2YSTA

Solution structure of the third cadherin domain from human protocadherin 7
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
119
structure length
119
Chain Sequence
GSSGSSGNDNSPRFEKSVYEADLAENSAPGTPILQLRAADLDVGVNGQIEYVFGAATESVRRLLRLDETSGWLSVLHRIDREEVNQLRFTVMARDRGQPPKTDKATVVLNIKDENDNVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Protocadherin-7
publication title Solution structure of the third cadherin domain from human protocadherin 7
rcsb
source organism Homo sapiens
total genus 12
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 2ystA01
3K6FA 2O72A 4APXB 1NCHA 3K6IA 5CZRA 2OMTB 4QD2E 1Q1PA 4ZMOA 4AK1A 4ZI8A 4ZMZA 3LNIA 4AQAA 3LNGA 2OMWB 4ZMQA 2EE0A 3Q2LA 2QVFB 2YQGA 3FF7A 2X2UA 4ZT1A 3UBHA 4AQAB 2QVIA 2A4CA 4AXWA 4AQ8A 4NUMA 2YSTA 4NQQA 1NCJA 3PPEA 1NCGA 1SUHA 3QRBA 4ZMPA 4OY9A 1WYJA 2V37A 3LNDA 5JYLA 2WBXA 4AQEA 5DZVA 4AXWB 4ZMNA 1WUZA 1ZVNA 4XXWA 2OMUB 2OMVB 4NUQA 3K5RA 3Q2WA 4AQEB 2WD0A 5JYMA 3LNHA 1NCIA 5CO1A 1EDHA 2A4EA 1L3WA 3MVSA 4APXA 4ZMXA 1OP4A 4ZMLA 2WCPA 4ZMTA 1FF5A 4NUPA 1ZXKA 3K6DA 3LNFA 3Q2NA 4ZMYA 2OMXB 2OMYB 3UBFA 4AQ8C 3UBGA 3Q2VA 1O6SB 2WHVA 4ZMVA 3K5SA 4ZTEA 5KJ4A 2OMZB 4ZMWA 4XXWC 3FF8A 3LNEA
chains in the Genus database with same CATH superfamily
2CA4A 3VFOA 4OF6A 1Q9KB 3FTXA 4Q58C 5AEAA 2AJUH 2OMWA 2W0FA 2DQDH 3QHZH 1LM8V 3HG3A 3D0AA 2DQCL 4MNGA 4CADA 4H8HA 2GJ6E 4FKHA 1NGYA 1D6VL 1KB9K 1ZK9A 4KUZL 3VD3A 5LO7A 3WNOA 4TULH 4HWNA 1BG9A 1QYGL 5F0MB 5B7FA 4E36A 5C70A 3QT2A 4OZGA 3CFTA 1JIBA 2AZUA 5F9JB 2DICA 4Q56A 1YJDL 1OM3H 4ORZC 1S9VB 2UY6A 5L8KB 3D07A 2IC2A 4PRHA 4ZAKD 2I60H 5FYLE 3QJZA 3MGOA 2AJZB 3IFNH 1WBYB 4NLHA 5F70A 2YD3A 1NCNA 1SNRA 2PW2B 4ZPVB 2R4SH 3KXFA 3IFPB 1E8XA 4TNVF 1CVRA 4OY9A 4E0RB 2IGFL 3CH1A 3MRHB 4HHAA 1N64L 4L4JA 5DF0A 2PPAA 5IMKB 3QDME 2XACC 3EJZC 1JFHA 2V17H 3Q3GB 1MCBA 3AT9A 3BYTA 5FUOL 5M94B 5I0YA 1HIML 3O3EA 4CVZB 2F5BH 4G9DA 4UT7H 1OP3K 4MZ3A 2V7HB 3FUNA 2OR8A 2P48B 4NN7C 2W9EL 4RNRB 4EF3A 3O6LL 3SJVB 3HFML 4N8VA 1IBFA 3TBYA 1JZDC 3FZUD 1NH6A 4QHMB 3T77A 5LNDA 2QV2A 3ELQA 5K1VA 1N6UA 1A4BA 4G70B 1NFIB 1UACL 5E8OA 1VPOL 3EJQA 3GSUB 3PHSA 5AW3B 4E9VA 3QUKB 4K3GA 1FC1A 1UWXH 3O6KL 4M1CD 1OV8A 5IQ9B 4K5NA 4WDIB 2A7BA 3OLGA 4JHUA 2ATAA 3L4YA 1F42A 3U0TB 3KPPB 3IFOA 2FT8A 1NGPL 4KI1A 1LO0H 4FG4A 1PY9A 4IIQA 5DZJA 2WINA 2ICEB 4NRXB 3MLXH 2Z8VC 2HTLD 2AXFB 5IESL 5D2LF 3NGBC 2PO6D 2Y36L 2NW3B 1B2YA 1U58B 1EV2E 2LW3A 2VDRL 3MV8D 4H1LA 4TPRL 4XMZA 2UVFA 4WHCA 1ES0A 3C60D 3ARXA 5H4ZA 5DA4A 3BUDA 2Y1YA 4PJFB 3QW9A 2IAAC 4U7SA 5DJXB 1UYWH 4TN9A 1PF3A 3TN0B 5ABDE 4Z6AT 2JB5H 4MDIA 3MRQB 5DVPA 3N42F 2R1YA 3NN8B 4JBSA 3GEWB 2NY7L 2YQ3A 3LIZA 3BFQG 2YQBA 2KZKA 4G6ML 4WSGA 2B9BA 1CQYA 1KCBA 2X2JA 1D6VH 4KUZH 4PJDE 1U95A 1FGVL 4Q89A 1QYGH 4NXSA 5DEGB 1YJDH 4Y7MA 5DD3L 5TDPA 1LO5B 3H3PH 3SE8L 1LP9F 4HS8H 3PAUA 4HK3J 5BZXA 1IBDA 3SDYH 1BQLL 2CBQA 1Q1JL 1XIWA 1XR9A 3EF4A 4XRCB 5HI3D 3U4AA 5C0EB 1FFNA 3KDMB 5DFVD 2WBWB 2YSTA 1CK0L 1OZTG 2F54B 5E8PA 3D8MA 1VZGA 2FYYA 1GZPA 2DI9A 2BIMA 2IGFH 3FCTB 3QWRA 3ZE1F 1AKJB 2GFBA 4OFIA 5GS0L 1IKFH 1OAUL 5KJRL 5E94A 3D4GA 4LHUB 4PB0L 1WAEA 4WNQA 1A21A 5T1LA 4KRNA 4XNQA 3FFDB 3OKOB 4IS6B 1TZ8A 4LLDA 4XE5B 1HKFA 2G5BA 4W9FC 3KLAB 3ES6A 4HLJA 5FM4A 3LV3A 3Q6GL 3FSAA 1F11B 1O7DC 2DMKA 5DC4B 4WQOA 3LKRA 4A6YB 4D0BA 3RX9A 2C3VB 3KBEA 5GIRB 4F1SA 2EUVA 4X80H 3KYAA 4X98B 3ZL4H 2Q7NA 4PCTA 5BNXD 2EXSA 3C5ZC 3HUJE 1QSEB 3KM1A 3WLBA 4JZJB 5EDSA 4ZMTA 1T5WA 1HQ4B 3AFLA 1KCUH 1CYXA 4X8XA 2MFNA 2DWXA 2VE6A 4MMXC 4U1SB 2FEDC 3S7GA 2HT4C 2X3BA 2IH3A 2FB4L 4XOBA 3TEUA 1EEUA 1FPTL 1NGPH 4PSPA 3S96A 2CKBH 2XWCA 4YAQA 3GYRA 3DUSB 4OZHA 1EPFA 4PW4A 2ZXQA 5ANHA 3ZSSA 1BLIA 1JVLA 3RNQA 4F20A 4B7LA 5IESH 2NNCA 4UTAA 2C9SA 2HTKC 2QSTA 3BWZA 5DDHB 5HJGA 5BZDA 1IGTB 3IJEA 1CS6A 3KLKA 3MR9B 3PQYB 4GT0A 7FABH 5LLIC 2CJ3A 4H0GA 2C3GA 3MRKA 5JLZA 2C3WA 4UM9D 5J6GB 2X2YA 4Z76A 4XZUB 3U2SB 4OFPA 4TUKL 5CLTA 4H7VA 3DETC 2VLME 4JM4H 4JDTL 3BAEH 3W3BA 4RA0C 2GK0A 1HNYA 2GI0A 3PGDB 1KJVA 2NY7H 4R4FL 2N7SA 2FL5A 1Z9OA 2NZ1A 4MAZA 2O93L 3FTVA 3TYFB 2WKLA 5DD0H 1XCQB 3VFUB 4BKLB 4IM8A 4FD0A 1MCPL 5D7IE 4IMKA 3FU0A 4PRAB 4XNBA 3C08L 2WKOA 2Q6WA 3U36A 3VU2A 1N0LB 5GRVL 2XWBB 5DD3H 1HJCA 1HH9B 2VL5B 3OAZH 4E42A 2R23B 4KGJA 3EGXA 4WGVB 2X28A 3I9PA 1C1EL 1GYVA 1C5DB 4QDGA 3ILPB 3FT4A 2W81C 3ZZQA 1TZGH 2DQFB 1KJ2L 4FC3E 4XXDB 1T1ZB 1GVIA 3E2HC 1F5WA 4GAFB 2G2NA 1H8SA 4UAOB 1JUFB 4ZQKA 5JTWA 4X5RA 2F7QA 2NY5C 3TP4A 2YEVB 5GS0H 4K5LA 4RMSA 3X1NA 4DEPC 4PJHA 3IDNA 5EZJB 1XGYH 5C3IA 2BVTA 4XNYL 4QOKB 4XXWA 1YPZE 1GY2A 3ENEA 4ERSL 1FIGH 4N0RA 2F8VA 2VXQL 3IETA 3HR5A 3OJDA 3T3PE 3ULVF 2O6FA 4KVCL 3CFBB 1DQQA 5K1NA 2FWLB 3QA3B 1PNCA 2AMUA 4BFJA 5EDXA 4P5TC 4KHXL 1HXYA 1SLVA 1QBMH 2XVLA 4MNQE 3WG7B 4ZOBA 4RMVA 1KTDA 3S3SA 1G7LB 1ZA6A 5KBMA 3RDJA 3I6LD 3O6FA 4ZUUA 4KQ0A 2UZIL 2K1MA 3G7TA 4TQ8A 4JFOA 5I0VA 5LBSH 1ECZA 2AQ2A 2CDGA 4TLSA 4PGDA 3MV11 4JRYD 2BCMA 1ODUA 3MLWH 4LMQI 3ULUL 4R7VA 2BNQE 1Z3GH 1FPTH 3BDXA 2JVUA 3HAEG 4HFUL 1TPXC 1INEH 2H0EA 3O3DB 1UCBL 3UEQA 2ENQA 5KN5A 3G5YB 1OWRM 4YQXL 1F8TL 1WA2X 2IGLA 2L7JA 4W9CC 2QSQA 4NERA 5ESQB 4JG9A 5SWZA 3BGAA 1IX2A 4LOVA 4MCMA 1Z9SB 4NRYA 1ZVYA 1E8ZA 5LCVL 4XC1H 4AQ1A 4PJCB 2GUYA 4JGJA 2Y06L 4P3DA 3OG4B 2EUZA 4F1ZA 4U6VL 1A64A 1I7TA 2P5EA 3MJWA 3Q6FB 4NQEE 4E41A 2VLJA 3CWGA 5JW3H 2XG4B 4UDUA 4JDTH 4U6YA 2FECL 2ZX9A 4RGOH 2DJMA 2X89D 1D5ZA 4DP6X 5D1QC 1IM9D 3O0RL 4P9HL 2YSSA 2UX7A 3O4LB 1FRGH 4R4FH 1Z32X 2YWZA 1MREH 4GG6F 2CPUA 2EO1A 4AH2B 5KSAA 4WU7A 1BWWA 4J3OC 4M8UA 2GBAA 4OI8A 2VR7A 4ODHL 1QZ1A 4PJEA 4XVSL 5AYTA 1CQKA 4J12A 3L3KA 4M9OA 3WL9B 5ECGA 3DMMD 4NAQA 4XP1H 4QRTA 2VISA 2C9UA 4JM2B 4S0HA 1M7IA 1MFVA 1U93B 4LU5H 3BGMB 1NEZG 4YL4A 4S2SB 3GMRB 4OLZH 1LMIA 2QPEB 2PUQT 2XWDA 3DKHA 4FKKA 3ZHDA 2VR6A 4Y2DB 4YHPA 1DQLL 1BF2A 5IJKC 5CHNA 3DBSA 4XX1G 2ADIA 3GB7A 1BG1A 5C2BH 1YY8A 4NQCD 5E23A 1ZTXH 4JDZA 4NPJA 4X9FA 4LSTL 3K6OA 2VXTH 4L3FA 2D3VA 1PJWA 3GRWL 1S7RA 1SJXA 1K2DB 2K3TA 5I6LA 3MREB 3FL7A 4ERSH 1LP9A 4LCCB 3S4SG 4OJFH 4N6RB 4PEEA 3LN9A 2W92A 1NIDA 4KVCH 5JO5B 3X14B 1ML0A 1U8QB 3O2WH 3NCXA 3RPIA 2BXYA 5KYUA 3VE0B 2ISDA 4HKXB 5DJAA 4I1RA 3MCKA 4GRLB 3TBTB 3UL4A 4LRIA 3KBHE 4X6BB 1X4XA 4QUOA 1YNLL 1RQ5A 3WFEH 2VLKE 3WO3B 3FUDA 5CMAB 2NNXA 3EXLA 1HZHH 3QNFA 3AS2A 5EUKA 2NY3D 5HHPA 1UD8A 4GUOA 2KKQA 2X4UA 2DQTL 1NICA 2VTFA 3DOSB 2BCKB 4AGLA 1J0YA 5KBKA 4X6CE 1ORQB 2BRQA 3MQIA 5I0XA 3WGVB 1M1SA 2ED7A 1UCBH 2E7BA 4AQ8C 3QGVA 2MQGA 1OGAB 2H32A 4FKEA 3O41B 2WXHA 3B1UA 1BMGA 2WNGA 2ESVD 1BQKA 1H3TA 2D3LA 1WA0X 4FG6C 5FKAA 3ABMB 1P6WA 3RTQB 3L3DB 1IEAB 1NIBA 4GUQA 4OV6F 3K46A 5DLML 4C4KO 2YPVL 4JNXA 2DWTA 3VNYA 3DPBA 1U8PB 3LNEA 3ZL2A 4LCWD 5IMLB 3QFDB 2E74C 2BNRE 1PG7W 3REWA 3FSZA 4GMSL 3M86A 1PY0A 3QCUL 4P9HH 4KKLC 4GP5B 3LPFA 4TXVB 3BN3B 4N2HA 1T66C 1TFPA 2VUYA 5AVTB 2DD8L 3GSNA 1EGJL 4ZYKA 3D7PA 3KLHC 1BJMA 4XVSH 5AW8B 4YZFE 1RD6A 3LZRA 1NDGB 3K80A 3JT2A 4ZAKB 3V6OE 3ZHLA 1Z1WA 2EE0A 2A3TA 1T04B 1DJZA 3UIZA 4PJGB 4MA3B 2BX5A 6FABL 1KLFB 1B2WL 1QWHA 2ZYSA 5DO8A 4U1JA 3L3IA 3KL3A 1Y0LB 1DE4A 3P9WB 4IRSD 1DQLH 2Y07L 3HPJA 2PYED 1F4WL 1PAZA 5IB3A 1WEJL 1A4JA 4LSTH 2Z35A 4AW7A 1CFNA 2IBZY 4AXWB 1F0LA 3KEHA 3GRWH 1ZVNA 4W9ZA 1N67A 2Q2LA 3T0EB 3EADA 2OJZH 1ITCA 1V5JA 2YAEA 3CVIH 1N4XH 4JG1H 3HZKB 3F7YB 4PTUA 2IWFA 4ISVA 4Q2ZA 2WLKA 1U8CA 3HHMA 5IBTH 1G9NC 3NCMA 3W56A 4BFOA 5KBDA 1Q9LB 3QDJE 1UT1A 12E8H 3B5HA 1JE6A 1YNLH 5CGYD 1IT9H 2GIXA 5A2JH 1JAEA 3UMTA 1IM3A 1JZGA 5DVNA 2XZCL 4GXVL 4JZOB 4GW5A 1AO7A 5FA4A 2WVUA 4PJXA 5IROA 1VGKB 3V10A 2W94A 3QUYA 5FFOA 3VA2C 4NJAL 1ZS8B 5KVGL 5DQDH 4HKJA 4NI3A 4UAOC 6PCYA 1RIUL 3BKYL 2OMXB 1CLYL 1JNNH 2X1XR 2GHZA 3HG1E 2VN7A 2FBOJ 1CFTA 1X9LA 5EU5A 2XN0A 1BBDL 3PWUA 3KYKL 4IKJA 4IBVA 2WB1A 1OTSD 4ZD3L 3BVXA 3G3LA 3D18A 3M6DA 4J27A 3GPEA 5DLMH 3P0GB 4BFIB 3V8OA 5ICZA 4DTGL 2YPVH 3N9GL 1HOCA 5MEQA 1A1NB 1PZ5B 5AD0B 3QRLA 2EVFA 4J8RB 2HUHA 4GAYA 3KVPA 2GIMA 4JEGB 4ZTOL 5JNYA 1G6RL 4GMSH 2QGDA 4HIJA 5BXFA 3U30B 1EUUA 3QCUH 4NS0A 3DIVA 4WJ5A 1KWGA 4I1PA 3OXSA 1OK8A 3QFGA 4EDWL 5INDA 1WFIA 5IBLC 3RWEA 3BUIA 3QIBA 2CO2A 1P4LA 4YXKL 5A40E 1FFOB 4JO4L 3PV6A 4KZCA 4NDMA 1EGJH 1S5HA 1SRDA 3DX8B 4F9PC 5I1CL 3DHPA 2NY5L 2NR6C 1ZDSA 3CH8A 3DYPA 4G80A 3TBBA 4OD2A 3VXMA 4LT7A 3PL6B 1ACYL 4JANA 1XGUB 1DZ0A 3TONA 3V4UH 1IILE 3NCEB 4MJIA 4MDJA 1NFKA 3BP5A 3FQUB 1MKFA 4ZPTA 4EUPG 1RUAL 4KBPA 5GRXG 3SJVE 1HNFA 1B2WH 3U0WL 2VDQB 4U3HA 1CLZL 3CMOL 1OB1B 4LEXH 4FMKA 3W37A 1ZHBB 1QX1A 2BSTB 1U91A 4NNYB 1BXVA 1GZQA 4GG6A 2OZ4L 2OW7A 5E5MB 1SBBA 1NIEA 1OM9A 4ADGA 3P3SA 4N2BA 4B9ZA 4JR9H 4POYA 3PGFH 3CZFB 1WC7B 4F7PB 5CSGA 1X6LA 3TPUB 5DMJB 3H7LA 2EUWA 4P57B 2R51A 5DEFB 2D31A 1ZE3H 1GZHA 4IRZL 4AMKL 5JORB 1T03L 3AU0A 1KXVA 5IFJA 4JFXB 4DP7X 2UZPA 1NAMA 4PJ7B 1VZIA 4M7KH 1CDCA 4OZFH 1UGNA 4MMYB 1TUPA 2YD5A 5L2KB 2CK0L 2MMXA 4HK3N 2Z8RA 5JIQA 1J05B 2Y2YA 2KERA 2VZ1A 1S3KL 2F5AL 4M6OH 3KLDA 5C8JA 2EQDA 2MWCA 4Y2DC 4S0TD 3LN4B 4L1SA 5E6IB 3RVUC 4NJAH 3GMMB 1SLXA 2EE3A 2FT7A 2XZAL 3UPRA 3BAJA 3BKYH 3H3KA 3BSZA 4PJ5E 5DYOA 3VRIA 1IC7H 3L17A 1DQIA 1I1YA 3VFVB 4AL8C 5F1OB 3DX1A 3CHPA 1R5VA 1NDTA 3QQXA 2VITB 2XX1A 2M83A 1BM7A 3D2UA 3F7QA 5IB5A 4WO4C 3KYKH 5D93C 1TTBA 2NY2B 3ML8A 3SBWC 5C2UB 4LCCC 5E51A 4HOWA 3DHJA 4ZD3H 3B9KA 4UM9B 1KCSH 3LHPL 3MKKA 3RX8A 5F3HA 4ZXBC 5ENWA 3VI3A 4BZ1L 5DK0A 2IBBA 3NSYA 5T1KD 1HHIA 4DTGH 2FBJH 4BGDA 3VXSD 5KG9B 1KJMA 4FTVD 4J3UA 1FLTX 5EEYA 3B5TA 4I0PD 2Y7QB 2AJYH 1GMIA 4YIQB 4Y9GA 3VXPA 1G6RH 3QE5A 3RKDC 3P1VA 4K7PX 4YXHL 1RCYA 4EDWH 2F54E 3EJRA 4F2EA 3EIFA 1TO5A 1R3HB 3LKOA 5EO0B 2TSAA 1MLBB 3VYNA 1JZ8A 4BV1A 4OGZA 3DA0A 4HKZB 1ZT4B 1ACYH 3X1FA 2IPTH 5I1AA 3BZEB 1W91A 3QEHB 5F93C 4R3SB 2HJKB 1QFHA 3NFNA 3CU7A 4WFEE 3L3HB 4ZT1A 4RSYA 4MD5B 1RUAH 3RTQC 3HLKA 5I18H 3PGCA 5IF0A 4FE9A 2DQUH 2VDMB 3AAZA 2PTTA 4GP4B 1SY6L 3HBGA 4YBQD 3IDXL 5BS0B 3GS7A 2Y2WA 1RZKC 5FK9A 1RFDH 3PRZA 5D5MF 5EIIA 3QQNA 3GBDA 2Q5BA 3DSFL 1KSRA 2VR5A 4POZD 3RRQA 3LIUA 1AXSB 1ZANH 4X7CC 4KITB 5I0ZA 1QPXA 2NPLX 3TVMB 1JDCA 4IRZH 4AMKH 4PJBF 5D7LE 2YD4A 4JHAH 1SXNA 1JHKL 5FFLA 1GJIA 5IW1A 2OW6A 4PP2B 2EIMB 3FO9B 3FO0L 2Y7OA 5DI8B 5JIHA 2NOYA 3OMAB 4X4ME 1MCJA 1QUNB 5EH1A 5FLUA 4GEJA 3N06B 1JNHB 1DBKL 4I9XA 2P5WA 2CK0H 4UNIA 1N0XL 2VLLA 5KYYB 4OCMC 4EN3B 4HEPA 3K8MA 2EXYD 1QTSA 2OR9H 4L1BA 3M17B 1H3VA 1HL5A 1X5AA 4FZ8L 5CFHA 4OV5B 2JCWA 3MRDA 4HC1L 1DJXA 1N3NA 1AR1D 1BVLA 2X10A 2KC0A 1IBBA 2XZAH 3FQ4A 2AV1B 1OSZB 5IVZB 3D9AL 4WEBL 4JL2A 5GGVL 3FH7A 4JHWH 2HSIA 5DUML 2E46A 2UY7A 3R8BB 2AK4D 5JIPA 2PWEA 5DD5H 3H2PA 3ZL1A 4XCYA 3EBHA 1CICD 4Y4KD 4J3VA 1H3PH 4LESA 3T0EC 1JHLH 4P4RA 1NANI 2J44A 3OKLA 5KVEE 1MNNA 5K59F 3LRKA 4LIQL 3IDGB 5CBAA 1K5WA 3NZHH 3TZVA 4ZMWA 2AXWA 3VRLF 4BZ1H 3DECA 1VKXA 1F4YH 1KV7A 2GPZA 3BHBB 2I24N 2YXMA 4Q52A 4YDJA 2V2TB 5IB2B 2HJFB 3EZ8A 1AI1L 3TA3B 4LL4A 4JGUA 3A5VA 1L3NA 3MLZL 5GGQL 1NCOA 4WV1C 5FYKH 4AIEA 3G6AA 5MP6L 3CUPB 5F7UA 3A22A 2CLVB 3D3VD 4IRJA 3TLRA 3IGAA 5D7KE 2WZPD 5C0IA 1XO8A 4KNUA 2E7DA 2Y7NA 4BXSV 3M1BA 4L9LA 1H6TA 2NNRA 4U3XA 1KIPB 5ABZA 4J28A 5J3HC 1W8EA 1G4RA 4JE0A 2VDOB 1RJYA 4NRZA 1OOAA 3CSTA 5SWQA 3EDDA 1QLRA 4RMBA 3RQ3A 3IDXH 4DGWC 3GMNB 3S97C 3C6LD 2AEWA 1A0QH 1M9SA 5T1MB 4HOZA 1GA2A 5FGCE 2O6PA 3FDWA 3U30C 1V10A 2XN9B 4K7FB 4OCLC 4LLUA 1YEDB 2ZSVB 4Z3EA 4MBOA 2G75B 1NCUA 5LGKA 2H9GA 2DH2A 3H8NA 5EBWB 3WNMA 2XTLA 1KCVL 1MFEH 3F12A 2ARJA 3BEVA 4ELMA 3B3BA 2XKUA 4LASL 2Y72A 3H2WA 1N19A 5C9JA 1WDAA 3QQ9D 3TXAA 1P69B 5F44A 3O11A 3FHAA 3U6RA 1P5UB 3PL6C 5C08B 1XBDA 1NEZB 4LZKA 2ZUSA 1J5DA 4BK4A 1DBKH 2WCSA 5DRZA 4Q0XH 2NY3B 4PJCE 1Y1UA 1N0XH 5CJOH 4GRWH 3QJVB 4HD5A 3F7VA 4Z0BH 4X50A 4HBQA 1JXGA 4IGBB 3GSQA 4AENA 1IIIA 4BSVA 2K78A 1WS8A 1AOHA 3SSGA 4DF9A 1RIVL 3EH1A 1KOAA 4HC1H 1OP5H 3EO9L 1EAPA 3ORJA 3P4NB 2LGNA 3T3ME 4B27A 4HOMA 3M8OL 3NZSA 2WKGA 3FB5A 4XMTA 4K9EH 1ZHKB 2BVQA 4RCAA 3ARFB 4NO2B 5GGVH 2UYLA 3O4LE 2I32A 4L4TB 3PWPA 3W11C 1OGTB 2IDUA 2VMEA 1T0MB 1JXJA 3S4SB 3SKJL 4X6DA 1OKEA 1PL3A 2YBRA 5DT1L 5BVPL 2APSA 5IQMA 5IVXE 4C56A 5I6KA 3UPAA 1DVZA 4HXBL 3ULUF 3UTTB 1HILB 2HA1A 2NT0A 2XXFA 3QQDB 4QRQA 3U7WH 4DGYL 5JQ6L 4NAJA 3VXOA 3ZKXB 5CJ5A 3ULAB 3RJQB 2IQAA 1KPUB 2GHWB 4MXQD 4R84A 4EI5A 3MCYA 4UNUA 5HVWA 1KB9J 1XVSA 2CKNA 3VW3L 4AVKA 3SPVB 2MCG1 3KPRB 3APFA 3VMPA 5C0BD 2RAMA 3LSOA 4DN4L 4P2OB 4IEFA 4LCUB 1EBPA 2HVKA 4I4WB 5E6IC 5GGQH 3PJNA 2F6AA 2VXUH 2LU4A 1XSOA 3D85D 2VDPB 3DXAA 4C83A 1KIQB 5LJYH 2NY0D 3KPSE 3ISRA 2WYTA 5F9WB 4OJDH 2BZ7A 1VJSA 2YUWA 2OQJA 2NY2C 3V4PL 4L3CA 1XR8B 4DGIL 5J57B 5CZXC 4N28A 1OGSA 4ESKA 1TTGA 1WA1X 1OF0A 2X1WL 3NPZB 3OGCA 2AI0H 4IRSB 4KI5E 2A6IA 4PUBL 3P0VL 5J9PB 4QMEA 5F7NC 4S1RL 5HDBB 3VTTA 1PIFA 1X9QA 1KNOB 3MN8A 1E2VA 3ZTEA 4FQPA 1MCKA 3TU6A 4OZ4B 1HSBB 1WYJA 1AANA 4Z7NE 1A6ZA 3P2DA 1MUJA 1OAJA 2V5TA 3RIKA 4MB1A 5IW6B 5DK2B 2K9FB 5KVDL 4AC4A 4UYPA 3ZRCC 1SHWA 1U8IB 3VFNB 4WY7L 4OF7A 5H94B 4LARL 2PWDA 2J1KA 2Z31B 4XCNA 1CE6A 1UTDA 4LPWA 1KCVH 3DX7A 4XBPA 2JCCF 3HKZA 5E2TH 4JFUA 1A25A 4AL8L 4OLYL 4R97B 1OGAE 2XQYG 2DQMA 1H3WM 1QEWB 4RQQA 4F7CA 1Z9MA 1FYHB 3NZ8B 5TQ2H 2BJMH 2DLFH 4IU3A 1HWWA 4M7ZB 1KENL 4F37F 2VN3A 2MHAB 4JJ5B 4AGNA 5FECA 4Y7OC 1AGCA 3M8OH 4TKWA 3CDZB 4F8OA 2VABB 4B60A 3GZQA 1FVCA 3KPLA 2DYRB 4GP8B 2A73A 5IHUL 1S5IL 3AY2A 5DT1H 3V55A 1HINL 3KJ4B 4J4PA 3SDXE 5BVPH 3BLPX 1M6OB 3STLB 3TVMC 4ZX5A 1U6AL 2QGCA 2Z64C 3FT9A 4MQ7B 3P77B 3GT6A 1KTLB 2OTUB 4HXBH 4KJPD 1GJWA 1QABA 3TV8A 5HHQA 5TE4H 5JQ6H 4DGYH 4HGWB 2WV3A 2NYKA 4PJGE 1U8LA 4NZJA 3LDBB 4NHCL 4L8SC 2JJTA 3VW3H 1E30A 3HZMA 3MRLA 3WDHA 3CZSA 5IUCA 5D1XA 5J5EA 3E6HB 5E5RB 2IAND 4JL1A 4X7TA 4ZNEE 3NRQA 2D73A 4M9PA 4GW4B 4DN4H 3RUGB 3F6IA 5IMOA 1DHKA 4KTDL 4FYRA 1CE1H 1E4XL 2KQNA 1RUKL 1PS3A 1MDAA 1RZKL 5GZOD 1AZBA 1R46A 3QUXA 3ZKNC 1H9VA 1HYSD 5KSVA 3NABH 1TF4A 4WUKL 5I8EB 3LKPA 1TEGA 4DGIH 4PRPA 3DTXA 5CEYB 4DK5A 5E7BA 3UBHA 1FHGA 4M43H 3G04A 3T04D 5BRZB 1MG2C 3ML9A 1ACZA 4PUBH 1Q9WA 2Z34A 4TS6A 1NC2A 3F5WB 2AV7B 4LVHB 2J88H 1QFWM 3N40P 5EEVA 4X8GA 1CYGA 5DWUL 2WQRA 1G1KA 4YSEA 2J4WL 1WT5A 5E6SB 1JP5A 5DD6B 2EDTA 2FJGB 4YOKA 4F92B 4GBXB 5IHHA 3TA3C 5AYUL 5I6OA 3PNWA 4FFVD 1SN2A 2QR0A 1JPSH 1SXAA 2HJLB 3D39B 5KVDH 4OBSA 3BXNA 2Q3ZA 4HUKB 5C0CD 4LARH 3ARPA 4HZLA 1G7MB 4KK6C 4KROD 5GISH 1MVUB 1HHJB 1T3FB 3T4AB 1YEHH 2JTDA 2VSKB 4JFQB 3UAJA 3GI9L 2DBJA 4PHZA 1T5XA 3MV8E 1CDJA 1HXMA 1F18A 2XFXB 1TOXA 5FV2A 2VZSA 3Q1SL 1EWHA 5AZEH 4WKZA 1PSKH 4AJWA 4EUPB 1QI3A 5HJ3B 2GBVA 1RLWA 2DH3A 1NCAL 2DLGA 3EGDA 3KPMA 3MRIB 3SCMB 3ZE2E 1SXCA 4GSXA 4HLZG 5CIPH 1AXTH 4L0ZA 1DQTA 3WSQL 1BECA 1ZSHA 2JH2A 1UFGA 1KENH 3Q06A 1A66A 4CMMA 1OARL 3QQ3B 4G8IA 4ZBJA 2VMCA 1MRFL 5J6HA 1MG3C 4L2LA 1AD0B 3FN3A 4YPGA 1KJ2A 1I8MA 2LU3A 3JWOC 2VXSL 5DJCA 1XZWA 4CN6A 1XCTA 3MFFA 4KKCC 3TJPA 1FAKT 4B53A 1QI4A 1I8KB 1S5IH 1XCXA 3JTBA 4TV3A 5FFGA 3UBXA 1HINH 1P4IL 2ED6A 3ZOAA 1I3UA 3FXIC 4YSPA 4R0LA 2VXQA 1R75A 1DLFH 4H26A 1T22A 1FYTD 3L3GB 4FTVB 3HR6A 3VWKA 3HLAB 3TCLB 3WN5A 5E2WL 1S7SB 3CFUA 4LLWA 4IHOA 4HPYL 5DMKA 3FBQA 1JGEA 1JTPA 1QQDA 1AGBB 1F3DJ 1HI6B 3CD4A 2BXZA 4GKNA 2O72A 4DUVA 3K72B 1G7IA 1U4EA 3AXLA 4QHNB 1AD9A 1Z5LB 2RCSH 3FUKA 1OALA 2WXIA 4IGBC 4LSDA 2OCFD 4LF3A 5FIEA 3BGFB 3IN2A 1HDMA 4IOIB 1DBMH 2ZT9C 3ABKB 4QAWA 5D70H 4Z78A 4KTDH 1H0DB 5EC1B 2MSPA 4H8WL 3UPCA 3MV7D 1WGVA 1E4XH 3BJLA 1I4FA 2K0RA 1SMDA 4P49A 3ARFC 3DYOA 4P0DA 1S7XB 2XNAA 4XODA 5ID0A 4N2AA 4DUWA 4PP1C 4DP2X 5B39G 2UUDH 1ZCRA 1JFQH 2G3ZA 3LKSB 4NKOB 3QJXA 3WY1A 5HY9A 2PXYB 2X4RA 4N8PA 2FH8A 3OX8B 2Y5EA 3DO4A 4M6AA 3NESA 2A4CA 2A9NL 3UH8A 3V95A 4YMPA 5F7HA 1TYRA 5AVWB 1FNFA 2OMUA 5T5FH 5LCVA 5KYWA 2DY2A 2WBJA 5ADOL 1MHHA 3ZKXC 4YSAA 2ITCA 1G9MH 5JQIB 3PXLA 1I1AA 3NJVA 4F8LA 1B3JA 1QLFB 1WITA 4HEME 2QHRH 4RAVB 3EJSA 1RHHB 1FFTB 4RFOL 4JFEB 4PRHD 2VDQL 3KJ6H 4IOFC 1MRDL 3QNYB 1DUYA 2WWMD 4P2OC 5JXEC 4QRRB 4JO5A 1AC6A 2X2HA 4LP4A 2A77L 5HVGB 3F00A 3TESA 1PVHA 3KXFD 4MS8D 3BP4B 3VD4A 5A2BA 4JREC 5DMGC 2BMKA 3I6GA 2FX7L 3SDDC 1UWGL 2GW5A 1NGXA 4ES8A 5F9WC 4TYUA 3Q1SH 3ZR5A 3IU4L 2UWEA 3SGDH 4JS7A 4LCVA 4TMPA 2LR4A 1NCAH 3MRPA 4JPQA 5IHBA 4H1LG 1J12A 2DMHA 5GGTH 1NC4B 1NUNB 3V4VB 5AENA 3H2QA 3P9LA 4TRPH 3KCPA 1OARH 1UXMA 4HS6A 4BFRA 4JCWA 1E9OA 1MRFH 3ATDA 4GO9A 3ATEA 4RMRA 5D9SA 1GL4B 3FFCA 3R8QA 4PAZA 4K7PY 3QDGB 4BFGA 25C8H 4ANXA 1UD3A 3ZRSA 4I3RL 1ZK5A 2DJUA 3G5ZA 1BAFH 4PRNA 4X8CA 2V7NA 4W6WB 4JKWA 1ZD6A 1UWFA 3GRWA 4L4VA 5F7DA 2Z31C 4PJAF 5AB1A 4HPOH 1JK9B 3NRPA 3WJLC 1TKWB 3LXBA 4PSRA 3PE9A 3QNZA 3V7AG 3GMQA 5IV2A 2C1OA 2GUOA 1C5CL 3Q5YA 1B9ZA 4AE1A 4R97C 3HZ3A 3OAYH 4HPYH 1JGVH 4BQBA 4CC1A 4N5EC 5BOPA 2XKSA 4R4ND 1SJMA 5FC9A 3TNMB 1G1OA 2G2RA 3UX9B 4HZ1A 4APXB 3C5JA 2UZXB 4WTQA 2VQ1B 3GZPA 2VIRB 1EFQA 1H5BB 1KIRB 4J3OF 3NJGA 3KW8A 1FIEA 3V0EA 4MA1C 1N6QL 4KK9D 1VFAB 3VD1A 4FNLL 3RAJH 2JXMA 1AMXA 4OM0L 3DX3A 3PHOB 1ACXA 5JUEL 3U6XA 2FLBT 5FYLL 2KZWA 1QRNB 2IEPA 4Q6IA 1IV8A 4X2UA 2EICA 4G43B 1XFPA 1BZQK 1HSAA 1OOWA 3FCSA 3HE6B 2HLFC 5E0FA 3KJ4C 5FF6B 4BDVB 4E9LA 2NTSP 3IS0X 4WWPA 1OAKL 2K7QA 4PJFF 5DRXB 3HMXL 1G7JB 1IAMA 1WAAE 3IDMB 4L29B 4U1LB 3RY6A 3UTSA 4JO2L 3W0WA 5C07A 5IK3B 1F6FB 3GRBA 2ED9A 5A2IH 2AJVH 1IGJB 4FQJL 1JPGB 1MW1A 4AQOA 3RWFB 3IMSA 4M7LH 2BFVH 2YPVA 3B2VL 4PWGA 4PREA 4OCRH 2WIIA 4JRYE 3QJRB 1MIML 4RFOH 3LKNA 3ARGD 5DO2C 2HG5B 1GH7A 2VRAA 1JK8A 4F5CE 3VO0A 2VC2L 4JRWA 1WCBA 3QJTB 3QR0A 4KKBD 4XCFL 2EO7A 1ID2A 3IJSB 1IGCH 5I30L 3C09B 2FX7H 4L37B 4K23L 3QWRD 4N2GA 2APBA 3FONB 2GTZB 1QI5A 1IC5L 4MCZA 3B5GA 4A39A 4Z3FA 4U1HB 1KCKA 1WIUA 4X5LA 5CF3A 4NSKB 4RGND 5T1LD 4NHUB 3EGSA 3NVQA 3I9IA 4L8DA 3RWHB 1LK3L 1MCWM 2WB7A 1GGBH 1JWUB 3ME0B 3NIGB 4NUPA 4XPHL 3ATFA 4LVHC 3ZW3A 1UB6A 5KVMC 1IGIL 5A7BA 3FULA 4DKTA 4NYLA 3QULB 1R3LA 3HFFA 35C8H 4DO6A 4GBXC 4JJHA 1SJEA 4TTGA 3HMWL 1XGRA 2CNYA 1DUZB 3PU7A 4BSWB 1J5HA 3JVFC 1YMHB 4WUUA 4N0CD 1ID5I 3OD3A 1MEXL 1WCQA 5I0DA 3UJIL 3QJFA 5KANG 1EXUA 3T4AC 2NQCA 4XMLL 5LN4A 3UTQA 4ABQA 3Q0HA 4GT7A 2Y25A 1B3IA 1MY7A 3D25B 3FO1A 1BZEA 1SM3L 4OJYA 3BVTA 5ICXA 3QFJA 2NXYC 3PLYA 4I8DA 3K1KC 2YUZA 4AW4A 1ZS2A 5F1NA 4F2MB 3WJJC 4OZFA 2Y22A 3SCMC 2Y1ZA 1UXWB 5I17A 2E9GA 3NP4A 3WAJA 2ZUVA 4PVNA 1XH1A 3SE4A 3IM1A 1IAIL 3K74B 4JO1L 1GKOA 4YLBA 3LXUX 1FV1A 1YAIA 1DQVA 2PP9A 3KAAA 1JGUL 5B3JE 1N6QH 3PHQA 3BYYA 5DQJA 1XH2A 4HIHB 3GHEL 1QR1B 4OM0H 3SB3A 1KN2L 3HZVA 3WIIL 5JUEH 5KANI 5IFHL 2QDWA 3BH9A 2K4AA 3AM8C 4FP8L 3S88L 4DKDC 2WO3B 1A5FH 2OP4L 1VADB 1ZT7B 1FZKA 4HVBA 4JO2H 2NY4B 2NT1A 5D8JL 3GBNL 1CIDA 1CL7H 1J8HA 3LS5L 5DFAA 5IEKA 2WVSA 3LVTA 3TJEL 5JYLA 1Z6JT 4OKDA 5ALCL 4AM0B 5E4EB 1VA9A 4I7ZC 1O5DT 2F74A 3B2VH 3IXAA 1KY6A 4NP4H 2BVPB 4PBWD 2FJFB 4Z7VE 4HIEB 4LOUD 1WUZA 4EMZA 3HW7A 4WU5B 3S6CA 3WEBA 3BGFC 1G6RA 3QH3B 4G71B 3QAQA 4O4YH 2HFGH 5I6XB 4N0FA 1U9KA 4L4TE 4XCFH 1GYCA 3QIWB 2ESVE 3ZKSD 5I30H 4IIZA 2Y7SA 3JWOL 1BD2D 3NOIA 4K23H 5AKTA 4MXVE 3S8WA 4HWBH 1DCLA 1KGYE 1W2KT 4FMVA 2DF3A 3L3OB 4M48H 5KSBA 3G9AB 1MJJB 4R7DA 3FOLA 2PXYC 1DYZA 4G5ZL 4KAQL 4N2CA 2EVHA 4HHWA 3QEGH 4YHOL 2DJSA 1ZPUA 4LCWE 1MFNA 4S1DC 2Z4QA 3BW9A 4HDIB 2EADA 4IKLA 4X99B 3L1OL 3WMSA 2QT6A 3O6MH 3JSSA 5G5DA 5TDOA 1HAUA 3MJ8A 4P5TA 3AU1A 2OZ4A 1EQWA 4Z18A 2AEQL 5AAWC 1AIFA 4X0KB 4R96A 3HMWH 1WUNT 4JFFD 4XBEL 5DRNA 3O6FD 1NFDB 3VB8A 1XX9C 4HCRL 3E8UH 2XY2A 3ROLA 2UX6A 3UJIH 2EDNA 4M8QA 3E1ZA 5I1KH 1CXFA 4XMLH 4M1DL 1R1CA 4P9ML 1BZ9A 3B8SA 4IRZA 4KRMB 2IWKA 1SM3H 2Z7YA 3EFOB 4A04A 3HRZB 1NLDL 2CRMA 2MTPA 1MNUL 3AITA 4NNXB 3L3JA 4U0RB 4CSPA 3MNZB 5JPMC 3OB8A 4YH6A 2QQLH 5HDBE 1FFRA 2C9QA 2GT9B 2FHCA 2PYEE 2YPLD 1ED3A 3IN0A 4FXKC 2BOCB 1IAIH 1QA9B 3CDGA 4JO1H 4UWQB 1ZGLP 5EC2A 3MNWA 3GKWL 5IB4A 4DAGH 3C9NB 4LDOB 4H8UA 5JXAH 4P59L 1TYEB 4PJAA 1TZHB 3SHSA 1VEPA 4YE4L 4FQXD 3GHEH 4E41D 3INUH 3QUML 1LK2A 4N8UA 4TSCL 5HPMB 4TVPD 1RK1B 3PWNB 4NZFA 5FYKD 3LZOA 1J88A 1TITA 2WLNA 4KY2A 3RIAK 5D1QA 2HVBA 4TL4A 3IJHB 4EZMA 4ANKA 1QNZL 1WISA 4KDTC 3RDTA 1CXLA 3HBPA 2DPKA 4V11A 3AS0A 1JG9A 5D8JH 4KKPA 2IGTA 3LS5H 4FJ6A 4MWFA 2C9VA 4CU7A 1MXGA 1L9RA 1UOKA 3QIUD 3CDFA 5ALCH 4EZJA 3BFOA 4FQCH 4BZ1A 2WLLA 4J6RL 4MVBD 2WNWA 2GK2A 3VYOA 1MFCL 1QFWI 2NW3A 2EXWC 3O0LA 1BSIA 1BLNB 1H5BC 2EIDA 4OKVB 1ZLWK 1RJLB 3P11L 5SX5K 3SBQA 4HSCX 2N01B 4PWHA 4PG2A 3KVDD 4QRAA 1JV2B 3TGXA 1Q9OA 4IBZA 5EF3A 3LKQB 3QXAA 3CHOA 2OSLB 3TWCL 3VQLA 4F8NA 3PAYA 2XPZA 3VXUD 3EOAB 3VWJB 4XBMA 2OK0L 3HE6C 4TUJA 4KAQH 2VJXA 1J1XH 3UOAB 5ICYB 1N7ML 3CLEH 4O00A 4YHOH 3T1WA 3W81A 3NEEA 5FO7B 5C09A 2JSFA 5HBBA 4ZW6A 1AG0A 4N1CA 1B0GB 2HH0L 2BS71 1WF5A 3HS0B 3IMVA 3STBA 1SY6A 3CSYB 4JFTA 1C12A 3UEZA 5HYJA 3L81A 4AYBA 4PW9A 3RZCD 3IDYC 1MAJA 1JV5A 4GSQA 1NGZB 1NOFA 5C0EA 3BCFA 4HCRH 1AP2B 2VUOA 3BIKB 1KYDA 2ZOLB 1AJ7L 1BFSA 2WZ6A 1A1MB 1HHHB 4YEEA 3T2LA 3C09C 5H2BB 4P2RA 5IBUG 4AV5A 1OCWL 3TBSB 2WQWA 2XWJB 3O8XD 4H88L 2KPWA 1E8YA 4HZAA 2R29L 4GAAA 4QYOB 1AZRA 3B9EA 5F89B 1BGXL 2I07B 4WWNA 3HI5L 2OI9B 1NGWB 3L9YA 4A2GA 3OR6A 5IM7B 3NIDE 4G7YL 3GSRA 3MRCA 3VFOB 4KVPA 1D7CA 2IBGA 4HC1A 5LAPA 1F11A 2W0FB 1WAPA 2OMWB 1WS7A 2C3VA 3QUMH 1AS7A 1OLZA 2XXMB 4MNGB 5CJXA 2A9MH 1OEZW 1NGYB 4LCYA 3MNDA 3VI4A 3LY6A 4Z7OF 3I6KA 4KUCF 4L5FH 4G2AA 4TSBL 4OZGB 4ZTPH 4MAUL 4BXVA 1KJ3H 4JFHE 4JFPA 4HULB 4AX3A 1W16A 3POHA 4DOHE 2UY6B 5JHMA 4UNVA 5J1SC 4UQCA 1FH2A 1Z3RA 4PRHB 2ZUQB 3AROA 1JN6B 3MXVL 1DSFL 4J6RH 1KCWA 3MGOB 1KF9B 3EW3B 4ZMAT 1MFCH 5B3NA 5DDHA 4APQA 5DK3A 2G60H 3BQVA 3H6AA 3KXFB 1OTUC 5JZ7D 3SPIA 3P11H 4EBQL 3CH1B 1MIEH 2AQNA 4HHAB 2P28B 4ABUA 1R3IL 5CO1A 1A9EA 1GOFA 2LLGA 2X9WA 3N0AA 4XPAH 3O3EB 4G9DB 4LOEA 1BMWA 2PWHA 2O5XL 2F2HA 3AUWB 4AGMA 1MQKL 3VXSE 4N8VB 1NPUA 4FTVE 3CFDA 1FF5A 3TBYB 5JQHC 2NY4C 2BSSA 4JG0H 2HKAA 3T77B 4JY6A 5E4EC 1J0HA 2FIKA 3EUDA 1HS6A 4DP5X 1E4WL 3TEWA 1WV7T 4Y4FC 3ZT6A 2YHGA 2JJUA 1D6EA 3V0HA 5IHZA 4X83A 4A2DA 2XIIA 1AO7D 3B8YA 3NH7L 3ILPA 3IFOB 1GYAA 1PZ3A 4GSDL 3QUYD 1FDLL 1E6JH 4PRDA 1DCEA 2X3AA 4ABVA 1A4CA 5I0WA 3QIWC 3ULVD 5I82A 2WINB 1JSYA 1T1ZA 3F01A 5F1SA 3V0FA 3GIZH 4QYAA 4L3ED 4F8QA 4OIFA 1OCWH 3HB3C 2J8HA 5JHLH 1P1VA 1U3HC 3BLKA 4FQLH 4H1LB 4H88H 1ZOXA 3K6FA 4J3XA 5CILH 4QOKA 1ES0B 3OBAA 3GO1L 4F9LC 5K69A 3ARTA 1CZ8H 5J06A 2Y69B 2ID5A 1TR7A 1YEKL 1BYPA 3ARDD 4LDLB 1T7YA 4WVRA 2XSKA 1IFGA 4PVLA 4MDIB 1HTYA 2R1YB 3ZIYA 3IEAA 2Q76A 3M7FB 1A22B 1Y1DA 5H37A 3OSVA 1J9SA 1OK0A 1MFDH 3Q5OA 1YN6A 4N26A 3F2LA 5EUOA 2LT9A 4QRRE 3O9WB 5IB1A 2ETWA 2BM3A 1U95B 2WXFA 4BZYA 3EDJA 1DBAH 1BHGA 2DDQH 2R15A 1W72H 5D2NA 1D5XA 3HVNA 2FSEA 1MCHA 5TDPB 1RI8A 4JPIA 1MCLA 2B0SH 4G6KL 1XIWB 1XR9B 4ENZA 3MJGX 4PV8A 1DSFH 4YR6A 1FFNB 5IT2L 2BNUA 4TLUA 4TQEH 4OVVA 4HCIA 3CFJB 3IAGC 1KGCD 5E1QA 3T8XA 5E8PB 5KS9E 2ZIDA 2VN5A 4GQRA 4M6NH 2FYYB 4Q4EA 1GZPB 1IKNC 5DTFA 5CD5D 3GXPA 2BRRL 4L9DA 4MZIA 2AK4E 4A38A 3VRJA 2GFBB 1OPGH 3QDGE 5E94B 3GTVA 5AVZB 4M61A 4NM4L 4WNQB 4RGNB 4LAJH 4XOCA 4OVUA 4ZFZA 4XNQB 3FNKA 1WIOA 4K3EL 3S34L 5CSBA 4C55A 4LLDB 3V4PA 3BMWA 2G5BB 4U1IA 2KMWA 2Z0BA 3ES6B 5A7EA 5MENA 3LV3B 5ISZD 3SGJC 3ZQXA 3LKRB 5C0AD 4B9GA 4D0BB 3EYVA 2GY5A 5DA0B 3L2MA 5TDNA 2G4GA 2HCZX 2JLLA 3BFWA 3DLQR 3FTWA 1EZUA 4QY8A 3HI6H 2O6DA 3WLBB 2IV8A 2NNAA 3SDAA 4F8TA 4ZFQA 1T5WB 1DANT 3D6GA 5F7WC 5TF1H 2VE6B 3D3VE 3R4DA 1OF2A 4N25A 4XHJD 3EYQC 2IH3B 4Y5YC 3NH7H 4PLNC 1F2XK 3TBVA 1KGXA 2P8LB 4PJ7F 4YAQB 2R56L 2B08A 1L0XA 2DL9A 2RJMA 3L1FA 4NCC2 4OZHB 4ABWA 3FTGA 5EEZA 2IAMC 1V3LA 3RNQB 3VWJC 5JA8B 2C1PA 5LNGA 3FB8A 3RZWA 5BZDB 2O1AA 1G0YR 2H5UA 2EDKA 3QEUA 5BPPA 2HFEA 4R2GB 2YO3A 1XF3A 4WO4A 4QLRA 4UIMA 4WW2A 1NSNL 3CMGA 4FFYL 4LCCA 4N90D 3MRKB 1XF5A 5JLZB 5IWLA 3GI8H 3JXAA 1VSCA 3EH3B 4Z76B 1U8QA 2NYYD 3MBED 3RTLA 3VFTA 2E86A 3HS0C 2GK0B 4ZXBA 3QI9D 2H2PD 4OGYH 4CL7A 1KJVB 2FATH 2X4PA 5ESVA 2FL5B 3CXDL 1OSPL 2YUXA 4ZUVA 3V6ZA 5JPNA 1T2JA 2QVKA 2OLDA 2X4OB 2Q6WB 3AWEA 2I9LA 1JCKA 1GOGA 5IQNA 2OXGA 2EO9A 1FORH 1CDIA 4TVSa 3GBLA 4YDNA 1A7NL 3UP6A 2DIBA 2Q3XA 4JK0D 4E42B 4GFTB 1A8ZA 1MZYA 3EGXB 5EZLA 2VLRB 3LD8B 4QKXB 1BJ8A 1KTJA 3NIGE 3FT4B 3MO1A 3P9MA 4NIYE 1WQVT 4PRIA 4HEPG 5FO2A 3TV3L 1J1OH 5DVKA 1PYWA 2VDNB 1SVCP 3WYRA 3QYCA 4ZQKB 1TVBA 2BRRH 5BZZA 2P1YA 2ZF8A 1NEPA 3IFLH 2NY6D 1OP9A 1K8IA 4KRPB 3IDNB 4PJHB 2EXTA 3JWDL 3T6ZA 1MJ7L 4M4RA 2VDKL 4CAGA 4WI5A 1LO3L 3HR5B 3IETB 3OJDB 3VFRA 2Q1EA 3HZYA 2Q20A 2O4EA 1DQQB 4K3EH 3S34H 4CVWA 3PS6A 1OY3B 3D12B 4UF7C 1MELA 5HHMD 3LNFA 1HXYB 3MCG1 3KVQA 4XNDA 5IVNA 1Q0EA 4QAMB 1KTDB 5I76A 2EDYA 1CD0A 5C0BE 3QXWA 4F2ME 1ZA6B 4JN1L 4BUHA 3D05A 3O6FB 4NQDA 4ZUUB 3OKMA 4WEEA 3ZDZB 4AVHA 4H44C 4DPAX 4JFOB 4JHVA 2LLLA 1V05A 2CDGB 2FGWL 4G42A 1KLFA 1NL0H 5IJBC 4OZIE 3FFOA 3OB0H 3QUZA 4HQQH 4RZKA 1O75A 4WFGD 3GZKA 4X4XA 5IKCA 1WAAF 4I18C 1Z7JA 4IBQA 3V0WH 2QL1A 2R0WL 4P2QA 2Q9OA 2R56H 5KOVC 4KK5D 1A6WL 4Q6KA 5KN5B 1PG7X 2NSXA 5SWZB 1EZLA 4UT6H 2Y6TE 5B8CA 4NRYB 4MHHG 4AQ1B 5DJDA 2GEQA 3B7TA 4XC3L 4P3DB 4K2UL 4BINA 4AYID 1NAKL 4FFYH 4PS3A 1I7TB 1RUQL 2YN3A 3PDOA 2D7NA 1LTXA 2P5EB 3BLBA 3EDEA 4Y19A 4E41B 2VLJB 4RH4A 1T0PB 4HF5L 1GPOL 4I48A 4YWGL 2ZF9A 4UDUB 4U6YB 4LPXA 4XB8A 1R0AH 3WXWH 4DN3H 1D5ZB 3VMNA 2HT2C 2YSSB 4ZDHA 4JO3L 2E9WA 5SWSD 4MJ5A 2Z9TA 3ARVA 1RUPL 5KSAB 1C7TA 4WU7B 1B6UA 2EUXA 3O2VH 1OAXH 5E9DD 5KBLA 5C7XH 4LDEB 4HT1L 4PJEB 4FG2A 2FD6H 4UIKL 1I31A 1NJ9A 3L3KB 3WLWD 1PZUB 4WV1A 2PR4H 2YQ2A 2BVOA 1K6QL 3CJJA 3AREA 3RILA 4MHHI 4ZO9A 4QRTB 2YA0A 2VISB 2NX5A 4JFYA 4IRJD 3RJOA 1M7IB 3LZLA 1N8ZA 3BKCH 4OD3L 2YPKA 5LKNA 4J3OH 1D2OA 4N9OB 2VSCA 4FNPA 2VZOA 3QNXA 4QNPF 4OCYL 1X7TA 1GCYA 2KPNA 4YHPB 1FFPA 4RDBA 1UWYA 5CHNB 4V1DD 3KLLA 2ADIB 1UD4A 3GB7B 4GMTH 4FNRA 4PB9H 3GIVA 1YY8B 4JDZB 4HX1A 5C7ZA 4CMHB 4UT9L 1BJ1J 3WO4B 1S7RB 2XV3A 1ADQH 3JWDH 4KTYA 3SD5A 3A3YB 3FW6A 2R9HD 4QXWA 3O9WC 4DIXA 3MVSA 1UKTA 4AEHL 1LO3H 5K9JL 4R9HA 2F7OA 4P4KA 1ZLUH 2XV0A 3FQXB 2BSED 2HTLC 4L1HA 2VDLL 3ISYA 4K5PA 3RPIB 1EHXA 5G55A 3DRQA 1I9RL 4KQ4H 1J9CT 1MFUA 3B6SA 5DJAB 2IJ0C 3MCKB 5KVFL 1OLLA 1AIZA 3JTTA 2IANE 1KIUA 3B1TA 3ESUF 4S0SD 1J0ZA 3PV7A 4AI7A 1I1CA 1XIWC 4LO9A 3ZE1B 1RU9L 3QPXL 4UZUA 1IFHL 1I9JH 5KVEL 2JK5A 4UZSA 5EUKB 5HHPB 2Z3FA 2FGWH 3T6QC 1EVTC 2WHVA 1DJGA 5ICUA 4E9QA 4G3YH 4P5MB 1UH4A 3L4VA 2ZSWA 4HIXH 5T3ZL 2R0WH 1M56B 2CAKA 2BH0A 2NZ9D 1SVZA 2O5YH 4QRFA 4UQ9A 1P4BL 3JWNG 3KLSA 2JKXA 2H32B 4ENEC 2HYMA 3CZFA 1Q0XH 4QHLA 2R59A 5FKAB 5JDSA 4MXWH 2XVGA 2DYPD 3S3PA 3SYQA 3QO1A 3LRLA 1TJIH 3AB0B 5FV1L 1HWGB 2MRYA 2F08A 3HC3L 3HNTL 2ZUXA 3DPBB 4JKKA 3MLVL 3QDAA 3UAAA 4Z7UE 4Z95L 4MZRA 4N2LA 5DFVC 2J8UE 4JX0A 4MQXD 5C0CE 3REWB 3RP1A 3G6DL 5FOBA 4JO3H 2B14A 3X3FH 4HG4J 4W4NA 1ZLSL 4LLAA 3GSNB 4ZYKB 3K71A 4LPVA 3SOBL 1NTDA 3WDJA 3D30A 4L23A 1UJTA 3TX4A 3UYRH 3V0IA 4E9WA 1RSYA 3AGWA 4HU8A 1K6QH 1L9QA 2PPFA 3K91A 4Y5VA 3RVVC 4AEIL 3SQRA 2QLVB 4DO4A 1HFUA 5TE6L 2YGPA 4RX4D 3ZTDC 4N8CL 5LXGL 4R2GC 3CLFL 4U1JB 3L3IB 1KZYA 1DE4B 4OCYH 3HOGA 1KEML 4YUEH 4ZRGA 2VQ4A 3HPJB 4NPYA 3FS9A 3HNVH 1SVBA 3EFDL 3TT3H 3F04A 1A4JB 1GJUA 1HL9A 1CFNB 2W60A 4CJ1A 5IMMA 5EORH 1I1RA 2AGJL 3AG1B 5DMIL 4AMWA 4DQOL 2Y5TA 4YIQA 2ORBH 4LGSB 5JW5A 1OVZA 5JIDA 4Y1AA 5HDBF 4PTUB 1FNAA 2EKSA 3SD2A 4ISVB 1LE9A 2BO0A 1XSKA 2PN5A 5D6DC 1EANA 1I9RH 2KUTA 4Q2ZB 4YEFA 1U8CB 3MROB 1Q94A 1B9KA 3HMXA 2VQTA 1GC1C 3DJTA 1XTLA 1OTTC 3BC9A 4JB9H 1EHAA 4IBWA 3QDMA 3AT8A 4PV1C 4BK5A 2FHBA 1IM3B 1CTNA 3LD8C 5FA4B 1IFHH 2D9CA 2YAMA 1AO7B 4GW5B 2CLRA 4K3DH 4PJXB 4CW1A 2KT6A 3NJXA 3ILDA 1DBBL 4R3SA 4EJ1C 5KVEH 3QUYB 1A02N 4JVPA 5HHOA 3ARSA 1L9TA 1UENA 4HKJB 5CINL 1FZOA 3PWJA 4QJ3B 2E75C 4FQ1L 1WZ1L 1CFTB 1A6UH 5EU5B 4KRPC 3ISWA 3CN1A 3PWUB 3ZYIA 4MNGE 3KWWA 4IBLT 5LQBH 3T0DA 4XXWC 3PWLA 2B7DT 3IMBA 3NSCA 4UTBL 4ZW3A 1TQUA 2IPKA 2FEEI 3GSXA 3ALPA 4WI8A 3LYRA 3VXRD 3D18B 1USQA 3NFSL 3HS8A 5CGBA 4K8RD 3LOWA 1HOCB 1ETJA 5MEQB 3OV6A 3VD0A 4PRHE 3MLVH 1BFOA 4GAYB 4KX9A 1QASA 5ITBL 5JNYB 8PAZA 4HIJB 5BXFB 5IQOA 1PZ2A 4WJ5B 3OXSB 3APDA 5INDB 3KXFE 1AH1A 3QIBB 3MRBA 1P4LB 2ZPKL 4L8SA 1ZLSH 1BWMA 1F3DH 4CGTA 3FMGL 3FU8A 3PV6B 4XWGH 4NDMB 1S5HB 4N0UE 1WWWX 2ITFA 1D9KD 1NCJA 4FFZL 1QP1A 4G80B 4NUGL 1EFXD 2P8PB 3KYOA 4OD2B 3VXMB 1FGNH 1OSZA 2H2SC 3ESPA 1TJHL 4MJIB 4MDJB 3BP5B 5TE6H 1EHKB 1WHPA 5EBLA 4ZPTB 1MCCA 1QVOA 4TNWK 3CX5K 4AQ1C 3ETTA 5LXGH 2W0PA 3CLFH 3GHBH 3RUGF 4HJ0D 4PRPD 3WY2A 4WIQA 2YKLL 1U91B 1GZQB 4GG6B 3ZX1A 1KEMH 4PJ8A 5CJQH 1RERA 3TM6A 1T2QL 3Q2WA 2AF2A 2H6PB 1YNKH 4JVUA 4W1TA 4E68A 2AVGA 2JQZA 1EEYA 4G7QB 2E7LA 3DPDA 1E28A 4Z9KB 1KWKA 2APXA 5J13C 5A3ID 4HFWA 1XB6A 1WFUA 2Y3AA 3SDCD 5IB2A 5ESAA 1GIGL 5FCSH 2GBTA 1SEBA 4DQOH 5KSAC 1U3YA 2NNFA 2GSIB 2QPSA 4POUB 3QISA 2D31B 2ZXDA 3KWVA 2WANA 4ZFFA 1JF1A 1V7ML 5D1ZI 3FUHA 5EWIH 5IFJB 4ODTH 5DVMA 5JOPD 3K6DA 3OHXC 1DN0A 2XWEA 3HAEA 1NINA 2XYBA 1MWAL 2ZKHL 3ETBJ 4KJYA 2LV4A 3F64A 5HI4C 2HMID 2CNZA 3NCYS 1KTCA 1DO6A 5C8JB 5KYNA 2GCYA 5I1LA 3T0WA 2OL3L 5IGXL 3SGKC 4XP4H 4I0KA 3LN5A 2GB2A 1Y6KR 4YGVA 1XH3A 5I1IH 5CN2A 4HWEH 4JRXD 1DVUA 1JPST 4U1MA 5FA3A 5FUCC 4GG8A 5CINH 5DHMC 3UPRB 3WE1A 5DYOB 3RIFK 1DJWA 3VRIB 5EEWA 5DZPA 3EBIA 3T0VA 3ZDXE 3G5WA 1R5VB 4CMHC 1EJOH 3D2UB 5IB5B 5LHDA 3OPZL 1C5BL 1BF8A 3ALXA 5C0RH 3RI5K 5I8KH 2LVCA 4YC2B 4GQQA 3B9KB 3HUJA 2VLMD 3K6IA 1L7TL 2ZSVA 4CA4A 4LPUA 3OQ3B 5F3HB 3ZUCA 5ENWB 3VI3B 1IGYA 1ILUA 1BQHA 2EABA 2R7EA 3DVIA 1HHIB 2X9YA 1KJMB 4RESB 2YAHA 4PJ9C 5ABAA 2ICWA 3BIAX 3KHQA 5E03A 1LO4H 3C75A 4NC2B 1SBSL 3KE0A 3VXPB 1T6WA 4KO6A 1UURA 4DK6A 3D1MC 3S2AA 1PW3A 5KJ7E 1Q90A 1KEGH 3PCYA 4MA8H 3PIQA 4RWHA 4XN1A 2LE9A 3LKOB 4HCRA 1NBVL 5JDJA 1XGTB 3D51A 3B43A 3NJNA 3PPEA 1A4AA 2W59A 4FFZH 2CSPA 4RGNE 5I1AB 1OXYA 2F58L 3EYSL 4P99A 3ULUD 1BXAA 2DMBA 1OGTA 1T0MA 3S4SA 2EDFA 1YSOA 3PGCB 1ZV5A 4FI6A 3N41B 5CN1A 5IF0B 3U79A 5BUPA 3AAZB 5E8EA 1RZ7H 2PTTB 4U7KA 5DS1A 1DO5A 4OSUH 5EBMA 4UTCA 1JDDA 3VAEA 2JJWA 1T2QH 2L4OA 2BHFA 3UTTA 1N5YH 5FK9B 4CKVX 1MAML 3F58L 1E4KC 43C9B 3RA7H 5CKGA 1E3FA 1GIGH 1X7SA 1HL8A 1VZHA 4PG9A 3QUMA 4NNPH 4MDRA 3GLZA 4A2EA 3BDBA 1URIA 1OB0A 2G4EA 3H3BC 5IW1B 4FX5A 5JXEA 4F24A 1MXDA 1J5IA 1GGCL 2YXFA 4UB0L 1MW0A 1UWXK 1FNGA 1ZV9A 5L4IA 4LSQL 2ZXAA 1KPRA 2P5WB 1JNLH 4K5OA 3SDDA 3JZYA 3WFBL 5HYIA 2VLLB 4LSPH 4XMKL 3EJZD 2C7UA 5L0QB 1XR8A 5IGXH 1I9IL 4NWUL 4XPFH 4Q14A 2VQUA 3MRDB 1I7ZB 5BMFL 1N3NB 1BVLB 1V7NL 1WK0A 5CD3A 1P6FA 3ILQC 4NZUH 5T33H 5TE7L 3U1PA 2G0LA 4G9FA 3MLYL 4U0QB 2UY7B 4HOXA 4MNQA 3AS3A 3MLRL 4HJUA 4LVOB 3BIBX 1KBPA 3FFCD 4XCYB 1G7QA 3OF6D 4K94L 4NQED 5F88A 5I28A 5DFTA 4P4RB 3OKLB 3CVHL 3AABA 3IGFA 4FMFA 2AQSA 1LQSR 2KZ1B 3DV6A 1WE5A 1FG2A 3EBAA 5CBAB 3TZVB 2DIAA 1S7QA 1NGQL 2HKFH 3BPCA 1PFOA 3N43F 2VN4A 1VKXB 1QW8A 4F7KA 1IAKA 3PNRB 3HRPA 3PFUA 4NQSA 4NENA 1VCAA 4RWYL 3S48A 4PPTA 3L9EA 5IROC 3EBGA 4U6TA 1ASPA 5AKSA 1TQWA 4EPSA 1UA6L 4P46A 2OV0A 1UCTA 3G6AB 3I3EA 1E65A 2EIKB 4DETA 1BEXA 4D8PA 1QPKA 3QEQD 4IRJB 2CDFA 3IGAB 5C0IB 3SYPA 2DLHA 5HHVL 4WFHE 1MJ8H 3M1BB 3VH8A 5I1HH 4WI3A 4L9LB 1T1XA 5JOEA 1SF3A 4GO6B 3ATAA 3N1FC 1DVSA 2P43B 2XETA 1MOEA 3BUTA 3MNVB 4N87A 4QRPB 4DO5A 1XAUA 3CXHK 3WEOA 1H6UA 1L4IA 1RJYB 4NRZB 5A6MA 2C34A 3L13A 2R29A 4PJ6A 4DVBB 5SWQB 1GGYA 4AKQA 3MLTA 4J39A 1QLRB 3F83A 4PRBA 2D2CC 4N68A 4JFFE 4YBLB 4JKMA 3N91A 4AUJA 1EHLL 5IOKA 1I8AA 4I87A 4LQFL 4U4BA 1MRCL 1JPEA 1Y18A 3Q8BA 4HGWA 5IUSA 4OJEH 4LLUB 3UO1L 3EH5B 1NCBH 1NCTA 3QIBC 1E5ZA 3B56A 3SBRA 3DVNA 2H9GB 4M5TA 4DWHA 4HGMA 4XVJL 1HXKA 4KJWC 5I1GL 2ARJB 3BEVB 4ELMB 3MJ7A 4LNRA 3BE1L 3MV01 1X5XA 1KBGL 2F8OA 4I5BA 4NC1E 5JIKA 5C9JB 3O11B 3U6RB 1GGCH 3K2UL 1O9VA 1UH2A 4XHQA 4C4BA 5SWZE 3QRFM 2OMYB 2YPLE 1YECH 4XN8A 4UDTA 3S5LA 4KMQA 3F7VB 4S1QH 4OZFG 1E27A 5CU9A 5J11C 3GSQB 4FJZA 4AENB 4BSVB 4E41E 5DMYA 1OAZL 1XF1A 3OWEA 2WP3O 2WY3B 1EAPB 4DT2A 5BMFH 1V7NH 4TVPE 2X70A 3HC4H 4OAWA 4MCYA 5FYKE 3FB5B 1G43A 2BVQB 3BKJH 3HHRB 3FU3A 2UYLB 3WFCL 3PWPB 3CZLA 2GABA 4OIBA 3GRGA 4M02A 5D2LE 3BKMH 3PXHA 4X6DB 2YBRB 3FT0A 5DD6A 3MLRH 3BT2H 4Y2NA 5CUSL 2ZNXA 2VLKA 1GZHC 3IRPX 3NIGF 3CVHH 4C56B 3DIFA 3WKML 2V3EA 1KXVC 5L88L 2BNRD 3C5ZD 3ESOA 3H6JA 3SPHA 1RULL 1ZRUA 5AB0A 1NGQH 1CURA 4QRQB 2MPVA 3ETSA 5F6HI 5CLWA 3VXOB 1JZ6A 2FEDD 2IQAB 2HT4D 2LLNA 3AY4A 1QBLH 4GLRH 4GIPD 1HWHB 4RWYH 5EULV 4EI5B 3MXWH 3P30L 2A99A 2XVBA 3IT8D 3W57A 4XI5C 1S7VA 3LSOB 4Y5XA 4O2EA 1W0YT 4IEFB 4GEIA 1AQKH 1GGUA 2HVKB 4JHBA 1RXLA 3K0YA 2V3DA 4Y4HC 2HTKD 2XBTA 4A67A 1JF6A 3VXUE 4Q9BA 4YDIL 5HHXL 4L1LA 3DV4A 1DQMH 2WXKA 3QJSB 2X6UA 3DXAB 3OJMB 3FO2A 3OAZK 4C83B 1CXEA 1XAKA 2P4AB 4GUPA 1T83A 1LP9E 3C2AH 3R4RA 2OQJB 5HHVH 5CEZD 2APFA 4L3CB 3VG0H 4HH8A 3DETD 4YC2C 3ZVVA 3B9KC 5AG8A 1WFMA 3MJ9L 2A6IB 2A4ZA 2WO2B 2VDRB 5B1BB 5HI5C 3VB9A 4XCCH 3X3GL 2CM6A 4BRVA 4UM8A 4OQ1A 1RIHL 4GH7B 4PBDA 2H26A 5D71L 1OZUA 1RURL 3ZE1E 1A6ZB 1JF5A 1MUJB 4M3JA 4C54A 1INDL 1IC0A 1RZPA 5CP7A 4HS3A 1MCFA 2R1XA 1JBJA 4YX2H 1QFWL 3QAZC 4JY5H 1VGEL 2XQBH 3E0GA 4XCNB 4XVJH 5F21B 3ETBF 3B4NA 3GMLA 3DX7B 1WICA 4QO1A 1KBVA 2K9UA 4NP9A 3BE1H 2G2PA 3NAAL 5F6IC 5GS1A 2AJSH 1C8PA 4PM1A 3OAWA 4L8BA 3V4LA 4JFDA 4RQQB 4F7CB 5GRZA 2H1LM 4NFBA 1JPTL 5DC2A 2EC9U 4IU3B 2JKLA 2O30A 5ACMA 2ZJSH 3HJEA 3FSWA 4TOYH 5FECB 1AC0A 1AGCB 4O5LL 4XO9A 2QTEA 4BCZA 3AZUA 2L3BA 1NKOA 2VXVH 4WTXA 1FVCB 3KPLB 3NACL 1JYXA 3QDJA 4P5TD 2A73B 4OTXL 4E9SA 5HDQL 3Q01A 2W07A 2VAJA 2ZKYA 4M7JH 3GD1C 4X5WA 4KO9A 2ZKXA 3O2DL 5ADPL 1BM3L 1MJUL 3DI3B 4RISL 4EIGB 1IJ9A 1FFQA 3VGHA 1PG7L 4IW4C 4ZUTA 5HHQB 2WSDA 3Q2CA 1RJCA 2KQMA 3RHWK 4GIAA 1QAWA 3FN0H 1U8LB 3FT1A 3HG1A 5F7EL 3FQYA 1R5WA 4NKMA 3HZMB 3MRLB 4O02L 4DPBX 4ONHA 1NFDF 5D1XB 4X7TB 1QNIA 3RNKA 4E5XA 3ILEA 5DJZB 4B3EA 2F15A 5IMOB 5JPMA 3WKYA 1YYLL 3CBRA 3JZ7A 3K7UA 3V4VA 5HHXH 4FXKA 1WBZA 3V52L 5EEUA 4HJTA 3PG2A 4N6QA 3QUXB 2QPFA 3QUGA 4X6EA 2PYFA 3G6JF 5ANME 1ADWA 3OMNB 2X1OA 4LVOC 3LKPB 4OI9A 1KYOJ 5AVUB 4PRPB 4C4KT 1XT5A 3DTXB 3G04B 1CLCA 5FYJD 1Q9WB 5EIVA 1EK3A 1NC2B 1OAYL 5ECJE 5D1QD 1CBVL 1KGJA 3TZVC 4CN1A 1JK9A 4ONGL 4OJAA 4FFYA 1U2HA 3EOBA 4PWJA 4KDTA 3FYEB 5CN3A 1RURH 4J3OD 2G3MA 4TTDC 5DR5L 1AO7E 3L4ZA 3PNWB 4IU2A 2WLZA 1LILA 2QR0B 3BUBA 3TNMA 1BYOA 1Z9PA 3BXNB 4Q6YA 3F8UB 4APXA 1KG0A 3ULVE 3QCVL 3CCHA 4HZLB 2IG2L 1VGEH 2GKIA 2J1WA 4L3EE 4X4KA 4ZMLA 1RVFH 4Y2LA 3MRNA 3FRPA 5E4AA 2J5WA 1HXMB 4I3SL 5F3FA 4LNVA 3NAAH 2J55A 3E9TA 4WKZB 2C3HA 3REVA 2KYIA 3CDYA 5GZNC 1L7IL 2EH8H 1S7TA 4J3WA 3EGDB 2CG9X 3KPMB 4Z3TA 3DYMA 5KBNC 4G43A 1FO0L 3UIYA 4PHXA 4DKEH 2QKSA 5FF6A 2LU5A 4CMMB 4G8IB 4C47A 4IMLA 4HJJL 3A4AA 3MOBL 5J6HB 2B1AL 4UINL 4YPGB 8FABA 2H1PL 4UV4L 1KJ2B 4YBLC 1I8MB 2R69H 2XWRA 3G08A 5DJCB 1M4KA 2CJTA 2H6UA 5LAXB 4B9JA 1XCTB 3MFFB 1K5NA 3S5YA 4F27A 3NACH 4G6FB 3ZKQD 5KWYC 1LXMA 4M5YL 3QORC 1ZMYA 3UBXB 3WCYA 3WBDA 1B4JL 2C9PA 5CZRA 1ZIAA 4R0LB 5JHAA 1YN7A 3H53A 4GAGH 5H4YA 3VQ2C 4H26B 5ADPH 3WN5B 4TL5A 3VWKB 4LLWB 1XGQA 1SQMA 2ZX6A 4R83A 4IHOB 2GY7B 4PGEA 5DZNA 5DMKB 1DVFA 1U2CA 3WXVH 3BVVA 1QQDB 2F54D 5EZOL 5B38G 1KGCE 1YJDC 4GKNB 1F58L 5F7EH 4XGZA 1G7IB 3WE6A 3AXLB 2KS0A 1AKJD 4KTEL 4O02H 1AD9B 4D9QD 5D7SL 4KH9A 1JWMA 3FUJA 4LF3B 4LHUD 4XT1C 1E2ZA 1VF5C 3Q5TA 4GG6E 3VGAB 4K9JA 3T1FA 4DCQA 4Z78B 4YFLI 3CFMA 5BV7L 3MLPA 4FG6D 2YD9A 1I4FB 3V52H 2ZCHL 5JR1L 1S7UA 3J2PA 5DC0A 2WN3A 3FT3A 1CR9L 2XNAB 4RMTA 4RSVA 5DUBA 3OMZA 4ZK8A 5ID0B 1SJHA 3D2TA 3QS3A 2GYSA 1DZBA 4AQEA 5HY9B 2X4RB 2X42A 5ISZE 1DUZA 3DX6A 5C0AE 5EV7A 2PLTA 5KTEH 4XVTL 1OAYH 1QSED 2OMUB 4PLJC 3OKDA 1CBVH 1Z0NA 2F1EA 2F61A 5KYWB 5F96H 3S98A 4KKLD 3TCXA 3VFSA 2WBJB 1MHHB 2ITCB 3OZ9H 1KCRH 1I1AB 1T66D 2R39A 4EI5C 2YXWA 1I85A 3QPQC 5ERWA 5DR5H 3R1GH 3KLHD 1ASQA 4QIRA 3WUZA 1ZVHA 4QT5A 2BSBA 2V0AA 4JDEA 3BUPA 2OSXA 2HRPL 4TUOA 3IRZA 4YHZH 5GRUH 1DUYB 1O7VA 3ZYJA 5T3XE 3VFMA 3JYCA 4E9YA 3QCVH 5HJBA 3IDUA 4JLRA 1MHPH 4OZGF 5GJTH 5TPWH 4D0DA 1OCCB 3TYGL 3JWNC 2BMKB 3I6GB 3PQYD 1FN4A 1NGXB 4MA7H 3ZGIA 3GBML 3GPSA 3ROOA 2UWEB 4N90E 4X4YA 4L18A 3MRPB 4NWTH 4H20H 5B1KA 1JD7A 2ZP9A 5ILTL 3ARZA 3SODB 4TSAH 5K1JA 1FVEA 3ZDYB 2QELA 5C6TL 5JHBA 4DW2L 3P9LB 1N18A 4F58L 3NEOA 2VH5L 3KCPB 4HS6B 4UOW1 1E9OB 4OLXL 2B1AH 5D7LA 4GO8A 4NOBA 2WOBA 3GTTA 4S1SH 5D9SB 4RBPH 4BKTC 3FFCB 1A6AA 4FI7A 1ZLEA 3SO5A 1ULVA 1JZJA 5K9OB 1E6OL 4PRNB 4WJG3 2EIZA 1E43A 2V7NB 5H37G 3R7QA 1FL5B 4UT9A 4L4VB 3WNJA 1LMKA 5F7DB 4HAFA 4AG4H 4Y4FA 3QNZB 4R4BA 4UU9A 3GMQB 5IV2B 2C1OB 4LGRB 2YUVA 1OSYA 3DUUA 2GUOB 4KU1A 2XHNA 1CB4A 4N0YH 3P2BA 5JIMA 2Y7MA 3JUYA 4WSKA 5T8IA 3FHEA 3QIWA 2G2RB 2WBKA 1A6VL 4QR7A 5EZOH 1IZKA 3C5JB 5L9DL 1W6WA 2LQRA 4WI0A 3A0OA 3NGBB 4QHUA 4RMWA 1U3HA 3RWDA 4AYEC 1MI5B 1PLGL 4QOKD 2C4XA 3NZUA 1GS6X 2Q10A 4X8JA 1VEOA 4KOCA 2J56A 5IJCC 2E47A 2JXMB 1SDYA 4UQ2B 2ZCHH 2XUWA 2HWZH 3OR7A 2LU7A 4Q6IB 2EDWA 5GS0C 1HU8A 4NZ8A 1IKOP 3SKOA 5TF0A 1HSAB 3ZTCC 1KYFA 1XB8A 5I66A 1FZMA 2QHLA 4J4PC 2HAZA 4MB3A 5HHME 4AV4A 4G6JH 4X0KA 3TEYA 2QSCL 2IALA 4G6AC 4ZFGH 3UTSB 3W0WB 5C07B 3QHTC 5F1IA 2QDVA 1JNJA 3S0PA 1CVSC 1YEGH 5IBLD 2EP6A 4MB5A 2OYLA 2AEPL 4N2DA 1IAIM 1KLUA 4PREB 1A7RL 2EEFA 2JJTC 3OKYA 4WFGE 1HX0A 5D1XC 2NR6D 4YDMA 2RFXA 3G6JA 2ZCKH 2IDFA 3LKNB 1SYSB 1RP9A 4G8GA 1A47A 3MBWA 4Z7QB 4QGTA 1JK8B 3ZT7A 1PKOA 1S6NA 3FC8A 4MD4A 4IKIA 4P8QA 1WCBB 4O58L 1OP4A 2WSPA 3ERXA 4D3CL 3NG5A 5AW1B 3ARBA 4YSUA 3QUXC 1IKNA 4WWKA 5C0DA 2W5PA 4X4ZA 4QJ5B 3BT0A 3OGOE 3GBMH 3NK3A 3ZMNA 1R6VA 4MCZB 2AJUL 3QHZL 4P07A 2DQDL 4YBHA 1LVEA 5I75B 3EGSB 1RZIA 1NWPA 3BD4A 3PWNA 4L8DB 2CO1A 4QHKI 1MY5A 2DMCA 1UB6B 4J3TA 5FOJA 4ACPA 2QEJA 4K73A 1BVKA 4NYLB 5MEND 4OLXH 5SWSE 1R3LB 3U82B 1WT5C 1UASA 2BHYA 3GC3A 1OM3L 1A8JH 1EJFA 3SGJA 1SJEB 3AW5A 3HC2A 5E9DE 1OPOA 3P4OA 5AUMA 1VB9A 4WUUB 4CVUA 3CE1A 2OXHA 4I1NB 3CVBA 4PY8I 3QJFB 3MBXH 2PW1A 3FQWA 3UAJC 1BLNA 5DUPL 2AERT 3UTQB 2R4SL 2NQDA 1ASOA 4LSVH 5D1ZC 1KTRL 1SHXA 3P3YA 1RJLA 3S37H 2I69A 1KYAA 4Y5YA 3BZ4A 5AOJA 4Y2DD 5ICXB 3UG4A 3QFJB 4MQSB 3RVUD 2V17L 3B2UC 3RWIA 3FB7A 4MLSA 5F1NB 2FO4A 4OZFB 2HFFA 1CGXA 2IAMA 4UQEA 2F7RA 4KV5F 5I17B 1EUTA 4KKQA 4V1DE 3RVXC 4D9RD 3WN6A 1S78C 2ZAHA 2NSQA 1TVDA 1FV1B 1PLGH 2WXGA 4WO4D 2ADJA 4L1DA 3II1A 1QSZA 3PHQB 4G8EA 4OZHF 4ZQTA 5DQJB 4JPVH 3SQOL 2HRLA 3IXTA 1AG6A 3F7LA 3HZVB 2VWEC 1ZPLA 1B0GA 3BH9B 4ZXBD 1OIOA 1IMHC 1PX4A 1YCSA 1P7QB 5KSUA 1RK7A 1J18A 4QI3A 4PN6A 1GGTA 1GR7A 4R0LC 5JMOC 2H41A 2Q7YA 1FZKB 1A7QH 5EOCJ 1J11A 3RKDD 3VWKC 3WN5C 4UTBA 1AP2A 4XOAA 3MZTA 1J8HB 2Y7LA 1VLXA 2H7WA 1B88A 2AABH 1X5MA 2F74B 2VZUA 1XMEB 1SOSA 2AEPH 3IXAB 4GSRA 3N1QC 4A2MA 4HH9A 1A7RH 5A43C 1PD6A 3KPSA 4RLDA 3WUWA 1R9FA 5LXVA 1AZZC 4ZUSA 3V8CA 2Z8SA 1G6RB 3A6CL 3VGAC 2WKOF 2XVKA 5AFAA 2ODHA 1BIHA 4PRID 4N0FB 4D3CH 3RTQD 4UAHA 2Z93A 1UYWL 1E4XI 2HG0A 3P0YL 3E2HB 5TQ0L 3MFGB 4KUCD 2JB5L 5KSBB 3CU1A 3WIHH 4R7DB 2LHAA 1QACA 3TFBA 3FOLB 4DEPB 3B2DC 2XTJB 5K5YA 2B59A 1E5CA 1UB5A 4HALA 5EB9A 1EH9A 2Z4QB 2KL6A 1BJ1H 2ZKWA 3BW9B 1A1OA 3ECBA 3ZSTA 2WBJC 4AT6A 2V3FA 2ZAGA 2OMTA 2W95A 1I1AC 5G5DB 5TDOB 4M3HA 3MJ8B 1SGKA 4PJHF 4P5TB 3AU1B 4OLWH 1AIFB 3U2JA 5ITFA 3H3PL 4HS8L 2DMGA 3SDYL 4R96B 3MC0A 4DH2A 2D7OA 3RGVA 4U1NA 2NXZC 5DRNB 3EHBB 1JN6A 5A2CA 5LGJA 1WFNA 4YHMH 4YNYA 3X12A 4P9HC 5F7BA 5CP3H 3KBPA 3ROLB 4FA7B 5DJYA 4M8QB 3D34A 2Q87A 5DUPH 4OGXH 1BZ9B 4I18A 5DS8A 5DEJA 1IKFL 2W8CA 1ZXQA 2B1HL 3F7RA 2FJSA 4LFHG 5ACLA 3L3JB 4NCDA 1TPXB 3DDGA 1TSHA 1IL1A 3SGDI 3ZDZF 1M7DA 1MWAA 2G0KA 5B39A 5I5RA 1BVOA 3PJSA 4N24A 2D7TH 3S96B 1YLBB 3SKMA 3BPLB 1ED3B 1RZQA 3ECUA 1TETH 3CDGB 4XXCC 3SDXA 1MFMA 5EC2B 3MNWB 1XHHA 3E3QC 3FYIB 4GOSA 2OL3A 4HKBA 5IB4B 3T0ED 4PJAB 1JPFA 4X9GA 4U31A 3SQOH 1QTYT 1Q4NX 1E2WA 3U7YL 1UADC 1LK2B 1TVHA 1A9BA 1F00I 3CX5J 4X80L 4XH2A 5GS3A 2VJ0A 3ZL4L 3LNDA 4UQ3A 2ZKMX 3MNMA 4ZX4A 1YMMA 2LOEA 4TNGA 5D1QB 1KCUL 3PYCA 4D0CA 3IE9A 3UP1A 1I9EA 1WP6A 3M45A 3RDTB 1UZ6F 2YOCA 3DTDA 2RQEA 4ETYA 3FH5A 1XGZA 3T9WA 3K5RA 4WSJA 2RR3A 4MWFB 2CKBL 4A7TA 1BQUA 4PGBA 2WLLB 3K6NA 1PQZA 1X7QB 4PTTA 1EDHA 5D5ME 4Z7IA 1NBZA 4OIIL 1OE2A 2RA1A 3F7PC 3A6CH 3SEPA 4FYSA 5F0LB 4PJEF 7FABL 4PJBE 5LNEA 1D7DA 2IFFL 3HPLA 1Q9OB 5DHEA 3NSXA 2HLAA 3QXAB 1U92A 1W8OA 2IF7A 1EIBA 3P0YH 5J3HD 4JM4L 3ZQWA 3BAEL 4Q6IC 5TQ0H 3RFZC 1KBWA 4P5KA 4UI2A 3VXRE 3OJ2C 4GQPH 2I9TA 1ZHNA 5BRPA 3S9DB 3MACH 3MCLH 4TUJB 4XMWA 2BZDA 3B2XA 4CN4A 5B7EA 1OP5K 3PXJA 5DD0L 3RY6C 3O9WA 1WHOA 1NOLA 3DROA 5C09B 1HYRC 3P73A 4M62H 4QXTA 5E8DL 1GSKA 1JWSA 3B7UX 4UOQA 2PO6A 3EYOA 2Y2TA 3MV8A 1C12B 4HUCA 1T6VN 5HYJB 1H6FA 1LEIA 4HISA 3S8FB 4DEUA 3LPGA 1SDDA 1P9MC 3FOMA 1JV5B 4LB8A 4R26H 3C60A 3N85H 4MSWA 3RBSA 5E1AA 4X5XA 4JE4B 3LVEA 3PL6D 5AAPA 2CDEA 3NJLA 1M57B 1DFBH 1ZJAA 1PFCA 1GAFH 3RVWC 4KZEH 1TZGL 3CFJA 4WTZA 4EO5A 1RV6X 3RE0A 5K59E 1O0VA 2WZ5A 4AUYA 3VRLE 4P2RB 2AJ3A 3W82A 2CWRA 1RPQA 1IBYA 4RFEA 4PRPE 2B1HH 3VYPA 1XGYL 1LWHA 2HFTA 2XKNA 5I75C 2F1AA 5JHDB 3DK0A 1FIGL 5D96B 4L8CA 3FT2A 43CAA 1S7WB 2FEEL 3W11D 4XMPL 1BOGA 4NM8H 1MFBL 3OR6B 2ZCZA 3OLEA 2OX5A 3PP3H 3GSRB 3MRCB 3EYUH 1X5JA 1IBGH 5DHVH 2DM3A 1QBML 4JKLA 3U7YH 2Q0ZX 1UZ8A 1GSMA 2ALAA 4RMQA 1M7XA 2YOAA 4LCYB 5JOPE 4HJGA 3VI4B 4BWUA 3I6KB 3ZTJH 5L2KD 3MA9L 5LBSL 3PAVA 3OTTA 4YDVA 3EOTH 3MLWL 1ZE3C 4JFPB 3JV6A 3CVHA 2QKIB 1XD0A 3GSWA 1FNSH 5MHSD 1Z3GL 3TEXA 1IFRA 5E6