1UOLA

Crystal structure of the human p53 core domain mutant m133l/v203a/n239y/n268d at 1.9 a resolution.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
195
structure length
195
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Crystal Structure of a Superstable Mutant of Human P53 Core Domain. Insights Into the Mechanism of Rescuing Oncogenic Mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 50
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1uolA00
2P52A 5ABAA 4KVPA 3QYMA 4AGOA 4LO9A 5LAPA 3KZ8A 2ADYA 2XWRA 2XWCA 5KBDA 5BUAA 2BIQA 4AGLA 3US1A 1YCSA 1GZHA 3IGLA 4L18A 3TS8A 3D08A 3WTSA 1TUPA 3D0AA 1E50A 4HJEA 2J1YA 2J21A 4LOEA 2PCXA 4QO1B 2BIPA 3EXLA 3VD2A 1IO4C 1EANA 4AGNA 4IBYA 3QYNA 2J1ZA 4L0YA 2VUKA 1T4WA 2IOIA 3Q05A 2H1LM 2OCJA 5ECGA 3WTYA 3US0A 2YBGA 3D07A 3WU1A 2BIMA 4AGMA 2IOOA 3WTWA 4IBVA 3ZMEA 4IBTA 4LOFA 5AOMA 5AOLA 1HJBC 2WGXA 3Q06A 1CMOA 2J1XA 2X0VA 1HJCA 2RMNA 3KMDA 4IBUA 1EAOA 1H9DA 3Q01A 4GUOA 4G82A 5LGYA 5A7BA 4G83A 3D06A 3VD0A 3EXJA 2AHIA 4A63A 3IGKA 3WTXA 3D09A 2J6WA 4MZRA 2IOMA 2ATAA 4AGPA 4IBWA 1UOLA 3VD1A 3D05A 5AOIA 2GEQA 1LJMA 4L0ZA 2X0UA 5G4MA 3WTVA 2MEJB 5AOKA 3WTTA 4GUQA 1TSRA 1KZYA 1HU8A 2FEJA 2J20A 4MZIA 5G4NA 4IBQA 2BINA 1EAQA 1GZHC 4XR8C 4IBSA 4IBZA 5AB9A 4AGQA 4IJTA 3WTUA 2BIOA 5G4OA 5AOJA 2X0WA 2AC0A 1CO1A 2J1WA
chains in the Genus database with same CATH superfamily
1UEMA 4L2YA 5ABAA 1NGXA 2Y9RT 4R7XA 4AYSA 1MEXL 3DV6B 4RLDA 3RIFF 3H7BB 2MOVA 3IVKA 1FI8C 4R7NA 5GRUL 1PKQA 3QUYD 2EC8A 2GPZA 4M48H 1VPOL 3ZDXE 4YXKH 4N20A 1JDCA 1U8NA 5SWZD 1K8IB 4RISH 1VFAB 3TESA 2R2BB 4UINH 2HLFC 3RVWC 2CWRA 4LCWB 3G5ZB 1MIMH 3KW7A 2AJSL 3N9GL 4IOIA 2EH8H 3QDJD 3VXSD 3AS3A 3JWNE 3GNML 5GISH 3ZZSA 2M2DA 4I1RA 5IQLA 1S6NA 1DCLA 2WO2B 3QJFA 3LPFA 5D9SB 5LBSA 4OGXH 3RAJL 1IO4C 4J5VA 5I17B 4APQD 1U8JA 2ZOWA 3BFQG 1NC4D 3WMSA 1MCCA 4QRUA 2B16A 1MRFL 3LNFA 1OLZA 3KLHC 1NUGA 4PV8A 4H0HB 2RFXB 5G5DA 5IVZA 3E7JA 1A0QL 1U58B 2ICWJ 1ZPUA 1N0LA 3D3VE 4AJVA 2PNDA 3CCHB 5IHBA 2H3XC 4HJGB 4KDVA 1O9VA 3RY6A 5IESL 3EO1A 1SYSA 1IU1A 1XBRA 3L5HA 2E7DA 32C2A 4J28A 3FFCD 2XIDA 3INUL 3M1BB 4CJ0A 1O75A 4PSPA 3VXQB 5I30H 1HHGB 2DQJH 5CCJA 5CJ5A 3GLZA 2D03H 4FNPA 2NQDA 4F1SA 3NCYP 1B6UA 2QHRH 1WZAA 3H6JA 2BOBA 3BAEH 2IBBA 4EIZC 2IWKA 2PO6B 5LGYA 3P11L 4IIQC 4JO1H 4Z18A 4OQTA 3DSFH 2PR4H 3OJ2C 1E40A 4EF3A 3ILDA 3T0XA 5B39B 3E1F1 2EDBA 1GRWA 3FU7B 3PXHA 1W0YT 5D70L 4JFTA 4NENB 3BEVA 1R3IL 5HY9B 4L0ZA 4KZCA 4X9IA 5DA0B 3DRTA 3B9KA 4XN5A 3GSRA 2ZTBA 3EO0B 4OGAC 4U4IA 1OAUH 4U1KA 3IXTB 5D1ZB 1QFUH 3BWAA 4WZ9A 4X6BB 1ZA6A 4YWGH 4HJUA 3EH2A 3U46B 2WNWA 1WS8A 2ARJB 1D9KA 1ACYL 2F53E 3BP6A 2QPDB 3HE7D 4LP8A 43CAB 3UBHA 2AJZB 1JSYA 2WXGA 3TO4C 5KTEH 5E08L 2VAAB 3MNZB 4AXWB 3T2QA 4QI3A 5BPPA 3EJYC 2GUOA 3KHQA 4TV3A 1KB5L 2JXMB 5GRWA 3L2MA 4WLCA 3IGUA 1UM6L 1ZT7A 5E4EC 3ECVA 4G43A 3AZUA 3RIAK 5IB3A 2NW3B 1M7IA 1IQWH 1MNUL 2P7TA 4U1GB 3PJNA 4G42A 2AVFA 4G11A 3CVHB 5FYJE 1DANT 4KJYA 1CLVA 2VN5A 4JL1A 1BQLL 1KJ2H 2EXWD 1ZGLP 1GW0A 4FD0A 2Y06L 1AQKH 1NCGA 3DTDA 4HC1L 3K81A 1QOKA 5DEFA 2ENSA 2WLIB 4ZNEE 4A7QA 5LJYH 1OAKH 5D7SL 5GGSY 3ZE2F 3FYIB 1QEXA 4APXB 3GSXB 1OF2A 4XP4H 1BJMA 1FO0H 4EVNB 4DP0X 3MLYL 2QLYA 4O2CA 1T1ZA 4DESA 2XTJD 5EH1A 4ANVA 3ELAT 4YNYA 4GI9A 2OYMA 1DSFL 5HJBA 1Q1PA 1RU9L 1AFVL 1KYFA 3AACA 3IDIB 4GEIA 5I8OL 3ZUNC 4JLRA 1S8DA 4YR6A 3IJSB 2J55A 2W07A 1T80A 3PIQA 1GZQA 1UWGL 2VZSA 3O6LL 1QW9A 4JM2B 4MJ2A 2WZAA 3RIFK 5CUSH 1WVZA 3OLIA 3ZTDC 2PETA 2JKLA 4DKFH 3ARXA 3IS1X 4FNSA 1QLRB 3P3UA 1H5BB 3BCFA 4HKBB 5B22A 4PW3A 2R1WB 3JV5A 3W9DB 4HS3A 4AZ8B 4ZMVA 3T3MB 1EAOA 3NACL 4L5FL 2OXGA 4HMCA 2G4GA 5BJTB 3ROOA 1R19A 4KUZH 2I26N 3E8VA 3QIBA 3CZFB 1MCPL 5AQ0A 1O7VA 3B1UA 1ADQA 5IW6B 4KK9D 1MLCB 5IVXE 1UASA 1FE8H 5EOCL 5JDSA 3GC3A 4M1DL 3RA7L 3RBSA 5I1JH 1OHZA 4KHXH 5LKNA 1HHKB 3O4LB 3T5WA 3ZGHA 4IRSD 1CXEA 1S7RB 2NX5B 4KUCF 2VQ4A 2NY2B 2QV4A 1HKFA 5DS8B 1ZLSH 4DERA 4N0FA 1YHPA 4PJXB 3IETB 5KYWA 1EHNA 4GOSA 3NA9H 2CHDA 3E0GA 4JRXA 1NIBA 4LQ1A 5EIIB 5JA9A 1RZ8B 3HHMA 1I8IB 3WN5A 5M7QA 1CICB 1DANU 1EA9C 4L4TA 2FDBP 1HSAB 3BN9C 5C07D 5KSAA 4PJ5D 2A74C 4ZMQA 3QHZH 1JZEA 5JXED 5K39A 1JFQL 4A2DA 4GH7B 3QRFM 4F27A 4WV1A 2BVUA 1H3WM 2UUDK 2VH5H 3RNQA 1SBSH 4XVUC 4MS6A 5HBBA 5EC1A 3TVMD 4YDJA 3EDEA 4HXBH 4CVUA 3EHBB 1W0VA 2V6HA 3K8LA 3QUYA 1FNEB 1YDPA 1YNTA 3QNZA 4XHQA 5EFIB 3LKNB 3LEVH 3L4VA 1V7MH 5SWZA 3QZOA 3AXIA 1ECZA 1YRKA 3LIZA 4OSUL 2YD7A 4B5ZA 5FKPA 4ZFFA 1R3KA 3FUHA 1UATA 5D1QE 2EUXA 3QDJA 5F8RC 3VXSA 1Z0NA 1TF4A 4H1LH 1ZVYA 2H26B 2QPFA 5T3XH 1BM3L 1BZ9B 1HCVA 2BXZA 3EZ8A 4LOEA 5GRXG 1AHMA 3BSZL 2O5ZL 3SODB 4APQA 2LLGA 2OR8A 1NC4A 1IT9H 4I13B 4ZYKB 4N0YH 1LDPL 3H9SE 3BH9B 1UVQB 1FVCA 1RL1A 3BMWA 4GMTH 1QACA 1E2VA 4GSUA 1WP6A 2PW2A 4MVBC 2NUPB 2B8OT 5IQ7L 2H6PB 1AXSB 4KFMA 2C9XA 1OAYH 1MWAB 4Z7WF 4LEOA 5JXAL 2K3HA 2O6CA 1U8QB 5IROC 4LESA 3KYMB 5J89A 1RJYB 3VXUB 1QHPA 3FFCA 2RA1A 4V11A 3KWVA 4RIRA 1JRHH 4G2AA 1A02N 2DWDA 5DZ9A 4FLOA 4JHWH 3IDYB 2P8MA 3K2UL 5F3BB 4OAWB 4K55A 1KTLB 4BQ6A 1D6VH 1P2CB 4XOCA 4N86A 1YY8A 1NLDH 3ZT7A 1G7JB 5AL0A 2WQSA 3REWA 2NCEA 1WS7A 2WCGA 5A3ID 4EAEA 4Y5YB 3DTUB 3RWJA 5D7JB 1T1XA 1Q0YL 3NH7L 3O9WD 4AIEA 4ZD3L 5BVPL 1LE5A 4YXLL 2JFCA 1MFBH 3PJLA 2RR3A 5IHWA 1U8KA 1PSKH 1JV5B 3PUCA 3TZVC 2QDVA 1ULVA 4XPFL 1EXGA 2NY5H 1IL1B 2MEJB 2ZX8A 1W72A 3KLQA 3UCRA 4ELMB 5CHNA 2HKFH 1RZFH 4JKWA 3UZQA 5DRXA 5GZOD 3IGFA 2X4NB 4KHTH 1S7TB 4S1DC 1AGEA 1AR1B 1LP9F 4FFZL 1U3JA 3HE7A 2B77A 2VXVL 1KTJA 2WY3B 3MCKB 4EOWL 2ZQKA 2P43B 2VLKB 5D2NA 5GGSB 5E1IA 5GS1B 2XA3A 5T3XE 5I8EB 1SF3A 5KAQF 4P48A 1I3RA 4XTRC 4H8WH 1JVKA 1P4IH 4OZIA 2C4FT 1T03H 3REVA 4B5EA 2BVQB 5B8CB 2NY1B 4AGOA 2AJVH 2AK4E 3WSQL 5C97A 4ODUA 1RUQL 3HZKB 5CN2A 1D7CA 1DBML 2HWZH 2PPAA 4RX4A 1IEAB 4WUKH 4G9FE 3BZFB 2K4WA 2HFFB 2QZQA 4K8RC 3BAJA 3NDZE 1I7RB 1DJYA 3WD5L 3DVNB 2X12A 4MXQD 5LWYH 2IV8A 1DJIA 3VG0L 4L8CB 1DBJL 3ZKXC 1TTAA 2LAAA 1EFXD 4PV9A 5BRZB 3J8F7 4PH8A 5EC2B 4Y1SA 1NIDA 6CGTA 4AQ1B 1QUPA 3GBLA 1CLYL 3MPCA 4XCFH 2WQRA 3IMWA 4P57B 5I6KA 2P8PA 1V7NH 5HD8C 3KPPA 1PTZA 2VIRB 3DMMC 3QIUC 4QRSA 3MHZA 5I66A 2OMNA 1JN6B 3AREB 3B9AA 4G1EA 5D7LE 1TQCB 4L4VB 4PRDA 4JS7A 4U3HA 1KEMH 2I25N 2FTAA 4IKNA 2UY7A 3ESVF 4WFHE 2YAFA 1J1OH 2A9AA 2J43A 1J0KA 5FFGA 3T2OA 3I6SA 5ISZE 4L1SA 1TXKA 3BJLA 4LKCB 4QRPB 1YPZF 1EHLH 1NFDF 5AW6B 1G9ML 5HDBF 3VFPA 2COVD 3CSFA 2GJ6E 4E9TA 3BGFC 1KSRA 1X3DA 3AQYA 4NWTH 4YDNA 5IFJB 2GEEA 2F74B 4DP7X 4IRSA 4ES9A 3K4ZA 3EOYG 4ONHB 5C0ND 2R4RL 3EJJX 2C4FU 4UQEA 3ECBA 5HYJD 1NA8A 2J6EH 4AIXA 3TN0D 5H4YA 3RLSA 1KJVA 1CGYA 4D9QE 1GYCA 5FO2A 4JO8A 2BRQA 3QPKA 1GC1L 3QCVL 4TNFA 5DQDL 5DZJA 4Z3JA 1KIRB 4Z7VF 5C07A 1E5CA 5CEXB 3DHMA 4PJ5A 2JQMA 4U7MA 2DB8A 5DYFA 2V4LA 5HHVH 3FU8A 4LVNB 5JXEA 3C87A 4TYUA 3J27A 1VF5C 3IDUA 4HOZA 3DURA 1UXSA 1MW3A 2CM6A 5CU9A 1GYVA 4CNIA 1QHQA 4RMRA 4XRCA 4YC2C 1N9PA 5FIEA 2ZX6A 25C8H 3TVMA 4CBZA 1CO1A 1UZGA 3HJEA 5CINL 2BHZA 2BP0A 1U8PB 2V2XB 1CF8L 3FT4A 3ARGD 3HE6D 3O6FD 4EN3C 4U6VH 1QLEB 3P0GB 2FJFB 5E6ZA 3U36A 4ELKB 4M1CC 3P4OB 3RILA 3L3KB 1R0AL 3I9PA 2Z93A 1T4KA 2AV7B 1NCDH 3HMWH 3ZE1E 4UIMA 3ECUA 3UJJL 4ATTA 5DHVH 3BE1L 3V6OC 4UANA 2V7HA 4YHNA 3LS5L 4MQXC 4ODSH 1XF3B 4R2GD 5D5MA 3ZKNC 5KYXA 4MQSB 3V95A 4X6FA 1MHPL 5HHOD 4YE0A 3LS4L 3U79A 1KCKA 4JFFB 4ZTPH 1GGUA 1N68A 3VSUA 5J1AA 3X11B 1DQDL 4MCYB 3V7MA 5GSVB 3WFZA 5J3HC 4HUXA 1J0IA 4OM1L 3V9FA 1U21A 1YC8A 3L8QA 5K9JL 1G7LB 4ZSOE 3FTGA 5JIIA 1A5FH 1KTDB 3CAFA 5HHOE 1KBGL 3DIFB 2QZ5A 2MH4A 1AQDA 4QRAA 2AXWA 2VZOA 5HVWA 2NR6C 1UD2A 3A6CL 4Q0XL 5EOTA 5I6XB 4NOFA 1IGML 1FH5H 1KG0A 2BVTA 4KMTL 1JYNA 4OGZA 3RGVD 4P2OD 1HL9A 2VC2B 2BC4A 1JTOA 1G6RL 2BRRL 1MFEH 4LRNL 3CBKB 1AHWB 4W9JC 2A6KB 3PL6D 5T1DH 1E0OB 2VDLL 2PWEA 1M4KA 1QRND 2OTPA 4JVUA 3WFDH 1RZ7L 5IG7A 3N1QC 1U8IB 4FQHB 3TTSA 3FB8A 1K4DB 2DJ4A 4XAKD 3IXAB 1EDHA 5JHDA 4OB5L 3EUDA 3C8DA 5HHXH 4XP6L 4KAQL 4Y4KC 3O9WA 1HE8A 2AANA 3SPCA 4KKCC 5IY5B 3QR0A 5DJ2B 3KR3L 3DETD 3QEUA 2H0EA 4PLNC 3B7YA 2CLZA 2IQAB 3KVPA 4H1LA 3W9EA 3EJPA 4CAGA 2FX8L 1NSNH 3BLPX 3HI1B 1FN4B 5GZOA 3OKLB 2I5YH 1MCQA 3IRCA 1DVYA 4LKXB 1J0JA 1E6OH 4WTXA 3S88H 4MB3A 2IG2L 2VE6B 1WC7A 3U4EA 1JZHA 4MLSA 2EYTB 1U8MB 4ZMYA 1AJ7L 3N04A 5IQNA 2F5BH 3L7FB 4MNGE 3KYKH 4Z7IA 1C8PA 2XIBA 1ZSDA 3ZDZE 4ZUWB 1ET8A 2V2WB 4X9HA 1UKQA 2RD0A 4HZ1A 5FYLH 4N26A 4G1MB 3DLQR 1DQQB 1BFOB 1CG9A 2DEYX 3ZL4L 1EEYA 3APCA 3MU3A 4Y4HD 1ADWA 2XICA 5HDWA 4PB9L 4P5TC 2HVJB 4NKOA 4DVRH 2R0ZL 1X7QA 2EVIA 1CI5A 4POZC 4HOWA 4QNPE 3FQ2A 5TE7H 3X13A 2QVKA 4N8VA 2EUWA 3COOA 3CUPA 3X1GA 4JFPA 2FB4H 4AGLA 2DLFL 1UKSA 3IKKA 4HEPA 2WBJC 4RGMC 3CVDA 1HL8A 1IGJB 2O5YH 1KENH 2IMMA 2V17H 4PUBL 4Z7QF 1S7WB 2X6UA 4GMSL 3V5DB 2WCPA 1Z0MA 4KBPA 3SDXF 4UNVA 5CD5D 1U92A 2ZJSH 3BW9A 3D18A 4U05A 3CFDB 2LAGB 1EFXA 3GRWH 4HXAL 2WNXA 2DQMA 3F83A 3HC2A 2CKNA 3RBGA 4PJEE 2IPUK 2AK1H 5DD1L 2APWA 4OF6A 3CFTA 3W0WE 1UQSA 4LL9A 3NN8B 5I1HL 1A64A 2XWJA 4FFWD 3LN4B 1HFUA 2C9QA 4MCNA 3KE0A 3IS0X 1MI5B 1IAKB 1NJ9A 4KQ4L 4XMPH 2OK0H 4YEEA 1HHIB 2OMWA 4TQEH 1WZ1L 1QASA 1UHVA 1IKFL 3PWVA 4KV5F 4OV6F 1S7XB 2DQTH 3B34A 1NPNA 3HHRB 4HWZB 3QFJD 4MXWH 5FYLD 3ARZA 1XZ0B 4FG2A 5AWNL 3AQZA 5FO7A 3MRMA 3N5AA 4QGTA 1WHOA 2D8KA 2YGOA 1UA6H 3IWVA 2VISA 4IJ3B 4R96B 4R0LC 3TBTA 4JEGB 4HFWA 4QF1A 2RH0A 2OSLA 4HIEB 5IM7B 1IVTA 4MMXA 1HTYA 1MFVA 4NQXB 3VGAB 1ZSHA 4OJDH 3HMXL 2WN2A 3R4DA 1Q4NX 1PZDA 5C0RL 5MEQA 3OR7A 1A6VH 3KWWB 4M7JH 4MASA 1FL5B 3HB3B 4Y88A 1IUZA 5KYYA 3OZ9L 4UILL 2JJSC 5E51A 3FTUA 4JCMA 3PDOA 3TJEL 5HYJA 2CD0A 4YHIB 4X4XB 5E2VH 3TN0A 1NGQH 2Z0BA 4JPVH 1F6FB 1SN2A 4JFOB 1NPUA 1U91A 4EZMA 2DIAA 5DJ8B 5IQ9A 1MCJA 3HI6H 4K73A 5CIPH 3VFVA 1XCQB 3SDYH 2XQBH 4W9HC 1D7DA 4ABVA 5AW5B 2G75B 1DL7H 1T22A 4BE6A 2IADB 1NANI 4PPTA 4X4ZA 2ZX5A 3KXFB 1P6FA 1WCQA 3RL2B 3LKPA 1KXQA 4RZCA 2F18A 3QIWD 4LZKA 4O2FB 1CE6B 4WEBH 2NZ1A 2EDYA 3DJZA 1AC6A 3ARGA 3HE6A 3L2NA 3O6FA 1ZHLB 3GTTA 4G80B 1QBMH 1HEHC 3GSNB 1SLUA 4F91B 4RBPH 2A9NH 1TVBB 4QRBA 4L23A 2CJUL 3MJGX 4FQJH 4E9RA 3EO9H 3UC2A 4Z7OB 4FG6D 3D5OF 5C0DB 2GY5A 3L1GA 4JY5H 2Z1PA 3G5VA 1I8AA 2XXGA 1XX9C 4Y1TA 3CC5B 3T8XA 4MBRA 3LXAA 1DN0A 3SO3B 3ULUC 2A9BA 3O2VL 4NSKB 3D0AA 4LCWD 1MCOH 4N1CA 5GGTH 3AB0C 1AZCA 3V9CA 4Y16C 3FQRA 5GS2D 4WF7A 5EN2B 1CIDA 5DA4A 5IIEB 1ODAA 4I48B 3SYQA 3ZW3A 5DFAA 4JE0A 1BJ8A 2BCKB 1FGVL 1BJ1J 2DQHL 4ZFOB 2GJPA 5DCCA 4DUWA 2IFGA 2I07B 2WKOA 3WKPA 3PAZA 5BRQA 5EEUA 2PP7A 3NSDA 1BSIA 1HOCA 1TQTA 1YEWA 3RGVA 4P2OA 4BDVB 1ONQB 2N0KA 4EI5D 4J8QA 3UCQA 2WUBH 3MUGA 3PL6A 5E5MB 4DQOH 2B1HH 1CFTA 1BVNP 3QT2A 1QRNA 1R17A 3MOBH 1FL6A 5TFSL 4R4ND 3PWUB 4ZUVB 1VZHA 3CN3A 2CNZA 1J11A 3NP4A 5EZLA 1KTCA 1Q1JH 2EIEA 2V5RA 3SE4A 2LABA 4C4BA 5D71H 1FORL 3LQMA 4I3SL 3RWFA 2CKBB 1LD9B 2ZUYA 5FLUA 5FV2A 3B9VA 2X9WA 3C60D 4LDLB 3AWEA 1TU2A 1CR9H 3QNXB 2L7JA 5AALA 4L3CB 4HPHA 2V5TA 4QRTB 1AR2A 5JW4M 3GMLB 2C9RA 1Z3RA 5KS9E 5KVGH 2IAMC 3HRPA 2VITB 1NBVH 5L8JB 4KPHL 3GK8H 2FO8A 3BWSA 3MOAH 3P3YA 3HI5L 2IPKB 3R7RA 4L9DA 4UOW0 2OQJB 4LP5A 4FL4B 1IGCL 1XAUA 2WVSA 2X4SA 1TSRA 4DPCX 1IAII 4JFEB 4MNHA 3V4VB 5D1ZD 5HVHC 2B15A 4EDXA 3RPIA 1YEJH 4Y9EA 3GSWA 2CAKA 2F54B 3RDTC 1OP5H 4RAUB 3NSXA 1YEIH 1ZEAH 4XP1L 4N5UA 2FRGP 4Y4HA 1PDKB 5ESVA 1NL0H 1KGXA 2E7MA 5GGVL 5L88H 4RDQG 3N85H 2NXZC 5AOJA 5ACZB 1OD9A 5LXGL 4E41B 4R7DA 2LVCA 3IMVA 4ODHH 4U33A 5IB5A 1XGQA 4HUCA 1LMKA 2FQFA 1BVKA 4N0UA 1FPTH 4G6MH 1IKNA 3FB5B 3AGVA 5E5RB 4JHAL 4LCCB 5BQDA 1FBIL 2R23A 4DGWC 5HHME 3VXMB 4LRIC 3UTOA 1KXHA 2EYRA 3TNMA 2P42B 4U1IB 5JHBA 4N2IA 3QQ4B 4HIJB 1Z32X 4NUGH 5C08E 5BS0B 3TC9A 1E28A 1M9SA 1XGRB 1W8NA 1KFAL 6TAAA 2NYYC 3VRIB 4JQVC 1IGFH 2D9CA 3ILQD 3QRGL 5L4MA 5F7EL 4TPRL 1I8LA 3MLVL 3CVIH 3D48R 5AVYB 1CLOH 2IGFL 2B7DT 2EINB 2W1NA 4F2ME 1QFPA 4PJCB 4DP5X 1OGSA 3MGTB 3GJFB 3QE5A 4X6DF 2ORBL 2NTFA 5FF6B 3BPOC 2XCMC 2W60A 2AXGB 2PXYC 4PBXA 5HHPA 1E3XA 2Z91A 4G6AD 4JO4L 2LU3A 1H6UA 4PVMA 4HLZG 4QR7A 4UAHA 3SB3A 3SGEI 3US0A 3HFFA 3BT0A 1JZ4A 1AZBA 5KVGE 1W8OA 4LEXL 4AM0Q 4HGMA 3U6XS 4YHYC 4NZUH 2BHFA 4KRPB 3MA7B 5DJ0A 3QFJA 2I7OA 4EI6A 1G1OA 4Y1AB 5BQ7A 4JM2D 2DKUA 5I71C 3KPQA 4KXZH 1TQVA 5IUSA 2BOLA 2IDCA 2R29L 4FHJA 3MRRB 4NYLB 5I1EH 1L9RA 2DIJA 4X4YA 2WMPB 3TIDA 4AG4L 4TULH 4UT9H 3ZTNL 5FK9B 4G82A 4FFVD 1PVHA 2WQAA 3ARDC 4U6HB 3ARYA 2VLRB 2OPCA 3OPZL 4PJIB 1PYWA 3WKML 1BGXL 3AWFA 3LXBA 1FZJB 2QKIB 1W2KT 3B8YA 4M3HA 5HDOA 5HDBB 2R0KL 4ZFGL 2GC7C 4HVBA 5GZNC 2XYCA 4AQ8C 4F7PA 1BYPA 2ICWB 4NAQA 2DJMA 4XPTH 2HH0L 3HHSA 4F3FA 1CB4A 1CIUA 1E5AA 2JCCE 3NIFE 4MLIA 2FD6H 1YEEH 4R84A 4KKQA 4JREC 5IFAH 1CICD 3O4LE 4HV8B 3GLAA 3WN6A 3QIWA 2EXYD 3B5HA 3VQ2C 1DQML 2B59A 2NX5E 5TPWH 3OAUH 1DQLH 1OAQH 4ORGA 4ABQA 3O0LA 5DD3L 35C8H 2VR5A 1OWRM 4NZ8A 2MCPL 1F4YH 4R3SA 2PLTA 3Q8AA 1D2PA 2ERJB 1MRDL 4J3BA 1IGYB 4XMZA 3PV6B 1BVLB 1F3DJ 1B6DA 3DV6A 3VX1A 3EHBD 1VGEL 5CWSB 4FXKC 1UG9A 4M29A 4RGOH 5K33A 5DRNB 4LLMA 3GXPA 4WHTB 1K8IA 3V0WH 3R19A 5JIMA 2R2BA 2YA2A 4LCWA 3G5ZA 2C8NA 4PJAE 4KI5D 2VR6A 2CK2A 3BLKA 3L5IA 1PY0A 4NQSB 4OLVL 3S3CB 2EIMB 3UTQB 5D9SA 4UQ3B 3KJ6L 2ZOTA 4NIKB 5I17A 1DEEB 5EOCJ 4G59C 3LKRB 3DXAE 2O72A 3MLRH 1PZ3A 4Z77B 4MJIB 1CBVL 2CCVA 2EO9A 3B37A 2RFXA 5JPNC 1U58A 5T33L 5CZVH 3HUJB 1ZT1B 3CCHA 4Q9RH 4HJGA 4F92B 1OSZB 5IBTH 1OQXA 2Z7ZA 3VXUD 4FNLH 4M61B 2WXHA 3GKWH 3VA6A 4WNQB 3LQAH 3H3KA 5AOMA 3SZKC 3VXQA 1HHGA 3L4TA 2B2XL 9CGTA 3H42L 3CTTA 4GUPB 1QR1B 1DCEA 5JR1H 2CO7B 1C16B 5SWQB 3C60A 3NJMA 2LT9A 3O6KL 4AYEC 2D7MA 1SQ2N 1BFVL 4QWWC 5I8KH 2IQ9L 1DZBA 5ID0B 4K2UH 4HOXA 3FU7A 3QARA 5EU4B 5D7JD 1J48A 4AQZA 5EZOH 3VB8A 3BVUA 1PMYA 2XZAL 4OCSH 4JFDB 5DEGA 2BVEA 2IC2A 1S7QB 3D05A 5GGTA 3VWKD 5F7WC 1NDMB 3QYCA 5BOZG 1A7BA 4XT1C 2JIXD 3GEFA 3GS4A 4CC1A 5E9DB 3ARPA 1W6WA 5B7EA 5GRYA 1FNFA 2APVA 4O9HL 4L8DB 5D1ZA 1FNAA 1KB9J 1KZYA 3KM2A 4X6BA 5EPMA 1MQKL 5KG9B 1ND0B 3O3BB 2APBA 4XNZB 4P59H 5CO1A 4ETQB 4Y2DB 3U46A 2X9YA 1I9JH 2ARJA 3MLZL 43CAA 2ZXBA 4DP2X 4JM4H 2I85A 4PLJD 2VAAA 3C5SA 1ZVHA 5DZPA 1AANA 1CXIA 3ZHLA 2P26A 1FHGA 1CDIA 4TXVB 3S37H 5DJZA 2JXMA 2BDNL 3DRQB 4IMKC 5C92A 1O7SA 2NY3C 1FSKB 4N1EA 2AJ3B 4YSTA 2VLKE 4I9WD 1BF5A 2NW3A 2NY1D 2ZAIA 5DQJB 5CXPA 5J11B 1KPUB 1T0NB 1ZT4B 3CVHA 1UWEH 4LPWA 1P69B 4CL7A 1BD2B 4M6AA 3H3BC 3FT3B 3P69A 3PGFL 4UV7H 4FX5A 2XBTA 2P8LB 3BGMB 1GJWA 1UH2A 3M46A 1A6AB 3U6XA 3KW8A 1AXTL 4F1ZA 2WLIA 4F8NA 2V2TB 2FO1A 1OZTG 1F4XL 1LK3H 3GSXA 4APXA 5L2KE 4ORZC 4EVNA 1ZPLA 5BZWB 4ZW7A 1N6QL 5FUOL 3KWTA 3BHBB 4NZRH 5BRZD 4FCAA 3R7QA 3IDIA 4PCKA 3U1QA 3JWDL 4FQLH 2OCJA 4MA8L 3JVFC 4QXUL 1QBAA 4LAQL 2YSSA 1JZ6A 1T2JA 4MAYB 3KL3A 3UTTE 1SY6L 4JM2A 2ZWSA 2BK8A 3TL5A 3BQUB 2D0GA 2ZT9C 5HI3C 1QLEH 2Z7UA 3ARED 4HWEH 4HJSA 4Z5RB 3VD5A 1QLRA 1E4HA 2CBQA 1DLHA 4HKBA 1OSYA 4L4VD 3MRDB 4F9LC 2R1WA 3ECWA 1AD9A 3C09B 3BJ91 1MUJB 5BJTA 2GBVA 4WGWB 4PY7B 2WZPD 4AWJC 2IDUA 5DJXB 2V5YA 2CK0L 1KTBA 3MMEB 4G7RB 5EBWB 3CZFA 2EVFA 1T1YB 2VDRB 1PLGH 4JZJB 2OJEB 2X09A 3RNKB 3VWJB 1CL7H 3NJHA 4QRPD 4Z3EA 1MLCA 1HZHL 2LU7A 1EQWA 1UB5A 2ZXQA 3MJ6A 4H44C 1CFSB 1HHKA 2OMYA 4JFSA 3NUKA 3VD1A 1YQ2A 1JYWA 1S7RA 3II2A 1EVTC 2Y36H 5AB2A 2FATH 1SLVA 3H9HB 2XJLA 4PJXA 5IJCC 5HGGS 1FZKA 2XZQH 3CPUA 3BKYH 1RZ8A 1I8IA 3HCVB 1CICA 2F19H 3WXVH 2X4OB 1ASPA 1GHFL 2BS71 2W8CA 4P8QA 2FLMA 1YNKL 5T1MB 5GGRA 4CVXB 2VC2H 2YA0A 2F61A 5AFAA 2JKTM 1RLBA 1K5NB 4Y7OC 5I15H 1GR7A 2YEZB 5AENA 2BIOA 3SGDI 4P4RA 4PB0L 2IEPA 4ENEC 2A9CA 2ZCHH 3TP4A 4AT6B 4M8UA 5L0QB 4UNTA 3SPGA 1FNEA 3EH4B 3UERA 5GPRA 5EFIA 3LKNA 4X8CA 5IJVB 3UBGA 3NCYS 5K9OB 3JXAA 1JNHB 5LNGA 4TM9A 1SHSA 2E6PA 4UT9A 2UUDH 4NN6C 1MCWM 1CLZL 5IHUL 5JPMB 3TS8A 1U93B 1JNNL 3DJ9A 4OD2B 4E0RA 1S7SB 1BZ9A 5DD5L 3RY6C 4YLCA 3MXVL 1LO4L 4GLRI 4O51A 4EZLA 4JFFD 3L5XH 2B9BA 1HOEA 4ZYKA 5F9DC 1GKOA 3BH9A 1UVQA 3GTVA 1F6AB 3TH3T 1E5ZA 4HISA 1AQMA 4GFTB 5DMJB 5H37H 1AG0A 1KJMB 2J1ZA 1AXSA 2ZICA 4L0YA 4ZOCA 2YK1L 2FQDA 3UBXI 1MWAA 1Q90A 3CQQA 2W80C 3I6KB 1F1DA 1U8QA 5M94B 1U8LB 4GXUN 3WTYA 3NSYA 3UPAA 4ADGA 4BCZA 4JFZH 4KY1L 1RJYA 5I0XA 3VXUA 2F7PA 1EJ6A 2NYKA 4YN3A 3QFDB 4QHMA 3TTYA 1TJIH 1IIKA 2R69H 5JQHC 2Y72A 4JFVA 5F3BA 4OAWA 1WA2X 4WI4A 3K6FA 5EBGA 1KTLA 1ZANL 3T4AB 1MCHA 5ANME 3GHBL 3RWEB 4YSEA 5HI5C 1P2CA 3FS9A 3JTSB 2CR6A 3B1TA 3D33A 1N67A 1R47A 1WBYB 1G7JA 2YUVA 3RVTD 1G9EA 3B9KC 2W9DL 4LHUB 4ERSH 3EFDL 1E9QB 2WXRA 4Z8FL 1USZA 1DBAL 1RHHB 4Y5YA 4XNBA 3SDCC 2D7TL 3NSJA 4QXTB 4KK5C 3L1EA 5D7JA 1T89A 3IMSA 3O6MH 5EUKB 4LNVA 4YHLL 1CQYA 5E2UH 4PJHB 5SWSD 4RMQA 3CSBA 2VSKB 5T8IA 2EABA 2P47B 3Q1EA 3VWKA 4BK5A 3UYRH 1ETJA 4LDEB 4J23A 2JIXA 1IL1A 2MQ3A 4GB9A 5EWIL 2WD0A 3A6BL 1A1MB 1A6WH 2VN6A 3AGWA 4ELMA 4Q97A 1GS7A 1I82A 4A55A 2ZCZA 2GKIA 2X4NA 4OD1L 1UH4A 3F7QA 1KUMA 2MIZA 3VD9A 4J3SA 3D39A 3T0WA 2YUWA 2WINB 4BELD 2VWEE 3MCKA 4TSBL 4C4UA 4F58L 4DW2L 3CMOL 1OANA 3FUFA 5GGSA 5F8QC 4URKA 1AKJB 5GS1A 2A99A 3TJHD 3KGTA 4L3EB 1GOFA 4OZGA 4YUEL 3QEGH 4KQ3L 3VGDA 2UX7A 2YD8A 4GAGH 4ILDA 1BFTA 1KBVA 1A7NL 12E8H 1QNIA 2J1WA 4J3XA 3APDA 2CRMA 3DC0A 4RZKA 1SHMA 3BZ4B 2EXTA 5B8CA 5JHLH 4QTIH 4CJ1A 3POHA 1MG3C 1WHPA 1F4WH 3HZKA 3RIKA 4S2SB 1IEAA 3T6XA 4M6MH 2WLHA 3M8OL 3RVUD 2WXQA 3BZFA 2W0FB 3N42F 2YAQA 1KPVB 4N68A 2KLRA 5KVMC 3EYSL 1I7RA 3QAZC 4JO2L 3PE9A 2J21A 4MAUL 4MD4B 4NM8L 1OAXH 4L8CA 2M8XA 3OKOA 1OVZA 1N70A 2VMJA 5BRZA 1INEH 1QWUA 5EC2A 4TUKH 4B97A 1CGWA 4B3VA 1JGVL 4TVPD 5D1XD 4MJ5B 2JKJA 4KROC 2FT7A 3LEYH 3N41F 2I60H 2OKMA 3E6FB 1SEBB 1KCUL 4DH2A 3H8NA 3S5YA 4Q52A 3HLAB 4JKPL 2VIRA 3GB7B 1EGJH 1MI5D 4K9EH 4HBCH 4YSUA 3AREA 4L4VA 5DVMA 1I75A 5DUML 3KYAA 5L6YL 1PFCA 3ZE2E 1JF6A 3MTRA 1OK0A 2BPBA 2LTQB 2HSIA 4HHWA 3QDMB 2WZPA 1BZOA 3L7EB 1ZK5A 2R9HD 4WNSA 4XPAH 2YO3A 4WSJA 3B2UC 3GEWB 4YEFA 4QRPA 1S9XB 1WDAA 4XP5L 5E6UB 3WN5C 5LCVL 1TDQA 1VRSA 1OTTD 2HTKC 4DP4X 3ULUL 1FC2D 5KSAC 5IFJA 4ONGH 1DVXA 2JTDA 4M43L 2F74A 1X5IA 2JJWA 4ONHA 3EOTH 4I2XB 4MHHI 2WYTA 1ETA1 5IMOB 1RCYA 1UA3A 3NJKA 1T04A 3L81A 4KJPC 2H1PL 2Y69B 2VMCA 3EYVB 2X2JA 1KIRA 1P5UB 3EDDA 4L1DA 3ULVH 1J9TA 3OB0H 3B5GA 5CEXA 5DYOA 4BZYA 2FSEB 3TV8A 3L1OL 3VGGA 4U0RC 2CDFB 3T0EB 1SYVB 4LSUH 2GTWB 3WYRA 4RESB 3KXFD 2Y0SA 3IRZA 3SOBL 1B4JL 2KI6A 4XPGH 5KZCB 4P23C 2AJXL 2R4SL 1LILA 1OGAE 1U8PA 2V2XA 2H0FA 1KTKE 3H1ZA 3FQ4A 4ES8A 4APQC 4PRIE 3L2LA 2FJFA 4TMPA 2CKBH 4ELKA 4FQIH 3KYNB 3P4OA 3ZBMA 3L3KA 2BJMH 2AV7A 1WIUA 3QULB 5D7IA 2Y1YA 1SVCP 5JQ6L 1JWUB 3U4BH 4G6JL 1XF3A 1XMEB 1HCZA 4K3HA 1BVNT 1BYNA 2AJYH 1PPIA 4LHUG 4DGVL 3R1GL 4JFFA 2C7FA 4J39A 4AEFA 4MCYA 1N8OE 1COBA 1JL8A 3K46A 3AS2A 5AW2B 1BLIA 2HRHA 4N1HB 3TLRA 4WKZB 1XZWA 5CEYB 4X2UA 1G7LA 4XCCH 4N4YB 5I16B 1KTDA 3NA4A 2X42A 3WIHH 1QSFB 3DIFA 5LLIC 3MLUL 1I9RL 1SN5A 4LU5L 3JTTB 1R5VB 2QFRA 3MGOB 4JB9L 4R97B 5D2LB 4UUJB 3IFLL 1DSYA 3SQOL 1NUNB 2NY6B 3PQYE 2XQYG 3ULVD 1NMBH 1VB9A 4CDGC 2NNRA 4OFKA 5AKSA 1AIFB 3E9UA 4FTVA 1MELA 1AHWA 2WXNA 3ATDA 5FUCC 3K8MA 2D0HA 4KTDH 5KSBB 1F6LL 5HYIA 3KAAA 2J8UF 5AOLA 1F86A 2NY7L 4FKKA 2AAVA 1U8IA 1XT5A 4FQHA 3VDAA 1G4RA 3C8KB 4WEUD 1FZOA 2CBMA 4UBDD 1I8KA 4G7VL 5ECJE 2VN7A 3APFA 3WIFA 1H9DA 1P1ZA 4JRYD 5A7BA 1FNSH 2XPYA 4ZMZA 2QR0B 5D4JA 1EVUA 5DJ2A 1TETL 1YEKL 5SWSA 4CILA 1SFDA 3DYPA 3HVNA 5D2NC 1PGRB 4DP6X 3ISRA 4WGVB 5F1IB 4R90H 3VI4F 3TBSB 2X4QB 1FFNB 3GMOB 4NZTL 1EBAA 3HC4H 4B27A 3MSPA 3HI1A 1FN4A 3RQ3A 3FO1B 3OKLA 4LKXA 1NGYB 3GJFH 3EADA 3ZU8A 4G6KL 3H3PH 4R83A 2XHNA 4YBLC 2ESVB 3FTSA 4OCRH 2VE6A 2E74C 2EYTA 1U8MA 4HT1H 2VXSL 4YSQA 4JFED 2HFEB 1LQBC 1VDGA 2WVUA 3L3GB 3QR2A 5GS0L 4H20L 4ZUWA 2V2WA 3LD8B 1V05A 2F54D 2EXWC 4G1MA 5LXVA 4YSRA 3THMH 2ODIA 1BFOA 1G9HA 4PS7A 5EBLB 2RCSL 4FQPA 5EUOB 1PKOA 1AD0A 4QHKJ 1KIUB 4WU7B 2VZTA 2HVJA 4E41D 1B2YA 4JO5A 2EDFA 4N2CA 2XTJC 3WLBB 3RKDD 4CA4A 4PIRF 2BSDA 2VW6A 3A47A 1LP9E 3WXWL 2P5EB 5CZXC 2Q0ZX 3VXMD 1ZS8B 1IGJA 4GAAA 4K7PL 4XB7A 1S7WA 4X4MA 5FW6A 5BS0D 3FB7B 1QBBA 2VZ3A 3HNVL 2WWOA 4K3JL 1GZPA 1AI1L 1S7VB 1EDYA 5KBLA 3QDGB 1JD7A 3HZMB 2DBJA 5D1XA 4HWNA 1UM4H 4F57L 2ZONA 2QQKH 4IBYA 2HT4D 3UGUA 1KXTB 1OQOA 1T4WA 3BIBX 3QUMB 1BREA 5EF0A 5BNXD 2ATKB 3VM7A 3MAWA 2P48B 4EO5A 3NN8A 3SYCA 4HFUH 2H45A 3LN4A 4M7LT 1RMFL 1MI5A 4KK9C 1IAKA 1OM9A 2UXTA 4WTZA 1U2YA 1S7XA 2AI0L 3NBNA 3CXDH 2VDOB 4FFYL 4KRPD 4HWZA 3DNKA 4WW2B 4AE0A 4AVJA 3S9DB 4PSRA 1XZ0A 4IRSC 4XVOA 3FCTB 4XN8A 4NPYB 3SKOB 3IJHB 1HWGB 4AYGA 3MLXL 4NP4L 2CHWA 2CIIB 4R96A 5JHLA 3QWNA 4BRVA 5FO9B 1CK0L 4HIEA 3A0OA 5IM7A 1NOFA 3I3BA 1ACXA 4IHOB 4KOBA 3QS3A 4NQXA 2J2ZA 4RFNC 2OMZA 4EE2A 3QO1B 4MSWB 4Y1AE 1TFHA 1QSEE 2LFEA 4P3CH 3GXTA 5JXEC 1FG9C 4PJ7F 3KWWA 4RFOH 1FL5A 1YO4A 2N0MA 3U7WL 4PRHB 4YHIA 4X4XA 3TA3B 5BO0D 4AJWA 4ODWB 2BW5A 4LPTA 1KC5H 4JFOA 1LJMA 2EH7L 3PUUA 4ESKA 5D1QC 3DO4A 4ZPTB 4JPWL 3TVMC 2UZXB 5DJ8A 2B5IB 3ZDYF 3L9EA 3UAAA 3W5MA 4OTXH 2VLRE 2OL3H 2WXOA 1F4AA 1XCQA 2BSBA 3PWNB 3NJXA 3DK2A 5IWLA 2X2HA 2XWBA 4O5LH 4OH2A 1YPZE 3LRKA 4HKXB 4ZOBA 3KXFA 2MNWA 4X7TA 5HDBE 1JHTB 4D3CL 1EAQA 4PGBA 1Z9MA 4TQ8A 3V4PB 2BCMA 5IGXH 2IJ0C 3VDCA 2RHEA 1CURA 4O2FA 3KPMB 2HT3D 1OT2A 2VLME 4G80A 1BAFL 3QI9D 5CJXA 4OLUL 4GS7B 4GBXD 3GSNA 3LNEA 4P5RA 1A3RH 2EADA 1WQVT 2IDQA 1HILB 4LSPL 1DFBH 1I9EA 4M8QB 3OWEA 1L9NA 3V0DA 1L7TH 2BW4A 2YLHA 3MUZ1 3I74A 1UCBL 1N5AB 5C0DA 5JIDA 4PQXA 2IWFA 1GZHA 5KANI 1ZHKB 2ZPKH 4XXWA 4R9HA 3CC5A 4TS6A 3GMMA 3IK2A 3ZKMD 1J87A 1IFHL 3SCMB 3VM5A 4HWBL 4PVLA 5EN2A 1FFPB 2DQIH 4I48A 1I3GL 5CLZA 2BCKA 3TT3H 2KQNA 2XFGB 2E9JA 3VI3B 4K3EL 3DX9B 4ZFOA 1N18A 4GP8B 1CTOA 3N1MC 4MJID 3BYTA 3EKCA 1RK7A 1FIGH 2I07A 3CFEB 3EGDB 5FW7A 5A3IC 1WA0X 3SJVE 4ZTOH 5FCUH 4BDVA 1ONQA 4XPHL 4JQXA 1SXBA 2CGRH 3WFEL 4NJ9L 2UZYB 1RUPH 1OPGH 1YEHL 3MRKA 4P9HH 4AYDC 3Q13A 4QAWA 3ATFA 3CFKB 1GIGH 4KXBA 1BHGA 4CMHC 3PWUA 4ZUVA 3CSTA 5J6GB 4WUUE 3TURA 4IOSD 3JT0A 2OZ4A 2X3CA 4HEMA 5DLLA 3BDXA 3V5HB 4JRYA 3BGAA 3ZIYA 3ZRSA 1NCCL 3FUEA 4MJ4A 1TPXC 3GRGA 3UO1L 4C58B 2CKBA 1LD9A 4GI6A 4A7GF 4NX0A 3QNXA 5IMMA 3D6GA 4PJGA 4BXSV 1NEZG 5B3NA 4QRTA 4AJYV 3M6DA 3AM8A 1UZ6F 2CE6A 3GMLA 3WEOA 1AZNA 1IBYA 2QJDA 2WTPA 2ZXEB 2EDHA 1LO0L 1RIUH 4YJZL 3TWYA 2VITA 2BNRB 1YMMB 4FZEH 4X5WA 5I1CH 2NY4B 3U0PB 3HKFA 4PHZA 1SFHA 2IPKA 4M4RA 2X6CA 2OQJA 2J4WH 4PG2A 2IANB 4MA3B 1G7IB 1FUNA 1MJ7L 3BVVA 5DTFB 3KG5A 4XBGB 4XN1A 5E9DD 1IE4A 2J71A 4JFEA 4LMQI 1I1YB 1NCOA 4YSOA 3V4VA 5E6YA 4HS8H 4JFDE 3F12B 2F54A 1A7QH 3T65B 3DO7A 4RAUA 4Y2DD 3MRBB 1MCBA 2DMCA 1V55B 2X5PA 2K9UA 2MHAB 1CYGA 2A9ML 4OJAA 3TWCL 1G1KA 1QZ1A 4MXQC 3ZN6A 5ACZA 5BMFL 1BG1A 4E41A 1J1XH 4KNSA 4XMTA 1WUZA 2DKSA 7PAZA 4IU2B 1KB5B 3FB5A 4BZ2L 1I7ZB 1RJCA 2VDRH 2X4PB 1MFAH 1ZWIA 3VXMA 2BP5M 3O45B 4U1IA 5JZ7D 2HG0A 4YFEA 1SOXA 4HIJA 4JRWA 4EI5B 1V3MA 4G3YH 5BS0A 1BD2D 3C8HA 2R0WL 1XTLA 1HIML 1XGRA 3VRIA 1NBZB 1DQJB 4O02L 4YGAB 5DVOA 5TQ0H 5HI4D 3WNNA 2OLDA 2GFBB 4YO0A 4XOAA 3EBHA 3D0LA 5FYKE 2BHUA 4FAAB 1KT2B 1IJNA 4H8WC 2UZIH 2OR9H 2WLMA 4PJCA 3ZPDA 4NNPH 1DP0A 5AAPA 3BKCL 2AXGA 3LB6D 1J8HE 2F7OA 5T3ZL 4UDTA 1DJSA 2D9QB 3N44B 2AKRB 1MZZA 2H1LM 4F8TA 5EO0B 3VXRE 1E42A 1NCWL 2KZ1B 3EH1A 4J3VA 2J56A 1TTGA 3AT0A 1G0XA 4ZXBB 4CUCA 3WJLA 3T1FB 4Z7QE 3MA7A 4MAYD 2Z1KA 2X6MA 4M56A 5KYUB 2EDKA 5C0NC 4KMLB 4QXGH 3SDXE 1JP5A 2CG9X 5LNDA 1Z7JA 4FXGC 4O58H 3TN0C 3PHAA 4Y2NA 2CBTA 1UB6B 3S5ZA 4NYLA 2FH6A 1WBXB 3MRRA 1CUOA 4HSAC 1RULL 2WMPA 4NDMB 5FK9A 2WTRB 5C0AB 2IALB 2AF2A 1I7UB 4U6HA 1EJ8A 4NQCE 1OXYA 4PJIA 4RNRA 5MHSE 1ITBB 3OMIB 2VXQH 4HUUA 5JO5B 4DP8X 1FZJA 2J72A 2FX9H 4PJFF 2YD5A 2CM5A 2QKIA 4XODA 1MW0A 1W80A 4KV5E 2DLGA 4WHDA 3MLWH 2NNFA 3ARBB 2G5UA 5J7CC 3GDCA 3AT9A 5J06A 1THCA 3O6FC 3ARGC 3BO8B 3HE6C 5I75C 3B7TA 2YQBA 3QG6B 3F3HA 1B9ZA 3EGXB 2ICWA 2EEXA 3MRIB 3TYGH 2JLPA 3FO9B 1CI3M 1O0VA 2R56L 2C34A 4OM0H 5EA0H 2BSRB 4GRLB 3QRLA 5ABDE 3V4UL 1DBKH 4HV8A 3NIDF 2YMXL 3ZTCC 3VGHA 1X44A 2CO3A 5CEZD 4UQIM 2E46A 3QI9A 3G08B 1U42A 3K2IA 4GBXA 2Y07L 4IU3B 3LH2L 3QC5X 4PJ9B 3UMNA 2X0WA 3QJXA 1LLAA 3U0WH 1RZKL 1IGYA 4D9RE 3PV6A 3UDWC 1BVLA 1E8XA 3G5YB 4P4KB 2P5WB 5CWSA 1IFRA 5DRNA 2LFGA 3QB7C 4WHTA 1H8OA 3KPSA 1DSWA 2QGBA 2Z92B 2WSPA 4PIBA 3CXHJ 2BNQE 2AQ1A 2XVKA 2AXJA 3PAYA 2XA8L 3POCA 5F0LB 3QWOB 4NN7C 1Z9PA 1EZVX 2K8MA 2GCYB 1TYJA 3RGVC 1NIEA 3AUWB 5DFVD 3MFGB 2D0FA 2VXUL 4NQSA 4OIFA 1JERA 4N87A 3UTQA 1BZ8A 1ES0B 2BIPA 2ROXA 4UQ3A 4LQFH 1G1CA 1QR4A 5FWRA 2N7SA 3EJUA 5I2IB 2VUYA 3LKRA 1IAIH 2DI8A 1Q72H 2FBJL 3PABB 3NCWA 2YC1B 5DZLA 1ZDSA 3WELA 4Z77A 4MJIA 2BP3A 2CO2A 2ZWZA 2JELL 5DWPA 4DEWA 3SE4C 1P9MA 5C70A 2HCZX 3ZQ9A 4F5CE 1E4WL 3HUJA 1ZT1A 4YDZA 1KBWA 1OAJA 2PYEE 5DJCB 5DVNA 1U6AL 4TOYL 4WNQA 3PFUA 1VFBB 3DOHA 4M7LH 3TT1H 1Q9LB 4IOSA 4ZS7H 5EO1B 5GHWH 3O4OB 1A7PH 1E8ZA 4HU8A 1A9EB 2YXFA 4AL8H 1EFQA 1QR1A 1L0XA 3R06B 2CZNA 3VFWA 1C16A 3NVQA 4B6ZA 2QSTA 2Q8AH 2R8SH 3NZUA 15C8H 4PRPB 3O3DB 3STBA 4LHUD 1VERA 3N50A 5CP3H 5F7KC 3WS6A 5ID0A 3VXNB 2DBLL 4IRZH 4O4YL 1XD0A 3CLFL 2R59A 2G3ZA 3MRQB 3QDAA 4YHZH 2ARWA 3BSGA 1E4KA 2D7OA 1FAIH 2WLLB 1YNTF 4LXFA 4WHCA 3CZLA 1U41A 2PTVA 4Y4HC 1EJOH 1MCSA 3TBVA 5F0JB 1SRDA 1J1PH 4K3GA 5F44A 5I1DB 5B3SB 3Q3GB 5ADPH 5E9DA 1SXSA 1OL0A 5HGDB 4LHJB 4MA7L 1RIVH 1RP8A 1IKNC 1MZYA 5KG9A 3MV8B 1ND0A 3FRUB 2HPOA 3O3BA 4U1NB 5EZIH 4ETQA 4Y2DA 4OLXL 2DWEB 3VMNA 2N01B 1SJEB 2YGPA 5HDQL 3GBDA 1VADB 4W4OA 3OAYK 2DQUH 2EP6A 1HL4A 4L3ED 1ZXQA 4R26H 5J12B 1DZ0A 1IGIH 2IWGA 2ZD0A 3PAVA 3DRQA 5ESQB 5AB0A 5ENWB 3MV7E 2VGLM 5DQJA 1A9BB 1KPUA 5HHNA 1T0NA 1ZT4A 1BD2A 4U6TA 2JKWA 3Q2CA 1GGCL 1RH8A 1YCSA 2EDQA 3FT3A 4RETB 1EHKB 1F11B 2D3VA 5E95B 1NGWB 2P8LA 4FI6A 4JDEB 3QJHB 1JVLA 1NOLA 3PS6A 1A6AA 3WDIA 4NIYE 2ITCB 2O26U 4XN7A 2V2TA 2YQGA 3UGXA 3TH2T 1ZTXH 2DLHA 5BO1L 2X6VA 1M71B 3OR6B 4WJ5B 4HDIB 1RXLA 3LOWA 1H3GA 2O6EA 3UJTH 4GO8A 3LQZB 1BVZA 1TT6A 1JFHA 3WFBH 1RZJH 3OC5A 2QFPA 3MRLA 3X1FA 4X9BA 4DK6A 4GT7A 4MAYA 2YGQA 3QEQB 1ICTA 5L4IA 3V8CA 5IFHL 1LXMA 3L3JB 5HDLA 3SDDB 4NO5B 1T20B 3ETTA 4OT1L 2BHYA 3FRPB 3VNZA 2YXMA 3MRDA 4FMFA 4K0OA 5IBUB 2XWTA 1MUJA 1DUZB 3QDMD 4WO4B 5AVSB 4PY7A 1N59B 4X6DE 5DJXA 4WJG3 5EBWA 1YQVL 1T1YA 4RDBA 4JZJA 2OJEA 3RNKA 3DIVA 5BOPA 4N9GB 2Y25A 4OZIF 2EQDA 3SPIA 3OGCB 1BM7A 1K3ZA 1OP4A 1F3RB 2YR3A 3QIWC 5D6CA 4AIZB 4LIQE 1K8DB 2ZYSA 4HAKA 4JQIL 4JHZA 2LW3A 2YPVH 4W9CC 5I1IL 3CJJA 3VACA 1VFMA 3LYRA 4UOJA 3H9HA 5AOKA 1QUNA 3L95B 1H0DB 3GZPA 4FG6C 4HCRL 1MVFA 3GBML 5E5UB 3I50H 2WSKA 5DR5L 5EZPA 2X4OA 4PCTA 5T1MA 4H7VA 4M48L 4V1DB 1X5ZA 3MJWA 4P46D 5LAXB 5D72H 1YA5A 3FTZA 3L17A 2YEZA 3BP4B 3DX6B 4W1TA 5C0IB 3T09A 4N3TA 1MIML 3SGJC 3DX4A 4UTBH 5KZCD 1JHKH 2EH8L 1FQ9C 4AT6A 3MACL 4M5SA 3WNJA 3Q2LA 5IJVA 3T0EE 1EMTH 5K9OA 1JNHA 5E8PB 2JQZA 5H2BB 1WRFA 5CMAB 4KXCA 1XR9B 2XT1B 3MUUA 4QGYA 4OD2A 3V0IA 1HDMB 4TNWF 1GGIH 1JCKA 5MENB 1S7SA 3CDGA 2VDNB 1QLFB 4WFFE 1OOAA 4HMDA 4OJFL 5FYJL 2E7CA 4JFHD 2DD8H 1INDL 1Q0EA 3O2DH 3A5VA 4N85A 4R4NC 1CDHA 4S1RL 1F6AA 1OT1A 1HYSD 2MKWA 5SX5K 1FRGH 1KJMA 5I30L 3WAJA 2DQJL 3B2MA 2WAHA 5A2FA 2D03L 2YBRB 4NHUB 2QHRL 1GS8A 1QSFD 1U8LA 2PO6C 4N9OB 5AVWB 2Z35A 4RWYL 1MFUA 4YAQB 4BH8B 3PHQB 5CR8A 2NY6D 4JFXB 3SBRA 3QFDA 2MCG1 1SM3H 4KVNH 1F56A 1TQUA 3T4AA 2HUEA 4MQ7B 5H94A 3RWEA 4XGZB 4GJTB 1PBYA 2VDLB 3JTSA 1NCJA 3C5ZB 3QUXD 2NPLX 1J12A 4UB0L 2X0VA 4LHUA 3W2DH 1E9QA 2CJ3A 1QEWB 3KMDA 3F6JA 3FCBA 3S4SB 4KK8D 3N0PB 1RHHA 5D1ZC 3X3FH 3MCLH 4QXTA 2HFGL 3MRCB 4UM8B 2VN3A 1QFUL 2WIMA 5EUKA 4HIIB 1CFBA 2BFVH 2XOTA 3P73B 5KSBE 1OM3H 4MNQB 4Z0BH 4PJHA 2ADJB 4PS3A 2VERA 2C3HA 4H88H 5KTEL 4N2MA 2GEQA 1A1MA 4Z95H 5IHLB 1FGNL 1NGXB 4KKAD 2XQYA 4AEIH 3QUMH 2UX6A 2D7QA 3IVKB 5D5MF 3KH4A 3BIAX 4B41A 4ZMOA 2WINA 1KACB 2ESVD 3WY3A 4KDTC 4U1GC 1FDLH 2F15A 3QUZA 1HZKA 3GSUB 4L3EA 4OCWH 2OTUB 1I9IH 1KYOJ 2VDOH 4IOIB 4F37F 5IP4A 3ILQC 3GM0A 1KJ2L 3Q9QA 3T2LA 4PMFA 2OMVB 4MQTB 2V9RA 4JR9H 4PYHA 1KEGH 3BZ4A 4PY8J 5B1BB 3UADA 4JNXA 3C5XA 3P54A 4IBLT 4U4BA 1V5JA 3TNNB 3WY2A 4QRUB 4KO6A 5BUGA 5KYNA 4XP4L 4NGHL 4G8GE 1FO0L 4KJWD 5C0CE 3BP5A 5JOEA 4BZ1A 4S2SA 5IVZB 3WAKA 3RI5K 1L3WA 1FLTX 3WY4A 5JW3H 2YJLA 2GYSA 2W0FA 3GTNA 4NKMA 2ZUSA 1T83C 2P5ED 5CP3A 5BXFB 1KPVA 3BUBA 4IRZA 3TCLB 2YRZA 5EEVA 1E50A 3BPCB 3NJJA 4B53A 2N1TE 32C2B 3BUYB 1PLAA 3DIDA 4JM2C 4MD4A 1D5BB 2ZWKA 1PU0A 4ZI8A 4JMXA 3O11A 1E4XH 4CU8A 3QDGD 1R3HA 1H5BC 5E7FA 4Z3TA 2BOBB 2KBGA 3HAEB 4MJ5A 3MBEB 3EJSA 1V10A 5T5NF 2GY7B 2ZCLL 4FFVC 1CE1H 3MN8A 4MRBA 4Q4EA 5GGVY 3E6FA 1SEBA 3INOA 5AAMA 3V4PH 2OXHB 2OSXA 2YWZA 4KUZL 3HLAA 3SGDH 3U2SA 2ZP8A 3ZHDA 1CZ8H 2OMXB 3GB7A 3QDGE 1NAKH 3BXNB 1IEHA 2X44D 4K94C 4S1SH 1TO4A 2NNCA 5KWYC 1FE8L 4PS4H 3S3SA 1OB0A 5I1JL 4KHXL 2C9VA 3CIAA 3CDFA 4HSQA 1MEXH 1OV8A 4FI8A 4LB8A 3QDMA 3G6AB 4ONOA 3L7EA 2NY2C 4WWNA 1VPOH 5K9QG 4TNWK 4GW5B 2Q7YB 1SXNA 3F7VA 1S9XA 4M4PA 4RGNB 2CGYA 3HG2A 2FBOJ 4HGKC 1CICC 2FECL 4BJLA 4YIQB 1T7YA 3ZUCA 1D9KB 2AJSH 2EXYC 2WO3B 2D4DA 3QO0B 2XPGB 3FN9A 4X5XB 2YD3A 3GNMH 2YQ2A 4I2XA 1UOLA 3CN2A 4PRHD 3RAJH 5IMOA 3TA3D 1P4LB 1AXIB 1LMIA 2QMKA 2GUOB 3MBWB 2VH5L 4I4WB 2Y1ZA 3I9GH 1MRFH 3EYVA 2CLRB 3OSVA 4WI3A 1DFXA 4AY0A 3EHBC 5I76B 2MRYA 4HXBL 1Y18B 3KEHA 4LCUB 3IPEA 2CA4A 4P46A 2CDFA 3F05A 4GKSB 1SYVA 2GTWA 4XR8C 1YZZA 3WJJA 3STZB 4HBQA 4EJ1C 3DV4B 1PL3A 2OYLA 5IHZB 2Q20A 1MVYA 4LLQB 2RQ8A 1LQSR 4WWKC 5T3XL 1BA9A 3NCBB 2P52A 3E3QC 4YXHH 1XTMA 1OF2B 3KYNA 1F42A 1IT9L 1UM5L 2KLSA 3MV11 3F2LA 4O2CB 2H3NB 3NEXA 2RIKA 1KGUA 1TCRA 4GMTL 1JGUH 5FUZH 4A68A 1JWUA 2BIQA 1NGPH 3VQ1C 2X53A 4JLRB 1OAYL 1DJZA 3WHE0 4NQEA 5CJQH 3PIQB 3AU1A 1GZQB 3S4SG 4PN6A 4H0GA 1MOEA 2EIZB 1R3IH 3ABZA 3QORB 4N5ED 2VM3A 5D4HA 3SCMD 5JOPD 1JRHL 3L3DB 3IDYC 2NNXA 3B7UX 4WKZA 5CEYA 3MLTB 4DGIL 2KPWA 2H32B 4TSAH 5I16A 3KPRE 4C56E 1QSFA 4HS3B 1BXVA 1DE4B 4XCNB 4F37K 3CH1A 2IBZX 3IJ8A 3GXIA 1BEYH 1JPSH 3AY2A 4UUJA 5D2LA 3QIBB 1ACYH 5FA4B 4ZQKB 4Y5YC 1FG2A 4L2LA 5D7JC 2WB1A 3WU1A 1AIFA 3CPLB 4OIIL 5JDSB 1R33A 3ZMNA 5D7KE 5F7NC 4BK5C 5I18H 2FNBA 3KH3A 1WD9A 2QL1A 3QUXA 4KKBD 1PSKL 5F1NB 1YYLH 5AW3B 3PAUA 1T2XA 3C8KA 4ZRGA 4HIHB 5B7FA 2NY5L 3TEWA 3QFGA 4LVOB 1MNUH 4FMKA 2HKFL 3ZE1F 1PIGA 4JBSA 1Z5HA 2P1YA 1A1NA 2H41A 1AR1C 1X4YA 2QR0A 4KHTL 4L4TB 5M95B 2DQ6A 5DS2A 1JK9B 2IV9A 3P1VA 3PCYA 1ZLWK 1BQLH 3NCXA 3P2BA 4GPVA 5AG8A 3HEIB 2ZUQB 2F7RA 3A4DA 4U6XB 5GS1C 3EZJB 4HC1H 1CBJA 5F1IA 5IW1A 4FG0A 3TBSA 2C7UB 2X4QA 1FFNA 1CDBA 3DYOA 1M42A 3MQIA 2BNRD 1YMMD 3II1A 1D5XA 4XC1H 1YJDL 4JK0D 2NY4D 3ZTEA 3FO1A 3O2DA 4H8WL 4OZ4B 4YE4H 3IN0A 1NGYA 2HTLD 3PWJB 5CCHE 5F7FA 1P4IL 5C8JB 3LQAC 4PJDA 3QUYB 5DC2A 1G1YA 4KNTA 2VLJA 1VFOA 1J0ZA 2ESVA 2NY1C 3MBXH 4FNUA 1XCXA 4TL4A 4D0DB 5B8CC 1CD0A 5I8OH 4Y9GA 1RU9H 1AFVH 3S3DB 2HFEA 3L3GA 2KMWA 1P0SE 2G0KA 2HWZL 1F3DH 1UWGH 3N06B 3VXSB 2YD1A 2EXSA 3BVDB 2IANE 1U4FA 3HAEG 3O6LH 4WUKL 3LDBB 5EBLA 3WGVB 5KVDH 5EUOA 4TVUA 3E38A 2MOQA 1KIUA 1NEZA 3GDBA 2WKOF 5CR1A 2ZF9A 4WI8A 2NZ9D 4FQQB 4K5OA 5KSVB 4OKDA 4OI9A 4N2FA 4L5FH 4BFOA 3UZEA 3WLBA 2DH2A 2EDWA 5C71A 1XV8A 3PU7A 2DLIA 4ABWA 5CD3B 4FYSA 4GSDL 2CO4A 1MCPH 3ARFB 3C08L 2P5EA 4LLUA 4AQ1C 2SEBB 4LEOB 1ZS8A 4XWOD 1J18A 3S36X 4Y9BA 2WNKA 2VQTA 4XCYB 4FEIA 4XCFL 1P6AB 5EOCH 2Q86B 1P84K 5E99H 3FB7A 3RA7H 5A1AA 4ZS6D 1WA1X 1YEFL 1NCHA 1FVEB 1WFIA 2B4CL 1FYTE 2DQGH 3D2TA 3JV4B 1KBPA 1S7VA 2P8MB 2ED8A 2DZEA 4NCDA 1DVQA 3AREC 2R15A 1WIOA 1TQCC 4P3DB 4CSPA 1MW1A 4QHNB 4G6FD 1KY7A 1KEML 1YY8B 4YVNA 5AAWA 5E03A 1KXTA 4H0LC 3QUMA 3REWB 6FABH 2ATKA 2ZUUA 3VXOA 5B1JA 2WQUA 4FADA 1X5JA 3FL7A 3ZL1A 1PD0A 5ACMA 2XYBA 3QC6X 1EHLL 3SKJL 3MO1B 3X12B 3S8FB 4ZXBD 2VO8A 1U8KB 2OTWB 3S5LB 4WW2A 4IBVA 2VR4A 4IBTA 4HW6A 4NWTL 4H4NA 1JZIA 4WCYL 2LVEA 3SKOA 1AIZA 2WW8A 2ZUVA 3IJHA 1OSEA 2CIIA 4NERA 1IC4H 2J6EL 5DRXB 4CMMB 2EDEA 2UXGA 4H8QA 1DBBL 1UT9A 4JFYB 4OSUH 2QQQA 1BIHA 1SEQL 3D06A 3NJGA 1QYGL 2F7QA 3HE7B 2O61B 3QO1A 4MSWA 4F9PA 1PEZA 1K5WA 5KVDE 2ZOUA 4JN2A 4LVNC 2L7EA 5HHVL 2AW2A 1BM3H 1Y1DA 3K1DA 2QHLA 4PRHA 3TA3A 1I3RB 3DSNA 4ODWA 4N2EA 3QISA 4WTWA 5J6SA 1G94A 5AOIA 2IGTA 4ZPTA 3ARBD 4XI5C 2UZXA 5C0AE 4L5FE 5DK2B 5C86A 25C8L 3ZK0A 1R5WA 3FT1A 3P02A 1A9VA 1WK0A 3X3GH 3HS0B 1C5BH 4WW1B 3GHEL 1ID5I 3PWNA 4ODUB 5EU3A 1E67A 5JXAH 2WTOA 2A73B 4AE1A 1TTCA 4DGYH 4HKXA 5KJRH 1NCDL 1JHTA 1ZV2A 2AGJH 4JO3L 4OCXH 3V4PA 4D7PA 4GRLD 4EI0A 1AH1A 1BXUA 1JNLL 1XIWB 3KPMA 3Q9PA 3K2UH 4FDWA 1OCWH 2VR7A 4G8AC 4PJ9D 3KCWA 4PFEA 1HILA 4J4PD 1R3LB 3ES6B 1OTUD 1KBBA 4F8PA 3RVVD 4FQCL 4P4KD 2P5WD 3KZ8A 3H9YA 1RURH 1RD6A 4ZW5A 1TR7A 1F18A 2J7LA 1Y0LA 1QPPA 4WY7H 5CZKA 4AMWA 5KUKA 1UYWL 3F7LA 4EN2A 4XX1G 5BVPH 1Q0YH 2OW7A 1MHHA 1ORSA 4ZD3H 4YXLH 4KTGA 2VB5A 2NSMA 5I6XC 2HA1A 2G9KA 5J8OA 1MHEB 4QRSB 1RJLB 5FC9A 3SCMA 4Z7AA 5GJSL 4XPFH 4X9GA 4CN1A 4G1EB 2I9TB 1EBPA 3I02B 1AHWC 4OLYH 3ZJAA 4X7SL 3HTLX 5GSRA 5T1DL 3VI3A 2VDMH 4P99A 4X7FC 2UY7B 4JJ5B 4PWHA 3DX9A 3IF1B 3V9EA 3RVTC 3WFDL 1OE2A 3CFEA 3KLSA 4FFZH 3EGDA 1B3JA 4EOWH 3EH5B 1JMXA 4IW4C 4LK4A 2UZYA 1I85A 2Z8SA 1XXFC 2VDQL 1EZVY 3R0MA 3TFKD 2AJUH 3CFKA 4Z7NB 4QOKB 5IREA 1SDAB 3ECBB 3FOLA 1OOWA 1Q0XH 3FU5A 4GO6B 4ICWA 4YX2H 3V5HA 1XEUA 4AIOA 1QSZA 1NSNL 4L48A 5I28A 3C2AH 1GA2A 2I5YL 1A6ZB 1A3LL 4Q6IA 1WYJA 2PABA 4PRPD 5TTRA 2J5LB 2AHIA 4GSQA 3B2XA 5C3IA 5DWUH 1F2QA 3DURB 2BNRA 1YMMA 4ACTA 4CNIB 1MJ8L 1NDTA 3U0PA 1T5XB 4WGKA 2HT2D 1DBJH 5EU5B 5I5IA 2ZCKL 1URZA 3K2KA 4OQ1A 1M7DB 2J8UE 2LOEA 4HUNB 3RJQB 1OARL 1G7IA 2YPLE 2CR3A 1AO7B 3WNMA 5DTFA 1E5UI 4XBGA 4NNYB 3VFTB 3OJMB 3MYZA 1CLCA 2Z93B 1T4KB 2Q7NA 5TE7L 1WZMA 3T65A 3GI9H 4YHNB 1WFTA 3BUTA 3RVUC 4TLTA 3MRBA 3V10A 2FB4L 3N55A 4LSSH 5KYXB 2LHAA 5F7DB 2BIHA 3D30A 1KENL 1J5CA 4DETA 2ZUXA 3VI4E 5J1AB 1MCKA 3V4LA 2WWKO 3NJNA 4ZDHB 1YYCA 3MV8E 1IILE 2ZJSL 4ATWA 1UUNA 1KB5A 4N2DA 3GRWL 3KGUA 4UNUA 3S5LG 4AI7A 3EYOA 3KCPA 2X4PA 3P0YH 1T0MB 3O45A 1EDQA 3D4ZA 4Y19E 3T08A 5BUAA 4ELDA 4EI5A 4LDCA 4NQDB 2AK1L 3F6LA 1ZV5A 3SYOA 3BGFB 3WTSA 2WJ7A 5ICZB 3GPSA 1NBZA 2CDEA 1T2QL 4PREA 4MB5A 2BSTB 2R4RH 2F6AA 4HC1A 4XMPL 4F20A 2GFBA 1IB5A 1LO3L 1UJTA 4RMVA 1E2ZA 4TQEL 2RB8A 4UV4H 2JB6B 5IG7B 3FB8B 3GIVB 3BKMH 3NABH 3QCVH 5F9AC 5A2IH 2R9HC 1F1GA 3CN4A 1B4RA 5JHDB 5E1AB 4IJ3C 1UA6L 1WUNT 4X80H 4UDUA 2AKRA 3ESPA 5KOVC 3FSAA 4GY4A 5EO0A 3JVGA 3O9WB 4UQAA 3GSOB 4P2RB 4HJ0D 4ZXBA 3WNPA 3T1FA 2BH0A 4TSCL 1WICA 2IDTA 2JJTA 2CLZB 3N1GC 1PJ9A 3QEQD 4FHBD 3D85B 2ZOKA 3HB3C 1A6VL 1ZS2A 4M7JL 3SDDD 3IJ9A 2E59A 4P07A 2XVLA 4F33A 2VSMB 1UB6A 5HVGB 3MRPB 3QWRD 2YD6A 4KX7A 5E2VL 1NGQL 3B8SA 3RFZC 4UOQA 2XG4B 3B9DA 4DN3H 2RMNA 4R5TA 1QVOB 4PCSA 4IBUA 1A7OL 3X17A 2IALA 5D1ZI 3UJJH 1UXLA 3BE1H 3HI6L 4WO4D 2CR0A 1PZBA 4JZNA 1QFWL 2DTML 2XQBL 3SDYL 2VDNH 4HQQH 1MHPH 2FEEI 2W94A 5JO5A 1ZAGA 4LASL 2Q9OA 3ARBA 5KVEH 2LU5A 3GS0A 2WVTA 1VHPA 1LNUA 2R1YB 4WEBL 3BO8A 4AQEB 4K9EC 4OM1H 3NDYE 3QG6A 3EGXA 1U9KA 3VMPA 3WFCH 1KBGH 5E8EB 2A9NL 1GGBL 1L6ZA 3FO9A 5ILTL 4BZ1L 4FQJL 2UVEA 4JFPB 2BSRA 4Q0XH 4GRLA 3FZUD 4NAMA 4BWTA 4YHMH 5D93B 2P49B 4KMTH 3D12B 3LHAA 1GZHC 3NZHL 4JY5L 4V1DD 4PJ7E 3G08A 3QBTB 2WBXA 4Z3GA 3GIZL 3O8XB 3CFBB 3TO2B 4PJ9A 3SO3C 4N8PA 3OHXB 4J6RL 4F7TB 4J1UB 3L3OB 1QATA 1JS4A 1LL1A 4J4PA 4PG9B 1MCOL 1RZ7H 3WDJA 2DWXA 4XO4A 4P4KA 2P5WA 3ZDYE 4JY6B 4Z7UB 3N40P 1WTGT 3U25A 4JPIB 1IBFA 2EIBA 2BWDA 3F7YB 2VAJA 4FTDA 4LLYB 4OB5H 1OE3A 1NEUA 4KAQH 1ZY9A 2W9LA 4JM2F 3GLDA 5BW7A 1UQSB 3KR3H 1XB6A 5ITBH 3KDMB 3ULVC 1I1CA 1BXXA 1OGTB 4KK6C 4LHQB 4P0DA 2EO1A 1NJ9B 5MEND 2HUHA 3HPJB 3PF2A 3BD4A 4JQXC 4GW4B 2A4ZA 3PWVB 1ES0A 3AROA 1PEWA 2DKMA 1WT5A 2FX8H 2CBPA 2WUBL 3BSZA 2F58L 2NYZA 4HJ1A 5BZZA 2B1HL 2EDJA 5I2IA 1WH0A 2ZYHA 5IQOA 4KNQA 3PABA 3B7SA 3MOBL 4LP4A 2YC1A 3MRMB 4L4JA 5KW9H 1TLKA 2B20A 2IG2H 3PWPE 1P1VA 2ADGB 1ZVSB 2IH1B 3SEPA 4QF1B 1Q1JL 1AJ7H 1FYHB 1KGYE 2W88A 1LO2L 1CTMA 2Q3ZA 4MMXB 5D71L 5ECGA 1KF9B 5FAAA 2CDGB 4BWUA 1MCDA 2X4UB 5DJCA 2ZYRA 2ZX9A 3F6IA 3OR7B 5EIQA 5LVEA 3AM8C 3FUNA 5KVEE 3AC0A 3ZL4H 4PJXF 1KN2H 4BCYA 3PDOB 1Q9LA 1XH0A 5EO1A 3WIAA 4R7VA 1RUAH 2UWEB 4IM8A 5KVGL 1LE9B 4W9LC 4LSVH 1HCYA 1M2VB 5IT2H 1A9EA 2YSTA 1U91B 5IJDC 3GK8L 3MOAL 3QH3B 2NXYB 4GKOA 3R06A 2OJZH 3A23A 4L8BB 3DYMA 1Z9LA 3C5ZD 1BQSA 4FL4C 4BFIB 2R1XA 3O3DA 4PRPA 4RMSA 4EXPX 4G83A 3JZ7A 2FJGB 2QELA 4RBPK 4HU2A 2CCWA 4RGMB 2E4TA 3M1CA 2YRLA 2E9GA 2YHGA 4XNUH 3MRQA 3OKEB 4HZAA 3M7FB 1YEJL 4GMSH 4NUPA 2WLLA 4LF3B 3WL9A 2A6IB 1YEIL 1HL5A 2AFNA 4HXAH 3G6JB 3LNHA 2V0AA 3HZ3A 1NL0L 5I1KL 4G8FB 1JOIA 5I1DA 4GUCA 3Q3GA 3U9UB 4MDIA 4M3JA 3AXHA 4KI5F 4GAFB 4JJOA 4KXZI 4ODHL 4NBYB 2PP8A 1HINL 3IDGB 4W68A 4MNQE 3FRUA 2QGCA 4U1NA 1FPTL 3NCMA 4BSVB 4DEPB 4LCCC 4R2GB 1NLBL 5I1HH 5J1SC 2DWEA 1RSYA 1SJEA 3G5VB 4KQ4H 4RAHA 1UZ6E 1DN0B 4XAWL 5FGCE 1IKFH 1VA9A 2X1QA 1G9NL 4Z7WA 1TNNA 2X2UA 1PKQE 2K7QA 3PNWA 1ET7A 5ESQA 3GHPA 1CTNA 5ENWA 3SY0B 3CVIL 4HWUA 1Q94B 5CFHA 1CLOL 3R8BB 4XBEH 5C9JA 3LTVA 2KQMA 4R0LB 5ITFB 4EUPG 3OAYH 1BMZA 2YRBA 4ALAL 4I77L 3FT2B 1Y6MR 4POUB 5BV7B 1F11A 3TV3L 4P2OB 1NGWA 4JDEA 4K9JA 5DHXB 1XGYL 3QJHA 4TQPA 4LL4A 4ENZA 3OZ9H 2YA1A 3MUGB 1ROCA 2W92A 3ARWA 1OZUA 3T4YB 2EDOA 4M9PA 3WJLC 4MJ6B 4FQXB 4AJ0A 1K3IA 4JGMA 4XXCA 5C09D 4L3FA 1JK8B 1M71A 4WJ5A 4HDIA 3Q5YA 2Q87A 1U3NA 4GQRA 4IIZA 1A6TB 4YL9A 5I1EL 1CGVA 3LQZA 4JX0A 1KJ3L 3MBED 2N59A 5J6HB 2WUCH 2OFQA 1MN4A 3FBQA 3IRPX 5DUBA 3BRFA 2NLJB 3QEQA 4JGNA 3T0BA 3TXAA 3NYKA 1BW8A 2F5AH 4PBWD 4YK4B 4ELMF 3SDDA 1IC1A 4NO5A 1K72A 3U7AA 1CGXA 2HJLB 4X5QA 1T20A 3EJCA 1L4IA 1UJ3B 4CRPA 3QWRA 1FFQA 2QKIC 5HXMA 2QSCH 3VJ6A 4TLSA 1JVOA 3JZYA 1MIEL 1NAML 5AVXB 1DUZA 4WO4A 2O93L 5HGAB 2FIKA 1OW0A 3MZTA 4J8RA 4MNHB 2J57A 2ZXGA 4NM4L 4LLWB 5F7YC 5GIRB 2BVOB 4XPTL 1PLCA 4N9GA 1PNDA 4YDKL 1Z1WA 4EDXB 4RGND 3EXJA 1K85A 2QTEA 1FNLA 2FD6L 1YEEL 3TX4A 3OGCA 2J88L 3O2VH 1AGCA 3OG4B 3RVWD 5IFAL 4AIZA 2C4XA 4YPJA 1JF5A 5AW1B 4JG1L 2NNAA 5TPWL 3AB0B 1K8DA 1AGDB 3EJQA 3OAUL 3IKCB 2X1XR 2YMTA 4RRPM 2H32H 3Q8EA 4NNXB 3U9PH 4EKXA 2ERJC 2DQHH 3K0WA 3L95A 5J9PB 1MRCL 1BVKB 3BRGC 2UVFA 3EGSB 3QUGA 4CSTA 3SBWA 4N0CD 1FWXA 4CKQA 5FM4A 2R23B 4HHGA 4YZWA 1ADQH 3CC1A 3PFQA 3OBAA 5C0BD 3ULSB 4RGOL 2E3VA 4V1DA 4AYMC 2WXJA 2DIBA 2XV3A 4JGUA 5LAXA 4AK1A 4PLKD 3V0WL 3BP4A 2WZ0A 3DX6A 4Y9CA 4UT6L 2FYVA 4RWHA 3ZKMC 2Y6SD 1CCZA 5TFSH 4NHCL 5IVOA 3R4RA 4LEBA 3MROB 4OLZL 1MCWW 5AKRA 1FORH 2R39A 4I3SH 5I74B 1XF4B 5E8PA 2NTFB 1B0WA 3MLRL 4URTB 4PBVC 5H2BA 1MJUL 1YYML 5HHPB 1EEZB 3A24A 5E70A 2JKIS 5MENA 3SGKA 3NIDE 7CGTA 3TJPA 5CZVL 4GEJA 1QLFA 2Q6WA 2DDQH 3DUSB 4Q9RL 3C6LB 4DN4H 4HPOH 3DX7B 5DGRA 3N91A 2CHXA 1NFDA 4FNLL 1NBCA 3KPQB 3O2WH 3QORD 4M93B 3VSQA 3LIZH 3WNIA 4N8CL 3U0TB 2YBRA 1ETZB 3KM1A 3CSPA 5JR1L 4ZW8A 4F7KA 3FDWA 3Q6GL 3HN3A 2F7IA 5EDSA 5F2FA 1PYWB 3MTXA 4YAQA 4BH8A 4XP1H 3PHQA 3WS6C 4TL5A 1H3PH 3QJZA 3OKMA 2DN7A 4Z7VA 2Y7OA 5GGVH 1NQBA 2GHWB 1W6LA 1G6RA 3QEHB 5LXGH 4MQ7A 1E4KC 4OCSL 4XGZA 4KVCH 4FLQA 5AD0B 3ABKB 2PTTB 3C5ZA 3CZUB 5HYEA 1X5AA 4JHAH 4EMZA 2NY0B 1QEWA 4OIAA 4I0PB 3S4SA 3MV9B 3BZEB 4UM8A 5FOBA 3MRCA 4OZFG 5DMIL 3J07A 2Q7AA 3P73A 2IBZY 2ZKHH 4XNZC 2DOCA 4P2QB 2ATPB 4Y2DC 1SVBA 1KFAH 2ADJA 3DA0A 4M5YL 3RWDB 4GP4B 4TPRH 5AZEL 2VUOA 3MLVH 3BVTA 4W4OC 5AUMB 5B4MD 1U95B 2Y7SA 2VQUA 4JRXE 3SOTA 4P9HC 4TUJB 3RUGB 3V7AE 4QKTA 4L4TE 5DZOA 3S37L 1KMGA 3L4CA 2Q1EA 4FHKA 3U83A 1FSKC 4LLMB 5EEZA 3EOBB 2J20A 4QRRA 5JZ7C 1S3RA 2YOCA 1D7BA 1E43A 3GSUA 4PJBB 4X7EC 4Y7MA 2OTUA 4YHPB 3LHPH 4YHYB 1KELH 4I18A 2QVFB 1CL7I 4EPSA 3KPNB 1OP9A 1K6QH 5IJKC 4UV7L 1D5IL 4OW6A 2OMVA 1A4KB 1W72H 3IMUA 2ALAA 2XN1A 5HI4C 5SWZE 5GGRY 2ED9A 4XMKL 4F8OA 1YEGL 4OF8A 4JG0L 3TNNA 4GKLA 1LK3L 3ZTNH 1GW6A 3QDJE 3VXSE 2JJUA 3LB6C 1TEFA 4M6OL 2OM5A 5ABZA 5K1NA 4FJ6A 5IOPB 5DHYB 4X6CB 5C2BH 1IC7L 3ARFD 3BAWA 1BGXH 3FC8A 3KWXA 5BXFA 4AVKA 1J10A 2HJKB 4ADIA 3TCLA 1I8UA 2AQRA 3BPCA 4MAYC 4KRLB 4PM1A 3BUYA 1KV3A 5C09A 5SV4A 3SPVB 3HG4A 1D5BA 1SJVA 1X9LA 3BQUC 1AGFB 1MDTA 3K80A 4NRZB 5D7HA 3SKUD 4U3CA 4L0PB 4OZHB 4AX3A 2PF6A 1BDYA 3NRFA 2HH0H 1L0YA 1MCLA 3HAEA 3MBEA 3C60B 4LSDA 3C09C 3FFCE 5A7EA 4OF3A 5DJ6B 5L4FA 2PKDA 2OXHA 1E8WA 3ZDWA 2K70A 2DW5A 2C3GA 3BN9D 4NKDB 2OMXA 3VWJC 3OD3A 3QJVB 1OEZW 1PLGL 3BXNA 5DD3H 1CL7L 2GABA 2MCPH 1JPTH 5DEGB 5EBMB 2L0DA 2Z9TA 2X87A 1PQZB 1F0LA 3PJSB 4FABL 2A6DB 4XVUD 3G6AA 4DPAX 3V55A 3K1KC 4NRYA 5EORH 3ZSTA 4H2AA 2FATL 2Q7YA 4GW5A 2G3XA 5TDPB 5EPMB 4W6WB 5FUCE 4OVVA 3WFHB 4YQXH 1PZCA 4PRNB 2Y3AA 4YIQA 1SMOA 2F19L 4A63A 5LGHH 3QO0A 4FQ2H 3WXVL 2XPGA 4X5XA 3HMXA 1X4XA 4HHAA 1HNFA 3B83A 1J8HA 3C5SB 1HNYA 1OSPH 1XH2A 2WKLA 4AGPA 5E2WL 2WANA 5I15L 2EE0A 1P4LA 3MBWA 5DJZB 2L7UA 4I4WA 4ZFQA 1UH3A 2VSDA 3ZMRA 2CLRA 1CBVH 2ZCHL 1JXJA 1BBDL 5L0QC 1E90A 1AZUA 5CU5A 5I76A 5D2NE 5C0BA 1Y18A 5TE6H 4AQOA 4MVBD 2ZG2A 1KCSL 2FHCA 4LCUA 2NOYA 5T33H 2KUTA 1ZIAA 3UMTA 5BUPA 3MNWA 5D6DC 4B0MM 3JUZA 4GKSA 4M6NL 2E75C 4IDJH 1OCZB 3IAPA 4LARL 4RX4D 5JPMC 1NZRA 1A4JB 1UT2A 4GXVL 3STZA 4OZIE 1HC1A 4H40A 4X8JB 5DFVC 1CFQB 3DV4A 5F6HI 2YRPA 5IHZA 3MLPA 1XIWD 3MI6A 2A77L 4LLQA 1Z5LB 2V3FA 1N0XH 1VGKA 4RDQF 3MJ9L 3L5XL 1XF1A 4DKAA 2H3NA 4BM7A 3O6KH 3IDMA 5GRVK 4A7UA 1HKLL 4XNXH 1BFVH 4IIQA 2PW1B 3MRFB 3MYJB 5F21B 3RJDA 4A2EA 1KOAA 2YSSB 3HG1B 1OIOA