2YSTA

Solution structure of the third cadherin domain from human protocadherin 7
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
119
structure length
119
Chain Sequence
b'GSSGSSGNDNSPRFEKSVYEADLAENSAPGTPILQLRAADLDVGVNGQIEYVFGAATESVRRLLRLDETSGWLSVLHRIDREEVNQLRFTVMARDRGQPPKTDKATVVLNIKDENDNVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protocadherin-7
publication title Solution structure of the third cadherin domain from human protocadherin 7
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 12
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 2ystA01
2EE0A 2WBXA 4OY9A 4ZT1A 2OMTB 2OMYB 4NUMA 3UBGA 3LNHA 3Q2WA 4ZMZA 3Q2LA 2WCPA 3UBHA 3UBFA 4ZMPA 4ZMNA 2A4CA 4AXWA 3FF7A 4ZMWA 4QD2E 1NCIA 2OMWB 3LNEA 4AXWB 4ZTEA 5DZVA 3K6FA 2QVFB 2YSTA 4ZMLA 4APXB 4ZMTA 4NUQA 5CO1A 4XXWC 4AQ8A 2YQGA 4ZI8A 2X2UA 2WD0A 3LNIA 2QVIA 1Q1PA 1NCJA 5KJ4A 1SUHA 1FF5A 3QRBA 4AQAA 2OMUB 4XXWA 2WHVA 3MVSA 3Q2NA 4ZMVA 1ZXKA 4NQQA 1NCGA 3LNDA 3K6DA 2A4EA 2V37A 3Q2VA 4NUPA 1OP4A 4AK1A 3K6IA 1WUZA 2OMZB 3PPEA 1L3WA 2OMVB 4ZMYA 4ZMXA 3LNGA 5JYLA 1ZVNA 1EDHA 1WYJA 4AQAB 4AQ8C 5CZRA 1O6SB 3LNFA 4AQEA 1NCHA 4APXA 4ZMOA 4ZMQA 2OMXB 2O72A 3K5RA 5JYMA 3FF8A 4AQEB 3K5SA
chains in the Genus database with same CATH superfamily
1FAKT 1J0IA 2CXKA 4DN4H 3B8SA 2OR7A 3RX8A 4M43H 3VWJD 1BYOA 3W39A 3UBXG 3FAWA 4Z95H 1MPAL 5B8CC 4B9GA 6FABH 3NH7H 4FMKA 2LU4A 3ARVA 4FADA 5FIEA 5MERB 4BZ2A 2W91A 3T0EE 1CD0A 2PYFA 3U0TB 4DKDC 4XN2A 4Y7MA 2XU9A 1JGUH 5DMKA 3P3YA 2UZXA 2VJ0A 1EERB 1MKFA 4MKTA 4PUBH 3FSZA 2DI7A 3MBWB 3VI3F 2AEQH 4PWEA 3GNMH 1CN4A 1CXFA 4ZAKD 3KLHC 1QUNB 1BBJB 1U6AL 2NLJA 1LD9B 2YK1H 4OD2B 4Z3GA 1OT2A 3A67L 4NDMA 4IEFA 3VXRA 3VXSA 4GRWE 4KTYA 4KUZH 4PRIA 1T1YB 3H85A 2TAAA 2HG5B 2ZX6A 4GW5B 4YIQA 4NSKB 2EEFA 4JO2H 2AABH 5FF6B 1YUHA 3P9LB 4GAJL 5HJGA 1BYNA 2YQBA 5DMGC 3NP4A 1NDTA 2F5AH 2IBBA 5ES4B 2BS9A 3BZDA 5ENWA 3TEXA 5I1DB 3BRDA 5FUZH 5L0QC 4S1RL 5CR1A 1NC4B 2OTWB 1DBBL 2MNJB 3H8NA 4QTFA 4FABH 5GJSL 2CPUA 2ZOKB 4RZCA 1LDSA 1WLHA 3LRSA 4TNGA 1M42A 4JREB 3HPLA 3PS6A 1CZ8L 3SDDD 3NN8A 2KZWA 4Q4IA 1NCGA 3BC9A 4PS3A 4BEIA 4JHZA 4MSWB 1E8YA 2QGEA 1IGTB 3SN6N 7FABH 1CTMA 4Y5XB 4LCCC 5I8KL 4OLUL 1AANA 1Q90A 3IJYB 1SDDB 4D0DB 4EIGB 5CCJA 3N40P 3HG4A 4NKDB 3RNKB 3UDWC 4AUJA 3RZCA 2PXYA 1KG0A 5T1JA 1ZV9A 2OYMA 3S4SG 3OMZA 1J8HB 2R0LL 4FG0A 5IQ7L 3MNDA 3RAJH 2YLKA 3LEVH 4HIEB 2H32B 1NL0L 1FBIL 3LXBA 4MS6A 4QWWC 4K8RC 3QP3A 3OSKA 5CZRA 4NRZB 1SOQA 1QFHA 3MLZL 4RMQA 3T4YA 2IV8A 3GMPA 4OSUH 3RBSA 3BT2L 4GXVL 5E95B 1U8JB 2DBJA 4J3OH 3BWUC 4BK8A 2BZCA 3IF1B 3R8BB 4PRPB 3NACL 3SCMD 5L6YH 4HJUA 1UZ8B 3RTQA 4ACTA 5JUEH 4K7PH 2PMZA 4RESB 4TUOB 2WWOA 1IGYA 5E24E 5CINH 3WTTA 2BIMA 4HOWA 4Z77A 3MROA 2FL5A 1QUPA 4NQDE 1MRCH 1NAKH 3BUQA 4EDXA 3F85A 3HC0B 1Q94B 4D0BA 1JZ3A 1LEGB 5LNDA 5JLZA 3S8GB 3IFOB 1TUPA 4Y1TA 5PAZA 5J9PB 1FNEA 1HEJC 4N6QA 3PDGA 5D5MB 1AMXA 4WWKA 3TN0B 2QQLL 1CDCA 3WAKA 2WTOA 2GJ6A 1DBJH 4ZUSB 2XPZA 3FMGL 4RX4D 4W9IC 1PYWB 4JN1H 3TFKD 1TVBA 1RUKH 3OAUL 4R4FH 4X5WA 4BUHA 5DLLA 1KB3A 2E6JA 1T5XA 2WZPA 1V05A 3IMBA 1ESOA 4EI5B 4OI7A 3ZE2F 2YQGA 3IXAA 4GP4B 4JKKA 5JDJA 3FRUA 3CNKA 3BP4A 4FI6A 3DOHA 3QZLA 2XUWA 1UUNA 3SE9L 1XO8A 3WEBA 2HUHA 2FBJL 4G7YL 5KVEL 2A9AA 1GGCH 2K6ZA 1UFUA 3UROR 2FO4A 4NQTA 1KGIA 3AM8A 3EO9H 1QO3A 2P5EE 3MRPA 4W4OC 4N1EA 3D09A 4D8PA 1C12A 3RVVC 3JWNC 3TBSB 4RVBA 4HUVB 3AWEA 1RK0A 2HVJA 3VWKB 4RMVA 1CGYA 3PWPA 3QDJA 4M6NH 4WDIA 5KSAB 2AQTA 4G3YH 1AGFA 3L3OB 4F2EA 3T0ED 2YXMA 1TNMA 2AKRA 2HX8A 3HUJE 4H25B 4AT6B 4URKA 4WENB 5HP5A 2ROYA 3S96A 2WWMC 3ECBA 2WM0A 3HG1D 1SXAA 2ZG3A 3WXVL 1D7DA 5I71B 5D2NB 3E6HA 1N3NB 1XGRB 3WUWB 3W9DB 2IANA 4KKQA 4W6YB 4FAAB 1ASOA 3NSJA 4HS8L 3L5XL 3KPQB 1MCEA 1UM6H 2DBLH 4ODVL 1M7IA 1MW2A 4L48A 2OSXA 3AZUA 2VZVA 4MMZA 4B9KC 4LP8A 4ZSOE 2NY3B 2XZCH 5I15H 4JFSA 4Y19E 2ZP0T 4HALA 2P24A 5MEQA 2WKLA 4OF7A 4OCXL 4LBEB 1E4HA 5FOBB 2B9AA 4LRIA 4P3CH 5CILL 1JAEA 1E30A 4CW1A 5DA4A 2ADFH 4ZOAA 4YWGL 3W2DL 2CD0A 2IQ9L 3GLAA 4MLIA 4BSWA 2ZSVA 5DJCA 4YSOA 4IIZA 5EG6C 3TT3H 1MLBA 1F3JA 2HJLA 3HOGA 1U8LB 4BCYA 1SF3A 5HI5D 4KQ0A 4YNYA 3VFVA 4PP2B 5A7EA 2QMKA 3C6LA 2ZOWA 3EO1A 2QJDA 1OF0A 1UD8A 3C5ZD 3QJQB 5I30L 3NIDE 3OJDB 1JZFA 2O5YL 2WXMA 1D2OA 4NUMA 4GSXA 5DJAA 1C1EH 4KI5C 1S7TB 5FDWB 4ZMZA 3DTDA 2QGCA 1U3NA 5HHOD 2G0LA 1I9IL 4BIKA 3VFRB 5CFHA 1IARB 3ZHLA 5F6IB 1WA2X 1VZHA 1HQ4A 4DQOH 4KKAC 4IRZH 1GZPA 1A4AA 4HUWB 3S2CA 5HHXH 5BMFL 1JBJA 2EIMB 3DURA 1T66C 2DAVA 2R56L 4WI0A 2D8KA 5C0GB 1H3GA 1BVNT 1KCRL 4XGZA 1WJ3A 2OX5B 3U83A 1AO7E 5TD4A 5TDPB 4MVBD 4BZ1A 5HJDA 2QVFB 4AY0A 4Y4HD 2R23A 2ZQKA 4Q2ZA 1AHWA 2A2QT 3HJ0A 3D0VA 5FYJH 2QQQA 2JKJA 4DZ8B 1WWWX 2C7FA 2IGFH 3FYIB 3PG2A 1BFVL 1HVXA 2Z1KA 1IUZA 3TO4D 1AFVH 3BSGA 2B4CC 1LO3H 3JWDH 1I82A 3V10A 4A7TA 1OAUL 1TJGH 2O6EA 4NZFA 3VGFA 1CC3A 2BP5M 1AJ7L 5LBSL 4FZEL 1IE4A 3CIQA 1KTCA 2DTML 2GUYA 4Y1SA 2WMPA 3MBED 1NQBA 1NSNH 2KLRA 3ALWA 3NFNB 2VXTH 3ZU8A 3L3JA 3GMNB 4R7DB 4F20A 3O6FA 3NJJA 1UYWL 2P26A 2YA1A 1QG3A 1YHPA 3QR1A 3WO4C 1T1WB 5AB1A 2EH8L 4F15C 5GGUA 5E94A 4NFBA 4JRLA 4I8DA 3MODH 3OKNB 3KJ4B 2HX9A 1I3GL 4RZKA 3EO0B 4DFIA 4Z7WF 5GISL 1E27B 4MA7H 1N6QL 3OD3A 3IRZA 2ICWJ 4MD4B 3SBRA 5JQ6H 2R39A 3L4UA 1YNLL 5BXFA 2BSRA 3HMXH 3N42B 1K72A 4JPKH 4U3HA 4E42B 3EYVB 4CVWA 4EF3A 1FIGH 5EU7E 3CX5J 1Y0LB 1PFCA 2Z31A 3NZ8A 1QP1A 4LLUA 5E9DB 1W0WA 1CDJA 1RULH 2R83A 2N7BA 4ZMYA 1HSAB 4PJ7A 3SPHA 4PGZA 3ZO0A 3NRFA 4KITB 1KJMA 1NCAH 3C5SB 4ALAC 2VWEE 1HU8A 3CFJB 1R3IL 2FZ3B 4DOHB 1BZEA 1E28A 5EORH 4UIKH 4HWBH 3UDWA 3PU7A 4BQ9A 1WH0A 4KC3B 1T1ZB 2P5ED 2P7TA 3BAIA 1EHXA 1SFDA 2UY7A 3VG0H 1EDQA 3FQRA 3LS5H 2VRAA 3KYNA 1M6OB 2DKMA 1U3JA 2ITCA 5GS2D 2N59A 5I82A 1MVFA 2BMKA 3QQ9C 2D2CC 2PWHA 3EJSA 4XE0A 3GS7A 3UBGA 4Z7VF 5ID0B 4KMQA 3RBGA 1E6JL 5D1ZC 4WSKA 5F70A 1YQVH 1MF2L 3GSWA 2IOMA 1Q9LB 3RJDA 5L4FA 2FD6H 2Y7QA 3GPEA 2GBAA 4GKZA 1FNAA 4AMKH 3VXQA 1I8KB 3FUKA 3ZKXB 3EOTH 2F58H 1ACZA 1C5CH 3SJVD 32C2A 4BKSC 1KTDA 1ZLDA 3WFBL 2A0LC 4LCUA 3FB7B 3VXOA 5KANI 2G75B 3LD8B 4I13B 1X7SA 1DVTA 4Y19D 2X4PA 3CHRA 1CFQA 4HBCL 5E51A 5JPNA 5CKGA 2V5RA 3PQYE 2B08A 4LB8A 4X8CA 1A47A 5LKNA 1JPTH 5B39B 5EUOF 4WO4D 5I1HH 4ZAKC 3GMMA 4Q9QL 4AZ8A 3I2CH 2J12B 4NP4L 1OWWA 1IM9B 2XNAA 4FQIH 1FAIL 1ZWIB 1T1XA 2OI9C 4QJ5B 3KBEA 2ATAA 4S1DD 2I24N 2DOCA 1B6UA 3OKKB 4JM2B 1JN6B 4R7NA 4J4PC 3B3BA 1HH9B 4N3TA 3C60C 4FQHA 4DGIH 2N0KA 3RJOA 3U36B 2Y22A 2AERT 1VIWA 4ZG1A 3S37H 5I0DA 3ZO9A 4HOMA 1DSWA 3HS0B 3OKEA 5DI8B 5FEBA 1HSBB 1BQ5A 3G5VB 5ERWB 3C5XA 3QDHA 1F56A 2CLZA 3PL6B 4W4OA 5FYLL 1M3IA 1AO7D 1KB5A 3BSZL 4KGJA 3TVMB 3WNMA 3QUYA 1GPOH 1H8LA 2EO1A 1FNFA 3VFTB 3HB3B 4PJIB 5AG8A 1ZSDA 3N55A 1T6BX 5T1DL 1WE5A 3RVTC 1DBML 4XWOD 4C57C 5KVDH 1QSZA 4GMTH 1BF2A 1WYJA 2WLIA 2B77A 2WN2A 4OQTH 4FFVD 3W3BA 4ZFZA 3U0PB 2R8SH 4AENA 3HA0A 4XVJH 2EIJB 4OM0H 4G43B 4MXVE 5AL8A 3ARFD 5DUPL 2OR9H 4TNVF 3D0AA 2HFFB 3QIBD 4L3EA 5BUGA 1KJ2L 4AQEB 3HZKB 1D6EA 5CFAA 5I75B 5EU6D 2GCYB 3B9KC 3U7YL 1T0NB 4IIQB 1SXCA 3T2NH 4Z7OB 5DWUH 1P6FA 2GAZA 2GBTA 4ODXB 3RUGA 2CBQA 4YHLL 4ODBD 4JY4A 5GZNC 2R7EB 2VLRB 2AI0H 3DGDA 3QEUB 1MY7A 5D1XE 5DUMH 3ZX1A 3CMGA 4JX0A 15C8H 5GPRA 3PUCA 4A39A 5CD5C 5DHYA 4ZMNA 3OR7A 1GR7A 3GS4A 1BPVA 1RI8A 1T6VN 3ULVH 2VM4A 4CUCA 4LKXB 3MRCB 2ZKYA 4Y7OC 2X42A 3O0RH 4OI9A 1EAPA 3HZYA 1FPTL 4PJ9D 4CSTA 3ARYA 4R2GB 2OTPA 3OB8A 3KL5A 2BNRD 4YDKH 1PIGA 3MRBB 4LKCA 4YE4L 2B8OT 1GHFL 1E6OL 3RIKA 1R4XA 5D7IE 3V0JA 2CE6A 3IU4H 3LDBB 4HLZH 1X5XA 4RMUA 4Z3FA 4OD3L 3BJ91 3PP4L 5H94A 2DQUH 4N0CD 2JIXD 4IS6A 2X2UA 3L54A 4JRXE 4F8QA 2KDGA 5LNEA 1CG9A 4CILA 5DEGB 1SXSA 4B9IA 4KWUA 4CMMB 4L18A 5CSZB 1I7RA 4OGZA 1WK0A 1J11A 1ULVA 2FJHA 2UWEE 3GBLA 3REWB 5E00B 1EXHA 4HJGB 2O5XH 35C8H 2F53E 5EO9B 2VR5A 2IDFA 1R3JB 1VEOA 1YYCA 2QQKL 1SEQL 3U0WH 2CO1A 2GFBB 3B6SB 3GHEL 2AXGB 1MHCB 1USQA 4QRRE 5JO5A 1YA5A 3RWDB 1R24B 4ZTOH 2WLLA 3DUUA 5T3ZL 4JCWA 4V1DA 4R4NC 4UQ3B 3QUGA 3TH3T 2NY1B 3B5GA 1CGWA 2AGJL 3LVTA 4PRAB 3AXLB 2WIIB 2DWEB 1SOXA 2Y23A 4NO5B 4JG5A 1NANI 2AJXL 2PPCA 3KS0J 4DK6A 1FVCB 2JJUA 3MRDB 1VADB 1B3JA 4XC3L 3PQYD 4PJBE 4CAGA 5D2LB 5IROC 1BQHB 3C8DA 4J3OC 2CK0H 3UADA 1SJMA 2XVKA 1ZIAA 1HL5A 3ARTA 4S11A 3L1FA 5JHLL 3ULVD 3OZLA 1NBVL 1PDKB 3UCQA 1UJ3B 3Q05A 2EDHA 1KLFB 2HJFB 2HVKA 3DVGA 4NLHA 3ARXA 5JHLA 2NY7H 3VU2A 1WFUA 3BN9D 2FT6A 4K5OA 4HXAH 3FOLB 4OIAA 1H9DA 3G5YA 1ACYL 1UD5A 4P9MH 1BGXH 4JREC 1BJ1J 4TNWK 4YSRA 3X3FL 3WV0A 3FCBA 1ZT1B 2Q6WB 1E9QA 2M1KA 4G9FA 3RWHB 2LAGB 4HWEH 1XF4B 3B9VA 5EO1A 3VTMA 5ISZB 3C5ZC 4X0NA 4Y5XC 1M9SA 2Y06L 2VSMB 1VACA 4JFFA 4ODUA 3HC4L 3H9HB 1GJIA 4KQ3L 2PETA 4JAMB 1G6RA 1MH5B 1EXGA 4NIKB 4OZFA 4TQ8A 1QW8A 5HY9A 4CADA 3E38A 2C1OA 4GKSB 1C5BL 2D0GA 3OAWA 3A6CL 3VFUA 2WZ5A 4K9JA 3L1EA 1N2RB 2FNBA 3Q9PA 5D1ZA 4ZMTA 2CNZA 2DJ4A 1WC7A 4MNGE 2JI2A 2R1WA 3WHXB 1LEKA 2DWTA 2Q3ZA 1A3QA 1WS7A 4UDTA 4TUKH 3S0PA 4JDVA 5IUSA 2HRGA 4P5MB 4FNQA 1BZ9B 2Z64C 2KERA 1A1NB 4TS6A 4AVIA 2FEDD 5IFJB 2PW1B 1MRDL 3GZKA 2VITA 2PR4L 3MNZA 3N91A 4GAYB 4JQIH 3T8XA 1ACCA 1Q72H 2ZAHA 1CXIA 5LO7A 4YJZL 3U2SB 5HVGB 4RAVA 4YPGA 4ZS6D 1G7IB 1YYML 1SGKA 1YEDB 2DQ6A 1T7XA 3OV6A 5D1QE 3VFOB 1J05B 2JCCF 5H4YA 43CAB 2F5BL 3SDCB 2UY6A 4F7TB 3WCYA 4PWGA 2IAMA 2G5BB 3O3BA 4POUB 3IAQA 4BFEA 1X5FA 3MBEC 4X6CA 4OZGE 2FUQA 3BQUD 4HISA 1CFTA 2VDPL 1NAMB 5IBLC 5JR1H 1IC4L 1T4WA 3D85A 2E7MA 3ZQ9A 2M8XA 4B0MM 1RAMA 4AK1A 2DI8A 1NGPH 2P1YA 2ATPB 3FQNB 1SYSA 4J4PA 3KGSA 1BMZA 4CU8A 3C60A 1BZQK 4TSAL 3D50A 5F89B 3QHFH 3DV6A 4I3RL 4YDVB 1WFJA 4WWOA 4EI5C 2BVQA 1SVBA 3MOQA 5CBAB 3C6SB 3SBQA 3L5HA 3MLWL 3PWNB 4NQSB 3UTTA 3D25A 4NC0B 4RWYL 1TPXB 4JRXD 3SZ6A 2ZCLL 1GCYA 4XVOA 5HBBA 3RY5A 3LXUX 5DHDA 2AK4E 2HFEB 4DQAA 1RJZB 1I31A 2JJTC 1X5YA 1OAXL 1EHLL 1MCHA 3PFUA 2F53D 4DPRA 4WIQA 2BVOB 1HTYA 3BAKA 1UB5B 3FSOA 4YH6A 4DF9A 5KYXB 3ZOAA 2C3XA 3BD5A 4XMZA 3TIDA 1JWSA 3L3OC 4ENED 3D9AL 3ESNA 4QRRD 4EXKA 4NT6B 4NQEB 2H6PB 3GSOB 3RGBA 1PBYA 4XNMB 4LRNL 1RK1A 3IDGB 3GZQA 3WL9B 3JVGC 4QPEA 4K07A 3FO9A 2ZOTA 5KJRH 1G9NH 5AVXB 5I71C 4IRJD 1ET7A 2H0EA 5D2NC 3BGMA 5EBWA 1CGSL 5EZLB 1K8DA 3OMIB 1ZD6A 3IJEB 4I0PB 2B2XH 3N0PB 4JHBA 4OKVA 2TSBA 2VDLL 2VXUL 3BZFB 4OKDA 5B4MD 5DYOA 5JHDA 3CHPA 2OZNA 4P4RB 1JHKL 3B9KA 3JWOH 4I77H 4LSPL 5D4IA 5FW6A 3TBWB 4AG4L 1IZKA 3BD4A 2F8IA 2F8VA 3JWDC 3QQ3A 5CP7B 5K93A 1E8WA 1DBAH 1K5NB 4K94H 2V3EA 3DX7B 2OQJA 4TULH 4YHKL 1NAMH 3ARPA 3AU0A 3JTBA 4FF9A 3VX1A 5BO1L 1YEJH 4PYGA 4NUQA 4PP1D 3Q5OA 5DFTA 1KENL 1QKZL 4BHUI 5I66A 1AGDA 4NQCB 1CICC 2WTRA 4KX8A 1O6TA 2UYLB 3CUPB 3QG6A 4AYSA 4PBWD 3A0OA 4U2YA 5DQ9A 5F0JB 3EFDL 3RWCB 1U8KB 1UGKA 4RGNE 5CIPB 1OP5K 4Y2OB 4HHAB 1WGVA 5CEYA 1YUKB 4ODSH 1J9RA 1LP9F 1RZJH 2BP8A 3ASNB 2JKNA 1NANH 3HI6L 4CU7A 1IT9H 4M02A 3IAPA 3MCKA 3PABB 5JOEA 3NJXA 2VDKL 4D9RE 4WFFE 4HF5H 3MA7B 2R2BB 2WANA 4ZPVA 4H2CA 1P5VB 5F6IC 4L9LA 2CJUL 3V6ZB 4WW2A 2Y07H 1R0AH 3X13B 3X14A 1UTDA 2HMID 4ZW8A 4AIZA 1XH3A 4ZS7H 3DV4B 5IB1A 3RTLA 4QTIL 3VQ2C 5H37A 3GTVA 5KAQF 5L4MA 1VEPA 4N86A 4YZFF 3NUKA 3ISRA 4G80B 4ZFGL 5AVUB 4EN3D 4PB0H 3QJFB 1MFBL 5DJYB 4QDGA 2E27H 3GRWH 2NUTB 3ELQA 5LBGA 1BW8A 4MRCA 1K5WA 3NK4A 1CE6B 3U0TA 5CJ8A 4HUXB 3HE6D 4KUCF 1RZKH 4HWZB 5BO0D 3R06B 3K2KA 4Z23A 2WVVA 5CLYA 3B9AA 3TA3D 4YEEA 1K6QH 4JFVA 3MBWA 1IM3D 1WBZB 4QXGL 4N28A 3WY1A 1KJ3H 1W72B 2H2SD 5LB1A 4C4KT 4GRMB 2FTAA 4Z7UB 1T0OA 2CO3A 1LD9A 2MHAB 2ITDB 3FT1A 4OD2A 4ATTA 3HLKA 4FFVC 5FHBL 5C7XH 4FTDA 3ARGB 1T1YA 3CZJA 1THAA 1NEUA 2YA2A 3HI5H 2A9MH 2HG5A 4GW5A 3GHPA 1E4WH 2YJLA 4NSKA 1OGSA 1X5LA 4B9CA 4HKXB 3P9LA 3QIBC 3ESVF 1E8XA 4FQCL 4HUCA 5CIPH 3SBWA 4PJXF 4KXCA 4BK5C 3KJ4C 4POZD 2O5NA 5ITBL 4OUUB 1B0GB 2HKFL 5I1DA 2EDQA 3IMRA 4AXWA 4AX3A 2OTWA 1NLDH 2UV3A 4YLCA 2VLME 5HHQB 1EBPA 1S7QB 4G8AC 3V4PB 2ZCHH 4WHDA 3UXFA 4OFIA 4KTGA 1YNTB 4MQXD 3W9EA 3BIBX 4MSWA 5F2FA 4PJ9C 5GXBB 1IGTA 3MLUL 3PWVB 4R8WL 3B2MA 3T2LA 3IJYA 5I1GL 3ARSA 4D0DA 2AK4D 4NKDA 1EEZB 3RNKA 1JK8B 3B8YA 3WFHB 3LN4B 1PD0A 5GSRB 5DA0B 2VXVL 5E8DH 1J8HA 4K7PY 1WPCA 2QADB 4N0CC 1OAQL 1GTNA 2OBGA 4HIEA 2H32A 3KPLB 3L5WB 3L13A 4IDLA 4Z7NB 5CJOH 1N64L 4PRDB 4AOFA 1SUHA 3QRBA 1MAJA 1ID2A 4NKOA 2X70B 3E0GA 3MRHB 5A40E 1E4KC 3O2VH 1IKNC 1JZHA 4GG8B 4O02B 5KN5B 1TU2B 1W72H 1L3NA 3Q48A 4NRZA 3IU3B 2PYEE 3QDGE 3DRQA 3UO1H 2FWOA 4WY7H 1OK8A 3QWOB 1DLFH 1X44A 3ZKXC 5FHAH 2XVBA 1U8JA 3VFNB 2D4DA 1F4XH 1L7IL 1FQ9C 2DWDB 2YAEA 4C56D 2BVEA 2HT4C 3MR9B 4PV9B 5IP4A 2DLTA 3IF1A 4NUPA 5AVZB 3QHTC 5GGTH 3SYOA 1T20A 2BH0A 1I9EA 4TUOA 4WI7A 4AMWA 1AS7A 3LD8C 2EXWC 5FUCE 4KROD 1PG7X 5GJTL 3V8OA 4UQEA 2XG5B 3H3PH 5I73C 3HC0A 1NBYB 2WGNB 1Q94A 4FQJH 4JJHA 1LEGA 3GI9H 1IKFL 3VI3E 5J9PA 4RAHA 4P46B 1RIUL 4M1CD 5D5MA 3V4PH 5K9QG 1X9RA 3TN0A 2EXYD 3BDBA 1V54B 2QFPA 4ONOA 2DRUA 5F72S 1F3DH 1JPGB 5T1LB 4F58H 4CGTA 2Y4SA 3QO0B 2BPBA 4K73A 1PYWA 4KKLC 3NVQA 4UAHA 1COBA 1NFDA 5T1MB 5IVZA 2FQGA 3UTSB 1HE8A 3ESMA 1RKRA 5EHFA 3ULVC 1YECL 4D9RD 3V2AR 4EI5A 4OY9A 3S37X 4A37A 1NEPA 2EJ1A 4H2AA 2BIPA 1J1PL 2VR3A 3PPSA 5F8QC 5F6HJ 4QR7A 5ADOH 1F6AB 3BN9C 4HG4J 3FKUS 4UNTA 3HS0C 2Q8BH 4HH9B 2YMXH 1DBKH 3KDPB 5IQOA 3AITA 2JJTA 3PL6C 2IDSA 4O02H 4HQQH 4ZOCA 5MEND 1DQJB 3TBSA 1JVLA 1OKEA 4YHOL 4G7QB 3TVMC 5T5FH 4LVEA 3VWKA 1Z3GH 4X83A 3BE1L 4ZUUB 5KSAA 1D6VL 3L3OA 4E68A 4FNUA 1VKXA 4HXBL 1NCCL 3BKCH 3TURA 4CKVX 4N22A 4X7EC 1GY1A 1E40A 2VMDA 3BZ5A 1MREH 3ZN6A 4UNVA 1MELA 5G5DB 1N3NA 1XGRA 2VB5A 1AG0A 3WUWA 3W9DA 1X4YA 1KIUB 2RMNA 4WTQA 1VGEL 2GSGB 3KPQA 4GAAA 5L2KE 1A14H 3P11H 1V8HA 4DPBX 2HFGH 4FKKA 3FFOA 3DWTA 4N1CA 1XXDC 4IIQC 2WYIA 2ZUUA 4LPWA 1FNGA 2I60H 2J8UA 3VD3A 3RWGB 3O2DH 4LBEA 5FOBA 2A7BA 1A6VH 2W0PA 3QUMH 1FH2A 1BVKB 5FYKH 5I0YA 3EOBB 3P40A 4FA6A 2P3YA 3F83A 4EDWH 4LE8A 2YPLE 1YEGH 2VMEA 4HAGA 2WUBL 3EYSH 2GQHA 1U8LA 2F6AA 4LVOB 1P53A 2ZXQA 2W9DL 3QDMB 4PP2A 8PAZA 4HMEA 2V37A 4PLJD 4R6UA 2VLMD 4YDIH 5HHME 4R7XA 2WLYA 3OJDA 4PRHB 3CZGA 2VAAB 3DRTA 5IVOA 4GEIA 1YEHH 3MJ9A 3BQUC 4XCCL 1S7TA 4ELME 5FDWA 4LMQI 3LDBC 5EIIG 3FT2B 1CL7I 3ROLB 1BZDA 3J07A 4QXUL 1UCBL 5AAWA 1BLIA 4TSCL 43C9B 1EAOA 2J5LC 4C8XA 1XCQB 1A25A 4HUWA 3BQVA 4R7LA 3TIEB 3VU1A 1RUPL 4HFWB 4X6FB 2VR9A 3QI9B 2MSPA 4NS0A 3AREB 3B9DA 4JZJC 5TDPA 3D3VD 2WQWA 1MRFH 4R7VA 3ZHNA 1KGYE 1FC1A 5B7MA 1FNSL 1KPRB 2X2YA 2ZF9A 2E9GA 1F90L 1YZZA 3ZE2E 2V6HA 3GSQB 1L9NA 1S78D 4AV0A 4OJAA 1DQDH 4AQ1B 1EO8L 4DZ8A 1FFOB 1FL6A 1HXKA 5CUSL 1FFTB 1MI5B 3QDGD 3TO2A 4HD9A 3H4FA 4NUJB 4ES9A 5JOPE 2PKDA 4HJEA 4J6RL 3V6FA 4L4TB 3SE4C 5J1AB 4P23B 1EWHA 1FV1A 2Q20A 3DLQR 3MRFB 1OW0A 4P8QA 1MCPH 4TVSa 4QY8B 3HCVB 4ABVA 2NY1C 1KEGL 4RFNB 2ESVB 5L2JB 2R59A 5MEOB 4UT9H 2GSMB 4ZMWA 3GXNA 2NSXA 3CFNA 1ZV5A 3NFNA 4JVUA 5C09D 1FZKB 3RRQA 1EA9C 1OP5H 3ZKND 2NMSA 4JUSA 4LEXH 1OTTD 3MKGA 4IRJC 1T1WA 2W0KA 4M5ZH 3ENEA 3S48A 3KPSD 3B43A 5B4MC 4XMUA 5CZXC 4DVBB 3OKNA 4BK5A 3VM7A 3MLVL 1E27A 4FLOA 5I26A 2AVGA 4QYOB 1X4XA 4MD4A 3VI4B 1SYVB 4E9WA 1PVHA 5EZJA 3K2IA 5IF0B 2NY6B 4UZSA 5F7WC 3SBPA 3KNBB 4JJOA 4UV4L 4WFEE 4E42A 3EYVA 4PP1C 1I9JL 1KCUH 4KV5F 2PWGA 3M1CA 3Q8FA 1Y0LA 4JM0A 4E41B 5E9DA 3C08L 2DPKA 3O8XD 2F7QA 2KH2B 5GS0L 5HYSG 2DEXX 4GO9A 3KW8A 4H20L 4L5FE 3C5SA 4P2RB 5E23A 3FN0H 4YFLI 4MNQB 3O81A 1F86A 1KXTA 2I26N 2FZ3A 4MJ6B 3OF6D 4JE4B 3ZE0E 3IDJB 3MXVL 3NIFF 4AITA 2ORBL 3HC3L 3ZDXB 1T1ZA 2KZKA 4GAFB 4PJEE 1U33A 2X1QA 2EDBA 4B3EA 1YEEH 4NBYB 4FRWA 1M6OA 3G6AA 2EC8A 2MKWA 1ZLSL 1OCOB 1KBWA 4G6MH 5BQ7A 3IRPX 4D94A 5ID0A 4L4VB 2TSAA 5DVKA 3DX8B 2CSPA 4NZTH 5BUAA 2NY4D 2UXVA 1M1XB 3H7BB 5DD3H 3WE1A 1Q9LA 4NERA 5CLTA 1F58H 2QVTA 3LPOA 5EU5B 3B56A 2PUQT 5DK0B 5EBMB 2FLBT 1I8KA 3NPSB 4EN3C 5DTFB 3STZB 2I7OA 3WKPA 1KYOK 2J88H 3W57A 2MQCA 4F7EB 1IGFL 4XMTA 5L2KD 4FQXD 2G30A 2A9NL 4ZUTB 3PF2A 2NNAB 3QT2A 3LNFA 2J4WH 3FB7A 5GHWH 2W9EH 2ADGB 3CXDH 1EHKB 4HJIA 2EE6A 5FUOL 1C16B 1MWAH 4LL4A 1JF5A 4X6DE 3UYPB 3FN9A 3C9NB 1G9NC 3EGXB 4PLOB 3SDCC 3GD1C 4Q9RH 3NIGB 1KF9B 3BWAB 1WWAX 2JJVA 1MFAL 3NDYE 5HGBB 1UCTA 3DO3A 2YPLD 2FVNA 3JWOC 3ILPB 4DERA 4LIQL 3Q2WA 4LSVH 4RH4A 1IM9A 4K94C 1BX2B 2A6IB 1ZWIA 4FNPA 1PLAA 1M1SA 2JV6A 1PEZA 1P7QB 1IEBB 3UPRB 5HHMD 3CMOH 1XQ4A 4NM4H 5GGVL 1NCIA 3F7KA 7PAZA 1M2OA 3OKKA 3K81A 4H0HB 1JN6A 4JM2A 1IBZA 2BSED 1RIHH 4RDQG 4XP1H 4B9ZA 1HH9A 1VCAA 4POZC 1I4FB 2CO6B 3J27A 2IH1B 3TPUB 3CDFA 2DEWX 3U36A 4Z7WE 2GK0A 6TAAA 5I18L 3QHZH 3WKYA 5DRXB 2GKIA 2NY2B 3HS0A 5DI8A 3G5VA 4FJYA 2BSTB 4IKLA 5ERWA 4KJPC 4LOUD 1SMOA 1CS6A 1RZJC 1JPSL 2P49B 4XCNB 4BM7A 1SBSH 2YXFA 3PL6A 5JQHC 4GXUN 3QAQA 4U7KA 2IFFL 2JLPA 3IMVA 4BH8B 4WJKB 3T3PB 1KXVA 1Z9OA 4AYID 1B4TA 2JKXA 5I6NA 1I3RA 4ZNEE 3T0XA 3TYGH 1SOSA 4PJIA 5BUPA 4IGBA 4AM0A 5B3JE 2DQIL 3E1F1 3OX8A 1JFQH 3BKYH 5C3IA 4HT1L 4MTMA 2DLEA 3AY4A 4OI8A 1GAFL 3GXDA 3TWCH 1ZJAA 2Z7UA 4PLNC 4PJGB 1BA9A 4HCFA 3U0PA 1CL7H 3V5DB 4N25A 3MUGB 3EJTA 4HOXA 4G43A 4BZYA 3QISA 3KPOB 2HWZH 2JXMB 2HUEA 3SKUD 3L7FB 2HFFA 4I0PC 5BW7C 1HZHH 2ED6A 3II3A 1NMBH 4PJCF 3HZKA 1RZKC 2KT6A 2GCYA 3TV3L 1T0NA 4IIQA 5DGRA 5KS9B 4ODXA 1IEAB 5JW4M 2YWZA 2YRZA 1TDQA 2VLRA 3BFWA 3QEUA 4J23A 1LQSR 4DZBB 2XHNA 3T0EB 4MB5A 3ET9F 3QXUA 4NEHB 4LKXA 4Z3JA 3AQYA 1DDTA 4XO9A 1ECYA 5AWNL 1ZS2A 2KYIA 3QVAA 4KROC 5EWIL 4WFED 4FNRA 4OBRA 3FTXA 1MUJB 4MXWL 2BSBA 2GSIB 5IMMB 2A6KB 3UJTH 3MRBA 3ZQXA 4ORGB 1IAOB 1GYUA 1F8TL 2WXJA 1A5FL 3LIUA 1WIOA 4M1CC 4PRNB 2JH2A 1LHZA 4ZX6A 3TEYA 2N7AA 1EX0A 4HYTB 4HWUA 1N7MH 2X6MA 5D55A 4AC2A 1QYGH 3V4UH 3T0AA 5LWYH 5DEGA 2VXSH 1PJ9A 4MMYB 1J1OH 5LDSA 5CSZA 3RVWD 5EF3A 5E00A 5AEAA 4FFYL 4HJGA 4AI7A 4YO0B 1H8OA 2FSEA 2VE6B 5EO9A 2DDQL 1R3JA 2CO7A 2ZAIA 1RZFH 2FEEL 3LKPB 1R3HA 1N68A 1QAWA 1VCBC 1JZ7A 3W37A 3B6SA 4RGOL 1T03L 1CLYL 3QC6X 1MHCA 4U3CA 1Q9KB 5E5LA 1IBGL 1OPGL 4DP5X 2CR3A 1YJDL 3RWDA 1U3HB 2BFVL 2FX7L 4JMNA 3QZMA 4CJ0A 2V9TA 2XOTA 3MGOB 3T3MB 1CBVL 1KGCE 3DBXA 3AXLA 2WIIA 2DWEA 1OOWA 4F3FB 3QUXD 4OTXH 1MCQA 1FVCA 3MRDA 3LZFH 1CK0L 3N44B 1C8QA 2KI6A 3TZVD 4JQIA 2BOCB 5D2LA 1XCXA 2ZKMX 2XV3A 1ZT7B 4DVRH 1BQHA 3FTZA 4WUKL 2E8YA 1KBGH 4UT6A 2O5ZH 3DROB 3TO4B 3ZPDA 1PDKA 4PBDA 1UJ3A 4OB5H 5LBVA 4WEBL 1KLFA 2HJFA 1RUAL 3FCTA 3VXUE 1OARH 2P28B 4JPVL 3NCJH 1M05B 2IALB 2JMRA 5GRJH 1UH3A 3FOLA 3FU7A 4LQFH 3IMTA 2DLFH 4K5NA 1A6WL 1IAIH 3N3EA 3ECWA 2JLLA 4M93B 3LQMA 3VYNA 1SHXA 2ZUQB 5KVGE 4NPKA 2CXGA 4NQDB 2Q6WA 4LFHG 2JVUA 3RWHA 2XIIA 2P8MB 1EXUB 1XF4A 2BCMA 4LOVA 3BMWA 1YLBB 3GJFB 3GS0A 5ISZA 3VXMD 4EQ3A 1PZ5B 4HCRH 1GC1L 1S3KH 1KCBA 2FECI 2H1XA 4NKMB 1BMGA 1IFRA 3GYRA 5C0EB 4JAMA 1MH5A 1GMEA 1NUDA 1BAFH 2VDOL 3MRJA 1A1OB 3UEQA 2QADC 1HINH 3LAFA 4NO0D 1N0XL 1N2RA 2AEPH 3RU8L 2LE9A 3WHXA 1FLRH 1A7RH 1UFGA 5DT1L 1MFDL 4K3EL 5K9QI 4P5MA 4BRJA 3CU1A 1A7PL 2F68X 1BZ9A 4NNXB 4QXWA 4G6KL 1A1NA 3NQIA 4WSJA 4M1GL 5FGBA 5T3XL 5IFJA 2PW1A 3ZVVA 2Q0ZX 5F7NC 3FFCE 4GAYA 5DO2D 3VH8G 4J3SA 3O9WB 4XAKE 5GRUL 1S78C 4OW6A 5I1AB 4PS7A 2Y6TE 4XNYH 3L3IB 3U2SA 2JKLA 4S1QH 5CGBA 1V7ML 4CC4C 3WLWD 3QSKB 1YEDA 5CBEB 3VFOA 1NGWB 43CAA 4HAKA 2AJYH 3FUDA 4TSBL 2FB4L 4B27A 2LT9A 1XB8A 5FGRA 3ZDZF 4F7TA 2ZYHA 5A7BA 1ZTXH 5K69A 2G5BA 3Q1SL 1XSIA 3M6DA 2GITB 3HMWH 4X5PA 2X1WL 4EI6B 3E8VA 3TBVB 2AQQA 3KVPA 4KO6A 4Y4FB 2QV4A 2P4AB 3ZKNC 4HPOL 2X28A 4P46C 1QFWI 3GSXB 1I1RA 1OTTC 3DBSA 2YOCA 4XVSL 5SWQB 2YN5A 3E9UA 1BM3H 2A1WH 2DD8H 3LPWA 3L9BA 4JO8A 2WOYA 3CD4A 1NGQL 5IG7B 2MEJB 4A1RA 2LLGA 2YEVB 4UTBH 5F9WB 3UAJA 3EH1A 3L3KB 2DWXA 4Y9GA 1BM7A 2VQ4A 5CBAA 3C6SA 4N9OB 2Q7AA 3IDXL 4HP5A 2EIKB 1Q4NX 3VDAA 3MLTB 2OS7A 1VJSA 1X5ZA 4DT2A 1P84J 3MRKB 4QOKB 4GH7B 3MA9L 4KDVA 3FHAA 4P59H 1D5RA 2Y1ZA 2DMKA 2HFEA 1RJZA 4FS0A 3MN8A 4HK3J 4XMLH 4MJID 5EC1B 1DQTA 3ZQWA 3MOBH 4XRCA 3QFJE 2BVOA 3NIDB 1UB5A 5KYXA 4I4WA 1WAAA 5E8PB 4TTDC 5TE4L 3GHBH 1TJIL 1XIWB 3WJJC 4JFQB 4YBLB 1UWGH 3FUMA 4NT6A 4O58H 4NQEA 1JI1A 1YPZB 4U1IB 5G55A 1HXMA 3QAZC 4KO9A 2V17H 2AQ1A 3IDGA 4N0UE 3WL9A 1CF8H 4P04A 3VFGL 1MNUH 3GRWA 3O3DB 4QRPE 2OMVB 5C0ND 4JZNB 5EZLA 1S2EA 3JTTB 4I0PA 1ZVNA 4RFEB 5ILTL 1BD2B 1BZ8A 2DKSA 3BZFA 4P4RA 4PJHB 1QRNE 3TBWA 4DO6A 3CE1A 5CP7A 5J57B 1K5NA 2AS5M 1KB9J 3MI6A 4MASA 4PGCB 4DGUA 1AR1B 1J9QA 5KANG 1SM3L 3SDXB 5DUJA 5EEUA 3AT9A 4FQXC 4NQCA 3EGSB 2Q86B 4FQ2H 1RU9H 5JXEC 2UYLA 1PX3A 1OP9A 4U2ZA 4LPTA 2MNWA 4HHWA 2XXGA 1U8KA 3D39B 4F8PA 3AY2A 4YHMH 3ARFB 5CIPA 3DUSA 5IGXL 5C0CA 4ETYA 5F1KC 4RBPK 4BFGA 3SEPA 2F7OA 1KELL 5FM5O 3PABA 1QSFE 2V2WB 3B3IB 3FDWA 3MA7A 4AVJA 2R2BA 2CRYA 3UZEA 1P5VA 2N4IA 4N0YL 2WP3T 3FH7A 5T33H 3X13A 4HV8B 3MV9B 2BK8A 4WUUD 2CKBB 4ZJ9A 3DV4A 1HEZB 4DO5A 1JE6A 2EYRB 2ZUTA 4RETB 5I1CH 2H6UA 1UEMA 4NKQB 4R26H 1BCIA 2I25N 1P9MC 4G80A 4FKHA 4BINA 1AXSB 1OGAE 4K9EL 3QJFA 2WSPA 5DJYA 1IGIH 1RH8A 1DYZA 3HHSA 1CE6A 1KXQE 1Q1PA 2ARJB 4XBEL 3GB7B 3L3GB 5IBTH 4AQ1C 2LHAA 4AK2A 3G6DL 3QCVH 1NBCA 4UNIA 5IVXE 4HUXA 5AFAA 3DXAD 4PY8I 1B88A 3EH2A 2J1XA 3BESR 4HWZA 1NIEA 5KJ7E 1TQWA 3R06A 4D3CH 3L1OH 4ETQB 5HVFB 4K8RL 4XAKD 4QMEA 3IKKA 4OCSL 3KYOB 1J5CA 1WBZA 2X0VA 4AW4A 3UZQB 1W72A 1Q0XH 1UA6H 1YMME 4GRMA 4Z7UA 1P6WA 3T8MA 5J12B 2MHAA 4G8FA 2ITDA 4WU7B 4Z0BL 1HIMH 3ZT6A 1MFUA 5IFAH 2AEWA 3K6DA 3WUZA 1L9RA 3ARGA 3DYMA 1R47A 2LU7A 2X53A 3UC2A 4L8CB 4AYGA 2DYRB 5E6RB 5GGTA 3AG1B 1FL3B 1UM4L 1EFXD 1WA1X 3MLXH 3FS9A 3KBHE 1DUZB 5A16B 4F5CE 2Q2LA 1PZ2A 1P4BL 3RLSA 2JJWA 4KRNA 1CU4H 2EKJA 1F1DA 2NY6C 5IWLC 3GEWB 3EYOB 5HHQA 5EZPA 3H3KA 3VMOA 4NBXB 1S7QA 1D9KB 5LLIC 2PTUA 4MQTB 3V4PA 1PG7W 2CKBH 3CPLB 2BJMH 4LVNC 1X5GA 5FWQA 4PMFA 3N1QC 5C0JB 5A1AA 2WQSA 5JIDA 2LU5A 3FF8A 4JKLA 1RJLB 4ZW5A 3PWVA 5EB9A 1G7LB 2C26A 2W95A 1NWOA 3H2WA 3NZHL 2EE0A 3CVHB 4ZT1A 5E1HB 2QVKA 4XPGL 1EEZA 1NUFA 2FRGP 1QBLH 1JK8A 3CX2A 5F0MB 3ALPA 2WXKA 3WFHA 3LN4A 5GSRA 2XN9E 1TZOA 2YKLL 5CZVL 4TOYH 1QSEB 1F41A 3HG5A 2V3DA 3QFGA 4X6EB 5I9QC 3L5WA 5T3ZE 5DURD 4BHUA 4PRDA 3WMSA 1OSPL 3AT0A 1DJYA 2PR9A 3RDJA 3SDAD 2NY0B 3UTZB 5KN5A 4GG8A 2W92A 2CHXA 2QPUA 1TU2A 2B1OA 1H8SA 3RVWC 3B2VH 4E9YA 3IU3A 5AW3B 2HAZA 3RKPA 5T5FA 5HSFA 3GXUB 1ID5I 4QRPD 5DZVA 5I8OH 2WVUA 3QWOA 5IZ7A 4ZOEA 1VFBB 2OP4L 4YZFE 1DJGA 3HFFA 4LCWE 5HI3D 5EDXA 4HC1L 1U92A 2DWDA 2IIJA 4L29B 3MR9A 4PV9A 4KK5C 3S35H 1OANA 2BWDA 3RL2B 1LDPL 5AG9A 5KYUB 1A9EB 3MSPA 4XB8A 3FJTA 3I9GH 4N1HB 3LTVA 1S9XA 4L1DA 4ISVB 2XG5A 1NBYA 1KNOB 2EVFA 5HXMA 1WFNA 1I1AD 2XA8L 1J5DA 3LZRA 5ECGA 1ZPLA 4LASL 4AV5A 4NLAA 5T1LA 3O2DA 4QHMB 5DRZB 3UIZA 2XA3A 2GJZB 1KDIA 2E7BA 3QO0A 3A6BL 2HKHH 1ZMYA 1UT9A 5T1MA 4LSRL 4GS7B 4HJ1A 4TPRH 3WNLA 1ZJBA 4A38A 1RFDL 3UTSA 3ULUH 5C08B 2XRAL 4L1BA 5EFIB 1AS6A 1O9VA 1QSFD 1N4XH 2MPAL 3LS4H 4PJXE 1XZWA 3GI8L 3NCCB 3E8UL 5D1XB 3FB8B 4O00A 2YD6A 7CGTA 2N01B 3L48A 2NY2C 1G7PB 1CWVA 4HH9A 5FKPA 4YXHH 1X6LA 1HHIB 3HZVB 1XH2A 3QDAA 5HYSB 4M7LL 3LQAL 1DQJA 2JELL 3S36H 3EAKA 1OSZB 4ERSL 5JW4Q 5DMIL 2HH0H 2XVGA 5KVFE 1AKPA 2R0ZH 2DWYA 5D7IB 2X9WA 4LVHB 2R15A 3WJJA 4B9FA 1YQ2A 1XDTT 2Y7LA 5BS0E 4YDMA 3GGWB 5IJCC 3LKNB 3F3HA 2OMXB 1T0PB 3B5HA 5G5DA 5FB8B 3JVFC 4FYSA 4XVTH 1GW0A 1QHOA 5H2BA 3NZUA 2B4CL 3TTYA 2GSGA 3BDYL 2DQFB 2CJ3A 5ICXB 1Z9NA 1A7NH 3CFQA 2K0RA 2JKSA 5EF1A 1HKLH 1TQBC 3ZKSD 1S7RB 4G9DB 3RWGA 1I8MB 5DO2C 4KOCA 4UT9A 3R1GL 1D5IH 3R19A 4IM8A 4R5XA 4PJ7F 5D72H 5F96H 2Z4TA 3EOBA 2WBJD 3PCYA 5JXEA 3HE7B 3WLWC 3O4LE 5DFVD 2NXYD 4X8XA 3H7LA 4QJ4B 3EADA 3K6FA 5F7YC 1ZIBA 4KY1L 2W9LA 2RA1A 1RURH 2ZXCA 1F97A 3QDMA 4WCYH 4G5AA 4FJ6A 1TTGA 1KBVA 3QZNA 4XNZB 1MIEH 4PRHA 1BREA 2VXQL 3M45A 3QZBA 2LV4A 3G6JB 2P5PA 1GYWA 3FT2A 4E9XA 3SKMB 3DJRA 5B1BB 4PJBB 5ABAA 4TRPL 4G8GA 1WSST 4QTHB 5JZ7D 3AXIA 5HYJA 3QPQD 43C9A 3SQBB 1JG9A 2NX5D 4HFWA 2WCGA 3QI9A 4KVNL 3AREA 5E6ID 1JGEB 5I74B 5FM5M 3BWUF 1P9MA 3QCTH 2DQGH 2OZ4A 2C9SA 1RPUA 4Y5YA 4EBQL 5T3ZD 1KPRA 2KQMA 2ZJSL 1FRGH 3GSQA 1TKWB 4QF1A 3C2SA 3OM3B 4TUJB 4AQ1A 4C54A 4ELKB 5LN8A 1FFOA 3BKMH 3V6OC 2RALA 2D3JA 5E2TL 3KPRB 1CFBA 4NUJA 1LVEA 4L4TA 1SLUA 5J1AA 1WT5C 4P23A 1U3HC 1U21A 3MRFA 1G84A 4LCWD 5JIHA 4P2QA 4QRUB 2JF1A 2XICA 5LCVL 3HCVA 3X1GA 3L4TA 5SWSE 5L2JA 5MEOA 3K8MA 4QNPF 5I6LA 1GW6A 2X4OA 4WKZB 2ALWA 2DJUA 4OCRH 5CJBA 3T04D 1URLA 2DQCL 3MV01 4HPHA 1FZKA 2F7RA 2P8PB 4KUCD 4MA3B 3VMPA 1IIKA 2ZWZA 3T0WA 1U9KA 2EIZB 2WO4A 4RBPH 4BFJA 1TEFA 1F0LA 4MNGB 3U25A 4DKEH 5LJYH 1U58B 3JV6B 4FYRA 2XWEA 4DVBA 3KCPB 4AE1A 2E0PA 3QNZA 4OZHF 2ENPA 3FPXA 3HE6B 1E43A 1MCWW 2YPVH 4QYOA 3VI4A 3Q9QA 1SYVA 5IF0A 2D3NA 4HIPA 1M2VB 5DUBB 1F1GA 3KNBA 3EFOB 1FYTD 4HIIB 4LSQL 3WKMH 2MCPH 3H9SB 4UBDD 4J6IA 5FYJU 4ZFQA 4E41A 3KWWB 2H1PL 5D1QB 4M93C 2BZ7A 5A2BA 1CE1L 3MFGB 5ANME 1R34A 4M5SA 5HVHC 2IPTL 4P2RA 5C8JB 4MNQA 1LWJA 4RGMC 3TL5A 4MJ6A 1MJ7L 5KSUA 1ONQB 1NOAA 5AOLA 4BUGA 3AG3B 4NZUH 5D7HA 2JJSA 1Z2KA 1TYRA 2O6FA 4ODWB 4XPTH 1OZUA 3MRMB 4L8BA 1QFWM 2BY2A 3NK3A 4FCAA 1ADQL 3LKQB 3MBXL 5BNXD 5KW9H 4YLBA 1JNLH 3RWFB 1L7TL 1U8MB 3QIWB 1C5DA 3DX8A 4UB0L 3SD2A 3K71B 3RUGF 1V7NL 1R5IB 3F7PC 3KM1A 3SDDA 1LO4H 1O7DE 5EZOH 5EU5A 5DK0A 4MJJA 2APSA 2VAJA 5EBMA 5IW6A 2OK0L 1CGVA 5DTFA 1OSEA 3STZA 3BKJH 4F7EA 4XH2B 2BLFA 4W9GC 1PFOA 1A9VA 4QXTB 4ZUTA 4PJ5E 4JO4L 1F4WH 4LSTH 2ADGA 4ES8A 3LV3B 5IKCA 2D03L 4LEBA 1C16A 1KBBA 4FXKB 2BW4A 2A99A 2DQTL 3IDYB 3BUBA 4LARH 3C9NA 1GVIA 3ARDD 5FWRA 5C9KA 1OGTB 1XL6A 3SB3A 3BWAA 2ZUYA 4Y0GA 4XPHH 1TFPA 2PPDA 2VDNB 3H0TB 2IWGA 3O4LD 3ILPA 2WO2B 4W4NA 3ZYJA 4OV5B 2BM3A 2A6IA 4Y4FC 4N68A 3U1QA 2AEQL 1EIBA 1UT1A 1P7QA 4P49A 4UT7H 3BRFA 5BVJB 4LEEA 1IEBA 3UPRA 1BSIA 2NDFA 1T7ZA 4NPYA 4TNEA 1NM9A 3EFFB 4TQIA 1QMUA 3EH5B 3QJVB 4KTEH 3SCMA 3MOAH 4AIEA 2IH1A 2X1OA 3TPUA 2BVUA 5A2KH 2QQNL 3GINA 1FH5L 5C0AE 5DRXA 4JO1H 4I2XE 1QLEL 2BSTA 1JMXA 4MJ5B 2B1HL 4AJYV 5D8JL 2V2XB 3E3QE 4XCNA 4A6YB 5F1OB 1XTLA 5LXVA 3GO1L 3WGVB 4BH8A 4HIXH 3BP6B 2WK2A 4IRSB 1PTZA 3AUVA 3DX9B 4RGNB 3RDTD 1N0LB 1OD9A 1Y18B 1EUTA 4K2UL 5DEFB 3DX4A 3MRGB 4GQ9L 3CH1B 1XIWC 3II1A 1LLAA 4PJGA 3U1SL 4JFDE 4G7RB 3O6LL 3TT1H 5I16A 3MUGA 4F9LC 2IV9A 3EXLA 2Q3AA 4ZYKB 4OUOA 5EDSA 5DS8B 4WQOA 4E9TA 2JXMA 1I8AA 4APXB 3DVIA 3L7FA 3IBEA 1Y6MR 3INUL 4NJAL 2VDNH 2HXAA 3PREA 1UACL 2J25A 1NBZA 4N6RA 5DLMH 2OKMA 1IEAA 3VH8B 2WC7A 3OLDA 4X5LA 4TL4A 5MI0B 2N56A 2GBVA 3KG5A 2X4NB 3INOA 4OLWH 5K39B 3EHBD 3JV4B 4OFYA 4DZBA 3T0EA 2R69H 3PJLA 1OVZA 2DQDL 4EOWH 3CZNA 3OC8A 5CCKH 3W0WE 2OL3B 1GOGA 1J1XL 1QLRB 4FTVE 5AW4B 1MUJA 1NCNA 2GSIA 5IMMA 2A6KA 4PJAB 4ORGA 5EF0A 1IAOA 1SOKA 5K5YA 1MRCL 1B90A 1ED3A 1WAPA 1JGDB 3V7AE 1KCSH 2X0WA 4PRNA 1JUFB 1W8OA 3EUDA 5TFSH 4AYDC 3LEYL 2EVJA 3IFLH 1TG8A 4OT1H 1JYVA 3KPMA 3QNYB 1BBDL 1NJ9B 2WQ8A 3QUZD 4JFZL 4OIFA 1KGUA 4K0OA 5E2VL 3OPZH 1MCOH 4CN4A 3PJSB 3APCA 4MMYA 3O41B 3MGTB 4N2OA 2XQ0A 1M7XA 4OJYA 3A6OA 3CFIC 1QASA 2VISB 4XOBA 2VE6A 4HCRA 3ME0B 4Z78B 3LKPA 4O4YH 3V6OA 2IBZY 5F7EL 1RUQL 4G7VL 4ADIA 1Q9KA 2GIMA 1HCVA 3WXWL 1U3HA 4FLRA 4DP6X 1DSYA 4CVZB 3EO9L 4X6CF 2EILB 1CDHA 3K6OA 4TLTA 1T7VA 4U6VL 3MGOA 4WV1C 5DHXB 3TPKA 2DS4A 4PJ5D 3UMNA 3V0IA 3K5SA 3EZJB 5GGQL 4F3FA 1IGMH 3QC5X 2XQBL 4W93A 2Z4QB 3P0YH 4YVNA 4P5TC 5J12C 3ZL2A 4C4BA 2H5UA 1JGIA 1DVFD 4Y4HA 2I27N 3BPOB 1T89C 2CR6A 3MZGB 3R4RA 3E2HB 1X7QB 1XGYH 1AKJD 4P9HL 3DNKA 4NN6B 1MCWM 4P2OB 2UXFA 2ILLA 3DROA 4N5ED 1YC8A 3TO4A 3PE9A 2PYEB 2NY5C 3QS3A 1JSYA 2CGRH 1B4RA 2R0WH 3GT6A 3JV0A 1YSOA 5KBKA 4PJCE 2DBLL 3UTPE 1K8IB 4YDNA 2QR0B 1M05A 2IALA 3FTWA 5FO7B 4AGQA 3ASWA 3II2A 2DYSB 2W94A 3QJUB 4Z9KB 5ALCH 3FUIA 3P69A 4XX1E 5AYUL 5E9AA 2R2HB 2KZBA 1D9KC 2H45A 2NXYC 4O51B 2CK2A 5DFVC 3WS3B 1U8NB 3DOSB 2FDBP 5J13B 5C0AD 4NQDA 2EE3A 1GCFA 1XXFC 1T2QL 3KD4A 2P8MA 1GGBL 3QR0A 1EXUA 3GJFA 4Z8FH 1LO0L 1I1FA 1PZ5A 2R0KL 2DQJH 3ULUC 5IMLB 5C0EA 1WZAA 4YSUA 5KSBE 1QWHA 4LL1A 2O6PA 1FO0H 3O6MH 1O9ZA 3LHAA 3M88A 3VD1A 4FQQB 2IDUA 1C1EL 3QPQC 2EDJA 3N9GL 2H3NB 5C6TL 2FWSA 2Y1VA 3ARBD 4KDTA 5L7XL 4URTB 4UNUA 2PO6D 2YAPA 4JO3H 2YC1A 2FX8H 2EINB 3PP3K 4H88H 4XMPH 2VN7A 2AJSL 4IRZL 4NNXA 3QG7L 4O9HH 3W1ZA 5HDBE 2EDKA 5E8OA 4UM9B 2NQDA 2QZ5A 1A7OL 1KEMH 4HKJB 3O9WA 1UXSA 3L3IA 3GBMH 3MJ6A 3DVNB 1OV8A 4K71B 5CBEA 3V0EA 3SO5A 4EAEA 3VGAB 4H8WL 4XO8A 5FYJL 1NGWA 3QW9A 2I69A 3BVNB 4AQ8C 3PY9A 2E6PA 3W11C 1AP2B 3JWDL 4KVCH 5CHNA 1N5YH 3HUJA 4HGMA 3UG3A 2GITA 2GYSA 4U1MB 3AUWB 3TBVA 3QJTB 1NCWH 4Y4FA 4ZMQA 1OWRM 4XXDB 1OAKL 3W0WD 3GSXA 2J8OA 1PU0A 3PDOB 1UKQA 5SWQA 5C6PB 5HPOA 1T5WB 1NSNL 2VXTL 3ZY7A 4CVUA 1ZSHA 1SRDA 3SHSA 1TENA 2IMNA 1W16A 4RRPM 4GS7C 5IG7A 2DM2A 2Z0UA 3T65B 3W81A 1DZBA 5DDHB 4KRMB 4YEFA 4Y2DD 2WXOA 3NA9H 3L3KA 4ZSOA 4P4KD 4UQ9A 1HXYB 1MOEA 4Y19A 5IHUH 2VUOA 3SGEI 1EFQA 2YFOA 4F8LA 1I85C 1Q1JL 2GW5A 2X4TA 4DKTA 5CEXB 4UBDC 2AMUA 2P5WB 4NI3A 3G5XB 1SLVA 3HMXL 5K1NA 4JPKL 3WTSA 1GYVA 4ZD3H 4ODTL 5L9DH 1YY9D 2NZ1A 2ZWNA 4LDOB 4M3HA 5EOCH 1IIIA 3DETD 3KBPA 5D93B 4JGMA 2C4XA 3O3UN 4PJ6A 4LVHC 1GZHC 4ELMB 4B9JA 4JFQA 1NCAL 4WK0B 4AYBA 5ID1B 3NJGA 1YPZA 1JD7A 1IJNA 4LAQL 4J3OF 4R83A 4U1IA 1VGKB 4XAWL 3LNIA 1ODAA 4HWBL 5KBNC 1SN0A 4Q0XH 5LHDA 5TE7H 2OMNA 3O3DA 2OMVA 4JZNA 1NCDH 3F62A 3JTTA 4BH7B 2DM4A 4RFEA 1BD2A 1CGXA 1MHPL 3T2PA 2Z7YA 4OZIB 4PJHA 2BNQE 5BRZB 2QSCL 1K4CB 2PABA 4R97B 5DHVA 4U1JA 1B0RB 3N1MC 4PGCA 1GXEA 4S2SA 3I50L 3ZJAA 4PCTA 3TGXA 2Y24A 4FXGB 4YSQA 1PY0A 4NUGL 4KKZA 1KYOJ 3WGUB 3EGSA 2Y3NA 4IBLT 1DSFL 1XB6A 2Q86A 1VRSA 1CLZH 4GXFA 3TOPA 3GUTA 4XP4H 4XHQA 3B7SA 2WKOA 3WFDL 3HE7C 2IWEA 3MLYH 3SKOB 3DMMB 1IFHL 3Q8AA 4LHUD 2QPDB 5EV7A 3UTPD 1KWKA 4H26A 3PUUA 1TZ8A 1V3LA 1JPFB 3OC5A 2FWLB 3ARFA 3SGDI 4MDRA 4YFDB 3BT0A 3FTVA 1TQTA 2GEEA 4XNZC 1X5MA 1PG7L 4S1SH 4P5RA 1HCZA 3DUHA 4AQAB 1SDYA 2V2WA 3B3IA 1JYNA 1DL7H 1KN2L 5AW5B 3VRJB 5CM1A 1PKQE 3CLFL 2OCCB 4W1TA 4NO3B 5EU4B 3MXWL 2Y36L 4ICXA 4HV8A 3MV9A 2JB5L 2CKBA 2Y2TA 4QKXB 5JMOC 4LU5H 1RVFH 1RIVL 3SDYH 2EYRA 5E4OA 3U48A 2UXTA 2FT7A 2K8QA 5CGYC 1H0DB 1AXSA 1JNNL 2VDQB 1PZAA 1AVAA 1U95B 2BSSB 3MNVB 4BWTA 1RCYA 4LLYB 5C0FB 2ARJA 3GB7A 3L3GA 2AP2A 5HGAA 2VZ3A 2EDNA 3MNMA 4LCVA 2A4ZA 3TESA 5D7LE 2WOBA 3ZE0B 2PYFB 3BAEH 5HGHA 3UZVB 1BXVA 3KYOA 3RILA 5D5MF 3GM0A 4PJEB 3UZQA 3S3JA 4PS4L 1FGVL 5E5UB 5C9JA 2UZXB 1GOFA 3SO3B 1QPKA 1LQBC 1WITA 4KRPD 1RP9A 4IBZA 4PREB 1E9PA 3EOAB 2X88A 4XPBH 1TQSA 3V0WH 4PRIE 1T89A 5KVDL 4GMTL 1B0WA 1MVUA 4PTTB 4OQTL 2R8SL 4BKTC 4L8CA 2I5YH 4NDMB 4XVJL 4IEFB 4OM0L 3UP6A 1FL3A 5A16A 1KYAA 1DUZA 4X7TB 2ARJQ 1MDAA 4HLEA 4X7SH 1ICTA 4YIQB 3S9DB 1IVTA 3ILEA 4Z3IA 4NZRL 3UIYA 3BVUA 2G4GA 2FHFA 5IR1B 1XX9C 4JRFA 4FHJA 3MLRH 4X6DB 3CPLA 3MZTA 2IBGA 15C8L 1ETJA 1R3LA 1SXBA 2G3XA 3PQYA 5C0JA 4KNUA 4UM8B 3ULVL 1RJLA 5AAMC 1DHKA 4JCLA 2E7LC 1G7LA 2VDQH 3NN8B 3Q5TA 3CVHA 2P48B 1ASQA 1TO5A 1ZVHA 1PZDA 2A38A 2E6QA 3O0RL 1A3LL 1GA2A 2R9HC 3DTUB 3M1OA 4B96A 1KDJA 1HHHB 3CSYA 1SJHB 2V5MA 3ORJA 1QSEA 1MFVA 4GNKB 3GUFA 4X6EA 2HTKC 4BZ2H 4BFKA 4XNBA 1ZHKB 1KG0B 1O75A 1QA9B 3HVDA 5ACZB 5DXWA 1MPAH 4KZEH 5BVPL 4HOZA 3U1PA 4TYUA 4AIXA 4ESKA 1OCWL 2BY0A 5IJKC 4KK8D 1VESA 2HRPH 3H9ZA 4XPFL 1U2CA 5C0BD 3I6SA 2QTVA 2QELA 1A9BB 2YIHA 2VSCA 3UAEA 4GUQA 3M07A 3VXTB 1VZIA 4L29A 4ZODA 4DAGL 2BNQD 1Q9OB 3NCYS 2O5XL 3CK0H 3H2PA 3RL2A 9CGTA 2WNXA 4TVPH 1BZOA 1AIZA 2ZXWB 4KJYA 1NKRA 4IDJL 1U6AH 3U0WL 4MLSA 4UWQB 4K3DL 2XZQL 3A67H 3IDYC 3KR3H 1BQRA 1XZ0B 4ISVA 1JF1A 1NC2D 1KNOA 2A4CA 1KCKA 1IGYB 4KKCD 4Z77B 2A77L 1JCVA 2FL5B 2OMWB 3LN5B 4GAJH 5E56A 3UMTA 3ILQD 3HN3A 2R1YA 2CRIA 2YSSA 4QHMA 1ZE3H 5DRZA 2GJZA 2VM9A 5JLZB 4S1RH 1Z9MA 1DE4B 3T8VA 4JRYE 1DBBH 2C9QA 2VMJA 2ZCKL 3AWFA 4LHJB 1OLZA 1TEYA 4BQ8A 4DESA 4WWKB 1AY1L 2WYTA 4N5EC 5C08A 1QNZL 5B7FA 5EFIA 5J7CC 1IMHC 1J9TA 2CK0L 1KOAA 1BQSA 1CZ8H 3PP3H 4ZFOL 5D1XA 3FB8A 4W9LC 1I85A 4EPSA 3IJ8A 4OGAD 3I6KB 1G7PA 4ADGA 3LCYA 2YPKA 3CN4A 4F8NA 5I8KH 5H37G 4G6AC 3I3DA 1HHIA 5HYSA 2OULB 2Z92B 3EJZD 2ZAGA 1OSZA 3AG4B 4IRSC 2R0LH 3QDJE 1D5BB 3SKNB 5T3XE 5IQ7H 5D7IA 1GZHA 3SGDH 1SDAB 5IB5A 1NL0H 1O5DT 2WLJA 4D8PB 1C12B 3GGWA 3ETTA 3LKNA 3OLIA 2Y5TB 4HWEL 4Q89A 2OMXA 4TF4A 2ATKB 4L4JA 4XN5A 5FB8A 3MLZH 2Y0SA 1P6AB 4CL7A 2ENSA 1H3XA 3S96B 2DQFA 3BT2H 2XJKA 5KTEH 3VNYA 3PPEA 4GXVH 5ICXA 1UOWA 2CKNA 3VXRD 2PLTA 3ZYIA 3VXSD 2PTVA 3N42F 5L8KB 5EIVA 2FJSA 3LHPL 4PRID 4JHAL 3CN1A 5CF3A 6PCYA 2ZP8A 2FBRA 1S7RA 4G9DA 4JKPL 4TUKL 4KZ0A 2P47B 1M7IB 3HNSL 3ARRA 1Q0YL 3DIFB 4DP9X 2NW3B 4PD4K 5L4JA 5MI0C 2XTJB 1JZ4A 4GKLA 4Y8DC 3MV8B 4ZFFB 1HESA 4QRRA 3HE7A 5I5RA 4LF3B 1Q72L 3D07A 5TQ0H 3BZEB 3MJ8A 4KY2A 1YNKH 3UGUA 1I53A 4X5XA 1I1YB 2QQLH 3RFZC 2XV6B 3CWGA 4Y4KB 3D52A 2OCJA 4DGYL 2WQAA 3FMGH 4E2OA 1MLBB 4ZUWB 1JJUA 2ODIA 2HKAA 4BXVA 1GS8A 3N5AA 3WHE1 1H3TA 2YPVA 3OAUH 3G6JA 3WYRA 3SKMA 1JRHL 2HTLD 3EO1B 4PJBA 3WIAA 4QTHA 3HLAB 4UOQA 2GC4C 5AW7B 1HHGB 5DJAB 3SQBA 2EEDA 2WCSA 3RZCD 3CBKB 3RVUD 3H1ZA 3RY6A 5JR1L 2PXYD 1JXDA 1XSJA 3SE9H 1NGPL 2FBJH 2WY3B 5KVEH 2HLFD 1D5MB 3VXUB 1HQ4B 1JGEA 4P4KC 1U4FA 1KY6A 1UQSB 4M7ZC 4ABQA 1TJHH 3JYBA 4OAWA 5C0IB 2P45B 1TKWA 4JN2B 1FSKC 5C3LD 4EJ1C 4PBXA 3L4ZA 4ELKA 1YEKL 5CS7A 3MX0B 5FYKU 1L9OA 2NXZB 1FL5B 5IUCA 1Z9SB 1ZV2A 2MIZA 3EUUA 5GGSB 3RKDD 3KPRA 2R23B 5I6XC 3FZUD 4NNPL 5IFHL 1NIFA 5DD1L 2ZWSA 1BF8A 3D34A 4ZXBB 4QRUA 3U30B 1NCJA 3DJTA 4WFGE 4XI5D 4PJFE 3B2DC 3MJ7B 4P3DA 4WKZA 2D4FA 4MDIB 2R27A 3RTQD 3T4AA 5MP6L 4HS8H 3TBCA 1Y1UA 1FP5A 3CFCL 3PNRB 2EDFA 4ODVH 3P30L 3VX0A 3MJGX 3NFPA 1BEYL 3WJLC 2Q7YB 4JM2F 4XNAA 5DVNA 2EIZA 4ZNCD 1KC5L 2WMPB 3BPOC 4MNGA 3ZKMC 1J18A 1R5WB 2HB0A 3E2HC 1U58A 3JV6A 4PS8A 4AJWA 4OCXH 2RFXB 3KCPA 4NN6C 3RB7A 5BZDA 4FFZA 5CILH 3HE6A 4M00A 3PRZA 4DKFL 5CD3A 1GSMA 2GJ6D 2MOGA 4YWGH 3W2DH 4OZ4A 2IQ9H 2B2XL 3SY0B 5L88L 3K6IA 3FFCB 1DCLA 2HPOA 5DUBA 3BUTA 4G6FB 3JWOL 4JRYD 2NOYA 3EFOA 1MHHB 4RA0C 4HIIA 4XVUD 3RPIB 5EBGA 4MRBA 1DBAL 4CW1B 2WZPD 1U42A 1NAML 2JK5A 3CQFA 3IGUA 5I30H 1M6UA 5CN1A 5D1QA 2FBOJ 1E0OB 2O5YH 4KXDA 4PJIF 1CJYA 3OGOE 1OE2A 3H2QA 3QXTA 3B9EA 3QQXA 2DYPD 4MAUL 5FM8A 4MZ2A 5C8JA 4Y2NA 4N20A 4AKOA 3LKSB 1WUNT 1I9IH 3NZ8B 1KN4L 1ILSA 3S8FB 1L5GB 1PEWA 1KJMB 4ODWA 5BMFH 4BZ1H 4A67A 2R56H 4MNHB 4Y88A 3FBQA 3SPVA 5E08L 4ODSL 5CWSB 1H6TA 3QDJD 3PWPD 1KCRH 1E5YA 1RZJL 3LKQA 3P3TA 4J8QA 2ZWYA 2P7TB 4HEMA 3VSUA 1BOYA 1U8MA 3QIWA 3RWFA 2EDXA 4Z7OF 5FFOA 5HPMB 1XGPA 4WTWA 3T6VA 1R5IA 4UMSA 3C6EA 4BFBD 3CZSA 3UO8B 5IJKA 1LM8V 1BFVH 3A5VA 2SEBA 2IAND 2O6CA 2DKUA 4EIBA 5KZCD 4J3WA 4XH2A 3D6GA 2C9AA 1BXAA 3GSWB 3N41B 5AVQB 2CH8A 4QXTA 2AK4A 4GKZB 1AJ7H 2ZICA 5AZUA 1EQWA 4FZEH 1ES0B 5BV7H 3LV3A 5FKAB 4FXKA 1HILB 4HFUL 3V0VB 3F58L 5J6HB 3VGAC 3QFJB 3TA4D 2XSKA 1ERNA 2K4AA 1TETL 5C92A 1RZKL 3MDJA 2ZUXA 1UYWH 5SV4A 1D2PA 4HHGA 3DOIA 3H0TA 2EH8H 4LDEB 5TQ2H 4NHUB 25C8H 3H3BC 1JCKA 1YCSA 4PJ8B 3RA7L 4OV5A 4IOFC 2ITEA 4QNPE 1I3GH 2F54E 5GISH 2OJ1A 2VN3A 2BIQA 3C6LD 1KJ3L 5EA0H 5BVJA 4Q6IC 3K1DA 2AJ3B 4AZ8B 3GXFA 1HYSC 1YNLH 4GO8A 5DHMC 5C7XL 1T83C 2AJUL 1QRNB 3EFFA 2ADJB 3T08A 2OCFD 4EZLA 5HYEA 3RIFK 3ARQA 3TFBA 2G60L 4X4MA 4E9QA 4OZHE 2LLLA 3IETB 3L16A 4R7NB 5J8OA 1QBML 2A74C 3KWVA 4MJ5A 1ETA1 1R3IH 1J7VR 4XBGA 4J5VA 5CSBA 1MAMH 4KKNA 4XX1G 5D4HA 5F1IB 2H26B 4A6YA 2K4WA 2QBWA 1KT2B 3H54A 3JWNE 4U4IA 3RVXD 4NAJA 3P4MA 5TPWL 4N2FA 2GT9B 3BP6A 2KL6A 1DO6A 3DX9A 2CLZB 5AOJA 5D93C 1F02I 4GXUM 1AXIB 1Y18A 4WWNA 5DEFA 2MQGA 2P8LB 4MCZB 4OFDA 2UZYB 4B60A 4JJ5B 3C8KB 3D33A 1MQKL 3CH1A 5D2LF 1SNRA 4P2YA 1E6JH 5LGYA 3S3BB 4ZYKA 2NZIA 4ZDHB 4CVXA 3OVUB 1IRAY 4WFGD 5I6MA 5DS8A 1XR9A 1RXLA 2ISDA 4APXA 4LP5A 4ZFZB 4AENB 2XVLA 1EMTL 3L4WA 1K3IA 1TITA 1HS6A 1WS8A 4P2CG 3O6FD 3HAEG 5I5JA 3LYRA 1OGAB 4R97C 5FFLA 3B2PA 3VH8A 1PAMA 1QPPA 3B7RL 3WEAA 5E6SB 5DMGD 2ZX7A 4HBCH 2X4NA 5K39A 4JG0L 4X9BA 5IVXB 5KYYB 3UJJL 3HBPA 4Y5VB 4H1LB 1KJ2B 1DLFL 4PQXA 4JY4B 4PAZA 4Q9QH 1FC2D 4NP4H 1KCWA 3DMMC 2OL3A 3G04B 5AKRA 5GZOA 1FAIH 2RGSA 3PWLB 1DFBL 3L7EB 3OKMA 2ICEC 2QZQA 2Z31D 3H55A 4PJAA 5C0DB 1YMMB 4KI5E 4NBZB 2FATL 1OAYL 1JGDA 5DK3A 3S5LG 3MYJA 5SWZE 4E5XG 1CXEA 1JUFA 4FQJL 2OYLA 1N67A 4XT1C 1HC1A 4J28A 3GPSA 3QNYA 2ADIB 1QW9A 1NJ9A 4Z3EA 4JANB 3FSAA 1H8NA 5ITFB 1KB5H 1U30A 1FLTX 3O41A 1IGCH 4XO3A 3KLLA 5DZ9A 4IS6B 3WBDA 1HAWA 3MGTA 4JDEA 4Z1PA 5KOVC 5FYLH 4A2HA 3BSZH 2VISA 3X2QB 3DO7B 3ME0A 2ZUWA 3WDIA 1FYHB 4ZW3A 1ZA6B 3NRPA 2UVEA 1WHPA 1AR2A 5T1DH 1DBMH 3D4ZA 3EJZC 4BKLB 3BWSA 3DYPA 2EEAA 3RE0A 3US1A 4CVZA 1F5WA 3F7RA 3FO1B 4ZO6A 4G2AA 4J3BA 3RI5K 3HRZB 2XN9B 4UQBA 5ABZA 1E7UA 2EIEA 3SO3C 1KJ2H 1L3WA 3MLSL 2WUCL 4RSVA 4NRXB 3U7YH 1OP3K 3BFQG 1FORL 3BKCL 4LL9A 3V79C 4FFWC 4YHLH 1X7QA 5DEJA 3H42H 4KFZC 4P2OA 1EDYA 3AB0C 2PYEA 2V5YA 2F54D 1TIUA 1F2XK 1N26A 1W8EA 1U0QA 5L8LB 4JY6A 1WVZA 3FTGA 4PGJA 1B4LA 1K8IA 4OD1L 2JNZA 1U91B 5FO7A 1FPTH 4L37B 4NAQA 1U8OB 2OXHB 1ZGLP 1OB1A 2NSMA 2PPAA 4E9LA 4YE4H 1GHFH 1E6OH 4O51A 2KDYA 3K2UH 4FCHA 3DOSA 4AUUA 3QUML 5E1IA 5HI4D 5CU5A 1WAAF 4OD3H 1ZE3C 4UV7L 3PP4H 2R1XB 3G5YB 3TCLB 1YEGL 4JFFE 1M56B 2AXHA 4MCNA 2IG2H 4LZKA 2J73A 3VI3A 3RVVD 4CSZA 5IMLA 4G9FB 4FA8A 2APWA 3WTYA 2OXGB 2Z93B 3QUYD 2VMCA 4MMXB 4GMSL 3Q43A 4FQQA 4J2XA 5ELIA 2H3NA 3TH4T 1KSRA 3RVUC 2WWMD 1ODUA 1KXHA 5HY9B 3G9VA 2QQKH 2C1OB 3ZHDA 2Y5QA 3O8XA 1J5OL 1HK6A 3GHEH 3FQYA 5DS2A 5I76B 4IBYA 4UM9A 5I1KL 5AVTB 4HKJA 3OF6A 4L3ED 1ZDQA 2YAFA 4HJJL 4GSDH 4JGJA 5JDSB 5E4IA 2AGJH 4UYPA 1UWXK 4YC2B 3DVNA 1G9HA 5IHZB 1FFNA 1XH0A 2AJXH 2HJKB 4G8EB 3BVNA 1GYAA 3A4DA 2VKXA 1H3PL 4XC3H 2AXFB 3QUKB 4RMRA 2CM6A 3E6FB 5BS0B 4K5MA 4U1MA 5E1AA 1ZAGA 4GRLB 1UHVA 2EZ0C 1NUNB 1A1MA 2UY6B 3IBOA 4XXDA 5JHLH 3LQZB 4G72B 2ZX8A 1NBVH 3O3BB 1D7CA 3PDOA 5DZAA 4EMZA 1T5WA 3UGXA 2HT3C 5L2KA 1JVOA 12E8L 1DFXA 2FX9L 1DEDA 1CFNB 3HHRB 4BQBA 3WS6A 3D85B 3T65A 4WWKC 2C9UA 1AE6L 5BZWB 4M5ZL 1ACYH 4K15A 2QGBA 1EVTC 1HXYA 1NTDA 2VDPB 3D06A 4H13C 3X3FH 4KKAD 5CP3A 1S46A 5FX3A 1XF5B 4TN9A 4IKIA 1T66D 4XVUC 5CEXA 1LJMA 4Z6AT 3QUHA 2P5WA 2R2EB 3DV6B 3BN3B 4EZKA 3FW6A 2YPLA 2VZUA 3G5XA 2Y06H 2EYSB 5K9OB 1L0PA 3HC4H 3D25B 4QRTA 2I9TA 4KQ3H 2D3VA 1UWYA 2DH3A 2E59A 3PGFL 2GABA 4M6ML 5FECB 3U7WL 1RD6A 3OZ9L 5D7JB 2X4RB 4Z7UF 1OEZW 1C5BH 3EYUH 3A6CH 5J6GB 2O93L 3AM8C 4ELMA 4H0IA 2BSEA 4JHWL 4HA1A 5EOTA 4YQXL 4UILL 5ID1A 1G1KA 1FNLA 4V1DD 1ET5A 1VGKA 3WTXA 5F7FA 1S5IH 2QTEA 4B3VA 2LTQB 2KC0A 4Z7QB 1A66A 2OTUA 3FU5A 4BH7A 2PR4H 4G8IA 4KHXL 3D18B 4OZIA 5LXGH 3FUJA 2CDEB 4TNWF 1NGXB 4G6ML 1K4CA 4N2BA 4UIMA 1B0RA 1DQML 4TUUA 1YYMH 5KYNA 4NZTL 5ECJE 1O7SA 2JI1A 5DYOB 3QORB 2K3TA 4FXGA 2AK1L 1F58L 4KPHH 3O6KL 3QQ3B 1BP3B 1YNTF 2XTJC 3LX9A 2C1PB 2VDLB 3L9EA 2ICES 3GFUA 4XP5H 4NRYB 3UC0L 4IU2A 4U31A 3SKOA 3DMMA 4B5EA 1IO4C 2ID5A 3AJ7A 3NJIA 2XN1A 2B7DT 1AGDB 4LRIC 2VDPH 3CFTA 3NGBB 1JPFA 5SWSB 1MWAL 3PXJA 2DW5A 1S7VB 3QULB 4Y4KC 1EZVY 4WRLA 1PL3A 4CDGC 3D7PA 4LHQB 2H0PA 4R3SB 3P0GB 3AGVA 4Q9RL 4Z7NF 3JT0A 4AQAA 3BH4A 1XCWA 3C6LC 2NYZA 2CZNA 4UOZA 4I3RH 4JFFD 4H8UA 4NO3A 5EU4A 3MLWH 4YDJB 2CHDA 2WVSA 4RWYH 5DRNA 5I1JL 2ZCLH 3N06B 2VLJE 4AGLA 1NFAA 1TZGL 4NM4L 1H9VA 3IK2A 4WW2B 2VDKB 4F37K 1H0DA 5ICZB 4KO7A 1BXUA 2WB1A 5D1ZD 1OAXH 3X11B 3ZUNC 1XH3B 2BSSA 3MNVA 1I7UB 3DPDA 1Z1WA 5IB1B 3GZOA 5C2BL 1ZHBB 1NEZG 4QRFA 3FUFA 1SQMA 3RVXC 2NXZC 3D9AH 1P7HL 3HPJB 1INEL 5F1SA 1AHWC 5IT2L 1SBSL 2WXIA 1JWMB 4LRNH 4FERA 4IKJA 1EK3A 3UZVA 2A0LD 4ZXBC 1VSCA 3A4EA 4J3VA 3U30C 3IDUA 1BQUA 4PJEA 5HJ3B 1CGSH 1Z3RA 2WVVB 1SUJA 3HG1E 2VXUH 2VDLH 4PREA 4UF7C 4F33B 1JFQL 1C08B 4F93B 3EOAA 4LSPH 4AG4H 4I85A 4YX2L 1ORQB 4NKIL 2IAMD 1OTSC 4C4KO 4LGRB 3OKOB 4PTTA 4YHKH 2WBXA 1T2XA 3HNTL 1NH6A 5F7MC 5BO1H 3ECVA 3HI1B 2DQHH 1QKZH 2YUVA 4X7TA 4XN4A 3AGWA 5BV7C 3O6FC 2QKSA 5K59E 1GJWA 2QVMA 3OMAB 2J6EL 4CN1A 1UT2A 1DJXA 3CHSA 1WEJL 2IGLA 4J4PD 3C60D 5IR1A 4BA8A 3EFDH 3PHAA 4BK4A 4GW4B 4Q14A 4AXWB 1INDH 2V0AA 2V33A 2ZTBA 2VUYA 4X6DA 1F6FB 3FT3A 3STLB 2PNDA 3UTTD 3VG9B 3HI6H 4M8UA 3LPFA 4J3XA 5EEYA 2K78A 3RQ3A 2VABA 2VDKH 2XWDA 4UM8A 3TP4A 2YLHA 1A4KB 2Z31C 3PXHA 3WO3B 3EG9B 2OW6A 3P2BA 1X9LA 1OT1A 5I6KA 1JZ6A 2CJUH 2W60B 5H37H 3W9EB 4F91B 4NHCL 4X4ZA 5HHOE 5E8EA 3NJMA 5E6YA 1HHHA 1J8HE 3N1FC 4GQQA 1SJHA 1V55B 3E80A 4W9DC 1OIOA 2EUWA 4QTIH 1F1AA 3RVTD 2XN0A 2DM7A 5I8CB 4ZFGH 5IJDC 5F7KC 1ZHKA 1QA9A 5ACZA 1MFBH 1MAKA 1OP3H 4PW9A 1CT8A 1X5HA 4RISL 4NZDA 5AZ2L 4DFHA 3NAAL 1QYGL 5F44A 3C87A 4NKOB 4AEIL 5BOZG 1MVYA 4I2XB 1YC7A 1A9BA 4FE9A 4GOSA 5JHDD 5J11C 3VXTA 3B9KD 1Q9OA 4PRPE 1ZHNB 4HPYH 3DRQB 4M9PA 2FWOB 4QXGH 5GZND 5F21B 2N0MA 1OCCB 2L8AA 3GEFA 1L4IA 4ZNEA 2D73A 1NICA 1IV8A 5FHBH 2W59A 5CD5D 2YXVA 1WFOA 1XZ0A 2JKTM 4XP9L 1TYJA 1FGNL 1T20B 2PO6B 3ZZ1A 2Z34A 3CXHJ 2HZHA 1O7VA 3DJZA 3E7JA 4JFDB 1T4KB 3T09A 2OMWA 3LN5A 3MC0A 4FQCH 4WTXA 1HOEA 2X12A 4PJ8C 4AJ0A 3NEEA 5JPNC 3OKDB 2ZOUA 5ITBH 1NKGA 1PSKL 2EIDA 2HKFH 4U1GB 1KCVL 1DE4A 4JFYB 3S97C 4DO4A 4KKBC 3RGVB 4AYFB 3WEMA 1RJYB 1A6AB 1XB3A 2H7WA 3TWYA 4NXKA 4JLRB 4MAYB 2RQ8A 1NFDB 3BPLC 3ATFA 1E3FA 1OAJA 5IVZB 2NNXA 3MYZA 3WDHA 4Y9CA 3I6KA 3N0AA 3MLUH 4N3UA 3G5WA 2VLJD 4UAOB 4R8WH 1HE7A 2W38A 3KVDD 1G4MA 5I1GH 3ZTNH 3NCJL 2Z92A 4I89A 1HCFX 4PH8A 3NMEA 5HI4C 3LH8A 1OK0A 2H32H 4FTVB 3ZW3A 1IAIL 1MZZA 2VXVH 4GUPA 1UWXH 1DEEB 1D5BA 3SKNA 4ICWA 2PP9A 3K72B 4K55A 1U2YA 4TQPA 1N64H 4B97A 2ZD0A 2Y5TA 2XKUA 4R4ND 3QUYC 2FJGB 2ATKA 5D2NE 1N5AB 4X9YA 3FQWB 4G71B 1D5XB 5FYJE 1VKXB 2ZXDA 1HJBC 2CDFB 1N6VA 2DQEL 3FFDB 4UINL 4WWPA 1Q0EA 1FFRA 3KGRA 3SY6A 4DTGL 4LEOB 3VI4F 3IKCB 2F18A 1AZCA 1FWXA 1L7IH 5IRO