ZB 4WI4A 1HQ4A 3Q0HA 3HKFA 4J23A 3R8QA 2CSPA 2YUZA 3IJYB 1X5JA 3TYGL 4H0HB 3N0PB 1GC1C 4NKMA 1AGBB 3MUY1 4ACPA 1J0YA 3BP5A 5D7LD 1OSPL 1MRCH 2EE2A 3QUYC 3X14B 3QDGB 1KV3A 3MV7B 4GAYB 3DX9A 4R0LB 3TA3A 1M7DB 5CEYB 1U6AL 1RFDH 1RHHA 1OTSC 3OGCB 1BVKB 3DXAD 3KJ6H 5A2JH 1PBYA 4IJ3B 4ONOA 5I2IB 3ULUD 1U8NB 3T08A 3L7FA 1WAAF 3KPNB 5DMKA 5HYJD 2JK5A 1O5DT 4XP9L 1CD8A 3BKML 1MFCH 5AYQA 3VXSB 2B4CL 4CMMB 1EHNA 3GSNL 5LGHH 2OI9B 1BLNB 4JJ5A 3ES6B 2Z31D 1OGTB 5ERWB 2QQLL 1F90H 4YEFA 2Y23A 5E8EB 3GK8H 4I0PB 1FV1B 1NDMB 5DC9B 4JY4A 1YY9D 3S96B 1IGYB 4U0RB 1C08B 2ICWA 3O4LA 4HKBB 4YPGB 1PSKH 5DK0B 5HGDA 3MRKA 1IC7L 3QA3B 1K3ZA 5MI0B 4DQOL 3QDGD 3CFDA 1S7WB 3MV7D 5JHLL 2Q20A 5INCA 2P24A 2W9EL 3H7LA 4NUGH 2WBKA 4YBQD 1RZKC 2BVUA 2UWEF 3BW9A 2QQKH 4Y0GA 1IVLA 3QXVA 3VFTB 3MXWL 4JN1H 1RUPH 4UOW0 1NEZB 1CLYH 1RUQL 5AG8A 1G7LA 3T65B 2XA3A 5C9JB 2C1OB 3VXSD 3GHEL 3H3PH 3BD5A 2OZ4A 1SY6L 3QDMA 5HHPB 4PJ7E 3GJEB 4F8QA 5FV2A 5HBBA 3ECBA 5T5FL 3LV3A 4I0PD 3F7VB 3G9AB 4U31A 1UJ3A 3FT3B 5EC2A 3U0TB 3RWIB 3GIZL 5T1MB 5EIQA 5CJBA 4YFDB 1KXQE 2ADJA 3T4YA 2HTKC 1GXEA 3L3HA 3RVTC 4NDMB 2DIAA 3SDAA 4ZFFB 3EYOB 1K8DB 3GMLB 4XCFL 2CRMA 1NC2A 2K1MA 4ODHH 3FRPG 1ZLSL 4OLZH 4YXLH 2MFNA 2Q1EA 3UTZA 5EC1B 2BVOB 2XY2A 4RQQB 2Z35A 3MJ7A 3DMMB 5L0QC 3W2DH 1JK8A 1INEL 5HI5C 4KDWA 2MKLC 4NQXB 2X4TA 3IFPA 1AI1L 3KWWB 4PJFB 3HR6A 4JFEB 3ARRA 3C8HA 3VGDA 1R0AH 3IU3A 3TT1H 3MJ8A 3K74B 3TM6A 3MCKA 5J3HC 2PO6A 3GM0A 4M7KL 3VI4E 1S9VA 5E1AB 1NCTA 4MVBD 4JQVA 2DDQL 4NQDE 3AXLA 4KKAD 1T1ZB 4LFHG 3K3QA 1F4YH 4XCCL 1BFSA 1VGKA 4AEIL 4PRPA 1EH9A 1HXMA 4PLKD 1VACA 4GBXA 1I8MA 2FX9H 3OKEA 5KSAA 4OCNC 1KC5L 1QFWI 3P77A 5M94B 4ELMA 1MOEA 5GGVL 3D69A 4LP4A 4TSBH 4NZTH 3VMPA 2DYPA 1HOCA 3QWOB 1A7QL 3QIWD 5JIKA 2N56A 2H2SC 5E6IB 1GSMA 4UT9H 1I7ZA 4D9RE 5IOPB 5ESVB 5HHQB 2V17H 2IFGA 3LCYA 4IRJC 4FQ2L 3DMMD 4KQ4L 2FEEL 3MRLA 4MDIA </