2YSTA

Solution structure of the third cadherin domain from human protocadherin 7
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
119
structure length
119
Chain Sequence
GSSGSSGNDNSPRFEKSVYEADLAENSAPGTPILQLRAADLDVGVNGQIEYVFGAATESVRRLLRLDETSGWLSVLHRIDREEVNQLRFTVMARDRGQPPKTDKATVVLNIKDENDNVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protocadherin-7
publication title Solution structure of the third cadherin domain from human protocadherin 7
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 12
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 2ystA01
2A4CA 1WUZA 5JYMA 4ZMNA 2OMUB 4APXB 1EDHA 3Q2VA 2WHVA 5JYLA 4AQAB 4ZMPA 2WBXA 4AQ8A 4AXWA 2V37A 4AK1A 3K5SA 1L3WA 4ZMOA 2WD0A 3UBFA 2WCPA 3K5RA 3LNEA 1NCGA 3PPEA 4NUMA 2OMTB 4ZMWA 1SUHA 3FF8A 1ZXKA 5CZRA 4NQQA 4NUQA 4NUPA 4APXA 2OMVB 1NCJA 3LNFA 4AQAA 3Q2NA 3UBHA 4AQEB 4AQ8C 4ZMYA 2OMZB 1O6SB 4ZTEA 4ZMXA 4ZMLA 3LNDA 3LNHA 4QD2E 5CO1A 4ZMZA 2QVFB 4XXWC 3K6FA 1NCHA 5KJ4A 4ZMQA 1ZVNA 3Q2LA 3QRBA 1WYJA 2OMYB 5DZVA 3LNGA 2A4EA 3LNIA 2YSTA 4ZMTA 4AXWB 4ZMVA 3FF7A 1FF5A 2X2UA 2O72A 4AQEA 2OMXB 1OP4A 3K6DA 2QVIA 2EE0A 4OY9A 3Q2WA 4ZT1A 1Q1PA 1NCIA 2YQGA 2OMWB 4ZI8A 3K6IA 3MVSA 3UBGA 4XXWA
chains in the Genus database with same CATH superfamily
3LXAA 1LEIA 3WY2A 5LBVA 1RAMA 3CZJA 3GSWB 2Q20A 4Z0BH 3CMGA 4QPEA 2R9HC 2NLJB 4U1LB 2QR0B 1ZT7A 4G6ML 1A4AA 5JYLA 1AC6A 4H4NA 3VRLE 3AG3B 4Q74A 3FTWA 3SDCA 2DTML 3NSFA 4YDLB 3I6GA 4UU9A 3RFZA 4E42A 1DE4B 3ULUE 4LLWA 3NIFB 5FYKU 2RHEA 1KBWA 3TWYA 4J4PD 3VM7A 3LQMA 5F1IA 4KUCF 5E5LA 5CUSL 4JZNA 4U1HB 3IDYC 4XMPH 3JWNH 4NQDA 1WUNT 3REVA 5L4JA 3BCDA 2FYVA 2H32B 4LSTL 3T4YB 2Y7NA 4GUPB 4DEPC 1BA9A 2DWTA 2HRLA 3ABLB 3WHE1 1M7XA 1RZFL 2FSEB 2R27A 4L9DA 1N70A 2BMKB 4QMEA 1EXUB 4JB9L 4R4FL 1CXHA 2JLLA 3EFDH 4FNPA 4Y8DC 4LBAA 4YL4A 3FB7B 2ZOWA 3QRGL 1CFVL 3BVNA 5TF0A 2G2RA 5FK9A 5J57B 2KHAA 1BFOB 2IAND 2RR3A 5CZVH 4KUZH 4D8PA 3M1OA 1FIEA 4JCWA 1PL3A 2E6JA 3OR7B 3QVAA 4TOYL 2EKSA 4MDJB 1JS4A 2WLZA 2EINB 1H5BC 1DLFH 3MCKA 5D1QE 5KSAB 4L4VB 2ZG1A 3NIDE 3DXAD 1HHHA 5C7XL 4B9CA 2PXYB 1GH7A 3OPZH 1OLZA 4WO4B 1N67A 2XZCH 1A1MA 4JEGB 1QO3B 4P3CH 4PG2C 3DOIA 3QJTB 4F3FA 1JHLL 1CICB 2MCPL 1OGTB 4OFPA 2ICES 1HKFA 4N8VG 4QYAA 1IUZA 5D2LF 1ZLSL 3PV7A 1OLLA 1H19A 4Y88A 5EOTA 3I6LE 4BH7B 1DUYB 5DS8B 3R06B 3KLDA 4X4ZA 5C6TL 2Q2EB 1ZT4A 4R4BB 4Z9KB 4BGLA 4JFDB 1XB3A 4HKBA 4IGBC 4UDTB 1FNEB 3AABA 1ADQA 1DVTA 1ZV2A 1NOLA 1K72A 1HHJB 2E4TA 4HFUH 2WIMA 3UOAB 2I9TB 4M7LL 5EA0L 3RYMA 1TMCB 2C9SA 1S5IH 5FECB 2H1PL 3RVWD 2ITDB 5ID1A 5H2BA 2C3VA 2ZSWB 3EAKA 4U1SA 1RK7A 5F1NA 3ARFD 5LNEA 2X0WA 5D72H 5IROA 4RQQB 2QKIC 2Z4TA 4U3HA 2ZOLA 4XP4H 3CQPA 4QJ3B 2ITCB 2H0PA 4I87A 5AAWA 1V5JA 5IW1A 4WLCA 1R1CA 1JBJA 2W8CA 2VZOA 3QDMB 4MXVE 2JQZA 4NNXB 5HPMB 5CJQL 4S10A 2NY5L 5TFSL 5E03A 4HWBA 4WJKB 5CGYC 4OD2A 3E38A 4K5NA 3RPIA 1CE6B 1EBPA 3W56A 3B2VH 2EIZB 3PWVB 4X6CE 2APBA 1DVXA 7FABH 2HFEB 3RNQA 3T8VA 2NY1D 2X4PA 2FO4B 5FO7A 3CFJA 3PGFH 4WY7H 5EIIB 4D3CH 1JWMA 4N22A 1F4XH 4G2AA 3QXWA 3SGDH 4F91B 4KKBC 1SMDA 3QUGA 1X9RA 4N2CA 4RESB 3LN5A 2M8XA 4Z5RA 3WTXA 2QSQA 4Y1TA 3ZKND 3X14A 4H8VA 5MEOA 2WINA 1R3KA 2J8UF 5IB3B 2O6FA 4N86A 5HYJE 1UGKA 4I1NB 2L3BA 1CYXA 3FQ1A 3MACH 2Y07H 4NIYE 2VXUH 2QSVA 4B0MM 4DVBA 4PJ5A 2IALA 4P8QA 4KY1L 1DBAH 3LKOB 1W0YT 2EIJB 2FT7A 4UUJB 3C2AH 1CT8A 4L8BA 3KPPA 5HI4D 2AEQL 5JIQA 3H42H 5I1DA 2Z7ZA 1RUAH 4P5TD 3FCTA 2DWEA 1U8KB 4BFJA 4OSUH 3LZQA 2Q76A 4Z7WF 2DQDH 5LXGL 1YUKB 5I15H 1F4YL 2JI3A 5JA8B 3HIZA 4N8VA 3O9WB 2BM3A 1P7QA 1HL8A 4M5YL 4YSOA 5K39B 5KBMA 1I1CA 2FJHA 2YAQA 2XVLA 1WCBB 3MRQB 1P1ZB 3B7SA 4AYGA 4N4YB 2VW6A 3SQOL 4DP4X 1F00I 3BXNB 1T1ZA 2BIPA 5FA3B 1JGVL 3PWPD 1AIFA 3FC8A 4HK3N 4X8JB 5F7MC 4KJPC 2NW2B 4D9LH 4L23A 1WO2A 2VAAA 1A5FL 3AROA 3ULVH 1CMOA 3ZL4H 4AENB 4F92B 1N68A 4NJ9L 2Q86B 3DIDA 2MFNA 2NZ1A 5CCJA 4PB9H 5A2AA 1MZZA 4H0HB 5J6HB 5J3HC 3MLRL 1CFTA 5J06A 4B96A 3BQVA 3N2JA 3O45A 3NFNB 1HAUA 3BWUC 2Q87A 1BAWA 2E76C 4X9GA 3GMQA 2K3HA 4X7DC 2JJVA 3FUFA 4GIPD 3AT0A 1F90L 5JYMA 1DZ0A 3ATEA 1IBGL 1AXTH 5GGRY 5I1AB 1H0DA 3GZQA 2EIMB 3RDTB 1OTUD 4R2GC 2BRRH 3ARBD 2NR6C 2BNUA 3SKJL 1WA2X 1K2DB 2EXYC 2PYFB 2XI9A 2IANE 1Q4NX 2OQJA 2JSFA 1F6LL 5EC1B 1J8HA 2CHWA 4JPVH 1OARL 1TQWA 2NT1A 4NIKB 4YHIA 2K4AA 2EXTA 3K5RA 1FFOA 1PU0A 5DJZA 3C6SB 5DJCB 3BAEH 4HJUA 1A4JB 5DJDB 4KKZA 3DX9A 5B1JA 2HT2C 4J6RH 3QIWD 4LBEB 3M6DA 4TSBH 3SGEI 3LMJL 3ROLB 4ONFH 1R3HA 2Z31C 1JD9A 4H0LC 4ETQB 1BEYL 2VLMD 3U4EA 3TBVA 2IWKA 3OX8A 1IU1A 4YQXH 4F15B 4IU3A 2F6AA 1I1AA 5KUKA 1G87A 5ALCH 4FG6D 4WUKL 1F02I 3NCYP 3F64A 4MQ7A 3EJUA 5K33A 1BXXA 5D6CA 2PCFA 4U6XA 4G6KH 1OTTC 1FVCA 4PB0L 4K2UH 3GZPA 2A38A 4N9GB 4XNUH 3FOLB 3CK0L 2ISDA 1X9LA 2DH2A 6FABL 5AZUA 2A99A 2LABA 3TZVB 2MH4A 3Q8CA 4PTTA 3L5WA 5EWIL 4Q6YA 3SE4A 1FL5B 5ACZA 4JFHD 4DVRL 1IKOP 4PSRA 2FR4B 4K9EL 2ZSVB 3W9EA 3TO2A 5LGHH 1PZ3A 4XVUC 4QGTA 5H8DA 2VMDA 1SLXA 4KV5F 4JPWH 1M05A 4JAMA 2YD6A 5HBBA 2DD8L 1HINH 3MLYL 4WNQA 3QUYB 2KL6A 5FYLH 2XVGA 4BE6A 3PDOB 2Y36H 4ODUA 2G75B 4M7ZC 4OGZA 5F1KC 5GRUH 4ILDA 4PRPA 2YIHA 4I3RH 4RGOL 5C0RH 1U8CA 2J73A 3VFNA 4WRLA 1YYLH 4GEJA 1FJ1B 1TJHH 4PVNA 1XIWB 1R3LB 1HHKB 4H8QA 1XF4A 3FRUB 5IUCA 3CN3A 2YMOA 3PL6B 1UM4L 1MVUB 3TT1H 4ZRGA 5ALBH 7PCYA 5FHAH 1EZVX 3WDIA 1OKEA 3APFA 5ESQA 1BQSA 3BZ4B 1G43A 3QIBD 5E5MB 5HHVH 2PTUA 2FCBA 1PNDA 2YLKA 3CPLB 4HUCA 3UZVB 1KN2L 5LNDA 4NO5A 4DEWA 2CCVA 4EN3C 3EDDA 3GXNA 1OSZA 1KJ3H 4OR1A 4PGBB 5FDYA 5I8KL 1KG0B 3P77B 3PAZA 3WYRA 4YDIL 1HJCA 5TTRA 3BKJL 4FFYH 4EF3A 4GFXA 5LN8A 3OG6B 4HLZG 4L3EA 5MENA 5KSAD 4DJMA 5KN5B 4JFFD 1H3PH 3B7YA 3WUWG 2F08A 3QEQE 2PXYD 3ARYA 4WO4D 4UAHA 3FUKA 3V4PL 3OGCA 4LSQL 1FH5H 2VRKA 3EO1B 2ZWZA 4Y8AA 2H0FA 5EFIB 3BFOA 3NDYE 3UL4A 3X3FL 4HIHB 4ZMWA 1KXQA 1RY7B 3G5ZB 3INUL 4LFHD 1YDPB 1ZE3C 1BREA 1MDTA 1LO2L 3MBXH 3W9DB 1IEAA 1KUMA 2XVKA 1QPKA 1RZJH 3MV7B 2E56A 4GRWE 1E7VA 1RLBA 2WYTA 4XMZA 2LAAA 3TEYA 1HXYA 4U3SA 4B6ZA 3MRJA 3J07A 4LCIH 4QTIL 1JDCA 1G5GA 2Z1KA 1KC5L 2HT4D 5FCUH 2W9LA 4M7KL 3FTXA 4FJZA 4A2GA 3FMGL 4WTZG 4R0LC 1C9SA 4UIMB 3EJJX 3MV11 1K9TA 3EGDB 5CBAA 3VD9A 2VDKB 4Y2DC 1S5HB 1A9EB 1VCAA 5AG9A 5FUOH 1T4KA 3J27A 2V7HA 4M1CD 4TLKA 3F62A 3VGHA 4APQB 2IAMA 2MQCA 3QDMD 5E00A 1D5ZA 3P54A 5HGBB 5DD6A 3WFDL 1SMOA 4QEGA 4ZXBC 4YHYB 4R4NC 4XVSH 4DUWA 2HVJA 3S3JA 3R7RA 4EJ1C 2OTPA 5ECJE 2EVIA 2ED9A 2QQLL 1DO6A 1X6NA 4K3EH 4MLIA 3VFOB 2EE6A 4NDMA 3QEHB 4BZYA 2FATL 5D70H 5ISZD 3APNA 3EXLA 1WAAE 3LRKA 2K6YA 5D7HA 3LPWA 4GG6E 4MDRA 1PKQA 4HCFA 1BEXA 3JWDH 5DFVC 4MJ5A 5EUKB 4ZTPH 3OKNA 3OR6A 2A7BA 1NC4D 1U3HC 3IJ8A 2WXPA 4IOSA 2WBJA 3BISA 1R5WB 3LZFH 3Q3GA 4TRPL 5C0JB 3WS3B 1JNHA 3T65B 3FHQA 2X0VA 5DUPL 3OWEA 3H4FA 4TQ8A 5KSBF 3FB6A 3QHFH 2BS8A 5L9DH 2XLLA 1XF5B 3VJ6B 1IZJA 3D25B 5CSBA 3EO0B 3HNVH 3V79C 4ZUVA 2K78A 5I16B 4OM0H 4OW6A 5AKSA 4ZD3H 4YPGA 3VD0A 3UFIA 3ES6A 2Y6SC 4GKOA 5DZAA 2N01B 5G4OA 3UCQA 2CBQA 3EYVB 4UBDC 4PRAA 2QMKA 1KCUL 5FKAA 2ZKHH 4AMKH 4N5ED 2IC2A 3DX6B 3WUWA 2R2EB 4G8EA 4KKRA 1KV7A 2AJSH 1YEKH 3FN0L 1X7QA 3HC4H 4KWUA 5H4YA 1B6UA 3DROA 3KLSA 4NZUL 4RMWA 2PCPA 4URKA 3VGAB 3TVMA 2SODB 2QVKA 5IVXE 4OJFH 4TTGA 1HYRC 2BCKB 1CBVL 4JVWA 3BDXA 1RKRA 4U49A 2GTWB 2YD5A 3OAUL 4HS3A 1NUNB 2EDHA 4X6BB 5IBUB 3AREA 5IY5B 3JZ7A 3UJIL 3NZ8B 4Z7QE 3WJMA 4NQQA 4R26L 3UTTD 4QRQB 4LRNH 5EBMB 1HHGA 4LF3A 2DQEH 2VMEA 3R4RA 4HX1A 3TIEA 4FABH 4XXDA 2Q2LA 2A9CA 3K0WA 3T4AC 3FH5A 4WTZA 2XG5A 2FECL 4DGIH 1E8ZA 1TZIA 4HK3J 4IYKA 2VLLB 3DMMB 3NIFE 4X9HA 2GBAA 4G9FB 1Y1DA 2AZUA 5KYXB 2NUTA 1QZ1A 5IGXL 2FJFA 3MSPA 3KVDD 2Y9RT 1I8AA 4U6YB 3WSQL 1A1NB 1YEIH 4KU1A 1UTDA 1FVEA 1T22B 1BAGA 1P4LA 3L48A 2DYPA 5I8CB 1OB1B 3GIZH 4OUUA 4PGEB 2VDNH 1UFUA 1IB5A 2DIAA 2HKFL 3S88L 2WLKA 3RWCB 4XMLH 5EZPA 3I9GL 5FDWB 3W11C 1NA8A 5F6IC 2XYBA 3HFFA 3U7AA 2WXNA 4GMSH 1PNCA 3O11A 4Y2OB 4Q6IA 1NLDL 2J5LC 1YEEL 3ZIMA 2ICWB 5H94A 1VACB 2YC1B 1A2YA 1XH0A 2F7PA 2WXGA 3FTVA 4QXTA 1LEGB 1OT4A 2VL5A 3QDGD 4OZFG 4U2YA 4L4VE 2B7DT 4LPXA 2YFOA 2GABA 1NIEA 3CDFA 2FX7H 5E23A 5GGQL 1QHOA 4DTGH 1D6EA 2UYLA 3W39A 1KLFA 5DJ2A 2JKLA 2JKRM 2VJ0A 3MREB 3BAJA 4GQPH 5I6OA 3RTQA 4X6DF 4S11A 5GS0D 3HI5H 3T8XA 3FT0A 3ECWA 4WFGD 4AKOA 2VLRD 5A2KH 3OD3A 1J86A 1YN7B 1E50A 4P2RA 2MKLC 2VN4A 2GHWB 3NACL 2R7EB 4X98A 2CALA 3KL0A 1ZJAA 4A2MA 2VDLH 3VRIB 5T5FH 1OAZL 1BVNP 1MFDL 1QTSA 2X10A 2PF6A 3ARPA 5DK2B 3QH3A 5K5YA 1HZHL 2NXZB 2WQAA 2X4RA 2V7NB 5D7IA 5HDQH 4PGDA 3L95A 1AC0A 4OCXL 1M7UA 4NRZA 4PS7A 3QNZA 1VF5C 1HL9A 4OZHF 4OH2A 1AE6H 4HU8A 3ULUL 3QG7L 2G9HA 4BFBD 3BEWB 5D2NA 5CP3A 2AKRA 1I7RB 2EXWC 2ZF9A 3QXAB 4NPYA 1OK8A 3VM5A 1FSKB 4PS4H 2BK8A 4ZW8A 5F71A 1JXDA 1P5UC 3OMAB 2PPEA 5E1IA 3V4PA 3UTZB 3K2IA 3PQYD 2OMWA 1KPUA 4ODVL 3QDME 2G5RA 4Y5YC 1P69B 2LFEA 2JIXA 4G8AC 4DP6X 2JCCF 2ZXAA 3Q5YA 5AVXB 5D4JA 2JJUA 4WI4A 4UNTA 3P0VH 3WAJA 4NNYB 3QUYD 3MPCA 3L8QA 2KQNA 1G7IB 1TZOA 3DGDA 5HHXL 5ISZE 1HOEA 1KIPA 1NANI 3LD8B 3VWKA 4F2FA 3AAZB 4FTVA 4AQEB 4LCWD 1ZIAA 4PI0A 2G4GA 4NNPH 1NBCA 3WIAA 1XIWD 4BSVB 2XWTB 5FO8A 4PVLA 5HVGB 1BYPA 1MWAL 2VOTA 2Y7QB 4PLOB 5KJ7E 3FSAA 4X50A 4N8UA 1ZY9A 4GLRI 2J1WA 1V55B 4BDVA 2B1AL 3MOAL 4KO7A 1LXMA 4A2EA 4JZJB 2W07A 1NCTA 4OZ4B 4ZO8A 5CEZH 2ZXWB 4WU5B 4UM9A 4ADIA 1JRHH 43C9B 2AXWA 1KJVA 3MNVB 3LXUX 4U7MA 5C9JB 1FLRH 4LLVB 4L8DA 1UG9A 2R0LH 4LO9A 4OZFA 4Y4FC 4P4KA 1MRDL 1MI5B 4KJYB 4NXKA 3CHXA 4JO3L 2RBLA 4KBPA 1P4BL 3QYMA 2ZYIA 3L2NA 1MW0A 2CBPA 4DN4H 2FL5A 2OR9H 5DJYA 2ZP0T 1NFIA 1AG6A 4MGXA 4RIRB 1IEBB 4ATWA 5DVKA 2AK4A 2PTTA 1YEHH 3N43B 1WITA 5F0MB 4KROC 4ODXB 5ICYA 1ACXA 2WIIA 3WMQA 1E43A 1ZKAA 2BVQB 3CSTA 4NQSB 4PRNA 1A0QL 3OWRA 2PABA 2DRUA 4XWGL 5CILL 4TVSa 1OSEA 1R3IH 1VCBC 5KYWA 1FG9C 2XJLA 4RMQA 2ICCA 1BWWA 1HXMA 5I75B 4J3OG 3SQBA 2ZUQC 2O5XH 1BQLH 5IHZA 3RI5F 1QZNA 5B4MD 1T89A 4EMZA 1E5CA 1LM8V 3FBKA 3LV3B 1NL0H 2L8AA 1JDAA 2IPTL 5EN2A 1JI2A 4APQD 3IU3B 1FPTL 1CQKA 3S36H 4TNFA 4UZUA 1XV8A 4RNRB 4U1GB 2VC2L 1Y18A 4YHKH 3ZKXB 3U9UB 2VM4A 3HKZA 2HKHH 2A3TA 1BVOA 4XNBA 4EKXA 3IJYB 3F6IA 3IDUA 4HWNA 1EO8L 1KNOB 3RNKB 5C0EB 4IRSB 1QLEL 2PR4L 3QCTL 2GPZA 1WBXB 2JFCA 1IZKA 5KZCD 2ICEA 5LDSA 5KBLA 4M5ZL 2DWXA 2WWMD 5TH2A 1HVXA 2UZYB 3QWOA 5LBGA 1XGUA 5E51A 3JWDC 1KEMH 4N87A 1X4YA 3P4MA 5FW7A 3QK0A 3SE9H 3HW7A 3LPOA 4YDZA 2I07B 3OLDA 5H37G 5SWSD 4ZMZA 3U0PB 2QLVB 4G5ZH 3A0OA 5EOQL 2QGCA 1SF5A 1DQJB 4QHMA 1CL7I 4GXUN 3MMEA 1LP9B 2NSMA 3C12A 3JV6B 4QTHB 3CFDB 5GRVK 3MLXH 2WZ5A 4LP4A 3RY4A 4RFEA 3DA0A 1C7TA 3KPTA 4L9LC 4P5SA 5IBTH 5IESH 1OXYA 4AV4A 4YSRA 3N1FC 2FYYB 2XXMB 4W9EC 1N0LB 3RU8L 4AYDC 3T2LA 3GSNH 5DT1L 1MJ7H 3D39D 1YPZF 2FX9H 2J3SA 1F3JB 2F1AA 1T7YA 2AQQA 2E59A 3BIKA 3KGSA 3MRRA 1MCHA 3MJ6A 6CGTA 2ENPA 2HVBA 3HKFA 3C5SB 3EBHA 1AGDB 1CGSL 1MHHB 3O0RL 3GJFA 5DO2D 1G9MC 1WA1X 3VXMA 1JF1A 5J11C 3WLBB 1MFAL 4RISL 3KYNA 1G7LA 1R5VA 5DXWA 2V2TA 4KQ4H 3N42F 3PUUA 2QGEA 3QCVL 1FIGL 5FXCH 3GSOB 4LLYB 4HPOL 5SX4H 3RWDB 3OMZA 1VFBB 4GBXC 4JZOB 5DJ0B 4BFIB 3KCPA 3PQYE 2V5MA 2EE3A 3QJZA 4ORGA 3R1GL 2FJGB 5HDOA 1UJ3C 1SNRA 4F93B 1GR7A 3UJTL 4FQ1H 3W38A 2JWYA 4PLJC 4MAYA 3OLIA 1I3RA 1AFVH 4HMDA 3S3BB 3B6SA 2A6JB 2D0FA 32C2A 1CDJA 1PYWA 2VUOA 1EZSA 5EMYA 1T1XA 4XAWH 2ZKXA 2J8HA 1NC2D 2EDDA 3V52L 3WIIH 2MSPA 5IFJA 4HIJB 2YJLA 2OBGA 1JHKL 3TEZA 3DVGA 1MCWW 5EZJB 4QI3A 2ATPA 2NQ3A 1U30A 4G83A 3CIAA 5FYJU 3HNTH 3GXUB 2P47B 3CE1A 3Q44A 4JM2C 1NKGA 4G6JL 3V0FA 2UZIH 2YRBA 4CVWA 3CGTA 4S1RH 4ZOCA 1XVSA 4Y4HB 4TN9A 4GAGL 5DFAA 4GKZA 4TQPA 4JRWA 1BIHA 1BJ1J 1SBBA 5FS5A 4DCQA 2V17L 3BQUD 4K7FA 3ZPDA 2XBTA 1MQ8A 4X9IA 4ZDHB 1IFRA 1U8HB 1EJFA 5DGRA 4EO5A 5ANME 5ESAB 4G70B 1T20B 3HLKA 5H37A 4HKXA 2BZCA 4YBQC 1U8LB 1UWYA 3MN8A 4XCNA 4PJAF 3SKNA 2R1YB 4EQ3A 1X5AA 3SODB 2G0KA 1QG3A 3ULSA 4XPAL 1KPRA 1UM5H 3GMPB 4LVNB 5EUOB 1MWAA 1LE9A 1U2YA 3SPGA 2YD4A 1SXZA 2C3GA 3DHJA 3B5TA 3NCMA 4RGMC 3QNYB 4TSAH 1PSKH 2YR3A 3ARDD 3MV7E 3VXUD 1S7QA 4HZ1A 1D9KD 1G94A 2IDQA 2X42A 2WLIB 3I84A 3I6SA 3L3KA 3OKOB 2B1HL 2BDNL 1J1PH 2WLLA 4PI2A 3P9LB 1O9ZA 5EEWA 4EDXA 1NCBL 1A6TA 1R9FA 1ADQH 5BZWA 1MIEH 4RETB 2DMKA 3NJJA 5JTWA 1S6NA 3VRJA 1I85A 5DJ6B 4QCIA 3GNML 5DHEA 3L3GA 2BVPA 2F58L 4MA1C 4IHOB 5DK3A 3K6DA 4KXCA 3K1KC 5FUCC 3QUXA 4FQXB 2E7HA 4KQ3H 2YQBA 2ZXEB 3MBEA 3FYIB 1PEZA 2EC9U 3HPLA 4OIFA 5F88A 2R83A 5B38G 1RVFH 2ZXQA 5I1KL 2X12A 3ESPA 1GC1H 3IETA 4NKDB 4NM8H 3VE0B 5IMKB 3ARGA 3MJ7A 2X4OA 3FXIC 5I2IB 1DANU 3DYPA 5KYYB 3VW3L 1V3LA 3ZYIA 4HWBH 4P2OD 1R0AL 3RWJB 1EWHA 2WN3A 1P6FA 2B4CH 4AVHA 2OMUB 4PWKA 5JPMC 4AYID 1ZD6A 3B9AA 4XPGL 5BW7A 4MNGB 2F7IA 2X4SB 4ACTA 4KHXH 3MLZH 1AYRA 1PVHA 1N7ML 3IDXL 1WAEA 5M7QA 4UWQB 3PABB 3ZKQD 2W88A 4DZBA 3FU8A 3FRPB 3F12A 3NABH 2GHZA 4X6CA 3VVWA 2OW7A 4IRZL 5SWSE 3MRKB 3U6XS 5EEZA 2FVNA 1HH6A 5JDSB 4MJID 5KVEH 1S3RA 4I5BB 4R7LA 3OAYH 2BW4A 1S7RA 5GGUB 1QR1A 5CIPA 1MIMH 5AWNH 3V7AG 2CGRL 3UG4A 3U0WL 4EI5B 2F7OA 1A9BB 1SJEB 1GA2A 4JG1L 2ZKYA 2HSIA 1CR9H 3DUSB 2CO3A 3EOBB 1SUHA 2IBZY 3Q1EA 3F04A 1ZXKA 2Z65C 4TVPH 2R15A 3ARUA 4WTWA 5AG8A 2DYRB 3WN5B 3ZTCC 3QA3A 2ZOUA 5HYJA 5I24A 4MBOA 3D39E 5IVNA 1ASOA 4LLQB 1JPGA 1AO7B 4JDTL 4XH2A 4D94A 4NKOB 2NY4B 2QSCL 3PS6A 4J3UA 4PS8A 3MLTA 3BGAA 3GXPA 1S7WA 1USQA 2PNDA 5B3SB 2J5WA 3F6JA 2B14A 5CAYB 1U8JA 1KB9J 5JIIA 3GB7A 5C2BH 5KG9B 1K5NA 1IKNA 2QJDA 1MNUL 3FCSA 1S7XA 2JJWA 4K8RC 2EO1A 5BV7C 1BMZA 3RZCA 3CX2A 4EOWL 5C0BD 5JW4Q 5F9AC 2LTQC 4OFIA 5CU5A 5C07B 2XQYK 4MX7B 3EOAA 3QS2A 1L3NA 1U8NB 3MGTB 4XNAA 3BH4A 1JXKA 1VFOA 4OQ1A 1AS6A 2XA8H 2DQGL 4X0KA 5D7SL 1WBYB 1P4IL 3WENA 1MJJA 35C8L 4KDTA 2I26N 3SYAA 2BXYA 4Z3HA 1K8DA 2VXSL 2OPCA 5AOJA 3FT3B 3OSVA 1OP4A 1EK3A 1GTNA 1M3JA 5B38A 3V6ZA 1EHLH 4L4TD 4PJXB 1R33A 2NOYA 3RURA 3K4DA 3QO0B 3IXAA 4CMMB 2FGWH 5F9DC 4HD5A 4HIIA 4J4PA 5I0XA 1M71B 4YGAB 1VAHA 1QTPA 4HMEA 3RVXD 4XPHL 4ENED 4V33A 1OEZW 3PJSA 5L2JA 3TH4T 3CX5J 4FI6A 3GS0A 4G6MH 1ND0A 3Q2VA 4K9JA 2XPGB 3VQ2C 2WCSA 1QI4A 3ZDXB 4AQAB 2W0FB 4MDIB 2PW2A 4I3SH 2FJUB 5F7DB 2EH8L 5I18L 4PPTA 2DTMH 4CBZA 2XFXB 1J05A 4IM8A 2NMSA 5SV4A 2GITA 2WMPA 2AXGB 2G2PA 5FFGA 3UC0L 3TBYB 3I3EA 3DETC 4WHTB 5GRJL 5J12C 5CD5D 1WT5A 1ORQB 1I4FA 1OW0C 2IANA 4JRXB 2O6DA 3ROOB 1T1YB 4U1JB 1P5VB 5CUSH 5IOPB 2K8MA 4WJ5B 4Z3GA 1K6QL 3GSUA 3LY6A 3T77B 4AZ8B 5KSVB 3DXAA 5HGAB 2ARJQ 1CXFA 4CC4A 2G9KA 1RZFH 4PBWD 2D7PA 1L6ZA 3C6EA 3HBQA 4JB9H 4LOUC 3SO3B 4R4FH 5EBWB 4NQTA 4YC2B 3RPKA 2NSXA 1ZPUA 3LNFA 4PIRF 5F21B 5EU3A 3IXTB 4MD5A 1O5PA 5I73B 1HZKA 3WE6B 2X3BA 3UBXB 4TOYH 1IMHC 2IH1B 1N4XL 5HDBE 3K1DA 4EUPG 4WFED 4YLBA 5DRZA 4ZMLA 4N2AA 2F74A 3PGDA 4FLOA 1YAIA 4JFYA 4ELDA 4M7JL 5C7XH 2YUVA 2OZ4L 4QUOA 3GS7A 3L1GA 4AI7A 3KLQA 1JHLH 4XVJL 3P3RA 4ZFFB 4CMHC 2MCPH 1HTYA 5INDA 1EEYB 3A47A 3ARFA 3LZLA 1UXWB 3VVVA 5FHBL 2VB5A 1ZLSH 4IJ3C 5I71C 1NBVL 1ORSB 1X5LA 3M17B 3PHOB 3EJSA 3BE1L 1WWAX 2MPAL 1I8IA 1JV5B 4LHUG 4E9QA 3NCXA 4QOKB 5C6TH 2AANA 2F54D 4QKTA 3HLAB 1UC6A 3RFZC 4G7QB 4XBMA 4M02A 2JXMA 2NW3A 4R97C 3KMDA 4HJ0D 2HRGA 4XHJC 1IAIM 4PBDA 4X6FA 2BOCB 4M7LH 5BUGA 1A6UL 1H15B 4QIRA 2H1PH 4PP2B 2RQ8A 2BRQA 5F3HA 5F6HJ 1CFSB 5EO0A 3WLWC 1P9MA 4DZ8B 5EB9A 1WJ3A 4N0CD 2EIKB 3DGCR 2X6AA 1I8MB 2FQDA 1X5YA 4S2SA 2FRGP 3UBGA 3FO2A 5FWQA 2DM4A 2JJTA 1NDGA 3F84A 5CN3A 4WV1B 5CJQH 5D6DA 1QVOA 3VXRB 5IWLA 1I7UA 5TFSH 3WG7B 1UWFA 5TDOB 2MNWA 4OTXL 4YDVB 4Z78B 5FA4B 3S4SA 4Y16D 3S97C 2X1QA 2BSBA 1MI5E 4LT7A 5JOPD 5IBLC 5JQ6L 3UZQB 3WL9A 3CFIC 4LEOA 5IKCA 1F45A 4KTGA 1XZWA 3INOA 4NX0A 1OP5K 3IDIB 1YMHB 5DQDL 4CNIA 1F1GA 2EDNA 5JIKA 4UQ2B 1MKFA 3L1OH 4WKXA 5EU4A 1J12A 3D05A 4G6AD 4PHXA 3TBSA 5J6GA 2XZAL 2J88H 2A74C 1QUPA 2LHAA 3JYCA 4IRZA 4PRDA 4P5TA 3LH2L 5C08B 2VUYA 3QEQA 3IMBA 2FLBT 4I9WE 1H8OA 5JW5B 1IBDA 1W8NA 1PY0A 4NWUL 3B5GA 4QY8B 5EBLA 2WKGA 4FXKC 1W80A 4HS6B 4D0BA 1RIHL 4ISVB 5I66A 1IV8A 5DHDA 3MUY1 4TKWA 4KY1H 1Z0MA 2XIBA 5L2KB 2DIEA 3L7FA 4BCXA 4CBPA 4EUPA 5B8CA 4JE4B 5AUMA 1B3JA 3T6XA 2J56A 4RX4A 4XP9L 3E6HB 4JJ5A 5IQNA 2VMFA 3H4HA 3KPQB 5JO5B 5IROC 2OP4L 3IGAA 3VUAA 2EDTA 3L4XA 1BYOA 5AAWC 5LXGH 5FR3A 1KULA 4LIQE 4MB5A 2K0RA 3BPNC 2I5YL 3O8XC 5TF1L 1UKTA 2DWYA 1ED3A 1ZVNA 4M5YH 5I1CH 4XR8C 2YEZB 2XWJA 1GZQB 2E47A 2B4CC 1QA9B 2DKMA 3SQOH 4LHUA 1HOCB 2CIIB 4N90D 3WJLC 1O75A 4CRPA 1JGVH 3AS2A 1UT2A 1JPFB 4PJDB 2C9QA 3WMPA 2VABA 1KDJA 4ZOBA 1A5FH 5GGRA 3MRMB 1L6PA 4AGNA 3ARBA 1FF5A 1AZCA 4NJ9H 3V5DA 2NYKA 3N41B 2AV7B 3WELA 4QRSA 3TH3T 1WAAA 4OJYA 4PTUB 4GG6A 2VXTL 2W9DL 3MLRH 3R7QA 2EE0A 4GPVA 4CW1B 1ZGLB 4WK2B 2HPOA 5D5MB 2Y7LA 1SOXA 1LP9E 4K3DH 4QXVA 5PAZA 3T0AA 4J8RA 3HR6A 3IWUA 3CZLA 3ILDA 1JOIA 3L9EA 3CBJB 5C3TA 1GYWA 3QIWA 1F90H 2FBRA 2BOBA 3KWWA 2DYSB 2HG0A 4XBGB 3WEXA 3LKPB 2F8VA 4HLZH 5IW6A 2NYYD 3TV3L 3ZL1A 2ZZUT 4LFHG 3OJMB 4PJCF 3SKJH 2NY4D 1SYVA 1WPCA 1YJDL 4GAJL 1K4CB 5LN4A 2E7LA 1N5AA 1QLRA 4IKKA 1PX3A 2IH3B 2XKSA 3IDNB 1YUHA 4RDBA 4PJFF 4WFEE 1N8OE 4KRPB 4E9XA 2AQ2A 5JXEC 2GEQA 2ORBL 5I8OL 3B9KD 4D9QD 2EE9A 3IKKA 1OF2A 4W9FC 1WV7T 2FT8A 3RWGA 1PG7W 4YHNB 1LJMA 3MNWB 4PWGA 1FZJB 3L9YA 3PU7A 3V9EA 5IVXA 1BEYH 1DN0B 5C9KA 1ZHNA 5F9JB 4NHUB 4Y9FA 1KCVL 1DVQA 2NNFA 4FOMA 2X53A 3B2XA 4LARH 3KM2A 3GSWA 5FF6A 1G6RL 5KYUB 1XMWA 2MNJB 2O5ZL 4MNQB 4HYTB 4B5EA 3EO9L 2NLJA 2F54E 1FNGB 2NZ9C 4K3JH 4U1LA 4WUKH 5D1XD 5L4IA 3LS4L 3QZMA 3MNMA 4F7MB 4UZGA 4LQFH 3X3GL 4PB0H 1L7TL 4HJJL 3QUML 4F7TA 1LYQA 2PP7A 3G7TA 4TM9A 1DE4A 3MLSL 1V3JA 2FQGA 6FABH 4XNXL 2WQ8A 3FQNB 4N0UB 3HZMB 2OYLA 3V4VL 1BQUA 4KPHL 4BRVA 5EWIH 3VX0A 2OZ4A 3FZUC 4U1HA 1YY9D 3O4LB 3QRBA 4DVRH 3O6FD 1JL8A 1GYVA 2N1KA 3H2PA 5D71L 4K9EH 3ILQC 2H32A 4AW7A 3T4YA 4GUPA 5B22A 4M48H 3L08A 2FSEA 3TU6A 2BMKA 4MMZB 4P23B 1CLVA 4LAQL 2DD8H 3AC0A 4M3KB 3HJEA 3PXHA 3NEXA 4DKEH 2EZ0D 4PJIF 3ZE0E 3FB7A 4F7PB 4KJQD 4UB0L 3SOBL 4QWWD 4N3UA 1XGQB 1BFOA 4RGOH 4JRXD 5K59E 3ET9F 4QHLB 5B1JC 4N85A 1MFMA 3OR7A 5CHNA 4MDJA 5EUOE 5KSAA 4XNQB 4JFFA 4OBSA 1E5UI 5IFAH 1UM4H 2PXYA 1J5IA 4WO4A 3I9IA 4JQIL 2UZPA 1QO3A 2V5YA 5JPNC 2UWEB 3VA2C 3R0NA 1OAXL 4XT1C 1E9QB 1RCYA 1ROWA 1JF6A 3CUPA 1HU8A 1WIOA 1IE4A 3VNZA 3BLKA 1KN2H 4BH7A 4KZEL 4R8WL 5I8KH 3WI9A 1DUYA 4YDIH 5DS8A 1UOLA 3BKJH 4KTEL 4R4BA 1KGCD 3MDJA 5CP3H 4UDTA 1G7PB 3RRQA 5BVPL 1QSFD 5FEBA 3WTVA 1Z0NA 3QWRD 2VH5L 2I9TA 3VD1A 1IAKA 3LKNB 3V4PH 1KBVA 2P49B 3SE4C 5FECA 2ZSWA 2A6DB 2GJZA 3HCVB 3B2DC 4KXBA 2AQTA 2JELL 3UTSB 3X3FH 2GJPA 4MMYB 2B5IB 4RQQA 3INUH 5D9SB 3HRPA 1D5MB 1S7SB 1LO2H 4OCYH 2ITCA 2IEPA 2WSPA 1SEQL 4P46B 4HDIB 4MNGE 5E8PA 3QDMA 4NNXA 4EZJA 1MCDA 2CRZA 3D09A 5HPMA 1CL7L 3II1A 2HRHA 4AQ1A 4XN1A 4YDKL 3VXTB 4QTIH 3TNNB 1KC5H 4FNSA 2WQSA 4Y9BA 1CE6A 1VZIA 4M7KH 3PWVA 3BFWA 4M1DL 1OAYL 5ISZA 5FWRA 3K71B 1W0VB 4D0CB 2PP8A 5C0GB 2N56A 3V4UH 2FO4A 2ZXBA 3GRBA 4QHKJ 5EIIA 2AAVA 1WFTA 3HG1D 3K6FA 4NQCB 3MCLL 1MAJA 4ANUA 1NC4A 1U36A 1WS8A 25C8H 3CH1B 5DCCA 1TG8A 3Q48A 4FNTA 3T08A 4BK5A 1QSED 1RIUH 1Y6MR 3WFDH 3T0EB 5F7FA 3VXRD 4L8CB 4FQPA 5IB3A 4YWGH 2NY5C 2EYSB 3HHSB 5HGGS 4WI3A 2BIMA 2XZQL 2QQLH 4OZFH 1AO7E 3BVUA 3K2MC 4U0QB 3IDJB 4AGMA 4E0RB 3DSFL 3BD3A 3H54A 1MCSA 3CXFA 3QI9B 1UOKA 4Y5VA 1Q72L 3VI4E 2GBUA 1G7HB 2C26A 3LKOA 1SXBA 3C5ZD 5JHLL 5E2UL 4TRPH 2X1PA 2VDKL 2J71A 3U30B 3UTQA 4LVOB 5C08D 5DUPH 4D9QE 3BVXA 1L9TA 1VENA 5E8NB 2DW5A 3SN6N 2AHIA 3FQWB 1JXFA 3BDBA 1O7VA 3EYUL 5T1KB 3GXFA 1KGJA 5K39A 4QNPF 2WN2A 3PXLA 4FADA 3JWNE 3N40F 2M2DA 2X4TB 4HWEL 3EJZC 1P1ZA 4PJHF 2G5BB 5IMLA 4JKPH 3L9RA 4XWOD 4DNLA 5FC9A 5L2KD 3BXNA 2J21A 3LVTA 5FA3A 3D8MA 1KCUH 2IV9A 4DAGL 5GSVB 5HVHB 4WTXA 4DHLA 3QR2A 3L3HB 1SHMA 4PJBF 3DHPA 3SJVB 3CN1A 3FN0H 4JL2A 1GPOL 2CJTA 4AENA 2Q86A 1A6WL 1A6VL 1SFHA 2GT9B 4NZUH 3P0YL 2P5ED 3IFLL 3LX9A 5J6HA 2DIBA 1CBVH 4JDEB 4PRHB 3NFNA 5J8OA 3OAUH 5KANI 4H0GA 1H3TA 5JW4R 1GGYA 5DJAB 1I9JL 3ARRA 4R26H 4PV9B 1SLWA 3KLAB 3HBZA 3ZDXE 3RIAF 5B1AB 5C3LD 1E2ZA 2XTLA 5I1AA 3K3QA 3RDTA 1G4MA 1KGYE 3P1VA 1G6RA 4LCCB 4XOCA 1M3IA 1MRCL 1AZBA 4JANB 4NENA 4FQQB 3VXNB 1ETB1 1K2DA 2UV3A 2VDLB 2WQVA 2PYFA 3ETTA 3D06A 3LXCA 4MRCA 4JRXE 4U0RC 5HHPB 3T0WA 3P3SA 4Z95H 2NY6C 4A7TA 1T0MA 3TN0C 3OKKB 5JIDA 1MF2L 2HT3C 3QUMA 4ONOA 2E8YA 3G9VA 5IGXH 3K8KA 1RIVL 5A2IH 5LLIC 3C6SA 4UILL 4Y1SA 5DJCA 5DJDA 2AQPA 3WSQH 2I25N 3S9DB 4A6YB 4R96B 5CGMA 2VDMB 3F85A 3BN9C 1AGFB 3A6BL 3SYOA 3V4VA 3ZMRA 4LASL 1TETL 3HB3D 2HKFH 1TO4A 4J1UB 3S88H 2OMYB 3I9GH 3VQMA 4ETQA 1XH3B 4L1HA 2OJEB 4NC1C 2H3NB 4L3CB 4YHPB 1UACL 1LE5B 1NLDH 2EH7L 2AJ3B 2JKWA 1JPSL 1YEEH 3GJFH 4OFDA 3ZKSD 5T3ZD 1CDCA 1HI6A 3QIUB 2YD1A 3L6FB 2WO4A 3ORJA 4OFYD 4KRPD 2X28A 4FZEL 4GO6B 4MXQC 3TVMC 5J9PB 1QSFE 2OLDA 2XN9B 3P2BA 3DLQR 1CURA 5DLMH 3CZGA 4X5WA 3VTMA 5KVGE 4N24A 5LHDA 4N9GA 3FOLA 3AREC 2X1OA 2HWZL 3KXFB 3O41B 4H20L 4MAUL 1D5XA 4WSGA 3F01A 3TZVA 2IADB 1BZ8A 1ZPLA 3ZVVA 4U1IB 3NACH 5D8JL 5CGTA 1Q9LB 3GXIA 4JQIA 3U6XA 1FL5A 5CFHA 1FC1A 2XC8A 3PQYA 4J3OH 2VSKB 1A6AB 4LSPL 4HLJA 1OAZH 1MFDH 2R69H 3D34A 4QOKE 2C5DC 3ZTEA 3X13B 3QO1B 3R0MA 2GBTA 3NRPA 3OKEB 4IEFB 5LKNA 3QUYA 4A7SA 4JFZH 3TV8A 4QLWA 1AKPA 3MJWA 1JMXA 4S1SL 1T83C 3ULUH 3QG7H 4UDUB 1NMCC 2ZX5A 1FJ1A 2CJSA 1LQSR 1XIWA 3TOPA 1KLUB 1R3LA 2XWRA 1HHKA 2V8LA 3O4LD 1GZHA 5MI0C 2X5PA 1FORH 1UA3A 3JXAA 4ODVH 3THML 1KTDA 1QSEE 4YSAA 2XETA 1MVUA 3VXRE 3WNMA 4PJ7B 4YEFA 5DQ9A 3MODL 1ITCA 1ZT1B 5SWZB 2MTPA 3BZ4A 1JZGA 4H8PA 5E5MA 2KBGA 5CZXC 4JKLA 5T1DL 4UIKL 3UZVA 3CPLA 2BSED 1RK0A 1UA7A 1PCXA 3NJIA 1X7TA 4U4IA 4CJ0A 5HHXH 1BX2B 5H37H 1UATA 3PGCA 3Q2NA 4PGBA 4A2DA 1KG0A 3P77A 3EYFB 4IKIA 1DQTA 3H9HB 5JZ7D 2QADD 3GSVA 4EXKA 1QNIA 3ZU8A 4N0RA 5E9NA 1YVLA 3FSVA 1CGYA 1RJZB 3RTQC 4Y9GA 2OL3L 1BVNT 1MWAH 4WNSA 4HOXA 5KN5A 3ULVE 4PVBA 2CO7B 4MB1A 5ANMA 2G2NA 5C08E 3K72B 1TZGL 2VWEC 4QYOB 3JVGA 2KDYA 4JN2B 5G5DB 2CR6A 5A40E 4HA1A 1Y0LA 2B1AH 3TA3D 1AZVA 2GYSA 2R0ZH 3D3VB 4X7SL 5EFIA 3MOAH 1F4WL 4HIHA 1AJ7L 1XWVA 3TFKC 2AITA 3G5ZA 1YDPA 3DX7B 4OVUA 4O51A 5IBUG 4Y4KB 3TO4D 1P7BA 1KYDA 2PWHA 3W9DA 2ITFA 4FL4C 5BJTB 2WLMA 3KPMA 1RHFA 5L2KE 3KYAA 4G80B 1MRDH 5L4FA 5I8EA 3FU0A 1V10A 2XN2A 1DVYA 3KW7A 1E27B 2V4LA 5HHQB 4ODBD 5D2NC 4MZRA 1PW3A 2A9NL 1P4BH 2F61A 2X9XA 4N68A 3S37X 4H25B 4ERSL 1G1KA 4HAFA 5JHLA 1ECYA 1WZ1L 5D4HA 4UIMA 2R2BB 1JWUB 3EGDA 2XQBH 2JJSC 3F05A 3UTSD 1S5HA 4KZCA 5FW6A 1JK9B 4D2NA 1A9EA 4PGJA 2VYRE 2YA1A 4P46D 4APQA 3PJLA 2CUAA 2FEDD 3CVBA 1A0QH 4OF7A 3VXOB 4I0CC 1RP9A 1XZ0B 1VGKB 3BGMB 4LB8A 4WQOA 3VWKC 4PJDE 1DCEA 2HRPL 1GJUA 2XU9A 3HVDA 4IBLT 3SY0B 1XGRB 3QQ9D 4U1MA 3QEHA 5IQOA 5EHFA 2EIBA 4YHOH 3GSNB 3SDXB 4U6HB 4K5OA 1OT1A 5D5ME 4XTRC 2EVGA 3UGXA 5EUKA 5CIPH 4MQTB 1A1OB 2IPTH 2FHBA 4OZIF 1R5WA 4FA7B 1FPTH 3P40A 5C0JA 3WS3A 1CDIA 3T65A 5CF3A 3VD2A 5SWSA 3KHOA 2WP3O 5ES4B 1KB5L 1XF5A 1XGYL 3VJ6A 4CC0A 4F7KA 1XB6A 5GJSL 2OX5A 3C09C 3D25A 3H8NA 1UOWA 3EO0A 4P2YA 3UH8A 5CZRA 4BQ8A 2WB1A 1V3KA 1RZPA 1EO8H 1LEIB 1QLEH 5I16A 2PR4H 4FFWC 3QCTH 1XGPB 2BSRB 4KO5A 5T3ZE 2V6HA 4M5ZH 2B08A 1ZT7B 4NBXB 3QFDB 3EYVA 1URIA 3D39A 4Y2NA 1QATA 1ETA1 2Z0BA 3ASWA 3DX6A 5FYLE 4OLUL 3N50A 3SDCB 3P2TA 3KPSD 2BWDA 2R2EA 2JTDA 3TCLA 5EOQH 4XXCA 2ALWA 1Q0YL 5AYUL 2Q7NA 4XN4A 4LLWB 4LIQL 3H2WA 2CSPA 5T1KD 2V3DA 2G5UA 2BCKA 5GGTL 3KAAA 2VISB 3BGFB 2GTWA 4X6BA 2JKTM 3HUJB 5AW7B 1CBJA 2X2IA 3NZ8A 3RU8H 1E65A 4MNQE 4H44C 5K9OB 1G6VK 4JE0A 5DT1H 5CEXB 1LD9A 2UX6A 2DAVA 5KW9L 5EBMA 4DQOL 1T89C 1CGSH 3MBWB 1CFNB 3SJVD 4ICXA 5T33L 1SYSA 3BVNB 5FK9B 4RISH 2DQ6A 3MZGB 3RHWF 4D8PB 1KFAL 2AFNA 2G60H 3HBGA 3QCVH 1FIGH 4ODTH 4N0UE 4HPOH 5KYXA 3IPFA 2TRHA 4WSKA 3O4LE 4W4NA 3DV6B 4FHBD 4J8QA 5DA0B 3R1GH 4UM8B 3WS6C 1A1NA 1T6VN 1FLTX 5AEAA 1T22A 1RMFL 3UJTH 5I8CA 3GBML 1OB1A 4PGEA 5CLWA 1JGLL 2ICEC 2OTWB 4MVBD 2YD8A 3K91A 3PHAA 5BQDA 3RWCA 5FDWA 5EOTB 4JVUA 5E99L 1DEEB 2W80C 2C3XA 4Y2OA 3V52H 1VACA 2AEOA 2YC1A 4AK1A 5MP6H 1JHKH 1LEGA 2DL2A 1G1OA 3BQUA 4HKBB 1ZLUH 1EAQA 5CBEA 1JN6B 4XI5C 5HHMB 2COVD 5C92A 2W0KA 4GI6A 1TNNA 2NNCA 4UAOC 1TZAA 3KDMA 4HCRL 3UO8B 1DFBL 3NCBB 4G6JH 2UWEE 3MREA 4U1SB 1J5HA 4DFHA 1SVBA 1WIUA 4HEME 3ZIYA 2EDLA 1YC7A 2YAHA 3RJQB 1QLFB 1JZIA 2ZOLB 3WJJA 4EBQL 2R56L 5DSCB 2R7EA 3GLAA 4CUCA 2H2PC 5DZOA 1D9KA 4ZNCD 2D4FA 3AQZA 4M3JA 2F68X 1KGIA 5DK2A 3X1FA 4ECNA 1JI1A 3D2UB 4DO6A 1UUNA 4KXZI 4AQ8C 2XN9D 2HUEA 2OMZB 15C8L 5F2FA 5B3JF 5J6SA 2YKLL 2KQMA 3EYOB 3KXFD 3CFJB 3KPOB 4AEHL 2OL3A 3BEWA 5TJWK 3UTSE 1NLBL 1I7RA 4MAYC 3CG8A 3LN5B 4K5MA 3CZSA 3UTZA 3F7PC 4X8CA 3X14B 3K6OA 4ENZA 5IQ7L 2ZJSL 2B1HH 2BDNH 1TITA 2OXHB 3EUDA 3LB6D 4GINA 4XN2A 3GMLB 4ZS6C 3P4LA 1FGVH 1NCBH 1SEBB 4P2OA 5DVOA 2OS7A 4QR7A 4NNYA 4B95C 3PNRB 3GXTA 2YFNA 3FTYA 5CEYB 3GNMH 2YA2A 2IALB 4MJ2A 2F58H 4YXHH 4AQEA 1UADC 2X09A 3ULUC 1MW1A 2BP3A 1CT8B 8CGTA 4BSVA 5C97A 4LDLB 3UGEA 5I1DB 2D8KA 5I1KH 3FCTB 1T66C 4I48A 3RIKA 4RGND 3QQ4B 2OSLB 4HJIA 5B21A 2D0GA 4PJ9C 4MJIA 3LVEA 5BS0B 3VW3H 1PZCA 4F57H 1R0AH 4GRLB 5TE6L 3BKCL 1EO5A 4JZJA 4XPGH 4ZAKC 4OZ4A 2FJHB 4BQ6A 1S78D 4WU5A 5DMJB 4NBYB 1V8HA 4NN6C 1CVRA 1N7MH 2B8OT 3IDXH 3MNVA 3AXIA 4CILA 3WD5H 1RK1B 1QRND 1AIFB 4ZBJA 3GKWH 5AW1B 3TF7C 1MI5A 3K0YA 3C5JB 4KJYA 5ID0A 4YBHA 1Z5LA 1WF5A 2VAAB 5D1QC 3SBPA 3KPSE 1ASQA 3ESOA 3QDHA 4IRZH 2EEDA 1KPVB 2GK0B 4QRPD 4WWKB 5A2LH 3WBDA 2QKIB 1OTSD 3LS5L 1CFTB 3D3VD 2CGRH 4MA8L 3U0WH 2CMRL 4RIRA 5FGSA 3T3MF 4JG1H 3MJGX 3OTTA 4ORZC 3I3BA 1BXAA 2NY0C 3HRZC 4LDCA 3L5JA 4Y4KD 2WLJA 4P5KB 1KB5A 3HHRB 4NKMB 2BVQA 4D9RE 4NQSA 4KJWC 2H6UA 4EUPH 3UPCA 3FT9A 4GQ9L 1YEJL 3X1BA 5INCB 1DSWA 4JDTH 4NERA 3C8HA 2IVFC 2B2XH 3QUXC 4A37A 2QSCH 3E2HC 3SJVE 3IKCB 2BNUB 4Z76B 3D6GA 3QXVA 2H9GB 3MBEC 3MNZB 4AUYA 3K2UL 1VADB 2WV3A 3F5WB 4GW1B 4Y1AD 5L6YL 3S5LG 3M1CA 2P24B 4NQVB 4RA3A 4YZWA 1KCWA 3ARGC 3NSDA 1QBBA 4PRHE 4H13C 1NCHA 4Y89A 1MFUA 3MC0A 3VACA 1MNUH 2X6CA 3BWSA 5DJZB 4GXVL 2RAMA 3IU3A 4TQIA 4NQXB 1S9WB 1NM4A 3KD4A 3O4OB 4YE4L 3RKPA 5FLUA 5IMOB 4EOWH 5GGTA 3RGVC 3NGBB 1PIFA 4TLUA 4JUSA 3HE6D 3IJYA 2B16A 2DBLL 4FYTA 4GI8A 4JQXA 3TBVB 4YHML 1KNOA 1AS7A 1PLBA 4JG9A 4IRSA 3RNKA 2C8NA 5C0EA 2DQGH 4H26B 4ZX6A 5ACLA 1IJNA 5D7SH 1P4IH 3FQUB 3NSJA 35C8H 4Z0BL 1I1AB 1WBXA 2GIMA 2VXSH 2DQHH 4M93B 4F7EB 4CJ1A 1AZNA 2QLYA 2VR3A 2J44A 3O6KL 4JKKA 1G9NL 4OJCA 3ZT7A 2BHFA 3B3IB 2BY2A 4MHHI 4DP0X 3OXSB 4U6XB 4YK4B 3BWZA 1G0XA 2I07A 4BBWA 1HQRB 3U0PA 3ZHFA 1UWEL 3ZT6A 4E68A 4OI9A 3LQZA 5FPIA 5F7EL 1MRFL 3D48R 5I6XC 2WZPA 2RCSL 1LP9A 3NPSB 4XPHH 3PJNA 3EFOA 4QTHA 3CFDA 1FA4A 5AVVB 1CVSC 3EZ8A 1WUZA 3DUUB 1FVDA 5KS9F 4U4BA 4GS7C 1P7KA 5GS2D 3FDWA 1BBDL 1U8QB 2FYYA 1N0LA 1TFPA 3W9EB 2EAEA 2EH8H 3BVDB 1F3JA 5I18H 3HS9A 3EBGA 4JAMB 3S48A 4XVTL 4N2NA 4HT1L 4JY6B 4DP7X 1RP8A 2BY1A 2XN9E 2C1PB 3C5SA 3UC0H 1AGDA 1MHHA 5DD1L 2YO3A 5J1AB 4ODUB 2NXYC 3CCHA 1IKNC 3ARQA 3OC5A 2HVKB 1NDMA 5HYFA 3OZ9L 1U8CB 3KXFE 3QG6A 1IM9D 1CG9A 1UH2A 3BMVA 4JG5A 4ONHB 5ICUA 3L2MA 3VFNB 4B9YA 1AQDB 1EHXA 1K6QH 2FEEI 1DFXA 4IOIB 1M53A 1J9TA 4U3XA 1VFBA 3US1A 4JZOA 1YN6B 4HCRA 2NNAA 4URTB 4FFVD 1BMWA 3VFVB 3CZNA 4PJXF 4MCYA 2H45A 3KEDA 4KDTC 1ZHBB 4J3BA 1CXKA 1NFDF 2XYCA 2RGSA 1R34A 3WKPA 5CEZE 3WUZA 4TLTA 4NZJA 1JK8B 1OSZB 3K8LA 2XNAB 1VEMA 4EIZC 1N4XH 1PLGL 3C60C 3L4YA 3EDJA 2F54A 4PRBB 4RLDA 3CFKB 4YVNA 4HIJA 4E41D 2BHZA 1IRAY 1UB5B 3BC9A 4M7JH 2E9IA 1JV2B 1QRKA 4J4PC 3FRPG 2OZ4H 1RZGB 5HI3C 5KYNA 4RSYA 1N12A 1T7XA 2VKWA 2FWSA 4XVJH 5ADOL 2P43B 3IAQA 5F7LB 4LGPB 5A43C 1L9NA 4PJ7E 1NMBL 3GXMA 4M1GL 5FHBH 2P80A 1WYJA 1NBVH 1SXSA 1ZIBA 1B4LA 3KH3A 5GZND 2VSDA 2XTJD 3D1MC 1EHAA 1A7PL 2F8IA 3IN0A 2YOAA 4X4XA 4IBUA 1HXYB 5JW4N 5D7JD 1QRNE 4Z7UF 3MRJB 3HG5A 4Y9EA 1UD4A 3VD5A 5HHMD 3KJ4B 4ZDHA 5ESAA 1T20A 1MJUL 4FHJA 3EH5B 4U7SA 4B97A 2BNQB 3OG4B 2ZKMX 4QRPE 4HAKA 2R1YA 3D30A 2E9GA 5KVGL 2VR5A 4WI7A 5CJOL 5CBAB 3D3VE 2CR0A 3GMPA 5EUOA 3VDBA 1IT9L 1UCBL 4WY7L 1J18A 3LHPL 5HHOD 3JTSB 4AVKA 3KJ6L 1QMUA 1I1YB 2FNWA 3QNYA 1NM9A 3FFCD 1IGJA 1HN1A 4OTXH 1S2EA 2CNYA 2LGNA 2WLIA 1EEUA 2HVJB 3CSPA 3OKOA 2HTKD 3EJYC 5C0NC 5JQ6H 3P9LA 3NCCB 1IILE 5A3IC 1IC1A 4NDMB 3JWNG 4LEEA 4Y7OC 3V6FB 5HDRA 3F7RA 1Z6JT 1JMZA 4Q9BA 5DJ6A 1E9OB 5LGKA 5K9QI 1DBAL 3RVWC 2H41A 1MDAA 1TOXA 3H85A 4O00A 2OJZL 1WHPA 4MJ5B 4FQXA 2XZAH 3WFEH 5BOPA 1CDYA 3ARFC 1KTLA 2WVVA 3LH2H 3Q3GB 3H42L 2QGBA 2CLRB 1JNHB 4AOFA 5I9QC 3SD5A 5JLZB 4DKFL 1WZLA 1YYML 3VE0A 4OSUL 3CSBA 1UD5A 5IMKA 5A2FA 3EIFA 5AOMA 2FO1A 4NWUH 5I2IA 3IAGC 4AKQA 5KYYA 1IGCL 4JFED 2CCWA 1RIHH 1AD0B 4XX1E 3RWJA 4BZ1L 2OMUA 1DHKA 4ZUVB 3T6ZA 2E3VA 1KGUA 4MNGA 2X4SA 1NCCL 1FFNB 1DQIA 1PAMA 4OJEH 4CN1A 3HJ0A 2Z92B 3PABA 1ZSDB 3JT0A 4I18B 4GW4B 4XP9H 3VWJB 2PYED 5FKAB 2IQAA 4K55A 4OV5A 3R19A 3FRPA 3CZUB 3NQIA 2BXZA 2OP4H 3DGGB 1J9RA 1IC0A 3FO0L 4G8EB 1N6QL 2Z8WC 5I74C 3ULVL 2VUKA 1X7QB 5E24E 2X4UB 2JJTC 3WOVA 2I5YH 2UXGA 5TF1H 1BD2B 3OHXB 4MMXA 1ZDSA 4B7LA 3ZKNC 4FN0A 5D6DC 5IWLC 4GMTL 1JZEA 1A9BA 1SJEA 1VKXA 1DUZA 3DUSA 3EOBA 4D0DA 4JPSA 3ZW3A 2E7DA 3BSZH 3WJMB 4DKTA 1TTCA 2YLHA 3B8SA 4IGBD 3WN5A 5T5NF 3SKOA 3VSVA 2P8PB 2V9RA 2HAZA 1HHGB 4LF3B 2VZ3A 3F58L 4HX1B 4TUKH 3TIEB 1AO7A 4AXWB 5I1EL 4R5XA 2BVUA 4HJSA 3VXQB 2VXTH 2W9DH 2CM5A 1DVUA 3VI4A 4WWKD 1TZIB 3SEPA 3VMNA 4Q97A 1C5CL 1Q9KB 5DEZA 3FCBA 5J7CC 5IHLB 3W5MA 1G84A 5DC2A 2NUTB 3C87A 4KOCA 2DEWX 2HA1A 3OAZH 1P2CB 5KG9A 2FJFB 3B9KA 4L29A 4F8QA 2EILB 3HUJE 1AHWB 4JFXB 1T7ZA 1QFHA 4NUGH 2XICA 4J6RL 1P4LB 4E9VA 3PWLA 5CGYD 5AALA 2DLEA 3QZWG 1S9YB 1SZNA 2XY1A 3TV3H 4DO5A 5HYSB 4X0NA 3MRDB 4N1CA 3GKZA 3MGTA 1YJDH 3O11B 1NBYA 4Q6IB 4RFNC 1MHCB 3OXRB 3CFEB 3HN8A 1WFJA 1IX2A 5KANG 4UNVA 4FAAB 4KKBD 3HFML 3ML8A 8FABA 4FP8L 4QXTB 2KERA 4E41E 5E8DL 2ORBH 1YNTA 3C2SA 3FT3A 5I8OH 4H5SB 1BZDA 1NANH 1TIUA 3DDGA 2BWQA 1D2PA 3ISWA 3HG0A 1OPOA 1GGUA 1Q9WB 4G6KL 4N2OA 4CMMA 1YEGL 3W39B 4K2UL 1TQSA 2VERN 1E5AA 5K1VA 3TJHD 3U9WA 1GOGA 1I53A 1N59B 2QTVA 3PP3H 2IH9A 3RBSA 4BWWA 1BYNA 3Q8AA 1M71A 1OK0A 3NEEA 3II2A 4QDGA 1N6VA 4X7EC 2P8LB 1G6RH 3UEQA 2BP8A 4GLRH 2O5ZH 5AW9B 2K3TA 4C57C 3BD5A 3K6SB 3EO9H 3I02B 4KK5D 3ISRA 5K1JA 2XPGA 2YRZA 3VGEA 3ZDYB 4G5AA 5T3ZL 4AQAA 5LGHL 2W0FA 2NTFB 3LS4H 4MDIA 1TYJA 4MS8C 5I1LA 4N6RA 5F7DA 5IR1B 1Y6KR 1HHIA 5HHME 3X3GH 2XFXA 4I77H 1L7TH 4HJJH 3QUMH 2WWNA 2AXGA 2UY6B 1HINL 1KDIA 1TTAA 2H1LM 5FYLL 3TBYA 3ZQWA 2YSSB 3LNDA 4XNXH 4WHTA 1ORQA 4JRXA 4LSUL 4JFOA 4MBRA 5IJVA 3ROOA 3V4VH 5EU6B 4ZTOL 1T1YA 2BY3A 4KPHH 4U1JA 2IO5A 4FD0A 5GS0H 5DHYA 3EW3B 3UO1H 1O9VA 1LNUB 3Q9PA 5D71H 2FQFA 5HHOE 3T77A 4AZ8A 4NQED 3BYTA 2CWRA 4YSCA 5IEHB 5KSVA 1KYUA 5HGAA 4KXAA 3UIYA 3NK3A 5GJTL 4YJZL 1V7ML 2AMUA 2JIXB 4N6QA 3MJ9H 4KJPD 3WO4C 2V5RA 3RQ3A 4LAQH 5EBWA 2E7LC 3QYCA 3PFUA 1LO0L 4FG6C 4HIPA 3N44F 1HWWA 4BA8A 4DGWC 3IXTA 4B9PA 5J3HD 3WE6A 1E30A 4FTVB 4OCLC 4BM7A 2IH1A 4FQCL 3ZL2A 1E0OB 5SX5K 4QRBA 2DQMA 4AKPA 3BUDA 5IVZB 1QSZA 1QSFA 3NH7L 2MCAA 2K6WA 3WKML 4ANWA 2VT0A 3QWRA 5J0BA 3H1ZA 4JQIH 1X6LA 1YSOA 4WHYG 2BSSB 5C8JB 5KVEE 1OAXH 4XXWA 2PO6B 2WSKA 4JM4L 4ZFFA 1EEQA 4OGYL 3QZWA 5T1MB 4P07A 1E40A 1PZBA 2NR6D 1ORSA 3WE1A 3M17A 3PHOA 4AM0Q 4KZEH 2EXYD 2YAEA 5I6KA 1SQMA 2XWCA 5GHWH 1JV5A 3CFCL 2AVGA 4JHZA 4YDLC 4QOKA 4I9XA 4KTEH 4L8DB 4N5UA 1CQYA 5F93C 4OZFB 2LU5A 2H6PB 2CBTA 1OWWA 2EEBA 2MRYA 2PYEE 4TMPA 5BVPH 3HG2A 3OKDB 2VH5H 2DS4A 3GK8L 2HT2D 3S34L 3NRQA 4FNRA 4LOVA 2WXFA 5G55A 4PP2A 2Z31D 1CFSA 3FB8B 5BS0E 4DZ8A 2JELH 5I26A 2HN7B 4AW4A 2C9AA 1I8MA 2AK4B 2PTTB 4FFTA 2IWGA 2OZNA 4Q8BA 3RG1C 4QTFA 3MAWA 4O2EB 1DQML 2X38A 4YS4A 2CZNA 3TBTB 3KYKL 4PJEB 4HHWA 1QSEA 4WV1A 1MG2C 1YEFL 1CL7H 5AL0A 4PRNB 3VXRA 1PBYA 4YDKH 2ZUTA 4X5QA 4YDVA 5TDOA 5L8LB 5FA4A 5J13B 1AAJA 4BZ1A 4GSQA 2UWEF 3F8UB 1OTTD 3EHBB 3UZQA 4M1DH 4HQQL 4ZPVB 1OAYH 2YPVL 5KSAC 4BV1A 3IDIA 2BNQD 4HCGA 3SQBB 4ZO6A 5IHZB 4G3YL 2X70B 4FXGB 4UQ2A 4WO4C 5CKAA 3C5ZA 3BJ91 3MCLH 2CO6B 2P4AB 3BI9X 1CICC 4B9KC 3HZVB 4IBTA 3STZB 3CXDL 1T03L 4K94L 5EN2B 5C08A 3LZFL 4UMGA 2SEBB 3K46A 4N2LA 2IG2H 3GM0A 1BZOA 1Y18B 5L9DL 2XZQH 2CRIA 1ZAGA 4QY8A 1XSIA 1SVZA 2APSA 2V0AA 1HK6A 3QULB 1F1AA 4W6WB 5GZOD 3DSFH 4ISVA 1FAIL 5E7BA 4ZD3L 1Q72H 1A6PA 2DF3A 2EDXA 4UQ3B 4BQCA 1KY7A 1KIQB 5L2KA 3G6JF 5FM5M 4Z3IA 5E2UH 4HUMB 2WK2A 1RQ5A 2VDKH 3BVTA 4JQVA 4OY9A 3E6HA 1F56A 3KPQA 5JO5A 4OLZH 2DKUA 3GI9L 3SHSA 1YEKL 3SSGA 3FAXA 4M1CC 4QXUL 2AMGA 4PRIB 5FIEA 1JNNH 2LLGA 5IB5A 1KF9B 1LO3L 2YEZA 1GZQA 1F3RB 1L0PA 4HWEH 4EN3D 2HUHA 5L88L 4FC3E 4G7SB 5IIEA 1QA9A 3PIQA 4RFEB 4I0KA 1HOCA 2CIIA 4YSEA 3KGUA 4K23L 4LPWA 4JO1L 1FFQA 4DAGH 4XO4A 4PJDA 3UGUA 4M5SA 4PM1A 2GJJA 1SFDA 4LRNL 3MRRB 1OM3L 2DQEL 3K2KA 3OMNB 3TP4A 1GPOH 3RVUC 2IBGA 1A6WH 1A6VH 1FGNL 2Q6WB 1M2OA 1XT5A 4PTUA 2XXCB 1BD2D 3FN3A 4F9PA 1ZGLA 4DGIL 4CW1A 1JYWA 1MCPL 3PWJB 5D5MA 4M8QA 3FL7A 3AADB 1K5WA 2Q3AA 4LSSL 4PWJA 4YFDB 2R51A 1IBBA 4FERA 5FM4A 2VDRB 1I9JH 3B2MA 4NQEE 4AIZA 4ELKA 1KGXA 5B1BB 5F9WB 1YEIL 1EUTA 3G6AA 3IU4L 1JP5A 3HI1B 4NO0D 4MA7L 2ADIA 2CBMA 2Y69B 4WTQA 3LKPA 4XBGA 1EQWA 1DJHA 1MRCH 3W81A 5AW6B 4C56D 3IMVA 1FUNA 1KB9K 4G9DB 5AB0A 1PYWB 3P11L 5AOIA 1XH2A 3T6QC 3IDNA 4JM2F 4OFYA 1USZA 2D0HA 2ZCLL 2MQGA 4H8WH 1MF2H 1RIVH 2ADFL 1EAPB 2F5BL 4UILH 3O9WC 4KDVA 5CS7A 1X5XA 4UTCA 4ZXBD 3MXVL 4R4ND 3IPEA 4MS6A 1PG7X 3CLWA 3A6BH 3IB4A 4PN6A 4YHNA 4JLRA 4LASH 1TETH 3MNWA 5DMIL 1Z9LA 2RH0A 3QXTA 3VG9B 1DN0A 1RD6A 1UACH 4GKZB 2EH7H 4ZQTA 1M9SA 2J25A 1JPSH 3QAQA 3NUKA 4M7LT 3AJ7A 4CU8A 1WVZA 1YJDC 4GP4B 4JO4H 4MNQA 5A6LA 2IQ9L 1LGVA 1U3HD 2QGDA 4FZEH 5T5FL 1TJIH 4LCVA 3B7RL 3KG5A 5JQIB 3Q5TA 4F7MA 5LBSL 3TWCL 5DVNA 3NG5A 1IL1B 4HKXB 3V0DA 3RAJL 3UYOD 4XCNB 4H20H 3CX5K 4MAUH 1Z32X 4CSTA 4A6YL 4G7RB 2VDML 1UENA 4KOBA 4N0UA 3HZMA 1S9KC 4X80L 4WKZA 1ETZA 1UT1A 5D8JH 5TDPA 2FBJL 3MOBL 1JE6A 4IW4C 2WVSA 2Y6SD 3O4LA 3RDTC 4XO8A 4M8VA 5EPMA 1ZHKB 4LSPH 4JPQA 1GRWA 1UCTA 4Q0XL 4UBDD 3KLLA 1GKOA 2GAZB 2LU3A 3L3KB 1S8DA 3OAYK 4V11A 2WLLB 5LGJA 5KVMC 4PJ8B 4OI8A 4EDXB 2CK2A 3DJRA 2BSEA 5BZWB 5CSZA 4WZ9A 4X42A 3WNJA 2YXMA 2JMRA 2BNQE 3UMNA 1DO5A 3FU3A 3VRJB 1RPKA 2H0EA 2BC4B 1SM3L 3VFSB 5EU6D 1NGZB 2R59A 2W91A 2XQYG 2EDQA 2Y5EA 2J72A 1L0XA 2CCLA 2YS4A 2ZXCA 1QPXA 3THMH 3N6YA 1RU9L 5IHWA 1RPUA 4QRFA 3UYPB 3QZLA 3MODH 3MJ7B 4EI0A 3PAVA 2X4OB 4F15C 4OVVA 3QR0A 1E9QA 4HEMA 2Q8AL 4UIKH 4Z7VE 1H9VA 2MNUA 1VFMA 3OAWA 4BQ9A 5EDSA 2C4XA 1MOEA 4YSPA 3ETSA 4J28A 5TPWL 4Z1PA 2NY3B 3GRGA 5CEZL 1PMYA 1UXMA 2XWXA 3MV8B 2BIHA 2OL3H 3A24A 4ZOEA 2YPVA 3TZVC 2E9WA 1RZKL 1Y6NR 1BP3B 4Z23A 2F15A 2XKUA 3LKNA 2Z91B 3BIAX 5DMKB 1UYWH 4PJFA 1HH6B 2A6DA 3HCVA 3MRCB 4X7SH 3RUGB 2PPCA 1F4WH 3DSNA 4OIAA 3W11D 3UTSA 5CIPB 1QR1B 4MMYA 3G08B 2C1OA 5D9SA 5AZEL 1D5MA 4F8NA 1S7SA 3LYRA 1G5AA 1UH4A 4XHQA 2H47C 1AH1A 4P46A 5DZVA 5E0QA 4XBPB 4CU6A 3QQXA 2Y1VA 4TQHA 1FYTB 3RTLA 1ZWIA 1F18A 3DO3A 3IRCA 3VXTA 3TNNA 2ZONA 1JPGB 3CH8A 4IHBA 4MKMA 5JR1L 1MCBA 1QLEB 2A9NH 3US0A 4P9HL 2B20A 4LEXL 3WTTA 3K71A 5E95B 1GCYA 1WZ1H 1Y1UA 5IW3A 4N2BA 1BD2E 3O3DB 1CUOA 3PL6C 2JKJA 2D3JA 1LK2A 1WFIA 5KBPA 1KLGB 2EDYA 1XXDC 3FKUS 4TSCL 1GL4B 3VAEA 3IAPA 1D5RA 1L7IH 1AHKA 2YQ2A 3CSFA 4M4RB 4A38A 4W9GC 1K5NB 5HDLA 1T0PB 5I76A 1T7WA 5ADPL 1B9KA 4HK0B 2ICWJ 2WVUA 3RZCB 2FEEL 2HRPH 4B9GA 5E1AA 4NFDA 4HV8A 4OU3A 2KZWA 3F7LA 1A65A 4ZZKA 3IDJA 4E0RA 5DURB 4RWYH 1E42A 3DRQA 4FG2A 2DDQL 2PR9A 4Q6KA 4TS6A 5E8EB 4X0KB 4BK4A 5F3BB 4O5LL 2PCXA 1BDYA 1G7HA 1J11A 1MJJB 1YO4A 2EXWD 3JVGC 3OJDB 1K8DB 3LRLA 2XQYA 1GJIA 5C0CD 3UG3A 3M1BB 5HSFA 5FCSH 4WW2B 2EYRB 3OJVC 3KPSA 4EVNB 1CF8H 1ZTMA 3I85A 4FS0A 4ODHL 5E8NA 2OMTB 1KB5H 1XGYH 4FJ6A 4K3GA 3N1QC 5DYOA 5GJSH 3CMOL 3FUMA 3FQWA 1G9EA 3WNOA 5T1KA 3BKYL 2CLVB 1MCFA 2RFXB 4HBCL 4L8SB 3SPCA 5L2JB 2G5BA 3CVHH 6PAZA 4J3SA 3D85D 2OULB 3B83A 5F7NC 4ZFZB 1LHZA 4AEFA 4G8GB 4ZMYA 2O61A 5GSVA 1VA9A 2OMBA 1MJ7L 5JDJA 5AVTB 3NJKA 4OLUH 2E46A 5I1GH 1I7ZA 3L3HA 3T2NL 1L9RA 4BYHA 2GITB 2WMPB 4UV4L 3SJVA 5AW4B 2X9ZA 2QHRL 3BP7B 1Q0YH 1BVLA 5AYUH 1NIFA 4F2EA 4POYA 4APQC 2B9BA 1I4FB 1HWGB 2AI0L 4LIQH 2GSMB 4PRID 2Z6FA 2ALAA 1KXTB 1ZHLB 5MHSE 3OKLB 3ZX1A 4YHYC 4KQ4L 5GGTH 4HOZA 5JHBA 3SDXF 2A83B 4JDEA 4PRHA 3QC5X 5F1SA 1XF3A 5GGSY 2WYHA 3DXAB 4KK6C 5DU7A 3S8WA 1VB9A 5DJAA 4B0MB 2ZE0A 2RB8A 4HIQA 1DQLL 1IARB 4KI1A 4LDEB 4PV9A 4YDJB 3KLAA 5KBDA 4Y4FD 4GRMB 3ZDYE 5KW9H 2VLKB 1QHQA 4MHHG 4DQOH 3AZUA 3AVEA 3GQFA 4LU5H 2DKSA 5T33H 3OZLA 4LCCA 1IE5A 3S5ZA 2FX8L 4JANA 3T3PF 4FQQA 2WJ5A 4FQJL 1KFAH 5HHPA 3QXDB 5T5FA 4WGVB 4XAWL 3EYQD 5EU6E 2DI9A 5LBSA 2CGYA 4PCKA 3RY6C 4HLEA 3OKKA 3AFLA 4KROD 4HF5L 4JFYB 4Y5XA 1YEDB 2Y5QA 5BV7B 1X9UA 3H3BC 3UPRB 3N06B 1RMFH 1T04B 4R96A 3GBMH 4YN3A 4A6YA 1MG3C 5E56A 4C55A 1AGFA 1EVTC 3GHBL 2LTQB 2DLHA 2KYIA 4JREC 5INDB 2EJ1A 4J1UA 4XCEB 3BEVA 3HPJB 2OMYA 4J3WA 3QAZB 4YZFF 5E99H 4S1RL 5I6NA 2OJEA 2LU4A 3V0GA 2Y1ZA 4YHPA 1LE5A 1IO4C 4AMXA 1I8IB 1KTCA 1X7SA 2FK9A 5DZLA 3SDDC 3QIUA 3DYMA 2FIKB 3GPSA 3I6KB 4FTVE 2IFFH 5HJ3A 1OHQA 1MH5A 4XXCC 1IGIL 2JXMB 5CCKL 1GY2A 3IJ7A 2XIDA 3VGAC 2LVCA 2XQ0A 4X6FB 4ZX5A 2XN9A 1ZLDA 1IKFL 4HCRH 3D07A 2P5WB 1CDHA 2NY1B 2P5PA 5EO0B 3DTXA 3KXFA 3O41A 4EZMA 1A66A 1BQ5A 2IADA 1HQ4B 2LU7A 4EBQH 2R56H 1UM5L 4U1IA 1ZLWK 1A4BA 3TA4D 2R0WL 1NDGB 2WSDA 1F3DJ 3P3YA 3QPQD 3S3SA 1A6AA 1YNKH 4OKDA 4XB7A 1I7UB 3GSRB 3SO5A 3X13A 3ESMA 1WP6A 2VDPB 3NEOA 4CKVX 4N2KA 4B27A 3DMMC 5CZKA 2OMXA 3OKEA 4F80A 43CAB 4XX1G 1B0IA 1EVUA 1T6BX 2DMBA 3IF1B 2PN5A 4LEOB 5EU7E 5IKCB 2CDEB 15C8H 1GJWA 2YKLH 5IP4A 1BBJB 2HYMA 5K93A 1WK0A 4MKTA 4AEHH 1NLBH 3BCFA 3U1QA 4F9LA 3IYLW 5EU4B 3ZE2B 3MV9D 1NCDL 4XCYB 1KLUA 2XPZA 4P5TB 3TGXA 2KS0A 2Z4QB 4PJEE 4N26A 3CHOA 4X5XB 1RVFL 5IQ7H 2ZJSH 3EADA 1GC1L 4PJ7A 1U4FA 3IE9A 1ZT1A 3PXJA 2MEJB 2GC4C 2Q9OA 4PJ8D 4OQTL 4XGZB 4UT6L 3D0LA 1MJ8L 4Z7OE 3ESVF 3QW9A 5FGBC 4LVHB 4MJJA 2A6KB 4HIEB 5MEPB 1CTOA 4X6EA 1DJSA 1BX2A 2ZKWA 3ZDZF 2QKSA 3KS0H 1AQ8A 3NIGB 3EYFA 2GJ6B 5B8CB 1QRNA 3PWPB 3BMWA 5AUMB 4GBXD 1QKZL 4HCIA 3QUZC 4M9OA 4JJ5B 4LEBA 4JDVB 1ACCA 1UJTA 2CO7A 4TYUA 3WDHA 3IDGB 3N0AA 1AP2B 1HIMH 2DY2A 3K72A 3IN2A 4QYOA 4D8OA 1PEWA 3DJTA 2XWBB 5EOCL 3ZYJA 5AVYB 5G5DA 4QRPA 3MFFB 4PLJD 2HJFB 3RWHA 3VI3B 1R47A 4NT6B 1ED3B 3D3VA 3BKCH 4ZPTB 1ZOXA 4B50A 5DMGD 3VD4A 4FLRA 1BGXH 1XCXA 2NXZC 3OBAA 3DX7A 1MCKA 4Y4KA 5K9QG 4JFVA 4UI2A 2P48B 4M4PA 4QRRD 4G80A 3RX8A 3MV8D 4H0IA 4AG4L 4M8UA 2YAPA 4WU7A 2R4RL 4AL8C 2IDTA 4DFIA 5HHQA 2X6VA 1THAA 3ARBB 1RL1A 5KJRL 1NBQA 4H25A 1FSKC 3R8QA 4QRSB 4GAYA 4JJHA 2X88A 3PLYA 4M6OL 3OB0K 1R3JA 4PD4J 3LS5H 4PRIE 3WU1A 2R2BA 4MA8H 2CMRH 1U95B 2DQCL 2JQMA 1QFPA 2JKXA 5EH1A 3TESA 1MLCA 1F0LA 3VXOA 3DYOA 3QIWB 1XZ0A 3SDAB 3BGMA 4PHZA 3LD8C 3PPSA 3TEUA 1YEJH 1DBMH 3WEXB 3D4YA 3NJFA 3HE6A 4U3CA 1K4DA 4KVPA 2YD2A 4YBQD 2V9UA 1WDAA 1RJLB 1M2VB 3DBXB 5A6MA 1OCWH 3K2UH 1I8UA 4I0PB 2WGXA 5L6YH 3EGSB 4X7CC 3B2UC 3MTRA 3QWQB 4U6HA 1MUJB 4O2CB 4WI9A 3QJFB 3QWNA 1A1OA 2F7QA 4GXVH 1DQDL 3AU0A 1AI1L 3GSXB 1A8ZA 1N6UA 3PP4H 4JZJC 3NCJL 4WGWB 1EHLL 4YE4H 4DEUA 3D18A 3X1GA 2A9BA 1YY8B 2DBLH 1ZHNB 4YHMH 3ZO9A 3W0WD 2ZPKL 3WFHB 2J1XA 5DURD 1XGPA 2BSRA 5FF6B 4K7PY 4Z7QB 2CIKA 1NGYA 5AVQB 4TUOB 1KYFA 1KCBA 2TAAA 1QUNB 2ZP9A 3L54A 1G9NH 1AXSB 2VMJA 3NFPB 3O6KH 3QFDA 1SJVA 1WZKA 4I3SL 5E4EB 2QVIA 2DQIL 3Q5OA 4BE5A 3AG2B 4F7TB 1M7DB 1O6TA 1UWEH 5F7EH 2H1XA 1GOHA 2ROXA 1MRFH 2RCSH 1IBZA 1A3LL 3SBQA 5A2BA 1XR8B 1N19A 1WIPA 2VISA 1GYAA 3E6FA 4BH8B 3BUQA 1ASPA 3HUJA 2HG5B 3NMEA 2K7PA 3FCUB 1GGTA 1BBDH 5GXBB 2CXGA 2UX7A 5K9OA 5I75C 1MFBL 3S35X 5CEXA 1UWGL 3EBIA 3HR5B 4G8GD 2Q0ZX 2YRPA 4XVTH 3QIBB 4GQZA 4HT1H 4X8GA 3T0VA 2Z8VC 5T3XD 3TBWA 4AYMC 3MBWA 3EF7A 1CFNA 5DD1H 2CUMA 3SZ6A 3RLSA 2ESVB 1OB0A 1CFMA 5L4MA 2K7QA 3FO9A 2X9WA 2FAUA 2WCPA 2CM6A 3J2PA 5D7LD 1PGRB 3OZ9H 4HIXL 3QYNA 2PMZA 1TQBB 1OPGH 1E4XI 3QEGL 4E41A 5CHNB 1QBAA 4U1GC 3SKMB 1D7CA 2ZG3A 3MV9E 3RE0A 4IIQB 2OYMA 3ZKXC 5BRZB 5HHNA 4JFFB 5ITFB 5E9AA 5TE4L 4M6ML 3DV6A 3X12B 3LSOA 2VSCA 3QPKA 4JQXC 4UM8A 4IRSC 4NP4L 2VLKD 5EF2A 2CH8A 3GSQA 3CUPB 2JNZA 2OTWA 2L04A 4GQRA 2PP9A 2F53B 5GZNA 4N3TA 4LPUA 1DEEA 3UBHA 1JHTB 1PLGH 3C9NB 1OE1A 2G3XA 5JORB 5D7JA 1BZ7B 1EFXB 4K5PA 2OA9A 2IOOA 1JN6A 4LRIC 2DTSA 1DSYA 2MJWA 4K8RD 1M7IB 5FYKD 3S2CA 5AVUB 1IAKB 5ADOH 2X7LB 3DRTB 4DGVH 1NMBH 1JYVA 4M1GH 2GJZB 4ESKA 2HLFD 1DSFL 1QLFA 4LOEA 5DGQA 2YD3A 1B0RB 5HHOA 5DSCA 2PPDA 1A7PH 2ZCHL 3F2LA 3HG3A 3KM1A 5E8PB 2WWOA 4Z7NF 4JMNA 4GP5B 5JHDD 4GG8B 3RX5A 4OQTA 4QRRE 4XCFL 4LL4A 3MV8E 4UT6A 4AQ1B 2HPTA 1OALA 3D2UA 5LDUA 3VFPA 3M7FB 4UNUA 1MJUH 4DQAA 2OMZA 3BZFB 2R23B 1VEPA 5ISZB 2P5WD 2YBGA 5KVGH 1ZS2A 3EYOA 5CJOH 1UASA 3KPOA 3RUGE 1A9VA 1IT9H 1UCBH 5I5JA 4GAAA 1FN4A 2D7TH 3L1OL 3LHPH 2BIOA 1X44A 1YEWA 4KVNL 1NC4B 3KJ6H 4RAUB 2KUTA 1QHPA 3QDJD 1J10A 1U4EA 2VZUA 1NCWL 2J88L 4L2YA 1J5CA 3G5YA 4HFWB 2FH8A 2WANA 1FYTE 4R83A 2DQJL 3L4UA 3FUJA 4X4YB 2OXHA 4G7VL 3GMLA 1MVFA 4LCYB 1SEBA 1FFTB 1MELA 2W65B 3DETD 2FIRT 4FYRA 5CEYA 2APVA 2NRDA 2V37A 3DO4A 1FE8L 1H6FA 4GFTB 4IOFC 4Y5VB 4UTAL 2D7NA 5DQJA 1ZEAL 5FUZL 3T09A 2FJSA 2OJZH 2BLFA 3U4AA 1ZMYA 3FQ4A 2PYEA 3FSZA 3IGLA 3UTQB 4U1KB 4DKFH 4PG2A 4Y4HC 1YYMH 4PP1C 3QQ4A 1HCYA 2OSLA 4LOUD 1WWBX 5DJXA 5BS0A 4D7PA 3PE9A 4AEIL 1IGCH 2YUZA 4GRLA 4BZ1H 2C9PA 4ZZFA 5I1CL 3DPBB 3LQAH 3T5WA 1NCCH 4PEEA 5IMLB 3L9RB 2GJ6D 3OSKA 3POCA 3CSGA 4M62L 1CI5A 5D2LB 4ZNEA 1RK1A 3UTTB 2QSTA 3UG5A 2DMCA 1FI8C 1K3ZA 5LQBL 1BJMA 3C5JA 2IH8A 2VM3A<