1UOLA

Crystal structure of the human p53 core domain mutant m133l/v203a/n239y/n268d at 1.9 a resolution.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
195
structure length
195
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Crystal Structure of a Superstable Mutant of Human P53 Core Domain. Insights Into the Mechanism of Rescuing Oncogenic Mutations
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1uolA00
2PCXA 3WTYA 2FEJA 1TSRA 5LGYA 4AGPA 4G83A 3VD2A 5LAPA 1UOLA 2AHIA 2J20A 5AOIA 4AGQA 2RMNA 2X0VA 5ECGA 5AOMA 2ADYA 1GZHA 3QYNA 5AOJA 2YBGA 3WTUA 2J1XA 2IOIA 3IGLA 4IJTA 1IO4C 5G4NA 3KZ8A 4IBTA 1YCSA 1H9DA 2J1WA 4L18A 3IGKA 2J21A 4IBUA 1TUPA 4LOFA 3Q01A 4A63A 2BIQA 2X0WA 2X0UA 3WTTA 1EANA 3ZMEA 2BIOA 3WU1A 5AOKA 3TS8A 3EXJA 2IOMA 4QO1B 5AOLA 4AGMA 1EAQA 2VUKA 3D0AA 2BIMA 1GZHC 3D05A 2J1ZA 2XWCA 2WGXA 5AB9A 3US0A 1LJMA 3Q05A 2GEQA 3WTSA 2J1YA 4IBQA 4MZRA 2IOOA 2BINA 4GUOA 2XWRA 4L0ZA 3VD1A 1E50A 1CO1A 5G4OA 4AGOA 3KMDA 3D06A 2AC0A 3US1A 4MZIA 3WTXA 4G82A 1HJCA 2ATAA 1HJBC 3D07A 2P52A 5BUAA 3D08A 4GUQA 4IBWA 1KZYA 5ABAA 5A7BA 2OCJA 4IBSA 1EAOA 4IBYA 3WTWA 5KBDA 4HJEA 4AGNA 2H1LM 3D09A 4L0YA 4AGLA 3Q06A 4IBVA 4LO9A 1CMOA 3EXLA 4KVPA 3QYMA 3WTVA 3VD0A 4IBZA 2BIPA 1T4WA 4XR8C 1HU8A 2MEJB 2J6WA 4LOEA 5G4MA
chains in the Genus database with same CATH superfamily
3EOYG 1UWEH 2XPGA 2ZWSA 2IH8A 3ZKQD 4PJDB 2YHGA 4GRLB 3O45A 2CA3A 2D03L 3N0PB 3TLRA 4HKXA 3TTSA 2J20A 4ZQKB 2AANA 4X9GA 3VNZA 2BSCA 2X0VA 4Y19D 1VADA 2L04A 4PRHE 4XNMA 1IAOB 4NO2B 4PJ9B 4U1MA 4JFYB 1L5GB 2YXVA 3IMRA 3AT9A 3F7VB 3Q8CA 5IESH 5EO1A 4P2OB 1RU9H 3I6GA 2N7AA 1JYNA 4JO5A 1HWWA 4MZ3A 3DXAE 2JELH 3E38A 3KPQA 3FT9A 2X2YA 4XP5H 1HEJC 3WYRA 4DFHA 5FM8A 4QOKE 2W60B 1FSKB 1G1YA 2NUPB 4PI2A 2N3JA 5GPRA 4LOFA 5H94A 2CK0H 5B1CA 1NCWH 4H8UA 5LG1A 3RNKB 3L4XA 1DCEA 3H56A 4PD4K 5I0YA 2IV8A 2CUAA 3DSFL 4M9PA 3QR0A 1ODUA 3CN0A 1WO2A 3Q0HA 5JW4R 3GM8A 2C3XA 2RALA 4PJ5D 4HH9A 1CFTA 5AVWB 4FNLH 1FG9C 1Y0LB 4OF7A 3ULAB 5CZVH 5CZKA 4DPBX 5AAWA 5DJXA 1PBYA 4DKDC 3VFWB 5A3IC 2NX5A 1KBPA 2E27H 3OTTA 1D7FA 4KKLC 4KUCD 3VXTA 4G1EA 4EBQL 3X3FL 4NPJA 3RWCB 3CFIC 1ZVNA 1X7TA 1SQ2N 4WKXA 1DN0A 1NLDL 1XF5B 4LIQL 5EO9A 4B9ZA 4XZ4A 4PAZA 3QAQA 4IW4C 5HVFB 4KKAD 3A47A 4LCIL 4BA8A 5J6HB 5A43C 3WJJC 3U4BL 3G5VA 1INEH 4PLJD 1J9RA 4JLRA 3C5JB 1TZAA 2A4ZA 1KGWA 3V6ZA 4P46D 2BY3A 4NO3A 3TN0A 4HCGA 1R75A 2A9CA 5EPMB 3RILA 4HXBH 4HUNB 3C6EA 4FI8A 1ZT1B 3J27A 4M3JA 5BV7L 4BK5C 5DQDH 1MCPL 2HJLB 4KK5D 1KBKA 1N3NA 1DBAL 1TSHA 1TYJA 1V7NH 1M2OA 4N6RB 1NA8A 4XP4H 4YHYC 2EADA 4CKQA 5IROD 2OJZH 4IRJD 1OGTB 4DETA 4I8DA 1CZ8H 5K9QG 5DI8B 4H20H 3INUL 1NTDA 3WO4C 3ESMA 1QFUL 3MNWB 4R0LC 4ZTPH 2DWDB 2VISA 3BZ4A 5LGYA 3K0WA 3O3AB 4JO1L 5FA3A 1W8NA 4DUVA 1QBML 5E2TH 1CGWA 1U8LB 2YOCA 3VXPB 5JHDD 1P6AB 4YIQA 4DNLA 2A74C 3M1BB 4TYUA 1ZT4A 1OW0A 3LKRB 3MLUH 4J4PA 4LPXA 3WO4B 4JUTA 4F24A 4NO0B 4XAKE 4R0LB 4S2SA 3F65A 5BV7C 1W0VA 1R5IA 2GUOB 4D8OA 1YEKL 1T04A 3MV8E 5GZOA 5FGSA 4N2IA 4L3AA 4GRWB 4HLZG 1RZJC 2A74B 4UYQA 5D5MF 3W11C 3V7MA 3N04A 2VC2B 4F8QA 3QIBD 4HV8B 1QLRA 2CJUL 4TUOA 4FULA 5FGBA 5AW2B 3B5HA 2GHWB 3DYPA 4JKPH 2HSIA 3GZQA 3VXUD 2VDRL 3K4DA 1AQKL 1U8CA 2VDOL 4KNQA 2ESVE 5DJCB 1REIA 5D55A 2WQUA 4K3EH 1QAWA 2O6FA 4U7KA 3T0XA 4AEHL 1BJMA 5AOLA 3TIDA 4ODXA 3BEVB 2RBLA 5I76A 4JB9H 2VITB 3MRNB 3U9UA 1S3RA 1SM3H 5KSVB 3MA9H 3S5YA 1FE8H 2CALA 4AZUA 1XR9A 3GUTA 2OS7A 2JCCA 4NQCD 3LS4H 4X5QA 4PQXA 5BVJB 1LP9A 1A6ZB 1OARL 4LKXA 3X14A 4X4XB 4DO6A 3SKJL 1DZBA 1PY0A 3BQUD 4UM9D 3S3SA 1U8PA 2WD0A 2XQYG 3O6KH 5IHZA 4L8DB 2GC7C 1GGIH 3HS0A 4HWEH 2Y7QB 3QZLA 3BKYL 1R6VA 4WENB 3DUUB 2RR3A 2Z3FA 5CCJA 5LAXB 1QTPA 2O93L 4HAGA 5KVEH 5M94B 4I5BB 3FU7B 2BNQB 1NBYB 2PCFA 5MERA 1G6RL 1D6EB 2H32B 3W39B 4YWGL 3SYPA 5JW3L 5AW6B 4RRPM 4U2ZA 4MFHA 4RDBA 5SX4I 2HFEB 4PMFA 3JWOL 1KCUL 2XQBL 4N2GA 3MGOB 5I66B 1UM5L 2XNAB 5F9AC 4JN1H 5LLIC 3UX9B 4XCNB 4KXZH 4AVHA 2DB8A 1RULL 5ICZA 1X4YA 2EYSB 4I3SL 1N0XH 1UJTA 4NKOA 2L0DA 3IFOB 1E5UI 4TNGA 1ET8A 3ISWA 4AVJA 1ZHNA 3FTSA 5JLZB 1NOFA 2GQHA 1Q9KB 2BOBB 2FEJA 4YC2C 1ZV5A 4PTTB 4KQ3H 5JO5B 4QJ4B 2X05A 1UT9A 1FRGH 3CUPB 3UERA 2KHAA 4NFCA 4P9ML 3HMXH 1PDKB 3HZ3A 1OGSA 3JTSA 4BFBD 4WTZA 4LESA 4WI4A 1IM3D 1OAXH 5A2FA 1BWMA 3ZZSA 4KRNA 1B3IA 2V17L 4HPYL 3JWOC 1FQ9C 1BQLL 2H0EA 2UXTA 4YC2B 2YMTA 3BSZH 3IWVA 1X5YA 1E42A 4IEFB 4OGZA 4MB3A 3PWLA 4NZRH 1NC4B 3ILQD 2F58L 3EYUH 4NM4H 1CFTB 5DUPL 1G6RB 1ILSA 1NAKL 5KJ4A 1DSWA 3TA3A 3UEQA 1XIWC 3WFEH 1TZIA 3Q8FA 2EAEA 1T66D 3HS9A 2AZAA 2NX5B 1P84K 3D4CA 4NRZB 5D70L 4Z7UE 5EOCJ 4GKSB 5EA0H 3MC0A 4IM8A 3HR6A 1VZIA 2AJYH 2IANB 4Z7OF 3AMLA 3L4YA 4HIJA 1NBVL 2PP8A 4HH8A 3SE4C 1MFBH 3NFSH 1HKLL 4NUJB 1A6UH 1TQWA 1ZS2A 1VPOH 3WFCH 1XIWB 4Q8BA 2ETWA 4ZS6D 2WW8A 5F1NB 1EQWA 4RGOL 4GBXA 2EE0A 2APSA 2R51A 1S7TA 4XNXL 4XNQA 2YPVH 4N1EA 1OPGL 2WQVA 3TBYA 1DUYA 1U92B 3IDUA 4Y1AE 4EXKA 3KBPA 4RQQB 1TJGH 1CXEA 4FN0A 2ITDA 1JTOA 2X3BA 4KH2A 5KYYB 3WD5H 3PDOA 3E6HB 5ICYA 5C0DA 4ZUWB 1ZHBB 4LSPL 2NCEA 3OJ2C 1DLHB 4PCKA 1SXZA 5A2KH 3L4VA 3IWUA 5IJCC 5JOPE 3OF6A 1GGBL 3WELA 2XV0A 2OMBA 3AM8C 3D39A 3DX4A 5D7LB 5HD8C 1RZIB 4EZKA 4WO0A 4G72B 3EYVB 5HGAB 3NPSB 3TT3H 4OLWL 1PZ2A 3N1PC 5EU6E 1QA9B 2GSMB 4DFIA 2JI2A 1JMZA 4KJPD 4KKNA 4N2FA 5JPNC 1OALA 2I07A 5HYIA 5T1DH 1BHGA 2VDKH 1YN7B 4WI8A 4WFEE 4XPFH 9PCYA 3AS0A 1HZHH 4AV0A 5D2NC 1SEQH 2LLGA 2XICA 1XH3B 3RDTC 5JPNB 1JZIA 2MKLC 4OIIL 4EUPG 2AV1A 3BWSA 4N2HA 4NGHH 4P57A 3UIZA 4IIQA 4RMBA 3FW6A 4F91B 4BSWB 4PJ7A 4LU5H 1KCRL 4AUUA 2KKQA 3I50H 4L23A 3IAQA 4LKCA 4JFEE 2CBQA 1SJXA 2H0FA 2WO2B 4K23L 4HZLA 5CBEB 5D2NB 4DK6A 3RDTB 3HW7A 4HIXH 3G5XA 5EV7A 2YUZA 3H2QA 3S35X 5KYUA 5I6LA 1DE4B 3KGSA 4IKIA 4EZLA 5HPMA 2WXGA 1GYUA 3L8QA 3UTSA 15C8H 2J8UE 1OAZL 5KANG 2PP9A 3VSTA 1X5XA 4AQAA 4L2LA 4A67A 2UUDK 3IDIA 4MDIB 2WVTA 4L8BB 5EU4B 5LDSA 3L3GB 4W9HC 3T4YB 1VFBA 3DI2B 1CJYA 5E5RB 3SZ6A 3IU4L 1GAFH 1XSOA 4G1MB 1UKQA 1XGTB 2DJSA 1WZ1L 1ZY9A 1OAYL 2V3DA 1W8EA 2GK0A 5I5IA 2JCCB 1JV5A 3O9WD 2YIHA 2X9YA 1E6JH 4Z7IA 4O51A 1MFDL 2V2XA 4KKLD 3HLAA 4LKXB 1E3FA 2X28A 5IWLA 4KWUA 1MPAL 3OBAA 1NCTA 1UQSB 2YFOA 4OR1A 4PRBB 1OAUL 4W9CC 1CGXA 3NFPB 1A6VL 4B9JA 1F00I 3HAEG 1G7PB 2XYBA 3TZVA 3DO4A 1UM6L 3B7UX 1R4XA 5MEOB 4QHMB 3FO9B 5D7SL 1QX1A 2O5XL 3PJNA 2HJFA 4X6DA 4TPRL 2JKRM 4UOW1 4UQ3A 3BUYB 5D7HA 5KN5A 1ILUA 1R24A 2AK4B 3IJ7A 4G3YL 2ZPKH 3V0GA 2XTSA 4DP7X 4OCWH 1R46A 3RPIB 3QFDB 5I17B 3PWPA 3UO1L 1Y07A 1YVLA 1LO5A 5GGSB 3KWWA 3MBXL 3FO1B 1U30A 2QSVA 3ARUA 1ASPA 3L4UA 1S7VB 5KS9A 1L9PA 1UT1A 5K9KB 5ABAA 4X0NA 4IBSA 5ID1A 1A9VA 2GAZA 5FKPB 3VXQA 4LBAA 3TWCL 4TOYH 5AZ2H 3IM1A 4K9EC 3H9SB 4J1UA 2ZAGA 4NO0D 4Y7MA 3C60C 1ND0B 2F1AA 4XNBA 4F20A 1EJ6A 3HMXA 1DQKA 1IE5A 2J2ZB 2IC2A 2IIJA 2RQEA 5JUEL 1KIQA 1IAKA 1CS6A 2VRQA 2VLJA 3PV7A 4HUVB 4XPTL 3RYMA 3BH8B 3BSZA 1M56B 2JKXA 3I84A 5C8JB 2HT3C 1ETA1 4Y9BA 4HJ0C 2A6KA 1AQHA 2X1PA 5DLMH 3AS3A 2UYLB 2GTWB 3TA3B 1D5XA 1TMQA 1XEDA 2NY4C 4I7ZC 1B0IA 3MRKA 2BP0A 4R3SA 4X6BA 2X4NA 5IY5B 1K6QL 3QE5A 3O6MH 1OCRB 4UQBA 3GHBL 3TPKA 4YS4A 5ESQB 2CO6A 2ZJSH 1AHWC 4AH2B 1D5IL 4FLHA 3D69B 3KYKL 3UJJH 3QG7H 4CBZA 2NY4B 2Z0UA 1D9KC 5INDB 1YJDL 4H5SA 4Y88A 3RBGA 3LSOA 2B16A 4GIOA 2YPVA 5DD1L 3UJTH 3WY1A 3BVNA 4DGYL 3CVIH 4LDEB 1AHWB 2EH8H 3L6FA 4HJIA 4K94L 3WMQA 4CW1A 3HB3C 4JRYB 1QFPA 3RTLA 1QLFB 1D9KB 4RESB 5DVMA 1CL7L 1ZDQA 4OIFA 1FH2A 2WKOA 3QZWA 1CN4A 3ARXA 1K2DB 1KACB 1WP6A 2DQGL 3Q1EA 4JY6A 5E7FA 2BNQD 5EF0A 4DKFH 1OXYA 4M02A 2O6PA 1JDDA 1KGCD 5CLTA 3SDCB 5DMKB 4JRXB 3GSUA 1JRHL 4QRSA 3QORA 2MJWA 4V1DA 3HB3B 3Q05A 2G3XA 2UWEB 3GSQA 1ZLEA 1TKWB 1Z0MA 5DK3A 5K69A 4S1QH 4JL1A 1U3HC 4NP9A 1M9SA 1YJDC 2IBZY 2VJXA 1CE1H 1X5KA 1HEHC 1RZPA 2I07B 4ZOEA 1RSFA 2Y1ZA 3AG4B 4G9DB 1E30A 3W2DL 1UEYA 4NQEA 4JN2A 4NKDB 4LVEA 4R97C 1PZ3A 1EFQA 2GFBA 4FS0A 3ES6B 3QIWC 4K94C 4BGDA 1TJHH 2QQNH 5T5FL 1HJCA 2BMKB 1U3HB 2GTQA 1H6UA 5DVNA 2QELA 3EH2A 3P4MB 1MUJB 1XZ0B 3EZJB 1JHLL 4NC1E 4N85A 4P57B 5A7BA 2NMSA 3V52L 4RVBA 4EI5A 1IFHH 4DWHA 4R97B 4UMGA 4YNYA 4FERA 3TYGH 3QIWB 3PRZA 4CN6A 4F7TB 4MAUH 2PWDA 1OCWH 4EXPX 1RVFL 2EDQA 5DUMH 5TQ2H 3AVEA 1NDGA 1CD0A 1U3NA 2WUBH 1HL5A 1QKZH 1T4WA 2O5NA 2DJUA 3D3VB 5G2NA 3N9GL 5IB4B 1U0QA 2F68X 4YUEH 4LEOA 3ROLA 5KTEL 4HGMA 1PAZA 2CRYA 3QPKA 3EO1A 4C83B 3ESOA 2J6EL 3I75B 4FYTA 4LCUA 1L9TA 3MRQA 1RUML 2DIEA 2IAND 3PCYA 3RA7L 3EBIA 2CKBA 5E23A 5AOMA 3TBCA 3FFDB 5E08H 1BAWA 3C08L 1W2KT 4PRIE 3HZVB 5FYKU 2HWZH 1XIWD 5IT2H 2O61A 3H2PA 4UF7C 4NNXA 4LRIC 5D4IA 3KXFE 1ZA3A 4GNKB 3OJDB 4L9LA 1ZLVH 3WKQA 2MCPH 5C1MB 5FYKE 5J9PB 3B43A 4GUPB 1CVRA 1D5ZA 4F2ME 4TMPA 1SXCA 5L7XL 1FZJB 2OLDA 2X4UA 3VQLA 1M53A 3EAKA 4JX0A 4X4YB 3P4NB 3LN9A 3GSRB 3NAAL 3BIKB 3T09A 4AVIA 4FQHB 3DPBB 3UMTA 2J57A 4R7DB 2HN7B 5IQ9B 5L2KA 2DL2A 4JE4B 5JW4Q 4D3CH 5DWUL 4F80A 3K5SA 3U4EB 2CCVA 4GI8A 1NH6A 3FMGL 3OKNA 1EHLH 3EOAB 3QXAA 4FNQA 4KROC 4W4OC 3FTYA 4GQ9L 4ZOCA 5E5UB 5PCYA 5IG7A 1TTGA 2NY7L 1UGKA 4NC0B 3SPIA 1JWSB 3QUKA 1OP3H 5TDNA 4N6QA 1NGYB 2QADC 1TQCC 1A6AB 1R9FA 2JWYA 3TO2B 3P0VH 4KROB 1MHCB 3MUUA 3IJHB 1FO0H 2P3YA 1AZCA 3QIUC 1MW2A 4ZG1A 3H85A 2EO9A 4N2DA 1K8DA 1UD2A 3B5TA 1NDMA 4LEEA 3WG7B 4KY1L 2RTTA 3ZT5A 3SBRA 2QADB 2V7HB 4DTGL 1TQCB 3T8MA 1KJ3H 4PGEB 1IVTA 1XSJA 3FT2B 3SDXE 1JZ8A 4NHCL 3FU5A 4MCYA 2I26N 3UZEC 8FABB 2WIIB 3QIUB 4JFQA 1SY6H 1BW8A 3WIFB 4F7KA 4N2EA 2NDFA 5C70A 3RDTD 3QYCA 3H6JA 5HGDB 3ZTNL 3FH7A 5E2UH 4WQOA 3VGGA 4UBDC 5HHOB 1P4IH 5JXEA 3P11L 2B20A 2I69A 2J7LA 3QC6X 4TULH 1TZOA 1HWHB 3S6CA 3U2SB 5D1ZA 2X1QA 3CIQA 2CO1A 2J12B 4CA4A 4X50A 4QF1B 4P2QE 1M7XA 1HT6A 3C5ZC 4C54A 2J71A 3JYCA 3TWYA 4CMHC 4HD5A 2W80C 3NPZB 1MY7A 4WLCA 4UTAH 4H5SB 3EFOB 3AWFA 3UBXI 1F4YH 4UZSA 4PVMA 1GGYA 3PXJA 1JIBA 3RG1C 2DI8A 1NMCC 3ALXA 5TQ0L 3C5ZB 3UZVA 4P3CH 1BIIA 1Q4NX 3O41B 3FTUA 3BJLA 5IW6A 3BT2H 5AW1B 3G7TA 4XGZB 2X4PA 4F9PC 2ZKYA 3S88L 1CDBA 1NC2B 2EXYC 1PZCA 5D93C 4ZOBA 3VCLB 3RGHA 4XB3A 5FLUA 3HC0B 5FW8A 3L7EA 4DEWA 2OL3L 3ROOB 1W16A 1UWXH 3JQOB 4ZX6A 1OF2B 1EXUB 1UFGA 4LAQL 1J0IA 5H2BB 1CGSL 1G7HB 3SQOH 4GG6B 5I5MA 3KBFA 1OCOB 2JI1A 3NCJH 4GAFB 5D93B 3SIKA 4PJ5A 5DMJB 2R56L 2F7PA 1YEJL 4X9HA 4NNYA 1TEYA 1ZRUA 3GLAA 3X12B 4AQ8A 4N26A 2R4SL 1EAPA 2CCLA 1CD8A 3ULVL 2ZWLT 4MXWH 1LMIA 4IMKA 4QNPE 4HP5A 4XRCB 3H9SD 5D6CA 5E2VL 2HFFB 3DX8B 4HWBL 4ISVA 1W72A 2A9ML 4DN4L 2ZUVA 3SDAA 3OHMB 3GO1H 2DEWX 4W1TA 2CHDA 1JNNH 2NSXA 4JZOA 4ZTEA 4G8EB 5K59E 3Q2CA 2J4WL 2Y0SA 5GS0L 1CU4H 3UTTE 1GIGL 4P46A 3C60D 4WUUB 1WUZA 3GSOA 1VEOA 2IGTA 2CG9X 5KBPA 1KZYA 4HIHB 3O0RL 1BVKB 2EEFA 2J72A 3MRHB 3HCVB 2OL3B 1AO7A 3EJSA 3W9EB 2AEQH 2BW5A 2AV7A 4K7FA 1RZ7H 5I18H 5KSBB 1QEWB 2WKLA 3CZKA 5CP7B 2YPKA 4OD2A 3ULVC 2HT3D 2SEBB 2XKNB 5F1IA 2KQMA 4HJ0D 1F1DA 3MRFB 2CKBB 4FMKA 4MQTB 2DWEA 3G08A 4TNEA 2XWDA 3C2AL 1UD4A 3V0WL 5LGJB 2NY4D 4LSDA 3ZYJA 4Q0XH 1CBVH 2IWEA 2ZWKA 4ABWA 3VGFA 2ZD0A 2YD9A 4CSSA 3LQMA 3Q1SH 3CTTA 4M1DH 4ZUVB 5IR1A 1L9MA 1PZBA 5KS9F 2J73A 2NLJB 4M1GL 4AT6A 3N40F 3QI9C 4JZNB 1P9MC 2VDNH 1YPZF 2WB7A 5J6SA 4BBWA 4QRUA 5JHDA 2ZX6A 4Q9QL 4NOFA 3H6AA 2XBTA 3GLZA 5DEGA 2CGRH 1HCYA 2DIAA 1D9KD 5EZJB 3A6BH 3BWUF 3MACL 3ABKB 3RVUD 4YDKL 5KVMC 2CLZB 4R26H 3FN0H 2VRKA 4LSSH 4EE2A 3QI9B 4JJOA 4AM0A 4QRRE 4HK0A 1C12A 4I89A 3ULUL 3B1TA 3IFPA 4JRXD 3S9DB 3SO3C 4FCAA 4IU3B 2AEOA 2P5EA 3T9WA 1PKOA 3ME0B 2KERA 4KZEH 3HB3D 3GB7A 2CBMA 4FNSA 3JT2A 2Y3AA 3Q6GH 1MJ7L 5IMKB 3D25B 1Z9PA 3AU0A 4KPHL 4ANXA 3VXUA 3SHSA 2P8MA 4HIIA 4PUBL 1J05B 2H3NA 2YKLL 4H4NA 4OBRA 1J10A 3QS3A 1WPCA 1FO0A 1I9JL 2GG1A 4U3SB 3SO3B 5J6GB 2E9IA 4PJ8A 3REVB 2GITB 4MD0B 5BZDB 3DXAD 4PB0H 5KSUB 4KDWA 1U3HD 3LNDA 4PREB 2EIZB 1EV2E 3LEYH 2D03H 2YWYA 2HKAA 1IC0A 1KIPA 3QUHA 3QFJA 1CR9H 4PJIB 1JJUA 3TESA 4LSQL 5DSCB 4MA7L 1SY6A 1ETB1 5CCGE 3ULUC 1V27A 5E1GA 1KMGA 3HRZA 4PRNB 4Z7VB 3STBA 5D9SB 4U1HB 3GSVB 4L29B 3FF7A 3D3VD 1AYOA 1UCTA 2DQMA 1ZPUA 2MPAH 3TFKC 3MLZL 3A0OA 4D0CA 5ELIA 2WKOF 2ZYIA 2WXRA 4LAJH 2I85A 1AS7A 2Y2YA 3C5SB 1KXQA 5MI0C 4HWUA 3NK4A 4CADB 1A25A 4TVSa 4O02L 1FZMA 3G9AB 3PXLA 3ZN6A 3HUJF 4N5EC 5F0LB 5EFIB 2W88A 4UTAA 4WHTB 1GPOL 1UXSA 5E1QA 3U2IA 1T1WA 4ZPVA 2YPLA 3CFKB 1PVHA 3L7FB 1JZ7A 5MI0B 4JVPA 4LL4A 2X4SA 5FECA 5EF1A 1AI1L 4D8PA 1LO3H 4W93A 4EBQH 3IBOA 4FAAB 5IMOA 1GC1C 5C0CB 2X6BA 3U0PB 4ENZA 12E8L 4LCCB 3LIZL 4ZMTA 4C8XA 4Q4EA 1BJ1J 4HJGA 1NLDH 1VGKB 3FRPB 2OZ4L 4XPHH 3VMOA 3ZUCA 2FCBA 2JK5A 1CK0L 3O81A 4LCIH 4P07A 3U4BH 2F7QA 5ILTL 4OF8A 2FD6L 1R3KA 2Z93A 1JN6B 2NSQA 3DDGA 5IV2A 1G7JB 4Z95H 4PYGA 4KDTA 4IJTA 4I18C 3GJEB 4X8JA 4RFEB 1XGYL 3PDDA 4FXGA 4OKVA 3WS3A 3GK8L 2YAQA 3OKEB 5BV7H 1D2OA 3RZCA 5I2IA 5D2LE 1KFGA 3DJ9A 3GTNA 4JDTL 2FECL 4FG6D 4QHNB 4M8UA 5FGCE 4E36A 2FIKA 4KROD 1YYML 1CD1B 5F7HA 4L1LA 5FWRA 4I18B 4FFZL 5DQJA 1A3RH 1JNHB 5T1KD 2BXYA 5D1QE 3TBWA 1OSYA 1ZTXL 3INUH 2PW2B 1W72B 1P1ZA 1QFUH 2GB2A 3AQDA 2QADD 3B2VH 4M6NL 1E2VA 4JPVL 3DOSB 4A66A 5E6IA 5B1AB 2IPKA 3GRBA 1AG0A 4PGCB 1QBMH 3FHEA 1L9NA 3QIUD 3RUGB 3L81A 5G5DA 2Y22A 3IMBA 5KG9A 1BXUA 3BRDA 5H8DA 2DV6A 1NCNA 3EFDL 1XMWA 3QNFA 1AFVH 3B6SA 4M7ZC 4FLQA 4XMXA 4PJEF 3RX9A 5C97A 3EOTL 4M7JH 4TUJB 2EKJA 1G5GA 5D7IB 5HDBF 2NY5H 4OZ4B 4WEMB 5D1XC 3O4OC 1YEGH 3GMOA 1WA2X 1WZKA 1DVFC 1FFOA 2YPKB 3K6DA 1NIBA 2NY2C 1PG7L 1XSIA 4MCMA 4WTQA 2F5BL 1WAEA 1IILE 4MA1C 2HKHL 1T1ZA 3NDYE 4S1DC 4UBDD 2BFGA 3UPRA 5K9OB 2QMKA 4A2EA 4AENB 1L6ZA 2VDRH 4P5TA 2HVKA 1IBFA 1H3UA 2ADJA 2VDOH 3JWNC 3O4OB 3P9WB 5D1XB 5F0JB 3RIFF 4F7MA 3TV8A 1P7QD 4A7QA 1OB1A 2NY2B 4XN8A 1U8OA 5CUSL 1FAKT 3C5ZD 2FEDC 4IDLA 2Q7YB 3G6JB 4AEHH 4I0PA 1KTJA 4MA1B 2FGWL 1H0DA 1J12A 3CFJA 2XT1B 4H88L 4P5MA 4WIQA 5DEGB 1ZHKA 3ZE2E 1NGWB 3FCBA 3RKPA 3O6FC 1T20B 2G5BA 4TKWA 4GI9A 3QCUH 4HS8H 5IVZB 5CJBA 5BRZB 2FQGA 3A6OA 4FYRA 3B2DC 5C07B 4Y5YC 2WPGA 1OARH 1NWOA 1QO3B 3SKJH 4N8VB 3H42L 4HZAA 3ZTEA 1EJ8A 5BZZA 1DQQB 3O6FB 3BKYH 4WZ9A 5DFWH 3ARFC 4UOW0 3H3PL 2WQSA 4L1DA 5GGRY 5HHMD 2N1TE 4A7GF 2DF3A 4JM2C 1ZHLB 2ZNWA 4NRXA 4FI6A 3TTYA 1OQOA 4Y5YB 5IW1B 1PCXA 3AC0A 4XMTA 4MJ5B 2ZOKB 2CNZA 1FL6B 4AW7A 5IHUL 5IBLD 4YHIB 2R1YA 1NPUA 3MR9B 3PQYD 3RX7A 5SWZB 3JWOH 4U6YA 2XQBH 2QKIC 2UX7A 3ARFB 3OXRA 5FYKL 2VO8A 2Z8VC 2W91A 3OMZA 3RIKA 2Z35B 4JM2B 1FGVL 3D18A 4LHUD 4P4RA 5F7EL 3G6AB 5ADPH 2OMTB 2HRLA 4HUXA 4JFPB 5DK0A 2V4LA 3CZJA 4I3SH 4DKEL 3FQUB 3V4UL 4FHJA 3O9WA 4LSTL 3P3YA 2QKIB 4M8QA 1XF2B 2NZ1A 4CSZA 4MMXA 1SPDA 4WUUD 3EGDA 1BZ7B 3AITA 1EO8L 4PRDB 5E9DD 1T03H 4ZUUB 2EDNA 1J9SA 1XAKA 1EMTH 2J1ZA 4OZHB 4P9MH 1EXHA 2GIYA 1F3JA 3WTSA 1MI5D 2OK0H 2Y36L 3VSUA 3IDMA 4XAWL 4EPSA 1GY1A 3IKCB 2JQAA 3OWRA 3EZ8A 4PJHF 3IDNA 1T5XB 1FIEA 3STZB 1DBBH 2B3RA 2A6JB 3HG0A 2ZKXA 3BP4A 5CMAB 5SX5K 1W9XA 5DUPH 4X9IA 4FFTA 4LLMA 1ZE3C 5ESAA 1ET7A 5IB1A 1NAKH 3N1GC 5DURD 1CURA 3MYZA 3ULVD 5D70H 2DQHH 5AW3B 1OSZA 3L16A 2LQRA 5CAYB 2J8OA 1E27B 2OCJA 3B9EA 3RIFK 4F8PA 1N67A 1OKEA 3S3DB 1NBVH 5HI5C 5HVHC 2CDEA 1UZ8A 4LB8A 1K8IA 1KPUA 4L0YA 4TRPL 4RGOH 3I6KB 3BWAA 3QI9D 3PP3K 4WI9A 4XNXH 5GS0D 2Z93B 3BP6A 1HOEA 4PWKA 1F02I 4Z78A 3VE0B 1OPGH 3VJ6B 5HVHB 1H6FA 5F8QC 5C2UB 3IDYC 2Y7NA 3ARWA 1V10A 3VFTA 5SWQB 2GJJA 3N1FC 4D0DA 3EKCA 5DZNA 1A9BB 4OFYA 4Y2LA 2G30A 2CIKB 2WLIA 5E70A 1UKSA 3L3IB 3EGXB 5FM5O 1OGAE 1MCCA 1EGJL 3UJIL 5EEXA 3QZWG 5DFVC 5KBKA 1GGBH 1OLLA 1RFDL 4BH7B 1E90A 3IDYB 3AY4C 4W6YB 3SDDB 4MJJA 1TZGH 1SVCP 4YN3A 3DARA 3PLYA 4BCYA 4ZYKB 4OLWH 2VR8A 4K3GA 1ZSDB 4LZKA 4WHDA 3CVDA 3IJSA 3IDGB 4F7EB 1A7NL 2WWMC 4FHKA 3Q01A 5JHLH 3L3OA 3G6DL 5I73C 3DX6B 5KG9B 3ULSA 4PIBA 2PUQT 1EVUA 3P1VA 4NM8L 5CFHA 1CTMA 1AXSA 3GMMA 3JVFC 5I82A 2R0ZL 3QUXC 1Z5YD 2VLRA 4JDEB 5FV2A 3VSVA 1II4E 3NTCL 5C0IA 4H0IA 1IC5L 1K85A 4NZ8A 4CN1A 1OP9A 4RETB 5LN4A 3ULUD 2VMFA 1KCRH 2IWGA 1DEDA 3CMGA 4M48H 3MV01 4OKDA 3GGWA 1YHPA 2BK8A 3QUXB 3M46A 3L3KA 2CMRL 1CE6A 3UP6A 4GSDL 4CJ1A 2WVVB 3BP5B 4BHUI 4UZUA 4W9FC 4WWNA 2EICA 3PGDA 2D9QB 1BPLB 1YYLH 3D9AH 4JQVA 5DHEA 4JS7A 4YSDA 5E4AA 1WAPA 3BT0A 3H9ZA 4AYBA 3VQMA 1T6BX 4UT7L 2OR7A 5CEZH 5C0RL 2N1KA 3RI5K 5JXAL 4KTEL 2A6IA 4UQDA 4XVJL 5C0CD 3EJJX 3FDWA 3IU4H 5DVOA 3MA7B 1KCLA 3QQDA 4NEHB 3BOVA 1YY9C 4DAGL 3OPUA 5E1AA 3PWNA 5CCHE 3LKQB 3PYCA 1X7SA 2C4FU 4G8GA 4YSRA 1MFDH 1V3KA 3RKDD 1MPAH 3KPNB 3NQKA 4R2GC 5AB1A 5TK2A 1P5UA 5T1MA 3DRTB 2Y9RT 3ARDB 3LPOA 2YSSA 1OAUH 2PWEA 4MDRA 4GINA 3QYMA 2WXNA 1QSZA 2EYRA 1BG1A 2IMMA 3S5LB 4EMZA 4WV1C 5JZ7C 3ZOAA 4HOXA 5CZXD 1BVLA 1MIMH 1LVEA 4WTXA 2O5XH 3CG8A 4YFEA 2Y25A 3WE6B 4R2GB 4TPRH 3SE6A 2VLMD 4U1IA 1CTOA 3HC3H 3S3CB 4G3YH 4PJAF 4Y4HD 3MV11 5EN2A 1GZHA 2QQQA 3ISYA 3L5WA 5BO0D 5FM5M 4MB4A 1MELA 3DJTA 3MBXH 2OW7A 5DXWA 1KCSL 1T1YB 1UB5A 2CM5A 1Q9OB 4HKJA 3P73A 1MH5A 3NJIA 5DUBB 1FJ1B 2BRRL 1VFAB 1A1OA 1ZGLM 3RWJB 1DHKA 4XN9A 5LO7A 1JWMA 3OC5A 4UUJB 5T5NG 3S5ZA 5JNYA 1KYAA 4L48A 5F3FA 4FNRA 5F7FA 3F2LA 5JW5A 2A6DA 2DQJL 3ZYZA 3OB0H 3M6DA 4FFWC 1F3JB 1HYRC 4M5YH 4P2RB 3G5YA 5J3HC 3P4OA 2H6PB 3IDMB 4Z76A 2FSEA 4XZUB 4L3ED 4JANB 5IMLB 1HXMB 2XWTA 4FMVA 3B7TA 5D5ME 4JREB 5FHAH 3QEQB 3BP4B 4E9QA 4GEIA 3W0WB 1KLFB 2ZKWA 3LIUA 1WBYA 2YSTA 3W3BA 3MRCA 1JXKA 3O8XA 5D1XD 4HLEA 1JDAA 1DVFD 1NCJA 1WV7T 4NZJA 5C7XL 2ZUSA 4HJJH 1K6QH 2NY2D 1ZGLP 4FFYA 2OXGB 4GT7A 1UZ6F 3T0AA 1HHHA 3GI9H 4YO0A 5B38A 4S1DD 3LKPB 1OT4A 2C9SA 3LXAA 3ZYOA 3RWDB 1PLBA 4JFFE 2V9TA 2JB6A 2UV3A 2WIMA 1P7KA 2E6PA 4R8WL 2QVIA 1YJDH 4LCYA 5BRZD 1I9IL 5C07D 5DD1H 1OK8A 1KSRA 3VI4E 1EHXA 2FEDD 2AXFB 1SHWA 4PS4L 5GGVY 4EN2A 2MQCA 3E9UA 4IBWA 3MV7E 2P48B 1AGDB 1BLNB 1HIML 1EAOA 2A99A 1K3IA 3T0EC 1AGEB 4F37F 5E8EB 1RZKL 2YAOA 3O6FD 3VFRA 4OTXH 2AW2A 4ABUA 3QDJD 1CL7H 5EU3A 1XT5A 2DQGH 1R3JB 4DCQA 3FRPG 1HQ4A 4WEUD 3CXDL 5AW7B 2Z31C 1QBAA 3RY6A 1NCDL 3CVBA 3GLDA 5E0FA 1EJOL 2RB8A 1JRHH 4FQXC 2YQ2A 1SXBA 4GXUM 3SQRA 3PDGA 3T0EB 1G5AA 4JFDA 4LQFL 3ARFD 1RKRA 5DJ2A 3UBXA 2I7SA 1DSFH 1FIGL 4B96A 2DIJA 4DZ8B 2H26B 1MNUL 4JM2D 4AYFB 2BJMH 3EYOB 4PJDF 4TLUA 4KNSA 1YN6A 3UH8A 3OAYH 1RSYA 3IU3A 3QO0B 5LWYL 2JLPA 2Z31B 1OEZW 5HI3C 2CO7B 5JHLA 4KMTH 2E3VA 3DV6A 3W2DH 4PRPB 3SJVA 4Z3EA 1L0YA 5EH1A 4FQXB 4C57C 1OCZB 1FCCA 1CGTA 5HDRA 3RWIA 1RZKC 2F0CA 2VLRB 1NEUA 2VZOA 4XCCL 1JHLH 1HHJA 3CH1A 4OZFH 2I5YL 2H3XC 4TS6A 4WNSA 4KRPC 2FEEI 2J21A 1K5NA 3RU8L 3OLGA 1VFMA 2UY6B 4YH6A 4I9WD 2HTKD 3UG5A 5MENA 4M7LT 1MLCB 5DCCA 4EDXA 3UAJC 1HILB 2DLFL 2P5WB 4D0BB 1RVFH 2UZXA 3BIAX 5KYXB 1PEWA 3CDZA 1UWXK 2FDBP 1AAJA 3N9GH 4HFWB 4KRPB 4NDMB 1C1EH 1JVKA 1L9RA 3T2NL 3DV4B 1URIA 2DTSA 4G9FA 5KTEH 1FORH 1I1YB 2OW6A 3CC5A 5FYKD 4O2CB 3HFML 3KDMB 2VAAB 2LAGB 2Y5TA 4HDIA 2K70A 5F6HI 7TAAA 5I75C 3ESNA 2V9UA 1QSEE 2R0KL 4XO4A 4Z7OE 1YEHL 3C08H 4PFEA 2ZG2A 3SB3A 2IOOA 4U4BA 3LRKA 4XB7A 2NNFA 4OCYH 4PJCE 1BFOA 1E8WA 3ZQWA 4L4VD 3OKDA 4A2FA 1L0QA 3R19A 4GQRA 1QRNE 5HI5D 5I75B 3F84A 1AGFB 4ORGB 4X98A 4ZJ9A 1X7QA 4UINH 5AVXB 3EG9A 3OG6B 2VDMB 1GTFA 4WNQB 3WEMA 4OM0H 4CBPA 4EAEA 4OUUB 3NAAH 4OZIA 1NOAA 2CLRB 2X3AA 1T2JA 4XNYL 4KGJA 3VFNA 1IBHA 5F6IC 5HJDA 5K39B 2WTOA 2DMKA 4F37K 3JWNG 1NGZA 1U8IA 5DWUH 2CJTA 4YR6A 5HDOA 3DIFB 5TH2B 1HX0A 1XD1A 4LLWA 1UM4H 3FMGH 3FT3B 1H15B 4U1IB 5JHMA 1KXVC 4GIAA 1KJVB 5CD3A 4NB7A 2C3GA 5F9JB 3NK3A 1H5BA 4P8QA 3QJXA 1JUFA 4N8VG 4PGZA 3I3DA 5F6IB 1EPFA 2QQKL 3QDMB 1CGYA 4P06A 4ECNA 4Q2ZB 1BPVA 3WJMB 5DFVD 1MCKA 3B2PA 5FFGA 5AW4B 4X5PA 1IGJA 2X4TB 2Y7LA 4IGBA 4N1HB 5MEPB 5DK2A 5HGBA 4PGBB 2XWJB 4BFNA 1WJ3A 4MWFB 1WA1X 5JR1H 4KY1H 3BPOC 4AKOA 4YE4L 1UACL 3WMSA 3LRSB 25C8L 3NCEB 5F3HA 4DTGH 2WWMD 2VLKA 5H35A 1ZVSA 5TPWL 4IHOA 2BFVL 1JOIA 5BO1L 1Z5LA 3RQ3A 4CMMA 1KBBA 2PYEA 2QPDB 4Y4FB 3KGRA 5AL0A 1MCHA 5E4EC 2X9WA 3QUXD 2EO1A 4R4ND 4BDVA 2Y07L 2Y2WA 2CK2A 1AMYA 3KNBB 3ZTNH 3BPOB 3PABA 1QBLH 1WBYB 2R4RH 3O8XB 3BQVA 3A6CL 2IQAB 3P11H 5TE7L 4PRHA 3FQTB 1MW3A 1A3LH 4YAQB 1F56A 3P9MB 2WWNA 1MAML 3SGEH 5E4EB 1AXTH 3P54A 4NENB 2FHFA 3NCMA 4L1TA 5HVWA 1DQMH 3V2AR 3OAZK 2DQTL 3WFDL 5H37G 1U21A 2XG4B 4QRQB 3ATFA 3DROA 3DXAA 2CRMA 2BHZA 1OAKH 1RIVL 4OF3A 4QOKA 1C7SA 4UT6L 3H4HA 1H3XA 4YGVA 3S98A 4QTIH 3ECWA 5E8NA 1P0SE 4NN7B 3ZHDA 3F7YA 4GUCA 4L8SC 5C09B 2D7OA 4X0KB 2AMGA 2P4AB 4BZ2L 5EZLA 3ZE1E 1YY9D 3AGVA 4M7LH 1KJ2A 1MVUB 3S88H 5DS8A 3FU0A 2ZWZA 1YUHB 3BH9A 2V0AA 5EHFA 4GMSL 4XNUL 3WS6A 2AKRB 3TXAA 2C34A 5TDOB 2GSGA 1CDYA 5KVFL 1VHPA 2EECA 3TCTA 2O6EA 2A9BA 3KPRB 4L8SB 4R2GD 2XA8L 4UNTA 1SLVA 3SQBB 2WMPB 3FQNB 4OLXH 4PB9L 3RLSA 3UBGA 2Y7SA 4RCAA 2BVQA 5JDSB 3OMNB 1KNOB 2OPCA 4GIPD 2BNUB 5JZ7D 5DD5L 3LZRA 3ECUA 1EEQA 4AIOA 4MD4B 2HKFL 3HG1E 2R56H 3U9PH 3ZTJH 3SJVB 4TVPL 2NY6D 2ZXEB 3CPLA 1KWGA 3CAFA 3MNVB 4X8GA 43C9A 4AK1A 1LEIB 3ULVH 3I9AA 1IQWL 2C3VB 3TOPA 4FZEL 3D6GA 2A73B 4MJIE 2OCCB 2OULB 1NUFA 2YD6A 3EBGA 4OSUL 2A9MH 4DN4H 2BVOB 5DZLA 1C9SA 3UDWA 1CF8H 2IH3A 3ZBMA 1RHFA 1OV8A 1RL1A 4P2RD 5KUMA 3SE3A 3T71A 1RPQA 1HNYA 5CLZA 5TE4L 5I16A 1I8LA 5F88B 2E7BA 5GS0H 1KB3A 1GIGH 5CGTA 3QEQD 4AKQA 4ZMNA 3W0WD 1OD9A 5EWIL 3GMPB 4FFWD 5K93A 3QXWA 3M7OA 5J3HD 1FFNB 5I1DA 1KN4L 4M9OA 4J3BA 3V6FA 4ERSL 3CC5B 2XIBA 4LK4A 2NXYC 5GGQH 3QJUB 5T1KA 3C2AH 3BZ5A 4HAKA 3V0WH 5GRWA 3Q6FB 4X9FA 4APQC 1I1FA 3T65B 3P30H 1XXDC 3MV8A 5MHSE 4QRRD 4FLRA 5DD3L 5K1JA 1G6VK 3AU1B 3F05A 5IBTL 2X88A 2NXYB 5GGTL 1FDLL 3AB0C 4JKNA 4Q9QH 1TJIL 1PSKL 1FFTB 1M05A 5DQ9A 4YPGB 2JXMB 4X7FC 4Z3IA 4HCFA 2GEQA 5D7KE 2BCKB 2V37A 2GJ6E 4PJFB 1AMXA 2PW1A 4CC1A 2O72A 5BXFB 4OV5A 2QQLL 3CZNA 3FB6A 5IKCA 3REWB 3DO7A 4ANVA 4M29A 2R2HA 3LHPH 1A6WL 3AB0B 2ALWA 3BD3A 3ULUH 4Q56A 3T0ED 2C8NA 1NIDA 4HIEA 3Q2VA 3CZGA 2MQGA 1H5BB 3ARSA 3CQPA 4FA6A 3IETB 3WBDA 5J12C 4ZMWA 1JYVA 4DERA 1YECH 2Q3XA 3CK0L 1NPNA 1RI8A 3TCLB 4C56E 4PUBH 4PRPD 2EZ0C 4BRVA 2VXSL 3MDJA 4FQXD 1OSPH 2YOAA 2CUHA 4IGBB 2ZX5A 3I85A 3TNNB 3DMMC 1GTNA 2R1WA 4Z23A 3QUZC 1I1AC 3FBKA 4HZ1A 5FYLL 4B9PA 3W57A 5J12B 1F4XL 3RGVA 4DK5A 1TTAA 1YG9A 4RX4D 1KIUB 5AVYB 4CRPA 4XNDA 1BF8A 1JG9A 3GHEL 5DMIL 1LK3L 3SY6A 1GKOA 4IHOB 3VXRB 2VH5L 2PYEB 3DMMB 2V2WA 4A2MA 4MB5A 1TU2B 2ICCA 1I1AB 3QUZB 1H3PL 3HBGA 3TCXA 3WKPA 5C0AD 4EN3B 4ZTOH 4CNIB 3PABB 3E6FB 1ECYA 5EEZA 5D8JL 4NKMA 1I8IB 2WWOA 2V7NB 1F5WA 1WWAX 1QSFE 3GXMA 4Z0XA 4PWEA 4TV3A 3MLZH 1DUZA 1QD0A 2EJ1A 3EJZC 4UTBL 5HVGB 2B08A 1XCTA 5E4IA 5C0GB 1WITA 1MCEA 1J0HA 5BZWB 2OR9L 3PP4L 2FWSA 3UAJD 3MSPA 5KVGL 5GRZA 1KELL 1VZGA 3RNQA 4RAHA 1VCBC 3PQYA 4O02H 3DROB 1OWWA 3UADA 4E9VA 3SYQA 5AOZA 1OAJA 4JQIL 1BD2B 4RWYL 3BO8B 1AY1L 4JRLA 1GPOH 4QOKB 4ZMXA 1D5MB 3HG2A 4X5RA 4IBLT 1E4XL 2JIXA 4Y5VC 3WTTA 5KBLA 1CFSB 3EFFB 1TCRB 1IGML 3V6OE 3RWHB 2WUCL 4I2XB 4NZFA 1M3IA 2K4AA 5I74C 4AMXA 4X6FB 2F8IA 3BAEH 3B8YA 1QI4A 3LIZH 4UIMA 3K72B 3LH2L 2GJZA 1KJ2B 3WJLC 4F27A 3DGGA 2WANA 1ESOA 1TTBA 3MRGA 5HPOA 3MFFA 4Y5VB 4L37B 5E9DA 3I9GL 1UOWA 3WUWB 3OLIA 4WU5A 1SYSA 5IQLA 1B9KA 3Q44A 4LARH 5ILTH 3FUMA 2V6HA 4ZDHA 2YZ8A 1MI5A 1NMBL 2FD6H 5EC1A 1LILA 3H9HA 1MWAL 2OP4L 4Z7UA 5I74B 3SKNB 3FSVA 3BKCL 1E4WL 2PCPA 2PWHA 4YHNA 2HZHA 5SV4A 2BVQB 4IOSD 1XGYH 2MH4A 1VACA 2YAFA 3LXBA 4LXFA 4Y2DA 1IKFL 1B9ZA 4HUWA 1ASQA 1T2QH 3GK8H 1KYDA 1A1NA 3TX4A 3AG3B 2VCOA 1MHPL 3DETC 3H4FA 3PJSA 4JDTH 4ZZKA 1BX2B 1BOGB 3RY5A 1C8QA 2CO3A 1YYMH 2B1HL 2R83A 1NIEA 4AIEA 1GA2A 2AF2A 1FH5H 1FP5A 3MRDA 4Z7WE 4ZFOL 2DH2A 4FFZH 1OTTD 3OPZL 2OMXA 1NIFA 1JNLL 5BRPA 4ELMB 1IEAA 2EDYA 3KPSE 3OKLA 4M6NH 2OJEA 4JPVH 3T3MF 2QL1A 5CCKL 3W37A 3ARYA 2DQUL 2GJPA 5C6TL 5CN2A 5I16B 1AKJB 1WAAE 1J8HB 1O6SB 2WBJA 4UAHA 1LDPL 2C9QA 3EFDH 1C08A 3U79A 2Q20A 4H44C 4CVXA 5F7DA 5TTRA 2JJUA 5EU6A 1KB5B 4JL2A 4DQOH 4AQOA 1PQZB 4UILL 4N0FA 2WZAA 2HVBA 4ONHB 1JCKA 3GSWA 3H7BA 4K4KA 2E9GA 4XCFH 1ML0A 1PG7H 5CFAA 3IMWA 4KZDL 1BVZA 4HSCX 3JZYA 1KTLB 2BVEA 3D39E 1HCZA 1SYVB 5FYJL 1EO7A 2NR6A 1RAMA 2Z91B 3MV8B 3PFUA 2E59A 4ZFOB 4X7TB 3VX1A 1FNAA 2BNRB 5E6RB 3MLVH 4JFEA 4EZJA 3CDGA 3QNZB 5C09D 4MCNA 1QEXA 1C16B 4H88H 1J5OL 2DMBA 5IQNA 4GKNA 3ZGIA 1T83C 3EH5B 4PVBA 1E9OA 2ESVB 4ZFGH 2J8UA 2EILB 2B1AL 1QNZL 1KFAH 3F7PC 5HDQL 4XMKH 3LQAH 4BHUA 3TYFA 1VGEH 2C7FA 3GMQA 4EIBA 4X5WA 3K71B 4FZ8L 1T4KB 3CZLA 5TE6L 5C9JA 4K7PH 5ENWA 2QPUA 2WTPA 3PJLA 5FO9A 1NMAL 2VR4A 1KTDB 5IHUH 2ZCKL 4D9RD 5BRQA 3UTSE 1R0AH 1LD9B 5C3TA 3BFOA 1PIGA 2ARWA 5IVNA 5FYKH 4DW2L 2C7UB 2VM3A 4E41E 3E80A 3WTXA 1FGVH 3U46B 3CFDA 5CKAA 1UUSA 1CXKA 3K46A 5F7EH 1ZLSL 3TJHC 5I1CL 2OAAA 3ILDA 1NBQA 2ROYA 3I02A 2DEXX 2CR6A 3ZO9A 4LSTH 4CU6A 2Z8RA 5DHVB 5FV1L 1OWRM 2VDPL 2W0FB 1RZ8B 5HBBA 2WJ5A 4GT0A 2F54B 3OZKA 4GP8B 5FFOA 2I9LB 4KJYB 2AZUA 2AJUL 1EO8H 2KZWA 4HC1L 5AYUL 5GZNA 4RIRB 1A22B 2IXQB 2V5YA 5F0PB 4Z7QF 2DI9A 4NI6A 2ROXA 2P24A 4QT5B 1E6OL 4HISA 2HT2D 4XAWH 4M62L 5IMMA 5DA0B 3RNQB 1TTFA 4O02A 1A21A 2YGOA 4I1RA 1EHNA 3CFCH 5DHYA 3UGUA 2CBTA 1AC0A 1YC7A 2BCMA 1PKQA 3B8SA 2O5ZL 4NQVA 1DANT 4XP1H 1V05A 5J57B 1XH0A 4U1JA 4Y4HA 3ENEA 3GDBA 4TVPD 3QXDA 4G7VL 3P3SA 1HSBA 4AL8L 1E5ZA 4JK0D 3RIAF 3VM5A 1H3WM 3IFLH 3QQNA 3DGDA 4F92B 2X70B 2K6WA 4LPWA 5J89A 5DC0A 1F3DJ 4IBTA 1WCBA 3LNEA 1DYZA 3LNIA 3OC8A 3V5HA 1YPZE 1OAQL 1NJ9A 4ELKA 4YXKL 4GOSA 4U6TA 1XO8A 3JWDH 3T1FB 4APQD 5DF0A 3MJ8B 4B9KC 3D12B 4QHKJ 3FU8A 3IJEB 1A7PL 3LS5H 4E9WA 1OGAD 2VDPB 4FXKC 3SPVA 3VRLE 1K4DA 4PH8A 5DJ8A 4B9IA 5HHPA 4XNAA 1GKEA 4L3EA 2PCPB 3F85A 2AQSA 3PAUA 1QW9A 1TZHA 4LCWE 5AUMA 4OF0A 1I4FA 1DJZA 1JXFA 1SLUA 3OLDA 1IZKA 4QAMB 4L5FE 3WY4A 4FXKB 4QRBA 3S37X 3UJIH 1EGJH 1DVFA 4MNGE 5I15L 4FFZA 3T8VA 4N0UB 5JW4M 3IMVA 3MRJB 5TDPA 3D34A 5GRJL 4YMPA 1SJHB 1VENA 2B9AA 2Y6TE 2JKTM 2E9WA 3HVNA 1DQDL 4LASL 4XOAA 4YHPA 3VFGH 5JORB 1ZXKA 1TETL 4WFFD 5DVPA 3S97C 3UBXG 4BYHA 4RFOH 5C0BB 4PWIA 4NQSB 1PZAA 3GXDA 1QHPA 1AD9B 3S96A 1HJBC 3F12B 3QUZD 1I1AD 2X4OA 5I6XC 4XI5C 2Z7YA 2R0ZH 3D87B 1JF1B 2AQ1A 3MCKA 5JTWA 3DBXA 4J3OD 3NTCH 3F62A 1S9YB 3QUMH 2EP6A 1IC5H 1ULVA 3O3EA 3LEXB 2D7QA 1RUPL 5CLXA 5D6DC 3QDJA 5CM1A 1MFUA 2XETA 4QJ5B 4P4KB 1SDYA 4O2EB 5DEFB 4BFOA 3JSSA 3A4AA 3S4SA 1AS8A 2PWFA 3D85B 4B7IA 3EO9L 2VDQB 4OVUA 3NJVA 5IJBC 3B9KC 4KXCA 3AWEA 4GSDH 5E6SB 2VQ1B 3NG5A 3PIQA 1BD2D 5DMGC 1EZVX 1XGUB 3AMKA 4PLNC 5I0VA 1TSRA 3NJXA 4KI5C 3EJZD 3HUJE 4G43A 3PV6B 4UQCA 3FQXB 5EU7E 2XWBA 3ATEA 2D0GA 4WKZB 2QR0A 2Q8AL 4V11A 3VWKA 1HI6B 5C0RH 1BBDL 3AXLB 5JXAH 1WYJA 5FYLD 3B9KB 2OSLB 3VRJB 2D7PA 4OQTL 5BS0E 1S7RB 5I8OH 2AAAA 2YBGA 1ZLWK 1IGCL 3IPBA 4XVJH 2R39A 3RIAK 3MAWA 3KPLA 1QHQA 5B1BB 1JE6A 1D5RA 4BQ9A 3GTTA 4IS6A 4BUGA 3NESA 4YDJB 4DQAA 3VXNA 1P4UA 2FRGP 2QBWA 4GP4B 4HUUA 4MJHA 1S6NA 3N91A 3FOLB 3VI3B 4OZGB 3GEWB 4UIKL 1KLUB 3LV3A 5AKTA 3OGCB 4IKKA 3NQIA 5EUOE 4EIGB 1S7XB 2BIOA 4PRIA 1KLGB 4JO8A 1JL8A 4GMTH 4GG6F 2HT4C 2FGZA 2XV6B 1IEBA 2Z7UA 5IQOA 2UXVA 4J12A 1O9VA 3V4PL 5EIVA 1T7WA 4O2FB 5DJDA 2P49B 3MUGA 4XC1H 3J07A 3U25A 4MNQE 3L9RB 2DLHA 4FG2A 4W9JC 1ZA6B 4RAUA 3FUNA 1GGCH 3SGDH 2FO1A 3ZY7A 1KBGH 4ZFZB 2F8OA 3DVNB 3T4AA 2A9DA 4RZKA 3BWZA 2PPDA 2V9RA 3OXSB 1DFBH 4L4VA 3B7SA 4X5XB 1NOLA 2F74A 5I1AA 1FVCB 5EBLB 4MA3B 4JKWA 1JF6A 2WXQA 2GABA 3VGEA 2ITCB 1KT2A 1IGIL 5B8CA 5D7JA 2DQJH 2OMVB 4XOCA 3EDJA 4GUQA 3N1MC 5L4JA 1IRAY 3RVTC 1M1XB 3QDGE 4PJEE 4Z7NB 3GBMH 5IB2A 2UY7B 3KGTA 3LD8B 5HDBE 3NFNB 4BZ1H 5IEKA 2B4CC 5D7EA 1E5YA 2H6OA 4GKZB 4N9GA 4NSKB 4Z7UF 1CGVA 1MHEB 1MCWM 3O4LE 5DO8A 3S3JA 2YC1A 1KJMB 4EDWL 4ZAKC 5JMOC 4JDVB 1HSAA 5AD0A 3U1SH 4UU9A 2HRHA 5HYJE 2E7DA 2DI7A 5FKAB 5KOVC 5C7XH 4ZSOE 1SF3A 1XHHA 3SDXA 3AXIA 4Y2OB 2BNRD 3WTYA 3T3PB 3ULVF 2X41A 3APNA 3K74B 4CU7A 3QEGH 4YGAB 3SCMC 3ECVA 4CVZB 2IEPA 2RCSL 4ZAKB 3QWRD 1ES0B 4K3JL 5EO0B 2IAMC 4FI7A 4A2HA 4R8WH 5M7QA 3APFA 4OW6A 1KXTA 4Y16B 3WCYA 2GW5A 4QI3A 3QWOB 2IOIA 2VN5A 1OF0A 3GUFA 4R83A 3RWFB 3QJVB 4UQ2A 4PS4H 2EDWA 4QY8A 4N2KA 3SCMB 1IAMA 3A4DA 5CGBA 4KI1A 1HIMH 3N41F 5I8KL 4KTGA 4P2QA 2Q2LA 2IAMB 1A66A 1RJLA 1F11B 3LYRA 2A4CA 2YA2A 3MZGB 3V0VA 5B1JC 3R1GL 3BZFA 3FQWA 3GMNB 3ARBC 5ANHA 3V0IA 4KITB 1EGJA 1T0MA 3DLQR 4UDTA 3M07A 2ATPB 3MUY1 3CXDH 5FO8A 4NUMA 1CICA 3BAIA 3RWEA 4YVUA 1WFTA 1WBXB 3S2CA 3BXNB 3WUWG 5CBAB 2XBDA 1X44A 5T5NF 1DJHA 1BEYL 1JGDB 1F13A 4M61B 4R96B 4EOWL 3GMRB 3GSNL 2WQAA 5HI4C 2BO0A 5FYJD 1FIGH 1D7BA 5T8IA 3L5IA 3JVGC 1M71B 1ZJAA 3D2TA 2FEEL 5F89A 3IN0A 3G04A 3MREB 5LWYH 4MAZA 4Y4KA 2K7PA 3KBEA 2O4EA 1Q8MA 5D4HA 4KKCC 1PX3A 2YUVA 3LN4B 3MYJB 4Y19E 4IOFC 2N0KA 4XPGL 4ATTA 2KZBA 3KPTA 5CJ5A 2F54D 4WDIA 2J43A 3QUMA 1EXGA 3TJHD 1H3GA 1NPJA 3T77B 5B3JE 3MFGB 2I5YH 3HHSA 4Z3TA 5L4MA 1CF1A 4H1LB 3TGXA 5BOJA 1L7TL 3SDYL 1LHZA 2CPCA 4L0PB 2J8UF 3GRWL 3S36X 3L1OH 3ULUF 3OR7B 4YEEA 3VH8A 2P52A 4AITA 4QRPD 1S7QB 2G9HB 4ALAC 1HCFX 1QSED 1UOVA 1IFRA 4PJHE 2WK2A 1FFRA 3BIBX 5AAMC 5J5EA 4Z9KB 1HHGA 1NCAH 1LEKA 3B7RL 3HVDA 4NQDD 3T2NH 5TK4A 4JR9L 1DBKL 4PJ9C 4DN3H 1CMOA 3DRQA 3GSNB 3VFVA 1IQDB 1IBYA 4LHJB 5GGUA 3HFMH 4NAJA 4UWQB 1RIUL 1X5ZA 2C9RA 1JGEA 5LBVA 1A4KA 1I3UA 4GKOA 3QPXL 4XXWA 5E51A 3UTTA 2LR4A 4OUOA 3S37L 1YEHH 1AZRA 4YSQA 3FRUB 2FT6A 4XBMA 3HNTL 3K6FA 1UUNA 2KDGA 4YHKL 3VRIB 4TSAL 3X3GL 1A2YA 3F5WB 1U95A 1YEDB 3NCFB 4NO5A 2QMJA 2R2BB 2OTUA 1GL4B 3FUDA 2ADYA 4F57H 4Q6YA 4QXUH 1EBPA 2EYTB 2MHAA 2PABA 2WXLA 4MCZB 4BH8A 2BXZA 1ZPLA 3BP7A 5ALBL 1NAML 4WO4C 4ODSH 4PV8B 1IJ9A 5A2CA 1I31A 3DUHA 4YQXL 1Z32X 1EAJA 4NWUH 3K7UA 4OGYL 1WFIA 2FK9A 1HOCA 2VDLB 3KXFB 1YY8B 3FO2A 1SNRA 2WQRA 4GI6A 3LNHA 3ZHFA 4AMKL 5ICXA 1G7IB 3VMNA 2I9TA 1SFDA 3NZ8A 4LLQA 4F2MB 4RGNC 1AP2A 4WO4B 1KYOJ 2QFPA 1J5CA 1R3LA 3VQ2C 4AJVA 3SYCA 2QQKH 2W07B 3NCCB 5C0EA 1FPTH 2NT0A 4UM8A 2R0LL 2F8XC 1VERA 2EDFA 4HKZA 4AC4A 5C0BD 4PHZA 3GXTA 4DUXA 3GJFH 5ANMA 1RZGB 5KSAC 1EDYA 4DK3A 4QRRA 3FUJA 3TT1L 1HE7A 4RGNB 4K5LA 5KYNA 4U6XA 2DKMA 3WDHA 5CNHA 1GVIA 1JV2B 4WJ5B 3CVHL 1T22B 1PX4A 2YMOA 3L1FA 5B8CB 3WKML 4YE4H 1UACH 5CR1A 2X9XA 4HGWB 1U8KA 25C8H 3RTQC 3U0WL 3ORJA 4UB0H 3NP3A 5AL8A 5DD6B 5KSAB 2RAMA 3LNGA 4BZ1A 2BFVH 5BO1H 1WDAA 3F7RA 3V5DA 2DJMA 4A7VA 4A7SA 5L2JA 4QJ3B 4MSWA 2X2HA 4XI5D 5DZJA 3D85D 2VIRB 1NAMB 4BCXA 2IH1B 3RWGB 2Y07H 3MRMA 2ICWJ 4U6HA 1N6QL 3FQYA 3RB5A 4HPOL 3RTQB 4DPRA 3F6JA 1XH1A 5BUAA 4J3VA 4JVUA 2P80D 5IVXE 2ZE0A 3SDXB 1W8OA 4NCDA 2PO6A 3VXUE 3B9KD 1ED3B 4H0GA 1ZXQA 3TIEB 3WFDH 2DQTH 5DMGD 1B3JA 5ID0B 3ARVA 3ZDZB 4B9FA 2LW3A 4KI5D 1N2RA 3HI5L 3D48R 2P8LB 1KXTB 4OJFH 4RX4A 2DAVA 2ARJA 4CC4A 4HKBA 4B0MM 2CR0A 4XMUA 2Q6WA 2AQTA 1BIHA 4L1SA 1FC1A 3HKZA 4LVHC 4UQ2B 3MZTA 3VFPB 2LABA 3D7PA 1XF4A 1LE5A 1DJIA 3WL9A 5ABDE 2XY1A 3EH3B 3PWVA 4NQCE 1LWHA 2VABB 1OIOA 1M7IB 5C0AA 1TVBB 3V0VB 2D3LA 3SKOA 5I8EA 3BVTA 5KVDL 3HI6H 5C08D 4LVHB 4GMSH 1HTYA 5T3XL 1KC5L 3O11A 5KVFH 5FUCE 3FZUC 2ZNXA 5A6MA 2CDGA 1S7WA 3LRLA 2XA8H 4FABL 2FZ3B 3VD7A 3KZ8A 4PB9H 2ADGB 1DDTA 2WAQA 3LQZB 5ERWB 3R7QA 4FQCL 2NNAB 1KXQE 2ZTBA 3MLPA 1X5GA 4PJAE 2NQDA 4R7NB 1P4LA 2DPKA 5E1HB 3N43B 5DD5H 3ZMNA 4FXTA 2WXJA 4PJBB 3WIIL 2BSSB 1OP5H 1SJMA 4JM2F 5F7NC 3TU6A 4GFTB 3EHBC 4WY7H 5AW0B 5F3BB 5KUKA 1J48A 3EO0A 5FO7A 1JBJA 2PYFA 3ZMEA 3O6LL 1NWPA 3QB7C 4XXDB 3VFUB 3QJRB 3OHXC 1KEML 3M8OH 2BX5A 4OM1L 4WFGD 5EN3A 5F70A 4NI3A 2DM3A 3AG1B 1FYTB 4FZEH 5JHBA 3BGFC 4H26B 3LZQA 4WK2B 5EBGA 3MLXL 2NCMA 3NZHH 1N5YH 1EFXD 1YNLH 3OJMB 2D9CA 4OSUH 3K6NA 1GZPB 4PJGB 4HS6B 1AC6A 2FH6A 1XGZA 4BKSC 1BYNA 4L5FL 1I8MB 1ACZA 3M17A 5EEWA 4UANA 4OZHF 3N42F 1LO4L 1GZQA 2FH8A 2J1YA 5HYEA 5TE4H 4XE5B 5JQHC 4MJ6A 4BE6A 1LYQA 3BGFB 3FAXA 3QISA 3FTXA 5C9KA 1X4ZA 3TO4C 2X38A 5D1QA 1I1RA 4F9LA 3DX3A 5DRXB 3RVTD 2DWYA 3FCTA 4YX2L 2GCYA 2FJHA 4WF7A 3MROA 4ERSH 4MMYB 1F58L 4HS3A 1AGBB 1AQDB 1N64H 5I24A 1FN4A 4A37A 3HG4A 3CFBA 1ORQA 3TO4B 3RVXC 1FVDB 2HFTA 4GSRA 3BSHA 4ZAKD 2BOCB 2G75B 2R0WL 2AXJA 3TBTB 4U0RC 3LDBC 1D3CA 3E8UL 5GJSH 4OLZL 3UGXA 4YXLL 4WI0B 2ICWA 2WTRB 5DD3H 1U8JB 4JO4L 4X4ME 5E8PA 5GGTH 2XVKA 2AXGB 3SCMD 3DK2A 1FDLH 4PGJA 2MHAB 3EYSL 3DVIA 3WNMA 1PLAA 1PSKH 4XMLL 4F8NA 2F2HA 4U0RB 1TVHA 3LDBB 4NQXB 4K8RL 3TEYA 1I9RL 1GCYA 1C5BH 5I28A 1A1MA 4J3OH 3ERXA 1ZSHA 4PTUB 1CT8A 1JGUL 4U33A 3TPUA 3SBQA 1F90L 2WO3B 5DR5L 4Z8FL 1JPFA 2VLLB 1LWRA 2XLLA 1NGPL 2VWEE 3KWTA 4YHMH 1T80A 3LKNA 3EDDA 3OX8A 4P9HL 4PG2A 5CHNB 3ARBD 4AYMC 1IO4C 2ZCHL 4GXFA 4W9KC 1MZZA 1NCOA 3S36L 4W9IC 1SMAA 3CK0H 3GJFA 1O7DE 4PJDE 3U1PA 1Q1PA 2VXSH 2DLTA 2PPAA 2EXWC 4W9GC 1MDAA 5HI4D 1H3TA 2I60L 1A8ZA 4LEXL 1KB9J 4K8RC 1UURA 5GIRB 4QCIA 3SBWC 3QRFM 5E94A 3VD4A 3R06B 1JPST 1BZ9A 3L3HA 4WW2C 2DMCA 3GHEH 4XXCA 5DMIH 4JNXA 4KKCD 2X7LB 2VH5H 2ORBL 2EIMB 4HEPG 4U3HA 5J1AB 4IOFD 4B27A 5K5YA 4RA3A 1H3PH 4Z0BH 1IM9B 2YD7A 4P9HC 3QNXA 1PY4A 4QYOA 2FO4A 5D8JH 4EO5A 3QQ3A 1UFUA 4MNHA 2AJXL 2KZKA 3FQRA 4UYPA 4LSVL 4PWFA 4DPAX 5CGMA 4BFRA 4FQ1L 3QO1B 4X99A 1G7MB 1NEZA 4HLJA 2LU3A 4WWKC 2OR9H 2ADFH 3MRLA 3B9VA 4JHZA 5KVGH 3EH4B 4GAGL 1KELH 3MBEC 7PAZA 4QGTA 1L7IL 1P5VB 4ZMQA 3JV6A 3PUCA 4Y7OC 1FL3B 4JQIH 2Q87A 1RZFL 4RWYH 4Z5RB 3GMLA 4OT1L 1MJ8L 2ARJB 4HKBB 1MFEH 1I8KA 1E4XH 5D4QA 1BQHA 4WWKB 2ZG1A 3U83A 1HS6A 3WE1A 1EEYA 1FNSL 1IGMH 3MBEB 2YMXL 1U3JA 1U8MA 1HVXA 2WUCH 1L6PA 2X6CA 2AJSL 3T0VA 2P8PA 4JFXB 3AREA 3HE7C 1UA6L 4XH2B 3LH2H 5CJXA 5DJ0B 4YHOL 5ACZA 1HH6A 2XZAL 1A4BA 3I9GH 3L2MA 4M5SA 3NIGB 1ZEAL 3O11B 2R2CA 3KCPA 2FJGB 1YLBB 4TTDC 1S9WB 5FOBA 1NMBH 3FF8A 4FDWA 1MWAH 2OP4H 3HE7B 4AGPA 4G83A 3BKCH 4WO4D 2Y23A 4G7SB 2DWXA 4QNPF 2APFA 4K2UH 3TA4D 2BRQA 3QRGH 2R2EA 1SXSA 1BAGA 3MRBA 2YR3A 1S9XB 1VB9A 2WZPD 1MHPH 3DTXA 2H2PD 1E9PB 1CFNA 1Y18B 4A04A 2B1HH 4RGND 1JI2A 5ESVB 1RHHB 2CIIA 3CHOA 4DZBB 5EEUA 4IOIA 5ISZB 3TEUA 2PP7A 3OPZH 4X42A 4XCEA 1FFPA 3PHOA 4LGRB 2A0LD 3G5WA 1CLYL 3H0TA 4XMZA 4M93C 5LKNA 1YMMB 2EDOA 2IPTL 4LIQE 5D2LB 5CCKH 3QCVH 5FCSH 5EB9A 5KSAD 2DQUH 4ZX4A 1PZ5B 4G42A 1OGAA 3IFNL 4GEJA 4M3HA 5FDWB 3PWJA 1FVEA 5F9DC 5FGCB 5C6TH 3X11B 5I1LA 3P9LA 1SEBA 5E5MA 4EQ3A 3HKFA 5I6MA 4RMSA 1YC8A 2P26A 3C6LC 3TEXA 3KM1A 2GT9A 4M93B 4NPYA 3KHQA 5GS1C 3RTQD 2CPUA 2IAAC 4APXA 3BI9X 4CC0A 1MW0A 1N8ZA 3AABA 4PJXB 3TV3L 1F2QA 3ARGA 1FZOA 4UILH 4RISH 4OF5A 4ZW6A 5LCVL 2F15A 3BPLC 3H3BC 1NFDB 4MJ4A 1NKOA 4KO9A 5BNXD 5D72L 4H1LG 3C6LB 4HHAB 3BPCB 5GS1B 3D0LA 4RDQF 1U93A 5EU5A 4F1SA 1DFXA 4LLDB 3EOBA 5CIPH 2W9LA 3C8KA 5C0JB 3PHQA 1XDTT 3BPLB 4R5XA 2FAUA 5FAAA 1R3HB 4XO8A 3FO0L 1JPSH 4HCRL 2Z0BA 2BSEA 4YHZL 4AUJA 1NGXA 1IBGL 1SLWA 2ZAHA 2B59A 1A7OL 1UB6B 2XIIA 3PNWB 2CXKA 2M1KA 4ZX5A 3HC4L 2X2UA 3X2QB 5TGBA 1JFHA 3U4KA 5GGRB 2CU9A 1JERA 4NRYB 5LVEA 1MXDA 2B1AH 1QNZH 1R3IL 3JTTA 1TF4A 4DP8X 3VFOB 2UUDH 3MVSA 1XSKA 3FB7A 1FLRL 2L7QA 4LSRH 4GAYA 3GIVA 2BNQE 4ZD3L 3ZL1A 2XZCL 2I7OA 1KGCE 4FZ8H 5TE6H 1R34A 3IXTB 3GSXA 5IFJA 4PIRF 5IEHB 5DRZB 3FZUD 3CQQA 3AZUA 4QIRA 5EBWB 3WUZA 5E03A 4EI0A 3RFRA 2ZCKH 3HI1B 3HZKB 1U2CA 2EEBA 4GLRH 4FEIA 2E75C 2G2RA 2AQRA 4XTRC 4DW2H 3RDJA 1FYTD 1I7UA 1MQKH 4I3RL 3MRPB 3U7YH 1C5DB 2Q3ZA 3MO1B 2EC8A 3EHBD 3BISA 3N50A 1N5AB 2H9GA 2UZPA 4KC3B 1GRWA 3ZGHA 1NFIB 1O7SA 3QQ4B 5D71L 1UXWA 4A6YB 1QW8A 4JZJC 5B7EA 2Z4QA 3AT8A 5FA4B 4FQQB 1CDJA 2QZQA 4J8RB 2B77A 2FYYB 4DP9X 4E5XB 4DEPC 4HC1H 5T3XD 1EANA 2MSPA 4XPAL 5E6UB 4X99B 32C2A 3QG6A 1EX0A 4HOZA 4UV4L 4AX3A 3QCTH 4HPHA 4XWGL 1QBBA 3MLRH 4U1NA 4JZJB 2PN5A 1X5MA 1UCBL 3MRLB 3RPBA 2FWOA 5IJKC 2YAHA 2AEPL 1NIAA 3RVWC 4Z3FA 1KPRA 2VR6A 2FJFA 4KXZI 4DEPB 3QA3B 4ZI8A 4JQIA 3T2LA 3TO4D 1JNJA 4KHTL 3O2WL 3FFCB 1DZ0A 1JMXA 1MCJA 2ZF9A 4OLUH 4D9LL 4Y9CA 5E2WL 2PXYA 3C6SA 3E2HC 3NSCA 5FK9A 2H1XA 2IANE 4AL8H 1R5VB 2DQEL 4MDJB 1T5WA 2F08A 1AIFA 5D4JA 5HY9A 4LVNC 2G2PA 4FQLH 2VZSA 3UXFA 4ZFFA 1RXLA 3RVXD 4QTFA 2DD8L 4I3GA 3T2OA 2J56A 5D5MA 3DWTA 1IBDA 3UTPD 5EEVA 3E2HB 4YXKH 5SV3A 2KI6A 3L3DA 3Q3GB 1PL3A 4P49A 1A7PH 1NGQL 4P3DB 1E2ZA 3LN5A 3ZKMD 1MWAA 3ZYIA 4YDVA 1M1SA 3WIHL 2CGYA 2X4QB 4LBEA 4BUQA 1JZEA 1JZGA 4QRTB 4KUZL 2OTWA 2XY2A 1Y1UA 5DJYA 4CVUA 3GNML 2FQEA 3BESR 3GF8A 4JFFA 4AZ8A 5D7LE 4YZFF 3VXSB 4YSPA 4QLWA 5J11C 2ID5A 4PY8J 1YNTB 2J6WA 4QD2E 2N0MA 4J27A 5DZOA 2Q86B 1A4JA 2GSIA 4TNVF 3VI4A 5I15H 1I53A 1LO2L 4DP1X 2CIIB 3PL6A 4YDNA 1MFCL 3IF1A 1S8DA 4UNVA 3MV7A 3EYFA 1JGIA 4LASH 4W4NA 2GI7A 3JBG7 4HJUA 1DQDH 1JSYA 3VSQA 1T3FB 3CBRA 4RSYA 1TETH 1U2YA 3MOBH 4ZUSB 5J11B 3QWRA 5IB5B 2VAJA 1QFHA 3UG4A 2J1XA 2XKSA 5E8OA 3SO5A 1NBZB 3TF4A 3ML8A 4FEMA 3BMVA 4K8RD 1MIEL 1IM9D 2ALAA 1ETZA 2HP4A 2QHRH 3KLAB 2FATL 2QGCA 4AQEB 2GTZB 5ITBH 4A68A 1T83A 5D2NE 1BZDA 1TUPA 1XXFC 5E8DL 5LXGH 3D2UB 3HPJB 1T6VN 4M8RA 3VU1A 3D4YA 1QI3A 1J8RA 2VJ8A 1A6PA 1OZTG 1RPKA 3NOIA 4XBPB 3WXWL 3BKML 1K4CB 4OCRL 4H40A 5BS0D 1RUQH 3EO9H 5GS2D 3ISRA 4BFIB 1XZWA 1ZWIA 3Q2WA 2VL4A 2XJKA 4MGXA 4PHXA 4RFNB 2Q7AA 1MCLA 3GRGA 4QRAA 1RIHH 1EERB 1ZAGA 1MJJB 5CIPA 2GHZA 3STLA 4BV1A 3CFEA 4IRSA 3C8KB 4LQ1A 4XBGA 5CEXA 2W8CA 3MBWB 2D31B 4WWKD 2VUOA 2Q8AH 4XHQA 1T1XB 1BBDH 3GIZL 2BW4A 3FTGB 5EF3A 2R9HC 3RHWF 5CD5C 1SOXA 4OCXH 1IGCH 4G2AA 5I1EL 5HYFA 5HTSA 3MLYL 3DSNA 4FXLA 4P48A 5EBMA 3RL2B 2FL5A 4JY4B 1OO2A 3CHQA 4NXSA 3MXVL 4OB5L 5HJ3B 2OMZA 1X9LA 1B0RA 3C9NA 3JTTB 1QNIA 2ZSVB 4JBSA 2XN2A 3MOQA 4UIKH 2X4RA 1UH3A 2WCSA 2H2SD 5INCA 5T3ZE 4QRPA 5DTFA 4MMZA 4M4RA 3OKOB 1QSEA 3V4VL 7FABH 5CINL 1KYOK 4KGLA 5TFSH 3LPFA 4FLSA 3VXOB 1OANA 4B60A 3P77B 3KPMA 3X13B 4EUPB 1S9VB 3BRGC 4TTDD 5EZOL 4FG0A 4PJCA 4NQDA 4PRAA 3V4PH 1GS8A 2HX9A 1INQB 3DK0A 2Y06L 3FCSA 2RFXA 1QRNA 3M1CA 2Z92A 4OU3A 5E6YA 4ZFQA 2WXFA 5GJTL 5CN1A 2BVPB 5ISZD 4PGDB 4AJ0A 3UACA 2MEJB 2WHVA 4TNVK 1MCQA 5GGVL 3ILPB 4E9TA 4TUKL 2Q1EA 1YMMD 1JWUA 2OX5A 3MX0A 4DVBA 3BHBB 3QDGD 1UOLA 2DW5A 2H9GB 3VFMA 3H9SE 5IFAH 4Y9EA 1Z66A 3T0WA 4KZCA 2DZEA 1WFUA 2E7LC 3AS2A 3OM3B 4XN2A 4HC1A 3O4LD 3ZL4L 1W15A 4FNTA 1U8QA 4IJ3C 3RBSA 1I3RB 3QZNA 1B6UA 1IGIH 5GSVA 1BA9A 1XGPB 3FT4B 1YUKB 3Q8BA 5B39A 1R5WB 4HBCH 4OBSA 2P1YA 5GRUH 5EIIA 4RAVA 1FI8C 4NNPH 4L3CB 5I8CA 2G4EA 4IBUA 3IVKA 1S7UA 2H8PB 2Y1VA 3C6LD 4FMFA 4MBRA 3VGHA 4X6EA 2Q10A 3BN3B 1ZVHA 4OAWA 4WW1A 3QH3B 5HHVH 5K33A 3V7AG 1K5WA 4EDWH 2K9UA 3WLBA 1RV6X 1BBJB 1X6NA 2Z8WC 4MXVE 2XN9B 3ZIMA 1UC6A 4KOCA 1OM3L 5IHLB 4N8CL 4YSUA 1VLXA 4EZMA 1IGFL 1DO6A 1HHIA 2X44D 4OGXH 1IL1B 1I7ZB 5L8KB 1BMWA 3GJFK 1WGOA 3KWVA 4F33A 3SGJC 3VWJC 2ADIA 3DUSB 2MOQA 1BWWA 3RHWK 2DKUA 4B9GA 5IQMA 3MV9B 3D0VA 3VX0A 4PP1C 3G5ZA 3LN5B 3QNYA 1N70A 3D4ZA 1LNUB 5IF0A 4GRLC 4Y1TA 1AOZA 1QR1A 2B7DT 3B2MA 4GXVL 1BM7A 3EDFA 5IM7B 1XGQB 3QZOA 5G4OA 3F6IA 2OMUA 4FNPA 2V2TA 4GO6B 3EJTA 4KJQC 1QTSA 1DQJA 1IBZA 2XG5B 5GS3A 2BC4A 4JRXE 1BMGA 1DDHB 4P2OC 5D1ZI 3NABH 2UWEE 1KIRB 1ZS8A 4GAJL 3COOA 3BZDA 4QGYA 1Z6JT 2F53B 3UTQB 1XCWA 1JVOA 3P69A 2RJMA 1BEYH 1FSKC 4UT9L 4FP8L 1KTKE 3FB8B 1I3VA 2IQ9L 2VE6A 1PYWB 1MRFL 2MMXA 3UTZA 1MHHA 2E4TA 5AVUB 1QVOB 4JDZA 4AV5A 2E76C 2X1WL 1F8TH 4ZK8A 3UIYA 3SGKC 4UMSA 1B2WH 1QFWM 1QLEB 4H0HB 4QHUB 1TCMA 1AD0A 3OKMB 2BDNL 3AACA 3K91A 4XCYA 4JFOB 3LPWA 3AT0A 4XTRD 3CX5J 3K6SA 1U8HB 1XB6A 3FONB 5I1HH 2OQJB 5IIEA 3PAVA 1KEGL 4R4BA 5EUKB 2IFFL 3DVGA 1U8NA 4FTVD 1M2VA 4GPVA 4ADJA 3BUBA 4J3OF 3W56A 4PW3A 1I3GL 4PY7A 5CKGA 2QVKA 4PG9A 5C08A 3HG1A 2ZXGA 1TO4A 4L4TB 2VW7A 1W0WB 4LRNH 3D3VE 4Z7QE 1N12A 5I6KA 1E5BA 1QQDB 1HQRA 2QVTA 4S1RH 2MCG1 1I7TB 3WLWC 1S3KH 1K3ZA 1DJSA 4D7BA 1RD6A 1X4XA 1NUGA 1ZIBA 4IRSB 4PR5B 4HUMB 1QWUA 3SY0A 4F8LA 2Z6FA 4MJIA 2GVYA 4JPIB 4MB1A 4JR9H 4F7CB 1DBKH 1L9QA 1LQBC 1RURL 2J5LC 3KYOB 4K3DL 4PV9B 1RP9A 5ETUB 4B5ZA 3H8NA 3O2DL 3RVWD 3MRRB 3WN5A 3NSDA 1OP5K 3QAZB 1BF5A 3FS9A 4AM0Q 5DZAA 2M26A 2GJRA 5F7AA 1RK0A 5KW9H 3HNTH 4F7PA 2QJDA 2J5LB 4YHKH 2OMZB 1VEPA 4TSAH 4G7RB 4ZXBA 2VC2L 1VKXB 5HGHA 2DYRB 1M7UA 2WNWA 3KS0J 3D8MA 2X4RB 1ZT7A 3PGFH 1SBSH 1RH8A 2WCPA 3AAZA 5BOZG 5HYSA 5IJVB 1JHTA 3IS1X 4IBQA 3AUWB 1I7RB 4YE0A 3ZKND 5ALBH 2X5PA 1CFQB 5IOPB 3VXMB 4CGTA 4R9HA 4GUOA 1RZJL 5FGRA 4YQXH 5SWSD 3T2QA 1HINH 4OGYH 3V4PA 2A4EA 1UA3A 3X1GA 5I6OA 5B3SB 3ARTA 3US1A 4AMKH 3FB5A 1XR8A 1XBRA 4LFHG 4PBXA 2FIRT 4WUKH 3RJOA 5CSZB 4A38A 3N2JA 4XPBL 4ZUTA 1JFQH 4EKJA 1MCSA 1KB9K 1KG0B 1WBZA 2Q2EB 3NCYS 2GJ6A 3MX0B 4H8WH 4FKEA 5HHQA 3BKJL 2R0LH 3MCYA 3W9DA 4G7QB 1PFOA 4JFWA 4DVRL 1FNHA 3DJZA 1G43A 2YJLA 1X5HA 1WT5C 2BIIA 4X6CB 2WLLB 3DTUB 5GRVL 2CD0A 5JIMA 3OR6A 2BWDA 4C47A 2FLBT 3VFSA 3CVHH 1SDDA 1USZA 1XTMA 3EGSA 3U0WH 3F58H 3M7FB 2QSCL 3EJYD 1ORSA 2J88L 4UAOB 4Y9FA 4C56A 4QLRA 4UDUA 4HQQL 1RY7B 3NJGA 5HHOE 1IKNA 3S34H 2OMYA 2W0KA 3BRFA 2EO7A 3FSWA 1N6QH 5JYLA 4HPOH 5GSRA 2FBJL 1I9EA 1T89A 4XP9L 4AXWB 4BKLA 3RFZA 4E5XG 4WI5A 1TNMA 1CD9B 1D2PA 1CXHA 2WOYA 4TSBH 2XPZA 2EIBA 3BUIA 1HAUA 1MW1A 3B3IB 2HLFC 2O30A 3VI4F 5JOFA 2DQIL 1LE9A 3MJ7B 2RD0A 1FAIH 5DRNB 4E0RB 2DYPA 3Q8EA 3HI5H 4MQ7A 4GW5A 1PF3A 4OCSL 1HE8A 1RP8A 2ZG3A 3KPOA 1QSFA 2D7TL 3TEZA 2VL5A 1Z9MA 2NY3C 2R9HD 3UYPB 2YA1A 1BOYA 1HAWA 4CUCA 4MQXC 5CD5D 2ICEA 5IQ7L 4QO1B 3T1WA 3DECA 2EC9U 2OMUB 1Q94B 2XACC 3TBVA 4MAYD 5EOCH 4ZS7H 1SZNA 5GRXG 3BVXA 1F4WL 3MLTB 1A14H 2XPGB 3US0A 3OL2A 1BDYA 1JD7A 5KVDH 2QTVA 2NY3B 4JPWH 3O45B 3TVMD 5T3XH 1KC5H 2HG5A 4HKXB 4GG6E 3RAJH 5HHME 1VADB 4XNMB 2F7IA 3V6OA 4U1MB 2GPZA 2VQUA 1XD0A 4H13C 5EO1B 4F15C 3I6GB 3LJ3A 3PQYE 3WIIH 4Z77A 1IGYA 2Z1PA 3KPQB 1RERA 4BD4A 1JYWA 1DVSA 1WFOA 1TR7A 3O6LH 4V33A 1T21A 4YL4A 4AGNA 2EEAA