2XNAB

Crystal structure of the complex between human t cell receptor and staphylococcal enterotoxin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
241
structure length
241
Chain Sequence
DGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSSRSSYEQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T CELL RECEPTOR ALPHA CHAIN C REGION
publication title The Structure of Superantigen Complexed with Tcr and Mhc Reveals Novel Insights Into Superantigenic T Cell Activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2010-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xnaB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xnaB02
3ZT5A 3FT3B 1MCRA 4OZ4A 3WL9A 4HGKC 4Z76A 1CICA 3V5KB 1ACYL 1B4JL 2VR4A 3QXUA 3MNVB 1QLRB 5CJQL 3JWOC 4FFWD 2YPVH 1IAIM 4F37K 3ARRA 3ZKXC 3L5XH 4X5XA 5FUCE 4L4TE 2FHFA 4LRIA 3PWPB 3DETC 1S5IL 2HT3C 3WFDL 1WITA 1FGVL 1DBBH 4AENA 4Y4KB 2ATPA 1DBMH 1J9CT 2DM4A 2EDEA 2R2EA 2R2BB 3BFOA 1GVIA 4ONOA 3QUZD 5DHVB 2BXYA 4LLYA 1NCDL 2XTJE 1RU9L 2H41A 5JO5A 4NCDA 2JIXA 4XNZC 5AAMA 1ORQA 3WNPA 3SO5A 3U6RA 3E6FA 5MI0B 5DMIH 4ELME 5L0QB 2N7BA 4W4OA 5HYSA 2C3WA 1HSAA 3WN5B 3FJTA 2CR6A 5A2IH 2W07A 3QDME 4W4NA 2IQAB 5CZKA 4O4YL 4UDUB 1A14H 3ILQC 1F4XH 1D6EA 5F6HJ 3SBWA 4LSUL 1X6LA 3V2AR 2B4CH 1Q0XL 3O3DA 1FC2D 2XA3A 1X5XA 3RDTD 3WCYA 2XTJB 4X98A 5AD0B 4HZLB 2DQTH 2UUDK 1N5AB 5CMAA 1IGMH 1XR9A 5DQDL 1AFVL 1SVZA 3R1GL 5D7JD 1OTTD 1A6AB 4B0MM 4BQBA 2VN7A 1QLEH 4MZ3A 3LS4L 4MAUL 3H2WA 3FQNA 1BJMA 1I4FB 2AABL 5J57B 2B1HH 4KWUA 5EFIB 2OR9H 1YN6B 4LVOB 3G08A 3BZEB 2HJLB 2QKIB 4YXHH 1QVOB 4L29A 4S10A 3MBEA 2HRPL 2GK0A 3O2DL 4EUPG 4E0RA 4KXZI 1WEJL 1L0YA 3B8SA 5A16A 1S7VB 4HKBA 3MGOA 4G6AC 1UWEH 1Q0YL 1OAXL 4JAMA 1A0QH 1FAIH 1V3KA 3RWHB 4BQ9A 4JZJC 4FG6C 3TBTB 1WIOA 1MCPH 3CSYA 3O9WA 1MWAB 1OB1B 1J0KA 2IJ0C 4LMQI 1GGCL 1K6QL 2XWJB 3E2HC 1CIDA 2VLME 2ADGB 4KXZH 3HC4L 4GSDH 3ULUC 4L8SC 3CSGA 1AI1H 4M4PA 2W0PA 2NY7L 3PGCB 3X3GH 1KFAH 3T2NL 1KBGL 2VR9A 2YWZA 4PJIA 2RIKA 2XA8H 1OGTB 1U3HC 3CXDL 2ADIB 1U8QB 2R4SH 2B0SL 4YK4C 5ADOL 3QFJA 3VFWA 2WUCH 4W6YB 1QRND 4ENEC 1DP0A 4GLRH 5DUPH 1OTUC 5DLMH 4G6KH 1AHWC 4G6MH 3U0WH 2DQCL 4LKCA 3VGEA 3RTQA 1NFDF 3VWJD 3MRMA 1PQZA 1LVEA 2CIKB 2YRPA 3BIKA 3QI9A 4QEGA 2DLHA 3VCLA 3ZDZE 4FQXB 1RUKH 3CLFH 5DD6B 4WO4A 3UTSD 5C0CB 2ARJA 3MLWL 3NCJL 5B39B 3B2VH 4JHBA 3DLQR 5FA3B 3GNMH 4WY7H 3RWDB 2Z92A 1T7ZA 1JL8A 1HI6A 3S5LA 1ZAGA 2XXMB 2GT9B 1C5CH 3VXSA 1RUAL 1CXIA 3B2UC 5IFAL 5JQ6H 3C6SB 5DD1H 4MNGB 3BD5A 5ISZA 5T1KB 3DVNB 1XGYL 1OD7A 2F54D 3K1KC 3MJ9H 4XNXL 4QTIH 2DOCA 2HTKD 3FN0L 3ZYZA 1F6AB 3LMJH 1K9TA 4HUNB 5AG8A 1GZQA 4FFYH 4YE4L 5E1HB 3SN6N 1K4CB 3TBSB 4ODHL 3CD4A 2DWDB 5CEXA 4X5LA 5D6DA 3PP3H 2DDQH 1VGEH 3C9NA 3F65A 4KK6C 4G5ZH 3S37H 1EJOL 4JY4B 2Z8VC 3CFEB 5F71A 2H8PA 3P0YH 4LCCB 5H94B 4HHAB 3BE1L 3LCYA 1ACZA 3VGFA 2RJMA 1A4JA 4G8IB 4TSBH 1R3LA 2FGZA 3AREA 2V17L 1JF1B 2UVFA 5F44A 3VXRA 1I7TA 1DUYA 4Y5YB 3GBNH 4WEBL 4UZGA 4ZFGL 5GZND 1X4ZA 1J05A 1NMBH 1CGVA 2J5LB 5HI5D 3JTTB 2AQ3A 3TESA 3FZUC 4FQ1L 5SX4H 3RL2B 5ACZB 2R15A 3EJYC 3ILPA 5EN2A 3VFOA 4F7EB 2XQBH 4U7MA 3DO7A 2GCYA 4H26B 4HS8L 4DGYL 3O3UN 3TC9A 2NXZB 4NFBA 2AXJA 1ZT4B 4YHPB 3STZA 3QG7H 3AGVA 1JHKL 4U6HA 1YPZF 1S7QB 3ARFB 2N4IA 3QNYA 2XV6B 2NY0C 4MQ7A 1FFPA 3QEHB 4JVWA 3OJVC 3K8KA 3O4OB 4DEPB 2G5BA 1FVEA 2UY7A 4W4OC 5IBLC 4GBXA 5CGMA 2W59A 2Z31A 4PG9B 3HC3H 2NY4C 4V1DE 3IDNB 4M93C 4XP1H 3IDIA 4Y16D 2RGSA 3CU7A 5C0BD 3BO8A 4DFHA 3MCLH 5JPMB 1IGYA 4QY8A 4MJ4A 1II4E 3RHWK 4DWHA 2X10A 4XT1C 5CZXD 1AKJD 4G3YH 1NGWB 2WBJD 3GMMB 2C3VA 4JKWA 2R0KL 1FZOB 3W11C 3O3BB 5GGTL 1PYWB 3IJYB 3EYFA 3VFSA 2HG5A 4OZIF 4YFDB 5E8EA 2PETA 3QO0A 3BRDA 4TYUA 1F11B 4LU5L 5D2NA 1YEEL 1L9NA 2NY6D 5DFVC 4I18C 4KTYA 4WHYG 3JV5A 5HHPB 2JK5A 4OBRA 4EIZC 3WE6A 3I6KA 1F45A 5HD8C 1F00I 4BKLA 4W68A 4I48B 4K71C 1G7QB 1S7UA 5F3HA 3JTSA 3T8XB 2ZUYA 5EZJA 4HV8B 3UC0H 3RWIA 5KVMC 2QHRH 1JWUA 4QTHA 1Q9OA 5TPWL 2XWTB 4RDQF 1VGKB 1NKOA 2PR4H 4Q9RL 1MIEL 1XCQB 3DBXA 1HK6A 5IUSA 4OI7A 1T6VN 2CUMA 5A3IC 4XWOC 2QV2A 3IDJB 5MENA 2EC8A 1N6QH 2OTUA 1RIVL 2YPLA 1UZ6F 3EO0B 4PJ9D 3FFDA 4L9LC 5SWSE 1YNLH 2VDLL 1AXSB 2FJFA 5CSBA 1MFCH 4FQJH 5KSVB 3GSWB 5IQ7L 1BD2E 5I1AA 4K2UL 4JVUA 1TCRA 5DJYA 1MRDH 1WK0A 3T1FA 1IAIL 4M7JL 2PKDA 3FQTA 5HSFA 3SCMD 4Q0XL 2BMKB 1KC5H 2IAMD 3S88L 4YR6A 2ZUVA 4Y4KC 4MLSA 3IDXL 4D0DA 5DEFA 1N0LA 1U3JA 3AC0A 4RBPH 1NL0H 4PJ7F 1KB5B 1QOKA 4JR9L 3BKYL 3LY6A 1CTNA 5SWSB 3FB5A 3VMOA 4WWKB 4OLYL 5TE4L 3GSUB 1A7BA 1QUNA 4P2RA 3WFHA 5IIEB 3EIFA 2DD8H 4PY7B 1BD2B 3JVGC 2GTZB 3MV9A 5FGBA 3CSPA 2VXQL 3TH4T 3K46A 3O4LD 4YGAB 3MYJB 5JDJA 4OV5B 4KH2A 2AV1A 3REVA 4QRPE 2ICWI 4OBSA 4KRPD 3UBXB 5GRWA 4PJAA 1FLRL 3GGWA 1AGFB 2VDML 1BBJB 1BVKA 3A6BH 1UKSA 5F9JB 4NHUB 1FG9C 3BX7C 3FQWA 3EFDH 5IW6A 1KT2B 2HAZA 1JNJA 2ENYA 3V0AC 4Q7DA 1FH5L 4TRPL 4C59B 2GJ6A 1ADQL 3TPUA 1KOAA 4L3CA 1R5VA 1B90A 3S4SB 3OF6A 3IU3B 4J4PA 2LQRA 1NDGB 1MCIA 4X7FC 3RGVB 4OIIL 2FGWH 1A64A 2VL4A 4Z95H 3OPZH 1EVUA 1T0NB 2BSED 2ESVE 3N1FC 3VGGA 1HCVA 2CO7B 3TO4D 4M6OH 4L3ED 3MOAL 3LDBC 2V7NB 5DD0H 1G9MC 2EXYD 3PABA 5EB9A 3D3VB 3CDCA 1BGXH 4M1DH 4ZNEE 1HHKA 4XAWL 4RAVB 3DNKA 4BZ2H 4AL8H 1WFTA 3SKNA 4P23B 2VYRE 1T03H 3LV3B 4JO4L 2JB5H 3K74B 5C7XL 4LDEB 4YHLL 4XXCC 3BUTA 4JQXA 4KJWD 2NW3A 3X3FL 5HYEA 4MXVE 4ZODA 4ERSH 2B1AH 3BGFB 4JFFB 1KCSH 3RKPA 5J12B 2BSTA 4JRYB 4X6BA 1A47A 5FXCH 4XCEB 1JYXA 3C6LA 4JKLA 5ACMA 3KLHD 1B4RA 1Q9LA 1JNHA 3QA3A 5EOCJ 5FB8A 1HDMB 1KPRA 3TVMA 3ZL4H 4FQ2L 4O51B 4EBQL 2WWMC 4R7NA 4HUXA 1DSFH 2NZ9C 1C5BH 4UQ3A 5FYJE 3QCUH 4JFPA 3MRGA 1ETZA 1GIGH 1Y6MR 4XCNA 3UJIL 3QUXB 1EUTA 4EI5C 3BDYL 5T3ZH 5EU3A 4ODXB 3MRIB 5ESQA 4NO2A 4AQ1B 4AMKL 4PRIE 5JIIA 2UUDH 4NO0A 1QSFA 4UT9L 3GMRA 1A3RH 5EU6B 3CX5K 4MAYC 3TJHD 3HHRB 1N26A 3V5HA 1FFNB 2F53D 4M7ZB 4FQXC 4P59H 5F6IC 5ESAA 5KVGH 1HNFA 2BK8A 4Z9KB 1MI5E 4GW5B 1U8MB 4JHZA 2GAZB 3CC5A 3MXVH 3SKJL 4QYOB 1YNTB 3ALPA 5D7SH 4PV9B 4J1UA 4M6MH 3RIAF 3NIGF 4KV5F 1BLNB 3EZJB 4K7PX 4JG0H 3ARGD 5C9JA 4PRIB 5E08H 5DHYB 2V2TB 4NKOA 4K8RD 4EDWL 4DVBB 3OAZK 5BO1L 1MHCA 1T2QL 4HGWB 1EEUA 5DJ8A 2R0LL 3BHBA 4YEFA 1A6VH 1MI5B 1F3DJ 4Z7WA 4QRQA 4YZFE 5JW5B 5E24E 3T2PA 4RMVA 3BP7A 4APQA 4PLKD 4RMQA 1VACA 3GO1H 1A21A 3O3EB 3QZWG 4F7MA 4GKOA 4LCCC 4O02H 5FYKH 5D1ZC 5HHQB 2IPKA 3TCLA 2IFFH 5KVFH 4P5TD 2H1PH 2X9XA 1WWCA 4LHQB 5TE6H 5I1IL 4LCWE 1XF1A 4JDVA 4QRPD 1U8IB 1GGYA 1KNOB 3HAEH 3FQUB 1XF2A 2CIIB 1K5NB 3QR2A 3QNXA 2RAMA 2J5LC 5F3BB 1U8KA 3D0LA 25C8L 1P1ZB 4P46B 5IJVA 4IRJA 4JRXA 3O11B 1WC7A 4UV7L 3FO1A 3UPAA 4NZDA 1VADB 3GFUA 2AJZB 3L9RA 3N06B 3TCXA 4S1SH 3V0VB 3C5SB 3O6KH 1QFWI 2W0FB 4PY8I 2O5XH 3LRSB 2EYRA 1W8OA 1A6TB 4Y8AA 3ZE1F 3SE4A 4HJ0C 4CU7A 4HCRL 4PB0L 1KCUL 2G9HB 3QIWA 4YXLH 4U1MA 4YBQC 1UC6A 2FX7H 4G43A 4IIQB 4ZPVB 5EBMB 1E4KC 2A77L 5E94B 1YDPB 4U1IB 5GJSH 3OSKA 1RULL 3G6DL 1FSKC 3HC0B 1A5FL 1HHIA 3EOYG 2ITDB 4HK3N 2QQKH 4HFWB 1I9EA 5JHDD 2VLLA 1JGUH 4XVUC 2A1WH 4JLRB 4L8CB 5IMMA 2G60H 4NQDE 4XNUL 2H26A 2BVQA 3PV6A 4L8DA 1UA6H 4PP1C 1JGVH 4XPGH 2OTWB 3NA9L 1MJ8H 3QT2A 1EAPA 2FRGP 1LE9A 2XKSA 5HYFA 1J5OH 3NPSC 1WF5A 4LARL 5HGGS 1S7SA 4F33B 3ULVC 4KJQC 3KPRD 1P2CA 2WP3O 4YX2H 4OCWH 3BN9D 4R7DA 4XCCH 4P4KD 4J4PC 2VZVA 3HG1A 3CVIL 3U0PB 4IHOB 3PDOB 3P30H 1S9WB 1AY1H 4DQOH 3H9HA 4G7VH 1J1PL 3PJSA 1XF4B 5F7MC 5ITFA 4YDLB 1FDLH 2A9ML 3P0GB 1TJGH 4K3JH 3VXMD 1NSNL 4F9PA 1NCBH 4QCIA 3GUTA 4OT1L 4LSQH 1NJ9A 4YAQB 1HYSD 4PJXA 2VLJD 4O5LL 3MO1B 5JR1L 3I75B 5LGHH 4JQXC 4HDIB 5F88A 5JIHA 1FRGL 4TVSa 3VW3L 1TQCC 2I07A 3D39B 1DFBL 3S96B 4HXBH 4ODUB 3UAJC 1A1NA 2R4RH 4YFEA 1CF8L 4LF3A 1JTPA 3D2UB 4FFZL 5E7FA 1LO4H 2XTLA 4OAWA 4NRXA 4WRLA 5EU7E 1CXEA 1T89A 2D0FA 3DUSB 1N5YL 5AZEL 1MCLA 4A6YL 1TIUA 5F7NC 5IP4A 1T04B 4DTGH 2Y07H 1RIUL 2JF1A 1ZGLM 3UYRH 3IU4L 3FOMA 3O6LL 3HR6A 3QDGA 1FQ9C 2JB6B 2VN4A 3LKSB 4KK9D 2WW8A 1IARB 3BEWA 3G6JE 5E8DL 3IDUA 3VGHA 5J1AB 1SVCP 1MVUA 4WUUA 1W8NA 3KPQA 4H1LB 4WFGE 5BRZB 5JXEC 1X5KA 3QEGL 2ZCKH 3MREB 4LVEA 3RL1A 5F1NA 3EYUL 3HN3A 3MCKA 1FZKA 1QSEE 1NMAL 1FPTL 1ZA6A 4Z7OE 1RZJH 3FN9A 2VISB 2J8UA 3UROR 1IM9D 3AMKA 3HKFA 1I8IA 2NLJB 3H0TA 1P4LB 3DSFH 2B5IC 2PYEB 3G6JB 1AJ7L 5ID0B 2ICWA 3K0WA 4WFFD 5KVDL 4HWUA 5C07B 3CFJA 4FQLL 1T1XA 4KZDL 1DQDH 2IQ9L 4ZXBD 1L6ZA 3ULUF 2GJZA 2DWEB 5E4EB 2XZZA 3KXFE 3MRDB 1HXYA 1A3LH 3GMQA 3ZHLA 3EW3B 1EEYA 3PL6D 3G5XB 4LEOA 1QSEB 4K7PL 4O2FB 4ZOBA 3ZKMC 5K9KB 3QRFM 1GOGA 2R69L 1ULVA 4OGYL 3L3HB 4XC1H 1NCCL 2VZ3A 2F58L 2XY2A 1TXKA 3CGTA 4GMSL 4WFED 5TJWK 4GAJL 2BHYA 3EOAB 1F6FB 4HJJH 3TBVA 3MRKB 1MFAH 4U1NA 4LDLB 3CZJA 4YFLF 1Q9WB 4U1HA 3O6FA 2OQJB 4OD1L 4YPGB 1AXTL 2BNUA 3CFDB 3R0NA 4NSKA 3VWKA 4NRZB 4ZQKA 4NQDD 3SDXF 9CGTA 1UM6H 4JHAL 3MCG1 5FAAA 5FOJA 1LE5A 4Q9QH 1GXEA 1Z3GH 3EGSB 1MHHA 3BQUB 5C3TA 2FL5B 5K9JH 5DMYA 1IQDB 4M8QB 3O3AA 5DS8B 2VABA 1Y0LA 2AGJH 4OTXL 2VZOA 1JGEB 2H6PB 4PGDA 3F7PC 2XG5A 5D70H 3QISA 1EHAA 4YXKH 3EKCA 1X5IA 5DT1L 4MHHG 4I0PB 3VG0H 2EO1A 4HK3J 4ZFOL 2G5RA 4XPBL 1CK0L 3MTRA 4P2OC 2VIRB 3QIBA 3TWCH 5CD3A 2X89D 1BQLL 4RZCB 3MA7A 3MV8E 3MJ7B 1MRFL 5JW4R 3FB8B 2CKBH 5D93B 5C0AD 2L7UA 3X11A 2EYSB 2DTSA 1N2RA 1O0VA 7FABL 2NX5D 1CDYA 2YOCA 3B9VA 2GITB 3TN0C 5I71B 4QWWD 1ZWIA 5JXAH 1NLBH 4ZPTB 3V7AE 4OB5H 3BP5A 5KTEH 1WZKA 3LEVH 1Q72L 4ONFH 4B7IA 1LO0L 5HHMD 5FEBA 4YDJB 3MLSH 1K3IA 3JWNC 2Y5TB 2D7PA 1DVFA 1FO0A 2VDOL 2LVEA 2ZUWA 3CMOL 2X4RA 4TNVF 5T1MB 2DL9A 5DHXB 1OGAB 3ZDYE 3BP4A 4PJEE 4FFVD 1Y6NR 4HPYL 2C4FU 1I9JL 3WKMH 4UT7L 2R23A 1KJ2L 2ZUUA 2MQCA 1A6UL 4MJIE 4R90L 4X6DA 3VXPB 3WIIH 3SKOA 3PF2A 2VLRE 1F3JB 3KNBB 2W9DH 4UMGA 2KZWA 1RHHA 5LVEA 4N8PA 1CFVL 4GRLC 2F74B 5L88L 1FL5B 3UXFA 4HBCH 1XR8A 3HAEA 4Y4FB 4NBZB 3TBYB 1PG7L 3VXNA 1L7TL 2KQMA 4N9GB 3W5NA 1GZPA 4GG8B 4GG6A 4LEXL 3QUZB 1EIBA 5FV1L 1G6RH 1U2CA 1C08B 1I7ZA 2P8MB 2CDGA 2AJVH 3GJFB 3RJDA 1G7IB 4YDIL 4RMRA 2VLRB 2HFEA 1G7HA 1XGUA 1HHGB 4MQXC 1CBVH 1CG9A 1HIMH 1CYGA 5MEQB 2X9YA 5I1HH 3U2SA 5GGSA 1JUFB 1NGYB 5DD5H 5F7EL 4E5XA 4RDQG 1XF3B 3TM6A 4JO3L 5KS9A 3P9MA 1OW0C 1HQ4A 5F9WC 3GB7A 3HI5H 4OM1H 5EUOE 4HWZA 5CP7A 2O93L 1AR1D 5ADPH 1UWGL 2NYYC 3CMGA 3NCMA 1P6FA 3ARPA 5GS1C 1NC2D 5JOFB 3RUGA 3CIQA 4JG1L 3QXTA 3BVNB 1PVHA 5IB4A 4GKZA 5J7CC 3OAZH 5EO9A 2AJUH 1U6AL 4MA8L 3DMMD 3FO9A 5LCVH 1ONQA 4N1EA 5D7JB 4DW2L 4QRUB 3Q1SH 2JELL 1ZT7B 5EOQH 3ESVF 4CU6A 4K7FA 3I6GA 5CJ8A 2XWBA 3EO1A 3PG2A 4L1DA 4TOYH 3BKCH 1U93B 4CL7A 5C0JA 1KENL 3HUJB 4TVPD 2PYFA 3MRHB 1YMHA 1BQUA 2ZOLB 5HGAB 1KEML 1OARH 5AWNL 3QUMH 4PRBB 4BFGA 3EOBA 3MMEB 5HPOA 4Z0XA 5DEZA 4R4ND 1DN2A 5TF1H 4AIXA 5IOPB 3LEXB 4WWID 4EN3D 3CK0H 1YEJL 5CJOH 1E6OL 3UPCA 5IJKC 3F5WB 1DANU 2FZ3A 4NKMB 2YA0A 1MHEA 2GUOB 4PJIF 3WUWG 4BQ8A 1ZS8B 3WLBB 4F58L 4ELKA 4JO1L 4QRTA 2QQLH 3QH3B 1U8NB 2IH1B 1YY9C 1CQKA 4CBPA 3HR5A 2XN9D 2J6EL 4NGHH 4RQQA 1PZ5A 4HIHA 4ETQB 1F2XK 3DVGA 4LLUB 4TQEH 2HMIC 1ND0B 4PUBL 4XB8A 3KLDA 2NXYD 2J88H 3I02A 4I3SH 1B0RA 3WSQL 2IH3A 4XCYA 3QQ4A 1Z5LA 5I2IB 1FZJA 2P7TA 2PXYD 3GZKA 1R24B 5BZDA 4NWTH 3QJHA 3GSRA 3I50H 1BZ7B 3NCYP 1J0JA 4MCYA 3U7WH 3JWDC 1QRNB 1OAKH 1HYRC 1E4XI 4PREB 5DD3H 1U58A 4MWFB 5JW4M 1AD9A 4NQCE 4WI5A 5GGRB 4OLVL 3L95A 1SBBA 3SEPA 4NPYB 4NYLB 1UVQA 2BNQD 4F7CB 5D1XB 1JZ8A 4AZ8A 5F72S 4X0KA 4DUXA 1JRHI 1JWSA 1M71A 4OZFG 4XNQA 2AV7B 2A6KB 1PX4A 3S36H 4RNRB 4DKDC 1DDHB 1JPSH 3SDDD 3ZKNC 1U92A 2MFNA 2DQJL 3ARDD 4LRNL 3T4AB 2RCSL 1CT8B 1OM3L 4NQCB 3RVXC 4CU8A 2H32H 4XP5L 4TUOA 3MV7E 3PXJA 4LCIH 4ONGL 1DLHA 5GS2D 2J4WH 3NH7L 3L3IB 1HN1A 2D03L 4RGND 4BSVA 1JRHH 1PY4A 2RR3A 1RY7B 2MTPA 2G2RA 2BX5A 1FE8H 1KJVA 2HLFD 4JFHD 2H2PC 2QHLA 1CDHA 5I8EA 2ADJB 1CFTA 5C71A 3F7YB 2AJYL 5GZOC 2ID5A 3PWLB 5DUMH 3H7BB 3MSPA 5IKCB 3FMGH 5HYJB 2APXA 3H9SA 2JCCA 3Q6FB 5IHLB 2DLFL 3MNWA 5EO1B 2ZUTA 2OL3A 3BJ91 4QOKA 35C8L 1F90L 4NKDB 5KJRL 5DJCA 3WHE1 2E7CA 2OLDA 1PDKA 1KN2L 1O7SA 2F5AL 3X14A 5E8OA 1YMMB 3AS0A 3DROA 1P9MA 3PHQB 5JW4Q 1R3JB 3GJEB 4U1SA 3BWAA 3RY6C 3RJQB 4UU9A 3P4OA 1YC8A 5HPMA 2FH6A 4WNQA 3U4EB 2A2QT 4GAGL 3SPVB 3CDGB 4XVSH 1M7XA 1H0DA 2FX9H 3QWQB 4EZMA 3PWNB 4EUPB 1MFBH 1DL7L 2Z8RA 3LQAL 1U8OB 2HJKB 3MNVA 3FQXB 4I3GA 4FZ8H 4J2XA 2CGRL 4KQ3H 5J1SC 3IJSB 2BFVH 3BQUC 5D7IE 4UB0L 3VI4E 1B6UA 4JFXA 1AD0A 4QHKI 3QQ9C 3VXOB 3LIZH 1X5AA 2EO9A 1PKQE 5GS0C 3DOSA 1J1XH 3LPWA 5DK0B 2R2BA 5C0BB 1J88A 4PJ5E 2FJGA 5AG9A 3UTSA 5DHVA 4HKJA 5KOMC 3THML 1IM3B 4I0PC 3NA4A 4MA1B 5GGUA 4FS0A 2NY3D 5HGDB 2CKBA 3DRTB 3IGAB 3HS0B 3FOLB 1ZV5A 1I75A 1FL6B 4OGAD 5D93C 1NANH 4P0DA 3WN5A 1KTKE 4L4TA 1L4IA 2IQAA 1AC0A 3PGFL 4G6JL 3D85D 1WWWX 4OV6F 4UDUA 5D1QB 4XBEL 5I71C 3RNKB 5F7LB 1HEZB 1KJMB 3SDAB 1PD6A 4K8RH 2A0LD 1I3VA 1NBZB 3G9VA 1FIEA 4IRSC 5AD0A 4U1LB 3TF7C 1JYVA 1YYLH 3MXWL 3VFUB 2R0ZL 5I1KL 2NPLX 1G9NC 4R8WL 4ELMA 1W0YT 1WT5A 3BH9B 5DFTA 5SWQA 5JA8B 3MUY1 4I77L 1IT9H 3QDMA 4QRRB 2EDQA 4KU1A 2OYPA 4NRYB 1YEKH 1OAQH 3MOBH 4OQ1A 1I4FA 1IKFL 4P3WA 5E6ZA 2Q3AA 2MCG1 4FFWC 2WWKT 2R2CA 3BZEA 2QKIA 1QVOA 3IXAB 1CI5A 2YA1A 4MD5B 1P7QD 2X1XR 3QQ3B 4WVRA 3PNWA 4M7KL 2ZG3A 1IEAB 3UTPD 4M1CD 4NNYB 4AEHH 1QP1A 1S7VA 1BBDH 1I1AB 3Q3GB 5F7FA 4AT6A 4XBPB 4PJAF 1R3IL 3QUZC 2CD0A 3HZKB 5E6YA 3RWHA 2D2OA 3RPIA 3BRGC 3TBTA 2WAHA 4URTB 2C3HA 2VDNH 4IS6B 3FONA 1A2YB 3U4BH 1TJIL 1JPGB 1CLOH 2XWJA 4ZUTB 1HKLH 2F8XC 5DK3A 2A6JB 2LFGA 1C5DA 3QFDB 1MPAL 1UYWH 3O4LB 1FGNL 1EJ6A 4GW4B 3PGCA 3QPQD 3W0WE 3B9EA 1T0MB 4FABH 5ITBL 4G42A 4H0IA 1U8QA 3MRPB 3VH8A 2J2ZA 3RDTC 3DWTA 1D5BA 1IFHH 1RK0B 4LGRB 5BV7L 3AXLA 3I84A 2C1PB 5EPMB 3DUHA 3QEQE 5D7JC 2CIKA 1OTTC 3IFNH 3KPLB 4JHWH 5DD6A 3QEUB 4UIKL 1IRAY 3TO4B 2HH0H 4L3EB 2QQNL 1INDH 5C6TH 3UO1H 4Y2OA 3L1OH 3QUMA 4HUWB 3WFCL 4ZS7L 5EH1A 3RWDA 1RHFA 2VKXA 1XEDA 1MF2L 4K9EL 3VFTA 2EYTB 3ZMRA 1CFNA 3CH8A 1F3RB 2P4AB 5IMLB 3F7QA 1I85C 4IRZL 4LDOB 1T0PB 4TSAH 1AQDA 1BQHA 4HUKB 3DVNA 3ZYJA 4PGBB 1JGLL 1E27B 3TNNA 4HPOH 4OSUH 2VQ1B 4XNMB 3EDEA 3DX8B 3T1WA 2APFA 2P43B 4D9LL 2DWDA 4GAYB 2W9EH 4O00A 5TFSL 2WMPA 4LPUA 2F8OA 4ALAL 1LDPH 2YK1H 3CFEA 2PTTB 5H94A 1MAMH 1JZ7A 2V5SA 4HFUL 1VFMA 2EDFA 4YH6A 1UJ3C 4LAQH 4NO5A 3SE8H 1G0XA 1FAKT 1W2KT 4Y5YA 1S9XB 1AP2A 3NBNA 2NTFB 4O2EB 1S9YB 3SQOL 2Z8WC 3PDGA 5LQBL 4MJ5A 3L7FA 2R1YB 3D9AL 4DGIH 4KI5F 4POZC 3WIHA 3CFKA 3KPSD 4LLMA 5DRZB 1IBGL 3RL2A 3EBAA 4G7YH 4MLIA 5I1GL 3VWJC 2DQIH 1QPXA 4A6YB 4HH8A 3CFCL 4H26A 5DMKB 5TDNB 2XXCB 2M8XA 3B4NA 3OR7B 4PY8J 1ZT4A 5FO7B 4YHPA 1DCLA 4DUVA 2M1KA 1ZSDB 4JJ5A 4RX4A 2WIIA 4JPWL 1S7QA 4HIEB 3ARFA 1WIUA 4Z7WF 4NQXA 5I1LB 5A2JH 3NABL 2BSRB 3QEHA 2XZAH 4NNPH 4Z8FL 4JFOA 1CFSB 2JJSA 3ARGB 4ODWB 4YBLB 2BDNL 5DURB 1FG2B 4RWYH 1ZT1B 5FUCC 3TH3T 1LO3L 2VNCA 3OKEB 4C4KO 4NQVB 2V2WB 3VRLF 3A6CH 3QCTL 1NGWA 3GMMA 3NAAH 3QRGH 2FO4B 4PR5A 1NLDH 1WWBX 4ODTL 4LPWA 4X5WB 3O3BA 4TNWF 4TSCH 4PJ8B 2AXFA 5HVHB 3LH2L 4NKQB 4Y4HD 4BH8B 2UV3A 1JYWA 3HNVH 3W5MA 3ILQD 3UJJL 2EDLA 1F11A 1WT5C 4CN4A 3OXRB 1IKNA 1ZK9A 5HHPA 3UTTD 1A7PH 4LPVA 1WICA 4V1DA 2X1OA 4P48A 1NCAH 3AB0C 4ZOAA 3W0WD 5KSBB 5L8LB 1U0QA 4I48A 1JZ5A 5GZNC 3SOBH 4R0LB 3T8XA 5DEGB 4HV8A 1LO5B 5HI5C 4LCYA 4XAKE 2IGFH 4XHQA 1VGKA 3TZVA 4NWUL 4OKVA 4CVWA 1XCQA 3CVHB 4JFZH 5GHWL 4HWEH 5CAYB 2HFGH 1EO8L 4U1GB 2IBBA 2UZIL 3BXNB 1GGIH 5HI3D 1CXLA 3SGDI 1OF2B 3QEQD 5IB5B 3C5JB 3EO0A 4J7RA 4UI2A 2WSKA 2VH5H 3K2UH 4NCC2 3MLTB 5GRZA 5KSVA 3GSWA 2GTWB 2NY5L 4MD0B 5E70A 3LKRB 4NQEE 4JDTL 1GC1L 1UB5A 4JM4L 5K9OB 5CLTA 1FNFA 4FXKA 1D5ZB 2QQQA 4F7TA 3OKYA 1ACYH 1SJVA 4JY6A 2WLYA 4FTVE 1CD1B 1K2DB 5CJQH 5GIRB 3QCVH 2YRZA 4Y16C 4PS4L 3MUHL 5HYSG 1KB5A 5CZXC 4X9FA 1NUDA 1CZ8L 1S5IH 2WBJC 3G6AB 3C8KB 1MY7A 4P5MA 1DE4B 4Y1AE 5SWSA 4WWKA 3WFDH 2ADFH 2VDPL 3L5WB 1BVZA 3TBWB 5IIEA 1R5IB 1VENA 4BFEA 4PY7A 1BD2A 5EWIL 3BZFB 4ZFOB 4UTAH 1SEBB 1MJ7L 2FD6H 1FN4B 2GW5A 3J7HA 5DJXA 1DQJB 3RIAK 5GSRB 1ZMYA 1RU9H 4Q74A 5HHVH 4PJXF 5CGYD 3JV4A 3HE7D 5MHSE 4OV5A 2NY6C 3HFML 3WHE0 3U9UB 2FECL 1QZ1A 4D3CL 3DRQB 1RAMA 1BBJA 4ZYKB 1MIMH 3BT2H 5FYJU 1QO3B 2W65B 4I4WB 4MXQD 5I8OL 1KT2A 1J8HE 1XGPB 1Q0XH 3S4SA 1GGTA 2J12B 3IU3A 4AH2B 3GMLB 3I2CL 3RGVA 2IADB 4PGEB 2DLTA 3B8YA 3ET9F 4J8RA 3SQBA 5CUSL 3GI9H 1KTDB 1FYTE 2JLLA 3WEXB 3O0RL 3BKML 4K55A 1VEOA 3F6LA 2CJUL 4PJ9C 4QRPA 2V7NA 4HJGB 3WIFB 3QWRD 5JDSA 3R1GH 4XWGL 3VFRB 5EZLB 3G5YA 2NQCA 1J8HB 3SCMC 2IBZX 3SGJA 4Y2DD 4LIQE 4P23A 2IAMC 4P49A 3LV3A 3PWUB 4KQ4H 4Z7VE 2CRYA 1QKZL 4XCFL 3KYMB 3VDCA 2HRPH 3JWOL 5GRYA 3OGCB 1NAML 2ESVA 1WEJH 2CXKA 2WWKO 3NCEB 2UWEE 2J8UF 5DVLA 3O6ML 3SDCA 3FRPG 4LCUB 4ZNEA 2BY1A 3TYFA 3BYYA 3V52H 5CBEB 2ATKA 5EC2B 4NN7B 1L7IH 1PW3A 3FQRB 1CICD 4KRPC 2H2SD 4HLZG 4F37F 3QUXA 4DOHE 5GISH 4GKSB 2VLKE 4CKVX 4EVNB 1RUQL 3OKMB 3HC4H 1A22B 4HXAL 4ODXA 1BOGB 1FNSL 2NY7H 1IM9B 3CLEH 1K8IB 3T2NH 1KBGH 5T3XD 1T4KB 4X4XB 1F8TL 3S7GA 3CXDH 3HPJB 1LD9B 3DO3A 4Z7UE 4P4KA 2IF7A 2B0SH 1EZVY 4ZXBB 3NPZB 3S5LG 5FUOH 2JIXD 3TO4C 3P3YA 1A7RH 4GW5A 2DQCH 5EZOL 1ZEAL 4EOWL 1KYOK 1ZHLA 1DANT 2EXYC 2VLKB 3RVWD 2OMNA 4MJ6A 2D9QB 4QYOA 2XICA 4O9HL 4HC1L 3WS3B 1YEHL 3G04B 3P9LA 3OL2A 2E9IA 3IJHA 3F12A 4J3WA 1AO7E 2LAGB 3B83A 3FB6A 5E56A 1WTGT 3GMNB 4PRIA 2V2TA 1MSPA 4KJWC 3GEWB 2CLZA 4HGWA 1LILA 2Z35B 5B3JE 3MV11 5DMGC 4RISL 1RUAH 1MI5A 1MQKH 1X4YA 4PRPB 1HKFA 3IVKA 3LRHA 3KYNB 1JZ6A 4PJCE 3KLHC 2VXUL 3CX5J 3O3EA 2FO1A 2VAAB 3BZ4B 1OOAA 4XNXH 4JFEE 4WDIA 3FN0H 5JNYA 1RJYB 5FGSA 1AO7B 2AEPL 5TQ0L 4HKZB 4YE4H 3F7VA 3V8OA 4DUWA 4WI8A 4ODHH 1F4WH 2K9UA 1U36A 2YC1B 5I1EL 4JQIH 1EJOH 1RUML 1IAOB 1U8IA 4N0FA 5D7LE 3MBED 5E7BA 2Z93A 4D9QD 2BNRE 2CIIA 3BE1H 4NZTH 4WV1C 4U6VL 1MNUL 4CJ0A 5BVPL 5F3BA 1GGBL 3ULUL 3TIDB 4P46A 1P1ZA 1FJ1B 4A2LA 4ZOEA 2CK2A 3O11A 5F1KC 2V17H 2LABA 4OZHE 5GGSY 4PJCB 5BW7C 3MA9H 1LP9E 4WEBH 4LLDB 2ARJQ 4P4RB 2CH8A 4ZFGH 3GJFH 5C0AB 4FHBD 3WXWL 4DZBA 2W0FA 4S1DC 4Y5VA 4HIIA 5T5NF 3BESR 2NX5B 1ZGLB 2NNAB 3LRSA 3WJJC 1NBYB 3O9WD 4GQPH 5FKAB 4LCWA 3T77A 4NZRL 2X9WA 4X6DF 1J10A 2DQHL 2G9HA 5L8KB 5BMFH 4DGYH 4HS8H 4IIQA 1UFUA 5EBMA 5TE7L 4NJ9L 5HHMB 4YPJA 1UH4A 5K9QI 5E9DE 3RGHA 4U0RC 2ARWA 2Y5EA 3VFGL 3B9AA 5E94A 1YDPA 1N7MH 3ARGC 3QXDB 2X4TB 2Q7YB 2LV4A 1G7PB 4K8RC 5INCB 4R26H 3BEVB 1SM3L 4JLRA 4MA3B 4L8CA 4YNYA 3QFJD 4N0RA 2V2XB 5C08E 1S8DB 5IB3A 4XI5D 2OTWA 2DTML 1D5IH 4KY1L 3TT1L 2VXSL 3ARWA 4PLKC 3RTQD 3D0VA 5L2JA 4PPTA 3QI9D 4Y19B 4OQTL 1NBVL 4MXWH 1M7DB 5E9DB 4WO4D 1ZLVK 1KTLA 3U0PA 3ARBA 3PDOA 4IHOA 4JN2B 4M5YH 2VAJA 4P5TC 5FYLD 1MVFA 1EPFA 1P4IL 4G9FE 5GGTH 5F1IB 1MLBA 4PB9L 3QUKB 2W1NA 5CINL 3QAZC 5D2LE 5AZ2H 3ARQA 1MEXH 1XF4A 5C08B 3U46B 4HAGA 2DQEL 3VXSD 5BCAA 1RMFL 2NY2D 4KPHL 3KGRA 3RUGF 4HX1B 4JM2A 4YAQA 5ISZD 3MO1A 5DR5L 4XP4L 1WWAX 2YRLA 1D7FA 4G80B 4NNXB 1T66D 3BPCA 1IAII 2EDRA 4R96B 1J18A 1KPUA 2PUQT 1BFSA 4HQQL 5J1TC 2E9JA 4K3GA 4ZAKB 4Q9RH 4JANB 1FORL 1MIEH 3D39A 3HI6H 3A0OA 3P11L 2IG2L 1ZOXA 4G9FB 2ZSVB 4MX7B 4ODUA 1P53A 4JGMA 2OS7A 5D2LB 1RIVH 4ZDHA 1MLCB 1WSST 3DX7A 1XF5B 4NN5B 2C26A 1S9KC 3DUSA 2A6IA 2VDKL 4M6AA 1FZMB 2RFXB 3ZE0E 5IVXF 1GPOL 5EOCL 3KR3L 3ARED 1TPXB 4U6YB 3QWOB 5HYIA 1CGSL 1C16B 3VXRD 2GJ6E 1IAIH 1DTUA 3MFFA 1V8HA 3IDGB 5JLZB 3DV6B 3T4YB 4Q0XH 3TYGL 5E1AB 4GQ9H 3T3MF 1V3JA 3S88H 3EDJA 1UZ8A 3OAUL 3IDXH 2Y7QA 3SGKC 3WD5L 3FTGB 4H1LA 3D18A 4E42A 4CVXB 3VFPA 1JFQL 5DJZB 3BRFA 4JR9H 4X7CC 3BKYH 4XRCA 3TNMB 1KEGH 3BPLB 3BN9C 1UCBL 3HPLB 4P4KC 2FWOA 4UNTA 3NN8B 4WI9A 4OLYH 5TE4H 4PTUB 5IEKB 4OZFH 4TNVK 4EN3B 1T1WB 4ZUVA 1QEWA 1KIQA 2DB8A 3MLYL 3ARXA 3R06B 5JHLH 4UAOB 2HN7A 3LPFA 1ZLSL 2D7QA 3JUZA 5IWLC 4W70A 5EO0A 1P4LA 2ITCB 4GBXD 4X7TB 2Z31D 3WXVH 1QQDB 1FLRH 1ZHKB 2VDMH 3G6JA 5ID0A 1SBSL 3CPLB 1S7XA 1HYSC 3CFIC 2P42B 2PTUA 4GRWF 5E6IA 4ZUWB 1KCVL 4NQSB 5IHZB 3NFNA 3DX6B 1H3WM 2NXYB 1FH5H 3FAWA 4TRPH 2PCPB 4YUEL 4OCLC 1Y18B 3LZFL 1INEL 4WW1A 1X44A 1QSEA 3IRPX 5K9KA 3X13B 2EIDA 1B6DA 1H3UA 3KG5A 1I8KA 2DL2A 4KUZL 2GHWB 4AYFA 3EOAA 4R9HA 3O2DA 5B4MD 3MRKA 5L7XH 5H2BB 5K59F 4MNQE 1Q9WA 4XAWH 4OF5A 4HW6A 2OQJA 4I2XE 2ZJSL 2I26N 1EXUB 2EIZA 4KK9C 2C4XA 1NEZA 5DXWA 3FFCE 3KXFA 4JO4H 1D3CA 4M43H 5C7XH 3CFDA 4NRZA 4YHLH 1JPST 1ZXQA 2MNUA 3GIZH 2D7TL 3REWA 4X6FB 4YHOL 1FFRA 5MEND 4Y5XB 5KSUB 3EGSA 3HZYB 2FL5A 2HVKB 5F7YC 1IQDA 3N85H 4I9WE 4M8QA 5J9PB 2Q8AL 3UTZB 2B7DT 4QHKJ 1Q9KB 4J3TA 3S98A 2JCCF 5ALCL 1KG0B 3INUL 3T0EE 4CDGC 4CMHB 4ZFFA 1X7QB 5DF0A 4I2XB 4RGNB 3NTCL 5GRJH 2AEWA 4NC1C 2XZQH 1QD0A 5KSAB 1IC1A 3F58L 2VIRA 3X12B 4LLWB 4K23H 3IB4A 4RZCA 5FDWA 2YD2A 4ZXBC 1CR9L 2VE6B 1ORSB 1QSZA 1V3LA 3L6FB 4OGXH 1TVHB 4AMKH 3L3OB 5I74B 4KI1A 1MRCL 4R2GB 2GITA 3PL6C 4O2CA 4P2RD 1YECL 2X4SA 4ZPTA 5FFLA 5J11C 4X9HA 4BZ1L 4XGZA 1WBZA 5C6WH 3OB8A 3MV9D 3T0EB 3U7YL 1DLFL 5EBWB 3U30B 4M00A 1TZGL 2E8ZA 5DQ9B 4KJYA 2FBOJ 3U82B 3MRJB 4PJ7B 4JEGB 3IDMB 3MV8A 3AY4C 3MROB 3O8XA 1H3TA 4PTTA 4NUGL 2EDYA 2GJ6D 3BZDA 1TNNA 4L4JA 3VXPA 3L3GA 3TFKD 4XMPL 3GMPA 4X6CE 5BO1H 1T2QH 3KNBA 4Y0GA 3QDJB 3OF6D 5AYUH 3ARSA 3W9DB 2R0LH 2X4QA 2JJVA 3ORJA 4LPYA 4JM2C 3WUWB 2QSCL 5LXGL 2L7JA 3MUJA 4R3SB 1JI1A 1WZMA 1FL5A 3RVUD 5IQ9B 4Y4FA 1JGDB 4N0UB 3TBYA 3D5OF 2FBJL 1MWAL 4N9GA 32C2B 5B38G 5HDQL 4PJEA 3CAFA 1C08A 4KUCF 2EH8L 2P8MA 2NY3B 4MJIA 3GJFA 1G7IA 2ZWLT 4X6CB 2VLRA 3EAKA 2Q8BL 4MNHB 5D7KD 5MEQA 2DQDL 2EDJA 3ARDA 1JUFA 2LVCA 2EEAA 2VDRH 1XF3A 4ELMF 4OCRL 1ZANL 2YR3A 2C7UA 5MEPB 2FYYB 3C6LD 4CVUA 4QWWC 3M17B 3V95A 4JFYB 3EYQD 3TVMD 1SJEB 2B39A 3BP6B 4LASL 5MEOB 4G6FD 4DKAA 4J3VA 1OT2A 1OSPL 3BVNA 2O61B 3FKUS 4D2NA 3S9DB 1OD9A 2ICCA 3RU8L 5F9OH 4IOFD 4S11A 3IFLL 4FFVC 5GSVA 4QRUA 1MCOH 1YY8B 1OP5K 1RULH 1ZT7A 1KCLA 4NO0D 1QSFD 5D5ME 4QGTA 2P5WE 1A5FH 3S37X 5JORB 1OWWA 1SJXA 5EUOA 4OLZH 5H35B 4DGVH 5L6YL 4MZ2A 1KGCD 5GGTA 3FAXA 5HGAA 4N90E 3K8LA 4PRBA 4DJMA 4Y7MA 3LEXA 3GSNL 3WYRA 1BFOB 2VUOA 3IETB 4LARH 3ROOB 5EIIB 2CKNA 1EK3A 1TZHB 2D4DA 4NKMA 4X7EC 3ULSB 4KI5D 2AKRA 5C86A 4P9HH 1ZS8A 3DIFB 3WLBA 5MERB 1D9KB 4YO0B 5FECB 2I5YL 3QH3A 2W0LA 2IH1A 4PJGE 5GRUH 5A43C 2JE8A 1SMOA 5HJ3B 4LLUA 4ZO8A 3OX8A 4JQVC 2ED8A 1ND0A 2YPVL 2EC9U 1HILB 4C54A 4CDHA 1BFTA 1BWMA 1NSNH 5E00B 5BXFA 1H3VA 3QUYB 5I2IA 3GIVA 2ZZUT 2WANA 4APQD 1DBBL 2MSPA 4O5LH 4HBQA 4QF1A 5JR1H 1AR1C 3PHOB 4GXVH 1FYHB 2XPGB 15C8H 4ORGB 1FRGH 5I18H 2Q87A 2BVOA 4NN5C 1I8MB 4PREA 1FNEB 1W72B 4KRMB 5ICYB 4BSJA 5KAQG 2V5RA 2M2DA 1IL1A 1CF8H 1QLFB 2DBLL 3MR9B 4FFZH 3DMMC 1A1OB 4F7CA 5D1XA 1KN4H 4PLOB 3ZDZF 1UT9A 4IRJD 3WNMA 2A6KA 1A14L 1RIUH 1F4XL 5IBUB 4JGJA 5SWZB 3O6LH 3H3KA 3O2VL 5F8QC 1ZLVH 5E03A 1E6JH 3BPLC 4C56B 2P8PB 2PW2B 4WI6A 4R4NC 3UP1A 3K80A 4NQCA 4Z78B 2DQTL 3ZTJH 4LPXA 3QIWD 1IGML 4UAOC 3ULVL 1RJLA 3L3IA 3QEGH 2O5YH 5KN5A 1QLEL 3LD8C 1G1YA 2H3NA 3C5ZB 5TGBB 2NY1B 4AIZB 5B8CB 4S2SA 3MUGA 3W9EB 1RI8A 1N8ZB 1U8JB 2M26A 1ADQA 1PLGL 5EUKA 3F7YA 4G9DB 1FPTH 3HE6B 3KPNB 3EYVB 5ALBL 3TO2B 1VA9A 3IDYB 5IKCA 2NXYC 5L2KB 3Q6FA 3HZVB 5KVDH 2PXYC 5H8DA 3MV7A 2IQ9H 4UINH 4CMMB 5IK3B 1UWEL 1FNGB 43CAB 1YMMA 1A0QL 2IWGA 4RMWA 3I3EA 5IVZB 3PHQA 3MRNB 1T5XB 3CFBA 3GJEA 2WIMA 1AR2A 3GSQA 4KJPD 5EOTB 4OUUA 4ETYA 4X8JB 3KWWB 5CSZB 5ANMB 5FF6B 1TVDA 3CDGA 4HEME 2OP4L 3U48A 4MB4A 3KDMB 4GSDL 2F58H 5T1LA 2DM3A 1AI1L 2IPTL 4GAJH 4K07A 4RIRB 2YZ8A 4ZTPH 3ZKXB 1ZHBA 4C83B 1U8OA 2HJKA 3MACH 3FQXA 1MCCA 4JRWA 2XA8L 2ZCLH 2X7LB 3IJSA 2KUTA 4OD1H 3SDDC 3I6LD 1CD8A 2EECA 3HZMA 5BVJA 1AXTH 2WUCL 4NZUL 3ARDC 3L3JB 1UB6A 4ZUSB 3VXOA 3VU2A 5BJTA 4JHAH 4P2QE 4CMHC 2YUZA 4NN6C 5TDOB 4RGNC 4WI3A 2IPUK 4DKEH 1RUKL 4I0KA 4ONHB 3QG6B 5HGDA 4OTXH 4GH7B 2HLFC 5DRWA 1JMXA 1A7OH 1JF5A 3HS0A 3FOLA 1U8PA 1FL6A 2MPAH 4GT7A 3GBMH 3GNML 5D7IA 1T20A 5DT1H 1CGXA 3QDGD 1OPGL 1DBAH 5I74C 1C5CL 5FKPB 1S7RB 3OAYK 5D1QA 4PP2B 1QFOA 3U0TB 4G8GE 4WUUD 1S3KL 3RNKA 1HEZA 3UTTB 5IMKB 1BQLH 1PKQA 1S5HB 4RFEA 3SDAA 5JQ6L 1AC6A 1MRFH 5DD1L 3SJVE 4A2MA 3PGDB 4BFIB 5T5NG 4H8WC 4PJ5A 3BMWA 3MJ9L 3S3SA 7FABH 3OB0K 3LMJL 4HD9A 4N0YL 4LGSB 2R2HB 4XP9H 1IC5H 4FFYL 4GG6E 1R3HB 1AGBB 3ZYOA 3OJDB 3ZE2E 1Q72H 3DV4B 1LO0H 4KTEL 3S37L 1VGEL 3BH9A 1NFIB 2YSSA 3LN4B 1QHPA 4PJDE 2IANE 4NRYA 2VITB 3HAEG 5DJ6B 5C09E 5EIQA 3ULUE 2PW1B 3KPOB 3OKNA 4G8GB 4KHTL 4TSBL 3LKPA 3R8QA 3SJVB 5FO9B 3IXAA 3QHFH 5T5FL 3RX5A 5KS9E 4MD5A 4HUUA 3ZSTA 3SE9L 5C2UB 3HCVB 1M6OA 1KJ2H 3N1GC 3PIQB 1IEAA 1A3QA 3UPRA 3IFPB 3CXHJ 3HNSL 5DRNB 1I1AA 1HWHB 1TENA 1K4DA 3Q3GA 4JZJB 2BRRH 5ESVB 4YHKH 1I8LC 3O45B 5L88H 2XQBL 5FCUL 2DQUH 5BS0E 3VE0B 2Q1EA 2DM2A 4L4VE 3QO1B 4QNPE 4WU5A 1PG7H 3FO0L 1L7TH 4IS6A 2DIJA 1RVFH 2GYSA 5C09B 1A2YA 4WFHE 1JJUA 3LKNA 4ZUTA 4LEXH 5DA0B 4OGAC 3O6FD 3IAGC 2A6JA 4FQQA 3ZO0A 3QFDA 5HHXL 1EZVX 4I1NB 2QL1A 5DSCA 4F15C 2DKMA 3QULB 1U3HB 3H8NA 4IOSD 3VWKD 1CVRA 4YK4B 1LNUA 3IFOA 2A0LC 1LK3L 5F7EH 4LIQH 3RWEB 1KXQE 1MCDA 1AHWB 3OTTA 4HCRA 4U3HA 5DZOA 4KVNH 4B41A 1U91A 2MHAA 4G3YL 5A2FA 1WCBB 5E99L 2IALB 2F9BT 1GHFL 1W0VB 3BIBX 5DTFA 2VSDA 4N5ED 4ZTOH 3EYOB 3PQYE 5EPMA 3MZTA 4TNWK 4JREC 4HLJA 4BM7A 2R8SH 3VFMA 3KPLA 5ID1B 4JG1H 5I30H 5FO8B 1VDGA 4BH7B 3SDXB 3OV6A 3QEUA 4GO6B 1IGTB 3W0WA 1CLZH 1M4KA 1TJHH 3QIBD 3IKCB 5FYLH 3U83A 3MLRL 5AUMB 2CDFB 4DW2H 1WQVT 4HUWA 1FLTX 1WVZA 1TETH 1NCWH 2JELH 1CFQB 4XNYH 3OJMB 2EYTA 4M1CC 3UC0L 4KHXH 4Y2DB 2QHRL 1O7VA 4MQSB 2W92A 1QR1B 3FRUB 1JBJA 5IMLA 2CLRB 1KENH 5C0EB 4AEEA 1T2XA 1XGQA 3AAZA 4PGBA 1IEHA 2BC4A 4QHNB 1T5WA 1E27A 1GAFL 4TULL 1KEMH 5I19H 1F02I 1HSBA 4MXVF 1VESA 1DVFD 3Q5TA 4GAYA 4FQJL 3V6ZB 3VD7A 4WJ5B 3WFEL 5A1AA 1DQQB 3JXAA 2F8VA 2CDEA 4F58H 1NAKL 1QBMH 2F19L 4DAGH 1BOYA 4NQUA 4JO1H 4OZ4B 4PJBF 1FVDA 5DJDB 2MOVA 1RZFH 2BOBB 1WCQA 4HS6B 4RGOL 3ARYA 7CGTA 4PUBH 3B3IA 1S9XA 4X5XB 2NTFA 3DI3B 4BZYA 5L9DH 2R1YA 3WSQH 5GPRA 3RX8A 4PJHE 4AENB 5DRZA 3SY0A 2ATPB 3GHBL 2K7PA 5IMOB 4M9PA 1EV2E 4LLYB 5E2UH 3BIAX 1OP5H 5JO5B 4GFTB 5TDNA 3GBLA 2P8LA 1MH5A 5FO7A 1ZSDA 4OLVH 4M61B 4HIEA 3A6BL 3V4VL 3B9KA 1TDQA 1X3DA 3TT3H 5FV2A 5I1LA 4DN4H 2BSRA 3QB7C 4GJTB 2NY4B 4L3AA 1CFSA 5ENWB 5DMJB 4M93B 1HQRA 1FG2A 3AVEA 5D96C 3VRIA 4PJHB 1D6EB 3SE3C 5FM5O 3O3DB 2ILLA 1NDMA 4PLJD 4NQVA 2A38A 4U7SA 2DQJH 4JO2H 4LRNH 4X7SL 3OPZL 2RCSH 4OCNC 3BAEH 2FO4A 5B8CC 4XP5H 1XR9B 4Q6IA 1XGRB 4PJ8A 3C09C 4YZFF 1BGXL 4M1DL 2D03H 4P5KB 4YC2C 4BH8A 1YJDL 3BD4A 4S1QH 4YHNA 1FBIL 3AM8A 1EA9C 5ICXB 4BZ2L 1FVCA 5JOPD 4KTDL 3FQNB 3RWCA 1T03L 2JB5L 4K71B 3A6OA 3U36A 3MBXL 4WW2C 3G08B 3PWPE 2AJYH 5KSBA 2VRAA 1CGYA 2DQFA 4MB3A 3AROA 5M95B 2GK0B 4MDJA 4ERSL 4R0LA 3BPNC 1KCSL 4F80A 1D6VH 1MFDL 1LO5A 4E0RB 1UQSB 2DLFH 5A16B 35C8H 1F90H 1CE1L 5DVMA 4HKBB 3MGOB 2WBKA 5IFJA 1KN2H 4L9LB 3BXNA 3ZL4L 5IM7B 2W91A 3OG4B 3C60A 3PQYD 1DSFL 4LL9A 1U41A 3JWDL 3QCUL 2FEDD 2NR6D 4D9RD 3O9WB 4MD0A 3U7AA 1DEEB 4GAGH 3KJ6L 3LKRA 5T3ZL 2N7AA 1T3FA 2LE9A 5IROC 2VMFA 3GSXB 2QJDA 5I1JL 1D5ZA 4Z77B 1E4WL 2ZSWB 1DL7H 3LQAH 1C1EL 1LEKA 5GIRA 3VJ6A 2WZPD 2CGRH 4PG2A 1TTUA 2ZUXA 1LK2B 4XH2B 4CNIA 3QFJB 3VFWB 3UDWA 4KK8D 5EULV 4MSWA 3G6AA 1QFUH 1DE4A 5C70A 3BDXA 4NO3A 1I3GL 3TBWA 3R8BB 1R5IA 1NCNA 3MRMB 3BZFA 4ZFOA 1SEBA 3MXVL 1PQZB 3H3PL 4NQEA 1DQJA 4JM2F 5GSRA 3BIKB 5D7SL 3THMH 3VCLB 4Y4HC 1N3NB 4IM8A 1IE5A 4PRNB 1UXSB 1XH3A 2R56L 3QJFB 4JFDE 4JG0L 1Z9SA 2DYPB 3U9UA 2ARJB 5EBLB 3DRQA 4FTVA 5IT2H 1A02N 2L4OA 4DVRH 3MLUH 1QO3A 1N59B 2W65A 5F96L 4MA7H 5C92A 2P48B 3PGFH 4L1HA 5I8KL 3QP3A 1XGPA 4X4YB 3WKNA 2NY2B 4PGZA 3DI2B 1A6VL 4Y1AA 3OWEA 1AXIB 5CEZL 4N9OB 1T83C 3KLAB 3OQ3B 4Q58C 4D8PA 3GO1L 4RMTA 1NUNB 4AH2A 3GMLA 1CDBA 4P9HC 2R9HD 2IADA 3LDBB 4PGEA 2BCKA 1BJ8A 1WFUA 5HI3C 5CIPB 1KTDA 3NCCB 3WEXA 5FYKL 1Z0MA 4IMKA 4JFDB 3MXWH 3CSBA 1H5BA 4HJGA 5I1KH 2V9QA 3WIFA 1HH9A 5KVFL 2H1PL 5C6PB 4HGMA 1KJ2A 3VFRA 2CRMA 3U4AA 3OJ2C 3CCHA 3EOTL 4YWGL 1J8HA 1F4YH 1IVLA 3DYOA 3H9SD 3GSVB 3PWVB 4QOKD 1A4JB 1EMTH 1R3LB 2AK4E 2DS4A 3N9GH 3KYMA 3VXRB 1DUYB 4YQXH 4GUPA 5E5MB 1RD6A 1MCQA 4M7KH 4WTXA 1J05B 1QRKA 3O6KL 3BDBA 1FYTA 3QSKB 2O5XL 3IXTA 1NEUA 2K1MA 4I3RH 5FA4B 5A2KH 3VFOB 5GS0L 1UEMA 5C0CE 1J0HA 2Q6WA 3RVVD 4G8FA 2HKFH 3KPPB 4YXLL 5LBSH 3VH8G 1S9VA 3RNQB 1KELL 2FX7L 1I1CA 5CGYC 1ITBB 2R1WB 5CBEA 4EI5B 2JJTA 1B2WL 3HE7C 1A7QL 3OAYH 3HLAA 4XXDA 2OSLA 3FRPA 1GRWA 3STZB 1TJIH 4Z7VA 5C0FB 5JIKA 3WO3B 2AK4B 1KULA 2BY3A 2QQKL 4MQ7B 4JN1L 3I3DA 1X5LA 3OB0H 4POZD 2V9RA 4MXQC 1BOGA 2G5BB 4N68A 4UQ2A 2G60L 4OF6A 4MAYB 4MNGE 1UA6L 1VB9A 1JGVL 1MJ8L 2YD6A 4Z7OF 4KMTH 3MRLA 2UWEA 3B6SA 3GSOA 1G0DA 3VD9A 3AU1A 1J5OL 5F6IB 4AY0A 2CMRH 2DI8A 2CSPA 4P99A 3ROLA 3ZZ1A 3FHAA 4EIGB 4YGVB 2C3VB 5BV7H 1XCTA 1UKQA 2UYLB 3P30L 3K7UA 1AY1L 2VLKA 1BQHG 4DQOL 1JHTA 3EJJX 3NIDE 1ODAA 1HE7A 3EYFB 3EDDA 2HG5B 3VFSB 1G9NL 4X7DC 5E8EB 2Y06H 1P4BH 3UTQB 3WS3A 4G7VL 3QO0B 1KLUB 4L4TD 4Q6IC 4UIKH 5D2NB 2AXGB 4Y2DC 2QQNH 4KKCD 2JK5B 1NCBL 3AM8C 4FP8H 3WFCH 4Z7UA 5D8JH 4RWHA 1UGNA 3GSNB 4KUCD 2XTJD 1MF2H 1S7UB 3RWIB 1Q9OB 2X1WL 3MRFB 4PRPA 3KYAA 1UWXK 4IRZH 3KYNA 3DBXB 5D1ZB 4JZNB 2B2XL 4HXBL 5I6XC 1V7ML 1RJYA 3MODH 1AO7A 2YPLB 3QDMD 4HKZA 3N1MC 4LSSH 3FFDB 5GGVH 3MUZ1 1CICC 2H2SC 4XPFH 5TFSH 1KYOJ 2YC1A 1U8LB 3FB7A 4LBEB 4DTGL 2Y07L 3D1MC 1IAOA 5CP3H 5CJXA 3V5DB 3FQTB 5FUZH 4LK4A 4C55A 2KBGA 4LRIC 1DQLL 4BQ6A 3TIDA 4XHJD 4HFUH 1FJ1A 4F9LA 1ZHNB 5DEFB 1U2HA 1WLHA 3OMZA 2XRAL 4PJCA 4JFQA 1CXKA 1NGXA 2CUHA 2XNAB 2ZCHL 4LLDA 4U2ZA 1LMKA 4JFEA 2YBRA 5LQBH 5HHOE 3MRQA 4NOBA 4Z7QF 3HA0A 2ZCKL 1ZGLA 3ULVE 3EJZD 1EGJL 3CH1B 4N8VB 5FKAA 1NC4A 3WFHB 1JV5B 3RVWC 3CFCH 3MV9B 1FSKB 2WP3T 5D7LA 3VFNB 2BNRA 2V6HA 3B9DA 1G7JB 5FIEA 2AV1B 5C3LD 4RMSA 1MQ8A 2Q7YA 4JPWH 4PJAB 5J0BA 3DYPA 2KL6A 1G7PA 5F6HI 3PUCA 4FXGB 3SBWC 1CL7L 3VDBA 1I7UB 1LEGA 4JPKL 4OZHA 4M48H 3FQWB 1LP9A 3BEVA 4PRHB 4MA3A 4Z8FH 1DQDL 4AJ0A 1OCWL 3UYOD 2V2XA 5HHOB 3NPSB 1S7TB 4PJEF 3TPUB 1R5VB 2SEBA 5B3NA 4Z5RA 2VLMD 4Y19A 4PJFE 2GIYA 1M7DA 5E9DA 4LHJB 4KDTA 4M6NL 4XC1L 2NZIA 4EXKA 4JN2A 3TEUA 4ODTH 4IMKC 1MFAL 1Q1JH 3LH2H 1HHKB 3WNOA 3MBEC 3T0AA 4FRWA 2H9GB 3NFSH 5C08A 1JMZA 3MLVL 4IDJH 4JVPA 3SKNB 2MMXA 4B7LA 5GRVL 1NMCB 3T09A 3Q0HA 1UENA 3RWGA 3MC0A 1NQBA 3WS6A 2OXHA 4U2YA 5F97E 3VGBA 2NW3B 1UM6L 4Q9QL 1Z3GL 5ETUA 4PJFB 1TQCB 1T2JA 1B0GA 5K9JL 2BSTB 4R96A 4X6BB 3O9WC 2ZPKH 4NWUH 4ZAKA 1T1ZB 3P9WB 4JANA 5ABDE 2OK0L 3BPOC 2P5EE 3AFLA 4J6RL 4G9FA 2ZSVA 5FB8B 1NUFA 2UZIH 5E2JA 5D2LA 5EUOF 1FIGL 1MLCA 1SQ2N 4Q2ZA 4YXKL 4UQ3B 1XF5A 1XMWA 1A1MB 5CKAA 4K3EH 5IFHL 4JFPB 4E41B 1ETZB 1FZMA 4XCNB 3NZ8B 4IJ3B 2JJTC 3QWOA 4U6YA 3K2MC 1C16A 1FFOA 4JDTH 1GC1H 4M62L 4LSVL 2AJSH 5ESQB 4Z7NE 3IDGA 4NO2B 3T4YA 5BQ7A 4QKXB 4XI5C 5E1AA 1DQMH 1QSFB 3UBXG 3GMRB 1Z6JT 2FECI 5JXAL 2E3VA 4PRAB 3RTQC 2P5EB 3O41A 4LFHG 2KH2B 5KTEL 3FTGA 3V5HB 4BFBD 5IF0B 4CVXA 3HMWH 3QI9C 3LEVL 5DJZA 4OJFH 2NXZD 3D3VE 3HPLA 4WO4C 2O5ZH 1A9BB 4NHCH 3LRGA 4RX4D 5AEAA 2D0HA 2VDPH 5J8OA 1CGTA 2J7LA 1F2QA 3BYTA 3ARFD 5EWIH 3S4SG 3CC5B 5F9DC 4KAQL 3R06A 3T65B 2B5IB 4N0CD 5JOEA 1BVLA 3KHOA 3HFMH 2DLEA 2XZCL 2FDBP 2NY2C 3LVEA 4X7TA 1QQDA 4D3CH 3RI5K 4GKNA 2X1QA 5EA0H 4JFFE 3WIIL 4E9LA 1MHCB 1PY9A 3IKKA 4JRYE 4ZUWA 4NQSA 3RX7A 5IHZA 3DX6A 1T66C 4JPIB 5DDHB 1Y18A 1IGJB 4Z7WB 5IG7B 4X80H 3BP7B 1QBLL 4APQB 3DGGA 3BGMB 5D6DC 1DZBA 1FL3B 3I2CH 5KG9A 3TH2T 4EDXB 4ODSH 2APVA 2X4UB 5BOZG 1G6RL 4PBVC 1W0WB 3TCLB 2YD5A 2AJVL 5DMGD 4V1DD 1T1YB 3AREC 2YEZA 5H2BA 1CDUA 5HTSA 1HIML 1IQWH 4FZEH 3RA7H 1VERA 3P4MA 5DRXA 3ZTNH 5I1HL 5EU6E 4FXLA 5DD5L 4KRLB 4M8VA 1UACH 4NBXB 1EXUA 4YLQT 4YEEA 3UZEA 1EDQA 4JRXB 4FQHB 3TZVD 3WHXB 4OM1L 3JWOH 3L9RB 3Q6GH 4Y5XA 3HZYA 1NAMH 2AEQL 2HVKA 2HA1A 4NUJB 4HUVA 3T04D 5J9PA 3QIUA 2I9LB 2PO6A 1JNLH 2EYRB 1N6UA 2FEEL 4OZGF 3UTZA 4BK4A 1Q9KA 2A9NL 4F8TA 2BVUA 1J1OH 2AJUL 4U1JB 1EFXA 2APWA 2VDQL 4U1MB 5C0DA 1EO7A 3MJ8A 4GAFB 4G43B 4MNQA 5LCVL 1X7QA 4I2XA 4P2OB 3SGEI 4I5BB 1QFPA 3FFCA 4GBXC 4M03A 2Z31C 4ZOCA 3PE9A 3WJLA 5EU5B 4IBLT 5I9QC 3S97C 4TOYL 3BKCL 3E8UL 4S1DD 3X12A 4LLWA 1YNKL 1RUQH 2A73A 4N5UA 1FNSH 5IMMB 2VE6A 3TN0B 2BVQB 3L6FA 3PV6B 3L3OA 5SWSD 5I17B 1OARL 1LE9B 3FT4A 4WWKD 2YKLH 4LPTA 1F8TH 2P47B 5TF1L 2DKUA 5D6CB 3QHZH 1BD2D 4FQIH 3DURB 5C8JB 4MS8D 3T0EA 1P2CB 1UJTA 5CZVH 3SGEH 3WNKA 5SV3A 1IILE 3WDJA 2CRIA 4R7DB 4DFIA 5DQ9A 5D2NC 2DIAA 3HG1B 2QQLL 3T0WA 4BUGA 1FO0H 5B4MC 3WDIA 2XACC 4LFHD 4O9HH 3FCTB 3IDMA 2FX8L 1YEHH 3UEZA 4HMCA 3MROA 1I9IH 1JNNH 2HT2D 4HT1L 5ITFB 4YBHA 3HRZB 2J88L 4KVCH 1BECA 4I3SL 3H6JA 5DK2B 4QCIB 3GUTB 4GRLB 1NJ9B 4CN1A 4PJXB 3QDJA 3GK8H 1SY6L 3RGVD 4LLVB 4LLQA 3W9DA 3I50L 4R3SA 3S3JA 3L5JA 5IQ9A 4YHZL 5D7IF 5CP3A 1INQA 2I07B 3VI4F 4NBYB 3DYMA 4LF3B 5DYOA 5TQ0H 2AEPH 4NRXB 2PF6A 1PFCA 3TJEL 4LHUB 4P23D 2AI0L 5B38A 3GRWL 4X6CA 5I1EH 3G5ZA 1RUMH 4FMKA 4OM0H 3FOMB 4JFFD 5F9WB 3WUZA 2ESVD 3DX9A 2ZKHH 3BEWB 5MEPA 1XIWA 1RZ7H 4WW2F 5GS1B 4WUUB 1EHNA 3SDCD 1X5JA 4JFYA 5C0IA 1ZLUK 5FGBC 2J4WL 5ERWB 3UCRA 3LB6C 3BP6A 5HDBE 1WIPA 4WEUD 2C1OB 3OGOE 4OFYA 5MEOA 1LEIA 2B4CC 5E8NB 4P2CG 1QFWH 2O61A 5DI8B 5JTWA 3QUXD 4ZFZB 4XMLH 3QQNA 3OBAA 3P77A 1P7HL 2J8UB 3H42H 1I8IB 3H0TB 3FMGL 4Y88A 1UWXH 3TFKC 5JORA 3PWJA 1SM3H 2YZ1A 5H35A 2GJZB 3D39E 3UZQA 4UIMB 5FYJD 3RVUC 1HXYB 3GMQB 4OUOA 4KROD 4LSPL 4XBGA 3TT1H 1L9MA 3V0WH 1BFOA 1MAKA 3IETA 4QRSA 3OZ9L 4R97C 5EIIA 2XQYG 3HB3D 3F6IA 5D71H 3ULSA 4OQTH 1NBVH 3DIFA 4XVSL 4OCSH 3D48R 5T3ZE 5MERA 1D9KA 4MVBD 4YO0A 5FECA 4PRID 1J86A 4RFOL 3RZCA 5D5MA 1NMCC 2P5WA 3TBVB 5EU4A 4OD3L 1A6ZB 3LEYH 5CINH 3TIEB 5HJ3A 1EUUA 5IGXH 1HILA 2DQEH 1RMFH 4KPHH 5BRZE 1MI5D 3K81A 1YQVL 2BNUB 3VWKB 4ZQKB 4M5ZH 3QUYA 1HHJA 3C6LC 1OQXA 1T6WA 4DCQA 4OCXH 5FGRA 1LE5B 3EYQC 4N1HB 3PHOA 3M1BA 5EDXA 4XP4H 3TVMC 3DXAE 4UILH 3TA3A 3P40A 4QHUA 1R3KA 1XZ0A 2X4OA 3O3AB 1UM4H 1IC7L 3ETBF 1FNEA 2VABB 1Y0LB 1IGCH 4HQQH 4GRWH 4PJGA 5ICYA 3P11H 4IJ3C 2IG2H 1SYVA 4H1LG 3NCFB 3QIUC 1QLFA 4TUKH 1BZ9B 2PYEE 4IOFC 4I13B 1A1OA 1B3JA 2Z0BA 1KLGB 3DVIA 2VDKH 1CWVA 1E4JA 5C07E 4B5EA 4AIOA 4P46D 5IHUL 1GPOH 2QLVB 3KR3H 1KF9B 3QIBB 3P4NB 2DMKA 4XVJH 1H3GA 2VWEE 5IVOA 4K8RL 4F7PB 5CEZE 2E5EA 4HK0A 3DXAB 3M8OL 1MFEH 5SWZA 2B8OT 3VMPA 3TYGH 1RURH 1N2RB 3RP1A 4HEPG 4K94H 4H20L 3Q5YA 3OAUH 5HDLA 4LCWD 5FYKE 1H8OA 3BP5B 2Q86B 4OI8A 1JFQH 1UM5L 4KI5C 4QXTA 3F62A 1QNZL 1BREA 1T7VA 2GFBB 1BZQK 2WINA 1IAKA 3N1PC 1DVFB 1VKXA 1OAQL 4AIZA 1OAZL 2X4RB 4N8CH 4YDKL 3W9EA 3VRJB 1N8ZA 1U8JA 3N1QC 2MCPL 1M7IA 1EBPA 3BP4B 5HGBA 4G9DA 4NP4L 3HE6A 1ZLSH 3F7RA 4H25A 5IVNA 5JMOC 1GL4B 3RBGA 5L2KA 2R23B 4XPTL 2X70A 3KPTA 2HTLC 3KS0H 3SKUD 3HZVA 4AEHL 1SBSH 2OL3H 4WCYH 4APQC 4D0CB 1DBKH 3N50A 2OZ4L 3CVHL 4KDWA 2IEPA 1RPQA 5IK3A 4R4BB 4AG4H 1VFOA 2BJML 2DKSA 4H0GA 2ORBH 1N64L 1NEZG 4GS7B 3STLA 1RSFA 3ARBD 1XR8B 3HAEB 3VXNB 2EDBA 5EOTA 1REIA 3RPKA 4X8JA 3U4BL 1PAMA 3KWWA 1BPVA 5CSZA 5FF6A 4YDVB 4W6XB 1HKLL 1F3DH 3KDMA 5TQ2L 3HI1B 3A67L 1V7NL 4KUZH 2CDGB 3VXUE 4IRJC 4JM2D 1NAMA 3ES6B 4C83A 5D4QA 1XGUB 4MGXA 1CG9B 5I1DA 5MP6H 1YEDB 3ECBB 2X7LA 2ZJSH 4E5XB 4NZJA 2D31A 3NOIA 4FQCH 3ZDXF 3L3JA 1H3XA 4D0BB 5C0ND 8CGTA 3NFPB 3P9MB 3SE4C 1HQ4B 3D39D 2D7TH 1HZHH 4HWZB 5CP7B 4YHOH 3QIWC 4GRMB 2DQGH 1XIWC 4OKDA 3WFBH 5DHVH 1SEQL 2RB8A 4R6UA 4RRPA 4RGMB 5IVXE 4JHWL 2N56A 4ONHA 5DC4B 1OGAE 5IB4B 4EEEA 2FATH 1MCSA 2HH0L 3VXUB 1MUJA 3ARZA 3KLSA 1INDL 5C6TL 2D7OA 3L1OL 1ONQB 1ES0B 3OXSA 4XPAH 2X5PA 3CJJA 3BKJL 1OSZA 5FKPA 1AGDB 4PP2A 3F58H 3U0TA 4UV4H 3PP4L 1P5UA 1S5HA 4IRSB 5C0JB 5I8CA 1OAYH 3PGDA 1RJZB 4P2QA 2PYFB 4WTWA 3ZT7A 5ECJE 1YMHB 2A83B 5IVXB 4HWBL 1JN6B 4HC1A 1MRCH 3EOBB 3LHPH 4QHLA 4H5SA 5I1CH 1YECH 1R3HA 1DN0A 2X4NB 3EO9H 1AGBA 5FM8A 4WU7B 3V7AG 4XC3L 4KJPC 3VXQA 5T1DH 5LWYH 2D4FA 3DV4A 1DLFH 4LNRB 5IB1A 1NFIA 5CHNA 2YK1L 1TZGH 4ELKB 2PYED 4F9PC 4LPCA 3OG6B 2FR4A 3HR5B 5DJ6A 1AGEA 2PW1A 3KPOA 4G8GA 3O2WL 5C07D 4LAQL 5DJ0B 2VOTA 4WFGD 3DVGB 4XPHH 5E6ID 3SJVA 5FO9A 3SE8L 4AM0B 2P45B 2R1XA 2W60A 3HCVA 3UJTL 3PIQA 2R29H 2YD4A 3IFPA 1QSED 2P7TB 3DVFA 5BZDB 2P1YA 4X8XA 3MNZB 4G7YL 2EDHA 3QJHB 4HG4K 5LXGH 5ESVA 3GSRB 1N0XH 1EEZB 1CN4A 2XKNB 4ZS6D 3VE0A 1T89C 2YD8A 3QO1A 4PJDA 2IANA 5IESH 2F15A 1DUZA 1MWAH 5C09A 4L8SA 4LQ1A 3I3BA 3MLXH 1AH1A 5HDQH 2QR0A 3D69A 4U6XA 3IAPA 5HI4D 1ZVHA 1IEBA 3KXFD 2EH8H 3QULA 1U3HA 3HUJE 4HWNA 1M71B 1QPPA 1YYMH 2Q8BH 3RDTB 1LDSA 3P73A 1SYSA 3K1DA 1AHWA 3L5HA 4FN0A 1U92B 3HMXH 4OCRH 5BS0A 5K9QG 4MDIB 5KANI 4JB9L 1WCBA 4L4VA 3C8HA 3MRBA 3QRGL 3T3PE 3U9PL 3EYOA 3CUPB 4TUOB 1QA9B 1H3PH 4AEFA 5CD5D 2DM7A 4PYHA 5IB2A 3HNVL 2FB4H 1YC7A 1OSPH 1I7RA 2D0GA 3NGBC 3SDXA 4BH7A 5M94B 2LU7A 1G7MB 2G2RB 2HLAA 4F8QA 1MREH 3RWFB 3IKCA 1D5MA 6FABH 5AUMA 1CFTB 4KRNA 2CDFA 3LOWA 4M1GL 1WISA 3IFLH 4P3DA 4HIJA 1CFQA 3W82A 3LN9A 2JCCB 3MNWB 4OQTA 2IGFL 4IOIB 3FRUA 1QR1A 1RJCA 2CLRA 1BM3L 1QRNE 1K8DA 3PQYA 5C0EA 5L6YH 4JFZL 2EEBA 2HFGL 3LAFA 3MLZH 4Z7VF 4QHNA 5E8OB 1GGIL 3DROB 5EZIH 2BVEA 2EE6A 3BWAB 4LNVA 1S7WA 4UU9B 3P4OB 1VHPA 3DTXB 3GKWL 3V6ZA 3VA6A 4WJ5A 1Z2KA 3MV8D 3IS0X 1DQQA 2UWEF 2WQ8A 3FO2B 3O6FC 3O8XD 3C08L 3S35X 2I5YH 1UJ3B 5DJDA 1DBJL 1YUHA 3ZLQC 2BOBA 3VWKC 1HINL 4HS6A 1F58H 4LVNC 5DJAB 1ZLUH 4DN3L 5I73C 3QCVL 4MD4B 1VEMA 2X2YA 3K3QA 1IAMA 2OM5A 4OLXH 4S0TD 1GOFA 2IC2A 2V7HB 3VWJB 4JFXB 1AD0B 1B0WA 2F54E 5HHNB 1NGZB 4Y4FD 5EORH 3WIHH 5KBNC 2ADFL 4N5EC 4C4KT 2GSGB 3BW9B 2FJGB 4UTAL 4QXUL 5IMOA 3UTSB 2FD6L 2JTDA 4HKJB 4UUJB 5HHVL 2XQYK 3MGAA 4Z7UF 1EBAA 4HIXL 5GGUB 4MJID 3V7MA 2CKBB 1E4XH 2VLRD 3QIBC 3EZ8A 4M61A 2DBLH 2Q3ZA 3DUUB 5HYJE 1MIML 3BT2L 2HKHL 5ENWA 2I60H 3FL7A 4L4TB 1J11A 2Y36L 4AEIH 4LOUD 4WHTB 2F54B 1PSKH 3FT2A 4PJHA 1YMME 5IEHB 12E8L 5FDYA 4BK5A 3EFFA 3KJ4B 3O2VH 5F7DA 1DEDA 3OKDA 2XOTA 3FHQA 1VFAB 5CBAB 2IMMA 2VR5A 3GI9L 5LAXB 5B3JF 2EDOA 1BF8A 1DVFC 2BHUA 5B21A 5JW3L 4PYGA 1X5FA 4XTRD 2R0WL 5J13C 4M7LL 1XGRA 4ELMB 2Z91A 3Q5OA 3ULVH 4I18A 4CVZB 5SWQB 4P5KA 4PJCF 4NM8L 1MJJB 3VD4A 3OKKA 3QDMB 5ICXA 1Z9MA 3AB0B 3LN5B 4KQ4L 2IFGA 1PLGH 1KSRA 4U6TA 5ALBH 2E9WA 4UT6H 3PNWB 5C0BE 1UQSA 4GS7C 5I16A 4X6EA 2VXVL 1RK1B 3LS5L 2ZUQC 1G6RB 1BEYH 3FT3A 4AT6B 1ED3B 4BQCA 4L9LA 1TZIB 1CLCA 1P84K 4TPRH 3V5KA 3GI8L 4OZHF 5IM7A 3V52L 4WTZA 3RPIB 1QLRA 2OXGA 1LP9F 3DECA 1L7IL 1CXFA 1CLYL 3JSSA 3FONB 3IRZA 4GLRI 5GISL 1DEEA 5DQJB 3PWPA 2OP4H 1NKRA 1C5DB 3GSXA 4Y4KA 2Y6SD 2IPTH 3SO3C 4R4FL 3TLRA 1NGPL 4Y16B 2ZSWA 4Z77A 1PEZA 3CLEL 5GJTL 2UZYB 5GS3A 1TFHA 4JKKA 3V4UH 2UVEA 1AKJB 4G42B 3UBXI 2WBJB 4PLJC 1LK2A 3VH8B 2BVPB 1RFDH 1VCAA 4XH2A 2AS5M 4RGMC 1KB5H 4NZUH 4TVPL 1D5BB 5FUOL 5DO2D 2VTFA 3JVGA 1A7RL 3AXLB 4KZEH 2VXTL 1TCMA 2HWZH 4X99B 1KIRB 3DARA 4QRRE 2HFFB 1Q38A 3KVQA 2NY6B 4NM4L 2ICWJ 5ILTL 4KC3B 1N3NA 4FMFA 5D1XD 4PRNA 1UXSA 3SDYH 5IV2B 2VSCA 3QJFA 2DYPA 3L3DB 1WJ3A 5EBLA 4DKFL 4XVTH 3QUMB 1N59A 4HZLA 3CNKA 2AVGA 1OPGH 1N5AA 3VFTB 2WLZA 5E8PB 4X4YA 2FSEB 1CFNB 5D2LF 4NQCD 2EDDA 3WV0A 1MQKL 1S3KH 4NOFA 5CILL 5F7UA 1A6AA 3V6OE 3KLAA 4NDMB 1AQDB 1BQHB 3B5GA 4GXUN 4PJ9B 3JV6B 4N0YH 4Q9BA 3TNNB 5CIPA 5EFIA 1U95B 1YN6A 4JFDA 1LO2L 2HJLA 4JZOB 2FEDC 2NR6C 1HNGA 4JJHA 1F4WL 3O4LE 4KTEH 3SCMB 4JQIL 5SX4I 2IAMB 5KW9L 2CRZA 2X05A 3V8CA 1M05B 4NZTL 4XXCA 2JJWA 5HYJD 1BAFH 1UG9A 3GSVA 3JZ7A 3PWVA 1KXVC 4KHTH 4NIKB 4NO5B 3MV7D 1ZTXL 2E6PA 5T5FH 3ZE0F 1CU4H 1FHGA 2AEIT 3MA9L 1AP2B 2YHGA 5E5MA 3SE9H 2CK0L 1YMMD 1MWAA 1OB1A 4MJ5B 4KK8C 3L7FB 3OR6B 4RFNC 1JK8B 5IBTH 4X4ME 5E95B 4WI2A 2ADGA 3CFKB 3HNSH 4LLMB 4ODBD 3S35L 5FA4A 3ZHDA 3NACH 1MHPL 1KJ3H 4L3EE 2EKSB 3KPPA 5FCUH 4KRPB 5BMFL 3RNQA 5T1LD 1HXMB 1V3MA 2R1WA 4EI5A 1OGTA 4PGCB 2ADIA 4LQFL 1N7ML 3FO0H 5TDPB 3BSZH 4JJ5B 5KVEL 2WIIB 2J1KA 3BMVA 3HMXA 2YMXL 5C1MB 5C0FA 4WUKL 2AK4A 4NQXB 5HYQB 5JUEL 4R26L 1RZKH 5HHXH 2EXWD 2H32B 4JFOB 4K94C 3E3QE 4MAYA 4OIBA 1VPOL 4H88H 1A7NH 2BVYA 1NCUA 4ORZC 1D5IL 1RZJC 4FQXA 5DVOA 3GJFK 3TP4A 1FNAA 1LK3H 1LQSR 5C0CA 1I9RH 2R9HC 1KIUA 4H8WL 2JJUA 4MXWL 4B53A 3RY4A 5E99H 4YGVA 1GHFH 2YXFA 5FYJH 5B39A 5FA3A 4PR5B 4M5YL 5J6HB 2UYLA 2GT9A 5E2WL 2ED7A 2DBJA 1CDIA 2AXFB 1YQ2A 3QDHA 3UTQA 4Z0BH 5F93C 1CDJA 5AZ2L 1KLUA 1MEXL 3P2TA 3C6SA 5F70A 4MNGA 2AXGA 5T1KA 5D1QD 1HHHB 4F57H 3LSOB 4GOSA 3MLRH 3SDAD 1F6AA 4V1DB 1CCZA 4PJ5D 4KKBD 1J0ZA 3GSNA 3AS1A 1K4CA 4V2CB 3TBSA 3C2AH 1OLZA 4K3DH 4CGTA 2WUBL 2BXZA 2XKUA 1JVKA 1P9MC 4LCYB 2F53E 2KQNA 3MRFA 4JY4A 1FNLA 4LCCA 5GGVY 3TZVB 2AJXH 4OKVB 3I9GH 4HHAA 3HI6L 2C5DC 2ICES 5D1ZA 4JZNA 1MJUH 3RVVC 4YHMH 1GAFH 2VL5B 4TULH 4G8IA 2HJFB 4WI4A 1K3ZA 4QRRD 1JF1A 1UKTA 2QTEA 1F5WA 4WV1B 2HRLA 3WFEH 1U8LA 2DIBA 4LBEA 1R0AL 2VC2H 1NAKH 1UB5B 2F19H 3JTTA 4JKPH 3V5DA 3NIFF 4P9ML 3S34L 3ZYIA 5HVGB 5ACZA 5HBBA 4FXKB 5DFWH 4XZUB 4F7TB 4GQ9L 4F7EA 4RGOH 2F53B 3HNTH 4JY6B 1WAAE 2GJJA 1I1AD 1SHMA 1J8KA 1ZHNA 3NCYS 2OMBA 5JA9A 2XNAA 5E5RB 4ODVL 1KEGL 3ZTJG 1AGCB 3L3KB 1MCHA 3EYSL 4OF3A 4X9BA 4P5MB 3CH1A 5GRVK 5JMRA 3GHBH 4N8VA 2E7BA 1E4KA 4U0RB 5MI0C 1JV5A 1JZ3A 4TTDD 5L0QC 5BOPA 5DJXB 1FV1B 5JHLL 1BFVL 3WN5C 4YHYB 4PG9A 1P69B 3VFNA 3IDNA 3JV4B 1U3YA 3EUUA 3V4PH 1G7JA 5KSBE 1NGQH 3VGDA 2CPCA 5JPMA 4KKCC 3WXVL 1QYGH 3L7EB 5GGQH 3V4VH 4FXGA 1I7UA 3KJ4C 4PRHA 1A4KB 5LGKA 2XTJC 4U31A 5HHOA 3LQZB 1S7TA 4RCAA 1FZOA 3SKMB 4HF5H 1PYWA 3IJYA 3QXAB 5FHAH 4OLUL 4ZG1A 3BJLA 3CDYA 1QG3A 4X6CF 1CE6B 1S78D 1OTSD 2NW2B 3PHSA 4J8RB 4P5TB 4X7SH 2EIBA 1AE6L 4XMKH 5GXBB 4QRPB 5D72H 3P0VL 3QAZB 1G7QA 4LVOC 5TH2B 5JDSB 5L7XL 4NCC1 1YJDH 2XWTA 5CCKH 1GOHA 5LGJB 1FBIH 2H9GA 3G5YB 2J8HA </