4HIHB

Anti-streptococcus pneumoniae 23f fab 023.102 with bound rhamnose.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
203
Chain Sequence
b'LINLVESGGGVVQPGRSLRLSCAASGFTFSRYGMHWVRQAPGKGLEWVAVVSSDGRTTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVFYCAKEGGDNKFSFDYWGQGTLVTVSSASTKGPSVFPLATAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVQTYTCNVDHKPSNTKVDKTVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 023.102
publication title Structures of Preferred Human IgV Genes-Based Protective Antibodies Identify How Conserved Residues Contact Diverse Antigens and Assign Source of Specificity to CDR3 Loop Variation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 203
sequence length 219
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hihB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hihB01
3OXRB 1BJ8A 2AK4E 1RUKH 1MI5D 1DQDH 3CXDL 2EDDA 4X6FB 4QNPE 5C0BB 5D9SA 3KJ6H 4OZHA 3TH2T 3QHTC 3DRQA 3L3IA 3QUYD 3BKJL 4WFFE 5HHVL 2XI9A 2HFGL 1BGXL 3OL2A 5DD0L 2C4FT 3GMPB 1OY3B 1KEML 3CSGA 1L0YA 4ODVH 1CYGA 3RY4A 1VGEL 1J0JA 1EHLL 3VRJB 4XNYH 2DWDB 1YNTA 1IM3A 5I1KL 2VIRB 1UJ3B 1UEYA 3O2WH 5TDPB 3GJEA 1FV1A 2DJ4A 4FXKA 1Q8MA 4YLQT 5I71B 2F53D 4XHQA 5BMFH 1W0VA 2XWTB 4PGBB 4PJXF 2EDYA 4QRRA 1NCWH 2QSCH 5ABDE 4NBZB 4PJHF 5CD3B 1SJHB 1KJMA 1NCAH 2ARWA 3OKMB 4RWYH 3BZFA 1M7DB 4QY8B 4M7ZC 3QDGE 2VDRH 3PIQB 4LPCA 3O4LA 4DOHE 4LGSB 4I3SL 4XVTH 5CJXA 2C3VA 1OGAB 1P7HL 2R8SH 4FZEH 2ITCA 1AE6H 4Y5VB 4MVBD 2GSGA 5E56A 1QVOA 2UWEB 3VFPB 4NKIH 3IGAA 4LNRA 5F1SA 1B6UA 4DAGH 1A6VL 1K4CA 4DZBA 2ILLA 3DUHA 3BDXA 4KROB 4U6YB 2XZZA 4Q7DA 4FQ1H 5CMAB 5FO8A 1KGCE 1OAKL 2AJZA 3FN0H 5DQDH 5H35A 1EEQA 3V4PL 1OVZA 4C58B 1B4JL 5I1HL 1A4JA 4Y5YB 5D7LE 4FQXC 4YXHL 2IAMC 3PUCA 3FJTA 5C0FB 4OCMC 4NSKB 3QDJE 1FNSL 5DJ8B 4CU8A 3KS0J 3EDDA 3P11L 2FJGB 3NBNA 3L3GB 5IVXB 2BVOA 3M8OL 4N8CL 2VXVL 4GRWH 5E2TH 1JZ7A 3PL6C 1FLRH 1I7RA 4ODUA 4YHIA 1Q72L 3EJZC 4HIXH 1AR1C 4OLZL 3D87B 3Q1SL 5HTSA 2EH7L 4ELME 3HAEB 2PW1A 3RUGB 1IC4H 4I5BA 4ZDHB 4E5XA 4XPHL 3T09A 5DJ0A 2ED9A 2Q6WA 3UYRH 1UZ8B 1CLOL 2BSSB 3BSZL 3IETA 3T2NL 4PRBA 4EEEA 1BJ1J 2EZ0D 5JQHC 3N9GL 1Y0LB 2EO9A 3BP5B 3HE7B 1ZGLP 5BRZB 1RVFL 1TETL 1BF8A 4JANA 4KTDL 2J12B 4QT5B 1WWBX 5LVEA 3L3KA 2FBJL 5KSVA 4R8WL 1VPOL 3T0WA 1QEWB 2ICWJ 1MCOH 2GSIB 1CLZH 5HYQB 5I1LB 4S0SD 3G6JB 5GS2D 3IFPB 2HT4C 4WW2A 1NLDH 2PO6B 3BMWA 1UQSA 1A6UH 5IW1A 1QSFD 4NNPH 1WF5A 1MHHB 4XWGH 2AJSH 2BNRA 2OZ4A 4XWOC 3VXNB 4DW2L 5FYKH 1I7TA 2EYTA 3E2HC 4F8TA 1U8IB 2MFNA 2I27N 4UV4L 3ZYOA 5K9QG 3HPLB 3GM8A 5FYLH 1RZFH 4G43A 1M71A 4KV5F 3RWIB 2J3SA 4MJ5A 4PJ8C 1CICB 1DBKH 1WJ3A 3PWNB 5ALCL 1K8DA 2O5YL 2I9LA 1B2WH 1PG7L 4O58L 3KYOA 4M1GL 4TSAL 1MQKH 5FYJL 4M6NH 2K7QA 4XP1L 3IDXL 1DTUA 4XH2A 4NQCA 2IADB 3LKSA 3RZCA 1F4HA 3OB8A 2J8UB 4G7VL 4D9RE 1XGPB 1VENA 3C8HA 5B39A 4HLJA 1X5YA 3V7AE 1NAMA 5KTEH 5GSRA 1TJHL 3IJHA 3LPFA 4OZHF 3GKZA 1ZAGA 4MMZC 1AJ7H 5AEAA 2LAAA 1BOGB 1HHGB 3IAGC 2XG5A 4PJ5A 2PF6A 2F54B 4X98B 4XB7A 4WWKC 4FTVE 3SKOA 4FFZH 4ONFH 2X41A 1IZJA 3OKNA 2VERN 4LCUB 2OR9L 2AJYL 3AY4A 4I8DA 4F57H 2ZZUT 5E95B 1FH5L 1T1YB 4KQ3H 3B2VL 4JFQB 4JFDD 2OJZL 5ERWA 2BOBA 4MAUL 3MLWH 3QDGD 4JY4A 3UX9B 4UT9H 1KLFA 1FL3A 1T03H 5E8OA 3GNML 3K7UA 4NWUH 5AUMB 1QFWI 2AGJL 4X5LA 3HPJA 4EZMA 2NTSP 4KRNA 1QSVA 3HFMH 3U9UA 3BQUD 3SDCC 5TDOA 2V5TA 2J88L 4TOYH 3HZVB 4PJEA 5E70A 3HG1B 2YXMA 1IBGL 3VRLF 1FE8H 3MGTB 3EZJB 4DKFH 5E24E 3ALXA 2Y6SC 3HUJE 1TZIB 1EAPB 1NEUA 1JMXA 1J0KA 5IFJA 3QDJD 3WBDA 5MHSE 3WIHH 1CTOA 1KPVB 2X4UB 5FKAB 3U7YH 1IAMA 5I2IB 4QRPE 2NMSA 3CDYA 3ARGD 3MBEA 1FFNA 4U6XA 4D9LH 5EIIB 1OAXH 5T3ZH 5GGSB 3UJTH 2OP4L 3FAXA 1JN6A 1UB6B 1VESA 2D3VA 4PBVC 5JLZA 3RVWC 4MXVF 3DYMA 4RMWA 5KANI 3TT1L 3TVMA 2VLLB 4KKAD 3HE6C 4MDJB 3RPKA 2BNQA 4JFOB 5TE4H 1J5OL 3DRTB 1T2JA 2R4SH 1XCQA 5DDHB 2RQ8A 4N1HB 1J1XL 1NBYB 4JO4H 3W0WA 3LRSB 3SE9L 3FRUB 1ORSA 4MJID 4KK5D 2BSTA 2R69L 4UNUA 3JTSB 4YHLH 2EC9T 3ZSSA 3ULUE 1ODAA 4OF5A 1BECA 1P7QD 3V6OC 2EE9A 1DZBA 1J8HD 3CFJB 1CXLA 2AEPH 4YQXL 2XKNB 3BZDA 3TPUA 5JMOC 2FECL 1LK3L 4M93B 1WBXB 5KSAA 4NO0B 4NOBA 2ARJB 5D1QB 4J3UA 3BPCB 5HYSB 4NZTL 1D6VL 1QSEA 3AROA 4MA7L 4OD3H 2VC2H 3P4NB 3OKYA 5KW9H 2GAZA 2VXTL 1ZLSL 5IMMA 4MD5A 2F8XC 4IOIB 4KZEH 1ZLWH 5DSCB 5CP7A 5I9QB 4M1CD 3OHXA 1BOYA 1KLUA 1UKQA 2QKIB 3MRDA 1F4XH 3OWEA 1KT2A 4L4VD 4WW2F 2N7AA 4K7PX 4ZXBB 4GAJL 1JGUL 4CVWA 5F1IA 1ROWA 4WFEE 1BLNB 2G5RA 2ZSWA 4EXKA 4D9RD 4LSRL 3MUGB 4NM8H 4U31A 3F65A 4XP6L 2Y25A 4YUEH 3G6DL 5F6IB 1T6WA 1T1WB 5I1AA 4POZC 4YK4C 3KXFA 1G7IA 4LKCB 2WWKO 3AGVA 5HVWA 1XH3A 3JWDC 3NIDF 4WI8A 2OR8A 3MRCB 3BEVB 4RBPK 5AYUH 3DO7A 3B5HA 3MLRL 4G8GE 4NDMA 3IRZA 5C0IB 5TGBB 1FRGL 4ZQKB 2HP4A 3NAAH 3T77A 4CMMA 4DKEL 2GUOB 3FB5A 5HDQL 5KZCB 3ZDXE 3OR7B 4ZOCA 1T22B 5JHLH 3CVIL 5T1DL 4S1SH 3RGVD 5I8CB 5CZKA 1IEBB 4HK3J 5IMKB 1F3DJ 4ZTPL 4GT7A 4DVRH 2PW2B 3TC9A 2X4RB 3I50L 3QDMA 3O3EA 1BFOB 3QQNA 5C07A 2VTFA 3W9DB 2G60L 1XIWD 3I85A 5FXCH 4NHCH 4YPJA 5GGUA 1HHJA 4HH9A 1HYSC 4ACPA 4LAQL 4X6EA 3KPSA 3KPPA 4KH2A 4X8JB 5MHSD 2YC1B 5A2LH 4XVJH 3MJ9A 4N1CA 4PRHE 2QQQA 5JA8B 3QIUB 1MQ8A 4QRPD 4PJEF 3GJFB 1J05B 1NPUA 1MFCH 4HFUH 4EQ2A 5C08B 1CD9B 2ADFL 3KGRA 4XBGB 4XP5H 4PJXE 3UTTE 4YHKL 2G2RB 3NVQA 3TBWB 1FVCB 1Z3GL 3TESA 1YEEH 3TLRA 4WUUA 4PJHE 2ZUXA 1MIEL 1ORQA 2BX5A 4WIQA 3WFDH 4EJ1C 4LU5H 4FFWC 4N0FB 3TJEL 4PGCB 3FMGH 1OQXA 1MCFA 3GSNL 2QLVB 1CXHA 5BVJA 4EI5C 1DQJA 4FQLL 4Q9BA 3MMEA 2R23B 3V52L 3WUWA 3ARVA 1MCJA 1TZGL 1D5XA 3PWPE 2DQFA 1ADQH 3ULUD 3QA3B 3O6ML 3EO0B 1FORL 1WZKA 1U2HA 4IRSD 1OLZA 3FT3B 4FG6C 2EDLA 3MRGA 1AGCB 1CGSL 3P0VH 4JN2B 4ZMAT 1MCKA 5CLWA 2M26A 3WV0A 5IVZA 1G7JB 3VXSE 5GSVA 5FAAA 1TENA 5E0QA 4UT7L 4FQXD 5IB4B 1Z6JT 2IAMD 3S34H 1K5NA 1E4WH 4X7SL 2IQAB 4HEPG 5CGYD 3I6LE 5F96H 3HNTL 4JG1H 4Q9CA 4OD2A 4LLAA 4UINL 1S3KH 5FM5O 5L2JA 1KV3A 5D1ZB 3UXFA 1T0NB 3QEUB 4K3JH 4UT6L 2X4NA 3D3VE 5HD8C 3UTSB 1YEIH 5C0CD 3CZFB 5I1EH 5DS8A 2Z31A 4OT1H 1YC8A 1CK0L 3X3GH 3CX5J 2X9YA 5IR1B 3F58H 3S5LB 4MZ2A 1Q9OA 3LEXB 1VEPA 3WNOA 4LSQH 3FB8B 2GTZA 4YJZL 3TBYA 1JRHL 2NXYD 2XV6B 3BN9C 3TN0A 3C2SA 1JV5A 4LARH 4LBEA 5B38A 2VH5H 3S9DB 3V5DA 2KQMA 3KPMB 4LQFL 1CFQA 4LVEA 3AREC 1IJ9A 5IB3A 4IBLT 5DC9B 4X6CA 4UIKH 5C8JA 2NY1D 4P2QD 1LEKA 3ZL4L 1DBBL 1WC7B 1CGUA 4PJCA 4HUUB 4X0KA 3RWCA 4MNHA 4MAYB 4A2LA 2FEEI 3DVNA 3EO9H 4O51A 1XGUA 3H7BB 3LPGA 3QEQA 5HI5C 2Y1VA 1C7SA 4QYOB 4UQ3A 3L7EB 1EFXD 2EDHA 4Z6AT 1AIFB 4JDZB 4YBLB 4KDTC 2BDNL 4FNLH 5T5FH 3MV8D 4JHWL 1D6EB 5TPWH 4YR6A 3EAKA 3MRIA 3BO8B 1WFNA 2HG5A 3DX9A 4HIEB 1AC0A 4HMEA 4JB9L 3O6FB 3SJVB 2IJ0C 3MJ7A 3RNKB 3WE6B 5JO5A 1UYWH 3DUUA 1X5ZA 2B0SL 1L7IH 2GCYA 5HGAB 1MWAB 4FFVD 3UP1A 1DBMH 4NZDA 1ZHKA 3ZKSD 4WU7A 2KQNA 4NN7C 3I6KB 4OZHE 4R2GC 3BAEL 4N8VA 4DTGH 1JF1B 1BQSA 4M7LH 1NDMA 3TO2A 2QHRH 1FNLA 3C09C 4LHUD 1UXSB 3MLVL 4XNZC 4A6YB 3O2VL 5ILTL 3UTTD 1IGFL 2NY5H 3WFZA 1IARB 1CT8B 1A3LL 3PP3K 4WWKD 5I66B 1NCBH 4RA3A 5KVEL 5EFIB 3BD4A 3AM8C 1HI6B 1KCVL 4JJHA 4L8BA 2R1WA 4KGLA 4PB9L 5I1GH 4TVPL 2VE6B 3QO0B 5IOPB 4S1RL 1U36A 1U8NA 2NNAA 3NABH 4P2RE 3LIZH 4N0UB 3QBTB 2VDQH 3VXMB 5C92A 5JA9A 5EWIH 4OKDA 1AXTH 43CAB 1J0ZA 2FR4B 1ERNA 2Y07H 4OZFA 4ZAKC 2VKXA 3WEXA 2WBJA 4PJBA 3VRLE 4BZ2H 1JHTB 2R0ZL 2ADJB 1FGVH 1QFUL 5A2JH 1KN2L 2DKMA 4GBXB 5JR1H 2WIMA 5FB8A 5CZVH 2ZUTA 1IC1A 2WSKA 4R4FH 2BNUB 5ESVB 3O4LE 1T20B 1HYRC 3D39B 4JM2B 4ZS7H 1XGYL 4P0DA 3SDYH 3N50A 2HT3C 3S35X 2PTUA 4HKBA 5I1DA 5F1NB 3MJ8A 2XA3A 4KZDL 3KDMB 3U48A 3LMJL 5BO1L 1VB9A 5CJ8A 1G6RL 4KJPC 2FJFA 1S9XA 5FV2A 4MXVE 1RIHH 5IHBA 4AT6A 4J1UB 5I8EB 2EYRA 4U0RB 1Z5LA 4OIIH 1CGTA 3SPVA 3TBSA 4KUCF 2F9BT 1KB9J 3SDXB 5CEZL 1EO8H 4I9WE 1B0RB 1MCWW 5H37G 1NJ9A 5ETUB 3EOTL 5L7XH 1DEDA 1GGTA 1MLCA 5EIVA 1TCRA 1MIML 1YNLH 2MHAA 3STLB 3L9RB 5MP6L 1UB5B 2Q8BL 4YHPB 1A5FL 1JPST 4YNYA 4HQQL 5DZNA 3UYPA 1KYOJ 3AXLA 5GS2H 2WBKA 5ESAA 3ARDA 3HNSL 5KAQF 2O5XH 5AWNH 5E00B 3SEPA 1FL5A 2D7OA 3BPNB 3MODH 4Y16D 1GHFL 1GOFA 4PS4H 3TP4A 4LLVA 1VHPA 5T1LB 5I71C 1KG0B 1OB1A 3OX8B 1HH6B 2R2HB 3LHPH 1ZEAL 1NLBH 4DUWA 1T0MA 2H9GB 2ZG3A 3OKEB 3NCYS 2E6JA 4L8DA 1E28A 5C0RH 1CF8H 3RKDC 2UVEA 4G8IA 3CC5B 1NFDB 3N06B 4QF1B 5GGRY 3GO1L 1RUMH 5CILH 4Y1AA 3WFBH 1XF5B 5JHDB 4ISVB 3VXPB 4X6CF 1S78C 2YD7A 1HSBB 3DHJA 4OLVH 5JW5A 3KPOA 1EEYA 3HC0B 2BNRE 2FX7H 2CKBB 4AL8H 4PJCF 4Y5VC 1P4IH 3GHEL 2CPCA 3VD5A 3AS0A 2CUHA 3LRHA 1A6TB 2YA0A 1NBZB 1X5LA 4QWWC 4LHUG 2R2BB 4KI1A 4HG4J 5E5UB 3PHQB 2VLRB 3L5XL 2BVQB 1K8IA 3H9HA 3GSQB 4D0CA 3D0VA 5CJ5A 3C08L 5INCB 3CPLB 4Y5YC 4HK0A 3L1OL 4P48A 3KPNA 4U1JA 3O81A 4OM0L 3K74B 4HS8H 4R97C 1SJEB 2YPLA 1NGQL 4DQOH 3LB6C 4DEPB 3SDDC 4NQCE 1OAYL 1RZGB 2PR4L 1JF6A 2ZOKB 1KB5L 1CLYL 1LGVA 3L95B 1U3HB 3IDJB 1AKJD 1OSPH 4F33B 4UU9A 4ZFOB 1KN4H 2Y7QA 4Z0BL 4ELKA 2JIXA 4HPYH 4LOUD 1JWMA 4PJ5E 5FUCE 1FFOA 4YZFF 5C0AB 4FQPA 2FYYA 2LU7A 5EUKB 3DROB 3PP4H 2VQTA 1MFAH 4QRRD 3GMLA 4XVUC 5L6YH 5DJAB 4P23B 4J3TA 5IW6B 3B9EA 5MERB 1OGTB 4M61B 2JF1A 4PJIB 5D7JB 3O8XC 3QCUH 1MJUH 1MHCA 5FDWB 3WIFB 5GXBB 4YDKL 2EYSB 3F12B 1KEGL 1T0PB 3MCLL 3ILQC 3O4LD 2X4TA 1FN4A 1N7ML 1A6AB 3NFPB 4KUZH 3RHWF 3UZQA 4N5ED 1KULA 3TCXA 3WNKA 2QR0A 5GS0L 5E6IA 1CL7H 4NT6B 3CVHH 2R0KL 4ZUSB 4EIGB 1MREH 1XZ0A 4NCC1 4YXKH 2J6EL 4PJEE 3QO1B 3SDAA 1RZ8B 1IAII 2DQJL 3HR5B 5DRXA 3ULVL 4OZ4A 4PJBF 4HS6B 5C3LD 1OOAA 1A7PL 1YEJH 3DUSA 5ADPH 4CU7A 4KJYB 3QIBD 5JZ7D 3B4NA 5J3HC 2QQNL 3MRPB 3WNPA 3SGEH 1UKSA 1SEQH 3JV6A 2AJ3A 4I9WD 4PTUA 3P4MB 3U4EB 5C09B 1ACYH 4U1IA 4Q74A 1CDYA 1AO7A 2IWGA 3MRBB 4NBXB 1Q9KA 2W0FB 4C83A 1F90H 2V2XB 1U8PB 1G1YA 2NXZB 2AVGA 1D9KA 1QFHA 3CDGA 1OTUC 1Q9LA 4XZUA 2A83B 2LTQC 3ULVC 2FGWL 5DVMA 4WY7H 2BNQE 5CBAB 3FQRB 3MROB 4FG6D 1DANT 3GSXB 1KIPA 3MA9L 3PV7A 4JFPB 1NMAL 4QGYA 1F13A 2V5YA 3E3QC 1TTGA 1OPGH 3OKOB 2RCSH 4G7YH 4JAMA 2PYED 5D7IB 4PFEA 3W0WE 1JNHB 4ZNCD 2VZSA 1X4ZA 4J3OC 2YMXL 1U58A 1WZ1L 2X4OB 5D72H 3BE1H 2MNUA 3I3DA 4ONOA 3VH8G 3VG9B 2WIIA 1QBMH 5BCAA 1YY9C 4P9HL 4F7TA 4ZTOH 1GGUA 4QRQB 5F1OB 3EJJX 1FVEB 5T1KA 4HC1A 2BK8A 1QSEE 4Y4FB 2FIKB 4ODHH 2X4PA 4YHOL 5I1JL 3VA2C 5I1CL 2IBZX 3MRLB 2V7NA 1CE6B 2XZCL 4GRLB 3GSWB 4MQ7B 3LV3A 4NPYA 3PHSA 5I19L 4RMUA 1OARL 5F3HB 5C6WH 1MVUA 3H9SA 5FA4B 4XC1H 1MNUH 3BN9D 1NGWA 4YO0B 1GC1H 4X4XA 3RVUC 3UTPD 3WHXA 5KJRL 1I9IL 1T66C 1GOGA 5IMLA 3RZCD 3QQ4B 1QHPA 4KVNH 1L6XA 3ARED 1U8OB 1N6VA 3IDGB 4X99B 2YOCA 1A9BB 4P9HC 5HYJA 2YD8A 4EDWH 4URTB 4X6BB 3L7FA 1C1EH 3P30L 2G5BA 3V6OA 3KXFE 4WU5A 3BKCL 4LASH 5IEKA 1DFBL 3PNWA 1S7VB 1A0QL 4LFHD 1RUQL 4PRIA 1GYAA 3GMQB 3W39A 4Z18A 4XVSH 4HLZG 3ROOA 1S7XA 3IRPX 1RFDH 5DO2D 1I4FB 4L29B 3Q6FB 1J1OH 1SJXA 3QZWA 4HBCH 1RZ7L 5DR5L 4N0CC 5F7HA 4N5UA 4PJGA 5T1MB 3P0GB 4DGVL 1PD6A 3PABB 5AZ2H 1G7MB 1Q9WA 1YN6B 3FCTB 4XPFH 3UBXB 3QDME 3MLSH 4UTAL 5C07E 3HB3D 2KZWA 2QADC 5CHNA 5IHUH 1M05B 4H8WH 2DTSA 5D1QC 4Z7WB 4OKVA 2XRAL 4YDJB 3DX6B 1XGRA 4GXVL 2AEQH 2JJTC 5IIEA 4ZO7A 1U0QA 1MFEH 4AZ8A 3JSSA 4HPOL 5EO9B 3ZLQC 5ACZB 2RFXA 2FSEA 1DLHA 3ZE0E 3NH7L 1JGEA 4GRWB 1W72L 4AEEA 4PR5A 2DLEA 1WT5C 1A7NL 1BIIA 4KRPB 1QKZL 1EHLH 5J9PA 1BPVA 2F74B 4JQIH 1JGDB 4I4WB 3MBED 3UYOD 4JRWA 3ULUH 1YEGL 3FTGA 1IM9A 2BHUA 2NY6B 3RHWK 5GS1B 3QCVH 1SYSA 1JHKL 3IDNA 4YHML 3RWEB 4BQBA 1GIGH 3Q5YA 1CIUA 4DWHA 5EBLB 4ZAKD 2XACC 3BGFB 3P73B 3TVMD 4LK4A 3O9WC 4WUUE 5H94A 2HTLD 2Z8SA 1FJ1B 1DQLH 2COQA 3QRGH 4FQ2H 3U36A 1I8LA 3RY5A 3B43A 1AC6A 3JTTB 1AH1A 4I0PB 1NGXB 1N64H 2WINB 1RPQA 3PQYA 5BVPL 2Z0BA 1CDIA 3D2UA 4PV9A 2W9LA 5EPMA 1FO0H 3FN3A 3TJHD 2WAHA 4Y7MA 1U3YA 4XTRD 4MCYB 3OAZK 1MH5A 4M62H 2HT3D 5C0JB 4Z78B 3OGCB 1JPSL 1J1PL 4I3SH 2M2DA 2OQJB 1YMMA 5KSAD 4WJ5A 3D9AL 4KJPD 3EGSA 5KVMC 5DFVC 5EBGA 1OF2A 3S36L 5BQ7A 1QSED 1A7QL 1NGPH 1F3JA 4Q9QL 1OAKH 2O26U 3CAFA 1BQLL 2V5MA 4JKLA 3F6LA 3O41A 4D3CL 4J6RH 1HSAA 1DLFL 1MAML 3S3JA 3TBVB 1EUTA 1KFAH 3S7GA 4MQSB 2BFVL 4NP4L 1IGCH 3ZHDA 5B39G 3HI1A 4LCWA 5IG7A 2H8PB 5H2BA 2A6DB 3VXQA 2IALA 2DBLH 4H5SA 3QIUC 3GRWH 2VLKB 1UH3A 4JO3L 1UWXK 1U8MB 5D2NA 4PG2A 1WTLA 1IFHL 4OLZH 5HVFB 3H3PH 2YEZA 5DMIH 4MDIA 1WICA 4HGWB 4TQEH 3OKKA 3QULB 4LLDB 5DMKA 3VXRA 1G1CA 4YHNA 3WNNA 4LFHG 3VFSA 3VG0L 3KXFD 4Q6IB 2YBRB 4NKOB 2NW3B 1QA9B 5D1XB 4XHJD 5F7KC 4CDHA 5K9OA 1CLCA 2D31A 4JN1H 5L8JB 3RKDD 5GRWA 1Q1JH 3ALWA 3TIEB 4P5MB 3ROLB 3G5YB 2OXHA 2NLJA 4J8RA 4NKDB 2GJ6A 4X6CE 2FJHA 4P5KA 4YGVA 4O4YH 3FQTB 3BVNB 1AQDB 2SEBA 3HCVA 4MB4A 4PJCE 1U95A 3MFGB 5IEHB 1AGBB 3VFVA 3SCMB 1HWGB 2YWZA 1GH7A 4PP2A 1TVDA 4O2EA 3DX7A 4Q97A 3QEQE 1NCUA 3GKWH 3LN5B 4P59L 4KWUA 1FYTA 5HHMD 1P53A 3C5JB 1U93A 1EO5A 4JO1L 4OV5B 4UAOB 2NR6D 5I17B 1S9WA 1UACH 5GS3A 3U1SL 4UV4H 4CADA 4PD4J 3BP6B 3KPSD 2ENYA 3MXVL 3EYSL 4UV7H 1SMAA 5HHPB 5F7EH 5L88L 3SDDD 4PJGF 1H3GA 4MD4B 3K8LA 5D1ZC 4C56A 1TQBB 1JWSA 1KTKE 2HVJB 3QB7C 1TVBB 4TUJA 3RBGA 4LP4A 3C2AH 5IFAH 4G9DB 4BFIB 4AG4L 4MNGB 4I0CC 1PYWB 1LEGB 4GW1B 4GAGH 4YZFE 1YQ2A 3I9GH 1MRCL 4M43L 3VWKA 3HI6L 2HRPH 4U3XA 2B1AL 2FBOJ 4NNXB 2MKWA 4BM7A 5FEBA 4XGZA 5J1AB 2VLJD 4WUUD 1N5AB 1MJ7H 1MFBH 4O9HH 3WCYA 1WZMA 5DMGC 3DSFH 5DRWA 3L3OA 1U91A 5SWSA 5GGVY 1PSKL 1YNKL 1YPZB 1CFTB 4HWBL 3VXUD 3O3UN 2AXGA 4LCYB 3P77B 5HPOA 3ILQD 2XZAH 3LS5H 4HXAL 2QTEA 2OJEA 2P5ED 1FH5H 1ZHBA 2OJZH 2L0DA 4WV1B 3HC3L 4ZD3L 4OF3A 2ZWLT 2CJUH 3VFOA 1INDH 3CDCA 3D69B 1ZT4A 2C4FU 2YK1H 4JKPL 3A6BH 3FOLB 3HZKA 3WUZA 5KOVC 4OLUL 5J13C 5IJVA 4PJBE 3GMNB 4L9LC 3QXDB 1FZOA 4P5TB 5JW4N 4E41A 3P40A 3FB6B 4QOKB 4K9EL 4A6YL 1INQA 1S9YB 4JPIB 5SX4H 2LAGB 3OSKA 4HIHB 1JNLH 1ONQB 3IXTA 1S9VA 4KUCD 5J3HD 4LCCB 5F9JA 4MJ4A 2HFEA 4F9LC 4YBLC 4X83A 4OQTH 4JREC 1NGYA 1FAIH 1NSNL 2BVPB 8FABA 3QNYB 4JFYB 4LEXL 3OKDA 3EYUH 4ZO6A 5FHAH 4I2XB 1ZVSA 2P7TB 4LLMA 2EXWC 5I15L 4JM4H 3BWAB 5IQ7H 4CN4A 1HOCA 1S7UA 1NUNB 12E8H 3OKLA 1GGIL 5DK3A 1D3CA 1KACB 2CDGB 4LP5A 1OTUD 3VDAA 4N1EA 5BV7L 4O2FA 1HHHA 3WFEL 2CRYA 3K2UH 2HN7B 1I1FB 4J3WA 4KI5C 4H26B 4DZ8A 3HMWL 4K9EC 1GJIA 4ODSH 4RBPH 3TCLA 4POUB 3BIAX 3TN0D 3FO0L 1JGLH 5KVFH 2EDTA 2D0FA 1CU4H 2DM7A 3T0DA 3G5XA 3IFLL 4KXZH 3K2MC 4JZJC 3K4AA 4ORGA 6FABH 4D8PB 2L7UA 2VAAA 3B2UC 3VFTB 1QHOA 5TE6L 4Z7VB 1QRND 4Z9KB 4YE4H 4YIQB 1OM3L 3CXHK 5HI3C 4GLRH 1R6VA 2A74A 4XXDA 1YMHB 2E8ZA 2XYCA 4FMKA 5BV7C 3QEQD 4GSDL 3C5SB 4EOWH 2GFBB 3PJSB 3U0WH 3JVGA 4K3EH 4KJWD 1KJ3H 5JORB 2UUDK 1E4KA 4YEEA 3OXRA 4O2CA 5J89A 3QXTA 4Z7UB 2VR5A 1BVLB 3I2CL 4Y1AE 4X6FA 5LQBL 1JJUA 2X4SB 5C0BA 3CUPB 1PKQB 3JWDH 3RVUD 4Y4HB 1QO3A 3CD4A 1QLRB 2AV1A 4OF0A 5IESL 1K4DA 1T66D 3GMPA 5CJQL 3NCJL 4AQ1B 1KPRB 2F58H 5DD1L 5IB1B 3NCYP 3EFFA 4LLQB 1IGYB 4ZFZA 3X13B 3FQWB 1GZPB 1ZA6A 4OBRA 3VRJA 1RZJL 2DWDA 2IANB 2FZ3B 3FZUC 3C6LC 2VXQL 3RJQB 1WWWX 1QG3A 3VFNA 2VIRA 3RNQB 1JPFA 3LN4B 1S5IL 1UJ3A 3IS1X 3WJLC 2VUYA 3AMKA 3MR9B 1IQWL 5CCKL 3L6FB 3WS3B 4H0HB 4U0RC 5TDPA 2B5IC 4ZYKB 1JHLH 2YPLE 1QFWM 4DCQB 3P9MA 3VCLA 4V1DE 4CMHC 1P69B 4PGBA 3WUWG 4HLZH 2UY7A 5EBWB 4R4NC 2X7LA 1B3JA 5IBTH 3VGAB 1OAZL 5CD3A 4IRZL 2CKBL 1E6JH 4DKEH 4RAUA 3S96B 1SY6H 3PV6B 1M7DA 2R29L 4QY8A 2XFXB 2GKIA 5D8JL 3PIQA 1AFVH 4MXQC 4P2OB 4BZ1H 1RZJC 4HCRH 2WBJD 3CVIH 4XPAH 5DYOB 5T1DH 1OGAA 3MRKB 4NN5B 3IXAB 1L7TH 3QUMB 4K3DL 5DURD 2ATPA 4LDLB 2UWEA 3IB4A 4OLEA 3VFPA 2HJLA 5C86A 5F8QC 3V6ZB 1K2DB 3GI8L 3TO4C 1CE1L 2FD6H 2YPKA 5E4IA 4LSSH 4FMFA 1CFVH 1MJJB 4M5ZH 1SEBA 2IG2H 4N0RA 2JCCA 2C26A 4Y5YA 1L9MA 5DA0B 5EU3B 4ZUWB 2VOTA 4XPTH 4F7PA 2CXKA 5C0FA 4NSKA 5DJ8A 4BFGA 2IFFH 2D7TH 4ZFOL 2Q8AL 2FJGA 5ESQB 3ETBF 1JFQL 1Y6KR 1QNZH 4Y19A 5IVXA 3CFKB 3VMOA 1A22B 4G8FB 2V17L 3MNVB 4APQC 4XP4L 3RPIB 5FA3B 4HEME 1AXSA 1H9VA 2DMKA 3C5ZB 1AO7E 1G7HA 2W60A 5B38G 1R3IH 3RUGA 1CDCA 5DT1L 2R56H 2P5WD 1BD2A 4ZDHA 4TSCH 1N0XH 3TJEH 3S37X 3IKCB 4RA0C 3T0EC 3TYFB 1UZ8A 1MCPL 1WBYB 3NACL 4PJ9D 3O3DA 3TA3B 1FBIL 2DLTA 1A7OH 3N1GC 3WN5B 3MXWL 1Y0LA 3ARDD 5ID1B 1MI5B 3HE7A 5BRZA 1ZT7B 2XPGB 1OAQL 4JDVA 4QT5A 1NCCL 5BJTB 2OZ4H 5B4MD 1FYHB 4ODTL 5F7LB 1R5IB 4GG6B 1QEWA 2A9NH 1X44A 5E99H 2GSIA 5HYQA 1CD1B 2C1PB 3G6JA 3S8WA 3IFPA 2PO6A 1NMBL 1DUYB 3EYQC 3R06A 5BXFB 1E4XL 1R3LB 2YWYA 1MHHA 4U1LA 4XNUL 3OTTA 4IRJC 5D7JC 2NTFB 1RU9H 2J5LB 2AJVH 5I1IH 2E7LC 4OLXL 1UM4H 1ZLVH 1I3VA 4Y1AD 1U8IA 3CLEH 4CN6A 2ZCKL 1OCWL 2G75A 5FUOH 3K1DA 2CLVA 1GZQB 2JTDA 4NJ9L 4NO5B 2JJVA 5E8DH 1QLEL 2ZCHL 1RULH 2IPUG 5EN2B 3RWIA 3T4YA 1WEJL 1CICA 3PWNA 3T0BA 1NAMH 1LP9A 3ILPB 4GG8B 5JOPE 2F53B 3OJ2C 4NQDE 4XCFL 4CRPA 1TJGH 4JQXC 1QRKA 3PP3H 3HR6A 3FONB 2J8UA 3H9SE 4OB5L 2CLZB 2VMFA 2VAJA 1NCDL 2EC9U 2HT2C 5H8DA 1A4KA 5D5MB 5ICYB 1P4BH 3L5JA 2JJWA 1C7TA 2YPLD 5E4EC 1HHGA 2F54A 4R90L 4X98A 2H32H 3QH3B 3SBWA 3DX8B 5HYJE 2A6JB 1R3JB 1RUKL 4EN3B 2DKUA 2CXGA 3A6CH 4LCUA 1LE9B 4OZFG 1DQDL 2A2QT 4WW1B 2J8HA 2JIXD 2NXZC 5EU7C 3SKUD 1T1YA 1YEFH 5J6HB 1T83A 3KJ6L 4UILH 3V6OE 5FDYA 5EULV 4P46B 4ZOBA 3BRGC 1ZHLA 4PRIE 4ODVL 3MV9D 4NO2B 1FZJB 1RUAH 4XNYL 4KKLC 3BJ91 3HZVA 4GMSH 3DI2B 3RBSA 4W4OC 1PAMA 3HG1A 3UZVB 5L2KB 1KTLB 4JFXA 2EH8H 2ITDA 1U3JA 3LOWA 3MGTA 3O2WL 3DSNA 5C70A 3BJLA 5E6ID 1I9JH 1GAFH 3VG9C 15C8H 1DQTA 1TZIA 1EAPA 4NCDA 2QBWA 2AXHA 3Q5TA 4BH8B 2D9QB 3BXNB 3D25B 4HK3N 1S8DB 2XTJC 1KPVA 2X4UA 5FKAA 1NCWL 2WUCH 2QSCL 3GMRB 4Y4FC 3QISA 5I2IA 1EEZB 2FL5B 4D94A 2UWEF 3MBXH 3CFDB 4G6FB 4HX1B 4L5FH 1NCAL 4QKXB 4RWYL 4GRLC 5EIIA 3MLVH 5GGSA 5ILTH 1UB6A 1CVSC 2VDRL 5FECB 1KCRH 1AO7D 4HUXB 4AY0A 2RHEA 2VLLA 4MNQD 2R8SL 5GGVH 4MDJA 4FZEL 1MFNA 5JW4R 1AE6L 4JFOA 4MXWH 3FAWA 2Z8RA 1QSFB 3EDEA 4NKIL 2X4QB 1C5CH 1X5XA 2NQCA 1D9KD 5DDHA 4DAGL 5IM7B 5IVXF 3SN6N 3BIKB 1MRFH 4FQ1L 1NBYA 3FRUA 3FN0L 1I3RA 5DQDL 4TTDD 1H3WM 4OGAC 2ATKA 3JTSA 4U1GB 2HJFB 4AM0B 3JV4B 1LILA 4GS7B 1VFAB 4I3GA 1H8NA 3MV7B 3PQYE 5J6GA 3RUGF 2XKNA 4HXBH 1WBXA 4NO0A 5CUSH 2ARJA 4NRYA 2APFA 5D1QA 3HHRB 3BPCA 5F7NC 2ESVB 3GBLA 5E2TL 1MCWM 3VWJC 1FLRL 2BSRB 3RVVC 4HIXL 2EXWD 3QI9C 5HGDB 1XGYH 3P4NA 1YMME 3BKYH 5C0ND 5FO9B 3RY6A 4IOIA 5DSCA 1IC4L 1XF4B 5T1KD 5HGHB 2QKIA 3CLFH 3MLZH 7CGTA 4YAQA 3G6JF 1HKFA 3UYRL 4K7FA 4OGXH 4ZXBA 4LF3B 3R1GH 4PB0H 4KI5D 1BLNA 2H2SD 3H9SD 1G7LB 2XQYK 5JPMB 3MLTB 1ETZA 4JFDB 1K6QH 1EXUB 2W9DL 3QDGB 2XNAB 1MLBB 4MCZB 1MCOL 2Y4SA 3MV11 3EOTH 1CLZL 4LCWE 3SE4C 1T1WA 1NLDL 1A6UL 3B2UD 4NNPL 2HMIC 3O11A 3MCG1 4PUBH 2AJSL 4XWGL 1LP9F 3BQUB 5FYKL 4OZIB 1N2RB 4ORZC 5D2NE 5A2KH 3MRCA 3BEVA 3L3DB 5C0IA 5TGBA 2E6PA 2NY6C 2KH2B 5HI3D 4ZQKA 5A3IC 4JG0H 5JQ6H 2GUOA 1UCTA 2J8UF 5FYLL 4Z5RB 2GY5A 1NFIB 1RZFL 1G0DA 4D0DB 3BGFC 1T22A 3W2DH 5JDSA 4G6JH 4YFLI 4WCYH 3ULVF 3UJJH 4IIQC 1DBKL 1IEBA 3FFCD 5IMKA 3RTQC 2A0LD 4F15C 5E2VL 2PW2A 2GJ6E 2GYSA 1FC2D 1B2WL 3BP7B 2UV3A 1MQKL 4M6NL 2X4RA 4U3HA 3DV4B 1MAJA 4CVXB 4NOFA 3W9DA 4PRNB 4QHNB 3MJ9H 3ARGB 1CZ8H 4WO4D 5KTEL 5IVNA 2VZ3A 1RHHB 4RNRB 3FRPG 5KANG 5J11C 3BYTA 2XXCB 1AJ7L 1CDHA 4NO3B 2DLFL 5F1KC 3FZUD 2OBGA 4X8JA 1FYTE 5DLMH 2VZUA 2YC1A 4KTYA 2OL3H 2EE3A 4D0BB 1NGZB 1OTTC 1C08B 3DGGB 3P2TA 4FFZL 4ONFL 3GJFA 1J05A 4F57L 1YUHB 4KQ3L 1UWGH 5C08A 5E2UH 4XBGA 1V7MH 2ZJSH 3UBXI 4WTZG 3MLWL 3TBWA 3G6AA 4MJIB 4C56E 4UT9L 2HA1A 3KYAA 1T03L 3GSRA 4HWZB 4NWUL 1P7QB 4J4PC 5HGBB 1J8HB 3HFML 3H7LA 4N0FA 2W0KA 4PGCA 4TOYL 2X05A 4Z77A 4U1HB 5GQBA 1FE8L 4LNVA 3HRPA 3RDTD 3H0TB 1OQOA 4RGMB 4DKFL 3R8BB 3DXAD 5L0QB 4OF7A 3K4DA 3NCCB 4OFIA 3VDCA 3QA3A 2V5SA 5CJBA 3EO0A 4UQ2B 2YUXA 5E8PB 1NQBA 1QSZA 4PREB 1RIUH 4F7EB 1P9MA 3FT3A 4L4TA 3WIHL 5M94B 5JW4M 4I13B 4JN2A 5E1HB 3IDYC 5EC1B 4L4VB 2BZDA 5HHOD 3U7YL 1G7JA 2KZ1B 3SY0B 3ARXA 4D9LL 1IC7H 5IB4A 1UJTA 1OAXL 5T3ZL 3UJTL 3NTCH 2IQAA 2QL1A 4I1NB 4E42B 5A1AA 4E41E 3V95A 1YMMD 2GJJA 3JWNC 3C60C 5D1ZA 1T0NA 1TDQA 4O5LH 3BIBX 1AGDB 5TE4L 3CZFA 3ARRA 3L5WB 2R4SL 4APQD 5EC2A 3UROR 1L0XA 4F2MB 3INUH 3QPQC 2ZP0T 4L3EE 3S88H 4JO4L 4S0TD 2XY2A 1BM3H 3LEXA 4YHLL 4U1SB 1HNFA 1IZKA 1V5JA 3CK0H 3ZHLA 1NANH 2PYFB 3T0ED 4LCWD 2C9AA 4Q0XL 4QGTA 3RGVB 2AEPL 2W07A 4JRXD 2P24B 3MLUH 4JY6B 5EO0B 3THMH 2NW2A 1EZVY 2ZUSA 2P48B 3KPMA 4TNVF 1FHGA 4OD3L 5A2FA 4HMCA 1I85A 1FGNH 2VC2L 1XIWB 4BA8A 3VXRD 1FIGH 5KW9L 1WC7A 4HUUA 3VJ6B 2CRZA 4KZEL 4JE4B 4MAYA 5F89B 4MJ2A 3H7BA 2W1NA 4X80H 1F4XL 2RGSA 4QYOA 1J0HA 3S6CA 4HKZB 5DRNA 3L7EA 2EKJA 1VFOA 1F3DH 2H45A 1JNNH 1UCBH 4IOFC 4JDZA 3S4SA 3M17A 4WEUD 1D6EA 1QOKA 2VKWA 3BO8A 4NM8L 4HIEA 4UDUB 1RV6X 2GITB 3O6FA 4YUEL 3SJVA 3WE6A 4IM8A 4KK6C 4P5TC 5HGAA 3LSOB 3T2PA 1QQDB 1MWAA 1YQVH 3BDBA 1F11B 1S7QA 2EDRA 4HKJA 4K23H 5C0BE 4U2YA 2GHWB 3I6KA 1JF1A 1JPGB 5AYUL 5F7YC 2DQDH 4M7ZB 5I19H 1EK3A 2WP3O 1UXSA 2UZXB 4ENEC 4YHYB 2CSPA 5JHLL 1MHPH 1DUZB 3V5KB 2DLHA 1J0YA 1M7IB 1JTOA 1TMCB 4S1SL 1UG9A 5IWLC 2HLAB 1A6ZA 4IRSB 5I66A 1C16B 5EFIA 3OJMB 4DVRL 4HV8A 5C7XH 1BX2B 4OZFH 3VWKD 3RIFK 3RIAF 1X5HA 4UDTA 4WI9A 1P5VA 3QO0A 5C6TH 1MFDH 4NHCL 4NYLB 4Y2DD 1W0WB 2X1XR 4FQXB 2IAMB 2BRRH 4N0UA 1KIRA 1Q0XH 3ZT5A 3TZVC 43CAA 5SWSD 1FO0B 2ADGB 4XVJL 1F2QA 2ADJA 2VL4A 4NCC2 3VRIB 4QXTB 1G9MH 5DZLA 2E8YA 1PQZB 5DQ9A 4GBXA 5C0CB 4XNMB 4WVRA 1VGKB 4S2SB 1IMHC 4LSUH 1A1NA 2BNUA 5ESVA 1MFCL 2FHCA 4HFUL 1ZLUH 3ARBD 4LLYA 1BVKA 1RJCA 4FQIH 1T20A 4XP5L 1OGAE 3EJYC 4LKXB 3D39A 4JM2A 3U0PA 3ZTNH 2NZIA 1YEEL 5EOCH 4D9QE 2UWEE 5F1NA 2W91A 5C9JB 1LO5B 3WFDL 3DHMA 4HHAB 4LU5L 2EE2A 1HQRB 2NXYB 3FMGL 2H3NA 4KHXH 3TBTB 5F7WC 3J8F7 3R4DA 4NQTA 3MRJB 1E27B 3MZTA 5DJXB 3VFMB 4Y4KA 2O61B 4G3YH 1T5WB 2VDKH 2VWEC 4GH7B 3D18B 1G7PB 4MA1C 4Y4HC 3SDXA 1ADQL 4P2QB 1B0RA 5EU6B 4OI7A 1UWXH 1JP5A 4Y19E 5EU4B 5IVXE 3QAZB 4JY5H 4JGUA 1HEZB 2A6KB 5D7SH 3STLA 1R0AH 5E8EB 4JQVC 1UB5A 3P0VL 3GSOA 3EDKA 1OD9A 4PLJC 4YHPA 3MRFA 3QIWA 4NKMB 2W65B 3BX7C 4ZUVB 2DM2A 3GMMB 1OTSD 2CUMA 3S34L 1CIDA 2D03H 3RUGE 3MV8B 3WD5H 1DP0A 3KJ4B 4LDEB 5E00A 5F96L 3PE9A 4JG1L 1ND0B 2ZUQC 2EDOA 2YXFA 4GRMB 3RKPA 1S3KL 3BZ4B 4ALAH 4K3JL 1AP2B 2KBGA 4KKBD 3SKMB 1HH6A 1YEIL 2R2HA 2H9GA 3OKEA 3VWJD 5I1EL 5BRZE 4L1DA 5EUOB 4OT1L 4M8QB 3RVVD 3QI9D 3VGAC 4R3SB 3X3GL 3CC5A 1NFDA 4MYWB 4QF1A 4WFGE 1VKXB 2JKXA 3F58L 3S97C 5TH2A 2R0WH 3G6JE 4LHUB 2NY2D 4H1LA 5JHDA 4ISVA 5DK0B 3VXPA 4P2OC 4GMTH 2D7PA 3UTTB 4PGJA 5EBMB 4LSQL 2V2WB 2X9WA 5EB9A 3HC0A 3AVEA 4NN5C 5I73B 4R7NB 4WWKB 4HUNB 4NQXA 4HIJA 3LH2H 3KWWB 4PJHB 1CBVL 4TNVK 4LARL 3QUXC 2VH5L 5ANMB 5C0BD 2R2BA 3FQNA 4CU6A 5MENA 1N0LA 3SGJA 2VLRA 4UIKL 2BVQA 1DANU 1MAMH 4XBPB 5TDNB 5INCA 3CPLA 3U46B 3MYJB 3CFBB 2IPTH 1WITA 1QFWH 3MO1B 1G7QB 2I26N 3W82A 2HMID 1SJEA 3MNWB 3EO9L 3I75B 1X5IA 1RZGA 1L6ZA 1OW0C 2ZOKA 2P8LB 2J8UE 2FO4B 3L95A 1U3HA 1WWCA 3PGCB 3IDJA 4LRNH 4UOW0 3GIVB 4P9MH 4F33A 3ULVE 3AB0C 1R5WB 4FNLL 1IEAB 5GRVL 5T5FL 4ZFOA 1BJMA 1BMGA 4B7IA 3SGKA 5TPWL 4HF5H 3WO4C 1M6OA 3RTQD 2F54E 4IHOB 5C0AA 3E3QE 5EUKA 2MCPH 4KMLB 3DROA 3DARA 4FS0A 1A1MA 2KUTA 1L7IL 5DJAA 4P23A 5ENWB 3FL7A 4DVBB 5IW6A 1VACA 3TIDB 5MERA 1DBML 4RGOH 4KK9C 4DTGL 5FDWA 2VLMD 1T1XA 3F12A 4JHZA 2I25N 3WN5C 3CFEB 4M7LL 3WHE0 2QHRL 4YBQC 1A6AA 3NFPA 1LDPH 2ZCLH 4HSQA 2Z4QB 2NY5L 3QUYC 1PDKA 4HJGB 4NT6A 2W92A 3QO1A 3AU1B 1NCBL 3HG1E 3HR5A 3RIAK 4XCCH 4HS6A 5HYIA 4HT1H 1VADA 5I1GL 3GJFK 4KJYA 4L8SA 3DV6B 4PGDB 1I7UB 1C5BH 3NABL 2V9RA 3MRPA 1LO4H 2YR3A 2VDQL 2CRMA 5EWIL 5LXGH 1AXTL 2HLFD 4DUVA 2GJZB 4QTHB 3P4MA 3U4EA 2Y07L 1MCQA 5C09A 4Y16B 3DNKA 4JM2F 4F9PC 1UT9A 4QHKJ 3Q0HA 4Y19D 2XQYG 4BZ2L 4OCLC 2W0FA 3UPAA 4LPXA 3MV01 3ARZA 5JR1L 2NY5C 5CZVL 5F3BB 1U8PA 4LSVH 3GB7B 3PWVA 3DURB 3PG2A 4R0LC 4R4FL 1XF2B 2BXYA 1R5VB 1HCVA 4GW4B 1F45A 5DJDA 1T7ZA 4JVWA 5MEPB 2A83A 4YX2H 4JPVH 4ZS7L 1BD2D 5CBAA 3FQRA 2AEWA 3MROA 3SDYL 5J8OA 2ZSVB 3GSXA 3HUJA 3SDXF 3VH8B 4JFPA 4KKNA 2JLLA 3OKOA 3IVKB 4W4OA 4W6YB 3HE7D 4GUPB 1JNHA 2C7UA 5ALBL 4YWGH 3GHBH 3ESVF 3L3IB 4HC1H 4WFGD 2UUDH 4OIIL 3LRGA 4WI5A 1EO8L 2FNBA 4WEBH 4W6XB 1TIUA 4YK4B 3ULSB 3NFSH 5L7XL 4HUVB 1V3MA 4QRQA 3QWRA 5DEZA 1FVEA 1YNLL 1BZ9B 4RDQF 3TNNB 3X3FH 5MEQB 2B7DT 5DVOA 1FVDB 1JPTH 5C6PB 4MQ7A 3GSWA 1AKJB 1HHIA 1EBPA 1JK8A 3GJEB 1GGBH 3NZHH 5F3HA 1NFDF 2O5XL 5AWNL 1A02N 1CICD 3EUUA 1BVZA 4YO0A 4HFWB 2WW8A 5SWZD 32C2A 3VFRB 1NC2D 4PS4L 2D2OA 2YN3A 5TJWK 4QXGH 1BFSA 4QRRB 3LHPL 1NLBL 5BS0B 3WDJA 3QQ4A 2ZKHH 4X99A 5C0RL 1A9BA 1CF8L 1UENA 4JPKH 4DGIH 3BZFB 3KG5A 1RUML 5CILL 3O4LB 4X6BA 3WFBL 3N85H 4FQHA 5MEOB 4YC2B 1L4IA 2F54D 4OLVL 2DTMH 2Y06H 2P45B 2FX7L 4RIRB 4K07A 5BW7C 3T1WA 2C3HA 3U2SB 1P4IL 3GMQA 3WJJA 4GAYB 3BH8B 1ZTXH 4LSTH 2XA8H 4UIMA 4DZBB 2IGFL 2YZ1A 5AYQA 5FO8B 1I4FA 5D70H 3Q6FA 5H35B 3QIBB 3U6RB 1A4JB 1OM3H 5FM8A 5T1MA 4KK6D 1ZGLB 3MJ6A 5I0DA 3PABA 1G7MA 2W0PA 5CEYA 4GS7C 4HS8L 1FG9C 1YN6A 3FCTA 3UBXA 4DQOL 2CR6A 4NGHH 4K7PH 3HG1D 4RGND 4EI5B 3GGWB 3UAJD 1N3NB 1M05A 5LQBH 1OSPL 4YDJA 4ENED 1JZ5A 2ERJC 1KN4L 5AAMA 1Y6MR 2D9CA 1J9CT 5FGCB 4HPYL 5EO9A 1SBBA 3SE3C 4I5BB 3D1MC 3SE4A 3PP4L 4E5XB 5CSBA 5IHZA 1MFAL 5C2BH 5L6YL 4PBXA 2R2EB 2F74A 5C2UB 1J7VR 4PRBB 5TF0A 4ZFFA 3QCUL 3OJDA 2PYEB 5C08E 1CDBA 1PLGH 4OUUB 5GS1A 2PXYC 5E9DB 4KUZL 5KSVB 5TE7H 5EBLA 3D5OF 5DTFB 1RJYB 3BD3A 3KYNA 1CL7L 3CVHL 1MREL 1LEIB 1AGFA 1VFMA 4YXKL 1XR8B 4QTIH 4I0PA 1NGXA 1F97A 4Y0GA 2WINA 5FGSA 2EYTB 3BOVA 3BQUC 3WKMH 3KYMB 1YEJL 5ADPL 3EJYD 3LVEA 4MCYA 4YEFA 2WM0A 3T04D 2Y5EA 3MYZA 4J3XA 4WI3A 5C0JA 4Z78A 4PYGA 4G43B 3OGCA 4XCYA 4BFEA 1SEQL 4PJXA 4OLWH 3V7MA 4MJ5B 2D0GA 1ACYL 3MGOA 2OQJA 3UCRA 1K8DB 4MLSA 5E8NB 3OZ9H 4I48B 3OJVC 1VCAA 4WTWA 1QPXA 1F90L 4HBQA 5AZEH 3RZCB 4OFKA 3RVXD 1IL1B 3AREB 2GIYA 4TTGA 3WFHB 5B39B 4IMKC 5D6DC 4LSPH 1ZE3C 4Y5XA 4M7JH 2NY7H 2MSPA 3UDWC 1GGYA 4WY7L 3VW3H 5KSBB 3UTSE 3TBVA 2FWOA 1MPAH 1BWWA 4XMKH 1JFQH 4KKAC 1OPGL 4ZXBD 3RRQA 2R1XA 2RCSL 4G7YL 1REIA 2H8PA 4TPRH 3JUYA 1IAKB 5TF1H 3OAYH 3L5HA 2NY3D 3QHZH 4NQSA 4XAWH 5D72L 3BE1L 1U8MA 4BZYA 1TFHA 2BOBB 1UC6A 2H32B 1XEDA 3MUJA 4HGWA 4X7EC 3QULA 1YY8B 4LLDA 4XCEB 5E8OB 1QBML 4Q6IA 2YD3A 2YBRA 1NKOA 2NW3A 1QA9A 5D1XA 4ZTOL 4PIRF 5JOFB 1IGTA 2EEBA 2VDPH 9CGTA 4PJEB 5F71A 1TNMA 5A2IH 4XP9H 3QWOA 4P5MA 3ROLA 3G5YA 4R96B 4HIIA 3FQTA 5LBSH 3AMLA 2LABA 3TF7C 2Q20A 1ZA3B 4XNZB 1AQDA 1PX3A 5K93A 4RGMC 4UBDD 5IEHA 2AERT 4JRYD 1AGBA 5L0QC 3SCMA 4XC1L 1JZ6A 4K94C 1MNUL 4HZLB 2OK0H 1GC1L 1QD0A 2F8VA 5F7MC 3QUXD 3LN5A 1BQHG 4M1CC 3H42H 5C9KA 3B9KC 4KVNL 1GVIA 4OLXH 3BD5A 1HINH 2BSED 3MBEB 5TQ2H 2B4CC 5I17A 4Z0XB 4R4BB 1ZHNA 4IS6B 5DFTA 3SJVE 4EDWL 5JOEA 4QCIA 3QXUA 5HHPA 4LRIC 4ZAKB 1C1EL 4OFYA 1HXYB 1UZ6F 3TVMB 4MD4A 1EPFA 3DWTA 4LASL 5GGSY 1TVBA 1XCQB 3JUZA 4JO2H 4BFIA 4XVSL 4AIXA 4MNGA 2FEDD 4GW1A 1ZVYA 4M8VA 1RFDL 5SX5K 1I3GH 3IFNH 5HJ3B 1GC1C 1J1OL 4U0QB 4HBCL 1CXIA 4Z7OF 3NA9L 2BSTB 2UZYB 4RFNC 5J1AA 5F9AC 1N5AA 4G9FB 5AZ2L 5ACMA 4XPFL 3TPUB 3E1F1 3C6SA 1YPZA 3MLSL 3RGVC 3KNBB 5KSAB 3TEUA 4Y8AA 2DQIH 2RJMA 2V6HA 2QQLH 3HMXA 1KJ2A 2DQHH 4LCYA 3P77A 5IHUL 4LHQB 2OSLA 4YBQD 3NMEA 4H8WL 1QSEB 1RZIB 2BVEA 4N0UE 4G5ZH 3VXME 1U92B 4OFVA 2BMKA 2AEQL 2FGZA 4WV1A 2OX5A 5FYKU 2XICA 2DN7A 1XIWC 1MFEL 3D69A 2ICWB 4FP8H 4JKKA 2GAZB 4M9OA 1EH9A 3GMNA 2AI0H 4L4TD 2UYLB 5E7FA 3OHXB 1OLLA 2AJXH 3FB6A 4QOKA 1KC5H 4ZUTB 4ETQA 4JQIL 1S9YA 2VN7A 4JPIA 1UWEL 1IQDB 4HIHA 4NRZB 4LCCA 3ULUL 2R4RH 1UXWA 3F62A 2ZSWB 5KG9A 3QCVL 3D39E 3R8QA 1GIGL 3QNYA 1G6RB 5F7FA 4NQEB 4P2RA 2P7TA 1DQLL 1RK0B 4LVNC 5B8CA 1TTUA 3BWAA 3QRGL 5FO7A 4FQ2L 4H8WC 5LAXA 4HZAA 2IFGA 3KXFB 2CGRH 3VMPA 3MREB 1N64L 3V6FB 2I60H 5LGJB 5GJTH 1FO0L 3DO7B 3UO1H 3KAAA 1U8JA 1H0DB 1RQ5A 3SDXE 1OT1A 4M62L 5JIKA 3FB5B 1I1FA 5HI4C 4Z76A 1DN0A 1IC5H 4UUJB 5GZNC 4AIZB 4YHYC 3KLAB 2N7BA 4GKNB 4HUWA 1KCLA 3ULUC 2CDFB 4RZCA 1BIHA 4S1DD 4IRSC 4LHJB 4WI7A 4OIBA 4F8QA 2IPKA 3G08B 3HS0B 2VYRE 5HHMB 1NGPL 3LKRA 3WLBA 5D7KE 5EU5A 2LVCA 4P4KD 4HAFA 4Z7VA 5GPRA 4GXUN 1HHJB 1SBSH 4J6RL 3S35H 4YIQA 3KPSB 4X5WB 5L8LB 1YMHA 3MRQB 4J3VA 5CGYC 4R97B 3IJYB 1KFAL 4KC3B 3SDDB 5EZLB 1IGCL 3C5SA 4RMSA 3VD4A 2GFBA 1LO3H 4BH7B 3PJSA 1VERA 1X5KA 5JORA 3E8UH 1YEKH 2I5YH 1NFDE 2O5ZH 2DBLL 2BRQA 4Z7UA 3ZKMC 1IRAY 1BVLA 3DYPA 3GRWL 1OAUH 1PY9A 3PDGA 2X4SA 5JHDE 3VGEA 2OL3B 4TVSa 1PKQA 1DVFA 2M1KA 3EO1B 3H3KA 1T89C 3H3PL 3O6FD 3I02A 5DMIL 3FO1B 4TQEL 2VLJB 1WGOA 1KPRA 5IB1A 4LLQA 1IGYA 3FQWA 1GZPA 3O8XB 4JN1L 1G0XA 2IANA 4NFBA 5DJ6A 2NXYC 1Q1JL 3VXUB 2P8PB 5MENE 3LS4H 2DD8H 2VLRE 3LN4A 4O4YL 2P5EB 1Z9OA 5CINH 3L6FA 3WUWB 5JXEA 2W9DH 3ESUF 2NX5D 1KB5B 1WCQA 4ZYKA 4ODWB 1HN1A 4DCQA 2NY1C 5FHBH 3KHQA 1IAIH 3CJJA 3KR3H 2G9HB 3H6JA 3GKWL 3MRGB 4J7RA 3QAZC 2ICEB 5EBWA 3CIQA 5IVZB 3V5HA 1MRDH 2AK4D 3OXSA 4OCXH 1UACL 5DK2B 3S96A 5EOQH 3PV6A 5C0AE 4QRSB 3GK8H 3QSKB 4WFFD 2ZUVA 4UV7L 4P2OA 5JTWA 1I8MB 2VDOH 3KJ4C 4OD2B 5F7EL 5DYOA 5L2JB 1MEXH 3MRKA 1VFBB 1AD9B 2X4NB 1H5BB 3SO3C 3QUMA 5E2VH 4GBXD 5CIPB 2GT9B 4PJAB 1NDGA 3C2AL 5IFAL 5DS8B 3KPRA 5DUMH 1YPZF 3D85D 4FFVC 1K2DA 4GAGL 4U7MA 3QCTL 1TXKA 4Z95H 3VFUB 5A40E 3KPLB 3I9GL 2HRPL 1MJJA 4JM2D 3DMMA 2LTQB 5DUBB 3CNKA 1MJ7L 1MFBL 4O9HL 2DLFH 1BZ7B 4OGZA 1SJVA 3DSFL 3TN0B 1P6AB 5ESQA 5I73C 3BT2L 4LBEB 3Q3GB 4G8EB 2I24N 4JFFA 5J57B 4TUKH 2PXYD 4Y4KD 3K46A 2XZAL 2PETA 3O2DH 3LS5L 3CFKA 3V5DB 4RRPG 4L3CB 4U1MB 2A73B 3VGDA 3MNVA 4CKVX 3ARFA 4CDGC 3S98A 4KVCH 3RPIA 5FA3A 1LEKB 1QRNB 2CJUL 2X5PA 4KQ4H 1INDL 5C09E 3C5ZA 4U05A 2YK1L 5IB2A 3A6BL 5IJKC 1OWRM 3X11B 2C1OB 2EDFA 2VL5B 1IKNC 2BY3A 4O51B 4U6TA 2R1YA 1ZS8B 3P9WB 3QIWD 1TJIH 3IKCA 3OPZL 3ZT7A 5EU7E 1WBYA 3BHBA 1R24A 1JNLL 3TA3A 4KFZC 5DJ2A 2OMNA 5D7KD 1MI5A 1KGCD 1ZT7A 4FQQB 1RK1B 4OQTL 4YR6B 1FAIL 5BJTA 2FHBA 5F7DB 4Q2ZB 3EYUL 5D7LD 5FHAL 2DWEB 1R5IA 3Q6GH 5JO5B 4GG6A 3L3JB 4U1NB 1KIUA 1CD1A 4JM4L 2C1PA 3FN9A 5IQ7L 2CR3A 1B0GA 1EO7A 1KENH 1DUYA 3S4SG 5BXFA 4MQXD 1LHZA 4XPGH 1R3LA 12E8L 1D5BB 2APWA 2AABH 2ZG1A 4PJ7B 2VZTA 1S7TA 2PKDA 1CFNB 3MUZ1 1X5GA 1NDMB 3GSVB 1HH9B 3EHBD 3T8XA 3K2UL 2FH6A 4QXUH 1GZQA 1P7KB 4Z7VF 1QTYT 2X1PA 2AP2A 4ODSL 1I7ZB 3DVGB 1WUNT 4JZNB 2Z35B 5KVFL 1JGLL 5I74C 1CU4L 5DD5H 1RURH 1V05A 2QJDA 3ILPA 3G5VB 2F53A 4GG8A 4OFDA 4U6HA 3T65A 3HLAB 4L8BB 4MWFA 1ZWIA 6FABL 4HDIB 5MEND 1A47A 1DQMH 1EZVX 3OBAA 3FONA 5ELIA 1U8NB 4EUPG 4Z7UF 4YE4L 5ICYA 1NEZG 35C8H 2OYPA 2E9JA 1I1AD 4OZFB 2WBJB 4Q0XH 4Y16C 5DVLA 4EOWL 1TZHB 2C3XA 3QH3A 3U0WL 1U3HD 4JFZL 1NCNA 2QADB 4K3EL 1KJ3L 2QSTA 2CO6B 2AAVA 3DETC 1R3JA 4EN3A 1LE9A 1JI2A 1KLGB 1NL0H 5EOTA 5J6HA 4M48H 3MOQA 5JXAH 3CH8A 3JWDL 3QXAB 4XXCA 1GL4B 3G5ZB 4P46A 5DD6A 4UNTA 5I1DB 3VE0B 2F58L 4RQQA 5I18H 3B9KD 4OV6F 1FZJA 4FFYH 2FJFB 5E2JA 2OTWB 4CUCA 2EECA 2Y5TB 4MHHG 4AT6B 5DI8B 4MJ6B 1UZ6E 1J0IA 5L2KA 5IROA 3V9FA 3O9WB 3V4UH 4LEOB 4O00A 4KPHH 3J7HA 1JHLL 4W4NA 4LLUA 3AS2A 3NIGF 3UMTA 4BQ9A 1FAKT 1FNHA 1TCRB 3QP3A 2MHAB 3MPCA 4FZ8L 3D25A 1MCLA 1ED3B 2P5WB 4IJ3C 5CAYB 1S8DA 3T1FB 4Z7OE 4Z7WE 4FTVD 3GMRA 1CCZA 1U8QA 2FL5A 3CFDA 4I18B 5IBTL 1W72B 4HX1A 2VDMH 5BZWB 4PJ9B 5CSZB 3WLWC 4PP1C 5ISZB 1E6JL 1OHQA 2EDKA 1SY6L 4LPWA 1HDMB 4N9OB 1FL5B 4AENA 1AFVL 5C09D 1KIQB 4BZ1L 4HUXA 4HCRL 3HN3A 1DR9A 4I77H 5J12C 4XPAL 5IT2H 4LLVB 1XF3B 4LOUC 5BW7A 5I76A 1L7TL 4JDTH 2XWJB 3NPSB 1OP5K 5TFSH 3RX5A 4MA8L 4ZS6D 1PVHA 4NFCA 1QSFA 1PGRB 2DQGH 2EIZB 5IM7A 2FD6L 3GIZH 5E1AB 4LSSL 4OAWB 4RDQG 5ID0A 1CFVL 4M5ZL 3EZ8A 4Y1AB 3T3PF 2IG2L 5F97E 1EIBA 1TTFA 2NPLX 2HJFA 4HULB 4XPTL 1FG2B 4N5EC 3JV4A 3QEGH 5JW5B 1YECH 4YC2C 1EEYB 2DKSA 5CJXC 1AHWB 3BKMH 1FDLL 3MV7A 3OF6D 2IFFL 2D7TL 3N1PC 1JUFB 2MQ3A 1QNZL 5CD5C 2H2PC 4H1LG 4KXZI 1PZ5A 4G80B 2ESVA 3WYRA 2XWBB 1MJ8H 4R7DB 3LKOA 1K8IB 3QIBC 3WIIH 3HZMB 5JZ7C 1VDGA 1A9EB 4MX7B 1R3IL 4XMLH 5FO9A 2YPLB 2X1OA 2R56L 4GG6F 4TSBH 4TSCL 3VDBA 1N0XL 2E27H 1CGYA 2EDBA 2FECI 5D6CB 3V0WL 1W0YT 1WBZB 3GEWB 4LF3A 5HI4D 1A7OL 5GZND 1G7LA 4ELKB 4WENB 3DVIA 5JPMA 3MLTA 1WISA 2OZ4L 5FUZH 1U8LB 4HWEH 4JFDA 1EXUA 1FFOB 3U4BH 2X70A 4LCIH 1DSFH 2OS7A 2XNAA 4XC3L 4MCZA 2A9NL 2Z8WC 1A14H 1QYGH 5E99L 1CXKA 4X7FC 3GMLB 2AEIT 4IDJH 2MTPA 1YYMH 3MV9B 2VABB 2OM5A 3LPWA 2VLKE 4WI4A 3BQUA 4OZIA 1NUGA 1RU9L 1MHCB 2KKQA 2AJVL 1PG7W 5I1IL 4AJ0A 3L3DA 1UM4L 3CLEL 1GSMA 5EOCJ 2AV7B 5FUOL 1A3RL 1Y18B 4Z5RA 1NFIA 4HWUA 4D0DA 2GK0A 4U1KA 5E8DL 1RULL 1DL7H 4E0RB 1XMWA 3GI9H 3EYVB 4RMTA 5D4QA 4WW2C 5FOBA 1NAML 4LMQI 3ZKMD 3BP7A 3JV0A 1TJGL 1MCDA 1WVZA 4L1HA 3DV4A 3V7AG 1YYLH 4CVXA 2EKSB 2QSVA 1YJDH 4WFED 3ET9F 3U9PH 5K59E 4PRNA 4QHNA 5GGTH 3ARGA 5INDB 2VXSH 1RJLB 1F58H 1RHHA 3OMZA 4JCMA 1P4BL 2DQUH 2AJ3B 3FO2A 3WKNA 3L3HA 5GZOD 3GJFH 4K3HA 4NO3A 4Q6YA 3QUZA 4ZUUA 2YD6A 4MNQB 4JR9L 2CIKA 1CBVH 4C83B 4RISH 4MGXA 2Q76B 4XNXH 4D0BA 1NGZA 1C08A 3ZKXB 3DGGA 4QRTB 3T3MF 3RZCC 4NJAL 3A6CL 3DIFB 2JB5H 4NIKB 5FF6B 1D9KB 4G8GD 1MSPA 5FV1L 4Z7QF 1YUHA 1YEFL 4UILL 3IFOB 2WBWB 5J13B 1HILB 5HYFA 5EZIH 4L9LB 4MJIA 2APXA 1EHNA 2ORBH 2DQTH 5T3ZE 4HWZA 1K3IA 5FUCC 1P7QA 3W9EB 4X7DC 4MNGE 5HGBA 1J8HA 1FFPA 2E7HA 1RUAL 3EOBB 4EDXB 1KCSH 4GMSL 5CZXD 1N8ZB 1U58B 4JREB 3AY4C 5DO2C 2EH8L 4LIQE 4G42B 4B50A 3H0TA 4NUGH 5HBBA 2WIIB 1I9JL 1GAFL 15C8L 3OR6A 4F7CB 1YPZE 5E8PA 2YRZA 4PREA 4I0PD 4F7EA 3IDMB 3FFDB 3MACH 3P0YH 4OCRH 5B22A 4PRHD 5F21B 2X4PB 2WUCL 4L4VA 5IK3B 3SKNB 3WXVH 3MBXL 3HB3C 3ES6B 4NPYB 5IHLB 3SY0A 4L5FL 2APBA 1NMCC 1MVUB 1BAFH 4S11A 1F4WH 2EIBA 4AH2A 1KCRL 4QOKE 5GJSL 2R9HD 4X4XB 3DTXA 3TT3H 5GGVL 1YN7B 4JZJB 5IMLB 4MXWL 1AGDA 1D5IH 3CGTA 3VFGH 3QUKB 3L5WA 3ZT6A 4PLKC 2FB4H 3ZE0F 1C5CL 2DYPD 2VDLH 2HKFH 3MBEC 1MRFL 1CR9H 2JJSC 4I2XE 5D2LB 4DFHA 5DXWA 5GGQH 4OIAA 4KDWA 3PWPD 3NN8B 5BV7B 4QRUB 1A6WH 4WU5B 1URLA 3TVMC 2AKRB 2PYFA 2HTLC 5IEKB 2E5EA 3M07A 2JE8A 3RGVA 4G6AD 4HS3B 3FFCB 3FQXB 4HXBL 3W39B 4M6MH 5CUSL 4JY6A 1C12A 5EO0A 4B41A 3VXSD 3SHSA 1NKRA 4EIZC 1H3PH 4HW6A 1XIWA 4PJGB 3TJHC 4XTRC 3IU4H 3I6LD 4WO4B 2HFFB 3H2WA 4GXUM 3BKYL 1HE7A 1I75A 5D1XD 1LWRA 3WL9A 4GW5B 5IP4A 3VJ6A 5LCVH 5E94B 3D3VD 4FABH 1EJOH 3CLFL 1JRHI 3MLZL 3C6LB 1X4YA 2BP3A 5KSAC 2JB6B 1VFUA 2AK1H 4HKZA 4Z7VE 5ALBH 4OGXL 5C0EA 3R1GL 3MCKB 4PB0L 4U7KA 4OZIF 3PHOB 5IIEB 1MWAH 2C3GA 2B5IB 2HRLA 2P43B 1K6QL 4UDUA 2GITA 3MLXH 4CMHB 3TNMB 4KMQA 4K2UH 4UNVA 3I6GB 3LSOA 5EO1A 5FIEA 3MQIA 1QQDA 2CRIA 3F5WB 4Z7UE 1F11A 2ZG2A 4PUBL 1S7WA 3FTGB 1PKQE 1SYSB 1T3FB 1HHKB 1XCTB 5DUPH 4EUPH 4LVOB 4PLOB 5BOZG 1MUJB 4JG0L 5JQ6L 2EXYD 1RHFA 3RDTB 5H94B 3CXHJ 3DXAB 5MI0C 3W2DL 4G6JL 3V5KA 1M7IA 2Y9RT 4WCYL 3UJJL 2HLAA 2IANE 3RI5F 1SYVB 2Q1EA 4HKXB 3DETD 2BCKB 4CW1B 5DEFB 4XHJC 3TO4B 4PV9B 1BX2A 4MA3B 1BHGA 4OCYH 5EPMB 3QG7H 2AXFB 5HHOB 1BQUA 2IQ9L 3KYKH 3MTRA 2DJUA 3GMOB 2X1WL 4NYLA 3MJ9L 5DRZA 1W0WA 1CZ8L 2MKLC 4FQXA 2IAMA 4OZGB 3HZYB 4EI6B 5I75C 1FO0A 1YMMB 3C8KB 3EGSB 4HUMB 5DLML 1OF2B 2ADGA 2OL3L 4ZSOB 4P57B 4QXTA 4MS8D 5C0CA 1WCBB 1T5XB 2IGFH 1LQSR 1TCMA 1F3JB 1R3KB 3PDOA 1VGKA 2W59A 2IMNA 3PL6A 4APQB 3NIGE 3VI3F 4PG9B 2OCFD 3C87A 4CN1A 1LO0H 5L8KB 1UWGL 2NR6C 5E2UL 1V7ML 2ZJSL 3LKPA 2FH8A 3P4OA 5DGQA 1WTGT 1X7QB 4YHZH 4BUHA 4TYUA 3KPRE 3T0EB 4RX4A 4HHAA 3HI1B 2L7JA 5IG7B 5H2BB 1EERB 4V1DA 3WLWD 4JRXB 4Z7NE 4PP1D 4H5SB 2ICWI 5EZOH 1CWVA 3MX0A 2NY0D 3MRJA 1E27A 5DJXA 1P2CB 3VFMA 2O61A 1TVHB 1T5WA 4P2RD 2CMRH 5J4MA 2DLIA 3D18A 3WDHA 3TYGH 3VXRB 5E5RB 4LPUA 1LK2A 5EU6A 2IH1B 3W81A 1RIUL 1YEHL 4JFFE 5EU4A 2A6KA 1DJSA 2W9EH 5E8EA 4IRJB 3QDHA 4LPTA 1T2QH 1A2YA 3MRNB 1Q38A 1P4LA 3T3PE 1SVCP 2NLJB 5ICZB 4NKMA 2W65A 2BJMH 2FJHB 3O6KH 4YGVB 3F7QA 4ZUVA 4BK5A 2E9BA 2SEBB 3HCVB 3GMMA 1IC7L 1HZHH 3R0MA 3NTCL 2J4WH 3MV8A 3VFVB 2HYMA 5T3XE 4PP2B 4W68A 3QT2A 1ND0A 4PJ8A 3F7YB 4GRMA 4MD0B 5CD5D 3BZ4A 3VGFA 1BBDH 5IMOA 2H2PD 3SKMA 2YSSB 4O5LL 5C71A 4H1LH 1MI5E 4UB0H 1UM6H 4YH6A 1HCFX 5EUOA 1MCEA 3INUL 4M8QA 5FM5M 3U0TB 3O6LH 4R3SA 5DHVA 3S88L 2NYYC 3ALPA 4GG6E 4MB5A 2CQVA 1BM3L 1KF9B 5DK0A 1QPPA 2BC4B 5E4EB 4M9PA 1OL0A 2YZ8A 3CX2A 5EBMA 3CK0L 5FM4A 1BEYH 3BISA 1UA6H 1H5BC 3H9ZA 4BSWB 4R7NA 4WWKA 2F19H 3KWWA 2Q3AA 1UADC 3PWLB 5A16A 3MLUL 3THML 2Z31C 4WFHE 5ANMA 1TITA 2VXUH 3QJHB 1DVFD 2BERA 3OB0K 4BUGA 3F7VB 4AMKH 1FGNL 3SQBA 4XGZB 4Y2DB 2GQHA 3TV3H 1FIGL 4WI2A 5IJKA 4XBPA 5TDNA 1XGTB 3U46A 3MYJA 3CFBA 1IKNA 3MO1A 2F53E 5DRWB 1YDPB 5D93B 5SWSB 3S37H 2IAND 3MNWA 3SDCA 3I75A 3TN0C 4X80L 3CDFA 5GRXG 4H0GA 4K94H 3IDIB 2FO4A 3T2QA 2P47B 2OJEB 3GIVA 5CS7A 1JNNL 5JXED 1UCBL 1ZHBB 1R5WA 1IEAA 2ZOLB 1ZT4B 4YXLL 3TH3T 3ARBB 1T4KA 3HZKB 1P84K 2B4CH 5I16B 4IHOA 3QFDB 2BNRD 2D4DA 2XTJB 1RY7B 5EORH 5ENWA 4DVBA 2ZUWA 3TIDA 1YQVL 1RZKL 4NRXB 3MRHB 4K23L 4NQDA 4KJWC 3EOAB 3B8YA 1NGYB 2PTVA 2DQDL 3CFEA 4I3RH 1KSRA 3TFKC 8FABB 4U6VH 1WFTA 3OKDB 2B1HL 1PEWA 2Z4QA 4J12A 5SV3A 5IGXH 1MHPL 3CFCH 3RI5K 3HE6A 1AGEA 4HJGA 3T3ME 2R0LH 4DN3H 2PNDA 3QPXH 4WRLA 3MRMB 2VZVA 3PWJB 3KPRD 4NQCD 4Z7QE 3QXVA 2ZPKL 5C7XL 5JPNB 5L2KE 3ZYZA 4XI5D 1FL6A 3FT2B 2MOVA 3DMMD 2Q87A 5C6TL 1MFDL 5HDLA 4PGDA 1I7UA 2NY4C 3WO3B 1GGCH 2BRRL 3QG6B 4IMLA 1RZKC 1Q0XL 2Y36H 3LKQA 4PJ5D 4M7KH 2JJUA 2GJZA 4Y16A 4JFEB 2Q86B 2WANA 4JFFD 1F6AA 1G9ML 3VWJB 5F3BA 3ARFD 3PXJA 4LSUL 2NZ9C 3GB7A 1XF2A 3DURA 3C5ZD 3NA9H 3SOBH 3QI9B 1R5VA 4GW4A 4FQIL 2JELH 4NM4H 1F8TH 4OQ1A 5MEPA 3CCHA 4XXDB 1EVUA 1T04B 3LEVH 5T3XD 2NY2B 5C1MB 3U30B 3ZTNL 3K3QA 3UEZA 1IAOA 2WNGA 5EOCL 2OI9B 5F72S 2WBJC 1QSFE 3K80A 1QR1B 1KPUB 4PRPA 3TA3D 1KNOA 4LPYA 4MMXC 3IVKA 4KHXL 4O2CB 4QHMB 5E2WH 4JFHE 4BYHA 4NZUH 4GUPA 3T08A 1IGMH 3I84A 4X6DB 1NUFA 4G3YL 3TPKA 3ORJA 1X5AA 4UMGA 1KTDB 4XMPH 1QO3B 2VDKL 2AV1B 2A38A 1K4DB 3MV7E 1G9MC 4ERSH 1IKFH 3ULSA 3EFFB 4ZFZB 3CMOH 4HUVA 2Y72A 4PLKD 1ZA6B 2DQEH 4JY5L 5D7SL 1R0AL 3DOSA 1BZ9A 2XN9A 1FSKC 2ESVE 3TNNA 1UWEH 2YRLA 1ES0B 3ARWA 2AQ2A 1S7RB 3VFNB 5MEQA 1JPFB 4WFHD 3HI5H 4UTBH 1B6DA 1FVDA 1JBJA 5EUOF 5FYJU 5ICXA 3VMNA 1AKJA 4OFPA 1FCGA 2D03L 4KAQH 3WD5L 5JIIA 3E6FB 2LVEA 2Z92B 2BNQD 3P9MB 4IIQB 1CFSB 3VCLB 4HFWA 3VU2A 3RTQB 3VFRA 4F15B 4ALAL 1AQKH 1D5ZB 3HNVH 5HYEA 1OSZB 5BS0A 2A6IB 3MOBL 5I6XB 2X7LB 5HXMA 3W0WD 3DO3A 3KHOA 4R26H 4X7TA 8CGTA 4PY7B 4I18C 4RAUB 2HWZH 4JFDE 4PJ9C 1AY1H 1JZ8A 3ARDC 2BOCB 2R0WL 5J11B 5MEOA 25C8H 4GMTL 1PBYA 4WWID 3VXTB 5B4MC 5E6YA 3LZFH 4YFDB 2ATPB 4HH8A 1T7VA 3RL1B 4RIRA 4OZIE 1SY6A 1QBBA 3CFIC 3U2SA 3NPSC 4ODXA 4W81A 3LH2L 4EN3D 2HJLB 4FQJH 5CBEB 5DZOA 4GAYA 3BH8A 4U3CA 1TNNA 2Q7YA 4HCRA 4HJ0C 2YPKB 2E7BA 1SEBB 1DCLA 2JCCB 3QIBA 3U6RA 4P46D 2HFTA 2V9QA 2VDNH 4WDIB 4F7PB 1ZGLA 1I8IA 1DE4B 2IPTL 1QFWL 1KOAA 1LO2H 1AHWC 1LE5B 1CGVA 2VQ1B 3OGOE 4Y19B 3S36X 4EI5A 3GGWA 1RAMA 1EGJH 5L2KD 1N3NA 5HHNB 4LRNL 4IEFB 4PJDB 4P9ML 2VO5A 3QQ3B 4KMTH 1AXSB 3ELAT 3GBNH 4HF5L 4OJFH 3GSUA 1G7HB 2W60B 1JYXA 4NC0B 5ITBH 3KLDA 2MCPL 1BD2B 3PWUB 3RL2B 1ITCA 2WQRA 2V2TB 4ONHA 2R2EA 2VITA 3IDYB 5HPMB 3I3BA 2ENSA 4G6FD 4RGOL 3O3DB 2PYEA 5ADOL 4POYA 4OUUA 4X5XA 3K4ZA 2KL6A 3F7PC 4JDVB 5E9DA 4MJIE 1BREA 1LDPL 2ZCLL 3GSNA 1OT2A 2D7MA 2HH0H 5IQ9B 5DTFA 1RJYA 3C60B 3A67H 3ZE2E 1J8HE 1U8KA 2OTUB 1LEIA 3R06B 1XR8A 4GKSB 3VI3E 3QDMD 4MB3A 4U1LB 2Z93B 5C07D 5JNYB 4XCCL 4Y89A 3RWHA 3V0VA 1IGJB 4HT1L 4JFHD 3KYMA 3FT4B 5LKNA 1FPTH 1ZANH 2G75B 4NWTH 4QHUB 2CLVB 3FKUS 1C5BL 1RD6A 2VZ1A 1LO4L 2WMPA 3M45A 5KS9B 5LXGL 3MV7D 3T4YB 3EDFA 1TLKA 5E6IC 1ZK9A 1JMZA 2HJKB 3M1BB 4JLRB 5TQ0H 3V4VH 1LP9B 2BVUA 4L4VE 5SWZB 4NFDA 3SDAC 1NC2B 5E8NA 1UM5H 4I48A 2DQCH 2CK0H 2ESVD 1H8OA 5T33H 3ZSTA 4JHAH 3QCTH 3AFLA 5DC0A 1IL1A 3AREA 4LSVL 2WLYA 2XY1A 3WFHA 2RBLA 1A4KB 1WIPA 3EW3B 4GKZB 1P1ZA 4YX2L 1N6UA 1O0VA 4JPVL 2IF7A 1Z0NA 5KSBA 3NCMA 3T0XA 5FGBC 1JYVA 3BT2H 1N5YH 4L9DA 1NBQA 4L4JA 4F58H 2HTKD 4QHLA 4YDVB 3QNZA 1KBGH 4LGRB 43C9A 3ZKXC 1IAKA 3VGGA 4C4KT 4KDTA 1A21A 4YWGL 1NH6A 5CP3A 5DEGB 3O4OB 5C0DB 3GHBL 1D9KC 4HC1L 4NQVB 1I1RA 1Y6NR 2H32A 4BSVB 1SM3H 1F6FB 4TTDC 1YY8A 4XCEA 1ZHLB 4WEBL 5AD0B 1T1ZA 2V7HB 3NFSL 5JOFA 1A6PA 3OPZH 5IFHH 4X4ZA 2UY6A 4HUKB 3UC0H 4OSUH 3T2OA 5CJOH 4RGNB 3X3FL 2NYYD 4R96A 3ZYIA 4JFXB 4KJQD 1JPTL 1WAAA 1BQHB 1CDJA 1KUMA 2ITDB 1ZA3A 1G0YR 4JVUA 4L3EA 1ULVA 1GGBL 3BP4A 3PGDB 3NZHL 2YN5A 4HZLA 4M3JA 1G9EA 4FXLA 1F4AA 3IKKA 4K8RD 5C0GA 2CKNA 3WFCL 4QXGL 5C0NC 3AM8A 2Z31D 3RWDB 4HJJH 5FK9A 3RWFB 4OGYH 2ZKHL 3F6IA 3MOAH 4N9GB 2JJSA 3RWJA 4Z0XA 4JPKL 4DGIL 4R4BA 4IS6A 5HHQB 2H1PH 3QQ9C 1HQ4A 3TZVB 5J1TC 2H2SC 3N1FC 3N85L 3QUZD 3B5TA 4ZAKA 2VR4A 1HXYA 3LD8C 2GW5A 2X6MA 2Q7NA 2DTML 1CDUA 2Y06L 4NC2B 4TUOB 2EC8A 4LIQH 1ZTXL 4LSTL 2XA8L 1WIUA 3KPQB 5D70L 5HJ3A 3R0NA 3IF1B 1OP5H 1I3RB 1FZMB 3HMXH 2ATKB 1KJ2H 2Z9TA 4G9FA 5ITFB 1HXMA 1K85A 5J6GB 1MHEA 4PV8A 1NC4A 3JXAA 3BDYH 4NGHL 4JFZH 3KNBA 3CU1A 5IKCB 4K7PL 4CNIB 4X4YB 2A0LC 4NRYB 2F5AH 4UOW1 3TFKD 1SMOA 1RZIA 3VFWB 3QFJB 7FABH 4HGKC 1U92A 2DRUA 4CAGA 4MA1B 2GEEA 1PZUB 2ICWA 2IBBA 3QDAA 4WO4C 2UYLA 5C0CE 5C2BL 4YAQB 5F88B 5DJCB 1A7RH 4ZUTA 4K7FB 4WGVB 1DBJH 1IQDA 2NY4D 4NRZA 1PLGL 4WUKH 1CVRA 1HIMH 5KN5B 3WHE1 4OBSA 2NY3B 4PJFB 1ETZB 5TE7L 2XG4A 2ZUQB 1G6RA 4NQEA 1KELH 4RFEB 3CSYB 1RK0A 4XCNB 1YA5A 5FKPB 2ED8A 4FZ8H 5E08H 2XWTA 1JNJA 3O11B 1WZLA 4QTIL 3MREA 1I1YB 3V6FA 4FN0A 3AC0A 2NZ9D 5LGJA 4S1QH 1I1CA 2MPAH 4N90E 1PEZA 1SJHA 5IW3A 3WKML 3OKMA 1H0DA 3TH4T 4LVOC 5F7UA 3X14B 2BVYA 4P2QE 3O3BB 5EU6E 2IH3B 1MCCA 4ONGH 2C5DC 4NBYB 4UUJA 4ZPVB 3RDTC 4AIZA 5JDSB 4XRCB 1UH4A 4JRYB 4KHTH 4OLWL 3KLAA 4GKNA 2CDFA 2GTWB 3ARYA 4Y5VA 5KSBF 1B9ZA 1I8LC 4RMVA 3OZ9L 4MA8H 3QUXB 4G6KH 3G08A 4N8PA 3HS0A 5AZEL 3E6HB 4JGMA 4NZRH 3BUTA 4U6YA 5CMAA 4PRAB 3MV8E 2LE9A 2WUBH 2AS5M 4LSPL 4M7JL 2NY7L 3EOYG 3S3SA 1OWWA 4X5WA 5DWUL 2FEEL 3VW3L 2FO1A 3FB7B 3MRQA 3IJYA 1FDLH 1MPAL 3SDDA 5KAQG 4XMKL 5EZLA 5FOJA 1J11A 5EUOE 3L3GA 4BH7A 4XBEH 4EBQH 5K9KB 4BQ8A 4TPRL 1S5HB 2PCPB 1QLFB 1AD0B 4U4BA 1UEMA 3AB0B 2FATH 3CMGA 3UJIH 4HGMA