2YSTA

Solution structure of the third cadherin domain from human protocadherin 7
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
119
structure length
119
Chain Sequence
GSSGSSGNDNSPRFEKSVYEADLAENSAPGTPILQLRAADLDVGVNGQIEYVFGAATESVRRLLRLDETSGWLSVLHRIDREEVNQLRFTVMARDRGQPPKTDKATVVLNIKDENDNVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the third cadherin domain from human protocadherin 7
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Protocadherin-7
total genus 12
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 2ystA01
2WCPA 3LNHA 4AQEA 4ZMNA 4AQEB 4XXWA 1WUZA 4AK1A 3K6DA 3UBGA 3UBHA 2QVIA 1NCHA 5CO1A 2O72A 5KJ4A 5DZVA 1NCIA 4AQ8A 2YSTA 3LNIA 4XXWC 2OMWB 3LNGA 2OMZB 4AXWA 3UBFA 5CZRA 2A4EA 4APXA 1ZXKA 2V37A 4ZMOA 4AXWB 4ZMLA 2EE0A 3LNFA 3PPEA 1NCJA 1SUHA 3QRBA 4ZMQA 1NCGA 4NUQA 2QVFB 4ZMWA 3FF8A 4OY9A 1EDHA 3K6IA 1ZVNA 3K5SA 2OMYB 2OMVB 4ZTEA 4NUMA 1Q1PA 2OMTB 4ZMTA 4ZT1A 4AQAB 4ZMYA 2YQGA 4AQ8C 4QD2E 5JYMA 3LNEA 3MVSA 4AQAA 4ZMXA 4NQQA 2OMUB 1FF5A 1O6SB 3Q2LA 2WHVA 3FF7A 1L3WA 2OMXB 4APXB 4ZMVA 3K5RA 3Q2WA 2WD0A 4ZI8A 3K6FA 2A4CA 4ZMZA 1OP4A 2X2UA 2WBXA 3LNDA 3Q2VA 3Q2NA 5JYLA 4ZMPA 4NUPA 1WYJA
chains in the Genus database with same CATH superfamily
3BX7C 2EILB 2J8UE 3P9LA 4Z7NB 5J5EA 2NY2C 3CFBA 3ZE2E 2PPAA 2Y2WA 3QQ9D 3QA3B 4KDVA 4NWUH 5IB1A 1GTNA 3DUSB 4JHVA 5JZ7D 3AJ7A 5EORH 4NWTL 3KS0J 4PLKD 4DVBB 3VFNB 4CMHC 5D4JA 2BC4A 3MBXH 4UILL 1ZHBA 4EI5A 1BZ7A 3RWIA 1FVCB 1ODUA 3BPLC 1XGYH 3OAYK 2Q3ZA 2D3JA 3UPAA 1ND0A 4Q58C 4H88H 4MDIA 1NC4D 3BT0A 1YYLH 2CKBB 2BP0B 3ARFC 1EJ6A 2W1NA 4G7VL 5CN1A 1J5OL 2YXMA 1M9SA 1U36A 3I6KB 4Q7DA 4X4ME 1W6WA 1JSYA 3DARA 3VXUB 2EYSA 2MMXA 2X6MA 4R8WH 4TTGA 3QIUA 5I5IA 3TCXA 4ZW5A 3K0YA 3QUZA 1ZGLB 1WRFA 4O4YH 3Q9PA 2XZQL 4AVKA 1GGCH 4I88A 1L9TA 2MCPL 5DMKB 1H15B 3NIFF 5CGBA 1OTUD 1SUHA 2AKRA 1DBKH 5EBLB 5ECGA 3UJJL 1MEXH 3GF8A 4X5WB 4HLJA 1AXSB 5HGBA 1NGZB 3EJQA 4HEMA 4NQXA 4N0FA 4U6XA 1S9YB 3TN0C 2FIRT 3F65A 4OV5A 5EDSA 1GYAA 3VG0L 3FN0H 1JD9A 4FFZH 4NC1E 4MYWB 3SDCD 4WK0B 3VWJC 1ZDSA 1TENA 3OC8A 1QWNA 3S35L 2BCKB 4MDIB 3HG4A 1H3XA 2VE6B 4GW4A 4X4XA 3FQXA 4MRCA 2BFGA 4HKBB 5DU7A 3X1GA 5HDQH 5A7BA 1AZRA 3FYIB 4HXBH 2MNJB 4HUXB 4QCIB 1RHHA 1BIIA 3SGKC 3T6WA 4WEUD 5ADPL 1PLGL 3N44B 1ZGLP 2X42A 1NPNA 4WV1C 1F56A 2PW1A 4IJ3C 3MACH 3SZ6A 4HK3J 3QDME 4R9HA 3PQYB 2BNUA 1E5ZA 3MRDB 3FTWA 4U0RC 3ZKND 3HZKB 1INEH 1IC7L 1X6LA 3KPRA 2DDQH 2V8MA 1TJIL 1QSVA 2VZVA 3FCUB 1DN0A 3O3UN 5KSBB 3K6OA 1FZJB 1PG7W 1J0YA 3T6VA 5BZDA 2LTQB 4EIUA 4JRYB 3AREC 2FWUA 3PXJA 2CIKA 1WIOA 2GJ6D 2KUTA 3ZHKA 3ZHLA 3ZTCC 3PNWB 1N64L 3DX3A 5EC1A 4F5CE 3HE6B 1BMWA 5CFAA 1M53A 4FFYL 4JREC 3UGXA 4YHLH 1OP5K 4ZZKA 1GCYA 3GSNH 3H9HB 2F7OA 4G59C 5A6IA 2AV1A 4U1GB 1QVOB 1M7DA 3BIAX 3MJ7A 5EBWB 5EIIB 3QJHB 3RX5A 4AEIH 3KWVA 1JFQL 5JW4M 2ZSWB 4NP4L 1RUPL 3VFWB 1DQML 4FNLH 1AQKH 1C7SA 1RIUH 1WUZA 4P07A 1ID2A 1K2DA 3IYLW 2CXGA 4JL1A 5I17B 2KQMA 3SDAB 5CJQH 4APQD 1C1EL 4D8PA 4FN0A 5F3BA 1I8MA 3KH4A 3ML8A 3ROLB 4LESA 4K5OA 5KVEH 1KCUL 2P42B 5D7LD 5AKVA 1FH5H 3NYKA 5FO7B 4FQJH 1GCFA 4TVUA 2JXMA 3BH4A 4PB0H 4PJBB 5CEZL 4HC1H 1CICA 3GB7B 3D4ZA 3WE6B 4TKWA 2WIIB 1IGMH 3I9PA 2R2EB 4U1MA 5DLLA 5HJDA 5C07E 2IF7A 2X9ZA 3SE8L 4K3EH 4N24A 5I1DA 1HI6A 3CDFA 1CO1A 1OLLA 2VABB 5CXPA 1XGPA 3DYMA 4L1SA 4MXVF 1MCWM 4UT6A 5IMOA 5HDBF 5AG9A 1MCOH 4FC3E 4GRWF 1GL4B 3S3JA 1CFNA 2PYEB 3D12B 4YUEH 4UQEA 4CRPA 2K7QA 1E40A 4EUPG 1KV3A 3BO8A 1A3RH 5GRZA 5G4OA 3O3EA 4JPQA 1W0VA 5DGQA 2JIXA 5DRWB 1S7RA 2DQFA 4HHAB 1O9ZA 3HAEH 3VGAC 1P7QA 2H1PH 2DD8H 4ZFGH 3O6FA 5JW4N 1JCKA 3V6OA 2QKSA 3MRJB 5HYSA 3UPRA 4LEXH 3OPUA 1H8OA 1G7JA 1OCWH 1NGQL 4Y5YB 2YAMA 3KYKL 4BKLB 4JFDE 4K23H 5D71H 1QI3A 5HYFA 2Z4TA 1KTRL 1KJ2A 4O51A 4ONHB 3P3RA 3L17A 1X4XA 3DETD 5DJCA 2WD0A 3VXMA 3ZE0F 3MLWL 4OW6A 4H20L 5ACZB 3BZ4B 3KHOA 1B4JH 3D08A 2BZ7A 5KBNC 3AADB 4L0YA 4AMWA 3OX8A 1N6QH 4F1SA 1BYPA 4UOZA 3WY1A 3KWXA 2DAVA 4QRBA 1LO0H 5FUOH 4QI3A 2PWDA 1F3RB 4FXKB 2QKIA 1IGIL 4MMYB 3PABA 4JFED 4PJ7B 4XAWL 3EJJX 1PKQE 3PYCA 4N2FA 4AYBA 4XNYH 1KIQB 5HYQB 4AK1A 1MDTA 5EO0B 2VJXA 1JZIA 4IBUA 1UWGL 4GQZA 3U0PA 1XMEB 3O8XA 3TZVC 3PPSA 3FO0L 3L16A 4QHMA 3RGBA 2RCSH 3ARVA 5C0CB 1XR8A 1NCAH 2CJUL 2YSSA 5FFGA 2VR4A 5LUMA 2CA3A 3PAVA 2X2JA 2EXWC 4PY8I 1I1FA 2QSCL 3VRIA 3W81A 3D07A 3AWGA 4LIQH 3DIFA 5GJTH 2GHWB 1Y18A 1HAUA 3HI5L 1OD7A 3CWGA 1IC4H 2PWEA 2YEZA 3FCTB 5EIIG 1IEAB 2DLIA 1ZS2A 3BESR 4DPCX 1BFVH 5IHUH 4HIXH 1KJ2L 3DRQB 4FQXA 4ONFL 3P3UA 4NC1C 3QORA 3CHPA 2JKSA 4LKCB 5D2LB 1V05A 2ZX7A 5C0CA 5KBKA 5TPWL 1XGYL 3GZOA 5CKGA 2X4NA 2EDJA 3VB8A 4Q52A 4UT9L 1AKJA 4HJUA 4PRAA 4P4KA 5JIQA 1IM9A 4GIAA 3DXAD 4LPUA 5KSAA 4KROB 4N8UA 3D69B 1OE1A 1E3ZA 1OW0C 4RGOH 4WFGD 3IS0X 1N8ZA 2LFGA 3D2UB 1MW0A 2BRQA 4KKQA 4MJ5A 1C5CH 4FYRA 1F11A 2ERJC 2VAAA 3QJRB 4P2QE 3V6BR 1OB0A 4LLDA 1KLGA 4UTBA 4N0FB 4U6XB 2Q2EB 4TS6A 5J56B 5DCCA 1MI5B 2BM3A 5DYOB 1DVSA 4UYQA 4OZ4A 3LDBB 1GIGH 1Z9SA 2XWBA 2ZPKL 2GBAA 4LBEA 4RWYH 5DDHA 4OZHA 4W9IC 3QUKA 5KBDA 3WTTA 4BBWA 1GZHA 3CZNA 3FHEA 4GEIA 4JE4B 4HG4K 2Z7ZA 5EU7E 1IGJA 4CADB 1FGVH 4XNAA 5E4EC 2MPAL 3L7EA 4Z7VE 2BJMH 1G9NC 4OB5L 4MA7H 3L3IB 3QRFM 3ECBB 1T83A 3DX7B 1JDAA 4QRTB 2NYYD 4JRXD 4LEBA 5KZCD 3P54A 2EO7A 3FU8A 3EOTL 1WG3A 2CD0A 4DVRH 3A4DA 3QJZA 4JRLA 4KZEL 3NTCL 4PJXF 2BOBB 5IBUB 2D03H 4TVPH 3V0WL 5LVEA 4G71B 1MWOA 3FUFA 2TAAA 3WFEL 4FNSA 2JB6A 3T65B 4H8QA 5D1XA 2RACA 3FC8A 1L7IL 1XGZA 2Z3FA 3MRFB 4LGPB 2GW5A 3CZLA 4PTUB 4KOCA 3PWNB 2FBJL 1X4YA 1MCPH 2K6ZA 5HPMB 4Z3GA 2ZAHA 3O4OB 3P77B 4XNXH 4S1SL 4XP6L 3ISWA 1WCBA 4ERSL 2YJLA 3US0A 4OFIA 1TQBC 1TFHA 4JY6A 2Z31D 3ULVH 2AEIT 5E2UH 1UT2A 2EVIA 4NNYA 2BOLA 4PAZA 4E41E 2CK0H 4MD4B 3HBZA 4YHKH 5HDRA 2PMZA 2JF1A 1DQDH 3MC0A 4L8CA 3DX6A 4IIQC 1TYJA 5D5ME 2ZXQA 4KI5C 1CURA 2CU9A 2XN1A 4P9ML 2RFXB 3WELA 4AUYA 3QS3A 1JTOA 3QZPA 3HUJF 4PJCE 3TTSA 4OFQA 5GZNC 1AQ8A 3UGUA 1T7WA 2YIHA 4HG4J 5CEYB 4ZMLA 4GP4B 1G5AA 2ENPA 4YL4A 3RUGA 3MNVA 4H26B 1YQVL 3NABH 3Q8EA 2R29A 3WFHA 2B9BA 1YCSA 4JPKL 3AU0A 4Z5RA 4FG6C 1EMTL 2AEQH 2ZYRA 5T1DH 4J3SA 5EIVA 4JEGB 2BVPA 1FYTA 1JMXA 4YNYB 1YDPB 5KBPA 4XX1E 3WXVL 1ES0A 3L9BA 3OKMB 4LLQA 4I4WA 1PLBA 4G1MA 3H2QA 2BSSB 1AR1D 3QWQB 4LHUA 4TQPA 3UERA 4FNQA 5D7IF 2I7OA 3C5JB 3BVUA 5TE6H 3RLSA 1DSFH 2VR6A 3GGWA 3W56A 3HIZA 4QMEA 3WO3B 4TUKH 3VGFA 3HC0A 2JB5L 3TZVA 3VGGA 3FUNA 1Z9SB 3TNMB 4NZJA 1E7UA 2DQIL 2O4EA 4Q9CA 5I1AB 5IMMA 4YLBA 2NTSP 1RIHL 5CCKL 2J4WL 1YEEL 2R0ZH 4JDTL 4UNTA 1RP9A 4LHQB 4M5TA 1RK7A 2A6JA 2H2PC 5CNHA 1NFIA 4AI7A 2K6WA 4UAHA 4RAVA 2P3YA 3WUWG 4N28A 1B2WL 3MRKB 4NPYB 2DMKA 4TNEA 3HJEA 4WWPA 1P69B 3IU4H 1AIFA 1LWRA 3WTXA 3BHBB 4KROC 5CILL 3CFEB 5KYUB 5KEZA 4C83B 4MJ4A 2ZONA 4WAFA 4F2MA 4TV3A 5BZWB 1FNFA 1WH0A 3PHOB 1AO7A 5T1LB 5LXVA 1ACYH 4LCYB 2XG5A 2LVEA 4YEFA 3DYOA 2FGWH 4MNGB 4OKVA 2IGFH 3IDMB 1JGDA 5HD8D 2Y7NA 1WAEA 3X12A 5HPMA 1MHHA 1MVUA 2OMWA 1XGQA 3C08L 3THMH 5I23A 3RVWD 1ZLSH 5DUJA 1DLFH 1ZLWH 2C9XA 2GSMB 1U42A 2EAEA 2F68X 3ETBF 3ROOB 4ZUTB 4G9FE 4M61B 3NJXA 2OZ4A 3AY4A 2UUDK 1HCVA 1XCQA 5DSCA 4XVJL 2EXYC 3BOVA 2EDMA 4RFNC 4QF1A 5CINL 5I6OA 3ZQXA 4GSDL 3UROR 3DSFL 4ZXBC 2IEPA 2VLRD 3U4KA 2WNWA 4LP8A 5TH2B 2JWYA 2OFQA 5HYQA 5ES4B 3C6LD 4BJLA 1AO7D 2BNQA 4XBPB 1L9NA 1IX2A 3NJMA 4JFOB 3VACA 2IPUK 3LN9A 1OCRB 5HDLA 4ZMOA 4OLYH 2FR4A 4O2FA 2ED8A 1J9TA 2PO6D 4IMLA 3T0WA 1Q9WB 3I6GA 4CVUA 3BAIA 1NKGA 4X8CA 1RZFH 2HRPL 3B7SA 2NZ1A 3DURA 1PX4A 1NWPA 2HVKA 1EEUA 3GJFK 2R83A 2VM3A 1HESA 1KB9K 1FVCA 2AK1L 3PFUA 4K7PH 4KKNA 4K3GA 4N8VG 1GAFH 3WTWA 1R5VB 3TVMD 1IKFL 2NTFB 4ZDHB 3G08B 4UIKH 2GK2A 3FTGA 4OAWB 5D1ZC 1KB5A 4N3UA 5DQJB 5FDYA 2RQ8A 1U4EA 2PXYD 3NJJA 4OVVA 4JUTA 3QIBD 3ZE2F 3ZTEA 3GXDA 5KVGH 4ZO7A 3LJ3A 2RB8A 4N9GA 4OJEH 2JNZA 4DUVA 2BSBA 1LWHA 3DVGA 4HC1L 2IFGA 3RJQB 4NBYB 1L6XA 3QWRA 3SEPA 3I74A 1SEQH 2FL5A 4KK6C 4BWWA 4BINA 1N68A 1ZIBA 2P26A 4M48L 4ZOEA 3WNPA 3MSPA 1XTMA 3LEXB 5EEXA 2F53B 4L2YA 3VI4A 4HBQA 4Y7MA 4WWOA 1A6UL 4PJEF 4RAHA 5IFAH 1O7SA 4X0NA 1RUQH 1QQDB 1VFOA 1YAZA 1ZT4A 1XEDA 3ISYA 5E6UB 1A1MB 2J1XA 5L0QC 3UG3A 1SRDA 3C60B 1F2QA 1MZYA 2EYRB 2VQUA 3O6LL 1I8KB 1NUFA 2OYLA 1ZHKA 1G7IA 5K9KA 2WNXA 3O4LA 4IM8A 3U0PB 4JVUA 3WNNA 4IRSB 5FLVA 3DGGA 2WN3A 2BNRB 5I1DB 1GGIL 1K9TA 1QBAA 3SDXE 4FXKA 4MMYA 4LSVH 2ENJA 3QUYA 4BELD 3T5WA 3DROB 5DMIH 1E6JH 2DQ6A 3PL6B 5DRXA 5E2WH 5I66B 1BXAA 3TWYA 2GJRA 3WUWA 4AH2B 5JXEC 2DI9A 3ZDWA 2MQ3A 3BKJL 1MCLA 3HZ3A 2BZDA 2FQFA 4MHHG 2R4RL 5ACZA 4F8TA 1FL5A 1T1XA 4KJPD 4Z8FH 2WXOA 1OSPL 3QZNA 4NZFA 2B5IC 3N9GL 3UG5A 1XZWA 3OR7B 5LCVL 3DTXA 2NQ3A 3LYRA 4G1MB 1KGIA 3OB0K 1EXUB 3PL6A 1QSZA 3AB0C 4JO1L 1IGYB 2WJ7A 3EO1A 1GC1H 3QWOB 2EDTA 1CDUA 1AS8A 3AROA 4YSQA 5MEPA 5K9JH 1GYUA 3CXHJ 4UT7H 4QY8B 1TCRB 1QG3A 1E4KC 3NJIA 5CF3A 4CMMA 3CC1A 3Q0HA 3FB7A 5ITFA 2AAVA 5I71C 5D1QA 3SE8H 5BPPA 1JFHA 3BP6A 3FS9A 1AYOA 4RQQB 4OGXH 3UOAB 2H3KA 1BGXH 3NCJH 3V4VL 2FHCA 1HDMA 2OCCB 1HL8A 3MRIB 4ODVH 4XE5B 3AQXA 5D1QC 2OTWA 5KSBE 1QNZL 3IDJB 5KAQG 1NCWL 3X1BA 4ODWA 1BECA 2CAKA 2CR0A 2HJKB 4LASH 4UQ3B 2Z31A 3HI5H 5IBLC 4F33B 2AERT 5J1AB 3O2DA 4C83A 1DFBH 1BPVA 4CSZA 2OXGB 4FKEA 1FO0L 1UXWB 2AEPH 3Q6GH 4MD0B 3SYOA 3MVSA 4L8SB 1FNLA 1BCIA 2NDGA 4G6KH 4PJ9D 4XWOC 1UXMA 3WTVA 2X3BA 5D6CA 4JY5H 3V4PA 2R2HA 4P2OD 5BO1H 1IMHC 1FFTB 2E74C 1OWRM 1C16A 4XO3A 1CL7H 2Y06L 3W3BA 4HF5H 2J5LB 2XPGB 5E23A 1GY1A 1FQ9C 1NL0H 5I1IH 2EIKB 1LGVA 4NWUL 5LXGH 4YXKH 1OAKH 3KPPA 4AK2A 3FT3A 3GMNA 4ELKA 7TAAA 4PJAA 3BPNB 2QZ5A 1DBBL 3K72A 3MV01 5FK9A 3MV11 1EH9A 3EO9H 4NI3A 2VLKB 1E2ZA 2JIXD 2B8OT 4NENB 4UCFA 7PCYA 2B0SH 1B0GA 1VCBC 5HDBE 4WJ5B 2DQIH 3HHSA 3NP3A 5IW6A 4UF7C 2A38A 3Q2VA 4HJGA 4Z0BH 1ZPUA 1HHKB 4H20H 1QTYT 2C1OB 2P7TA 4OFYA 3ISRA 2O61A 3ILQD 2MQCA 4JLRA 2R7EB 4G7VH 2YQ2A 4Z3EA 1YY9C 3KYNB 2P5ED 1THAA 4NYLA 4FE9A 2ALAA 4HJIA 1CE6A 2G60H 2MOVA 3V6FB 1KTDA 2B14A 2ITDB 2KQNA 3S48A 3K71A 5TDOB 5EC1B 4MA7L 3PWLA 4X6DA 3STBA 5JPMB 4XMPH 2XV0A 5DZ9A 4M61A 4EEEA 1S5IH 4W70A 3G5ZB 1FFPA 3ZPDA 3BDYL 1I8KA 5L9DL 5HVWA 1W72H 4Y0GA 4OSUL 5K9OB 2FHFA 1MAMH 2PO6A 5I1GH 1OGAE 2XU9A 4Y4KC 3P4MA 5C0FB 3C60C 2DEYX 3VG0H 3INUL 4HEME 1YO4A 1YEIH 2NZ9D 4XMTA 5IV2A 1JPST 2VGLM 1CXHA 1U8LB 2XKUA 4GPVA 4I5BB 5T1MA 3QUMA 5GJTL 1H3VA 3N42B 2EE0A 3TT3H 5EC2A 3BRDA 1CVSC 2QVMA 2EVFA 3PWPE 4B5EA 4KNSA 5T8IA 4Z95L 2ZJSL 4PJEE 1JWMA 2E27L 3D06A 3CFQA 4APQB 2GTWB 2WBJD 4XMLL 2FDBP 3LZNA 3OSKA 1T1ZA 3HRZC 1VADA 4F2FA 2ADFH 3RA7L 5T33L 3DSFH 2O5ZL 5DWPA 1Q9LB 3HI6H 1NEZA 1PZ3A 5BS0B 5JDSA 1KY6A 3O2WL 4P2OB 4G6JL 4ZG1A 4OUUB 5J1SC 1TPXC 2A83A 5LBSL 3TU6A 2Y6SC 4FHJA 1R3IH 3WAKA 3MRHB 2AJ3B 1RJZB 1INDL 2DIBA 3CUPA 3ZUNC 2X4OB 4JO4H 2NTFA 4PLJD 2YKLH 4O02A 1JRHH 4EF3A 4B97A 3GHPA 1RZFL 2HRPH 1D7CA 1O7DC 4HWBL 1YMMD 1SJXA 5EU4A 5ELIA 3EYFB 4DZBB 5BVPH 2H26B 4CSSA 4JS7A 1HXMA 3SE4C 3V5DB 1JIBA 3ARDC 4G5ZH 4N86A 5D4HA 3T0AA 3ARTA 1FV1A 5F21B 4NQCB 3E80A 2O30A 3L3HA 5DQDH 5E4IA 2CGRL 3BZEB 5IB5B 4PRNB 1TZGL 3FF7A 3SE9H 2UXGA 5DJZB 3WSQL 1CGVA 2VMEA 5JPNA 1SYVA 4CL7A 2CKBA 3N43B 2CDEA 3ZR5A 4QHKJ 4F91B 3DO4A 4JM4H 3US9A 3G9VA 3VXQA 5JQIB 2CUMA 4OQ1A 3UXFA 3VCLB 3MXWL 3VE0A 1UUNA 5AUMA 1CTNA 3RUGB 1NC4B 1HCFX 5KVEL 3NH7H 3VMNA 5JYLA 1MHHB 4RLDA 4WJKB 5C0AB 1BSIA 1C16B 3ZK0A 1U8JB 2AQSA 5F7YC 3UEZA 4NM4H 4AQEA 1IM3B 3LXCA 4YAQA 3V4PB 2ORBH 4LCYA 4AVJA 1MWAA 3T3MF 3KBPA 3ULVD 1MRFH 4JMXA 3COOA 1OPOA 1D3CA 4JZNA 4XP5L 2ZICA 3ARBA 1R0AH 4I13B 3QWRD 1CE1L 1N12A 1PQZB 3HHRB 4N22A 2WBJB 3FT4A 4LL9A 3FOMB 4FZ8L 4FQLL 1F4YL 1NWOA 5E2UL 3ML9A 1IL1B 5ADPH 2AANA 4XO9A 2D0FA 1LILA 3QGVA 3QAZC 4YBQD 4X80H 3BYTA 4FNUA 5DRWA 2HFFB 3L7FA 4HFWA 5E8PB 4HZLA 3UTTE 5CZKA 1R19A 4IGBD 2DIJA 3O6MH 1JHTA 3EUUA 5CZVH 4NFCA 1HZLA 4Y19B 1WZKA 4OU3A 5D7IB 1CU4L 1FFNA 3BUPA 3S88H 3MLSH 1JERA 1TJIH 3BLKA 4RMQA 2K45A 2LW3A 1DUZA 1YAIA 3NQIA 2E76C 1NICA 3GPSA 1B3JA 3QRGH 4DH2A 3DOSA 1DVTA 2XTSA 2AXWA 1AFVH 3U4BL 2NR6A 4FTVB 2WAHA 3Q8AA 1BEXA 1OANA 3S96A 2GJ6A 1QPKA 1YSOA 4KUCD 4PV1C 5DVPA 1Y1DA 1G6RH 4JFQA 3N1PC 2R23A 4JPVH 3PQYD 3TOPA 5B4MC 3TBVA 3BFWA 2YBRB 3REVB 3T3PB 4HPHA 5JPMC 2R7EA 5HYJD 2KL6A 4HISA 5D7KD 4CAGA 4PRPA 3UTPD 3US1A 4FFVD 1EWHA 5CU9A 2PABA 4UNUA 2XV2A 3GMPB 4M56A 4P2RE 5J13B 1QEWB 2GJ6B 3DK2A 2WTRA 4GAAA 3FSWA 1BM3L 1T4KB 2XIIA 4TSCH 2M8XA 3NRFA 4PJAB 5JIDA 1OGAA 1PCXA 2V7NA 3FRPG 3MOAL 3E2HC 2NCEA 3V8OA 1UD5A 2ICES 2WNKA 1CTOA 2ITCB 1EAPA 5FDWA 4ODVL 2Y5EA 3GLZA 5MI0B 4XPGH 3MNWB 2FWOB 5CEZE 3NJVA 4M8QA 3OQ3B 5GZOD 4P5RA 2LT9A 3WIFB 2V2TB 2CJ3A 2FATL 3V95A 1S7QA 4FXLA 4Q6IB 5LKNA 5IHBA 3H3PL 2OMNA 1T21B 4HU2A 3T77A 3DGGB 3AAZB 1OKEA 5TFSH 4GKZB 4NQEE 1DFBL 1T89C 2ZUUA 4RWHA 3O6FB 1QLFB 2IWEA 3E0GA 1KN4H 3LB6C 4OCWL 4XODA 3W37A 2GB2A 3W2DH 3V9CA 1L3NA 5HGHA 1IARB 1AACA 1OE3A 4LLMA 4YUEL 2NQDA 3BIBX 4OM1H 1FIEA 2BNUB 2GY5A 5FM4A 3X11B 4M62H 5BRQA 2QQKL 1NL0L 2J8UA 3ILDA 3QQ4A 4K7FB 3SPVB 4AQEB 4C56D 3SBQA 1RY7B 1RI8A 2DQTL 2XC8A 1K6QL 5KYYA 1JXGA 4QRUB 3MJWA 3GXFA 3QXDB 3E1F1 1OAXH 3FU7A 4J3OH 3TEUA 3EOBB 4LVEA 1T04A 4OIAA 3HR6A 2H2SD 4GIOA 3VE0B 3I3EA 3MRQA 4BGLA 3VXQB 4JFTA 4UT9H 5DJAB 2H32A 2K3HA 4NZRH 5AAMA 4QO1B 5BMFH 4DP4X 3KYKH 3DMMD 5J0BA 2VDKH 3OLGA 5E9DE 3VXSD 3QNXB 1SLWA 2IBZY 1AKPA 1FPTH 4D7PA 3JVGC 5F0JB 3EHBD 1E6JL 2B3IA 4RESB 3CMOL 2DQJL 3GBNL 1F0LA 3DGDA 3MOQA 4M7ZC 2W8CA 3VSTA 3ARQA 2OL3B 3LKPA 3PPEA 5DC9B 5MP6H 3ZDYE 4D94A 2GJPA 1AGDB 5TE4L 3WLBB 1M2OA 2VH5H 4XPBH 2H41A 2QPFA 2VQ1A 5LDSA 4GXFA 1NCUA 4HQQL 3BRFA 2J2ZB 2BERA 3ASNB 1ZANH 5EOTB 3EYSH 3L8QA 3PUUA 4YXLH 2R15A 3D2UA 3MHZA 4HEPA 3K4AA 3ZT6A 4JQVC 3SDYH 4S1DC 5BS0E 1RJZA 2ZXWB 3IS1X 5D7IA 3AT8A 4PRID 3O45B 4ALAH 4XRCA 1QFWH 4BK5A 4I87A 3R8BB 4A7VA 4GG6E 4JFDB 4QHNB 3MV9A 3D3VA 2EC8A 2QGEA 4BSJA 2FLRT 1NKRA 5DMJB 2W0KA 5MERA 4DP9X 5T33H 1WD8A 3HVNA 2AP2A 5D1ZI 3DO3A 4OCXL 4JDEB 4YDLB 3MLVH 4BWTA 3ZE1E 4NSKA 5IIEB 5AVSB 1ADQL 3SHSA 1Z3GH 5KN5A 4YDVB 1PLAA 2VDOB 4OCRH 4U3CA 5KWYC 3RGVC 2QDWA 4Y4FC 2R1YB 4EE2A 1ZHNB 2R69H 4WGKA 1PDKA 1TIUA 1BBJA 3MXVL 2NLJA 1ROWA 3C5XA 5I82A 5D93B 4ACPA 4MB3A 2ESVE 2AQPA 1HI6B 5C0CD 3GSWA 1U2CA 1RZIB 2DLTA 2PP9A 3ZT5A 1QUNA 1BZ8A 4PJ7E 1NOFA 3SKNB 2FYVA 3VJ6B 5BO0D 1D2PA 5I6XC 1B4LA 1TNMA 4HS6B 2X6UA 3Q3GA 2PUQT 5TDOA 5BOZG 4BZ1H 4LL4A 2XQBH 4M43H 2M2DA 3EYVB 4JY5L 3M1BB 5FFLA 1I3VA 2CUIA 4OAWA 4HHWA 1AZUA 4MWFA 4BFIB 3F04A 4PJCA 4CSPA 1V7NH 4BK5C 1I3GL 1XMWA 4AGNA 2K6YA 5EO9A 4B9IA 1AE6H 2WZPD 1MN4A 2VZUA 1CFQA 3WN5A 4RMWA 3TF4A 2C8NA 1HC1A 4YXKL 4C55A 1YQ2A 4RIRA 5I6KA 4CC1A 2V5RA 4K71C 3CC5A 4XTRD 5D72H 2LU4A 4K73A 1OGPA 3IMTA 1CC3A 4ZOBA 1YPZE 3CQQA 4Z8FL 1U58A 1N5AA 4FFTA 1JNLL 4HH9A 3K4DA 1CK0H 2R29H 4K8RL 3G5XB 4BFIA 4BKLA 4BIKA 5DC2A 2Z4QB 1NAMH 4HXAL 4CW1B 1AI1L 1F1GA 4JFXA 4KQ0A 3QSKB 4KNUA 1KCSH 4WO4B 2O6EA 1BOGA 3LKNA 3S34L 4G42B 3CPLB 3SCMC 1K8IB 4TN9A 3WJMA 3IF1A 2BIIA 2IQAB 4J6RH 2OA9A 3TC9A 3ZIYA 1UJ3C 5IB2A 1SJEB 2ZXEB 2IAAC 1YEEH 2WYIA 4JDTH 4P57B 1LD9A 2IAMA 4YZFF 4ZUVB 3SQOH 3ZSSA 3VFRB 1DJWA 2H1XA 3VXPB 3IEAA 3BUYA 1MAML 2H6PA 4FXGC 4MB4A 4ZK8A 2Z93A 3GZPA 4TMPA 1I1RA 1NFKA 1UWXH 3EKCA 1Q1PA 3LVEA 3KLKA 2PO6B 1TU2B 4XZUA 1LK3L 1FG9C 5EIQA 1QABA 4WSJA 4B53A 1CYGA 1J11A 2WXRA 3VXRE 1VRSA 3OHXB 4FAAB 1DSWA 3D39E 1UWEL 3JUZA 5AW6B 5E9DA 1A9EA 3FFCB 4P9MH 4L3AA 1TTAA 3CVIL 2R4SL 1O5DT 1DEEB 4LSRH 1NCBH 3DXAA 3SYCA 5BUGA 4N2IA 15C8L 4N1EA 3G5WA 5I1AA 2FNBA 1H15A 2APSA 1EBAA 1HINH 1BQLH 1J1PH 1JOIA 2ZSVB 3NJGA 4GXVL 4JJ5B 5GGTH 2YKLL 5FWQA 5LN4A 1MKFA 3MI6A 1QHOA 4LVOB 1X5MA 5C09A 5FUZL 4XR8C 4DO6A 3JWNG 2C5DC 4JFEE 1KXHA 1I9EA 3CLFH 1RU9L 4PGEA 3PFQA 3NACL 2WB7A 4I4WB 4PG2C 3RU8H 1VESA 2ZCHL 3CXHK 5DF0A 2DM3A 3L7EB 4LOFA 4AOFA 5I66A 4LSUL 4LARH 1CGXA 3LV3A 2OZ4L 4XBGA 2X4RA 3VXUE 1S7TA 4IIQA 3KLHC 2ROYA 3L9RA 2AJSH 4GIPD 3MRQB 3KLAB 1MI5A 3GSWB 4LCWE 4V1DE 5JHDA 4WNJA 4FA6A 3ABLB 1D9KB 3FFOA 5E03A 2X9YA 5IFJA 2YK1L 5DJ0A 5GRVL 5KYYB 1N8ZB 3EYUH 1QSEE 3D25A 4IU2B 1J0JA 2GAZB 1UEMA 2NR6C 4Q8BA 4M6OH 3IFNH 3RFZC 5F1NB 3VFSA 3BMWA 2PW1B 1AIZA 2XFGB 5IT2H 5CLZA 5DK0B 4MDJA 5F7KC 4HJ1A 2A9NL 2G4EA 5L4MA 1MPAL 3BWSA 1SNRA 4UBDD 1WAAF 1OHQA 2MHAA 4Z78B 4NAQA 1KPRA 4U3HA 4LEEA 4ZSOA 1L0PA 3MUY1 3P0YH 1QR1A 3FH7A 4G42A 4A2HA 5KYXB 5EF3A 2B1HL 4LEOA 4JFDA 1RZKH 2E6QA 3QHTC 2TRYA 4U6YA 3WNKA 5G2NA 1QKZH 3VXOB 3T0EA 2VDKL 5L8LB 4KVPA 3SE3C 4GKSB 4JFZL 4N6QA 5BUPA 5CUSH 1TVHB 4PVBA 1AHMA 2EO9A 2X2YA 2FX9H 2Y2YA 1CU4H 2OMTB 3MAWA 4LOUD 3TCLA 3O6LH 3V55A 3DBXA 4Y5VB 5LQBH 4NN6C 1HQ4A 1CDCA 3JT2A 1RERA 1AHKA 2ZP0T 4LHUD 2J7LA 8FABA 1FNEA 2J1WA 5EOCH 5F9JB 4RZCB 3D18A 4GBXB 1J05B 4M93B 2VLRA 2FT7A 4JM2B 4ODHL 2W80C 4LSTH 2WLNA 3GMRA 1JK9B 2VM9A 1M4KA 4PJAF 3T3ME 2CM6A 1MZZA 4PJDB 5FYJU 4XOCA 5EU7C 3N91A 2VDNL 4I18C 1A7PH 3WNJA 4N4YB 5DJXA 3MUHL 5IVOA 4XCFH 4DVBA 1V27A 3QQNA 3DHMA 2IAMC 4IBTA 1YNKH 3BH9B 3WV0A 4E9TA 4KXBA 5BVJA 1MREL 2G9HB 2JCCB 1IKNA 2J8UB 2IG2H 1I3UA 4H8UA 5HVFB 3APDA 2NSXA 3QPXL 3IMUA 5EDXA 2IPKA 3DTUB 4XP1H 3HS0B 1TKWA 1F18A 2F8OA 4CKQA 3D9AL 3S4SA 3QAZB 3K8MA 2VDPB 3QIWC 4L4VA 3WKPA 4G6AD 3UBHA 4Q9RL 2RTTA 4YQXL 3RL1A 4FXTA 4P05A 4Z7UF 3II2A 2E6JA 4MZIA 1DE4A 3CFEA 5KYUA 1WPCA 1TQVA 4RISL 1CZ8L 2D31A 5C0ND 5C9KA 2VL4A 4EMZA 1RULH 3HN8A 1DVQA 3AAZA 4N85A 2WINA 4JFSA 2ETWA 4UT6H 3W57A 5AW7B 4M4PA 4Z7OF 2IPKB 4K9EC 2V8LA 2CLVB 3QIBB 4X80L 4DZ8A 1XSKA 2VDLL 5DJDA 4YAQB 2DYRB 2VUYA 1S7XA 2V37A 1YMHB 1XR9B 4FL4B 1GGUA 5IK3B 4HA1A 3MV9D 1XR8B 2YSSB 1OAYL 2D0GA 1U93B 3JWDL 1S5HA 2AXFB 4PW4A 4DN3L 1DBJH 5LCVA 1UCTA 1YLBB 3A3YB 3R0MA 4X9IA 2JCCE 1EFXB 1U3YA 3CX5K 4RFEA 4Z77B 3OPZH 2HVKB 1XH2A 5I2IB 4XO8A 1HKLL 1R3LA 1T7YA 3IJEB 3MLUH 3HRZB 2A77L 3TA3D 3U25A 3WIIH 3RURA 1T22A 1B90A 4PJXE 4D9LH 3B3IA 3WUWB 4NAJA 1DP0A 3MLZL 1WDAA 1CFBA 4PD4K 4PJDE 3O3BB 1U2YA 2Z8RA 5DQ9A 1SF5A 2R51A 5LXGL 1FNSH 3QUYB 4M4RB 4OLVL 4YIQB 1HHJA 1U8CB 2YAHA 3S9DB 2FB4H 1HYSD 1YPZA 2Z92B 3A24A 3HG1E 3D30A 5CJBA 4HAKA 4OLZH 4TOYL 2DI7A 4BA0A 1S3KH 3NG5A 2LR4A 1KJVB 1SFHA 1A6TB 3HPJA 2IXQA 5F7MC 1N4XL 3OZ9L 4P2RA 5CZXD 4U1JB 4XHJD 2WHVA 3WHE0 3FTZA 3BVVA 4OBSA 4UAOB 3HMWH 3P11L 1D2OA 4QHUB 3ULSB 4QIRA 2IAND 4BQ8A 4TPRH 4Q74A 3O2VH 3OHXA 3I84A 3WENA 3KCPB 1WFMA 1LK3H 3GMLA 5E8OB 1L5GB 4ZI8A 2WK2A 1IQWH 2O6FA 3IAPA 4LPWA 2GUOA 5C08A 3V0AC 4XZ4A 2C9QA 1IE5A 4JGUA 3MRCB 3C2AL 2NUTA 4U2YA 4GRWB 4JZNB 1F02I 4WI0B 2Q76A 2QSVA 4OGAC 3MKGA 4G1EA 5FYKL 5IEKB 5I19H 1Z5YD 2BHFA 1NAKL 2AQ2A 3G6AA 4FS0A 2X4PA 2VLJB 1MQ8A 3LZFH 1A02N 4IQHA 1SLVA 2HUHA 5KVFL 3CIAA 2VDML 3DV6A 3WMPA 1G9NL 4AEHH 4LGRB 2DI8A 4O2EA 2MCAA 3TASA 3GSOB 3D39A 3FO9B 4YSUA 2Q8BH 3VAEA 4JFEA 5GGVL 3SGDH 2JJWA 2XWTB 1JE6A 3QUMH 4U1KA 4NI6A 5DHEA 3VFUB 4W9KC 4NUJA 1HH9A 2Z4QA 3RU8L 2DQUH 2OQJA 1JL8A 1HILA 4NJAH 4AZ8A 4X4YB 5H2BB 2D7QA 1F86A 3V6FA 4GRMA 5GSRB 3IMVA 4WTQA 2D4FA 4IW4C 3OG6B 4PRHA 4TTDC 5C7ZA 1RZJH 3VXRD 3QUYD 3VFVA 1IGJB 4HSCX 1QA9A 4CADA 3HAEG 3MCLL 4WWKC 4CVXB 1SVZA 5I6MA 3L48A 3T4AA 2VXVH 3FUIA 4P2QB 4OZHB 4EPSA 1XX9C 2DF3A 4YSEA 2GBUA 3BSHA 2OMTA 4X5XA 2R2BB 1NTDA 1L7TL 3ARZA 3HMXA 1DJZA 4IRJC 4XPBL 4F7EB 2E4FA 4Z3HA 5BQ7A 2CE6A 4IGBB 2CGRH 1UC6A 2GIXA 2XPGA 2X7LA 1C8PA 4FQPA 2K9UA 1LE5A 5DD5H 5HDQL 3MBWA 1XH1A 5H4YA 4KMLB 2WLHA 1N3NA 2Z91A 5TDPA 1MF2H 1JN6A 1QWHA 3GSXB 4LAJH 2GTWA 2YWYA 1TXKA 4QYOA 1S5IL 2GIYA 2NUPA 4M9OA 1T1ZB 4BSWB 4FQ1H 2JI1A 4KRNA 2XACC 1MW1A 2MH4A 4DEUA 1PLCA 3GHBL 4XCNB 4Y4FB 4N2EA 2CJSA 4OGYL 4LSDA 4M7LT 1WFOA 3BEVB 2DTMH 4F20A 1QKZL 3LD8C 1MAKA 5FGCB 3RL2A 3FQWB 5AOMA 3U1SL 5JR1L 4HUWB 3O11A 2C4FT 4B7IA 3DIFB 4H8WC 5H35B 3L5HA 2WSDA 4D0DB 3RNQB 1Z9OA 1D9KA 4YHML 3BD3A 3RWDA 1AGEA 3JVFC 5ALCL 3ZLQC 3ZN6A 6PCYA 4Z95H 1J5CA 1WP6A 1XVSA 3T8XB 4ZMZA 4FFYH 3QVAA 1F4YH 4KRMB 1WICA 3VFPB 1DCEA 4YFEA 2DQDH 2C4FU 5B1KA 3CZFB 1OCOB 3LV3B 2A0LC 2ZUQC 1J9CT 6CGTA 5ACMA 1RUPH 1BF2A 3IDGA 1WHPA 3QYMA 3NVQA 4HS8L 4PGEB 3SPJA 4HV8A 5I16B 2VIRB 2QHLA 3KBEA 1XDTT 3Q43A 4AEEA 4YNYA 1D5ZB 3A4FA 1TFPA 2VQ1B 2ZOTA 2GABA 3V6ZA 1G6VK 5DMKA 2XIBA 3E1ZA 2G2PA 1WFJA 5KJ4A 3WEMA 4NDMB 2J12B 3BDXA 1YPZB 1B0GB 3BVXA 4H40A 4TUUA 5CP7A 5LJYH 1KIRB 1EX0A 1FJ1B 3G6JE 1FZKA 1J1PL 2JSFA 3B9EA 4J3VA 5GGTL 4WEBL 3UC0H 2LABA 3PDGA 4XE0A 1P0SE 2VDOL 1OZUA 4XPAH 4FXGA 3WFZA 1T83C 3VUAA 1AYRA 2ZOUA 3PHAA 1G6RB 4WTZG 4DK5A 4M29A 3DUUA 4XX1G 1VGEH 3JWDC 2DICA 2J3SA 3KG5A 4A66A 3EBGA 2B4CH 1YNLH 4WFFD 4LARL 4KOBA 2CDGB 5ETUB 2CMRH 5JXEA 4LQFH 4JM4L 4WFHE 1JZFA 1NBZB 3RVXD 5DUMH 1U4FA 2ATKB 2EXSA 4I89A 1CCZA 4MA8L 4YHOL 4MBRA 1GGTA 2A1WH 3LXAA 1NCGA 1F41A 5KN5B 3V79C 1A3LH 1LP9B 3B2VL 4UOQA 5F3HA 3RWGA 4MMXC 3IGLA 3G6AB 4O5LL 2JV6A 2BOCB 3OSVA 4RA3A 4EZMA 4FABL 1S78D 4U7KA 1A3RL 3N41F 1R4XA 3U7YL 4X8XA 4ZMTA 5D2LF 2J88L 1DANU 3ZZ1A 4AV4A 2WXFA 1I3RB 4MSWB 2A9NH 4U05A 2DM4A 3IKKA 5C07B 4BSVB 1NLBH 5DO2C 3BQUC 3KPOA 1Q72H 2EIZA 3IB4A 1RK0A 4Z7WB 4XOBA 4GW1B 5FWRA 4HSAC 4PEEA 3WIFA 2FZ3A 2HMID 2V2TA 5IBTH 2OSLB 3SJVB 2K70A 3K71B 4Y1TA 1OCWL 2N3JA 3X14A 1B4TA 1E90A 3U7AA 4AT6A 4KFZC 2J20A 3CLEH 5AKTA 3BQVA 1UCBH 2ZP8A 4DQOH 1ASPA 3ZO0A 3OR6B 1PG7X 5GHWL 3JQOB 1ZE3C 4YE4H 4ONOA 1GMEA 1VGKB 3JTSB 4U6HA 4YZWA 1R5VA 3IFOA 2UZIL 1T1YA 1SJMA 3JTSA 1GOFA 4U6HB 4PBWD 3AQYA 3T2LA 2VDRH 3D1MC 3OB8A 4J4PD 4E41D 3L3OC 1RUAL 4N2OA 1XF5A 2EXWD 1HT6A 2BS71 1PJ9A 1NMBL 2AK4A 3M1BA 3MBED 4WI3A 1EZLA 5FYJL 3KWUA 3HKZA 1X9QA 1MWAL 4KV5F 3NAAL 3NEOA 3N04A 1SY6L 2V2XA 4WNSA 3FO0H 4P4KB 3B7TA 3NCWA 4Z7OB 2AAAA 5ANMB 4GQQA 3U2IA 4X99B 4FTVA 3UPRB 3OKNB 1EO7A 4UOJA 3LD8B 2VH5L 4W4NA 2FJFA 3D8MA 4L48A 3F7RA 5KG9A 1L0YA 4KKAC 4KXAA 4Z7UB 1TZHB 5SV3A 2P24B 3FB6B 4D0CB 1S7XB 3KPSB 4MDRA 1YNKL 5HYJB 1KCVL 1ED3A 4FQQB 2WINB 1ECZA 4LMQE 2VDMH 3HBPA 3U2SB 1A9BB 3RZCA 2VR3A 4JDVB 2XSKA 1IC4L 3UZVB 1ZHLB 2VNCA 4BUGA 1U3HA 2EE6A 3APMA 2JCCF 4E0RB 1N6UA 4UIMA 3WN5C 5EU6D 2AJYH 2R59A 1DHKA 3ARBD 1D5XB 3BW9B 1ULVA 4YSRA 3QRBA 3WY2A 5ID1A 3CQFA 5TPWH 4Y16C 5EU3A 1A7RL 2V2XB 1E4JA 4RISH 4CBPA 4P3DB 4E2OA 2BIHA 1ASOA 5LWYH 3F12B 3V4LA 1G7LA 2FWOA 2JKRM 4OH2A 1U3JA 1KB5B 4ABVA 2O6DA 4O02L 4WCYH 3VXMD 4OCRL 4RGOL 5D55A 5FOBB 2XXGA 4JCMA 5EOTA 4JKNA 3MLWH 2CHNA 3D51A 4AG4L 5F6IC 3G6JA 2WKOF 3EGDB 3ZXAC 4E68A 2J56A 1PYWA 1NBYB 1R5WB 3QDGD 3BE1H 2C3GA 5EU6A 4JHAL 1N5YL 1RSFA 1GYCA 2E8ZA 3V4VA 4C47A 5INCB 2VIRA 3N40P 1MOEA 3IU3B 5T5FL 3BZFB 2E46A 4Z0XB 1I1YB 3OGCA 4AT6B 3KZ8A 4BRVA 5TK2A 4K8RC 4ODHH 1I4FA 1CGWA 4PY7B 2DMHA 1FYTB 3T3PE 1SOQA 2Z31C 4PJXB 1PGRB 5F1SA 5C0EA 3DVIA 3EOBA 4J7RA 1HX0A 5F89B 4WKZB 3EBIA 4N0CD 1WFUA 4U1HB 3J07A 3D48R 2ADGA 3UADA 3WKMH 1ZANL 5GS2H 1MCPL 1S3KL 3KDMB 4XCFL 1QBML 1GC1C 2PWGA 1OSZB 5E1AB 3OKKB 4R4BB 3DUSA 2YD8A 4B9YA 1TYRA 1JF5A 4WHTA 1JI1A 1KJ2H 4ONFH 3OF6A 4MJID 4U6YB 2XG5B 5C92A 5EZIH 4HZLB 3KAAA 2APFA 4OKVB 4XPFL 4OCNC 2VDRB 2GTZA 1MXGA 3V52L 5F44A 3TFBA 3P9MB 1KBWA 1WBZA 3ZE0E 3DX6B 1XF3B 3UTTB 3GSUA 4UQ9A 2V5SA 1A6ZA 4M5ZH 1E5AA 1JGLH 4F80A 1KZYA 1KBPA 5IMKB 1AH1A 5DHVH 3GS4A 3PXLA 2L3BA 3ZX1A 4JPWL 4ZW8A 3WFBL 2ITCA 5DT1L 3ZL2A 3S8FB 3QORC 3D50A 3UTOA 2VDLH 4ZZFA 3TONA 4JFDD 3ZO9A 3CHSA 3GBLA 3EJUA 3IE9A 2AKRB 4OLUL 3L3OB 2DH3A 1W0YT 1FVEB 2DQGH 3SGKA 1EVUA 1YQVH 1WBXB 3X3GH 4WEBH 1UEYA 2XWCA 3GSRA 3ZZSA 5BUAA 1CF8H 4FXKC 4OB5H 4CC4A 2KZKA 3QIUB 1BLNB 3WKQA 2VSDA 3MJ9A 1KN2L 5IOPA 3TJHC 4P8QA 1SOXA 1X7QB 3QYNA 4JPSA 2FO1A 4X9HA 4I3RL 1NCBL 3TO4B 4ZQKA 1N26A 1PD6A 2L0DA 3VW3H 4KZDL 1RK1A 3ABMB 4XMKL 3GI8H 3PXHA 5HHNB 1DSFL 4ENEC 3EGDA 3KLSA 2NXYD 3KXFD 4UTAL 1ZV2A 4W9ZA 2BY3A 2CLRB 3CV5A 3GRGA 1FGNL 3EYVA 1I7ZA 3OZ9H 1U8KB 2J4WH 4YX2H 4DP5X 4KHTH 5HD8C 5F71A 5BRZB 1CFMA 3LZPA 1G7LB 1RZ8B 1AI1H 1PY4A 4EKXA 1FDLL 3ZE0B 1RZKC 3RVWC 3TL5A 3SOBL 1Q38A 2TSAA 5CGTA 3CZJA 4MD4A 3DECA 5GRJH 4DO4A 5BQDA 3QDJE 3SGJA 2NLJB 2C9AA 3QXWA 5EC2B 5I8CA 5CILH 3TBTB 2J57A 2WWMC 5AAWC 3NK3A 3UDWA 2BP8A 3C09C 3MA7A 5GQBA 5T3ZE 5IIEA 4HIIB 3THML 3SKUD 2X0WA 5F7EL 3NZHL 2ZE0A 3SKOA 3GSNB 5BQ7B 5L2JA 4JPKH 3ARGD 4KXDA 5IQOA 4BYHA 3MGOB 1BOGB 4G8FB 3MMEA 2FWLB 4JZOA 4PSRA 5C1MB 1JZ8A 4U1NB 4AQ8A 1MCKA 5B39A 4NO0A 4UNIA 5IESH 1ET5A 4W9GC 4X4KA 4M6MH 4I0PC 3LNIA 4AE0A 4DGYH 4KKZA 5EG6C 4R0LC 1P6FA 5EHFA 1QFPA 1NMBH 4N2CA 5A1AA 5AAPA 3K6NA 1EXGA 1X5GA 3QIBC 4W6YB 5LAXB 4PJGB 2FVNA 2IDTA 1K4DB 1AOZA 4LPYA 1CFSB 4UQDA 5KJRH 3Q8FA 3B3BA 1CTMA 5FKAB 2G0LA 4D3CL 3TEZA 4G70B 4Z77A 2E9GA 5I15H 2NXYB 3KXFB 3K2UH 1ZS8A 2VXUL 2PN5A 1I53A 5IKCB 5FS5A 2VZSA 4K7PL 4NO0D 4NUQA 4X6FA 1MCIA 4NKMB 5AB2A 5C97A 4TSBL 1KDIA 1MFBH 2VLRE 4L5FE 2A83B 4A67A 2HX9A 1P5VB 1QFUH 1UZ8A 5T3ZH 3D69A 1DUYA 1YPZF 2BNRA 4HWEL 3HC3H 4R90H 5DD6B 4LK4A 3CDZB 1A7PL 2AJSL 1JWMB 4HOWA 2IBZX 2VLLB 4EBQL 3VNZA 4Y8DC 3RTLA 4XVOA 2DBLH 3QORB 2VL5A 5K9QG 1SMAA 1QQDA 1ZT4B 5A16A 3QPXH 3FH8A 4Q89A 1XXFC 3PGFH 5HJBA 4C56A 3QEQD 3BIKB 3KE0A 4NERA 3GLAA 4ABUA 3MU3A 5JR1H 2ZUQB 3FB6A 2J25A 1SYSA 1U8QA 3QHFL 1W0WB 4Q9RH 1FNHA 4Y9BA 2F58H 2VZTA 2G4GA 2O6CA 3VWKA 3HNSL 5DUPL 2RJMA 1FZOA 3UDWC 1JD7A 1EHKB 1LYQA 1SJVA 1Q0XL 1X5AA 1Y0LA 3HHMA 3MRMA 2W5PA 4BV1A 3BZDA 2NY6C 2IDCA 5L7XL 4OM0H 4B60A 1KTBA 2Y22A 1M71B 3D39D 3OWEA 5ESVB 3LTVA 3UEQA 3L4WA 5CMAA 3RZCD 3TS8A 2IANB 1TJMA 1GS6X 3HRZA 1T4KA 3GSQA 2JK5B 5F9JA 1KB5H 1T1YB 3S3CB 3DVNB 4S0TD 1ETA1 1CUOA 1HKLH 2WKGA 4AH2A 4H0GA 2IBBA 3KYMB 2IV8A 1ONQB 3AMKA 3KYAA 1HSBB 3UIYA 3W5MA 3RTQD 1F00I 1VFMA 3CN2A 5EUOA 4B5ZA 3ARFB 4PJIF 1RD6A 4KTDH 4JFPA 2F08A 1Z32X 1S7SA 4OF7A 5I9QB 4GG6A 2KBGA 2OSLA 1RJLB 3CBJB 3D3VE 3ZYIA 1Y6NR 1OAZL 4OJCA 1A1OA 1VHPA 4IRSA 1HL9A 4NZTL 5IBLD 3WGUB 1IJ9A 4HIEB 3AT9A 4WWKB 3HRPA 1PY0A 3C09B 2BW4A 3S36H 1WEJL 4HKXA 1JGLL 4GJTB 3HFFA 5E2VL 2DM2A 1QHQA 2DLEA 3FRPA 1U3HB 4GBXD 1EEYA 5DUML 3SBRA 4ZX3A 4XWOD 5D7JC 5T3XH 3HG0A 2R0KL 1VFUA 1OGSA 3BP7B 4JM2D 4QAWA 3WLWC 4A2DA 3IDNB 4AL8L 3G5VA 1S46A 2A3TA 4HWBA 3C2SA 5AB0A 3EFDH 1MJUH 3S4SB 3ARRA 1W0VB 1ZLUK 3BUBA 2WAQA 5ANHA 5FO8B 3PL6C 2C3VB 3BO8B 2XBTA 2YA2A 3ZRSA 4MX7A 4X7TB 1VFAA 4KV5E 1TTUA 4L3ED 4A04A 2XWDA 4U1IB 4AENA 2JJVA 2P46B 2Y1ZA 4H8WH 1OM3L 3AT0A 4L4VD 4YZFE 5I1HH 4FULA 3OJVC 3GJEA 4FQCH 3JZ7A 3RVTD 5SX5K 5L2KA 5E0FA 1IFHH 4IRSD 1GTFA 2VDQB 3RDTC 2BHUA 1CZ8H 3P2DA 3HZMB 5HI3C 1UKSA 2Z91B 1A0QH 1R5IA 3DJSA 4L4TE 1FNGA 5DGRA 1J5OH 4UV7L 3UO1H 1U8KA 5BW7C 7FABH 3CN0A 1DSYA 1J9QA 3BKJH 5DD0H 2UX6A 5FO7A 2HXAA 5KJ7E 1MCHA 4QXGL 1UYWL 1CL7L 2Y06H 4KQ3H 3PAUA 5FYLL 2P80A 4XMKH 2NNAB 4PLKC 1OPGH 2CBQA 3VYOA 5KYWA 5ERWB 3SKMA 1ETB1 1MAJA 2XA8H 2XRAL 3KNBA 4JRXE 2FEDD 1E4HA 2HJFB 4BH8B 4IHOA 2Q0ZX 1PFCA 1Z66A 2BP5M 4XNBA 5I17A 2GT9B 3ESUF 3MRBA 4I77L 1AG6A 5F0PB 1F58L 4P4KC 1OK0A 4YHZL 1O0VA 1Q0EA 5HDOA 2XJLA 2WCPA 4PJGA 3ARFD 3TIDB 4GQRA 1G9ML 1M71A 2YUWA 2OMBA 3B9KC 3NIFE 2NT0A 5HI4C 2OTPA 5C0GB 3DK0A 5DD1L 4Z7VA 1GRWA 1FV1B 2AV1B 2X6AA 1CQYA 3QIUC 2DW5A 3FU0A 5EOQL 3CZFA 2BVTA 3D52A 3JXAA 3ATAA 4AYEC 4N2LA 1ND0B 2VN3A 3EYOB 3VSVA 5LG1A 1U3NA 4AW7A 5I73B 4HDIB 5FHAH 2Z7YA 1DUZB 4MVBC 4MMZA 1K3ZA 4KRLB 2F9BT 2GPZA 4F7MA 4HETA 4QXWA 2BO0A 5FYKU 3B1UA 2YMOA 3FQUB 4E36A 2XNAA 3HBGA 4U6TA 4X98A 3CZSA 3KR3L 3T0VA 1T03L 1CMOA 4KKPA 1LP9A 1KGXA 1FFOA 1HHIB 2G3MA 2ZOLB 5B3NA 2KLTA 4KKBD 4FFZA 5FA4B 3VXSA 1H6UA 5BZXA 1OK8A 3PWJA 4JJHA 2P47B 3GI9L 5DFWH 1S9XB 1LWJA 2R1WB 4PY8J 4O58L 2VRQA 1YEKH 3E7JA 3GHBH 1I8LA 1RZ8A 2N7BA 4JKPH 4OZFH 4YC2B 5T1MB 4ZMQA 1R3IL 2J5WA 2CDGA 1CB4A 1ZOXA 2OMVA 2XXMB 3UJTL 3P77A 5F7HA 5I19L 3LAFA 2BCKA 5K69A 3QJUB 1CLOH 1ILSA 1BLIA 1P5UB 3K5SA 3NDZE 3M17A 5CIPB 3WFBH 5EN3A 1IKOP 2L7JA 2IH3A 2KH2B 1YEFH 5L4FA 3E9UA 4GSRA 1MSPA 3ZDYB 2DKMA 3ABKB 4ODSL 2CLRA 3DPBB 4JO4L 3AFLA 2V4LA 3EXJA 5I8KL 3F83A 4FZEL 1XH3A 3GXMA 2XQYG 3OAUH 3BD5A 4X2UA 3PS6A 1CG9B 2VR8A 4HK0B 3WJLC 4ZFFB 5BVPL 1CFQB 5LGYA 2YAOA 1QLEL 4I0PA 4DTGL 1X7QA 3FN0L 2F2HA 1SXSA 2XKNA 3L4CA 4JHAH 4GB9A 1PZ2A 5AEAA 5EZJA 2DJ4A 4I0PB 4G82A 4HGMA 2WLLA 4M1DL 5A2JH 3FFDB 1EFQA 5C6PB 5ICYB 1ZLVH 4PBDA 5FCUH 3FQYA 1QI4A 3UO8B 2IWKA 5DYOA 5FK9B 4UINL 2MSPA 4GAYB 4EN2A 5JLZA 4G11A 4NT6A 2H1LM 3UTSE 5HXMA 3QO0B 3TCTA 3WHE1 5DI8A 4NUPA 4FTVE 4P23B 3FQRB 5ENWB 3X12B 4AV5A 3MRHA 4B9JA 5GS0L 5MEND 1LNUB 4FLRA 4HGWB 1JNHA 2WWKT 1QBMH 5F7AA 1CDBA 3K1KC 4RA0C 4U1SB 5KSAB 2CO7A 3B6SB 2CNYA 3ETBJ 3ULUL 2CR6A 5EF0A 43C9B 4ETYA 4RVBA 4BH7A 3L3JB 3PV7A 25C8H 4MJ2A 4KHTL 4L8SC 2YN5A 4GSQA 1V3MA 4YBHA 5KVFE 2VN7A 4LPXA 2NSQA 4Z23A 4ZX6A 3VQLA 3MRCA 5D5MB 5IOKA 3VRLE 4N8VA 5CN3A 3HI1B 4G8GD 4L2LA 1J0KA 4HAFA 2WZPA 4ZFZB 1XB8A 1JN6B 4QTIH 5I5JA 1UB5B 4NN7B 3O3DB 4F2ME 2HVJA 3KYOA 3GS0A 2IH1B 4E41B 3DHJA 1A8ZA 5HYJA 1TQUA 3OQRA 4L5FL 5FECA 4LZKA 4WI7A 1XCTA 1ZXKA 3P4MB 4FDWA 5B3SB 1HSAB 1I1FB 4WNQB 2P4AB 3G5XA 4NP4H 1DQMH 35C8L 5FIEA 4L1HA 4JPWH 1XGRA 5F7EH 2HFEA 4PHZA 1RMFL 5DFAA 4HUVB 4MBOA 2IXQB 2VXQH 3ZDXF 2LAGB 4FFWC 1R17A 4G5ZL 3KWWA 1OGAD 3STZA 3X3FH 3LMJL 2KT6A 5EU5A 3M7OA 4XVSH 4LLAA 4XXDB 5FO9B 2CKBH 2CO6B 5E5MA 1J7VR 4NRYA 4X6BA 4URTB 2AQRA 2WSPA 3OKMA 3VMPA 1I4FB 1A4KB 2Y2TA 3FB8A 5CR1A 2UWEF 3O3BA 2IMMA 3FSZA 4WTZA 3T04D 3NT0A 1I1AD 4NC0B 1MUJA 3U36A 5I73C 5FB8B 1MLBB 1KBKA 3RWFA 4IHOB 3UGEA 4KO6A 3WEXA 3LHAA 4KZDH 4JG5A 5G5DA 3ULVE 1WEJH 4NN5B 4YPJA 1BEYH 3DX4A 4HPOL 1J0HA 3M46A 5IROD 2Y1AA 1FA4A 3VRJA 2MJWA 2QPDB 3PNRB 3OKLA 2FRGP 2HLFC 4NO5A 1MELA 3DV6B 2ZKXA 1KXVC 3LPPA 2RFXA 2YUZA 1E43A 1SFDA 2R2HB 3GTTA 4FHKA 4A2GA 1MJJB 1VGEL 4KY1L 2WSKA 4NSKB 3N55A 1J8RA 3HMXH 4PRAB 1YJDL 5CD3A 1I1AA 1J87A 1U6AH 3TNNA 43CAA 1FZOB 4MZRA 1A6ZB 4XVUC 1REIA 3VG9B 3Q13A 4JG0L 1DQTA 1T5KA 2XX0A 4DGIL 3V5KB 4R7VA 3RJDA 2AEOA 1UZ6F 1ORSA 2BVQB 1NIFA 5DEJA 2HVBA 4O9HL 2GTZB 1M1XA 3FT2A 3EDJA 1D6EA 1M05A 3BKYL 5C08E 3TO2B 4F33A 3Q2CA 2SEBA 1JDCA 1WT5C 1LDPL 3W0WE 1F6LL 1FCCA 1WAAE 4JDVA 4QYAA 4NLAA 1PNCA 4X0KA 4ZOCA 5IHHA 3EJYC 2W0FB 4Y19D 1JYWA 1M7IB 4YSOA 5I30H 4QT5B 2WGNB 3BKML 4F7MB 5FYKD 2HUEA 5DJYB 4PI0A 5KBLA 2OK0L 4LB8A 2YMXH 3FRPB 3QDMA 4RQQA 3T4YB 3PP3H 2QQKH 2JH2A 4N0UE 5HTSA 1SN5A 1DQVA 2HKFH 3B37A 4QHMB 2D7NA 2EIBA 3UBGA 3VI3F 1MFCH 1OGAB 1BD2D 5J13C 3EBHA 2EE9A 3IETA 1X3DA 1TUPA 2ZOKA 2ZUYA 1Q72L 2WLIB 4NOFA 3IGAB 4D9RD 4GOSA 3GMPA 5E7BA 1G0DA 5JHLA 5DUPH 2CCLA 2XLLA 3H0TA 2OMZB 2ZAGA 3GPEA 3H7BA 4YHIB 5FFOA 3AXLA 3M8OL 3BP4A 5CZRA 2H5UA 4P49A 4FQ2L 3L1GA 4QTHB 4F5CA 3WO4C 1NEUA 3O9WD 4N87A 3EAKA 5F1KC 3BGAA 1M3IA 3ENEA 4J2QA 5IEHA 3QNZA 2ZOKB 3MA9L 2V7HA 4YXLL 8FABB 4ZFOA 8PAZA 3IFLH 2ILLA 2ZSVA 3GRWA 3WG7B 4FQXC 2FJSA 5HGDB 4QR7A 1K72A 2DWEA 4JG1H 4AJYV 3GDCA 4XAKD 5JXAH 3ZSTA 3X14B 4NPJA 5C3IA 1COBA 3GJFH 5F7DA 1F8TH 1HSAA 1IEHA 5AYTA 5C3LD 5FYJH 5M95B 2NX5D 4CN6A 2DYPB 1MFBL 3SD5A 5FYLE 1HHHA 1JK8B 4KTDL 1KN4L 3D7PA 1QFUL 4PJEB 3AS2A 2O1AA 3IMWA 3RZWA 2AEWA 4E0RA 4XB3A 2EKSB 4B9KC 3LKOB 4L4TB 2ZG3A 2P5WD 2ZF9A 4GQ9L 3TJPA 4PIRF 1VACA 5C07A 1ZAGA 2X09A 3U82B 2OTUA 5D1QE 1J9RA 4HFUL 4X6CE 4EN3A 5IM7B 2QGDA 2V33A 2WP3T 2IFFH 1G43A 3TLRA 1U8PA 1ZGLM 3PWVA 3VI3E 2D7MA 1WWAX 2HTKD 4ADIA 5ICUA 2F53A 3C75A 1FORL 2XZAH 5I8OL 1IQDB 4WRLA 2P24A 1TQSA 2X0UA 2YPLA 3KGSA 1F3DH 5C0DA 2ZUXA 3ZTJH 1MFEH 5F6HJ 2DM7A 1HJBC 4G6MH 5IB4B 1KCWA 1F45A 3IXAB 1BYOA 4XH2B 3WDJA 3A47A 3P0GB 4XNZB 3MYZA 3HNSH 2XETA 2G5BB 3DUUB 1GZQA 5KS9B 3DMMB 3LIUA 1UOKA 5IQ7H 3VM7A 1OVZA 1IAKB 4PJ8B 1A0QL 5I6NA 1RUKL 3MLTB 4RRPA 1KGCD 1IO4C 1G9MC 4YPGB 4L29B 2Z35A 1IGTB 4NQCA 5E5UB 1Y7VA 2COQA 2YPLD 1E30A 2BHYA 5D72L 1YEHL 3FOLB 1CFVH 3D4GA 1K8DB 5FYLH 3REWA 5EFIB 5HY9A 2BMKB 3MQIA 1CFSA 2OW7A 4HJJL 3QEQE 2QQLL 3LRSA 1YEGL 5I0DA 5C2BH 4O51B 4XXWC 5GGSY 1N2RB 2E5EA 5CJOH 2Y7QA 3GK8L 4PYHA 4APXA 5C09E 5D6DC 4YHZH 3QW9A 3FONB 1CLZL 1U3HC 3V8CA 3DSNA 1TQCB 5TF0A 3D4CA 5F7LB 4ONGL 2G5BA 5KS9A 2HVJB 3KYOB 3AACA 3B7UX 3S8GB 5I0XA 5BXFA 1IM3D 4UU9B 4PPTA 2KZWA 3FPXA 5EPMA 1W0WA 2NSMA 4F27A 5IJVB 1OOAA 5JW4Q 2JI3A 4HHAA 3O6KL 4ZSOB 4TUJA 3S34H 1BBJB 2YZ8A 3C8HA 3SDAD 5JHLH 4HX1A 1EDHA 5T3XL 1ZTXL 1KV7A 1MCCA 2QT6A 35C8H 1J5DA 2X1QA 1QSEA 2R1XA 4POUB 4Y5YC 1RUMH 1B0RA 2NW2A 2YGNA 5KOMC 4B96A 5IB2B 1TITA 2A74A 2K9FB 5DZPA 3RWEB 3H55A 4ISVB 4H1LB 4H8WL 2CGZA 5JOPE 2ZXAA 1ADWA 4TNWK 5CINH 2YQ3A 2RHEA 3O41A 2HG5B 1DUYB 1BFTA 1DL7H 2FECL 2WC7A 4JL2A 5J06A 4L18A 2IDUA 3D09A 4ZPVA 4KRPD 1I3GH 1AQKL 1UXSA 4R0LA 5EB9A 4OZFA 4NKQB 2YD4A 3JWOH 1T6WA 2H47C 1GOGA 1NMCC 1Q94B 3IBEA 2RH0A 2WLKA 4LNRA 1R3JB 1RJYA 2E9BA 1FRGL 5IJBC 3LQMA 4M5YH 3AREB 4Z7WF 1JNLH 2N56A 3D4YA 1OQOA 1RJYB 3QEGH 2XA8L 2XRAH 4NCC2 3W5NA 1WZAA 1M6OB 3X13A 2VT0A 5H94A 3EFOA 2GJZA 2X4OA 4IKNA 1E8ZA 3I6KA 3KBHE 3SQBB 1H8LA 1SY6A 1QRNB 1KJMA 2W60A 5HGAB 1GW0A 2DMCA 4R97B 2NY0C 4HH8A 4IBLT 4JG0H 4DGIH 4AW4A 2PR4L 3SGEI 3NCYS 2R8SL 3UIZA 5F1IB 4IU3B 2XWZA 3L1FA 3U0TA 3OKOB 3R0NA 2WV3A 4UTCA 1DBKL 1Q9OB 1Z0MA 3SKOB 2B4CC 2B5IB 3ULUD 3NDYE 3HE7B 3RGVB 1TJGL 1ANUA 1BF5A 1X44A 3AQDA 1J9SA 4PJIE 5H37A 2PXYC 3TWCL 2B39A 1IBYA 1F4HA 4WY7H 3G5VB 1ZVSA 4XPTL 5I9QC 2QV2A 4PS4H 5CD5D 4DFIA 1D5IL 2BXYA 5LBVA 1FL3B 4Y1AE 1UA6L 1AXIB 3CZUB 5CLXA 5AZ2H 3RDTA 2K4WA 2XYCA 4TLSA 1U8MB 1FFPB 3UL4A 3KPNB 4PJ8C 1ZXQA 5C08B 1KELL 3L9EA 4ABQA 1A9BA 4LU5H 1XQ4A 2JKXA 3GI9H 3RX9A 3CVIH 5ISZE 1R3KB 43CAB 4PWIA 3T77B 5CJ5A 1HWWA 5D7SL 1KLFB 3S98A 4OZGB 2WLYA 4NKDA 3P4NA 5KTEL 1CXEA 3NZHH 3KYNA 4ICXA 3WU1A 2DDQL 2ADJA 4PGZA 1VZGA 1BQLL 4KVCH 5E0QA 2MFNA 4C56E 3NRQA 5DHVA 1CS6A 1DO5A 2BWQA 1ZMYA 3MR9A 3RFZA 4HT1H 3R1GH 2X28A 1AC0A 5AW8B 2ZYSA 3QH3B 1AR2A 3LS5H 3IFLL 3SZKC 1JV5B 2NNRA 4Z9KB 1K8DA 4IRZL 1MFMA 1V54B 1XB3A 2YXVA 1CN4A 1F1DA 1E7VA 5CWSB 3WEXB 3TTYA 3K72B 1EUTA 1HHJB 4LSUH 2JTYA 3WL9A 2EDNA 3QI9C 1G7QB 3CE1A 1PVHA 3WKYA 4HUMB 4ZMVA 3IJEA 1MVFA 4JFHD 2D4DA 1FI8C 5KJRL 2V17L 3FAXA 1XWVA 4G6AC 4N0UB 3CBKB 1A5FH 1S9VA 2I25N 2H9GB 3MNDA 2EUVA 4P2AA 2EDBA 2YD9A 2YK1H 3KPMA 3ARPA 2A99A 4PG2A 2XA3A 4KJPC 1D9KD 4MXWL 3V7AE 4YLCA 2MWCA 3CDGA 1BZ9A 3ZRFC 1XR9A 3QZWG 3FRUA 1J8HE 3B5HA 3IFNL 3RPIB 3RVVD 2BLFA 4K3DL 1A6UH 5MEQB 4X4ZA 4Z7VF 1BFVL 4PS3A 5IHUL 1MHEA 3B5TA 4GRLC 5IEKA 3LKQB 2MNUA 3BN9C 1HEZB 4Q0XL 5GS0D 2Y6TE 3OJ2C 2HCZX 1AD9B 2A73A 3ZDXB 3OHXC 2H8PA 4G80A 25C8L 2ZF8A 4MFHA 3KPLA 4UMSA 3PJSB 2DJMA 5DZVA 1MHPL 2NXZD 3MV8D 1LK2B 4HC1A 2D3VA 3S36L 1C8QA 4IOIA 3GBEA 3UFIA 2Q2LA 4LSVL 3RKPA 4HEPG 4F92B 4YDJB 1UT1A 3IMRA 1SPDA 3H6JA 4AL8H 5MEPB 4KGJA 5IY5B 4KXZI 1P5VA 3CD4A 4U1SA 1IM3A 2AQTA 2H0PA 3PGFL 3RQ3A 1INEL 5CN2A 3SKJH 1BZ9B 3DC0A 3QDGE 4DP7X 5I30L 1A6PA 2XZCH 1E3XA 1YEHH 3K0WA 5GIRB 4YO0A 5B38B 1JXJA 2Q7NA 1OSPH 3E6HB 1BWMA 4PGDB 4LEXL 1W72A 3VXME 3C9NB 4N26A 2XWEA 1NIEA 1Z9MA 2WLLB 2IANA 2NY2B 1Z0NA 1FNSL 3K6IA 4FMFA 4LVNB 4PJBA 3MBEA 2OXHB 2Y7OA 1BJ8A 3VD2A 2VUOA 3REVA 3L3DA 4BZ2A 4L1BA 3FYEB 3FCSA 1QR4A 3L3HB 4NRZB 3ROLA 1ZLWK 4LDLB 1RIUL 5AWNH 4AYGA 2CH8A 3B56A 4KBPA 3OL2A 4Y5VA 4GY4A 4C54A 2K4AA 3DTDA 3K3QA 4G8FA 4JZOB 3ROOA 5I1EH 3L4UA 5T5NG 2GSIB 4FQJL 3UCRA 5C0DB 4AIZA 3ILQC 1KLFA 3N41B 3SJVA 5B1CA 1J8KA 2R0WL 1F6FB 1IGIH 5J1TC 3FHQA 5DK2B 3H4FA 3PWVB 1EZVY 4KZCA 3K5RA 5DEFB 2F54A 3CU1A 3FQNB 4EIBA 1W80A 2P45B 3A6CH 3GS7A 5IWLC 1KGJA 2OR9L 4L1LA 3BXNA 4NZTH 2ZJSH 5B8CB 1P7QB 3VA2C 1VACB 3W9DA 2XY2A 2VLLA 1AZZC 4XMWA 3WFDH 1NFDB 3PP4H 1NM9A 2WJ5A 4D0DA 3LZFL 4XPHL 2B1AL 3ZKMC 3ASOB 3UZQB 2B15A 5C0AE 3RTQB 5LBSH 3IKCB 2FJUB 2KERA 2QSCH 4PCKA 5EO1B 1A6WL 3WHXA 3DJ9A 1ZSDA 3HCVB 3L6FA 4KK9C 1N7MH 2F5AL 3QUXD 5BV7C 1OAYH 2YZ1A 2NZ9C 3D0LB 3PCYA 3EH2A 3MJ9L 5AVQB 4P23A 4WTWA 3BUTA 4MNHA 2VTFA 3O81A 3FUHA 3U9UB 4CDGC 2ARJQ 3VXNB 4IU3A 2W38A 4FQCL 5D70H 1S9VB 3EOYG 4ECNA 3II1A 1EFXD 5ANMA 2EDFA 3VFTB 5C7XH 3WXVH 2VXSL 4LCCB 3VDBA 1IBZA 5AW9B 4UWQB 3VVVA 2BP3A 1NPUA 1DVFB 4OFKA 1A2YB 2HX8A 1IAOA 1L6ZA 1HNFA 1OF2A 1A7QL 2FE0A 4B0MM 2WVUA 2F8IA 1IAIH 4M1CD 2YUVA 3SDDB 1KIUB 1EXHA 2Q3XA 2X4UA 2WQ8A 2CPUA 5EBMA 4TUKL 3V7AG 4TOYH 5IUSA 2AS5M 4PLJC 4XXCA 1PPIA 3QNYA 2BS8A 1NAMB 5EU5B 1VGKA 3IETB 1U2HA 3JV6A 1R9FA 1T1WB 2EDKA 2R0ZL 3P2BA 4FG2A 4FZEH 4JHUA 4KO5A 3DI2B 2WUCH 4FF9A 3S5LG 4IHBA 3PIQA 2FEEL 3ARDD 2ZNWA 1OT2A 4KX8A 2C9VA 2MQ0A 5I1GL 4NIYE 1BFSA 1FO0A 4GRLA 3HB3D 3INUH 4M02A 5JTWA 1OY3B 1NUGA 5AW3B 3OF6D 4WY7L 3RDJA 1MRFL 4LCCA 1CGSH 4J3BA 3KM1A 3MROB 4A39A 3ZRCC 1Z1WA 4PI2A 1D5IH 1H5BA 4R7NA 1AO7B 3ULAB 2ZWKA 4R26L 1BZ7B 5FKPA 1PZSA 3RWIB 3C5ZD 5KANI 4WFED 4PP2A 1Q0YL 4QNPF 4O2CA 1S7WA 3FT0A 3CSGA 1F5WA 4G8GA 1ACYL 2NW2B 2EVGA 4O2EB 3BSGA 3VFGL 4P5SA 3RWEA 4FQ1L 2FQEA 3D0AA 2IQ9H 2Z93B 4Q6KA 3O11B 3HLKA 1KJ3H 2DQHL 5D7SH 5ESAA 4CGUB 1I9RH 1TJHL 2C3VA 3V4PH 1TZIA 4PJDF 4B9ZA 5JORA 5FO2A 3E8UH 2QMKA 3QCVL 3HPLB 3LIZA 1IVLA 4TLUA 3OKLB 3EJZC 5F7WC 5CHNB 1QI5A 1S7WB 2XPZA 3AMLA 1NC4A 2IQAA 3UAFA 4GKNB 4PH8A 4HDIA 3PWUB 1PKQB 1U92B 3GTNA 4PJ5D 1L9RA 3IN0A 2P48B 3NIFB 3B43A 3G04A 5D7JA 1NANI 4ODUA 2EDLA 3NSXA 3K2IA 3PWPD 3L2NA 4JPVL 4OR1A 1OO2A 4YBLC 2EXTA 5HGAA 5HHXH 5EA0H 1CFTA 2ZOOA 2IDSA 4LHUB 5JIMA 2FIKA 5GS3A 1BG9A 3N50A 2V2WB 5D2NA 2YFOA 5C0BE 1PZBA 1HSBA 1BLNA 4K07A 3DJTA 2F53D 5CP7B 2V17H 1MXDA 1I7TA 3P4OB 1RMFH 4W6WB 5AVUB 4ODSH 3UAJC 3CVHL 4Y5XB 1CG9A 4P2QD 2V9QA 4BH8A 4C4UA 4L1DA 4RIRB 4E9QA 1TTCA 3G6JB 4WENB 4H13C 1PY9A 4XNUL 3WNLA 4HWUA 4QJ5B 3O9WA 3T0DA 4IJ3B 3KPPB 1A25A 4ZXBB 3P9WB 3ZTNH 3K8LA 2QL1A 4GS7C 4U49A 5B4MD 5T1KB 1YNLL 3H56A 1P5UA 1CJYA 5MHSD 4Q0XH 3RBGA 4AKPA 4HHGA 1VKXA 4TQEH 4BFBD 3R7RA 3F12A 1TVDA 3I75B 4KDWA 3MLYL 3WFCH 2UY7A 4EQ3A 1R0AL 1JZDC 4FFVC 3NIDF 3F62A 3NIGE 5H8DA 5FW6A 3HI1A 4ONGH 1BD2B 2CMRL 3DO7B 1PDKB 1U93A 3K1DA 1NFDF 3TJEL 4N2MA 5EZLA 5CKAA 3U1SH 2KPWA 4ODTH 3UP1A 5A3ID 5IB1B 4JREB 2VQ4A 2EYRA 2OYMA 3U9WA 5GS0H 3CFCH 3BUYB 5CZVL 2FBJH 4LDCA 3CLWA 1OTSD 4MZ2A 5D7LE 5CBEA 2IAMB 4ZUVA 3TIEA 5IV2B 4XNXL 3SKJL 2BVUA 5GZOC 1KF9B 1N0XH 1RPUA 4XMZA 3KPSA 1INQB 3UYOD 3UTZB 4CN4A 3T1FA 1Z3RA 3WTYA 5BXFB 5JYMA 1JPTH 2DQDL 4H5SB 1K3IA 3IBOA 4P3WA 4UNVA 3AG4B 1TZOA 3MUUA 3QIWB 1DQDL 3KL0A 3QZMA 5I76A 2J6WA 4LFHG 2GEEA 4BFJA 3VI4F 1QBLH 4ZAKA 4PJBE 4PJEA 3D85A 3GJFA 3GEWB 4PBVC 2FGWL 2X0VA 3W0WA 4Y4HB 2QSTA 3MZTA 3QDHA 1FNAA 1TO4A 3QFDB 4JLRB 4B95C 3X17A 3DTXB 4FCAA 1JF6A 4P4RB 4DGUA 5DJ6A 3RIAF 3MRPA 3LN5B 2KLSA 1CLCA 5KW9H 2HRHA 3R4DA 2UWEE 1XH3B 2I85A 3ZHNA 2Y24A 1UOWA 2W9LA 4RGMB 1P2CB 4LCUB 4LOEA 4RMBA 5F6HI 3VGEA 5AZEL 1K5WA 4EIZC 5C8JA 3OR6A 1GYWA 4XPGL 4A7QA 3QBTB 1UATA 3MUGA 2VDRL 2YAQA 3H9SE 2FD6H 1SY6H 2FATH 4HS6A 5CSZB 1PG7L 5AVYB 4MA3A 4A7SA 5E1QA 1XIWA 5TJWK 1E9OB 3EHBC 2XBDA 1NBVH 3MRMB 1MNUL 2K7PA 1J8HA 3LDBC 1XSJA 4NP9A 3BVWA 3MV7E 1MFAL 3EDKA 2KMWA 3WFDL 1BEYL 1UQSA 2WB1A 1E3FA 1A5FL 1FAIL 1X5YA 2VR9A 1XBDA 3FNKA 5DJYA 5KVDL 5J1AA 3QDMB 4HPYL 5JXAL 4YVNA 1P7BA 1P6WA 1BHGA 4LSQH 3U2SA 3WUZA 5DHXB 4X6CB 4S1DD 3E3QE 4HULB 1Y18B 1DJHA 4HOXA 3JV5A 1XHHA 5KVGL 1KG0A 1QSFD 2C7UB 2W9DL 4U31A 4JGNA 2P28B 2Q86A 1AGFB 2G75A 4CILA 1KGYE 1OP3H 5AVZB 4F7PA 2DQEL 4L9DA 1D6EB 1M05B 3TO2A 1NDGB 1HIML 5SWSD 5FX3A 2FL5B 1A7RH 2R0LL 1BREA 3IDYB 4DIXA 1AGFA 2Q86B 4EZJA 5AAWA 3D34A 3TNNB 1YEDB 4KITB 3HNVH 1XTLA 4K9EH 4JY4B 3WJJC 3QJQB 2UXFA 5JDJA 2BWDA 3LPWA 1RJLA 2AFNA 4OF8A 3WTUA 4X6CA 3RWJA 3PABB 2GAZA 1KBVA 3H1ZA 2JELH 3QUXA 5F8QC 5AFAA 4EQ2A 3V4UL 1WZLA 4X9YA 3T0EE 1S6NA 4GI6A 3CDCA 3FRUB 1XF5B 4ZODA 5DJ8B 1PIGA 4DEPB 3MRNB 4ZT1A 4JM2F 2V7HB 2WQWA 1MFNA 3JVGA 2CBMA 4UM8A 4EI5D 2A9BA 3L9RB 4HQQH 2BSEA 5HVHB 1MJ8H 2DS4A 3RWCA 3VVWA 4PGCB 3LS5L 1RK1B 1Z9LA 3V10A 4QTHA 1HN1A 1PD1A 4IMLB 1ZK9A 2W0LA 3MBEB 4I3GA 5IQ7L 3TBVB 1MFDH 3L5XL 1B2YA 4BFGA 1E28B 5DVNA 5IJCC 1PJWA 2BNQE 3QJHA 3BKCL 1V7ML 2ZOWA 4NUGH 9CGTA 3AWEA 4EN3C 3NP4A 3ILPA 4NQDD 3NZ8A 1MJ7L 3R4RA 4S2SB 3MODL 4WW1B 4ZUSB 1EFXA 2YOCA 2AVGA 1KCSL 3JV0A 4I48B 1NMCB 1HQ4B 3SDDC 4HMEA 5IGXL 4LKXB 1OB1B 2IC2A 4A2FA 4CC4C 5JA8B 4Y7OC 2EZ0C 3BUQA 4DAGH 2FLBT 4MNGE 3MO1A 5KVEE 4L9LC 1JJUA 3GK8H 3IE4A 3CFUA 5LAPA 3W0WB 4JO5A 3QPKA 2QLVB 4YMPA 5IW1B 1NCTA 3L7FB 4HFWB 4G8GE 3VD1A 1JZ5A 4ZBJA 3RX8A 3IDNA 3BEVA 3GIZL 3QFJE 5HPOA 3KPNA 2ZG2A 4BZYA 3LKSA 5J4MA 3L4VA 2NY0B 4XPFH 2X89A 3EH5B 4HK3N 3A6BL 3W39A 4N8VB 1ZT1A 3UC2A 3G9AB 2W07A 3ARBB 1BBDL 2ZUWA 2QGCA 4Y4HC 3UMNA 4AUJA 3U1PA 5EBGA 4BE6A 2WKLA 2A6DA 1DO6A 4JKKA 3V5HB 3ZT7A 2ZX8A 3ZL4H 3F58H 4BZ1L 3IVKB 2XQBL 4QOKD 3TX4A 3BSZH 1B3IA 1F90L 1O75A 1RUQL 5EUOB 1O6TA 2XWRA 3TGXA 3FTGB 1DQQB 1LVEA 2AC0A 2OJZH 4HWZA 4TNWF 4D2NA 4LVNC 4NWTH 3BN3B 2XCMC 3J2PA 3ARXA 2B7DT 2EDOA 3QI9A 4G6KL 5E08H 4HIJB 4LSPH 3A22A 1OIOA 4PJXA 2DQGL 6FABH 3P0VL 4D8OA 1HEHC 4TNGA 3WTSA 1WGVA 5ICXA 3L3GA 1SMDA 3OGCB 3L3IA 2JVUA 4JFQB 1SF3A 2H6OA 4C4BA 3PJNA 1LHZA 5FO9A 1PFOA 2A9ML 1A7QH 4HIHA 1MCWW 4OTXH 2BMKA 2HRLA 4AYDC 1DBBH 1WO2A 3O8XD 4HCFA 4F8PA 2VLKA 3FPYA 3CHRA 2QDVA 2NX5A 4ZNEA 3UTSA 5AWNL 1MCNA 3MJGX 4UM8B 3TJEH 5JUEL 4HKJA 2CCVA 2WXPA 5M7QA 1XCXA 4NQQA 3M17B 5IR1A 5BZDB 1O6SB 4BKSC 1FZMA 1YHPA 2E0PA 3CSBA 2PTTA 2YA1A 1LEGA 2FX8H 1P84K 4PJ8A 5EV7A 2QKIC 3I9IA 3B2UD 4KKLD 4G2AA 4MJIB 1MVYA 4XP5H 2OKMA 3NFPA 4HSQA 2BY2A 3VFMA 2LE9A 1V8HA 2X4QA 3GO1H 2R2CA 5ESAB 4DKEH 3Q8CA 2ZG1A 1QPXA 5CCJA 4IBVA 1BJ1J 2VDQH 1J0IA 1BQUA 2X41A 3GBMH 4Y16B 4XMPL 5IVZA 2YN3A 1VADB 1FDLH 4R7XA 4JAMB 1IUZA 3BDYH 1AIFB 5JQ6H 3RUGF 2LU7A 3TT1H 3ETTA 4QHKI 4Y16A 1GGBH 2AJXL 3DJZA 1BV8A 3M6DA 4JHZA 3GKZA 5DRZB 5E24E 2HLEB 4JO2H 3L13A 3VFMB