4HIHB

Anti-streptococcus pneumoniae 23f fab 023.102 with bound rhamnose.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
203
Chain Sequence
LINLVESGGGVVQPGRSLRLSCAASGFTFSRYGMHWVRQAPGKGLEWVAVVSSDGRTTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVFYCAKEGGDNKFSFDYWGQGTLVTVSSASTKGPSVFPLATAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVQTYTCNVDHKPSNTKVDKTVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab 023.102
publication title Structures of Preferred Human IgV Genes-Based Protective Antibodies Identify How Conserved Residues Contact Diverse Antigens and Assign Source of Specificity to CDR3 Loop Variation.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 203
sequence length 219
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hihB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hihB01
3B2VH 3CXDH 4UINH 4LLMA 1MFAL 3RKDD 1U58B 5FYKD 1L9MA 4LDOB 2QADC 5DT1H 4M5YL 1R3JA 5J12C 3WFHA 2Y7QA 3TGXA 4I3RL 5D71L 5HHNA 1QR1A 4JFEE 1YQVH 5KS9E 1WZLA 3C5ZA 2OM5A 1CD8A 1KJ2A 2ZJSH 4LEXL 1UWGH 3TIDA 2DTMH 1DANU 4LRIC 1NSNL 3QUKB 4JPWH 1J10A 4HPYH 1MI5A 1MY5A 1JPFA 2GJZA 4XVUD 4IMLB 3GJFH 3O3DA 3EFFB 3MV8D 4F15C 1J1XH 3A67L 1CU4L 4OLZH 1ADQA 5C92A 4LQFH 4MNHB 3CFCL 3C9NB 5KVDL 4RIRB 2X4UB 2FD6L 1SY6A 2UY7A 3FCTB 3VD5A 3L3IA 3V7AG 4DUWA 5DJXB 4JQIH 4P4KA 2A9NL 3P73A 1MJ8H 4HLJA 3QEQD 3SDXF 1B0GB 3MBEC 5FHBH 4HK0A 3ZL4L 2Y5TB 5DHYA 4P57B 5HY9A 2AV7A 1LK3L 3H6JA 1NLBL 4X9BA 2CDEA 3SKMA 2XICA 5BJTB 1H3XA 1WT5A 1WFNA 2EDNA 3PDDA 5IQ7L 3FFCA 4NQTA 1EO8H 4Y1AB 1M05B 1RHHB 4ZFZA 4MWFB 3VE0A 3FN0L 4K8RD 4OD2B 2J5LB 3NIGF 5TE4H 1DBML 2A6KA 3VWJC 1AGDA 4YHNA 4I13B 3H3BC 1IKFH 3QG7H 3UP1A 3BD5A 5CBAB 3LKPA 2IJ0C 4I48B 5ALBL 3WJJC 2QJDA 1A7NL 2V9RA 4PFEA 1C5BH 4XVSL 3MJ9L 3OB8A 2DWEA 5C86A 2VLRA 4WGVB 2VWEC 5I1KL 4ERSH 1WEJH 4YQXL 4LCWD 4X80H 1IILE 5D5MA 2Q3ZA 1IAMA 1T22B 2FGWH 2LAGB 4DFHA 4NRXA 5INCB 1KOAA 1LK2B 3ORJA 5LQBL 1FYHB 4JKLA 3C09C 1BF8A 2XRAH 1EA9C 4JN2A 4Q6IA 4PB9L 3RWCA 3VDBA 1HNFA 2DLFH 5F1OB 4ONHB 1PJ9A 3CVHA 4RWYL 3ME0A 3C5ZC 1HE7A 2C4FT 4I0KA 4PJFE 1MREH 4UUJA 4XTRC 3O9WD 3RNQA 1D6EB 1PG7H 5TDOB 4YXLL 3U0TB 1HH9A 1KBGL 4WWKB 4G8GB 4TTGA 1DE4B 3P11L 1YDPA 2IG2L 4N0FB 5JHDA 1C16A 2QHRL 3QT2A 3DBXA 1RUKH 1NMAL 2VR4A 1KCVL 2H45A 5I1JL 1YPZB 3EJZD 1I9IH 5F6IC 5F7FA 4U1NA 4P3DB 2ESVA 2E9IA 4RCAA 1YEJL 2R4SL 1HXYA 2D7TH 3AS2A 1FV1B 5DA0B 3ULUH 1SJXA 5ADOH 3O6FD 4P4KC 1OTTC 3CDFA 3BDBA 2X4NA 2VOTA 3K8KA 3GMNB 4LGPB 2UZIH 1F3DJ 1FFPA 5EWIH 1T1YB 4PJEE 4YLQT 2NW3B 2DJUA 2IBGA 1S3KH 2V6HA 4Z7NF 2W60A 4PJGE 3PWVB 4I2XA 1DUZB 4FXKA 1WT5C 1A4KA 1QSFA 3GSUA 4O4YH 3ULVF 3QPXL 1OP5H 3QFJE 2XQBL 3DOSA 3LY6A 4OV5B 1FNLA 3SDAA 4ZXBD 2C7UB 2XA8L 1P2CA 3BWUC 3CFKA 5FYJU 3WNMA 1LEGA 2H1PH 4ZUUB 3FO1B 3TNMB 4DAGL 5D7JC 3UBXB 4JY5L 2DQGL 2VDOL 2Q7YB 5DD0L 2R39A 1KPUA 3G5XA 3C5JA 3HUJE 1T0NB 3LV3A 4OCYL 3BPCA 1NC4B 3ZZ1A 4Q6IC 4G7VL 3TO2A 1A7RL 2QSCL 5SWSE 5KG9B 3VXPB 1LDPL 4R97B 3MV11 2E8ZA 4L3AA 5CEZL 1INQB 1EIBA 5D70H 5FHAL 4X4XB 3REVB 3SDDA 1C5DA 4J3UA 1I8LC 32C2B 3E3QE 5GGTH 1I8MB 5FUCE 3PP3H 4QRTB 1TJHL 4EI5A 1RZ8B 5FUOH 3WSQL 4QHLA 2ADIA 2R9HD 1G6RA 1OARL 1H3PH 2B5IC 2QEJA 4JDVA 1KIUA 1IAKA 4NJ9H 5F9DC 4X4YA 2BNRA 4LLVA 2CJUL 1ZHBB 5FF6A 5EU7E 2G5RA 5EBWB 5KVFL 4JB9L 1KXTB 5JOFB 1KIRB 4FFVC 4OTXL 2WUBH 3CD4A 1CBVL 1U36A 1KCRH 5DJ8B 3GO1L 4M48L 5DR5L 3K4AA 1EEZA 4M7JL 4HDIA 3UTSA 3KPMA 4MQ7A 1S7QA 2IADA 3MLSL 5JZ7C 4LVHC 4ZUVA 5FO7A 2A1WH 4O02L 2OS7A 4OZFA 1MLCB 2DWDA 2VDRH 3O6LL 5EUOE 5J11B 5HVWA 5KBNC 1AD0B 3D39A 4LSSH 5ERWA 2VLME 4R2GC 1VACA 1ZT7B 3KPRB 1FQ9C 2ADJB 5SWQB 3QI9D 1GZPA 1E6JL 2ZCLL 4PR5B 4LNRB 5I1HL 1T2QL 5DZNA 2XTJD 3HZMB 5E95B 1KLGB 1I3RB 3P40A 2P7TA 4GW4B 1FVDA 4HWZB 1KTRL 2FIKA 2GT9A 3MRLA 5H8DA 2VZOA 5IT2H 5DYOB 5IVXF 2FYYB 2HMID 4HX1B 2WIMA 5E2VH 4NBXB 1U3HA 1A22B 2P4AB 4XC3H 4LOUC 3KHQA 2IPTH 3KWWB 3BZEA 2YHGA 1ED3B 5FCUL 1AKJA 3QHTC 4WEUD 5B4MC 4YHOH 3FJTA 1GGUA 1NFDF 4JG0H 1QBAA 3H9SB 4V1DD 3SDDC 4GG8A 4P2OC 1AR1D 4P23A 2F15A 2R1YB 2A9MH 4LCUB 4XBEL 3LPFA 4MD4A 4XBGA 4OQTL 2G60L 4EI5C 1NKRA 1YNLL 2VRAA 4I0PD 4UV7L 5B39B 4U6VL 1U58A 2HVJA 3KAAA 2EXYD 3L9RB 3AS0A 1CE1L 1F97A 1GGTA 5F6HJ 1RK1B 2ICCA 2F58H 4JDZB 3R0NA 5IFHL 4J3WA 3R06A 1IC1A 3QUKA 4NCC2 5IBTH 1HOCB 1LO5B 3EOAB 4PJXF 5C09A 5F9AC 5JA9A 2D9QB 4LPWA 3S98A 4GKNA 4LFHD 3ARZA 3WIFB 1LP9B 1A02N 2B1HH 3SCMD 3VWKD 1A14H 2X1XR 2RHEA 1LO0H 1VGKB 4OAWA 2NXZD 4PJIF 4JR9H 4RFEB 3X3FH 5EIVA 4OLXH 3SO5A 2EDXA 3FCTA 4JVUA 5D8JH 4M43H 5EOQH 1NDMB 4DN4L 5MP6L 1DBJL 3DUHA 1B0GA 1U8HB 4FHBD 3GSXB 5HGGS 3MCLH 2GSGA 1UCTA 2Y5TA 3QCUH 3S3PA 1YUHB 3MUJA 4L3EB 1YEDA 4HIEB 3QSKB 4JRYE 3PJSA 4NZRL 5MENA 4NNPH 1U3HC 4KK9C 5DD6B 1IAII 5I30H 2ICWI 3QIUD 4JM2D 4RAVB 1RHHA 3ULSB 4MWFA 3MXVL 4OIIL 4OD2A 5JPMA 2FLRT 3O4LB 3WLBB 3W5MA 1L7IH 4OZFG 1ZGLM 3U4BH 4QRUB 1B0RA 1OAUH 5KS9F 4FXLA 2MOVA 2DD8H 1TQCB 3TJHD 4F37F 4LSVH 4D0CB 4MAYB 2BNQD 4P23C 4TSAH 2WANA 4C57C 1QBMH 1IGJA 4MXQD 2DQJH 2P5WA 1T22A 5FA4B 1OD9A 5INCA 5DMIH 5HXMA 2R0WH 4HKBB 4GRWH 3QWRD 3RWIA 4M7LT 3AMKA 1GAFH 1KIQA 5F7EL 1F3DH 1KJ2H 1N5AA 3LQZB 1C12B 5GJSH 5HHQA 2B4CH 3G6JE 2W07A 2XA3A 1CFSB 4UTBL 1JNHB 1D6EA 1H9VA 5TDOA 3DGCR 4WWKA 5FXCH 3VFWB 3CSYA 4OLUH 3Q5OA 4L9LA 3UAJD 4N0FA 4JO3H 1O0VA 3BIKB 4I3SL 4Y19A 1UWXH 4N1CA 4MNQD 3NCYS 4ODTL 1X5KA 4RZCB 2YUVA 4UT6L 5EB9A 1P4BL 1SY6H 4R7DB 5EU6E 2AK1L 3THML 2IWGA 4BK5A 4PRHA 2Q8BL 5C07D 3L3KB 2XZQH 4P9HC 3GZKA 5IB1B 3DUSA 1A0QH 3GMNA 1Q9LA 1WWAX 1T1YA 4OCWL 2IMNA 4HC1H 3RVXD 3WMSA 1OAXH 1B4JL 4XI5D 3KPSD 5CP3A 1MQ8A 2F53E 3GRWH 3PWVA 1DUZA 3MLTB 1CVSC 1I8KA 1SHMA 1GC1C 3QO1B 5GRJH 4CGTA 3QG6B 3V4VH 1UCBL 2J5LC 3VW3H 1DQML 4OV5A 2B0SH 5DFTA 4EI6B 1G7HA 1TNMA 1XR9B 4DKDC 1CWVA 2C7UA 4Q2ZB 3WLWD 4ZUUA 1NLDH 3T0EE 4BSWB 3FO1A 3TNMA 1CICD 1JHLH 1U8MA 3UBXA 4X7SH 3DURA 5CKAA 3DX7B 5GJTH 4M4RA 1MHEB 2XFXB 1NDGB 4F58L 1I1AD 5IHUL 4BZ2L 3L1OH 2Q7YA 1C1EH 2C3WA 2YPVL 4MQXC 3DVNB 1F3RB 2P46B 3QUML 4YWGH 1NC4A 1Z3GH 5KG9A 1FGNL 3ULUE 2HTKC 4UBDC 4ZYKB 2XPGB 1U6AL 2WWKO 4K2UH 1RZFH 2Y72A 4K07A 3EDKA 2A0LD 4R7NA 2DQEH 32C2A 3TLRA 3BXNB 4WWKC 4KJQC 3DUUB 3AGVA 4QRRE 4UV4L 5ISZE 5J1TC 4X98A 3U9UB 2CLRB 1F4YH 4PJEF 3NN8B 4M7LL 1ZA3A 4G7YH 3O11B 4MJ2A 3MLYH 3H3PH 5EG6C 3QIWB 1YN7B 1U3YA 4HH9B 4ONFL 3STZA 3O6ML 1ZT1B 1RJYB 5JOFA 1YQ2A 1AQKH 2IC2A 1KCSH 3NA4A 1U8PB 1UJ3B 3MPCA 1WFUA 3PQYE 1WC7B 4WU5A 4JKPH 4ELKA 2MPAH 5JORA 1RD6A 1UZ6E 1FZOB 4GG6B 1HILB 4ODHL 2O61A 1AD0A 1UJTA 5E94B 4J3TA 4MJ6B 4K7FA 3CUPB 5BVPH 3GSWA 1BD2A 1YEHL 3U46B 4W70A 1NUFA 1OP3K 5HD8C 1KTKE 5HVGB 2NY4B 4ODVH 4U1JB 5HDBE 4RMRA 1N3NA 3MROB 3HUJF 4PR5A 4G43A 1UEMA 1F8TH 2OI9B 1PSKL 5MEQA 1I3RA 1KLGA 4HWZA 1I4FA 2AJYH 5E1AB 4GUPB 5B8CA 1ZSDA 2F8OA 3TBVA 2LFGA 5DYOA 2FYYA 4HBCL 4HX1A 1MY7A 4JRXA 1IGIL 1RIHL 2BVQA 4CADB 4HG4J 5JO5B 1KB9K 1LILA 2JCCF 1JPTH 2DL9A 3MBED 1RURL 2LTQB 1CFQB 3LEVL 2ATPB 1R3LB 5ILTL 1CGWA 5L7XL 4WUKH 5SX5K 4JLRB 3BKYH 3GDBA 3RPIB 2CGRL 4M7ZB 3H9SA 1MQKL 4G6JL 4GRLB 1GRWA 3HZYA 2R1YA 3MMEB 4NQVB 5J3HC 4LMQI 3AMLA 5DO2C 1G6RH 3QEGL 3T4AA 1OW0A 5IIEB 5HVFB 4LASH 4U33A 2VABB 4JFZH 4WHCA 3TYGH 5B39A 1XGUB 3NTCH 5CZVH 4GQ9H 1BQUA 2RCSH 5BRZD 3FQNB 3C8DA 3L9RA 1IM9B 4Q58C 2YA0A 1D3CA 1NCWH 4H20H 4RQQB 3IDNA 3UBXG 5C0RL 5E99H 1BJMA 5E8DL 2OR9L 1YYLH 3O8XB 4FQXB 2N7BA 2W9LA 5I66B 1HOCA 2ITCA 1A3LH 1MAMH 5E2TL 1TVBB 3EOAA 5CCKH 1I8IB 2FBJL 4ETYA 5I1GL 5C6WH 3EOTH 3WIFA 1LP9A 4ZAKB 5J11C 4L8CB 5TQ2H 2AJUH 3HA0A 3HNVL 4J3VA 3M45A 5BV7L 1UM6L 4PJCF 2X1OA 5D2NE 1YEKH 3RJQB 1T7YA 1MI5D 4DVRL 5L2KE 4X6CE 1DANT 1G9ML 1H3TA 3CZFB 5CSZA 2QQLH 3BKJL 3MYZA 4LBEA 4RISH 3JV0A 4LHUB 2X1PA 4NWTL 1UB6B 3EO1A 1U8HA 4DTGL 3MRCB 2F19L 3GSXA 4GT7A 4WUUB 5DURD 5B8CC 1DLFL 2UWEB 5BOZG 5F93C 1YUHA 2HT3D 1NAMB 2YK1L 5ITFA 4P4KD 4Y4FD 4QRQB 3ARDA 4ZFFB 1ITCA 2Y4SA 2ARJQ 1QSED 1EHAA 4PD4K 4RAVA 2ARJB 2CSPA 2C4XA 3ARXA 3O4LA 3WLBA 1MCPH 3EJJX 4S1DC 1XEDA 4S0SD 5K9QG 5C9KA 3L7EA 2IQAA 3VCLA 5JIKA 4D0CA 1KENH 4YIQA 2VXUH 4F8TA 1IMHC 3RUGE 4X7CC 5I8KL 3BE1H 3BEWB 4P2QB 4XVTH 3HAEH 4K3GA 3KHOA 4LLQA 1E4XH 5GRVK 5FA4A 2KKQA 2R0KL 3QA3A 4ELMA 5D7JD 4D94A 3S8WA 1RIVL 2EIDA 3OG6B 3P9LB 3LQZA 4NWUH 1PG7X 1C12A 4PTTB 3KGRA 4PJ9A 1AE6H 2AJSH 1U92B 3FB7B 3OG4B 1CFSA 3P77A 1JNHA 2VDQH 3I9GL 3VFWA 3KNBB 4QO1A 3HE6B 3BIKA 5L8LB 3BRDA 2HT4D 1A7QL 4M6NH 3PWNA 3NACH 3U7WL 1PGRB 1OSPL 3LQMA 2RB8A 1RPQA 4X4ME 4P59H 4K94C 4BZYA 1ZS8A 3M1BA 1UA6H 4FNLH 4JKKA 5MHSD 3VG9B 5D7LD 4R7DA 3SJVA 5E5MB 1KCUL 3PV7A 3CLFL 5C8JB 3QULB 3L3KA 2IFFL 1I7RB 1Y0LB 4HXAH 3ULVL 4I77L 3FTGB 3T2NH 3D2UB 1SMOA 1P1ZB 3RQ3A 5B39G 4CAGA 2GQHA 2I60H 1IC4H 2R15A 4XCFH 1U8QB 2FX8L 5JZ7D 1OQXA 4IS6B 1QLRA 4O51B 4OGXL 5C0DB 4J4PA 4EUPB 4GRWE 3ARDC 1JNLL 3CXHK 1G7IB 2Y6SC 3QO1A 3MBXH 3BO8A 1J1PH 4F57H 4K3EL 5IVNA 4NQCB 4NC0B 1XR9A 3UTZB 3GMQB 4Q2ZA 4PLJC 4K9EL 2R2EB 1J7VR 2X1WL 4LRNL 3OZ9L 1TQCC 2MJWA 3NH7H 5F72S 4MAYC 2NY3B 3C60B 3DX7A 4JJ5B 4BH8B 1N4XH 1NMBL 4CBPA 2XFXA 3FAXA 1EJ6A 2V2WB 1DVFB 4OFPA 2VZUA 3JWDC 3EHBC 1EJOL 4JJHA 4K8RH 1T1XB 3H42L 2IPKB 4DOHB 5J57B 2IBBA 4JO2H 3PL6D 2OZ4A 5KVEL 2GYSA 4S1RL 2B39A 4PJ9C 2YBRA 3G08B 4P5KB 2YKLH 4LOUD 1AGFB 3CDYA 5I8OH 1G9NH 2RQ8A 1QBBA 4MXWL 4ZFOB 5DHVA 4GMSL 1J0JA 4PJ5E 1VFAA 5J56B 2CLRA 2HT2C 3HFML 3NN8A 1N26A 1KPRB 1EV2E 3O11A 3ZYOA 1J05B 1MRFH 2FX7H 4P2OD 4PP2A 3D25B 1NCCL 1YN7A 2ZKHH 1CGSL 1ZT1A 5E0QA 4HEME 4YHML 3ZE2E 3QXUA 1OGAD 2EH8L 5DLMH 4OGAD 1UJ3A 1MHHA 3KYMA 4PJHF 5C9JA 5TE6H 3SGDH 1JF1A 1JGUH 1WC7A 1KYOJ 5EU5B 4I9WD 3BUYB 3IAPA 3ARSA 4RBPH 1UVQA 2X4SB 4DN3L 4JFOB 1HILA 3G5YB 2NZ9C 2VITA 1I3GL 1FDLL 3BDYH 3CUPA 5I74C 3MYJA 4E9LA 5J6HB 2V7HA 3MOQA 1I9RL 4ZUWB 1J9CT 2GK0B 1FO0H 4L4TE 1OVZA 1ZGLP 1RJZB 1QEWB 4U1JA 2PW1B 1D6VL 2ZPKH 4RFOH 3ARGB 4JY6A 2Z35B 4PRID 4N8CH 3MRMB 3ULUF 2DQCL 5L8JB 3BP6B 1X4YA 3GSRB 4ZUSB 4B5EA 2VLLB 4G5ZH 1Z5LB 4YJZL 2FBOJ 2OBGA 3FOMB 4F9LC 4XMPH 4CJ0A 2YC1B 4YHKL 3WS6A 4BA8A 2MCPL 2NX5B 4KHXH 5EOCH 1FLRL 1UXWA 1MAKA 3TBYA 3QXTA 5D7KE 3QUYB 4X7EC 1T7VA 4Z95L 1R3LA 3RGVA 3T0AA 1J5OH 4JLRA 3S35X 3SOBL 2JIXB 2EXWD 3RPIA 5JPNA 4ODSH 5EZOL 4MLIA 1FNSH 5CGTA 2VXSL 1BP3B 5C0CE 2NY0B 3EBAA 4HKJB 2PW2B 5IIEA 2C3GA 2PNDA 2IEPA 2Q87A 2OTUA 4M6ML 1KULA 3QUMB 2IF7A 4LIQH 5FYJL 5F96L 4MDIA 5KSBB 4ZPTB 1ZTXH 4ISVB 1KC5H 3NFNA 1QZ1A 1I3UA 3MRIA 4MGXA 3QIWC 3UYRL 3VXSB 1IM9A 5IBLD 3C87A 4BFEA 1SYVB 5FOBA 3G9AB 1FHGA 2C3VA 5KTEL 1W72A 3O8XA 4F7EB 1UJ3C 3OPZL 3JTTB 4LL9A 4CN4A 2EKSA 1ZLSL 1TVBA 4E41E 2WQRA 1I8IA 5I19H 3GB7B 4ZAKA 2MKWA 1EHNA 5EU4B 3PHOB 4YBLB 3MXWL 5HYFA 3C8KA 4G6FB 3NGBB 4HUMB 3TEUA 4OM1H 1RV6X 2NPLX 2WP3T 2A6IB 1CD1B 3FAWA 3T0DA 4M62L 3CZFA 2NY4C 4MB4A 4PRAB 4U1LA 4RGNB 4RMQA 5JIIA 1RUAH 2DKMA 4OZGE 2F5AL 4M3KB 4MA3A 2OI9C 4LHUA 3TO4D 2ORBH 1U8LB 1OAZL 3Q3GA 1MHPH 4WUUA 1QRNB 1BWMA 5INDB 2UWEA 3KJ6H 1E4WL 4Z78A 1NAMA 3GI8L 3WS6C 4HQQH 4QRQA 4O9HL 2BY0A 2DMBA 3ETBF 3MA9H 2C3HA 4MXVE 3QR2A 4NQEA 2LTQC 2WK2A 4XPBL 1T21A 2IANB 3NCMA 2JB6B 4NCDA 2O5XH 1T89A 4GAGL 4C55A 1FGVL 3DTXA 4Y1AD 2F54E 4N0UE 3VFSB 5IMOB 2Z91B 5A40E 2DQIH 3MRRB 4P2QA 5TF1L 5E4EB 5MERB 1RJLB 3KXFB 5C0BB 2BERA 4N68A 3NFSL 2BDNL 3GMRB 3MX0A 2FR4A 4OUUB 4PRBA 5GRZA 3P9LA 1ZHNB 3X14B 2HJLB 4PTTA 3IFPA 2OX5A 1E6OH 1XGYH 1X6LA 2IQ9L 2X44D 3WEXB 1KJ3H 1VPOH 2Y25A 1DBBH 5HPMB 1U92A 4BJLA 1C08B 3FB7A 4MQXD 3L5IA 3O8XC 4XPGL 4FQXC 4PYHA 4BQCA 1DQLL 1BF2A 3KNBA 3ES6B 1UADC 5AWNL 2VYRE 4XHJD 1CDBA 4HULB 3O3BB 3HE6A 4LAJH 3GSNH 2HTKD 2W0PA 4KI5C 2R2HA 3MODL 4ZAKC 5I8EA 3EO9L 4HW6A 5IW1B 4L4VB 3TT1H 3VGAB 4LNVA 4WWKD 1VEPA 4KJQD 4G8GD 1A4JA 1MEXL 2NMSA 3WDIA 1T5WA 3BPOC 4NYLB 2N4IA 5FOJA 3GHEH 1BAFH 3C2AL 1O7VA 1I7RA 1MFDL 1S9XA 5DJZB 2JJTA 3M8OL 3QJFB 4JPVH 1MCIA 4FABL 3K1DA 1MWAA 3D2UA 1AXTL 1P1ZA 3SDXB 1E4KA 1PX4A 5GGSA 4TPRL 1PY9A 2AJZB 1GGIH 1IC7H 3W0WE 4GMTH 1ITBB 3EYUL 5BV7B 2VLJB 4F7MB 4H1LB 3RUGF 3GI9L 4IS6A 4O51A 3AAZA 3G9VA 4CUCA 5FKAA 2XI9A 1G7IA 1FG2B 1RZJL 3IU3B 4JFQB 4OF8A 1ZVSB 3P9WB 5EUKA 1B88A 4Y4KD 1HQ4B 3TT3H 1FAKT 3UTZA 1FVCB 4D9QE 1BEYL 2Q8AH 4TSCL 3IDMB 2BHUA 1T89C 5HD8D 4WHYG 4KWUA 4HWEL 1Z2KA 5ENWB 2LU7A 4JDTL 3TV3H 4DUXA 5DD1L 2EDLA 3IT8D 3LEYH 1WCBB 3C60A 4BH8A 4JJ5A 5FYKE 5FIEA 4G3YH 3L6FB 3RIFF 1DVFA 4TNVF 3BH9B 1X6NA 1PAMA 1T1XA 3X12B 2R56L 2DL2A 3LIZH 2IPKA 4LHUG 2XZCH 3FQUB 5T1LB 3WFBL 1T4KB 5DZLA 4U7KA 2QQKH 3HRZB 1XH3B 4X0KB 4Z7VE 2ZUSA 4Q9CA 2E27L 1YEFH 4FQJH 4OCRH 1ACYH 3RWDB 4UOW1 3G08A 4P5KA 4WI4A 1AGFA 3RWGA 5DVLA 3Q6FB 3MV8E 5ANME 4ZFOA 3KPTA 1JPGB 3PGCA 1NC4D 3RU8L 1FAIL 1OB1B 3HE6C 3WKNA 4P9ML 5CINL 4JCMA 1DQDH 4BFGA 5I1DA 1KPRA 5H37G 1G7JA 3O2VL 5KOMC 1TZHB 3PIQB 2CH8A 5DO2D 3VG9C 2FJFB 4GRWF 4G6KL 3R8QA 3JV4B 3QEQE 4HXBH 4TVPD 1E4XI 2AAVA 4QCIA 2FATL 3IDYC 3KLSA 5EU5A 2JJTC 4DCQA 3L5JA 1ZT4A 5IESL 4NN6B 5GPRA 5GS2D 1E4KC 1T66D 2N56A 1GOHA 3BP4A 4NFCA 4G8IA 3MV7B 1KN2H 3O3AB 4DGIL 1S7RB 1FRGL 1MCCA 3Q5TA 5H35B 1G0YR 2HG5A 5BMFH 3U2SA 5J4MA 5J6HA 2EH7L 3GKWH 4ZUWA 2GK0A 1N0XH 2D0HA 1AI1H 1RJZA 5GS1B 1QEWA 1IC5L 2BJMH 2PW1A 1OHQA 4QHKJ 2WWMD 2HKFL 1Q94B 3ARGA 3MCG1 4UNVA 4ODWB 1U8KB 2MHAB 2Y5EA 4LCWE 1MUJB 2V2TB 5L6YH 3BP6A 3MO1B 4LVOB 5ESVB 3GSRA 2VLLA 3KPRD 1IKNA 5IW3A 3FOMA 5AAWA 4HS8L 5C0AB 1D5ZB 2YC1A 3C60C 1TJGH 2NY3C 3Q6GH 3OKEB 3GMPB 2NX5A 4LKCA 4Z8FL 1LNUA 1DVFC 3P9MA 1UM5L 1W0WA 2DBLH 4U49A 5HHVH 2ITDA 4HHAB 1NAKL 1EK3A 1OGTB 2R4RL 3QUYA 2BRRL 4MA8L 1G7LA 1TJIH 1JZ6A 3UO1L 1AFVH 1FL3B 5HHPB 2A2QT 2CDFB 1JHKH 2FX9H 1XGPB 3BKML 3OKKA 3BDXA 3WO4B 4YO0A 4HKJA 1RUPH 3T04D 2PW2A 1WISA 3NOIA 5LG1A 3TN0B 3EZJB 4TN9A 3WFCH 2HJFB 2ZNXA 3H9SD 3UC0H 3G6AA 1QKZL 3BYYA 1I9JH 4WVRA 5HHXL 5KSBA 4ISVA 4MCZB 1PEWA 3HMXH 4HK3J 2D3VA 3WUWB 5LAXA 2VIRA 2DS4A 3QNYB 3FB5A 3Q1SL 4KV5E 1SYVA 3PHQA 5GSRA 2X05A 3VFOB 2YMXH 1EGJH 4XPHH 3ZYZA 1Y18B 3RVTC 3OAZK 4F7EA 1SVZA 4ALAL 1WWBX 3VXUB 1MCRA 3QXDB 2EICA 4YBQC 2PXYD 3ARBA 3KYNB 4K23H 4PY8J 4IMKC 4CU6A 3H7BB 4H0GA 4M03A 3DRTB 1QFWM 3PHOA 4O5LL 3FB6B 1GPOH 3RZCB 1IAIL 1KEMH 5FO9B 4F37K 5CAYB 1BZ9B 1FZMB 4DKEL 4J1UB 4Q9RL 2A6IA 1NBVH 1A6AA 1CFBA 2EDHA 5BOPA 1FYTE 1AD9B 4HCRL 4LLYB 1P4IL 3ILQC 4JFDB 2VC2L 3ARGC 1MIEH 4N0YL 4XCCL 1U8LA 2DI8A 5HDOA 1QRNA 3BMVA 5CWSA 1LO2L 1IKNC 1YC7A 5DWUL 5T3ZL 1I1FB 1CDIA 1YMMB 4PGZA 4PS4H 4L8DB 1F6AB 4YFEA 5D93B 4NIKB 3LKSA 4B50A 1RZKH 4MDJB 3QUYC 5D4QA 1Q0XH 4UB0H 5J1AA 3WIHH 1OSZB 2NXYB 3N1PC 4GJTB 4OD3L 4L3ED 4YDIL 4ZOAA 4F7CB 4Y2DA 2CD0A 5CS7A 2Y6SD 3MGOB 1N59B 1NGPH 2RFXB 2EYSA 3VFSA 5IMOA 2Z91A 1RJCA 3O4LD 1JHTA 1LO4L 3MRRA 3LQAL 1HINL 3P0YH 4KJWC 3W11C 2CK2A 5MERA 1K2DA 4Y5YB 2E5EA 5EDXA 4BQ9A 4M3JA 4G8FA 2XN9B 4LPVA 4EN3B 3C08L 3S34H 3GMRA 1NCAH 1RZGB 4MAYD 4UINL 3X14A 1ZHNA 2HJLA 1W72H 1T80A 3BESR 3WEXA 4QRSB 5DRWA 3FQXA 2Y06L 2H9GB 4Y8DC 4FFYH 5DT1L 3FMGH 3DVIA 1KTLB 3NA9H 2E7LA 3P0GB 4MA1B 3EAKA 5IK3B 4PJXB 3BIBX 1I75A 2ZJSL 4A6YL 1UWGL 4LP5A 5FEBA 3E0GA 3IDIB 2ED7A 2HLAB 4GO6B 4HPYL 3GSVB 2HN7B 4YBLC 4J3XA 4X6BB 3OAUL 3NGBC 3B6SB 2XTJE 2JE8A 5IOPB 2R1WB 1GGCL 4WRLA 1E28B 2HT2D 5GISL 4UT7L 4RGNC 43C9B 4LQFL 3IDUA 5ALCH 5DJZA 5K59E 3D6GA 4Q97A 4YHPA 3CFJB 3SDXA 3KR3L 4KKBC 3BZ4B 1FJ1B 1AGEA 5E8NB 4XXCA 5D7IF 1I9EA 4JQIL 5M7QA 3H2WA 3ROLB 1CFVH 1UZ8A 2VLJA 1GCFA 3STBA 4H1LA 4XVJH 3K8MA 5B3JE 3QDJB 1WK0A 5IGXH 1K8IB 1QLFB 5H37H 4HMDA 3E2HB 4KDWA 3IU3A 5E2JA 1HEZB 4JFQA 3T4YB 3VU2A 4V1DE 5E6IB 4OV6F 2NZ9D 4PB0H 1HQ4A 2F74B 1X5YA 2HWZH 3QDGB 4AJ0A 4OCXH 4PLKD 3ZDZE 1EO8L 2LU4A 5HGAB 3IDMA 4Y2DC 2YWZA 3U9PL 1OP3H 1EHXA 5ENWA 1MRDH 3FT3B 3OX8B 4H25B 1FFRA 1T7WA 1IKFL 2D0FA 2FO4B 2V2XA 3QG7L 3VJ6B 3BHBB 2DQUL 4NDMB 5D1XB 1MJ7H 3L6FA 4ZSOE 5E4EC 4YXKH 3VFUB 1PQZA 5DMGD 3ALXA 3BH9A 1F2QA 4ERSL 4HZLB 4X80L 3VD3A 1HXMA 1T4KA 2FGWL 3RWEB 1CF8L 3HRZA 1XH3A 3MNWA 1Z0NA 4N8VB 3WNOA 5FGCB 2EO9A 4OM0H 3VRJB 4H0IA 4OCSH 4N1HB 1CXKA 2HKHH 2W0FB 3FT2B 1JPGA 3UPRB 3F7VB 1HHKB 1FL5A 1B6UA 1OB1A 1OAQH 4MS8C 5E8PB 1MREL 4YHLH 1PG7L 1X9QA 1WTGT 3K4ZA 1TZHA 3VGAC 3TJEH 2R23B 3OHXA 4HAFA 2XWTB 4PY7B 3B8SA 1RUKL 4ONGL 1A7OH 1X5JA 2PYEB 1S7TB 2GUOB 4X6FA 2HYMA 1EXUB 1LD9B 1D5IL 4IOFD 1WTLA 3MOBL 3QUZA 1PKQE 3QIWD 3O4OB 2M26A 4OLYH 1WCQA 2D7TL 2HH0L 2QBWA 3SE8L 3F58H 5CEXB 5ADOL 4U1MB 4E42B 3O3AA 3FN3A 5BV7C 5H35A 4X6DA 3QISA 2UZIL 3QDMA 3RJDA 5EWIL 1G9MC 2HFFB 1X44A 4UDTA 5GS1A 1S3KL 3EFDH 1SM3H 5LWYL 3DX9A 4OZHB 5HGBB 1Q94A 4TTDD 2BNQE 2J4WL 5DJ6B 4WV1A 1U8KA 1ZVHA 3GNML 1MUJA 3BWAA 2DLEA 4Z7VF 1A3QA 3N1MC 1FE8H 5ESVA 5IB4B 4NPYB 4L3CB 2NY4D 4C56A 1GH7A 1IEBB 5T1DH 3A6CH 1NCBH 4XP5H 3OKEA 3UPAA 3QHZL 5EBMB 1BM3H 1HNGA 1F45A 3ARUA 4HUVB 3EYFB 3MLRH 3RWJB 3P30H 1BHGA 2VN4A 2DJ4A 4DGYH 1A7PL 3NIFE 2Y23A 2D03L 5J9PB 4X7TB 4PTUB 1FL3A 2P45B 5HHPA 4LCCB 4L1HA 2CDFA 5C71A 4ZTPH 1XGPA 3QFJD 1MNUH 1KLFA 1ZMYA 4H1LG 4OF6A 4WY7H 3QQ3B 4MNQE 3BAEL 1X7QB 5D70L 3TN0A 3WXWH 2HJFA 1T0MA 3BEVB 25C8L 4GRLD 1KN4H 3L5HA 4LLAA 4MCZA 4HS6B 1QFHA 4ZO9A 1AQDA 3QNYA 1H3PL 3GMMB 5ID1B 3VFOA 3FQTB 2PKDA 2FEDC 2QV2A 4U3HA 3U82B 4NJ9L 1Y18A 3PWPB 4LDEB 3TIEB 2NQCA 4WEBL 1PYWA 3VXUA 1KSRA 4WDIA 4OLVH 3KPSE 2WUBL 5FGBA 2GY7B 5CEZD 4NN6C 1KCRL 1MF2H 3KYNA 1YYMH 3H7BA 1XCTA 5FV1L 3O8XD 2Q86B 3FT4A 4FQXD 3FB6A 1KUMA 2XIDA 1JZ7A 5FO9A 3U6RB 1BZ9A 4NO0B 1CD0A 1FZMA 4EDXB 4K71B 4J1UA 4U0RB 1XGRB 3K74B 5GS1C 4Z7WA 3P2TA 3ULVC 1AD9A 1FFNB 4WFED 4HLZG 2AXJA 4LSSL 5HYQB 1T03H 1H3WM 5EO0A 1XF2B 2AK4A 4X5XB 4XMLH 1UH3A 1A5FL 3HR5B 4LVOC 5CIPH 2XT1B 4KJPC 3VI3F 3LKQA 5IVXA 2H32B 2A73B 4Y5VB 1I1FA 3I02B 1YMMA 4L8DA 3W9DB 1K4CA 4QY8B 3IDJB 1H0DB 2JCCB 1XZ0A 4UQ3B 4MDJA 3VFGH 2WUCL 3NABL 4DZBA 3S88L 4WUUD 2ZP0T 5DUBB 5EORH 5A2KH 5E2VL 1Y6MR 2BZDA 3G6DL 1OSZA 1CK0H 3QPQC 5I9QB 3RBGA 1NFDA 4XC3L 1V7ML 2IPTL 3EGSB 3HCVB 2CXGA 3T3ME 3MGOA 5J7CC 4NN7C 4HUNB 3GUTB 1NEZB 3MLXH 3WO4C 5EZIH 1YECH 1SEBB 2DQHH 1IVLA 3QIBB 4RMSA 3UTTA 3TN0C 5MI0B 5CP7B 1JZ8A 2XN9A 2A9ML 4IRJD 4KQ3H 1MFCH 4YX2H 4EN3A 4Y4HB 3L5WB 1WLHA 4UT9H 1JBJA 2VLKB 1U8OA 4IRSB 1G7MB 3PWLB 4P2QD 3U7AA 4WO4D 2Z9TA 5C0NC 3QWOB 3LKOB 3SKNB 1KTLA 1LO3H 2EZ0C 1HDMA 2ZSVB 5FGBC 3QO0B 4PJXA 4M8QB 5IK3A 5F7WC 3F7YB 4UTAL 5FECB 1R3HB 5IBTL 3IDIA 2HLAA 4XWGL 1UG9A 3GSVA 5I1EH 2HN7A 4PGBA 4PJCB 2GITB 4PJIA 3B6SA 4YNYB 1BVZA 2LABA 5IOPA 3HE6D 2R1WA 1E28A 1H3GA 4UIMA 3SO3B 4FOMA 43C9A 5GGQH 1JGEB 1MCSA 2E7CA 3CMGA 1A64A 1BX2A 3X3FL 3CFJA 2KH2B 4OLXL 3BZ4A 1G6VK 5GRUH 5E8NA 1NPUA 5DEFB 3D18B 5D8JL 3ET9F 1DR9A 1JFQH 4ENEC 3TZVD 4QNPE 5D1QB 1IAOB 1B0WA 3EYQC 3WHXB 4QXGL 5FKPB 5ITBH 4OZIE 5KOVC 2X1QA 1T20B 3MCLL 1S8DB 5D93C 3ZDXE 3K7UA 4CN1A 2R0ZH 1Z9LA 3MFGB 1OWWA 1CT8B 1WIPA 3T4YA 5E6IA 5FDWB 2IGFH 2F74A 2AXGA 2NXYC 4NRZB 1FP5A 4JVPA 4NNPL 2RIKA 5I30L 4R8WH 3TP4A 4JFEA 4U6YA 5KS9A 1DQJA 3FT3A 4LSTL 1L7IL 1V7NL 2WBWB 3T0VA 3U4BL 2FO4A 1EPFA 1EEQA 3VJ6A 1OAUL 5D1XA 4NQCD 5BRZE 3VFUA 4Y5YC 2PYFB 4TSAL 1FSKB 5KVMC 1QBML 2FLBT 2APWA 3PG2A 2DQJL 4HZLA 4IBLT 4EN3C 2YRLA 1IQDB 1X5FA 4YHIA 2I9TB 2H2PC 3C60D 4Q74A 4O2FB 5DMIL 4ZFGH 3MUHL 3IJSB 4N8VA 4Z0BH 2R0WL 1N6VA 1CE6A 3PGDB 4MA7H 4NZDA 3LCYA 3VRJA 5DK2B 1KJ2L 5F3BB 3MFFB 2CUHA 2W0FA 2JLLA 2B4CL 4MA1C 4Y7MA 1BQSA 4TVSa 3UPRA 2PTUA 3F7VA 3BP5B 1KB5H 4PJBE 5E8PA 4Z9KB 3GM0A 4P4RB 1MI5E 3INUH 1U8JB 4OLUL 4E5XB 2QSTA 4HKZB 5AYUL 3OKLB 1ZV5A 3AUVA 2R23A 4FQPA 1ADQL 2XWTA 3LB6C 4UQ2B 3WFEH 4PY7A 3UJIH 5B3JF 4P2RD 1S7TA 4EOWH 1ONQB 3B5HA 3LSOB 1EXUA 1V3KA 1LD9A 2R69L 5F1NA 5KSVB 1FN4B 2RR3A 5FB8B 3RA7H 5IHLB 1SY6L 3V4PH 5FK9B 3L5XH 4A6YB 2I9LB 2X4TA 4EIZC 3ZDZF 5DJ0B 3SPVB 1S78C 2XZQL 1RVFH 1N7MH 5CMAB 4U1MA 1OP5K 2W92A 5CEXA 1QSEE 5GGRA 4XMKH 1AO7B 3GJFB 4FQHA 4YGVA 2CRMA 5T5FH 2NY1B 5GSVB 4HC1L 3WD5H 4YBQD 1A9EA 1OAXL 2HFFA 5CZXD 3CVIH 3E2HC 5IB2A 3ALWA 5E6IC 5IM7B 3GRWL 2R29H 4JGMA 4YDLB 3RI5F 2DQDH 1E27B 3BSZH 2B1AL 2COQA 5DUMH 3RKPA 1BIIA 1TXKA 5IB4A 1BLNB 1FLTX 4NPYA 5FUZL 4L3CA 3VW3L 1J8HB 4PJFA 3V0WL 2B0SL 4MX7B 1IEBA 4XP4L 5KJRH 1KIPB 4MMZC 4KZEH 3R0MA 5EBMA 5HJ3B 3ARGD 4Y2OA 5D1XC 3VD9A 2PETA 4HK3N 4HFWB 1CLYH 4AZ8A 1JHLL 3EYFA 5D5ME 3RWJA 1BBJA 3VFTB 4HJGA 3RVVC 1WBZB 3HE7A 2M2DA 4D0BA 3PP3K 5DJDA 1OT1A 3MA7A 5EZLB 3UJJH 1C1EL 4W6WB 4DQOH 2NX5D 4PTUA 4HLZH 4LCCA 3BT2H 5DVNA 1DLHB 5HHOB 1KF9B 1UC6A 3CVHL 5ESAB 4YWGL 5SWZD 1Z3GL 3IFNH 3VG0H 3QQ3A 2ZCHL 1X7QA 2PN5A 1ODAA 1RZFL 2HRLA 2JIXD 5MHSE 5CZKA 2W91A 5D7LE 2DQEL 1FORH 4PJEA 3FQRA 4QTHB 4X7FC 2IH1A 2AXFB 5AG9A 3MCKB 4HS6A 2F53B 3QJHB 2NY0D 4PJGA 1D5XB 3KS0H 1F4YL 1C7SA 1DEDA 3FQTA 4M8VA 1IJ9A 3KPNB 2OK0H 3H3PL 1A21A 4PJHB 1UQSA 4TUJB 1G0DA 4MJIB 4KI1A 3VXSD 3DSFH 4D9RD 3CFEA 3O4OC 4Z7OF 1AQKL 5ADPL 2AQ1A 4JZNB 5BW7C 2G2RB 5KSAB 3EOYG 5DRNB 1FL6A 3ARVA 4J2XA 3BZDA 5DDHB 4JKPL 1PZ5B 1D5BB 2Q86A 4JFHD 3GHBL 4ETQB 4IJ3B 3R4DA 2O5YH 4N8VG 2HRPH 4NO0A 3O41A 5LBSH 4EDXA 3MRKA 1L6XA 4PG9A 3WE6B 2BVTA 4F7PB 1FFNA 4I8DA 2W0KA 2DM7A 3HUJA 1JWSB 4QTIH 2ZUVA 5K93A 2UUDH 3NIFF 4NKDB 1S5IH 4G6FD 2Q7NA 5SWSA 1XF2A 1DEEB 2YN3A 3HR5A 1EVTC 1AXSA 5DD3H 4EBQL 1S7SB 1BGXH 4JM4H 3ZE0E 1Q9OB 4RGND 4Y5VA 5GGSY 4OKVB 1S7XB 4NM8H 2DICA 1NCNA 3I02A 2AJYL 4JFPB 1KFAL 4I5BB 4LU5L 1MFEH 3IJHB 4QY8A 2OXHA 1RZJC 4NSKB 1LE5B 2Q1EA 3CDGA 4EIGB 1YEEH 3LEXB 1QRND 2BOCB 1ES0A 1FNEB 3HE7C 3BFOA 4FFZH 3BVNB 2EIBA 1JPTL 2CLZA 1PDKA 3HCVA 5D6CB 3V6OA 3IS0X 4LCCC 3GMOA 4G42B 5JIPA 2VTFA 1NEZA 1TQBB 1G9EA 1JWMA 3GFUA 5DSCB 1JPSH 5I75C 4LARH 4N9OB 1QR4A 2IAND 4MHHI 4Z7UB 3QIBA 1WGOA 5CP7A 1EMTL 5EUOA 1B2WH 1G6RL 1OGAE 4Y4HA 2YD3A 3L5WA 4HIJB 5CEYB 2VLKA 3V6ZB 1J87A 5JUEH 1S7VB 2Z93B 4LASL 4RAHA 3RY6A 5I1IH 3PWLA 1N64H 4F3FA 1R5WB 1UXSA 4I9WE 2HLFD 3NTCL 3ZYJA 1GGBH 3KXFD 2P42B 5DQ9B 2FSEA 5C0BD 4HJJL 3EUUA 4RMUA 4XP9L 3K81A 1NCWL 1PVHA 3ZKMD 3QO0A 4NC1E 1QOKA 3HPJA 5HYJB 5E99L 3F7YA 4OI7A 2E7BA 5DXWA 5FECA 5F9OL 5JOEA 1KPVA 3OF6A 4PJCA 4A2MA 2GITA 5J6GB 3EOTL 4YNYA 4K71C 4PRIE 5TQ2L 4U0RC 3PABA 2AJUL 4X9IA 1KTDB 2P5EB 3RIFK 4ZO6A 4TNVK 1OOAA 5IB3B 1JGEA 1YEKL 1C7TA 1IGTA 4L4VD 4AIZB 5F89A 3RWFA 4LF3B 4RRPA 3RAJL 1FPTH 2NY2B 2BMKB 4RISL 3D18A 4R96B 5EIIB 5I73B 3WNLA 2PUQT 2OP4H 4X5WB 4Y5VC 5D1QA 3WHXA 1J0YA 1F3JB 4H8WH 3BW9B 1A6TA 2PO6A 4LK4A 4WCYL 1T20A 5IB5B 2OCFD 5C70A 5A16B 1QRKA 2F5BH 3N1GC 1IRAY 1U8IB 4FFWC 3NBNA 4ZD3H 3W81A 2FIRT 5I9QC 4PJ8D 5EU7C 4R4FH 1YN6A 1FCGA 1B4RA 3HI5L 1OAKH 3V6OC 3B8YA 1MCPL 2H6PB 2RJMA 3L3OB 3QUXB 2FWOB 1IFHH 2WLYA 4D3CL 5E9DB 3IRZA 3QIBC 4F2MB 2PYFA 4HIIA 5MI0C 3CFIC 5H94B 2VXUL 3F6IA 1FH5H 2VDKH 2I9TA 4GS7B 4Y4HC 1V3MA 1E4XL 5CHNA 3CC5A 4IRSC 3RY6C 5SV4A 1UWXK 3IJSA 2ICEA 5EH1A 3P4OB 3PGDA 5F7MC 4DUVA 2I5YH 3L7FB 1QHPA 3S97C 4AY0A 3U1SH 5DK2A 2BVEA 2DF3A 2ENSA 3IXAB 3I6LD 3MFFA 4NWUL 5T1LD 2EDBA 3V4UH 3VGDA 1AE6L 2AJSL 3DMMA 3U0WH 4RA0C 5JNYB 3DRQB 2L7UA 2I07B 4P4RA 3OBAA 3B9KD 2GJ6B 1U8JA 4E5XA 4HKZA 4QNPF 1IGCH 3OKLA 4APQB 2NY6B 3TWCL 4MLSA 3KLHC 2HP4A 1XF5B 1JMXA 5EBLB 4IHOB 1NEZG 4P59L 1W8OA 3D3VB 3LSOA 3QCVH 3SO3C 1DTUA 1VADB 4FNLL 4POZC 3WIIL 1FN4A 5FB8A 3IU4H 4BSVA 3IJYB 4XPAL 5FYLH 2I9LA 4P9HL 1QSVA 3MTRA 2G9HB 4HXAL 4QLRA 4QGTA 5CMAA 5LJYH 1SVCP 1AO7A 5CBEB 3T2NL 5D1QC 4I3GA 4MMXC 2I60L 1KLUB 4M93B 4LLUB 1IC4L 4IEFB 4PJAF 3MLUH 4XCFL 3HPLB 4M5YH 1F90H 4KKLD 5E8OA 3MV7D 5E2UH 5IM7A 4Y1AE 3HNSL 5B22A 1NSNH 3G6JA 4DKAA 1J8HA 3QRGH 4MX7A 4F57L 3ULVD 3UROR 3N06B 1KIPA 1TVDA 5HJ3A 4OSUH 2IALB 4EQ3A 1CU4H 3NH7L 1ZHLB 1FSKC 1G7PB 1WBZA 3BOVA 4KJPD 4HKXA 3HC3H 5DEZA 5HTSA 1V5JA 3CFCH 5C0AD 5KVDH 3G04A 3KPPB 4RRPG 1KT2A 1IBGH 5EZLA 1YY9C 4WI8A 5EU6A 1ZHKB 5IKCB 1ACZA 1EEYB 1DLHA 4FP8L 2ADFH 3RTQB 5AG8A 3LQAC 4TQEL 5C2BH 1OTSC 2YKLL 1GZQB 4G8GE 1NLBH 4Q7DA 4XCYB 1MHCA 4QTHA 5J06A 2AXFA 4PJ7E 3C09B 3MCKA 1R3JB 3REWA 2F53A 2X4OA 2LAAA 3WFHB 1RZ7L 5IQ7H 3BPNB 4H26B 3S7GA 1YPZE 4GRWB 1VHPA 4GXUN 3C5ZB 4R9HA 3GBML 2YN5A 1KJ2B 4KXZH 4U1KB 2WAHA 2KZ1B 1DBMH 5D1ZA 3RL2A 5JMOC 3TIDB 4PJHA 2ZKHL 3IGAB 4FN0A 4TUJA 2EDTA 3T3PE 1IARB 5ALBH 1A7NH 4XVSH 3MJ9H 1JPFB 4JZNA 2GJZB 2G2RA 1NC2A 5KSAA 5DC4B 4NQDB 5DRNA 3O3DB 1IEAA 4YEEA 1JGUL 5C0ND 4YQXH 1ZLUH 1PZ5A 3MV9B 4XPTH 2R8SL 4AEEA 4F33B 3VXUD 3SDCB 2EZ0D 4JCLA 2HFEA 2NY1C 4Y16A 1FBIL 5LQBH 3LH2H 4F7PA 3FB8B 3AROA 4PB9H 3L3IB 4YDLC 3LRHA 3RZCD 4RWYH 4XNYH 1CR9H 2BC4B 1DEEA 3RRQA 4PRDB 2ZPKL 2EKJA 4YXLH 2AJVL 4U6TA 1KBGH 1AGCB 4R3SB 2AV7B 3LPWA 5FO8B 3UXFA 5TGBA 3P11H 1Q9OA 2IG2H 3ZTNH 4OKVA 3K3QA 2CDEB 3SKMB 4HJ0D 4JFPA 4JFDD 3BQUB 1VFBB 4KK5C 4WU7A 4QRRA 1AXIB 1XT5A 5ISZA 4NSKA 4JFFD 5I1JH 1OPGH 4XMPL 3LEXA 4ZFZB 5IFAH 3VE0B 2BOCA 1EHLL 1FNEA 2KQMA 2A6KB 4EXKA 1AGDB 4KHXL 5FV2A 3EYQD 4YHNB 2C9AA 4KTDH 1T5XA 5EOCL 1YEJH 2G5BB 1A1NB 3MJGX 4PD4J 3LKPB 5D6CA 5I6XB 4P5TB 3MUZ1 4HUXA 4G42A 2DWEB 3ZYIA 2VLRB 2PTTB 3PQYA 4NT6B 5DSCA 5T1KB 2NXYD 3DX8B 4C4KT 1T04B 1XIWD 1N6QH 4ODSL 5DJAA 4NRXB 1FNSL 2KDGA 3HC4H 4P3CH 1UB5B 2AEPL 4TVPE 4XWOD 5IG7A 4O58H 3ILPB 4H88H 4HIJA 1CGYA 2DLTA 2Z93A 3RWCB 1NBZB 4FG6D 3QPXH 4NP4L 1MH5B 4KMLB 3TCXA 2XQBH 4UUJB 3TH2T 3RNQB 2J7LA 1GJIA 1QLEH 1HH9B 1MELA 2XKUA 1X4ZA 3W5NA 2H2PD 1YDPB 4M1GL 4U7SA 3D9AH 3ELAT 3RY4A 1I3VA 5J13B 5JHDB 4NM4H 2EO1A 5GGTA 5HI5C 5KSAC 4JY5H 5DI8B 3DX6B 2EEDA 2DI9A 2N7AA 3ZE0F 2AKRA 2VDOH 4IJ3C 2BX5A 3RVWD 3P4LA 2ESVB 5LGHH 5IV2A 3F65A 2P5EA 4DK3A 5FYJD 1HXYB 5C2UB 4EXPX 4G7VH 2QSCH 3HG1D 1P7KA 3KPRE 5EFIB 5K33A 1LDPH 1KV3A 4OM1L 2GTZB 4LF3A 2ZUTA 3ZKNC 2X4NB 3LB6D 3ULUC 4QOKB 4X8JB 1EFXD 1KGCD 2DIAA 3ARFD 1RUAL 4R96A 1P5UA 6FABH 3TBTB 3WSQH 4YK4C 4RWHA 5C0CB 1B3JA 2WP3O 3BW9A 1JYWA 4FXKB 4R2GB 1A4KB 1TLKA 5IB5A 1QSFB 1R24A 4N1EA 1KEGH 3RWHA 5TDPB 2ICES 1S78D 3S3SA 3D69B 5HVHB 1MCOH 5EZJB 3OJMB 4HQQL 2DKUA 4J6RH 4JB9H 1JGLH 2O93L 5HGHA 4OTXH 3SDAB 2KBGA 1CBVH 3CXHJ 3CPLB 1LEGB 3GO1H 4JN1L 4M48H 5DR5H 3UYPA 4M7JH 3QDJD 4G6AD 1WVZA 5C0IB 3QRFM 5FM5M 3MLSH 4U6HB 1WAAF 3SBWA 1CIUA 3H9SE 4O02H 3QUXA 4GKSB 2X7LB 5E6ID 4UAOB 3O6LH 5E9DA 3QDGD 4F2MA 1IGFH 1KPUB 4CMMA 2DQIL 3G5XB 3C5JB 3V5DB 5ICYA 1QSZA 2CXKA 2X40A 1IAIM 5F7NC 5D2NA 1A3RL 2VAJA 3KPLB 3P4OA 1E6JH 3UMTA 1BJ1H 2X9WA 2ZCLH 1X5GA 1T2QH 1WIUA 1HN1A 3RVVD 3IXAA 3QNZA 3T77A 1RFDL 1E6OL 1XGYL 1VPOL 1DBBL 3KYOA 5DJYA 2DQTL 4QHLB 4YDJA 1F4HA 5JNYA 1ORSB 2F54D 1G6RB 2DYPA 4EDWL 4KKCC 2GJ6A 1YEIH 1U93A 4JG1H 2BNRB 1LP9E 4LLVB 1IGMH 4APQA 5FF6B 3OJVC 1XF5A 4IHOA 4JRWA 3GIVB 5C7XH 3D3VA 3TT1L 1EEZB 1VADA 3F5WB 3UTSB 3KPMB 4MQ7B 1S7QB 2IADB 4UIKH 3IJYA 4BM7A 3I6KB 2A6DB 2DWDB 3AXLB 3GHEL 1BAFL 2G9HA 2NY2C 2PYED 5D7IB 4OQTH 3CMOL 5CBEA 3VGBA 5TH2B 3D39B 5KW9L 3RUGA 5ERWB 1MRCH 1KLUA 1JK8A 4UV7H 4LLUA 1GGIL 1IC7L 4U6VH 4GMTL 4L3EE 4FTVB 3HPLA 1GZPB 3N85H 3G5VA 3K4DA 4YEFA 1CE1H 3C6LB 4NUGL 5IVZA 5GIRA 2P7TB 1FVDB 2VH5H 3O4LE 1ZEAL 2FIKB 3M17A 1NUDA 4FQCL 2QSQA 1F58L 5IFHH 3RDTB 5C6TL 4HS3A 1SQ2N 3TT3L 3S36L 3QUXC 2ERJB 1NGWA 2Q8AL 1HHGB 3V52H 2IALA 2KUTA 1U3HB 4G9FB 4POYA 1ZHLA 3JWDL 5BQ7A 3BZEB 1NUNB 3WFDH 4GS7C 4X4MA 1KACB 1AKJB 4G3YL 4EUPH 4RMVA 4NZTH 2GI7A 3QQ9C 5D2NC 2QHLA 1EFQA 1F4WH 5F7HA 3LIZL 3SKUD 1EEYA 3O81A 2XZCL 3RTQA 4Q9QH 4GG8B 3SGKA 1OQOA 1KXQE 2QQKL 4D9QD 4P49A 5KZCB 2FHCA 4ZS6C 4FQJL 1ACYL 5IMLA 3HS0A 1GZQA 1X5LA 4XCYA 3HAEB 1CLZL 2HVJB 3IETB 3CFBB 3D85D 4WFFD 4NZRH 4APQC 4GFTB 4S1SH 4RBPK 1LEIB 4H26A 2FJHB 1MOEA 2NY6C 3VH8A 3IVKA 2P8PA 4OIIH 4R26L 1LEKB 1RMFL 5FM5O 4U1KA 1H8OA 1XGQA 4NUJA 1ZOXA 4XBPB 3IGAA 3R06B 2CK0H 3AM8A 5AZEH 5EN2A 4RX4A 1CL7H 4HXBL 1CCZA 3BIAX 3MC0A 5C09B 3LAFA 1YY8A 4GKNB 4NQDA 4BQ6A 2EC9U 3PWPD 2QQQA 3MV9A 3VXQB 3NAAH 2BY1A 2V17H 4OAWB 4F33A 3SDCA 3WFZA 1OTUC 3DPBA 2EIEA 1YEGH 2NR6D 2OMBA 4M93C 5T33L 1XFPA 1P84J 2R1XA 3FB8A 4RGMB 5F7EH 5BMFL 4M6OL 1K6QL 4BFIA 1HHJA 1A9BA 3ZTJH 1AI1L 5HSFA 5DMJB 2BJML 4WNQB 2BC4A 5IHZA 4PRDA 2GSGB 1AGCA 4R3SA 4R4NC 5FO8A 5I0DA 1JRHL 4PGCA 4I3SH 2GKIA 1YEDB 2VMFA 4HC1A 4C83B 5KSUA 3BQUA 1VFBA 5L6YL 3PJSB 4IOIB 1RHFA 5IEKA 4PJ5A 5M94B 5MENB 2MKLC 3GRWA 3IFLH 1TJGL 1DN2A 4FQQA 4UT6H 5JPMB 4PJ7F 1F11A 2GK2A 2DBLL 1BVKB 5ICZB 1T2XA 2OZ4L 1B0RB 2G5BA 1A6UL 5HHVL 1A1NA 2Q8BH 3VFMB 4P5TA 1S9VA 1TJIL 3RTQC 4NJAH 1P7QA 3V2AR 4ZO7A 4LSUL 4XNXH 2PTTA 4NT6A 5DJCB 5T1KA 3RY5A 4FFWD 1IGJB 5BZDB 2P5WB 1BFSA 3DX8A 1T04A 1U3ZA 1JHKL 5IJKA 1B4JH 1UB5A 3JTSB 1ZLWH 1AHWB 2VZSA 2QQNH 3P3YA 1CDUA 1RUPL 2XOTA 3I2CL 3ILPA 3RWIB 3MNVA 2VZ3A 1N5YH 2VL5B 1KIQB 1A6PA 1N5AB 3RZWA 3BPNC 5HHQB 1NBZA 5H2BA 3QIBD 3UC0L 4L4TA 4PV9A 1REIA 1MH5A 5JXEA 1I9JL 3MSPA 5F9WB 1A47A 2B4CC 4Y4HD 3AM8C 1UM4H 3I75B 3KJ4B 3CSYB 4L9LB 3K46A 4XNUL 2I25N 2YMXL 4XPHL 4XXDB 4IRSD 4Y19B 5TF0A 4DVBA 5E7BA 4YDVA 1ZLVH 5DI8A 3DX6A 4UMGA 4GG6E 4FS0A 3SDCC 1A6WH 4NZUL 2CPCA 1DSFH 4PRHB 1GPOL 3QAZB 3S37L 2UYLB 2YUWA 5D96B 5EFIA 3OKDB 4HV8A 3O9WB 1WFTA 2GTZA 3DUSB 3IDXL 1UGNA 4QOKA 5J8OA 1Q9LB 4X8JA 1U2HA 1NMCB 3T0BA 1AY1L 3KLDA 4KXZI 1F4XL 3TBTA 1P6AB 4POZD 5C0CA 4X6DF 4P48A 3HI1B 3VH8G 2AEIT 3BQUC 2GY5A 4GAYA 3DXAD 1I8KB 3FFDB 5GGRY 1FIEA 5F1SA 3U4AA 5TDPA 3KYKL 4OFYA 3D69A 4G6MH 2ARWA 5EZJA 1FO0B 2UVEA 4PS4L 1G7HB 4PRPD 2ZCKH 3CPLA 1FYTD 3V5KB 2XXCB 4NNYB 3ZDYE 5C0IA 5I6XC 4GBXD 4P5TC 8FABA 4U6HA 2EYRB 1U8MB 1QFWL 1PEZA 3DURB 3RVUD 4GKSA 2X7LA 4X5LA 1BPVA 1DBKL 3TVMD 5HYEA 1AJ7L 3E6FB 4E41A 4NC2B 3IKKA 4YUEL 1LQSR 5IJKC 3O3UN 5T5NF 3V5DA 3SQBA 5T3ZD 3BGMA 2C1OA 2NW2A 2CRZA 4XP1L 2ZUQC 1LWRA 4N5UA 1X5XA 1RULH 1BFVL 3KPLA 4ZXBB 5CEZE 3UX9B 1NCAL 4AEFA 5E56A 4R7NB 1QD0A 1CN4A 1W72L 4IIQA 4OZGA 3BN9D 5J13C 1OM3H 3RI5K 5C0EA 1ORSA 2PCPA 4PGDA 4X98B 1YY9D 5GS0H 4HBCH 4KRPB 5AD0B 1ZA3B 1IGIH 1QNZH 1RIHH 5T1MB 1H5BB 4WFEE 4JANB 3RPKA 5ACZA 3DECA 3STZB 2ZUUA 1ULVA 2W9DL 5DVKA 3GIVA 2VXQH 2AJXH 5ILTH 3F5WA 5DFVC 4WU5B 1GVIA 4ELKB 1M4KA 1JWUB 4IRZH 5JORB 3I6KA 2DQFA 5FA3A 2A6DA 4YAQA 3AXLA 3PWJB 5D7IA 1BZ7A 5ALCL 4XNZB 2O61B 5EBGA 4N0UA 4U1HB 4V2CB 4WUUE 4K7FB 5TH2A 3DJ9A 3GSWB 1BD2B 3QDHA 2H2SC 2UWEE 1NAML 2W38A 2Z0BA 2BSRA 4FTVA 1H8NA 4H0HB 1CFVL 4Z7WF 3FN9A 5HVHC 1N3NB 4HZAA 4XVJL 3S96A 2BVUA 3PP4L 4G43B 3C6LA 1AO7D 5MEQB 5IGXL 3SDAC 1CFTA 2NZIA 1I4FB 5E8DH 2OR9H 3OMZA 5B8CB 1ZSDB 1KYOK 3RDTA 3TBVB 4PB0L 4I4WA 1ORQB 2HWZL 4HUKB 2VZ1A 5E2TH 2OJZH 4OCXL 3HTLX 4JRXB 5KN5A 3S5LB 4UAOC 2BVQB 1HHGA 4KAQH 3I3EA 3W2DH 2YOCA 1DN0A 4G9FA 5JR1H 3HNVH 4P2QE 1DCLA 5CILL 4X9GA 1UM6H 3MRQB 4GLRH 1J8HD 4OGYH 3T0XA 4UOJA 3QI9B 4YXKL 4XRCB 2V5MA 4DVRH 3LHPH 3SDYL 4KK5D 4Q6YA 3BKJH 1ZWIA 4JAMA 4OZ4A 2OYPA 3B5TA 1W0VB 2CIKA 3HZYB 3S35H 2YPLD 4NWTH 2MCG1 1DQTA 4DTGH 3T4AB 2Y07L 5GZNC 4OM0L 1DLFH 2X89A 4OCSL 1R5VA 1WQVT 4BH7A 5EO9A 2HKHL 3HAEA 4AH2B 2X10A 1Z9SA 3IETA 4XHQA 5HHOD 3CFBA 5B38B 2ZOLB 1XF3B 4WI6A 3TA3B 1FZKA 2Z31B 4YHLL 4IDJH 1LEIA 2FJHA 3EJYC 1HSBA 3B9VA 3NCBB 3IDNB 1AIFB 1LEKA 5I71C 4KROD 3T65A 2IFGA 3TJEL 4XBPA 4CKVX 5CJOL 3AS1A 5F7DB 2ITCB 2VN7A 4M6AA 1MWAL 4DEPB 2J8UE 3VXQA 4JFXA 1B90A 4NO2B 4LSQL 1D9KD 4GKZA 4OLYL 2R0KH 4E0RB 4MJID 3AFLA 5DTFB 4KTEH 5E4IA 5AAMA 2OMNA 3GSOB 1RIVH 1L0QA 2NYYD 4LBEB 5CSZB 2DDQH 2APTA 3C6LC 4L1DA 4YC2B 3VDAA 3WHE0 3FQWB 43CAB 4Z7VA 4WNQA 3EO1B 1SM3L 4NQCE 5A2JH 5EPMA 3I9GH 2CDGA 3RDTC 3T1WA 3ALPA 2Y36L 3FRPA 3SCMB 3VWKB 3H9ZA 2ERJC 5ITFB 5ACMA 4C83A 1A7QH 4IOIA 3ARDB 1OSPH 5EOTA 5IJVA 1WBXA 2NXZB 4HIXH 4AG4H 3DYPA 4LAQL 1NCBL 4XP5L 1YZZA 5CLWA 5K9KB 1BM3L 5IUSA 3MRBA 2J8OA 1BVKA 5ICZA 4DOHE 2V7NA 3P30L 3PGFL 2IFFH 3L7EB 3QEQA 3VFMA 4AL8H 2IQAB 3VCLB 5E1HB 4I77H 3WDJA 3U4EB 4HEPG 4YIQB 4MVBC 5DJCA 5BZDA 4Y0GA 4LLQB 1JN6A 4ZFOL 4ZTPL 2ADGA 15C8H 1XMWA 3QA3B 3JTSA 4HF5L 4ELMB 1AHWA 4P2RE 2FX8H 2ZG1A 4I0CC 4YR6B 1JNLH 2VL5A 2YPKA 3WXWL 4PJ9B 5HGDA 1OAYH 5DK3A 5GGUB 3P77B 4K3EH 5LVEA 2WBKA 1KXVC 3I75A 1M7DA 4K9EH 4WI7A 4IDLA 5GRVL 5E7FA 5F88B 4XXDA 5DD5H 4NO5A 3WNKA 3OKOA 2YA2A 3KVQA 3PWNB 1QBLH 4HGWB 1EX0A 1NMBH 2IAMD 2BNUB 4JQVA 2WLZA 2X2YA 3H0TB 3DIFB 1ZS8B 3M1BB 1J1OH 3CJJA 3SJVB 3FHAA 4QYOB 5T3XL 5HYJD 3QXAB 3H42H 2CKNA 1RU9H 5DC9B 5KVEH 4RGMC 4MZ2A 2FNBA 2UYLA 3OKDA 4AEHL 3CGTA 3O9WA 4YHZH 2I27N 4NQXB 3IF1B 3HAEG 3VXMB 4JO1H 3B5GA 3TBSA 1I1YA 2P5ED 3NIDE 1T03L 4XVUC 3FO0L 2MQ3A 3FO9A 3UJTL 3ARPA 4GMSH 3BKCH 5I74B 3TF7C 3HI1A 4XMLL 1PLGL 4CJ1A 1QLRB 1K8DB 4X6EB 3HFMH 1CL7I 4JFYB 3FFDA 2NX5E 2NY2D 3IFOB 2Y9RT 3FRUB 1U3JA 5IWLA 3BO8B 1FO0A 2CQVA 2C1PA 2K9UA 5SWZE 1NJ9A 5C07B 3G5ZA 5GRWA 5DEGA 3O6FA 2APVA 5CKGA 3V5KA 4NNYA 4TRPL 1M7IA 4U2ZA 4PJFF 2EYRA 1UWEH 3SKJH 2P8LA 1AP2A 3E6FA 3KYAA 4OT1H 5GS3A 4GRMB 2EIZB 1RUQH 4GAFB 1AHWC 3DVGA 5BCAA 1L0YA 1EDQA 3DARA 2PR4H 4AK1A 4K8RC 1F6FB 2FGZA 3SN6N 2LQRA 5E9DD 1GHFL 4KQ3L 1MFCL 3VXSE 2YBRB 4ZXBA 3MLWH 4D9RE 2B2XL 1E0OB 3FRPG 4UT9L 5F9WC 5J1SC 4FXGB 4M7KH 5C0GB 1CICB 3QHFL 5MEOB 5DHVB 3KJ4C 4JFHE 4L9LC 4XC1L 2W9EL 4JPKH 1VFAB 2H26B 1G9NC 3QQ9D 5E8EB 2VL4A 2A83B 5AD0A 1JGVH 1LO3L 4D8PB 2MCPH 4PP2B 4JQVC 3BISA 5T1MA 1EZVX 1H5BA 5JQHC 1J12A 4YPGB 4JANA 4PJGF 5A43C 2BY2A 5C08B 4L8BB 4XZUA 1WZKA 2YD7A 3QAZC 1MHHB 3ZE1E 3KYMB 5C9JB 5D96C 1JF1B 2QADD 3WJLA 1JWUA 3M07A 3DI3B 3O9WC 1GGYA 4RGNE 5F70A 1YNKH 5L88L 3VGFA 2NY6D 3PWJA 1UVQB 5I1LB 2K3TA 3ZSSA 2VXSH 1NMCC 4BYHA 3ZDYF 4NHCL 3MR9B 4U1HA 3D3VD 4YXHH 2VITB 3DETC 1QRNE 4NQSA 1X4XA 3MYJB 5C3LD 4M6MH 2V7HB 4XCNB 3T8XB 3DO7B 7FABH 4DW2H 1JFQL 2CIIB 5F1IA 3VFVA 3WCYA 5IWLC 5ITBL 1HSAB 3NFPB 4JY6B 1MCWM 4U6XB 1DFBH 2I24N 2R0ZL 1OTUD 2IANE 2ZOKB 5KTEH 3LRSB 2IGFL 4NCC1 1HQRA 1ORQA 2EDOA 1ZLSH 4X4ZA 2BSSB 4R8WL 3S5LA 3ZMRA 1UXWB 1MVUA 4UU9B 3TBYB 4I18A 3KXFE 3LRGA 3MRQA 4OGZA 4R4ND 5C0BE 3QI9A 4Z0XB 3RGVB 4PRNB 4XRCA 4M62H 4QXUL 3CSGA 5GHWH 1D5MA 1CD9B 4ZXBC 4NKMB 5JPNB 3CFDA 1W0VA 4WW2F 5B21A 2R0LH 4ZFGL 1DZBA 4Q9BA 2G75B 3QEHB 4Z0BL 3VWJD 3B83A 4XB8A 2OTUB 5F44A 3X17A 4ZOEA 1E4WH 4OFVA 1HHIA 1ZK9A 4KRPC 5EUOF 5F9JA 3PXHA 4AH2A 4MDIB 5HI3C 4M5ZH 5B38A 2ZOLA 1XF3A 1H5BC 4GW1B 3TA3A 3NFNB 3MRIB 2Z31A 2DAVA 5FDYA 2WIIB 3VI4E 4K7PH 4L4VE 3X13A 3INUL 3JWOH 1AIFA 2P49B 5FOBB 4ZPVB 3ZLQC 4LSRL 2C3VB 5HHMB 1W72B 4V1DA 1SEQH 2D7MA 1NCDL 5F7DA 4UNTA 2JKXA 3UJIL 2EKSB 2ICWJ 2AABH 2NTFB 2D0GA 1FGVH 1JZ3A 4EOWL 4FQ2L 4I1NB 3C5ZD 4Q0XH 3RA7L 4XNZC 3WDHA 2R9HC 4LCYB 4XTRD 3GSNA 3OL2A 4JKWA 5TF1H 4NO2A 3C8KB 1VSCA 1ZAGA 4E0RA 4JEGB 1J0HA 3BPOB 3MUY1 3NFSH 4MNGB 1RVFL 4PJAB 5DTFA 7CGTA 5JQ6L 4JHWH 2AGJL 3GSOA 4X83A 3I50H 4U1LB 5BXFB 3MV9D 3WD5L 4MA3B 3FQWA 4W6XB 4X99A 2E9WA 3GMLB 3CVIL 3NIGE 43CAA 2EC9T 4MZ3A 4P2YA 4YPJA 4XPGH 3Q3GB 1DUYA 1ZKAA 1DQLH 3VRLE 2DQDL 3BSZL 4Z78B 2C26A 4Y88A 3SCMA 2BHYA 3VWKA 3Q48A 1OTTD 3GJEA 1XCQB 4LPCA 3EO9H 5I18H 2FH8A 4I18C 5KJRL 1QHOA 4NQEB 3HKFA 3TPUA 1MEXH 1JPST 1T21B 2EEAA 3QI9C 5K9KA 3I6LE 5D2LE 1CLYL 1Q0YH 3OQ3B 2J88L 4KQ4H 2JF1A 3BRGC 3C2AH 3DTXB 2BFVH 3FFCD 5JW5B 2E3VA 2PTVA 3UDWA 3JVGA 3M8OH 3U4EA 1CQYA 3CAFA 5DURB 4MCYB 4DQOL 4OLWH 3TPKA 1PKQA 1OW0C 2Z92A 1N8ZA 4Y4FB 3IFNL 3VG0L 2Z4QB 4P5TD 2YD8A 2J8UF 1QSEB 3QIUA 2YD2A 2VLRD 4JM2A 4RDQF 4YR6A 2FR4B 4PRBB 3TA3C 2Z31C 3SE4A 3IFPB 1F2XK 3D0LB 1FORL 4MB3A 3NCJL 1P7HL 5GGUA 4HWUA 1OLZA 2X4QA 4UOW0 3EYSH 4XAWL 3S5LG 4KH2A 4LSDA 4GLRI 2VERN 2EE6A 3KDMA 5E08L 3IRPX 1WWCA 5F88A 1FNGA 4HWEH 4JDTH 4DFIA 5DD1H 2EDQA 1JF5A 4LPYA 4HGWA 4DEPC 5FYKH 1U95A 2R2HB 3I3BA 5EO1B 5I8EB 2BNUA 1F42A 3A6BL 3H0TA 1FFOB 4NKOB 3DIFA 3K2UL 3MV7E 4KMTL 2OTPA 3QWRA 1A4JB 1CYGA 3O45B 1T5WB 2EXYC 4QYOA 4Z7NE 5JHDD 1MLBA 3QXAA 3IDYB 3WHE1 1S9XB 3U36B 3F6LA 5LBSL 4YC2C 3ULVE 2E27H 4AM0A 1MWAB 4NQXA 5GGSB 3IF1A 2ESVD 4FFVD 2JK5A 3GBLA 3VXMA 5B38G 2UZYB 1A1OB 3RU8H 1NUGA 5DFVD 4MNQA 3SCMC 3VWKC 5CINH 1U41A 3AAZB 1K8DA 4X6EA 5C0AE 4WW1B 5FKAB 5L8KB 1IT9H 4JFYA 4KY1H 4GAJL 5DD3L 4JQXA 1TTUA 2NXZC 4QGYA 4QOKD 1BGXL 3IFOA 4QRPB 3O2VH 1EAPB 1Z9MA 2O5ZL 3FRUA 4NM8L 4PGJA 5EUKB 1X3DA 3VFNA 5FFLA 3LN5B 3WV0A 4G6KH 1CVRA 5C07A 1MFEL 1YJDH 1HH6B 2P43B 2H2SD 1YEEL 4R2GD 2NY7L 1QSFD 3PXJA 2FATH 1SYSB 1HYSC 3G6JF 3UDWC 5IESH 4Y89A 1XGTB 4FFZL 2VE6A 3MLZH 3JBG7 5DFWH 1QO3A 4LPTA 2F8VA 3KPSA 3SDAD 4LVNB 4ZDHB 4GRMA 3EYOA 2EIZA 4DGIH 3MRDB 1FRGH 3NCFB 1JPSL 1MCKA 3TNNB 3DGGA 3QIUC 1QQDB 3AREB 4BQBA 2AEWA 2XQYK 2VKXA 3SE4C 2JB5H 3HZKB 1NGQH 1TPXB 3MRHB 4CVWA 1B2WL 1II4E 2A38A 1I1RA 4XH2B 4LFHG 2H3NB 3RWGB 4FXGA 5C0GA 4QF1B 3A0OA 1CICA 3MUGB 4FQ1L 5I1IL 3TJHC 5MEOA 4H5SB 3PGCB 1C5CH 4MD0A 5B4MD 3OTTA 2H26A 4MXQC 2YD1A 3VXUE 5E8EA 3GSQB 1I1AA 3GIZH 4M00A 4GKOA 5I1DB 2A83A 3CDCA 3JSSA 1GIGH 3NCEB 2QKIA 3NIDF 1DL7L 4D8PA 1G7JB 3SDDD 2XWBB 2YZ1A 4TSBL 2GHWB 5CUSH 4YPGA 1BQHB 1UM5H 5E24E 3QNXA 4X9FA 5LGJB 5TFSL 4C54A 4EI5D 3PL6B 5EULV 1NAKH 2R4RH 2BRRH 5C08A 4MA8H 3HMXA 4L8BA 4R4BB 4QCIB 1G0XA 3RNKB 1JL8A 4CVUA 1J0ZA 4HUUA 1OL0A 1EGJA 4DCQB 1ZT4B 2BNRD 2KPNA 1Q9KA 5TE7L 2J6EH 3KPOB 4JFDE 3EJYD 5I1LA 3BP4B 4G8IB 1RUMH 3MR9A 4JFFE 3UTQB 3BUTA 2HG5B 3UTSD 3U2SB 4XCNA 1FPTL 3T8XA 3DO7A 3BH8A 4J4PC 4M1CC 3T08A 4ACPA 3LD8B 3RHWF 2Z8SA 1QKZH 4JQXC 2OP4L 5HHXH 2CIIA 3P0VH 1SJHA 4F8QA 4KVNH 1HSAA 3Q1SH 1OP9A 3NFPA 4DGVH 4U6XA 3D39D 2ZOKA 1EO7A 4LSPL 3LRSA 4FTVD 2BVYA 1MCFA 2FB4L 3CLEL 4FZEH 4LCIL 4U1SA 3RVXC 2BSSA 5CIPB 5BZWA 4LKCB 2VISB 4XI5C 1LNUB 1OAKL 3P9MB 1W0WB 1JYXA 4UU9A 1HWGB 2ITDB 5GGVH 5AEAA 2WV3A 2CO6B 1G7LB 2ZSWA 4WFHE 4Z0XA 4Q9RH 3NZHH 4PRNA 2HFGH 3WIHA 2BOBA 1FH5L 1U3HD 2VDKL 4HCRH 4KK9D 4NKMA 4G9FD 3WLWC 4LLDA 3OKKB 4EVNA 1WFOA 3ZE1F 1IM3A 2EE2A 4YFLI 5I0ZA 1CICC 4YO0B 1AKJD 2G75A 2VB5A 3QEHA 1W0YT 2I5YL 4YE4H 4KMQA 1LO2H 1UZ6F 4HMEA 3U1SL 3AVEA 3L3GB 1Q8MA 3G6AB 4XX1E 4GQPH 5CJBA 5FYJE 4P23D 4GW1A 5CFHA 4BFBD 5KZCD 3HG1E 1U9KA 2WIIA 2OQJB 5LAXB 2VIRB 4OZIA 3FB5B 3UPCA 1GL4B 5GSRB 3PHQB 4D9LL 3I84A 1PZUB 2EDRA 4LQ1A 5I1AB 4ZPVA 4HGKC 1IGCL 2HVKA 5HDBF 1KGCE 1ZVYA 4YDKL 4YDIH 1IQWL 3F12B 3D0VA 5DRXA 2NTFA 2VDLH 4U31A 3WXVH 2Z8VC 3ARBB 3QCVL 1RIUH 1T1ZB 4CVZB 3IU4L 4LCYA 2L7JA 4L5FL 1KJMA 5IEHA 5FYLL 1CXEA 4L29A 2NY5H 5BRZA 4RAUB 4MNGA 4PJAA 5C09D 3EKCA 3AY4A 3MOAH 1W8NA 3C08H 1BECA 3O3EB 1A6AB 5C6PB 4OFDA 3QDJE 4BELD 5HYIA 5BXFA 4PJDE 2Q20A 1RY7B 1J8KA 2Y06H 3MLUL 3GMLA 5E2WL 4PLNC 1F90L 3QDGE 5E2UL 5CWSB 4M61A 3E8UH 3WS3A 2EDYA 2UVFA 5DS8B 1F13A 4A6YH 1EBAA 1IL1B 1XCQA 3LKSB 2VUOA 4PJBA 3DV4A 3QRGL 4OJFL 4S2SB 1R3KA 4PV8A 4FZ8H 3CH1B 1H15A 3OAUH 5J1AB 2RGSA 4OSUL 1RZKC 3RGVC 1MFNA 5IROA 1GGCH 3NCYP 3VI4F 2DM4A 1JYVA 5GISH 1ZGLA 4UT7H 4Y2DB 3TO4B 5MEND 1CS6A 3HC3L 1CXIA 5JW5A 2D7QA 2EYSB 4UDUB 1IBGL 5FGCE 2E6JA 1F00I 1JHTB 4MCYA 3KR3H 3OB0K 1S7WB 2A74A 1K2DB 2ADFL 4Y4FA 4G8FB 4ORZC 2HTLC 2Z4QA 1MJUL 4R90H 1QSEA 2PF6A 5C2BL 1OCWH 1MJJB 4JREC 5F6HI 3D0LA 5I1CH 3QH3A 2P5WD 5FAAA 5DMKA 5DRWB 4W6YB 3FQXB 3E6HA 4X6CF 3BMWA 2VAAB 3MRNA 2PYEE 3J7HA 3P4NB 1FIGL 5CSBA 4PGEA 1E4JA 2DKSA 3U9PH 5BS0B 3LS5L 4UBDD 4OB5H 1NBQA 1I1CA 1CLOH 5EO1A 5HYSA 2DQUH 1KB5B 3VRLF 1FFOA 4NKOA 4Z7QE 4JE4B 2UUDK 5D7JA 1S7UB 3B43A 1CG9A 2ZWLT 2EDWA 4MQSB 3O45A 3AY4C 4Y19D 4XPTL 1NL0L 1CF8H 3GGWA 3C5SA 3U36A 4OZHE 4YHPB 5F8RC 5D2LF 1MIMH 4K7PY 3LH2L 1AGEB 3MRGB 4TUKH 4PLOB 1A1OA 1BFTA 4PRHD 4OF0A 4XNYL 1UZ8B 3LN9A 1CR9L 2AERT 1I8LA 4WW1A 2E6PA 5D7LA 1PKOA 4QRPA 5BO1L 1EAPA 2VXVH 3R8BB 3ZTNL 3S3JA 4NFBA 4ZO8A 4PJ7B 3LN5A 4W68A 1T6WA 3DETD 4HIHA 4N8PA 4ONGH 5IROC 1IZKA 1HH6A 3R1GL 3DLQR 1NKOA 1OPGL 1GSMA 5IFAL 1JZ2A 1D5IH 1SYSA 5ICXB 3MOBH 3ESUF 1V3LA 5IVOA 4KTDL 1XGTA 2V2XB 1U2CA 3ZT6A 3LMJH 1BWWA 2HH0H 4WFFE 2ZZUT 3SE8H 2HT3C 4ZDHA 1PQZB 4TOYH 4Y4FC 3MRDA 4O2CA 1CTNA 3TNNA 4X7DC 1QQDA 4JHZA 1R6VA 1HXMB 1N6QL 2D31A 3AREA 5LCVH 1WJ3A 3MNWB 3HZKA 4Y4KB 3HC4L 4P3CL 5I15L 3MRHA 4QHNA 5LWYH 2OL3H 5F71A 4O58L 4XH2A 2H3NA 4H88L 1UT9A 2D7OA 2CKBH 2D2OA 2J4WH 2BY3A 4QF1A 5DGQA 4C4KO 2VQTA 3MUGA 4WJ5A 3PWPE 3GNMH 4H5SA 1NANH 3EO0A 2EDKA 5KAQG 3O2WL 1L6ZA 3GK8L 4TUOB 1FL5B 3GSQA 5JOPD 5JXAH 2FHBA 5D7SH 1QLEL 1K4DB 3QHZH 1N2RB 2XWBA 2GFBB 3D9AL 5J3HD 1BQHA 5DQJB 4CVXA 4NM4L 3OHXB 1R3IH 3VFRB 5LGJA 2MNUA 4L8SB 3PL6A 2W0LA 2ZG3A 4X6FB 1XF1A 4R4BA 1JTTA 4KRPD 1HKLH 3RNKA 1A7PH 5A3IC 3GBNH 1G84A 1V05A 1BIHA 5CJQH 2D03H 3QUZB 5HI3D 2AI0L 1Z6JT 5LGHL 4HH8A 5HBBA 1QFPA 3WNNA 3KPOA 2YD9A 3VD7A 5DK0B 2HT4C 3UTQA 3BAEH 4X6DB 1JVKA 2NTSP 4P2OA 1Q72H 3QDMB 5LGKA 1LDSA 25C8H 4HPOH 2W1NA 4UDTB 6FABL 4OCLC 4ODXA 3DX9B 1OGAA 2JCCE 3F62A 4CW1B 5K9OB 4WV1B 3DV6A 1KEGL 1BD2D 5KVGH 2V5TA 3BWAB 4DKFL 1MCOL 1NH6A 4WEBH 5HYSG 1WWWX 4J6RL 1JGLL 1WAAA 4C56B 4KUCD 3V6OE 1UH2A 4ODUA 5CIPA 3BZFA 2VXTH 2DLIA 2VISA 2RAMA 4OCNC 3NMEA 3W9EA 4LVNC 5JDJA 4AIOA 4WHDA 3SKOB 3ZKXB 4LKXA 1A1MA 3AREC 1JZ5A 4JRXD 4YFLF 5IMMA 2LE9A 1IGFL 2VLKE 1TPXC 1Q1JL 4NRYB 3ZE2F 1FCCA 4PRIA 2DBJA 4NN7B 4AENB 3B9AA 4B53A 4AT6B 3JWNC 3QQ4B 2FEEI 3QXWA 1A5FH 2X4PA 4S1DD 4OIBA 2Q76B 3L3GA 3WKMH 4K7PX 1T0MB 2ED9A 3I6GA 2AQ3A 4OBSA 3EYVB 2P24A 4XT1C 1U42A 2MQCA 4M1DH 2OQJA 1AQDB 4RA3A 2WUCH 3NABH 4MHHG 3S88H 3PL6C 3O2DH 4PJCE 5I1AA 1YEIL 3G6DH 4JG1L 3U7YL 2W59A 4WIQA 1IGML 2WNGA 1DQQB 1PYWB 1V7MH 4WDIB 3F12A 4BSJA 3TA3D 2C5DC 2Z31D 2DTSA 5HI4C 5C7XL 1BOGA 4K3JL 3DXAE 1T1ZA 4CVZA 4UIKL 1XCTB 3FT4B 4J3SA 4AIXA 3LD8C 4RAUA 4PRPE 4JY4A 5JHLH 3O3EA 4Z7WB 5I2IA 1WZ1H 4ZG1A 3O0RL 5DQDH 2JJUA 4RNRB 1MRCL 4OGAC 4J23A 5EO0B 3UYOD 2AK4B 3BYTA 4KPHH 4DWHA 3N85L 3SY0B 2M1KA 4NKIH 2PXYB 3LKQB 3P4MB 4NN5B 5IVXB 1BQHG 5IF0B 5DS8A 2VH5L 3SGDI 2GSIB 5T3ZE 3V5HB 4OF7A 4UTAH 5TDNB 1IL1A 1JI2A 4NC1C 1K4CB 3OAYK 1TZGH 4S2SA 1XZ0B 5FCSH 3BRFA 4DZBB 4XWGH 1HZHL 3CH1A 4S1QH 4PUBH 3DWTA 3UCRA 3V52L 4IMLA 4PBVC 3EFFA 4HWNA 1NFDB 4M9OA 4K3HA 2FHFA 3ARDD 3TO4A 1J0IA 1JTOA 3WFDL 4MNHA 3C9NA 4UDUA 5FYKU 5IFJB 4NZTL 1LGVA 2X4UA 4RIRA 3JUYA 1TZIB