4HIHB

Anti-streptococcus pneumoniae 23f fab 023.102 with bound rhamnose.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
203
Chain Sequence
LINLVESGGGVVQPGRSLRLSCAASGFTFSRYGMHWVRQAPGKGLEWVAVVSSDGRTTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVFYCAKEGGDNKFSFDYWGQGTLVTVSSASTKGPSVFPLATAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVQTYTCNVDHKPSNTKVDKTVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Preferred Human IgV Genes-Based Protective Antibodies Identify How Conserved Residues Contact Diverse Antigens and Assign Source of Specificity to CDR3 Loop Variation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Fab 023.102
total genus 41
structure length 203
sequence length 219
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hihB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hihB01
3MPCA 3MGTA 3C5JB 1IGIL 2BSRA 4B53A 4GJTB 5E8NA 4HX1B 7FABH 2Z91B 3ARFD 1J8HB 5EZOH 3TA3A 2NY3B 5BOPA 1B6DA 2OTPA 2WQ8A 4ODXA 1XR8A 5E1HB 4PG2C 5EU7E 2A0LC 2R56L 3MLRL 5AD0B 3HE6C 4HH9A 3X3FH 2VAJA 2XIDA 3DETD 1C5BH 1QPXA 2DM7A 3WIIH 3ZHKA 4EOWL 4PREB 1YEJL 4YDVB 3QIUB 4LAJH 1CI5A 4YZFE 2EDEA 5TDNB 5ICZB 4S11A 4YE4H 3L3DA 1NC2A 4PFEA 4ZUVB 4IRSA 3RUGB 2APVA 1JHTB 5DWUH 3VFOA 4UDUA 3OQ3B 5EORL 5DD3H 1CLCA 1ZLVK 2ZG3A 4BSWA 1DQMH 3R4DA 1X44A 3C6LC 2UZYB 4Y4FD 4AIZB 1DQLH 5D1XD 2JJTA 5D7SH 3QWOA 1I3RB 3KPRB 3SGEH 1L0XA 3QZWB 1CL7I 4OZIF 4EZMA 2PTTA 4Z76B 3CVHL 4ZXBD 1OCWL 2VLRE 1N5YH 3T65A 1OHQA 4HS6A 2IBBA 1S5IH 2JE8A 4HJ0D 3OJVC 4XNUL 5EULV 4NFBA 4XH2B 1ZA6A 1FLRL 5GRUL 5HHOB 3ARPA 3QPQD 4OFPA 1A7OH 3SDDC 4M9OA 3V5KB 3DXAD 5TJWK 2YUZA 4ZNEA 1YPZA 4S2SA 4GXVL 4UT6H 5E03A 3DUUB 5IGXH 2OXGA 1QBMH 4HFUL 1A3RL 5BXFB 4OIBA 3ULUC 4IS6B 3BIKB 1DVFA 5E2WH 2OQJA 1WV7T 2D7TL 4GW4B 2VLJB 1JI1A 1MJJA 2NY0B 1FNAA 3S37H 4Z7NE 1MI5B 3OGCB 2A6IA 5E8OA 4W6WB 4HKXA 1OD7A 4NO0A 3FOMB 5C0JA 3TT1L 1D6VL 5DMYA 5GPRA 2VDRL 3A6BL 5E5RB 4MDIB 2HKFH 1CFQB 2NY1C 1U8QB 3ZKSD 4Z7VA 5GSRB 1Y6KR 4ERSH 1LGVA 1U6AH 3SE4A 3BXNB 5HYIA 1AI1H 1NBVL 4Y16C 4OZHE 3SGKC 2BNQE 3TBVB 5J9PB 2YBRB 4Y4KB 2DQTL 2HFEA 1WJ3A 4JM2A 3CZFA 1LK3H 3BKCL 1C16B 2ZUQC 1JNLH 3MYZA 2ZUWA 2APFA 3W9EB 1NMAH 3VFGH 1W72B 3IDYC 1KJ2L 4K71B 4YQXL 4PRIB 5LGJB 1CU4H 5IB2A 2GUOA 4TPRH 5IF0B 5AUMA 2FH8A 1N59A 3RWJB 3OKLA 1KPVB 1OAZH 3HUJE 2OJEA 4QWWD 3SDCA 2BVQB 3FRUB 4JFEB 3T4YB 2QSQA 3WL9B 1N4XH 2NW3A 2X4SB 3FFCA 4MGXA 3STLB 1JGDA 3NIDF 2E9BA 1ORQB 4WHTB 3G6JE 4H20L 1KJ2A 3P9MB 4F15C 3UPRA 4E42A 1Q9WA 1IAIL 2IALA 1NMCC 5KAQF 1Y6MR 5A2FA 1ETZA 2DQCL 3VXPA 1M7IA 2FH6A 5E08L 2AEPH 4WI8A 1INDL 3Q6GH 1G7PA 1JF1A 4R2GD 2H6PB 1T66C 2R8SL 2IBGA 3MMEA 4ZDHA 2HN7A 4DFIA 1IGJA 3JXAA 1KV3A 2DWEA 2P8MA 5HHXH 1IGFL 3LMJH 2ZSVB 5IFHH 2HTLC 5KZCB 4F9PA 3GHBH 3QXWA 2AK1H 2NX5D 4MNQD 5BVPL 4HLZG 4Y7MA 1WICA 1NAKH 3MA9L 2J8UB 3EHBC 2YMXH 2F74A 2VDQH 4ODBD 2P5WE 3T1FA 4MQ7A 2NNAB 2ESVB 1RZKL 1NANI 1IL1A 2VJXA 4L4TD 5DT1H 3WN5C 4OZGB 1FP5A 4NM4H 5IHUH 5FKPB 4U6YA 4G9FB 2NY2B 1KIQA 2G9HA 4DVRL 5EOTB 3ULUH 1EAPB 5HJ3B 5IR1A 4V1DB 5I6XB 2ZCHH 4NSKA 4KRPB 5JUEL 3WUWA 2PXYA 3IU3A 4WWKD 4LP4A 3R8BB 4ODVH 4PGBA 4K8RH 1YEKH 5B38B 2ORBL 4Q58C 3VI4F 1T0PB 1CXIA 1I9IL 1SM3L 3ARTA 3FAWA 4C4KT 5GRVL 4QF1B 5CILH 1CVSC 3HE6B 4ONHA 4KMTL 2ARJQ 4LSVL 4M6NH 4L8SB 5DZNA 2J8UA 4J1UA 1U9KA 4EBQH 1TVBB 4JRYE 5C09A 2YC1B 5H94B 2W91A 1T20B 1U3JA 5IB4A 4L29B 1HIMH 4CVZB 4Y2DD 5A1AA 1DQJA 2EDRA 4G8FB 3FQNB 3O41B 4GRWB 3FO1A 3BSZL 2MQ3A 5HYQB 1Q9OA 3MLTB 3Q3GB 1TNMA 1OOAA 3WLBB 4M6ML 2XNAA 3ARWA 4YDIL 1TQCC 1NSNL 4Z0XB 4TULL 3DX9A 4ZXBB 4XP9H 4G9FD 2P5ED 4PJGA 3I2CL 1SQ2N 4PR5B 1UCTA 4HV8A 4QHLB 3CDYA 4QY8B 5B39B 2QQQA 2OYPA 4NQXA 1OAKH 4NO5B 5MEQB 1HXYA 1Z3GH 3LIZL 1FO0B 5BV7C 3QEHA 3F12B 1P5VA 3GSOB 2PO6C 4O2EA 4NKDB 1H3WM 1I8LC 2Y07H 3KPPB 3B5GA 3NCYP 4DZBB 5F3BA 4CN6A 5CLTA 3LEYH 1TXKA 4LPVA 4P23B 2AI0H 3U1SL 3C2AH 2EH8H 1NFDE 5LBSH 2VLME 4NQTA 3FN0L 3T0EE 3FHAA 4G5ZH 4WTZG 4XP1H 1KPVA 3HB3C 5FYKE 2NY7L 3ALPA 5L6YL 1ERNA 2YPLD 4OCMC 3HNSH 1FN4A 2PXYC 4P9ML 2DM3A 3MLVL 3ARXA 4OD3H 4FA8A 2R23B 1A9EB 5DJXB 1Z0MA 4GUPB 1CLOL 4AL8H 1REIA 4HK3J 1RJZB 3FB8A 2BJML 1YJDC 4GXUM 4PP1D 4KK5D 4LLQB 1ZA3A 1BZ7B 1YEHH 1T6WA 3ARDA 4PRBB 1MHEA 1GSMA 4WO4C 2Q76A 1MCPH 2XA3A 2N56A 2QLVB 1T2QL 2XT1B 4HWUA 4KJQC 5FHBH 1H3GA 2FD6L 2C3VB 2FGWL 4IMKC 4OLEA 3SJVD 2DIBA 3JUZA 3QEQD 4LRIA 5DFVC 3DYOA 2FCBA 5E9DD 2V7HB 4M62L 3PHSA 4NNPL 4U0RC 2HG5A 5F96H 3G5VB 2QQLL 3S36H 3MNVA 1ADQA 5D1QA 3MOAH 3ZKXB 4XPTH 1UADC 3RWCB 3CIQA 3OAUH 3KYKL 3IS0X 4MNGA 5E8PB 3LH2H 2E27L 4XNZB 4X9HA 5F7FA 2C3VA 5C0ND 3PQYA 2E7MA 1Z9MA 1CGSH 1BZ9B 1EJ6A 4GQ9L 1YEFH 2LTQB 1I7ZA 4U1HB 4P9HL 2E9JA 5HD8C 5EN2B 4LSTH 2RCSL 5F96L 1KC5L 2XZQL 4HBQA 4KGLA 4KRLB 1IBGH 5IFAL 5C0GA 4LSTL 4ODWB 4YHPB 5DZOA 2GKIA 5TDOB 3UYOD 1JE6A 3C5ZA 3CU7A 5ADPH 1MNUL 4MA1C 3MRDB 1E4XI 4PBWD 1XGQB 3ALXA 2EDXA 4W70A 5I1EL 4FQXB 1E6OL 1E28A 1NEZG 1JGVH 1RMFH 4PREA 5EU4A 4HWEH 1BZQK 1IKNA 2DKMA 4AENB 2R69H 3U83A 1WIPA 1LP9E 4PRDB 2FECL 1VERA 3DV4A 3CK0H 3EJJX 1CXLA 5CZXC 5D7IB 4P23A 3GJEA 1U91B 4PIRF 3HLAA 2G2RA 4HJJH 4OZHA 1LWRA 4YBQD 3K74B 1AIFB 3GO1L 3D5OF 3DVIA 1G6RL 3OR7A 5SWZE 1CWVA 1QFHA 2VZ3A 3VJ6A 3RAJL 1SEQH 3FN0H 3QDJD 1WZMA 2QV2A 1CD9B 2P42B 3I50H 4ZUWB 1MRCH 3OB0K 1H8SA 4LVOB 4N0YH 3T0AA 1P7QB 1ZT4B 4XTRD 1CE1L 1IGTA 2OR8A 4WFFD 1MUJB 1XIWD 2X4RA 5GJTL 3ZYJA 4WFEE 1AGFA 5DYOA 1MCSA 2D7PA 4WHYG 4L4TA 3VFTA 3UZEA 5LVEA 5C0IA 2WV3A 1I3GL 3IFPB 5C08A 2ZZUT 4PD4J 1X4XA 3TZVB 3KYOB 5J11B 4MXVF 4Q2ZA 3TP4A 1N4XL 1FVEA 5D2LF 5ETUA 3MLTA 4DWHA 3F5WA 4K94H 3QI9C 1BP3B 3JUYA 4JZOB 3BZEB 1U91A 3A6CH 3TJHD 5IKCB 4HF5H 1GGYA 1X5KA 3B8SA 4YHYC 4XCFL 1WTLA 3HNSL 5IQ7L 4MNQB 3BH8A 3O6KL 1NUGA 1OAXL 1AP2A 3G9VA 4E5XB 1CLZL 2CJUH 1MFAH 5JW5B 4B7LA 1MPAL 1PEWA 3BJLA 3FB8B 4QEGA 3VG0H 1OAUH 3VXRA 3C6LA 5T33H 4KY1H 4P3CH 4WW2F 1AC6A 5D70L 3QI9A 4HS8H 3RWIA 4TOYL 1GGCL 2NPLX 3EYUH 4R26H 4JM4L 2PTUA 3TIEB 2CIIB 5DJYA 4EVNA 1YEEL 3FO2A 3TV3H 2VZUA 2ZPKH 4FQXC 3SE8H 1UA6L 1G9NC 3WHE0 1OAKL 1MEXL 4F7MA 3ETBF 6CGTA 1K4CB 4HCRA 1ZXQA 4LGRB 1JHKH 4LEXL 5FAAA 1MVUB 4HUNB 4TVSa 4LCUA 1UCBH 4GH7B 3V4PL 3ZE1F 2ZG1A 5IW1A 1PG7X 5GIRB 3PIQA 4JPIB 5E70A 5HGGS 5IJVB 1OF2B 1KC5H 2P24A 1KG0B 1LEIB 1RIVH 2CMRH 4ODHH 5IVNA 3TN0A 1WK0A 5DQ9A 5T3ZH 5MEOA 1U95A 1LK2B 1KB5B 1UACH 1HWGB 3IXTB 1SVZA 1W0VB 4PRAB 2JK5A 1T2JA 4LF3B 2D0GA 2AJZB 1EEUA 2R69L 1FLRH 1AQDB 2WUBL 2V2WB 4URTB 4I5BA 3NABL 2IGFH 2JB6A 4PBVC 3QIBA 1UKQA 2WANA 1N5YL 4E41A 1I9IH 1SM3H 3AAZB 3CPLA 3IFLL 1NKOA 3O3DB 4HEPG 4NKQB 3T3PF 4J3UA 5DJ8B 5JIKA 4LCUB 2FJHB 5JXED 4FFWD 4M7JL 3O4LD 1WAAF 2XZQH 1ZA3B 4UT7L 2H45A 2RCSH 4P2OA 1D5BB 4MSWA 5JO5A 1SEBA 3R06A 4Z9KB 1B0RA 1H5BA 5EUOA 5MP6H 4NNXA 3WJJC 4QTIH 2FD6H 3VGFA 4CMHB 5B38A 5KS9A 4OM0L 3SKOA 2GJ6E 4WO4B 4K3JH 2F5BL 1LEKA 3H9SE 2JCCA 1A7NH 1G7HA 2ZNXA 5FK9A 1MWAH 2GUOB 3SPVA 3PDDA 4OFYD 2V9QA 4NCC1 1IFHH 3EW3B 4JQXA 5TH2A 1O7SA 1HYSC 1IL1B 3H7BB 4G6ML 2BSTA 4R7DB 3SCMA 2NNAA 3HZVB 4P2OB 4ZMAT 4FP8L 4N0RA 4WTWA 5DD5H 2K3TA 5MI0C 1T83C 3LDBC 5B4MC 2FYYB 3ZE0E 4MCYA 5EC2A 2EEBA 5DVLA 2R1WB 4JHAL 4BJLA 3C87A 1LQSR 1YZZA 5I8KL 1LO0H 1RZJH 2OP4L 2EYTA 2X4QA 3E8UL 4TSCL 5EFIB 2BFVL 4C83A 2VLRD 4Y4FB 1YMMA 2V9RA 2DIJA 3U0TA 3ZKND 3O4OB 5F71A 1EVTC 2FJFB 3LAFA 1CS6A 3GIVB 1EGJH 2I60L 3MMEB 5ALBL 3OTTA 4J6RL 1R3KB 5I1JL 4BFIB 1HQRA 3Q3GA 1J1XL 3LIZH 4P57B 4M5ZH 3Q5TA 1XFPA 4GXUN 2HTKD 4G7VL 4N0UB 4OM1L 3FTGB 4ONFH 1P4BL 1G9EA 5GS3A 1B4RA 2R1WA 4OZFG 4MCYB 4KKCD 1EEYA 5EC2B 4DQOH 5DFWH 1KSRA 1MWAB 3ALWA 1EPFA 4FZEL 2YRLA 4D0CA 2NY6C 2HJFA 5GGSY 1YMHA 3U46B 2CPCA 4GOSA 2QADD 2B8OT 2NW3B 4S1DC 4JHWL 1TJHH 2HKHL 1R5WB 3BQUA 2D4FA 1RI8A 1OAYH 2X44D 4HKJB 3RWHB 4JRYD 4U7SA 3DURB 4RFEB 1AI1L 1NBVH 3RZCB 3G6AB 3QIBD 3B9EA 1A4KA 4Z7NF 3QG7H 4G9FA 5IWLC 1CDUA 2OMNA 2Z31D 3ZTNL 4PGDA 4MA3A 4JHAH 1UQSA 3RNKB 3CZFB 4YHMH 4ODWA 3EDJA 2AJVL 3SJVB 3LQAL 1IILE 4NKOB 5DJ6B 3T0WA 3HI6H 3HZKB 5JHDB 3ARRA 5DMJB 4K2UH 3TYFA 1QBML 2J8HA 2JF1A 5I2IA 2W07A 1F4XL 3GK8H 1TJGH 5DVNA 1FGVL 1NUDA 3UO1H 1MFDL 4LPWA 4JREB 4HFWA 1NEZA 5D7LB 3IETA 5B3NA 4LASL 2JB6B 1H8OA 1N0XL 3MGTB 3PQYE 2HN7B 4JRYB 1OT2A 4KVCL 3CDFA 2IANE 5TFSH 5FO8A 3MRKB 1EHXA 3L6FB 1L7IH 5F8RC 2DKSA 4F37K 1U95B 3IKKA 4PRPA 4U1GC 3LD8C 5D1QB 4DGVH 2E8YA 2NTFA 3I85A 3MNWB 3O6LL 4RAHA 5ESAB 3CXDL 2P47B 4ODVL 3HNVL 1GAFL 5KSVA 3T0DA 1DQLL 4KPHL 3WFDH 1R5VB 2ESVD 3QNZA 4OZHB 4IJ3B 3HLAB 3PXJA 2DM4A 1EXUA 4GT7A 5AZ2L 5DMKA 4HXAL 1XGTA 12E8L 5IBLD 1ZMYA 2IMNA 4PP2A 2AP2A 1JUFB 4U6VH 3WL9A 1RHHB 3WSQH 1BVKA 4D9QE 4WUUB 1QOKA 3ZLQC 2VDQL 5C70A 4X6DB 1OY3B 5IESL 2VZVA 3P30H 3FO0H 4AIZA 4JFDA 4RGOH 1URLA 3W5MA 2JIXD 4BSWB 1HDMB 2VB5A 4JDTH 1T04B 5JOPE 1W72A 4R2GC 4JDZA 4NFDA 3LQMA 3VFSA 1FPTH 3NCFB 3QNYB 3CZJA 4S1RL 3QZWG 3QCVL 3D9AH 3F7YA 4XHJD 3V5HA 3WFDL 4ZS7H 1IRAY 4I3RH 5C6TL 4NKIH 5DI8A 3VGAB 1DLHB 3AU1B 3T08A 3CXDH 4TRPL 4JFOB 1YEGH 5I8CA 4UZGA 4H88L 1OAQH 2ZWLT 3MRBA 4KK9C 2FEDD 2GK0B 5DMKB 1DQQA 5IWLA 4PLKD 5FUOH 3QUZD 1Z5LA 2KZ1B 4XCCH 4CU7A 1FJ1B 3CLFH 1LEGB 2Y06H 5I1GH 4JM4H 2FWOA 1U3HD 4GKOA 3O8XB 1CFTA 4XP4L 5E2JA 3RWFA 4JLRB 5AZEL 5C2BL 5EUKB 5F1IA 4L1DA 3Q1SH 1XIWC 4GW4A 2Y9RT 4F7EB 3LRGA 5SWZB 2YUWA 5IQ9B 4YHIB 1DP0A 4HC1H 2GSIA 4QXWA 3TGXA 1JPSH 1WCBA 3MNVB 1PY4A 1QVOB 4BSJA 3MOQA 1X5XA 5DSCB 3FFCD 4Y4HC 4WUKL 4XNMB 2VMFA 2CKBL 5IQ7H 1ITBB 4YHML 3IETB 4X6EA 4NO2A 3G5YA 2FZ3A 5LQBH 1AXSB 2IBZY 3D3VA 3SQOL 2P5EE 1ACYL 3HZMA 3ET9F 3OL2A 2EXYC 4Z5RB 4NBZB 2B0SL 3QUMH 4NN6C 3QEQB 4M6AA 1R3IH 1G9MC 4L29A 5IMMA 1A14L 4E41E 2A6JB 3J7HA 1ULVA 4MXQC 3UPCA 3C09C 1NGYB 3O9WA 3QZWA 5F9WC 5GS2D 4CVXA 2DQTH 3BPCA 2OX5A 2OI9C 1CDIA 1Q1JL 2G75A 3GHEL 4MA3B 5IMLA 4D94A 4OLUH 1IEBA 4PJAE 5K9OB 1IC4L 1S5IL 4MLSA 2X1QA 1T2XA 5C3LD 1OCWH 1HH9A 1EAPA 4JVPA 4UUJB 1FC2D 2G60L 3MGOB 5I1DB 3DIFB 4M1DH 1BBDH 3Q6FA 3UX9B 5L88H 1KT2B 3OKYA 5C6TH 1ZS8B 4TNWF 5KJRL 5E0QA 5FHAL 4FABH 4LLVB 1YMHB 5SWSB 1FPTL 3I02A 1MSPA 4DUXA 1QRND 2QHLA 3MSPA 3PWLA 1L4IA 1VEPA 1WZKA 4KUCD 2BNQB 5I1EH 1RSFA 2VL5A 3KPSE 3EFDL 4AK1A 4A6YL 4OCRL 3E8UH 2Y1VA 1XF4B 4J7RA 4TSCH 3WIIL 1CL7L 1HN1A 3DX6B 2Z35A 3JVGC 4KI5F 3JWOH 5I30L 4WFGE 4UQ3A 1Z2KA 3WXVH 3WNMA 3KPLB 3CVIL 2DWEB 4MD4B 4K3GA 5EOCJ 1QP1A 1VGKA 4RBPK 3CDGA 4MJIB 3N1MC 1T5WA 5F72S 4GMSL 3CFKA 4NIKB 4PRNA 5MEND 3DX8A 4ZUSA 2CDFB 5EFIA 1CD1B 1EHAA 3O6LH 4PJEB 3FO1B 3NIGE 4XBEH 5HY9A 2PR4L 4MB3A 3NZHH 2WWMD 1CE6A 2A6DB 1BJMA 2P8LB 1MHEB 1JHLH 2EDOA 3LH2L 1VADB 4PRBA 3MOBL 1CICC 3QIWB 1CF8L 2IANA 3CC5B 4AIOA 4X98A 3V4UH 4DK3A 1LNUA 2ZSWB 3SCMB 4LLUB 5KVGH 3OHXB 1RZ8B 3F6LA 3REWB 3U7YL 1TJGL 3DMMA 2R9HD 1FH5H 2VE6A 2SEBB 3RWJA 2IFFH 1CGWA 1D5ZB 1K8IA 5JIPA 1FFPA 4G6KL 4OI9A 5GGRA 2V6HA 1KPRB 2C1PA 2HLAB 4P5TA 4H25B 3IU4L 2D7OA 4M1CD 1JNHB 3GSWA 2OL3B 1C1EL 2ID5A 5GJSH 1G7JA 1H5BB 3GIZH 3GRWH 5F89B 1A3LL 4EUPG 5JO5B 1DQDL 1OGAD 4ODUB 5T3XE 3C2SA 2LU3A 2FX9L 3IF1B 3MO1B 3W2DL 4L8DB 5GGUB 5DJZB 4NN5C 3K4AA 2DTMH 1DN2A 3PL6B 5FA4B 3D25A 1D5MA 1C8PA 2ICWJ 4OCYL 5TQ0L 3UYRL 1RIUH 3SE3C 2R29L 3KYNA 4TUKH 2XKNB 3GMRB 5KTEL 4DW2L 4W4NA 2GY5A 4RISH 3QIBB 1FNLA 4O5LL 1G7LA 1FYTB 1KGCD 1SYVA 1UXWB 1VPOL 2ITCB 1TITA 2XRAL 4X8XA 4X6CB 5E6IC 3UTSD 4XB7A 9CGTA 3TLRA 1HXMA 5DMIL 5HHMB 4PRAA 4Y19A 1UB6B 1U8NB 2DI7A 3MBED 1NCTA 4YR6A 5MEOB 3X12B 3VXTA 3WO4B 4EI6B 1BFVL 3A67H 5JPNB 1CG9A 3TV3L 3H3KA 3MV9D 4GW5A 1ETZB 2HT3D 2I9LA 4OZ4A 5I1CL 3QQ3B 3KXFE 3MCKA 3PABB 3B4NA 4JJ5B 5IB4B 4GFTB 2J3SA 4M6OL 1HHIB 1IM9A 4EI5B 1F13A 3SDAD 5T33L 3K2MC 2CIKB 3BEVB 4LCYA 2C7UA 5GS2H 3E3QC 3ZYOA 5CZVL 4HSQA 4DGIL 1IVLA 4PJ5A 1F11B 5DEGA 4HXBL 4P99A 3OAZH 1RZJC 4F80A 4D0DB 4N1HB 4EI5A 3TZVC 2VLRA 3O6KH 2X4PB 4FN0A 2EE9A 4PJBE 1G6RH 4M93C 3HAEH 4GRLD 1BM3L 25C8H 2VN7A 4HF5L 4X6BB 4LBEA 1MLCB 3MRMA 4GW5B 1J0HA 3DGGB 2BDNH 3D9AL 1UGNA 1LP9B 2FIKA 4MQ7B 1G6RB 4PJFB 4OGZA 5KANG 2HFEB 4PGCB 3RDTB 4FFYL 1GGBL 5GJTH 5J4MA 5J9PA 2VOTA 4XVUC 5GZNC 3BH8B 4U1LB 1M6OB 3H9SA 4BELD 5IESH 1WWAX 1KN2H 4XHQA 4HQQH 4OM0H 2A0LD 5I16A 4MB5A 5BOZG 5DXWA 1ZSDA 2XWJB 1MQ8A 1BX2B 5B8CB 3LRHA 1E27A 3BGFB 2EDNA 2UV3A 3KYNB 3ESUF 3SGDH 5AZ2H 2LV4A 4ZUTA 3MNZB 1AGEB 1QRNA 4JQIH 1NCDL 4NJ9H 3QG6A 1AR1C 1P6AB 1YPZE 4LHUD 3CCHB 5KVFH 3IVKB 2IADA 3D69A 3EJYC 3VXME 2PCPB 3EYOB 4OZFA 1JF1B 4OTXL 3UROR 2J8UF 4ZUWA 5JW4Q 2Z92B 1NGWA 3IDGB 5IVXF 5A16A 5CIPH 4I13B 4IM8A 1ZEAH 4OGXL 3FFDB 4XRCA 4Y5XC 2P43B 3V0WH 2DWDB 4KVCH 2ADGA 3GMNA 5CJ5A 1UACL 3STLA 4RIRB 2XY2A 2DI9A 2LTQC 4KJYA 1E4WH 2W0LA 4NP4L 1NBZB 1B2WL 1ZLWH 2FLRT 5LKNA 3AMLA 1QRNE 3P3YA 4OQTA 4U1NA 2OTUA 4OLXH 4PJIA 4Q0XL 2I07B 4QYOA 1XGQA 2DL9A 1IAMA 2VDNL 4MJ2A 1U8OB 1JL8A 4JY4A 2VXSL 1U58B 2X89D 1E6JL 4FXGB 3MRCB 3ROOA 3MV9A 4P2OD 4ISVA 1MCRA 3LQAH 3D2UB 3N9GH 1BD2B 3S35X 1MCBA 1E0OB 3EDDA 4G43A 4LKXA 5FUZL 2Q8BL 5C0AE 3T3ME 4YK4B 2HJLA 3AY4A 4NGHL 4EQ2A 2DRUA 1I4FA 1IM9D 2Y36L 4M8VA 5DFVD 5L0QB 3S9DB 5CGMA 2ZOLA 3CDGB 5EN2A 1P84K 1JGUH 2A83B 3DECA 3PHQB 4RCAA 3V9FA 4Z7VB 3EO1A 1Y6NR 5MENE 2VLJE 4J3OC 3STZA 4QHKI 5JR1L 1OAUL 2VTFA 3KPMA 3WFEL 5C0DB 3OKMB 2VR9A 5HYSG 3DARA 4H0IA 4G5ZL 4LNVA 1NFIB 4DVBA 3C5JA 3VFGL 1AY1L 3D85A 4HH8A 1WZ1L 4JFEE 1PQZB 4EEEA 5I1HH 1PX4A 1GXEA 3STZB 1HKFA 5D1XB 1Q0XH 4N9GA 1LK3L 3IF1A 1MCOH 2ATPB 2Z93A 4B50A 3VWJA 3PWPD 3UTQB 3CUPB 3SDXA 1KJ3H 2ZOLB 1D9KA 1JWSB 1KT2A 2P5WA 2H26B 2UY7A 1L7TL 3IDJB 2A9MH 5EC1B 3TH3T 4HIHA 5KSAA 2H8PB 4POZC 5IW6B 2BXZA 4LARH 2X9XA 3L3HA 4MS8C 2PYFB 3LN5A 4KJPD 5DJ2A 5ELIA 4PRIE 1S5HA 1JTTA 4GBXD 4ENED 2J8OA 2XWTA 1ADQH 4XP1L 3HS0B 5JDSB 5JIIA 1ED3A 2UZIL 4UV4L 1I3RA 3KPRA 4R4FL 4L1HA 3BIAX 5GS0H 4LCWA 2V5SA 3SO5A 2NR6D 4KTEL 5KTEH 1N6QL 1RIUL 4HJGA 2XTLA 3NFNB 3S37X 2WK2A 3OAZK 4E41D 1W8OA 2IH3A 1Q94A 1T89A 3VWKB 2DTML 1XF2B 4Q6YA 3CK0L 4ONGL 1HHJA 1KIUA 3OKKA 4OSUL 3GMMA 4P48A 4B0MM 4P2RD 2AXFB 3KG5A 5LG1A 1TPXB 4MJ5A 1JIBA 1EHLH 3UTSA 3VWJB 4PJDB 3QUZC 4K3JL 1IEAA 3EJYD 4LQFL 4UQ3B 2O61A 3FFCE 2B5IB 1I7UB 4IRJD 4MWFB 3GKWL 3TEUA 4X8JB 5MP6L 3SDCC 1QG3A 5HI3C 3MV8A 4NC0B 4Q0XH 1WBYA 5SWSE 3ULUL 4OF7A 3DSFL 3QH3A 5E8NB 4UT7H 4L4TE 3W9DA 1F97A 5HGAA 3G5ZB 4UV7H 3DVGA 3HR5B 5JZ7D 3IJSB 4QY8A 5B39A 3VXRD 4JB9H 3EO1B 3O3EB 2W0PA 4Q9BA 1EFXA 4RMRA 5BW7A 5D2LA 4ZOAA 3RDTA 2CKBA 1A7QL 4KMTH 4Z0XA 5J6GB 2GTWA 5CILL 4PJFA 1TIUA 3MJ9H 4L4VE 4NQSB 4XBEL 1RK1A 3VWKA 3T2QA 5CJXC 1YQVH 2DN7A 5I75B 3VFSB 4HG4K 2R1YB 4X6BA 4OKVB 5D9SB 2D9CA 2PETA 2YPVH 5HPMB 4OV5A 5IMLB 4NQCE 5L7XL 4YXHL 4G42A 1HHKB 5HYJD 5HI5D 4OCWL 4YHKL 2HT2D 4R4BA 1NGYA 3OMZA 4N5EC 5T1KB 5IMMB 4O51B 4OAWA 2BY3A 3BESR 3UC0H 3L5XH 5GGSB 5ISZB 3MLUH 5F6HJ 4RDQF 2PXYB 2W9EL 4NC1C 3LB6C 1EHLL 2OS7A 3BGAA 1EDQA 2H8PA 3ABZA 1DBAH 1YUHA 1KEML 4P59H 5IB5B 3MRRA 4JPVL 5A16B 4BZ2L 2I9LB 2P5WD 3SDXB 4DKAA 1CFNA 2J2ZA 2X40A 4PJ7F 5HHVL 1KELL 5D1XA 5CCKL 1U8NA 2VAAA 4CBPA 1PQZA 4O4YH 5F7NC 1FORL 2P8PA 3QNXA 5E6ID 4DZ8B 1KB5H 2J88H 3JVGA 2EDHA 4KK8D 4WFHD 5D7IF 4WW2A 3OKMA 1HNFA 3JV6A 3OX8A 3IRZA 2XKNA 1IQWL 2VNCA 2XXMB 5GS0C 3BKCH 2FRGP 1BOGA 2HLFD 2XXCB 3GSUB 3I75A 3MRBB 5FYKH 4AY0A 4HUXA 4JFHD 4JFDD 5BS0B 3QHFL 1KN4H 3T0BA 3PWNA 4WWKA 2A9ML 3RUGE 1DLHA 3AU1A 3MV9E 2H6PA 3K2UH 1AC0A 3ZHLA 3RNKA 3ZKXC 1QSFB 2DLFL 3F7YB 4HK0A 2WBKA 2BCKB 2DF3A 1HHHA 2ZUUA 4XCYB 5DUBA 3DUSA 1YA5A 3I3EA 2VXTL 3IS1X 4NZUL 1OW0A 4RDQG 5ICXA 4PJCF 1X9QA 1KJVB 4P2QD 3GNMH 3DO3A 1EVUA 2VE6B 4TULH 3LS5L 4UNUA 4P4KB 4DW2H 5IGXL 3BDYH 4CKVX 3UMTA 3OXSA 1RVFL 3N0PB 2R0WH 3PWVA 4ODSL 1T7VA 3MJ6A 5FGCE 5C0CD 3TYGL 3QNZB 2DWDA 1YQ2A 1ONQA 4B41A 4HIHB 1M05B 3MCKB 3EOBB 3KHQA 1SY6L 2CSPA 2ZJSL 2VLKD 3VFUB 1D6VH 3ARGD 4KI5C 4PGZA 2VQTA 2BNUB 3O8XD 4TTDC 3WO4C 2XZCL 5GGVY 1WAAA 2IPKA 3H3PH 3G9AB 5TQ2H 5BJTA 4OZFB 1TCRB 1T1YA 1IAOA 1INQA 3MRQB 2VXSH 1UM6H 2EKSA 1T5WB 5FECA 4MJIA 3MZTA 3BD3A 2VKXA 4Q9RH 4UTBH 4XZUB 4HWNA 4HLJA 4DVBB 1AXIB 5CBEA 1RHFA 4ELKA 1FYTA 2ITCA 2C1OB 2JJSA 2VLKB 4L4JA 1F8TL 5D7LA 3U7YH 3QB7C 1GC1L 4UBDC 1PLGL 1RZKH 3VXQB 4U6TA 1KB9J 4HKXB 2VH5H 4QHUB 2ITDA 5D1XC 1M6OA 3OJDA 1S7UB 3R8QA 2MPAH 1RD6A 3GB7B 4JE4B 5F1SA 3T8XA 3BIKA 4NKOA 1IAKB 4X0KB 1J0YA 1OGAA 2IPKB 5EB9A 3ULSB 4Y8AA 4F2MA 3QHZH 4JR9H 5TH2B 1S78D 2X1OA 5KVEL 1ZS8A 4KUCF 2VC2L 3MRRB 2AQ1A 2VIRA 5E9DE 2FIRT 2NX5B 5HHOA 3VXMD 1T5XB 1G7HB 1HH9B 1JF5A 3BDXA 5I0ZA 4HBCH 3F6IA 3HPLA 5LGHH 4PB0H 3UBXG 3CFIC 3QWQB 4LL9A 2F19H 4PRPE 3S4SG 2BVUA 1K6QH 2AVGA 2V2TB 4G6AD 2AEPL 5ANMB 3NBNA 2WNGA 4MMZC 3RL1A 4JFFE 3VFVA 2NY4B 1RJYA 1MCPL 1YEJH 4MA7H 1KN2L 4LVHB 3BPCB 3WS6A 1TETL 4L9LC 1AKJA 3O9WB 3MBEA 4AJ0A 3CGTA 3GI8H 2WM0A 4GKNB 1B6UA 4NKMB 3WFHB 4FFYH 1VENA 4OJFL 3OF6D 3IDYB 4K71C 4YDKL 1J11A 4YEEA 3NH7H 4XCYA 5INCA 5EU3A 5HGDA 1J5OH 4EN3C 5KJRH 5TDNA 1Z9SA 1HQRB 3EGSB 3LPFA 35C8L 5TF1H 2OR9H 5CJQH 1QO3A 3MODL 4QNPF 3SDAA 4Y19B 4OI8A 4LVOC 3VD7A 2FB4L 3D48R 3WIHL 2YPKB 5FGBA 2B1HH 4ZUTB 4C56E 1TJIL 2ATKB 3TBYB 3IJSA 1HILA 5DLMH 3V5DA 1JV5B 1ZWIB 3U30C 2C3WA 3DVGB 3HR5A 4OLUL 4JFYB 1KG0A 1LEIA 3D85D 5DRXB 2Q3ZA 2W60A 3C2AL 1OGAE 2VO5A 1MHHA 3B2VH 5M7QA 1VGEH 5HI4C 4FFVC 2BNQA 5CEXA 2B2XH 3NCYS 1PVHA 4RAUB 2J12B 3HMWH 4M7ZB 5GRJH 3QRFM 4LEOA 2YD7A 3PHOA 2OSLA 4FG6D 2YA1A 1XH3A 2V2XA 2D0FA 1JRHI 4CNIA 1K4CA 3EJZC 4D9LL 4YDJB 5D5ME 2B1AH 4MJ5B 1A6ZB 3NZ8A 5DJYB 4CU6A 1S9WA 1G9MH 2ADFH 4M7ZC 4C55A 1AD9B 3PV6A 4G7VH 3P4NA 3E6HB 3UEZA 3NIFE 4XP9L 2I5YH 2FECI 1UKTA 4JDZB 4NO0D 3NCMA 4JFXB 1A3RH 1AHWA 4F57H 5EUOB 1PG7W 2NY0D 3OKEA 4K23L 2Y23A 5B8CC 4G7YL 4XBPB 2A1WH 5KSBF 1IKFH 4XP4H 5ESQB 4GQPH 4ONOA 5IVZA 3ARGB 5F9AC 5FM5M 3GSXB 1MREL 3TIDA 3E6FA 4NUGL 1CE6B 2AJUL 2R1YA 1OP3K 2H2SD 4OD2B 1LDSA 1N8ZA 1BFTA 3K81A 4KDTA 4NQSA 4NQVB 4PRNB 3X12A 1JPST 1UZ8B 2XWBA 3B43A 5ID0B 3IFPA 1FZJB 4UOW0 3MBEC 1RAMA 1JJUA 4LSQL 4H5SA 5FF6B 4JREC 5HHQA 4HG4J 1W0YT 3RKDC 2H32H 4I18B 3BWAB 4I77H 3WKMH 2J1KA 1S7XB 5IB3A 1NGXA 4Z7OF 4OZGF 2EYSA 4GAJL 4QT5B 5IB1B 5E7BA 3NCCB 4X9IA 3FO0L 5EUKA 2DD8H 3H9YA 4KKBD 1GH7A 2D7QA 2CO6B 4MXWL 3EDEA 4IRSD 4LHJB 1MRFL 2NY2C 4HT1H 5CZXD 4LIQL 5BRZB 1XGUB 4UMGA 1P1ZB 3VA6A 2G2RB 4CU8A 1UH4A 1MHCA 4ODUA 4WNQA 1WF5A 2HWZH 43CAB 5GISL 5I1IH 4DUVA 4I0CC 3DBXB 3L5HA 3L3OA 4L8CA 1IZKA 1MY7A 4FQPA 2CIIA 3OKKB 2YSSB 5KVFL 2VC2H 5DI8B 4BQBA 4NN5B 3QI9D 2FJGA 2JELH 4X6FB 4BFGA 3MRJB 1HHGB 1BD2A 4F8QA 3TBTB 3JSSA 4JO2L 4DGVL 1MCLA 2NY3D 1YEDA 3DV6B 1GJIA 2DMBA 3JWOL 5I30H 1PG7H 4Z95L 5IEHA 1LD9A 3VU2A 4LMQI 5FYJE 1V8HA 4YBLC 2GJZA 5J6HA 4LLUA 2GT9B 4JFFB 4QRQA 3DSNA 2ZOKA 5CAYB 3ZO0A 3V79C 1QR1A 4I3GA 5HHOD 2AV1A 2NR6C 1SJEA 3CFCH 3QIWA 1XGRA 1X4ZA 4U1GB 5FV1L 5K93A 3UTTB 5D5MF 4MNQA 4X4ME 1JUFA 4U1SB 1S3KH 5ENWA 3P73A 3QQNA 3QEUA 1MFNA 2BRRH 1Q0YL 3DVNA 1BF8A 3BGFC 1FVEB 5ETUB 4G8IA 4Q2ZB 4H0GA 4EDWL 5EC1A 3UZQA 3VRJB 2CLRA 2NY1D 1CGYA 3KXFB 2BVTA 1V3LA 5DYOB 1P7HL 3RZCD 3O3BB 5D2NC 1XF5A 3UBXI 5FO9B 2I26N 4POZD 5IFJB 3RTQD 2BHYA 2OMBA 2O5YH 2IADB 3D69B 2FLBT 3QJFA 4JFZL 3VJ6B 2GYSA 5J7CC 4WU7B 1Y0LB 5LWYL 3Q5YA 2EDDA 3OKDA 2KL6A 2CRIA 4ZFZB 4KZEH 1FCGA 1ZSDB 3DVNB 3VD3A 1BF2A 3GJEB 3WNOA 3FCTA 3PHQA 4NWUL 4TUOA 4Y5YB 3O4LB 3VI3F 3WNNA 1A0QL 2G5BB 2QHRL 4RWYH 1I1AA 1JN6A 4OUUA 4QRRA 1MCWM 1V7ML 1TFHA 3E3QE 4EDWH 4GG6F 3IDXL 4XXDB 3RWGA 1ZT1A 1FZMB 2R0KH 4K94L 5B4MD 3SDXF 1BQHA 2D7TH 3PL6D 1A9EA 2BRRL 4ZTPH 1CDJA 1YEDB 2NW2B 3U0PA 1A4KB 1IEBB 3ULVL 1QSFE 2XOTA 4H1LG 2R1XB 4X9BA 3NFPA 4K55A 4K94C 1X6LA 2LQRA 1TTUA 4FQ2L 3SGEI 4XI5C 4N90D 5C0CA 4WFED 3ARQA 4KJYB 2R2BA 3KPRD 1PG7L 3TNMB 4P5KB 5HDQH 1JZ8A 1QUNA 5J13C 4N68A 5GJSL 1I7RB 2E3VA 4FQ1H 1U41A 3GO1H 3WUWG 2WINA 4M43L 4NO2B 3BO8B 3VFRA 3KAAA 2D7NA 5HSFA 1FSKC 2RB8A 5ESAA 1TVHB 1JPGB 5GGQL 4LU5H 1N2RB 5C0CE 2PCPA 3EYOA 3V7AE 4FQLH 1J8HE 3O6FA 5GGVH 4XMKL 1PYWA 3VGHA 5FO8B 1HXMB 1YN7A 4YFLF 5IM7B 3TNNA 4YAQA 3ZT7A 1YJDL 2JJUA 4HFWB 5I74B 1DBBH 3A6OA 1Q9OB 1RZKC 3TO4D 3WIHA 5KSBA 5I16B 5CEZE 2CUIA 2XQBH 3ESVF 1DQQB 1OQOA 4WWKC 4XX1E 3UTZA 2OM5A 1T20A 4JFOA 5E9DA 2GFBA 3MXVH 3GMOB 3O9WC 1N0LA 2JJVA 1UZ6E 1DBKL 5ABDE 5JOFB 1GAFH 1U2CA 1KFAH 4XPFL 3MR9A 3P4LA 4JR9L 4EI5D 5KVEH 2EE3A 1KNOA 1NCWH 1MIMH 3GSWB 3O0RL 3KLAB 2MJWA 2PO6D 3QXUA 2RGSA 1A6TB 1HDMA 3GUTA 4RMTA 4KRNA 4MCZB 1K8IB 3KYKH 4JFDB 3Q0HA 1LO2H 4YUEL 2VDOH 1F58H 5A2KH 1HINH 5MHSD 1OTSD 4R8WH 1BVKB 4K7FA 5DA0B 1A6ZA 5A43C 4K23H 4NNXB 1KCSH 5CEYA 2VUYA 3QUZB 2F53A 1B9ZA 1HE7A 1NQBA 4D0CB 5EBMB 1WISA 4DZBA 5F3BB 3HE7D 3ES6B 2F53D 1A8JH 5JNYB 1A6UH 4JN1L 4X7FC 4WW1B 5D6CA 5EBLA 3L5WA 1R3LA 4G8EA 5HY9B 2NY0C 2HFFA 5FV2A 4WIQA 3MRHB 4BFIA 2R9HC 1SY6H 1T66D 3EZJB 3UTTD 3MLXH 3BE1L 4L4TB 1IGJB 2BXYA 1GGCH 2DMCA 5FA3B 3U4AA 5TE7H 1IKFL 3P9LA 4G80B 1ZHLA 1MCIA 1KB5A 2EE6A 4OD3L 1XF3A 1MCHA 2XNAB 3MV7E 5DURD 1MRDL 1MAML 3MREA 2FSEB 3BN9D 1KXVC 4F58L 3FQNA 3O41A 3QUML 5KVDH 4R0LA 3BKJL 4WW1A 3I6GB 5C0BD 2XQYG 1JYXA 1XR9A 5CIPB 3S36X 1YEIH 2F58H 4GKZB 5LXGH 5C0BA 1NMCB 5FCUH 2YEZA 4LLVA 3UP1A 1YMMD 4DKFL 2B1AL 3C09B 1S78C 5TDPB 4M5ZL 3BAEH 3DV4B 1P6FA 5KW9L 1P4IH 2Y4SA 5C0AB 1T1XB 5BVJA 5GGRB 2QSTA 5CP7B 4J6RH 1JPTL 3EDKA 3FHQA 1N59B 3BEWB 5EU5A 4L3CA 4EN3A 5J12C 5J1TC 1HKLL 5D96C 5K9OA 5FO7B 2NW2A 3U0PB 2VIRB 3BUTA 5F93C 4J3WA 1T1XA 4U4BA 1XT5A 3OHXA 3ZHDA 1KF9B 2O5YL 3R06B 1H3PH 3O3AB 3KDMB 4K7PH 4FS0A 3JWOC 5JORA 3LPGA 4M3JA 5D1ZD 4GKZA 1JN6B 1AFVH 4OUUB 2IANB 2D03H 5JPMB 1A6VH 4FXKA 4JANA 4HHAB 5F21B 1CFBA 3P4MA 35C8H 3ZE2E 1U8QA 3X17A 2W65A 4R0LB 2N7BA 4G6MH 4P57A 2P4AB 5C09E 1SYSA 2CUMA 2ZCKH 4MMXC 4X9GA 4XPBL 3S6CA 1FBIL 4LP5A 4IHOB 4MD4A 3WHE1 3WNPA 5L2KB 3NN8B 2HA1A 4U6XB 2GSIB 5D7JD 4CVUA 2BOBA 2VH5L 4U6VL 5AYUH 2NY5C 3UAJD 1T89C 1T0MB 3F7PC 4JO2H 1SJHA 4M00A 2O5ZH 1FNHA 4EKXA 1M71A 5IVXB 4MA1B 5EOQL 2J6EL 4Y19E 4WWID 3VXNA 2NY4D 5TPWH 1MCDA 1I7RA 2X1WL 1ORQA 4WHTA 1KCUL 5I73C 1Z5LB 4GQ9H 3ZTJG 5I9QC 4UINH 3PE9A 3NAAL 5D8JH 4OFVA 4EVNB 4QLRA 5LCVH 5I1DA 4RGNC 3MGAA 1S7QA 4UUJA 4R9HA 4R7NA 3O6FC 3L95A 2DBLL 1A6TA 3WFZA 4OTXH 2ED9A 2DQEH 1IC7H 5KS9B 1SMOA 4M48L 1TVDA 4RNRB 3DRQA 4M7KL 3K8LA 5F3HB 4DTGL 4PJ8A 5T1DH 3FMGH 3QEGH 1QBLL 4X6DA 2EYRA 3U0WL 3O45A 3GMQA 1MJ8L 3T2PA 3D0LA 2CLVA 1CK0H 3S3PA 3O4LA 2YRPA 1RIHH 4PP2B 3NGBB 4HQQL 3QFJA 3LDBB 5IKCA 1YNTB 1NUNB 4PGJA 2UVEA 4MDIA 3UTSE 4YXLL 5BMFH 1OSPL 4H1LA 4J8RA 1AXSA 1C12B 3QQ9D 4OCXL 4OLVL 3UDWC 3VXNB 4YHZH 3KYOA 5L2KE 2AJUH 3I3BA 3X3GH 2IF7A 3F7QA 4R26L 3WDHA 4YAQB 3S35L 5HBBA 2P8PB 2JK5B 2VLJA 1AR1D 4DEPC 2VAAB 4FZ8H 3N50A 2R0ZL 4GG6A 4EUPH 3D18A 4L5FH 3JTSA 4U6XA 4KMQA 3U36A 2WQRA 4CN1A 1F02I 3MRKA 4A6YB 4I18A 4S2SB 4WGWB 1AFVL 2WW8A 3MRFA 4K3EL 4X6DF 4ZAKB 1KEGH 3KPRE 5FOJA 3IGAA 1SYSB 2Y72A 2VQ1B 4YIQB 4CW1A 3DLQR 4LPTA 1OAXH 5SWQA 3UJTL 2HT4D 3U4BL 4GS7C 3RVUD 1OPGL 3RVXD 5ERWA 1DN0A 4BH7B 3SKNA 3ARGA 4AENA 2ERJB 2QQNH 4LLQA 3CFEB 3HMWL 4O00A 2BY2A 2B2XL 3SKMB 5GS0D 1ZHKA 1NLDL 3R0NA 5F7EH 5FYKL 5HPMA 1F3DH 4W81A 4BZ1L 3W0WB 1DBMH 4M8QB 4WJ5B 2B4CH 3BT2H 1I1YA 1F4YL 1IQWH 1RUPL 4BQ8A 3QA3B 5E94B 3S37L 3L5XL 2FJGB 1LO0L 4X6FA 5F6IC 3SKMA 4BYHA 4RFEA 3VRIB 1XGPA 1KIQB 2G9HB 1AGDB 3L3GA 2EXWC 1I1AB 4WUUA 3MXWH 3LQAC 4KDWA 3QDJB 3ARBA 1KIPA 4OCYH 5TQ0H 3UYRH 2R0ZH 3VXMA 5EIIA 15C8H 1XH3B 1KLGB 1HIML 4OCLC 5EZLB 4HLZH 3IYLW 5E2UL 2DBLH 4FFVD 5CHNA 5AEAA 1CDCA 3T0ED 3WEXB 5DURB 4XNUH 2ARJB 4JAMA 5CD5C 3TVMA 4PJ8D 2W59A 3FT3B 1PZ5B 1DBKH 4BSVA 3EOTH 4YWGH 3ZL4L 4KI5E 5FO9A 3ZDYF 3D3VE 1DZBA 1J10A 2EDJA 4QRTA 1GOGA 5A40E 3E0GA 2IAMA 2WAHA 4LSUH 5CFHA 5ISZD 5IHUL 1BECA 1F6AB 4X4MA 1NFKA 3QXVA 5EWIH 2PYEA 5J12B 5GRXG 4YWGL 1F58L 4RMWA 4OD2A 3B2UC 2AKRA 3M1BB 5FGRA 5ICYB 3TYFB 4EJ1C 1CYGA 5LJYH 1U93B 3QQ9C 2BNRE 2AV1B 4JY5L 5C09B 1KJ2B 4P0DA 1CXEA 4ZS6C 2GTZA 3ZKQD 5IJKA 1E28B 1UM5H 5D93C 2YD2A 4R7DA 3DRQB 2Q7NA 4NQDA 2WLZA 1S9VB 1A6PA 4JFPA 3CMGA 3DV6A 4WDIB 2BVQA 3FRUA 3S97C 3SPVB 4PJHA 1CGUA 3IU3B 1A9BB 1RIVL 3WUWB 1OGTA 4NSKB 5IG7A 3IFNH 3VFNA 1N6QH 4YPGA 4OI7A 4XCEA 4M62H 4YDLC 1X5HA 2NX5A 1PAMA 1R5IB 1T1ZA 4GW1A 2G5RA 1CQKA 3IDJA 1INEH 1VESA 1YC8A 3LKRB 4OZGA 3AXLB 1SEBB 4PUBL 3P0YH 1Q9KB 3KPSB 1YJDH 4X0KA 1EO8L 2B39A 4JM2B 4FQ2H 4ZQKA 4U7KA 5BRZA 2UY6A 1NL0H 3DHJA 5GGTL 1NLDH 5GGVL 1RU9L 2YD1A 4UIMA 1OP9A 1JPTH 4Z7UF 2EDWA 1DE4B 3CPLB 4MDJA 2I9TB 1D6EA 1L6XA 4C58B 3KPOB 3MREB 1ES0B 1Z9OA 2R2HB 5CP3A 4KGJA 1JV5A 4CRPA 4M1DL 5CD3B 2XA8H 1FAKT 3BZ4B 4HV8B 3CX5K 2Z8VC 3ZMRA 3G5XA 3F62A 3KPQA 4FQ1L 4O2CA 3VXUD 2FJFA 4NNYA 3SDAB 4DOHB 4HXBH 4JG0L 2UZIH 4C56A 4PJCE 4PJ8C 1BVZA 5J3HD 4RMSA 4NN7B 3CXHJ 2HFFB 3K8MA 3L5WB 4UB0H 5CJXA 5C0AD 2A74A 3QIUD 4WO4D 5C7XL 3VD5A 3GSXA 2EIEA 4FZ8L 1MFBH 3WFHA 5LWYH 1J88A 3NTCH 3IFOA 2OTUB 4JPWL 5JORB 4L3EA 2Q3AA 4L8SC 1NBYB 3VRLE 1JGDB 4CADA 4HWBA 2BSTB 2R2BB 2Q8AH 1FNEA 3W5NA 4PTUB 5CKGA 1JZ4A 4N0FA 4AM0B 2BY0A 1WIUA 3ZTJH 1V7MH 3NGBC 3UBXA 3L7FB 4X6CF 3HPLB 5IR1B 3LKNA 1R24A 2YXMA 4GMTH 3N06B 5L2KD 1G9NL 1RUAL 3I6LE 3HNTL 1DDHA 4R96A 5E2WL 3WV0A 3LHPL 4RGMB 1PD6A 4YX2H 2Z92A 3H0TA 3VI3E 5TDPA 5E8DL 5JW5A 4WEBL 4N0CC 4F7PB 2K9UA 1JGUL 4Y4KA 4U3XA 4O9HL 3FT2B 1C5DA 3CFDA 3O6ML 1S7UA 1ZHNB 4U6HA 4BQCA 4Y5YA 4C59B 4L8BB 5DD6A 2N7AA 4RFNB 4NT6A 4AT6B 5HYFA 4J4PC 5IROA 5DK0A 3MJ7B 1YYLH 2WIMA 4JO3L 4LPCA 5D8JL 1MY5A 1H0DA 2XWJA 3TBWA 3KNBA 4E41B 1MNUH 4TRPH 4DOHE 1VB9A 1KFAL 2IAMB 4I2XE 4XPFH 3VE0A 4HX1A 2YPKA 2XQYK 2VXQL 2ZCHL 5FM8A 1AQDA 3TNNB 1WEJL 3QNXB 4ETQA 2F9BT 4FQQB 3CX2A 5ISZE 3BVNB 3QIWD 5K9JH 3IDMA 4IEFB 4YE4L 4NDMA 3CFCL 4KFZC 3L5IA 4R8WL 1EIBA 2BZDA 3WFCH 5IJVA 1JRHL 1E4JA 2A2QT 2J7LA 4V2CB 3OR7B 4MXWH 1ONQB 3O4LE 3BRGC 4GSDL 5CKAA 4LCIL 5CLWA 1JK8A 2FNBA 4PJAA 3DI2B 1CGXA 3HMXL 4FQLL 2VDPL 1G0DA 1HI6B 3ARBB 3HFML 3TBSB 1WCQA 3RL1B 1T3FB 4YDLB 5L8JB 3UTTA 4N8VG 3UXFA 4HC1A 2Y5EA 2CIKA 5E00B 1DUZB 1UKSA 2WP3T 2VISB 3MA7B 2APBA 4KAQH 4L4VD 2D03L 5IF0A 2NQCA 4P46A 4DFHA 3ULVD 2YK1L 4Z77A 5DUBB 5HVWA 3O6FD 3RGVC 1MREH 4NZRH 1T22A 4BKLB 4XVUD 3HE7C 4RGND 1XIWB 5C0GB 4U31A 4XC3L 3O3UN 1LILA 4KKAD 2DD8L 3G6DL 1AR2A 1BJ8A 4LVNB 4JY6B 4XWOC 3C8DA 4E5XA 2NY5H 4FTVE 1YYMH 3FAXA 3N85L 3QAZB 5ERWB 1T0NA 3UTZB 5I8EA 3OKOB 1F4WL 3GSUA 3I75B 3HE7B 4TVPD 4NHCL 4XXCA 3VGBA 4I77L 3WKML 2VWEC 4Y0GA 4GRLC 3PG2A 5I1AB 1QTYT 4LCCC 4CW1B 4F8TA 5DO2C 1VDGA 4GBXA 4RX4D 5E8OB 4ZAKA 4OCSL 4FQCH 3EO0A 4PY7B 1IGTB 3WLWD 1ZT4A 2F8OA 1KTDB 4O5LH 3SDAC 3RI5K 4DGIH 5C9JA 5FYLD 1M7IB 3QUYB 2OL3A 2NY6B 2BMKB 4FHBD 1AJ7H 1A14H 5F9OH 1TJHL 5ID1A 3RIFK 2OCFD 1IJ9A 1ZV5A 1GIGL 2NYYD 2PF6A 4MVBD 3SGJA 2SEBA 4BUHA 3V6FB 4XPAL 4WCYL 3QFJB 1F3RB 3FO9B 5D7IA 3E6FB 1FE8L 3WXWH 1GHFL 4XPHH 4Z76A 3ULVF 4LSRL 4UAOC 1QSZA 3HUJB 4UI2A 1I8LA 3ILPB 2LU7A 4PJXE 3I2CH 1A6AA 1T4KA 5DMGC 1JCKA 1KJMA 1LD9B 4QCIB 1S5HB 5E5MB 3WFBH 1N26A 5D1QC 3QULA 1BQLH 3L95B 4XXDA 3RWGB 1S3KL 1FNSH 1B90A 3PV6B 4RFNC 4ZD3H 2BK8A 3KS0J 1TZHA 1KPUB 1NDMA 2VDOL 2DICA 4MZ2A 4OGYH 3VW3L 1AQKH 4U1HA 2Y36H 4HH9B 5C0EB 4M6NL 4CNIB 1UWXH 2VLLB 5EUOF 4GLRI 4F15B 3OAYK 4XX1G 1UWEL 3PQYB 2V5RA 1UFUA 2VUOA 3LKQA 3KHOA 2YPLA 1M71B 3IFNL 5IVXA 3B5HA 1ZVHA 3OKDB 4F9PC 4P2QE 3ULUD 5D1ZA 2IAND 4DZ8A 2XTJB 2VZTA 1DQML 5C0DA 3QJFB 3HB3D 3CSYA 4QNPE 1I7UA 2BOBB 3BP6B 3P0VL 3U79A 2ED8A 3TBYA 3CVIH 5SWSA 4CJ1A 3LKPA 3QFDA 5FDWB 2X2YA 1WT5C 4HT1L 2YMXL 4MA7L 3SKJL 3OPZH 4CMMA 2DQUL 2V7NA 5EWIL 3S5LG 4P9HC 4PJDF 3QULB 5JQ6L 1KYOJ 3SCMD 1FYHB 3LN4B 2Y5TB 3AGVA 4JANB 4M7JH 1U8IB 2I07A 4QYOB 5EIQA 1ZT7B 2G75B 3KJ6L 4DGYL 1NGPH 4K8RD 4NQEA 3KDMA 2ADJB 3V4VH 1JNJA 2W9LA 2O93L 3WXVL 2XPGA 1FO0H 2CK2A 4JFXA 3MV7B 4NQUA 3L3DB 2PYFA 2F54B 1E4KC 2C3HA 4D2NA 4XAWH 1MRFH 3WUZA 2K1MA 4CMMB 5T1LB 5DS8B 1Q1JH 1UT9A 3EFDH 1J0KA 1S9WB 4I0PD 1T21B 1NCBH 2MFNA 4D9RD 4XNXH 4U1MA 3QUYA 5DJDB 1FDLL 3TH2T 2HP4A 1KCKA 3T1FB 1MCCA 1U36A 5D7KE 3B8YA 5J89A 4KH2A 2QSCH 3KYMB 4Q9RL 3B9DA 1QRKA 2PXYD 4RAUA 2J5LB 3GNML 4PJAF 5KOVC 3TCXA 3GFUA 1DUYA 1Q8MA 5F9JA 1QRNB 1JHKL 25C8L 4PJBF 3WO3B 1FZOA 2GI7A 3EYQD 3MV8B 1DBML 3HC4L 2X9WA 4WUKH 4NO5A 5I1AA 5MEQA 4JFYA 2DQHH 3VH8A 2PN5A 4NQXB 4JFFD 2KQMA 2XN9B 4YQXH 4HD9A 2PW1B 1FRGL 2VLLA 2EXYD 4G80A 4OCNC 1AGBB 3EYVB 4JZJA 1WT5A 4PJ5D 1RVFH 4ZUUA 5CBAB 5ITFB 5ALCL 1GZQA 2Y25A 4G6JH 1PJ9A 4JFZH 1YNKH 1R3IL 1RK0A 4X7TB 1K85A 4W6XB 3QDME 1FRGH 3MJ8B 2RQ8A 1H3UA 2CJUL 4JM2F 3VXUE 3MRCA 3ROOB 3MZGB 3SOBH 4JY4B 4RZCB 4E42B 4K3EH 4LCWB 1A6AB 1T4KB 4M9PA 1FORH 1I9RL 2AEWA 4H88H 1AKJB 4L8SA 3F7VA 2BP3A 3T0EC 2NY4C 1LHZA 3NA9L 4NCDA 4H26B 4RMUA 1QHPA 4OIIL 1VPOH 1BMGA 3PWJB 1PSKL 2GSGB 2HH0L 4LCYB 3MV8D 4HFUH 1IKNC 3QHFH 1JVKA 5CP3H 1M1SA 1TLKA 4XBGA 1EGJL 2DQFA 3CSBA 4OJFH 5BQ7A 3SDXE 4YHZL 4JJ5A 5K9QG 4LPXA 3NVQA 1BVLB 2H26A 2AAVA 4NZRL 1FFOB 1C16A 4BQ6A 3REVB 1CK0L 4IOIB 2X7LB 2ATPA 1I9JL 1KTDA 3P11L 4N9GB 3GIZL 3T8XB 1MCKA 3TJHC 2E9IA 4BK5A 2HFTA 4RWHA 3S34H 5L7XH 2CKNA 2OR9L 4RBPH 2ITDB 2H3NB 1K3ZA 4PJHE 5D7SL 5I73B 3RVTC 2GK2A 2O5XH 1UWGH 4EQ3A 4U1KB 5L9DH 5EORH 1ZWIA 3EOAB 1I8KA 5GISH 3MJ9L 4QOKE 4WW2B 1D5MB 5I8EB 2JCCE 1HSAA 1C5DB 1PKOA 4ZDHB 2EDTA 2ERJC 3UJJL 2A73A 2WUCL 4ETYA 3GJFH 1XIWA 5ANME 4KHXL 1QQDB 4GRLB 4RQQB 5SX4I 4I0PA 3X3FL 4M1CC 3H9ZA 1KULA 4OCWH 1F4XH 4Z77B 5HPOA 1T21A 4RGMC 3VFRB 5LGHL 3HHRB 1QFOA 2AJ3A 3IJHB 1U58A 1OSZA 3DTXA 5DRWB 1WEJH 1CTOA 1V7NH 1WQVT 2UUDH 5H35A 3UBXB 1I85C 2BC4B 3FFCB 4OLWL 1MQKH 2H32A 2ICEB 4XPGL 2LU4A 2MTPA 1EGJA 2FX7L 4ZYKA 3GMNB 3HAEA 1EFXD 1T5XA 3O6MH 1IE5A 4A6YH 2ZUYA 3RFZC 3HCVA 1A21A 1WSST 2P8LA 2BSSA 3SDDD 1PLGH 1JBJA 1FNSL 5IMOB 1FZMA 1LO4L 5T3XD 1S9YA 3T0XA 4UOW1 3VMOA 1Q9LA 1T7ZA 2LVCA 2VDMH 1HZHL 5T3XL 1S8DA 4UQ2A 3CCHA 3IVKA 4J3VA 3AS2A 4O2CB 1I7TB 1BBDL 1X7QB 3DMMD 4KVNH 1T1WB 3GMLB 4EXPX 5DO2D 1LP9F 3VE0B 4RX4A 2F53E 2WWMC 4ZTOL 1LVEA 2NY2D 1KOAA 3W9DB 5C0FA 5L2JA 1J87A 2AK4B 2OJZL 3MCLH 3MLYH 4NT6B 3QYCA 3TT3L 1Y0LA 4XVTH 2QQNL 5I1JH 3EFFB 2L0DA 2V5YA 6FABH 3LRSB 4Y88A 3TYGH 4TVPE 4PRHE 1BIHA 2M2DA 1IAOB 4WRLA 3D1MC 5F9DC 1WWWX 2A77L 2Y6SD 1CTNA 2HTKC 1QYGL 3BHBB 3DRTA 3IAQA 1S9XA 7CGTA 1U8PA 1T7XA 4JFQB 1TJIH 5CS7A 3VG9B 4PLJD 3U4EB 4APQC 3WDJA 3TZVD 2X4PA 4I3SH 5H8DA 4XCFH 1IGYA 4WV1C 5BS0D 1Q38A 3HZYA 2C3XA 4C4KO 1DVFD 2DJUA 2IWGA 1WBXA 1A1NA 3L3IA 5T1KA 4TUJA 4HGWB 5DK2B 1RFDH 1XAUA 1VFOA 4MSWB 5GS1B 2GTZB 3VGDA 2EICA 3Q1SL 3DTXB 5DRWA 2FJHA 3TO4A 1OSPH 3X14A 1QZ1A 2YN3A 3LKOB 3QEQA 2F5BH 4L3EE 4OZ4B 1J8HD 4Y16A 3SGKA 2JKXA 4KVNL 1MFCL 2V7NB 1JZ2A 4C56B 2A73B 2F19L 4OLXL 2LE9A 1FL3A 4U2ZA 4KKNA 1HQ4A 4MNGE 4ZS6D 3JTTB 3C6LD 5TE6L 3QUXB 4LCWE 4OKDA 3OR6A 4AMKH 5GZOC 2WBJD 2P5EB 3KPQB 4FP8H 1RULL 3NMEA 4CMHC 5IQ9A 4AIXA 1SHMA 3VXSA 2FBJH 1P1ZA 1EEQA 4S1RH 5HI4D 3TVMB 3EO0B 3H3BC 1NFIA 1MFEL 4XT1C 3O8XA 1A7QH 5IHZA 1WBYB 2NZIA 1GGIL 3KPTA 4I48B 1O0VA 1AO7E 2JB5L 3RX8A 3PWLB 3ARFC 3BISA 5DZLA 1E6JH 3KPSA 3TFKC 3GSQA 2CLZB 4Y5XB 4F33A 5F7DB 4MQSB 4IOIA 5C0EA 1ZLUK 3UTPD 4F7MB 1RZFL 1NGQL 5D71H 2ZP0T 5KOMC 1PKQA 3JTTA 4FMKA 2J6EH 2IG2H 2EIBA 4JY6A 3NPSC 4Y5VB 4WI9A 4LLWB 1DR9A 5IIEA 1XGPB 3FKUS 3FB6A 3VFMB 1UENA 2IEPA 1E4WL 3QDJE 4Y19D 3GRWA 4HMEA 5J1AA 3GKWH 3BI9X 1CGSL 3VFWB 4FXGA 3FZUD 4OAWB 3IJYA 1AH1A 3VXRB 1ZHKB 3WIFB 3MBXL 4KZDH 5ACLA 4NZTL 3HA0A 4LLYB 3HUJA 2IQAB 1OB1B 4TUJB 3EZ8A 5TF0A 3RTQB 1VADA 4Q9QL 1T6VN 5C07D 4NC1E 1IGYB 4UV7L 1OP5K 4IRJB 4AMKL 4M43H 2VN4A 4KTEH 3QWRA 4MAUL 1NCDH 3OZ9H 1OTUD 1R5VA 3TZVA 1EA9C 1FFQA 4R4FH 1XCQB 3DSFH 1U8LA 5T1MB 2P5WB 1NGWB 2VLMD 4NHUB 4OZHF 3BHBA 4HWZA 1S7SB 3BMVA 5DSCA 1EAJA 4PG9A 1ZHBA 4Y8DC 2K7QA 3RGVA 1OM3H 5HYJE 4F7EA 3DX6A 2ZPKL 5CEXB 5BRZE 3UCRA 3OB0H 3ARZA 3QG7L 4DCQB 4JLRA 4OV6F 4OZFH 4P2YA 1ORSB 4HEME 2VL5B 2MHAB 2Y7QB 2AEQL 3RVWD 2DLGA 3LEXA 3LKQB 5DRXA 5CEZL 3DHMA 4IMLA 3QXDA 3T2OA 3P4OB 3IDXH 4ZOCA 4Z8FH 3RVVC 3RDTD 4P3CL 2WWKO 3B83A 4QOKA 4P9MH 4I3SL 2EDYA 1I7TA 1MPAH 1X7QA 5JMOC 4WGVB 3LN9A 4ZOEA 5I8CB 1NDMB 2QEJA 5DUMH 5F7HA 5KSUB 4JG0H 2AGJH 3VRIA 3BKJH 2H2PD 1T22B 4S0TD 3ARGC 2Z31C 3U1SH 4RNRA 3T4AB 5JR1H 2R2EA 2Z0BA 4QRPB 1I1YB 1S7TB 3WS6C 3SDDA 1MLBA 2L4OA 3WN5A 2B5IC 3K4DA 2XYCA 3G6AA 1SBSL 4X4XA 3TCLB 2FR4A 4I4WB 2UWEF 3BUYA 4U3HA 5F1OB 3W2DH 2J5LC 1CR9L 4JFDE 2CRZA 3P2TA 4N0YL 3MRPA 4LSSH 3S88H 3JZ7A 2FL5A 4NOFA 5E99H 4J4PA 1F3JA 4LSPH 3HR6A 4JZNB 3ZYZA 1LO3L 2VQ1A 1Q0YH 4R90L 1NSNH 3OBAA 1H5BC 3SE9L 3FQWA 1K5NA 3OZ9L 4DTGH 4PLNC 3WD5L 4MS8D 1A6WL 2OXHA 3UTQA 4X4ZA 1X3DA 2E8ZA 2YZ8A 2AV7B 1W72L 1KGCE 1IGML 2EO9A 4ZSOB 1M4KA 4G6FD 4PJ5E 3WS3B 3NN8A 4S1QH 1G0YR 5E2TL 2E6QA 4NNYB 4AH2A 1G7IB 4RFOH 4JRYA 3PGCB 4XGZB 1BWMA 2PUQT 3SY0A 4M7LT 4P4RB 1UXWA 2FHFA 1E6OH 1WLHA 5LCVL 1CFTB 4U3CA 1DQDH 5CD3A 4LHUB 5IVOA 3V8CA 1HEZB 4V2BA 2ORBH 4U1KA 2AJXH 3IU4H 3MJ7A 5TE4H 4ELKB 3MLZH 2J4WL 4P46D 3EOYG 3QQ4B 3H9SB 4WV1A 5HVGB 1CIDA 1T0NB 1GPOH 2AQ3A 3I6KB 4DN4H 3NIDE 1TZHB 3BPOC 1SVCP 3QFJE 1Q9LB 4NM4L 3VMNA 3H7BA 1RJZA 2DJ4A 3B2UD 5C8JA 2VDLH 4H25A 3OPZL 1KPRA 2C1PB 2HLAA 4P5TB 4OF5A 5E5MA 3V4UL 1HSBB 3PWPB 3HI1A 1MCJA 1X6NA 5F7LB 5J8OA 1U8OA 3V0WL 3PV7A 4QHMB 4MAYC 1DBJL 5EU5B 3CLEL 2VLRB 1OGTB 1YEHL 3DURA 2E27H 1N5AB 4D3CH 4CGTA 2WBJB 3LSOA 3QPXL 4Q6IA 4RFOL 4JQVC 5FYJL 1BBJA 2IBZX 1RZ8A 1YY8B 5IP4A 3FO9A 5T3ZL 4I2XB 3F7VB 4CJ0A 4AYFA 3AC0A 3S36L 1OW0C 1KJVA 4I9WE 3BH9A 4F37F 3SKUD 4GAYB 4Z7UE 5ID1B 3RJQB 1MHPL 5F7WC 5CSGA 3D39B 2FGWH 1CL7H 1MFCH 2PYEB 4X7TA 1S9KC 4MJID 1T2QH 3LPWA 3VW3H 1Y18B 1J18A 3OKNA 5I8OH 3MFGB 4C54A 3QUKB 5DD1L 5SV3A 2GITA 1KXTB 5HGHB 2HLFC 4NBXB 3RBSA 1BFSA 1UB5B 3FQUB 4JZJB 3G6JA 1AGEA 3WFBL 1LK2A 2IPTH 32C2B 1SBSH 1FGNH 4OZIE 4ZO8A 1BX2A 1CLOH 3LKSA 1BEYL 4M1GH 1F2XK 4XVJL 1WITA 4MZ3A 1NCUA 5DHVA 3V95A 1BQSA 2WIIA 3V8OA 3FQTB 5DJZA 5CHNB 4RWYL 3C60D 2Z4QA 3ARBD 2XRAH 4ZQKB 1ZANH 4PJ7B 1UQSB 4YDIH 3NPSB 3REVA 1G7JB 4NRZA 4PRHB 3RWDB 4LCWD 2KKQA 5FUCE 3ARED 1YUHB 1T1ZB 4O02H 4LKCB 4K9EL 5I75C 2LABA 3ISWA 4ZAKC 1KLFA 3BEWA 2Z31B 1YN6B 4D0DA 3MLXL 3TFKD 4WO4A 4I18C 3QRGH 5KAQG 3QHTC 2E7HA 5C0AA 1CICA 3PWJA 1WC7A 3MJGX 4NQDB 3GRWL 2FB4H 4TN9A 5GZND 2B20A 3TPUB 4KXZH 1GL4B 1YEGL 3CH1B 3MLWL 4TQEH 1IM9B 1TMCB 4KKAC 1FFRA 4I3RL 4UTAL 4X5WB 1OQXA 3RKDD 3S5LA 2AJSL 5C0BE 2KZWA 3H6JA 1WIOA 3BGMA 3CMOH 1RJLA 4MNHA 1WBZB 5INDB 4NPYA 4ZFGH 1JGEB 2ADIA 2H1PH 3JV5A 2NY5L 4WTXA 1GZQB 2CH8A 4OFYA 2DQIL 3MRNA 3D6GA 4FQQA 1UB5A 1AGBA 1S7WB 5JHLH 1ZEAL 2X10A 3IDNA 4NWTH 3D18B 3IB4A 4HXAH 5EZIH 4XWGL 4Y4FA 3SGJC 3O0RH 2ZCLH 3NAAH 4HZLA 4PLJC 1D6EB 2DQDL 5F7YC 3MUHL 1MQKL 2X4OA 4RMQA 5CSZB 2VL4A 5B38G 1NAMA 3S7GA 5F9JB 2YD6A 3QUYD 4L8BA 5DD6B 2Q6WB 2YPLB 2IFFL 1KENL 5GGUA 3OGOE 4HWBL 1ZVSB 2X1XR 3HG1B 2XQBL 4U1IA 4KV5F 5H2BA 1NGQH 4XB8A 1KIRB 5AYUL 4HS3A 2HT4C 5FUCC 3D0LB 3QIBC 1XF1A 3ORJA 4ZSOE 3FO2B 4UNTA 5HDBE 5JW4R 4YPJA 1JPFB 4R96B 1FFPB 1G7QB 4LASH 3WSQL 4X4YB 1VEOA 2DLHA 12E8H 3Q5OA 4PJIE 1A9BA 5BRZD 5AWNL 1HSBA 3VH8G 3GHBL 3TO2B 4YH6A 2X4TB 3KGRA 2YHGA 5IFHL 1XMWA 2FATH 4PJGE 2Z8RA 3LV3B 4WUUD 4YNYB 3UZVB 2ADJA 5JHDE 3W0WE 2UUDK 5DJCB 5C6PB 4GAGL 3WJJA 2A6KA 1C5CL 4XAKD 3I6KA 5DEZA 3S34L 3SO3B 1U8IA 3C60C 3U7AA 4JPKL 1BQHG 4JG1L 1FG9C 2I24N 2NMSA 5DJ8A 3ZTNH 5EZIL 1I1FB 3FCTB 1I9JH 2CR3A 5DHXB 4Z5RA 5CSBA 1II4E 4M61B 2BSED 4JZOA 2F5AH 4PJEA 5HHPA 5KSBB 4PJEF 1QBAA 2CDFA 4A2MA 1TDQA 5IOPA 3G5YB 3O81A 4XXCC 1A7PL 4WI6A 2UWEA 1J86A 2QBWA 3OGCA 1QLEH 3MRFB 3CUPA 5DQDL 1FVDA 1PYWB 4PJ9D 4Z7OE 3MNWA 5JXEA 5T1KD 5BXFA 1PZ5A 2B0SH 2BJMH 3AB0B 4OT1H 4UILL 4QWWC 2Z35B 4UTAH 5EO9B 5KG9B 5EO0B 5L88L 4NQCB 3TN0C 2AQ2A 5FCUL 4LVNC 5F1NA 5IW1B 4G8IB 4WI4A 1NFDB 4JZNA 1AIFA 3SOBL 1F3JB 4XP5L 5IK3A 4P5KA 4OBSA 2ZKHH 5FB8A 2GK0A 3QDMA 1P7KB 3K2UL 3P40A 3T65B 3BYTA 4FQXD 1YNKL 5ALBH 5DHYA 3D87B 4QRUB 3Q6FB 5L8LB 5EU4B 1I4FB 2J6EA 4I4WA 4N1EA 1EBPA 2HRLA 3RWEB 5D6DC 3DETC 5EOCL 3VFNB 3X11B 3MRIA 4MHHG 5DGQA 1EERB 2OJZH 3MCLL 3MLYL 5DRZB 5EH1A 1VFMA 3TO2A 3A6BH 4Z0BH 1OTUC 4JEGB 3C5SA 3NIFF 2B1HL 2AERT 1A3LH 1BQHB 4L3CB 4Z78B 2A38A 4QRPE 2OR7A 1DUZA 2K7PA 2YXFA 1JTOA 4W6YB 5DD5L 4KQ3H 4O58H 1NBZA 4P4KD 5C2UB 3N1PC 4JM2C 4HULB 1HI6A 3TBSA 4YHOH 5H2BB 2BNQD 4N0UE 5D6DA 5AD0A 1KCLA 1ND0A 3W39A 2CDEA 2IMMA 2IQ9L 5D7JC 4HKZA 1RU9H 1P84J 1FAIH 2VDKL 3QR2A 3GI8L 1S7RB 1J8HA 4R3SB 4PJXB 4MX7B 4N0UA 1MJUL 3STBA 4JRXE 1C5BL 3RL2B 3UC0L 4H8WL 3PP4H 4M5YL 2NTFB 1P7QA 1ZTXH 5JIHA 1I75A 1FIEA 4PRPB 3BPLC 4K3HA 1ZHBB 1IQDB 4FFZH 3RIAF 4HCRH 5IMKB 43C9B 4P5TC 2ARJA 4PJCA 2V7HA 4NKIL 2UWEB 4GBXB 3V7MA 4PG2A 5I17A 1PEZA 2GIYA 3MC0A 5DJAB 1A1OB 4F7TB 2E7CA 3W39B 4M61A 2ZCLL 1P9MA 1ND0B 2EC8A 1MJ7L 3VXMB 3HE7A 4G8GE 4QHKJ 4PRDA 2RFXB 3ARDB 2FYYA 3G6JF 4RRPA 5DQJB 4KDTC 4LLYA 1BZ7A 5DD0H 5GGRY 1T03H 1G6RA 4BKLA 1TQBB 2HFGL 4YNYA 1ZLUH 3FONB 4ZFGL 4XMKH 1L0YA 1V05A 2MNUA 3PJSA 4UTBL 4V1DA 4PRPD 3LKNB 4IRJC 2VISA 3MA7A 3S4SB 1M7DA 1S7VA 1IGFH 1S7QB 5DEFA 1GZPA 1UH2A 4YHNB 3SKOB 4UDTA 4TSAL 1UXSA 5HD8D 4BH7A 3N1GC 1BFOB 3M17B 5C07B 5FM4A 2RAMA 4LLMB 2Q20A 1UA6H 1D5BA 5JHLL 4L3EB 5HVFB 2Z4QB 3IFOB 4MJ6B 1LE5B 1NFDA 4FXLA 1EEYB 5E2UH 4GLRH 4BH8A 4F7CA 1VHPA 5E2TH 4MD0A 4YIQA 5IBLC 2Q6WA 4K9EH 4N5UA 5JOPD 2M26A 5CWSB 4KY1L 1CG9B 5EO0A 4NDMB 4QT5A 4JHWH 5IW3A 3ULUE 3U36B 3L3KB 3SE9H 1EEZB 4XWOD 4P2RA 2HH0H 4HW6A 1UB6A 1IC5H 4PJGB 5I1KL 2V2WA 4ETQB 3QUXA 4LF3A 3MLWH 4TQEL 1BIIB 1SYVB 1HQ4B 1FZJA 5HVHC 4NZUH 2ICES 1GOHA 2WMPA 4LSRH 4C83B 3EGSA 1A0QH 4BZ1H 2BY1A 2YR3A 2X89A 4M3KB 1DSFH 1YEEH 2NCMA 3BW9B 3QDGB 3RY6A 3VGEA 8CGTA 1IM3A 1KN4L 3TO4B 1Q9WB 1EJOL 5GQBA 5E2VL 2GAZB 5MI0B 2EH7L 4N8CL 4J1UB 5AZEH 1CE1H 5CGYC 2KH2B 2HKHH 4Y4HA 3RPKA 1MCOL 3O3AA 1AXTL 1CBVH 3OKEB 4KRPD 3UAJC 1Q0XL 4LDEB 4E0RA 1MRCL 2V2TA 2F5AL 2R39A 2HKFL 3LQZB 2WBJA 3LSOB 4DN3H 1WUNT 2OJEB 2EZ0C 3QDMD 3SDCB 4BUGA 1KB5L 3AFLA 4HIEB 5D1ZC 3VFPB 1CCZA 2P45B 3S96B 3DX7B 5E56A 1FIGH 1AD0A 3U4EA 5IHLB 1OVZA 1TTGA 3PWPA 4N90E 4JFQA 4TNWK 5CJQL 5IBUG 4P5MB 1NLBL 2DS4A 2X42A 3O2WL 4N8VA 4N0FB 4AM0A 4ZS7L 3QCVH 1B0RB 3VXOB 3NH7L 1LMKA 4YGAB 5HI3D 5JA8B 2AK4E 1IFHL 3TO4C 2YEZB 2HJFB 2C26A 1IAKA 4JPVH 2V17H 4HWEL 4X98B 2LAAA 3TPKA 2CR6A 2KDGA 3M45A 1MWAL 5KZCD 1VACA 5FUZH 1NCBL 3FQTA 5FYJD 3C5ZD 2DLEA 3DUHA 4O2EB 4TUOB 4QHUA 4HDIA 5GHWH 2BFVH 1EZVY 2OL3L 3QDGA 1T0MA 2QSVA 5C0FB 2VDLL 4NN7C 3MFFA 1HEZA 4ZUSB 1X5IA 3QXAA 5M94B 2P8MB 4PJCB 4QRTB 5T1DL 2VABB 3BP7B 3OWEA 5FGCB 4BA8A 3PGCA 3MACH 4XGZA 4BK4A 3VXSE 3HRPA 4PGEB 4GAGH 4ZXBA 3FQRA 4IS6A 1DLFL 3PP3H 3SDYH 4YO0A 1UYWL 3DMMC 3IAPA 3U2SB 1YNLH 2I25N 3AY4C 4U49A 5DWUL 4PP1C 1I9EA 1M05A 1CXFA 4HUWA 5EZJB 2IGFL 5TFSL 4JRXA 4LIQH 2R4SH 2P44B 3HAEB 3QUYC 1R0AL 5F7KC 3HE6A 2OK0H 5D93B 3NOIA 5ENWB 4K7FB 5CMAB 1UXSB 5CGYD 4EUPA 5FO7A 3JBG7 1R5IA 4GW1B 2DJSA 2UVFA 4U7MA 4XCEB 4R90H 3V2AR 5D72L 3MV8E 3RY5A 1KLUA 4O2FB 4HIEA 7FABL 1YEFL 4YGVA 1IGIH 4LEXH 5CJ8A 1CGTA 1U8JA 1CZ8H 4P46C 5F7MC 4QRPA 3WKNA 2AJVH 1S9VA 4JFPB 5HYEA 3L9RB 2XZCH 3ZSTA 1ZT1B 1MEXH 3F7RA 4HK0B 5HHOE 1UWEH 3RWEA 5JXAH 5JOFA 2ZJSH 3CFEA 3QRGL 1QNZH 5FEBA 5KSUA 1BAFL 1AQKL 4ZPVB 5DQJA 2A6JA 1L6ZA 5F6HI 1U92A 1OLZA 2FBJL 1XR9B 5GGTA 3U7WH 2R4RL 2A1WL 2H1PL 5T1LD 2IFGA 1N3NA 1OAYL 2PO6A 2QQLH 4F7TA 1A1OA 3BDYL 5DDHA 4X5LA 4Z7UA 5GS1C 3FT4B 1NKRA 4QRRD 3LS5H 5K9KA 1LO3H 5F1NB 1UCBL 1BIIA 3V4PH 1CLZH 43C9A 5FHBL 1WVZA 1Q72H 1TZGL 5MERA 3D0VB 2VWEE 2YN5A 3SN6N 3CX5J 4V1DD 1J0IA 2B4CL 5IB3B 1CDBA 3VWKC 1G7PB 4CAGA 1QSVA 2X7LA 4QXGH 5K59E 1UVQA 1IC1A 3RRQA 4N8CH 4MJIE 1FE8H 2BNUA 2Y07L 3RIFF 1FL6A 5D6CB 5EBLB 2DDQH 1FGNL 2PW2B 3ARBC 1JZ5A 4XMPL 2YD9A 3BO8A 5A2IH 1MAJA 3L7EA 4BH8B 4F7CB 5IOPB 1C12A 1P4IL 4HS8L 5EIVA 2W0FB 4HKZB 1X5AA 4XH2A 3VXUB 3NCJL 1V3JA 4FTVD 2QJDA 2OLDA 3FRPG 1RZGA 2NY7H 4JFEA 3T4YA 5I1HL 3O2DL 1BBJB 1ZANL 4HPOL 1SY6A 4IDJL 3RA7L 3V52H 3TVMD 1QR1B 2JJWA 1I3VA 3O2DH 3OKLB 2EH8L 4M6MH 3LV3A 4JQXC 3IJYB 4GUPA 4MYWB 3CVHA 3MODH 3NFSH 4K07A 4MLIA 5BV7L 5IT2L 5MENA 3C6LB 3TBTA 3W0WA 4U2YA 3OB8A 2AS5M 4X4YA 4R7NB 4LDLB 1DEEB 3BD4A 1J7VR 3QDGE 5EBWA 1I3GH 4BZ2H 4Z7VE 3X3GL 4QRUA 1Z3GL 3NA4A 2C5DC 5BS0A 3P9WB 1A3QA 2DMKA 1TETH 3O3EA 5DD1H 2W1NA 3QUXC 2EEDA 2GJ6A 1OTSC 2PW1A 4U0RB 5ADPL 5D7KD 4ODXB 3BZEA 4W4OC 3VH8B 5C1MB 4L3ED 4ZFOB 2VDNH 2W0KA 3CXHK 3HTLX 1ORSA 3PWPE 5FYJU 1SJHB 2HVKA 2XG5A 5JW4N 1MF2L 4OZIB 1PY9A 2WBJC 4AH2B 2X4RB 1KCSL 4A6YA 5D71L 1N64H 4C57C 1K8DB 2ICWA 2XFXB 3H9HB 5EPMB 1F5WA 1E4XL 4GG8B 1S7XA 2CQVA 5F88B 2XZAL 4Q9QH 4X5XB 4Z7QE 1EK3A 3UTSB 3ULUF 2UYLA 4U1MB 4GRMA 5C6WH 1HOCA 1VSCA 1J05A 2XICA 4KZDL 5K9KB 3DGCR 1IGCH 5IB5A 3T3MF 4YFEA 1HNGA 3NZHL 4FQHB 3L1OH 1X5JA 3C60B 4OLWH 5EA0H 2F8VA 1KTKE 4YFDB 3FL7A 4GMSH 1B0GB 2F54E 4HHAA 1V7NL 2YRZA 3B9AA 4X5WA 5EU6D 3H7LA 5EOQH 4NCC2 3TA3D 2A6KB 4NNPH 3BUYB 5T3ZD 3CH1A 4PJ8B 5F97E 3NFPB 4TYUA 5EBGA 3VWJD 5HI5C 5KVMC 3PXHA 4P9HH 1FG2B 2J4WH 3MUGA 3WN5B 3L9RA 5ANMA 4UDUB 4LSPL 5E08H 3HC3L 1UH3A 4P2RE 3HZYB 1HWHB 1MCQA 1FN4B 1KLUB 1YYLL 3L3HB 1GYAA 3GMPB 1GGBH 1QFUL 5C3TA 5BVJB 5J6GA 4WHYH 4NFCA 3PDOB 3TN0D 2CKBB 3BQUB 3OAUL 3QT2A 1QACA 4S1SH 5DRNB 3AMKA 1ZLVH 2J8UE 2CLZA 5FB8B 1MHCB 1W72H 3HG1A 3HPJA 1ZVSA 2YD4A 1FFNB 5C07E 2GQHA 1JGLL 4PY8J 4YX2L 4XNQB 3VXRE 4TPRL 1OARH 3W0WD 1QR4A 1RUAH 4UV4H 3HG1D 1H3VA 5L2JB 1JWUB 3MUZ1 3UTTE 1VFUA 4G6AC 4MWFA 1NCNA 3CFJA 4P3WA 2VXTH 3ZKNC 32C2A 3QDHA 2C1OA 1ZHLB 3P9LB 3A6CL 1TQBC 3FB7B 5DJ0A 1T1WA 2VR4A 3K1KC 2Q8AL 2DLFH 5I71C 4QRPD 3SJVE 5FDYA 2OBGA 3TWCH 1NC4A 3KXFA 4F3FB 1A22B 4XMPH 5HGHA 4ERSL 5D2NA 2FO4A 5LAXA 3ZE1E 2DDQL 2DIAA 4FTVB 4NQVA 2E9WA 5D5MB 4NPYB 4OIIH 1NAMH 2HAZA 1B3JA 4RRPG 1K3IA 4IRJA