1UOLA

Crystal structure of the human p53 core domain mutant m133l/v203a/n239y/n268d at 1.9 a resolution.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
195
structure length
195
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Crystal Structure of a Superstable Mutant of Human P53 Core Domain. Insights Into the Mechanism of Rescuing Oncogenic Mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 50
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1uolA00
4IBSA 1KZYA 1YCSA 3D07A 3D0AA 4AGLA 5A7BA 4AGQA 2BIQA 2J6WA 1GZHA 2BIOA 2X0WA 4IJTA 3WTVA 2J1YA 3D08A 1H9DA 4QO1B 5BUAA 3EXJA 5AOKA 2IOOA 5AOJA 3WTTA 2FEJA 4IBYA 4IBTA 3WTUA 1HU8A 1LJMA 2YBGA 3ZMEA 3WTSA 2IOMA 4G83A 1EAQA 2RMNA 4IBVA 5LAPA 3Q06A 2X0VA 3VD0A 1E50A 3QYNA 3KMDA 1HJBC 1GZHC 2AHIA 3QYMA 2P52A 4IBUA 3WU1A 4HJEA 4LOEA 3Q01A 4MZRA 5G4NA 3IGLA 1CO1A 3D06A 2XWCA 4G82A 1TSRA 5AOIA 5AB9A 3WTWA 2BIMA 5G4MA 3US1A 2J1WA 1TUPA 2AC0A 3WTXA 3IGKA 2BINA 4L18A 3US0A 4AGNA 5KBDA 2H1LM 2WGXA 4AGMA 1EAOA 4AGOA 2MEJB 2OCJA 4L0ZA 2BIPA 1T4WA 4KVPA 2J20A 4IBZA 3Q05A 3D05A 3VD2A 3KZ8A 2IOIA 4A63A 1EANA 2J1ZA 4MZIA 1CMOA 2J21A 1IO4C 5ABAA 5AOLA 2GEQA 2VUKA 3EXLA 2J1XA 2X0UA 2ATAA 3TS8A 4GUOA 1UOLA 3VD1A 2ADYA 4GUQA 4IBWA 5AOMA 3WTYA 2PCXA 1HJCA 4AGPA 3D09A 4LOFA 4LO9A 4IBQA 4L0YA 4XR8C 2XWRA 5LGYA 5ECGA 5G4OA
chains in the Genus database with same CATH superfamily
5IQ7L 4PJHB 1FAKT 4MA3B 3GHPA 4ORGB 3T2PA 4IOFC 5IJDC 3AB0C 4OF7A 1PFCA 2PWGA 4NT6B 3RUGB 1IKNC 3WTVA 1CBVL 2OS7A 4WZ9A 4G11A 1IKFL 3CU1A 3MRDA 2QSQA 4OI9A 2R0LH 3CZNA 3DIDA 5JTWA 4JVPA 5DEGB 1BHGA 1I1CA 5MENB 5FO7B 3MLPA 3RKDC 3LS5H 3CBRA 1SJEB 4I13B 4S1QH 3FT2B 2DMBA 3H3PH 3EF7A 5KSAA 3DBSA 3BSHA 3MXWL 2WZPD 4P06A 3A3YB 4D0DB 3HG5A 4IJ3C 2FQFA 1X5MA 2LU4A 2P28B 3L4YA 2OMYB 3QYMA 4KHXH 5ERWB 4ODSH 3H9SD 1IQDA 3MLRL 4QEGA 1JYWA 5DWUH 3SDAB 3BAKA 1N0LA 5IFAL 4ADGA 1S7QB 1A9EB 1AJ7L 3IK2A 4Y9FA 2D73A 1QRNA 4TSCL 2CR3A 4E5XA 2P44B 1NGYA 2ZKHL 3C09C 3L3GB 2D9CA 4Z7QF 4PJDA 2V33A 2P8MA 3QAQA 1LO5A 2HB0A 2CKBA 1NSNL 2BDNL 4MJHA 4JAMA 4UINL 1H3PH 4NO0A 2YGNA 5D7JB 5B3NA 3TXAA 1OSPL 1SPDA 3OKNA 4CC0A 1U93B 4EN2A 2IALA 5GRUL 1N5YH 4RCAA 4PRIA 1D5MA 5TDPA 2XY2A 5C0AE 4XP6H 2NXYB 2X6CA 3T0EA 2YMXL 3ZU8A 2X4TA 3NMEA 5D8JH 1NCAL 3ZDZB 2G5UA 4WV1C 1U92A 4FHJA 2AQRA 3JT2A 3UP6A 4Z3HA 1FUNA 2FUTA 4CAGA 4KHTH 3RI5F 1L9PA 1CICA 2DN7A 1BBDH 2NSMA 3DO7A 3RWEA 4EPSA 4S0TD 5BRQA 5T5NG 4ELMF 2HRPL 4YDZA 3QRBA 1P84K 1BQHA 4G6JH 1UM6H 5F9AC 1HILB 5AVSB 3CFBA 2ENQA 1B9KA 1U8QB 2PCXA 4ODUB 1KJ2B 4KI5E 5KBNC 2FJHB 3LB6C 4OBSA 4U1NB 5KVFL 4HU2A 2X4QB 3AJ7A 4AJVA 1BLNB 3E3QE 3DBXA 5LGYA 4M8RA 1BD2E 3GHEL 4Q97A 4AVHA 3N1PC 3LKRA 5BRPA 5F3BB 3MOQA 3D3VD 1XMEB 5IROC 3QIWD 2JH2A 2Y36H 4ZBJA 2TRYA 3WNJA 1UCTA 1KFAH 4I4WA 1G7MA 2G2RA 2B1HH 2JE8A 3A47A 3FBKA 4PTUB 3VYOA 4D9LL 1JFHA 3NJKA 3WKNA 1IEAB 3AG1B 3DDGA 3N50A 3RPIB 3WNKA 4OCXH 4GS7B 1J1PL 2P46B 3UOAB 4AT6B 3E9UA 1U8MA 4OFVA 3MRQA 5DRZB 3V9EA 1BZQK 3BUYA 4E36A 4PJAB 4KKPA 1G7HA 3SPHA 3BVTA 3LKPB 4J12A 3TA3A 1QEXA 4OCSL 1KPVA 3HNVL 4JO2L 5HHXL 4MAUL 4KJPD 1SQ2N 5EBWA 2YOAA 2R2BB 4P46D 1R3JB 3KYNB 2F5AH 3SDCD 1WLHA 3QYNA 2GBTA 3F62A 1YEWA 2WWKT 3DRTB 4ZFFB 1OAQL 2ZTBA 2DI7A 4NNYA 1CTMA 5FX3A 3GNML 4PJHA 2KLTA 2DL9A 4YDKL 4MA3A 3PQYE 5IJBC 1XAUA 5EC2A 4DZBB 5F7FA 1Y6MR 3QG7L 4NT6A 4UTAH 3RUGA 4HFUL 2WQ8A 4CVUA 4QXTB 4NAJA 3S5LG 2CLZA 1RY7B 5FGBA 1KCSL 4I2XE 1TQBB 2BLFA 1JV2A 2IBGA 1WYJA 2DLIA 5DEGA 5MENA 2HVKA 3RVTC 2AF2A 4FRWA 1SZNA 5FO7A 3V4UH 5L6YL 3NIFB 4FX5A 5C0JB 4WI7A 3FT2A 1FI8C 4DUWA 5EWIH 4D0DA 4P4KC 1J0YA 5T1LD 3WNLA 4LVHC 1E2WA 3V8OA 3BKCH 4UU9B 2C7FA 5AL0A 3QUZC 2IDSA 4TVUA 1KYFA 2Z31C 5EN3A 5FLVA 3SDAA 2FT6A 2XTJE 1X9RA 3T1WA 1UWXK 1XCTB 4HHWA 1S7QA 4UOJA 4AOFA 4PG2A 1LP9F 3IWUA 3WUWB 5T3ZD 4RFNB 2PWEA 1CGVA 3G6DH 5CJ8A 4XCYB 3L3GA 3DHMA 4NDMB 1DO5A 2J1KA 2FX8L 4EI5B 1GGIH 1TJHL 1UOLA 3K80A 3DX4A 3JWOH 1TEFA 2O1AA 4J3OG 4U1JB 1IAOA 2GUOB 5BS0B 4JFSA 1ZHBB 4KX9A 3UTTE 3BW9B 4C56B 3T77B 5IEHB 1EQWA 2FEDC 4GAFB 4PJBE 1X44A 1U8CA 2NYYC 5IEKB 4EOWL 3T3PF 4Z77A 3TVMC 2UWEB 3OLEA 4MMYB 1Z9MA 1EGJL 4YNYB 4BZ1A 1BZEA 2CO6B 4Z3TA 1WA2X 2VMDA 3TCLB 3EOYG 4AUYA 4WI3A 3SZ6A 2CNYA 2IOOA 2YSSB 2AGJH 4M9OA 5J12C 3STBA 2AS5M 3BVWA 1IUZA 1WBZB 2AEPL 4MB5A 1P7HL 1HILA 5DJ0B 3BP7B 5T3XH 1U8QA 5F7MC 4R4FH 4ODUA 3UBXG 1KJ2A 2OMTB 4LPUA 2FH8A 4JG0H 2DJ4A 2NY5L 3ARBB 1MF2H 5HHQB 4TNVK 4L1DA 3NGBB 3QB7C 3F04A 3EJTA 2B0SL 5F3BA 3QCUH 5E0QA 1KN2L 3SE4A 3L08A 2AK4B 4LESA 4KTDH 1YEIL 4E42A 2JNZA 2Q8AH 2EVFA 4LDOB 3RAJL 3FBQA 3GXNA 4BK5C 1UH3A 1IEAA 3VRLE 4ZUSB 4PJIB 5E56A 5K93A 3WO3B 1LO4L 4HBCH 1X5LA 4N1EA 2Z4QA 1BM3L 5DRZA 4PJAA 1TEYA 1QAWA 4K5OA 2KS0A 1HVXA 2K6ZA 2CWRA 4B9ZA 2R2BA 4Y5VB 4AY0A 1R3JA 3KYNA 1HL9A 3MNWA 4KNSA 4KUZL 1RUQH 1BREA 3ZE0E 2OAAA 2MEJB 5CHNB 4EQ2A 4ZFFA 1WWAX 5DTFB 1KXTA 1LK2B 2XIBA 3LXUX 5K59F 4WHDA 4NN5C 2AJVL 3ES6B 3UBFA 1LNUB 1DVFD 2XQYK 1QWNA 1YEHL 4DZBA 1JPSL 3LRMA 1HS6A 3GMLB 3EGDB 3O6MH 4UM9B 1KLUB 3KBHE 5D1QC 4KTEL 2N56A 4QRFA 5IF0B 5F7BA 5IMMB 1NFIB 5J56B 3SE3A 1DYZA 3CHOA 3VGBA 4WK0B 5JHMA 3TO4B 2BS9A 1P7QB 3M88A 2M1KA 1QX1A 3TF7C 1QLEL 4D0BB 5CLZA 5GGTA 5C0JA 4D8PB 1MVUB 1RUMH 1SOXA 3RFRA 3RGHA 3J27A 3JV5A 3WNPA 1V3KA 3PV6A 5CD5D 5DHYA 5BV7C 4OIIH 1DFBH 1L6ZA 4NWUH 4NBZB 3VXMD 5J89A 3QDJA 4G8FB 4PRAA 2ZOKB 4TSBH 5KJ4A 3Q8FA 3BAYA 1KCLA 2XN0A 5CZKA 4ZMYA 1XCTA 2FHFA 3L2NA 2UXTA 2ZSVB 2P42B 4LHUG 5LKNA 4HD5A 1T3FB 5DUPH 1S78C 3I6SA 3UTZB 3O8XC 3V8CA 3WUWA 4TNVF 3RWCB 3QNFA 5FM5M 2GSMB 3A4DA 1RSFA 2R27A 1VEMA 4NDMA 5J06A 3CN4A 4JM4L 1TITA 2ODHA 2XVLA 4EI5A 1NICA 3P69A 4M8VA 4X99B 5H35A 4AMKH 4ZX3A 3IWVA 4IBLT 3QIBC 4YHNA 2R8SH 4E41D 4WW2B 3CZGA 2GUOA 4X7CC 1R3IH 5BS0A 4M7JL 3UXFA 2YMTA 1V3MA 2MPAH 3T77A 2JV6A 3FO1A 4LIQL 4PIBA 1UGKA 3NIFE 2ALAA 5TTRA 2CJTA 1EGJA 3MGTA 1M05B 4MMYA 4PY8J 2ZZUT 2MCG1 3PGFL 4K5NA 3WEOA 2G3NA 4OBRA 3EYSL 3FCBA 3ZR6A 1FHGA 2VL5B 3MCLH 3QUXC 4ZMZA 3TCLA 1OLLA 3EKCA 2V5RA 5IHLB 1DQKA 1X4YA 2KZ1B 1OAXH 1AGBB 1U8JB 2YSSA 2A1WL 1YNTB 2QV2A 3F7LA 3RY6A 4GRWF 4BUQA 1TVHB 1YEDA 2EDRA 3NCEB 5FKAB 3X1BA 2DYSB 1CF1A 2UZPA 1UWEL 3BP7A 3FT1A 3WELA 3MRBB 5D4QA 4J6IA 1RXLA 4CJ1A 4MCMA 1ZVYA 2OMTA 1OTSD 2AJZA 3TIEB 5CEZD 3ARBA 4RGNE 5KSUB 4MZ2A 3LPOA 2DM2A 2JQZA 3MCG1 1RSYA 2J20A 2OYMA 5GRJL 2IMMA 4BSVA 4GRWH 1GW6A 2AK4A 4UT9A 3KZ8A 1B6DA 4BHUI 4Y19D 2BVOB 1JZDC 1TQUA 1U8KA 3LIZH 5FYJE 1N6QH 4C56E 3L3DB 5C92A 4N4YB 4M3KB 4Q9RH 4FA7B 5D96B 1WZLA 2UWEE 5GXBB 4PJ9C 3M1BA 5C1MB 1OTUC 1O9WA 3EFFB 3MLSL 1FZMA 4JO1L 3WV0A 3ZDYF 1HL5A 1L9OA 1XR8B 5DLLA 2CK2A 3S37H 3F64A 1MPAH 4UB0H 5CHNA 4Y2OB 1JRHH 5C07A 1HZLA 5DLMH 3RGVA 1F90H 1LILA 1P1VA 1UWFA 1LK2A 3D87B 4LE8A 1FO0B 1TO4A 4OZGB 1IIKA 5ECGA 2D3VA 2W80C 3ABGA 3ZKSD 3ESOA 1U8IA 4OD2B 3RDTA 1QYGL 1GZHA 3EGDA 4PRHB 3WD5H 1Z0MA 2JFCA 3P0VH 1KLUA 4MFHA 3MBEA 1B4RA 3JVGC 2XWJA 5IF0A 3ULUD 2O5ZH 4FQHB 1NFIA 4AE1A 4X5XA 3JUZA 1AR1C 3TO4A 4DFIA 3AUVA 1P7QA 4F9PC 4FQXC 4X8XA 3IN2A 2EDJA 5I8EB 5C6PB 4D0BA 2UX6A 3F58H 1RZGB 4H0LC 2VGLM 4WFGE 2AJXH 4X7EC 1MVUA 3TBTA 4ENED 2VLRD 4PJIE 1IFHH 1OVZA 1YYML 3VO0A 1G1KA 4FCAA 3TT3L 1SDAB 4Z7VB 4A38A 4JFED 4PTTA 3VE0A 4FQCL 3HRPA 4YZFF 4PCKA 3PWUA 3INUH 2G9HB 4DQAA 4OY9A 1JDAA 4JFUA 4FLOA 3Q0HA 4G8FA 4Y2LA 4HJEA 4UDTB 4YWGH 2AZUA 2ZOKA 3F7KA 4PVNA 1EIBA 2LLNA 4XB3A 1MCWM 4WI0B 1MJUH 2VQ4A 5GS0D 2ESVB 2ICWJ 4Q8BA 3WLBB 3EHBC 4KAQL 4DCQA 4M6OH 1T3FA 5EU6E 3UTZA 5KTEL 1VSCA 3RWCA 3CVHH 2EACA 5KSBF 4G6ML 3QNXB 5IG7B 3UTOA 4F15B 1BMWA 1CQKA 2Y2TA 3N0AA 1V3LA 4KMLB 4PV8B 1MFCL 3F65A 1T80A 1OL0A 5B38B 4F8OA 2VDKB 3C6LC 2EINB 3V5DB 3OHMB 4WW2A 4XBGB 4Q0XL 5FDWB 2DEXX 2DH3A 4P04A 3WIIL 5C3TA 5CKGA 5J11B 4CJ0A 5T1KB 1BGXL 4LPYA 4ZO7A 3KPRD 4JFVA 4XHQA 1ZTXH 1M05A 4FQPA 5FCUH 5E8NB 2FATL 1XB3A 2PO6B 3PAUA 1PIGA 2F1AA 3WUZA 3EJQA 3ZQWA 7FABH 1PZ5B 2ZKYA 4KKLD 2VL5A 4EZLA 1DP0A 1TNNA 1ZWIA 2NNCA 1NFDE 4HLEA 4CMHB 2P7TB 4GSDL 5T1MB 1QQDA 1YNTA 4M48H 4PGBA 4APQC 2CCWA 1IE4A 3I9PA 2KLSA 2ZG1A 1K72A 1JIBA 1XSIA 2Y4SA 4QCIB 3ET9F 5IHZA 5BUGA 4M6NL 1JPST 3MRBA 2EDFA 1KT2B 3EIFA 5C09A 2XQBH 5KSUA 3WFZA 1XD0A 1AZNA 1CLOH 2RD0A 1UB5B 4YOKA 4OI8A 5HDBB 2K4WA 2V5TA 3C87A 4HJ1A 2W9EL 4BH8A 1KPRB 3GK8L 2EE2A 4HJJH 2DAVA 2BVOA 4OJYA 3KCPB 4F1SA 1GS7A 3QS2A 4KY1H 4X4YA 3ZE1E 1P9MA 5IQ7H 3K1DA 3U4BH 1UXMA 2F1EA 3DIVA 1PG7X 3VNYA 4U1LA 4IBYA 3EFFA 1EMTH 1CBVH 2VB5A 2N7BA 4AIOA 4D9QE 1Q0YL 1IKFH 3RY5A 5TPWL 1F6LL 2R59A 3ZZSA 4DGWC 4MXWL 3BO8A 4L4TA 4M7LL 4Y2OA 1A14H 2Y0SA 1ZGLB 4NQVB 6FABH 1XB8A 2YZ8A 3VUAA 3MLUL 1CIDA 1EJ8A 1PKQE 3VFOA 1VGEH 1FO0A 4OZGA 1BD2D 2NCMA 5D72H 3MXWH 2XWDA 4HMEA 1K6QL 4OF8A 5SV4A 3H7BB 4BDVB 1U4EA 4MD5B 5CGMA 3SB3A 2NCEA 4NO0D 4PRHA 4DPBX 5C70A 5CCGE 4YEEA 3MLRH 1E5CA 4OUUA 4DJMA 1KY7A 1B3IA 2F8VA 3ARFD 4FQHA 4PRID 3S35H 3LRGA 2E9WA 5IFAH 2DV6A 5I1LA 3T0ED 3Q7JA 5AZEL 4XNDA 1MDAA 4FXGB 1MFDL 5I8EA 1CDHA 1TQCC 1TLMA 1A9BB 1J05B 2K4AA 3MREB 4FXKB 4QAWA 5FF6A 3MV9E 2VXQA 3IMUA 5KYYA 1J5HA 4CBZA 1CICD 1Z9SB 3T4AB 4JHAL 4FN0A 2JJUA 3EJPA 4ZW8A 2VDNB 2P9RA 3I6KA 5AD0A 2ZUYA 3G9VA 4MMZB 5F7DA 2NY0B 2G9HA 2BDNH 2NTFB 1U9KA 1RUAH 2DLHA 2Z7WA 4HW6A 4UDTA 3BWSA 3TN0C 2BP0B 3L81A 4PJEA 2NY2B 2ESVA 2BW4A 3WLBA 4OCWL 5EO1A 3CBKB 3ZSTA 2HMID 3WDJA 1V5JA 4JO8A 1TCMA 2ZOOA 2FB4H 1G1CA 4OZIF 2YMXH 1NCAH 2DQGL 3HN8A 3QNXA 4JFPB 4LCVA 4PRPB 4UQ2B 5IG7A 4MAZA 2V4LA 5BZWB 2G5BA 2J88H 3AU0A 3G6JE 1E90A 4PV8A 2FD6L 5B38A 3FRPG 1OAJA 5GGSB 1UKSA 2VJ0A 4JHZA 5M94B 1XF5B 5EUOE 5IB5B 1S5HB 2I26N 3VU2A 5T1KA 3KEDA 1F8TL 2GIYA 4RMSA 1MJJA 4NC1E 2ODIA 3VXQA 1HE8A 4XNQB 1VCBC 4K2UL 4YSSA 5BZDA 3K46A 4U1SA 2BWDA 2F8XC 5E8NA 3QPXL 1BAFH 2Y1AA 1KTLB 2YAEA 3QZBA 2PO6A 4G3YL 4IJ3B 4PV1C 1SMAA 5KVFH 4Z7VE 1IBFA 1UEMA 5AL8A 1PZ5A 1G6RH 2VSDA 3GHEH 1FL6B 4JN1L 1R0AL 1OOWA 2WHVA 1E4WL 2X38A 5I1IL 3ZL4L 2P7TA 5HYSG 5T1MA 4Z7QB 1S9WB 3ESNA 4U6HB 4WTWA 2GSIA 3X12B 2XA8L 5FV2A 2E6PA 4D9LH 2QPDB 4QCIA 4MS8C 1BG1A 5B1CA 3CDYA 1PQZA 3SO5A 3C09B 4X9HA 1KT2A 3VXUE 4BK4A 1T0NB 2XPGA 2DW5A 3H0TB 4MCZA 1LMKA 4RGMC 1TYRA 4FQIH 1UB5A 4OCSH 4JO2H 5MEND 4LSTH 5F1IA 3FULA 4MAUH 5IUSA 3RPKA 3O0RL 1KPRA 1VA9A 3WLWC 4ELKB 3EG9A 2CO7B 5F7YC 4CDGC 2YWZA 2R69L 3NA4A 1MCQA 1URIA 3MX0A 3FZUC 4P59L 4EJ1C 3S2AA 3GNMH 3A67H 4ELMB 1WK0A 4WV1B 5D71L 1PG7W 1AHKA 4FMVA 4WQOA 1NBZB 1UT1A 3SDAD 4R97B 3TONA 3QG7H 1PGRB 4Z1PA 3RFZC 3RVVD 1XGQB 5KVGH 1DQTA 4HFUH 4HF5H 3B43A 5IWLA 1WAAA 2HCZX 4X9FA 4HEPA 4YL9A 2P8PB 3H1ZA 4OJCA 1N4XL 2O4EA 4UBDD 3OLGA 4NQVA 4ONGH 3NEXA 4XN9A 4HUMB 2AEQL 4OLXL 2WNKA 2ZUQC 3HG2A 3DGGB 1FLRL 4NZFA 1WBXB 4WHCA 3NYKA 3VWKA 3H7BA 4BDVA 5D6CA 4MD5A 3B6SB 3NPSC 5IHUL 2YD2A 1UA6H 1RIVL 2IDUA 5D7JD 8CGTA 1R46A 1WFUA 5AWNL 4JL1A 1O7DE 3GIVA 5TE4H 2CHDA 4GAJH 3FQWB 1MAJA 1AYRA 4MZIA 4PSRA 1JZ3A 2VAAA 2NXYD 5A43C 2ED6A 4FXGA 3IFOB 3R4RA 4FFWC 4LEEA 1CCZA 1A9BA 4FAAB 1SDDB 4XWOC 3TH2T 4TRPH 1Q1PA 3MDJA 2EIZB 5FFGA 1HXKA 3T4AA 1Z9SA 2GJ6B 1F3DJ 1ZVSB 3GHBL 2FX8H 3TBSB 5BNXD 2GUYA 4GFXA 1TJHH 1HEHC 2XWBB 4MMZA 3ARPA 2NTFA 3F2LA 1GPOH 3CFEB 2JKIS 5B39A 2BP0A 3IDNB 3PHOA 1RK1B 2RCSH 1IBBA 2NY5C 3EADA 4U1IA 3OC5A 4N0UA 4JG1H 1AOHA 4EOWH 4ZJ9A 3OJVC 3V9CA 1SLUA 1CFNA 4K3DH 5BZWA 3UO1L 1UC6A 1UFUA 2EXYC 4JQXC 2Y7NA 4N85A 3BVXA 2AJUL 5GGSA 4GJTB 3S98A 5GSRA 1S9YA 1XF5A 4U3CA 4O2EB 1FN4B 1S5HA 3V10A 1LO2L 2AEPH 3VH8G 4YN3A 4Q9BA 4XNQA 2Z0BA 4XO8A 3DMMC 4XP4L 2ZX9A 1C5CL 4XTRD 4K15A 3F7QA 4P4KB 4UMSA 4I9XA 2NY5H 5AALA 2EC8A 2WWKO 4QHKI 1LP9B 2Q2LA 2Z8VC 3QUZB 4IKLA 4OFYD 3OMNB 1FL6A 2Z31B 3E6HB 2JKWA 4HCFA 4O4YH 4YPJA 3MBWA 4ZZFA 4M7LT 1W80A 1F5WA 3AGWA 3HE6A 4NBYB 3P54A 4QDGA 3GBML 3TZVC 15C8L 3FXIC 3X12A 4MQTB 1BF5A 1BX2B 1FVCA 1MQ8A 2DDQL 3QDGE 1SHSA 4AKOA 4I87A 5I75C 2AC0A 2DWEB 4JS7A 3PWVA 4PW4A 1LO4H 3OGCB 2Y5EA 1G7PA 2WQUA 1PZ3A 1BM3H 3AACA 1T0NA 1TYEB 2EYSB 2JKJA 1JP5A 3DPDA 3FOMB 4KFZC 2Q10A 4L0PB 3H0TA 2X89D 5DK2B 3VXOB 4KJQC 2N0KA 3NJLA 5D4JA 1I8IB 3IMTA 4V11A 2A73B 4Y4FC 3SDYL 2OLDA 4JB9H 1V55B 4FJYA 2QQKH 5CZXD 4HUWA 4ELKA 4ZFGH 4Z0XA 1GL4B 5PCYA 3WE6B 1QI3A 3HVDA 4H1LA 1VACB 2YXMA 3VFMB 3CZFB 2XYCA 5FUZL 5ETUB 4ELMA 1YEHH 3PAYA 4JVWA 1JZHA 1O7VA 1T0PB 2QTVA 4DKFL 1XGQA 4UQCA 3LEXA 4MNQA 3FCGA 4KTEH 1QVOB 5D7SH 1KUMA 2EAEA 3WG7B 5J12B 3UTSA 4YH6A 2DWTA 1HKLL 3GSXB 4Z7QE 4KJWD 1QLEH 1R6VA 1CT8B 4U1GC 4ONOA 4URTB 2F6AA 2X9ZA 1XL4A 1YMHB 3BD5A 4L3AA 5SX4H 1PKOA 4A67A 4EI5D 4LCUB 2Z8RA 1WBXA 1WO2A 3GB7A 1A8ZA 3WL9B 1RD6A 5BS0D 3FB8A 4JDVB 1MREL 4C56D 2J73A 1ZCRA 2A6JB 2C3WA 3AW5A 2VDLL 4B9CA 3FQWA 3TIDB 3W9EB 3V0HA 5INCB 2IAMC 3WIHH 1ML0A 3IFOA 4HCIA 1RZ8A 2LHAA 3Q1SL 1B0GA 5AOJA 1IJNA 4J7RA 1OT1A 4P2OC 3TBVA 1SDDA 5BRZB 1M56B 2YAMA 2EIZA 2Q76A 2R29L 1AG6A 5FM5O 1MUJB 1ZVSA 2OV0A 5DDHB 1XH2A 1ZLUK 1IGFL 3DJTA 5LWYL 3GMPA 4XPAH 5B4MD 5L2KB 4NZJA 3NESA 4W68A 2YPKB 4YFLF 3ARSA 4ABUA 1OWRM 1RQ5A 1HESA 2D0GA 3IGLA 3WEMA 1E65A 4HPOL 3ARBD 4LIQH 3D4CA 1PD6A 4FI6A 3A4AA 5EZIL 3B5GA 3UTPE 3SHSA 4YDVA 2HTLD 3PGFH 3KD4A 2GT9A 5J5EA 1UZ6F 2AK4D 1Y7VA 3ZJAA 3QORB 5D1QB 2A6KB 1IX2A 1KBVA 2QPUA 1MCKA 3H2WA 3P3RA 4IRZH 4BFFA 2P48B 4O2EA 4GAGH 2D7OA 5E00B 3AWFA 2VDQL 1AXSB 1UWEH 1T4WA 5CCKL 4GRLB 1Z7JA 2CA4A 4DN4L 2YHGA 5K69A 3WKQA 2GJ6E 2OR9H 3QJTB 4DGIL 1HWWA 2EKJA 1PZSA 1LP9A 4ADIA 5LNDA 4S0HA 3CVBA 2C1PB 1BSIA 2KZBA 4FKHA 3QA3B 4XMPL 4OVUA 1EUTA 1EHNA 1CS6A 1LWJA 2FEEL 43CAB 2GHWB 2DRUA 2VH5L 3IDJB 4XVUD 4ZD3L 2DWEA 1KMGA 3CNKA 5IUCA 4B50A 1CPUA 3OGCA 4Q56A 4UM9D 2G4EA 4DP5X 3C5JA 3G5ZB 4U1HB 3FOMA 1IGYB 5E5MB 4P5TC 5KWYC 4F7CB 3JTBA 5DK2A 3VXOA 5IP4A 3TO4D 3RNQB 4JO1H 4V1DE 2MCPH 1P7QD 5C08A 3GMMB 4XB7A 4MCNA 3S8WA 4E0RA 1VZGA 3QIBB 2WJ5A 4HISA 3MYZA 1ZY9A 5INDB 2VDML 1AANA 3WE6A 3S36L 1KZYA 6PAZA 4N2NA 4YHLL 1VACA 3VFMA 2J6WA 2VNCA 3CZFA 4TM9A 3T6ZA 2OQJB 5ETUA 1MW0A 3TX4A 3WDIA 3UDWC 2X4OB 2O30A 4GRWB 5EZPA 3VNZA 2K9FB 2YPVA 4P4RB 4QO1B 4OVVA 4ZX5A 1OLZA 1KBBA 2BNUA 5JDSB 3RWJB 3SQRA 1S9XA 4UDUB 1QVOA 1JVOA 5HVWA 3LPFA 2RMNA 4I18A 3RVWC 1CT8A 2WKGA 1E4XI 3UAAA 1SLWA 5BOPA 1ZLUH 2FJUB 4HS6A 4DOHE 3Q06A 1XH0A 4I8DA 3LZRA 4JREB 5DQDH 4ZW3A 1EVUA 4IOIB 4K55A 5JQ6L 4IQHA 1WGVA 1YYMH 5D7IF 2PR4H 4OJFL 5I19H 4QRRA 1PIFA 4FQCH 5EIIG 1P4LB 3KS0H 2A9ML 4JDVA 4NM8H 5F70A 5JMOC 4U0RB 3LSOB 4IOSA 1KEGL 4CVZB 4NZTL 2EDLA 3T3PE 4AUUA 3W9DB 3W9EA 3IJEB 5INCA 3EGXA 5IVXB 5T3XE 2NR6C 5JHLL 1AGFB 3BZFB 4KAQH 1CXLA 3KPPB 3FOLA 1E3FA 3GUTB 3ZDYB 2YKKA 5BRZA 1CJYA 3UPAA 4D9QD 3FSWA 2J55A 4G6MH 4HKBB 4U31A 5FO9A 2MOGA 5FOBA 4L18A 1MUJA 4TNEA 5DDHA 1BA9A 2XNAA 1G0XA 4NKMA 4UAHA 5LBSL 3MR9B 3P9MB 2OYKA 2CIKA 2QV4A 3VTMA 4TLTA 2DYPB 2YPKA 3UC0L 1EH9A 3GSQB 1DANT 3D12B 4XO9A 4PJGF 4WUUB 1E8ZA 3WIIH 2CMRH 4JDEB 1BGXH 4PREA 1A21A 3B2MA 2H0JA 1U8OB 4N0RA 5DZOA 4LHJB 4HZLB 5KUMA 2FATH 2WXQA 2FIRT 4JFZL 2NY4C 1HHKB 5IR1A 5IMKB 1YC7A 3GJFK 3QORA 4GW1B 2A6KA 3EJZC 4OZHF 3ZMRA 4BGDA 3RP1A 1NEUA 5I1HH 2CBPA 4HFWB 2F58L 4GSDH 1TG8A 3KPQA 1AR1B 2WGNB 3FFOA 4JRYB 4PMEA 1NMBL 1MFEL 5E00A 1RU9L 5DQ9B 3N41F 5KZCB 4GRLA 2NDGA 1W6WA 2WTRA 5EUKA 3LV3B 5L4FA 3N1FC 4TSAH 2P4AB 4NCC1 5CINL 4B96A 1KXHA 1PY4A 5IQ9B 5K59E 4BFRA 1U58B 5E4OA 5LNEA 1N68A 3QA3A 4MAYB 1VFAB 4EUPH 3L7EB 5L2KE 2HKHL 3MRNB 4N3TA 3X14B 4X7SL 5TH2A 1NLDH 4EF3A 1MCPL 1HH6A 3EHBB 5DJZB 1YPZA 43CAA 2E0PA 1X4XA 3P0YL 2XX0A 2NTSP 1INQA 4MJIE 1COBA 4WLCA 4PRHD 2OJEB 1J12A 1QI5A 4L3EB 1HHJB 4E9SA 4U1HA 4LRIC 4E9WA 5E5MA 3GEFA 4R7DB 5HVGB 3CX5J 3RNQA 3C6LB 4FXLA 1IAIH 1Q0YH 4OI7A 4OFKA 5D1QE 5I8KH 4M7KL 3QRFM 2WC7A 5TPWH 3LRSB 2YN3A 5INDA 5B7EA 4Q9QL 4EN3B 1BOGA 1PS3A 3Q48A 5KAQG 3P02A 3MLUH 1B2YA 1U3HA 2JI1A 3JV6B 3MI6A 5F9WC 1BMGA 2VDOL 3ZTNL 1SHXA 1JGLL 5CGTA 3QEGL 5FO2A 1MY7A 1G5GA 2OQJA 4GEJA 4N6RB 1TSRA 1K6QH 3GLAA 4XC1L 3V7AG 1X5YA 3CSYB 3O4LB 1KIQA 3AREC 1E67A 4PPTA 5JDSA 2ESVD 1Q9KB 4Z8FL 4UDUA 3BAEL 2XVKA 3Q9PA 4APQB 5AZEH 4B3VA 4Q6IB 3LVTA 3EYQD 1T21A 4O9HL 5FGRA 1Y18A 1A3RH 1EVTC 3T0XA 3ARGB 4AGOA 4OGYL 1H8OA 4N0FB 2N1KA 5GGRY 4IOIA 1I7ZB 3QZWB 1Y1DA 4JHAH 1K2DB 3RJDA 1KNOA 2BSRB 3KL5A 5E2WH 5B1BB 4YXHL 1QFWL 1IARB 3U6RB 3RJOA 1SHMA 3ESUF 1UWGL 2RH0A 1L0XA 2DYRB 3LSOA 3MRKB 3KHQA 2WXRA 5T1KD 3SO3C 4CVZA 4P9HL 1F13A 4FLSA 3DPBA 5SWSB 5TDOB 3A4FA 3W9DA 5FAAA 3IJEA 1I1FB 4OD3L 5JHLA 1L0QA 5IVXA 1AGFA 3PHQB 2YAHA 2PO6D 3KPPA 4WO4B 4AM0Q 3HA0A 1K8IA 2F53E 3GJFH 4MMXC 1D9KA 2FHBA 4TUKH 1Y07A 5HHOB 2DQGH 4HKBA 4MHHI 5BW7C 4Q6YA 4GRWE 3P3SA 4GBXB 4ZRGA 4ZUTB 2AW2A 1PD1A 3P9MA 1RFDL 1A6WL 2FR4B 3RVUD 4JZJC 4K7PX 3GBLA 3HLAA 3P3YA 4WUUA 4JRFA 3BJLA 3P2DA 4MYPA 4WENB 5KG9A 1I53A 4I3SH 1F8TH 3OAZH 1JGEA 3SBWC 2ATKB 5I73C 1ORSA 2UZXB 2XZAL 4CGUB 2A74C 4RBPH 1I3VA 3QPXH 2XLLA 1PLGH 2YGPA 1YEFL 2DLEA 1HHKA 1D5XB 1WIOA 5IMKA 3WN5C 5I28A 5DC2A 4GW1A 4OF0A 4JN1H 3WFEL 2ZCLL 1JFQL 3WTUA 5I1IH 5AAMC 1JWMB 5J1AA 1J11A 4NHCL 5JA8B 2WXMA 4G83A 5J7CC 3GXDA 2XA8H 4XO4A 1A7RL 4KRLB 3DJZA 3G5WA 5DJ8B 5DQ9A 3ZIYA 3ZDYE 2OX5B 4HKJB 5A7EA 4HQQL 4B3EA 3LV3A 5ILTL 5LG6A 1KGCD 3FF8A 1E3ZA 3FU7B 4F7PB 4P3CL 2R4RL 4OZIB 2H45A 2M26A 3T3MF 3LN5B 4MAYA 1VFAA 1C12A 4JKPL 3CDGB 4XNZB 3MRNA 4HAKA 4QOKB 1HSAB 5JHDA 1B4TA 4FYTA 5FYLD 5DJZA 4S1DC 4Y1SA 3BP5A 3PJLA 3LKNB 1G6RB 5ANMB 2OJEA 3N2JA 4L3EA 1HHJA 4NRXA 4PV9B 5D71H 1GZPB 5E5RB 1N2RB 1CZ8L 4R7DA 1NCOA 5HPOA 4C83A 2UUDH 3CVDA 3BE1L 3QWOB 4F92B 4YBLC 4HK0B 4HLZG 4A7UA 2FWLB 3AQXA 4X6BA 1U95A 4EN3A 3K1KC 1KENH 3MJ6A 1MSPA 3NJFA 4JRYE 4YZFE 4JM2C 3MSPA 3WXWH 5J1TC 2AEQH 3JV6A 3FFCB 2QADC 4OLXH 1GW0A 4IMLA 1S7RB 2XYBA 5DT1L 2L4OA 2X3CA 4ZFOL 1JZ5A 1FLRH 2NY0D 4N6RA 3CHPA 1Q9OB 3ARZA 4PJXA 2R0ZL 4QRPB 3SIKA 2NNRA 3CSYA 1RIVH 5E9DA 2NY2D 5AWNH 2AV1B 2DKMA 3FUJA 2DH2A 1H3TA 1Q9KA 4MA8L 3I75A 3RWGB 1FAIL 2ED7A 1OGAE 1UT9A 3Q3GB 4PS8A 5KSBE 1EZVY 5ICYB 3ARRA 2DM3A 1H19A 1QHOA 3Q2LA 4Q6IA 3QRLA 3NFSH 4PRPD 1KXVA 3D4ZA 4ZQTA 2VW6A 1NEZB 3ARGA 3REWA 2F2HA 1OE3A 3CH8A 4N0FA 4XWGL 5IVZB 4BE5A 2W07A 5DWPA 3QZWA 4Z9KB 1K2DA 1UWYA 3U6RA 5J1SC 4BWTA 1K85A 4TPRL 3IMBA 3QC5X 3MRKA 3TNMB 5JW4Q 2XBZA 4KK8D 5TFSH 3RKDD 3EJYC 4ZO9A 5SWSA 4AZUA 1HK6A 3BPOC 3VTAA 4Y1AE 1ZLWH 1T2JA 3ASNB 4XPHH 1S6NA 4JK0D 1LTXA 1X7QB 3PHQA 2HP4A 1S7SB 4WO4A 5JZ7C 5JXEA 3T0BA 4AIEA 5JPMB 4NO3A 2CXKA 3PJNA 1MH5A 3CMOL 1S3KH 3VXRB 1LMIA 4GBXA 4R96A 5ACZB 4MJ6A 4OT1L 4BBWA 4FFVC 5JDJA 4AYMC 3RFZB 2DLFH 1AZBA 3O4LE 2NYKA 1TYJA 2FR4A 2CHNA 3TH3T 1E50A 4G1MA 1XL6A 5DEZA 5C0IB 4MJ5A 1EZLA 5LVEA 2CD0A 3OR6B 4XPGL 3ZHLA 3IBOA 4UQ3B 4H4NA 4OGZA 1IQWH 2N1TE 3JYBA 5D1XB 2ZUQB 4JHVA 4NP4L 3G5YB 2XWCA 4R26L 1U3YA 3ILQD 5K9JH 4P2RE 3QFJB 3U4KA 1DEDA 1D5XA 1UZGA 2E9BA 3GSOB 1RZKH 4NUMA 1ZT7B 4WEMB 4PQXA 1X9UA 2JJTC 4YBHA 5AVTB 1TTFA 4MNHB 3J8F7 5CJOH 1JWMA 3MVSA 3U30C 2A5UA 2X28A 3WFHB 1P1ZB 4S0SD 15C8H 4XOCA 1RURL 2X6VA 1G87A 1QATA 1EEZA 2MTPA 2R2CA 4X4MA 3FF7A 2VC2L 1MXGA 2CRMA 5EFIB 3AWEA 2GTWB 4EQ3A 2GTQA 4LEXL 3NCJL 4Y4KB 5HHOE 5I0WA 1IKOP 4AEHL 4LKXB 1BQHG 4YDIH 2EDEA 1CG9B 5D70H 1NANI 4OZIA 4BCYA 2H5UA 3SDYH 3DVFA 5I1AB 3LN5A 8FABB 5G5DB 3CDGA 2EIEA 2WBKA 1A7QL 2LW3A 1HSAA 4QOKA 3Q6GL 1J9RA 2H6PA 3QUML 1NM4A 1W72A 1G6RA 4TULH 1INEL 5I26A 4Y2NA 5FUZH 5DD1L 2EKSB 4PV9A 3MGOB 4TOYH 1GZPA 1YUKB 2XN9B 3EJCA 4UAOC 5IROD 4DKFH 4KC3B 3JV4B 4L9LC 2CRZA 2Y6SC 3DSFL 3QWOA 1IEBB 3FTVA 3CDFA 4ANVA 4Z5RB 4L8BA 5D2NB 2BSSB 3V0EA 3QULA 4Y2DC 4JPQA 4B41A 2QGCA 4X5RA 3LHPH 1UVQB 2WIIB 3NDZE 1FFOB 5AKVA 2GJ6D 2EDWA 3FFCA 3HNTL 4RAHA 2ZWNA 3FO9B 3SGJA 5CBEB 1Q9OA 4QRPA 4RIRA 3L17A 5GRZA 2B8OT 5EF0A 2AV1A 4MB3A 2NNAA 5E7FA 2AJ3B 4FQ2L 1M1SA 2VDLH 4G80B 4GQ9H 5F72S 4DESA 2ZCZA 3Q3GA 3PREA 2DQTL 5ICYA 5JUEH 4QHMA 3TZVB 1QFHA 4AV4A 3Q1SH 4POZD 5I75B 1EAQA 5KVFE 3VD4A 3BP6B 5IVZA 2BM3A 1CU4L 3OWEA 5ANME 4HWBA 2OFQA 4UT6A 4J27A 4ZDHA 2IPTH 3B2UC 5KW9L 1V8HA 3PIQA 4UF7C 4JFYA 3H8NA 3HS0B 2BMKB 3WU1A 3ZK0A 2YEZA 1QLEB 1IGFH 2R56H 3OKYA 4I9WE 4L5FL 2VQ1B 3RVTD 3TNMA 5LWYH 4G8GB 3JSSA 1WZMA 3F12B 3QZLA 1RZIA 3OMZA 2Q6WB 4PYHA 2PCYA 1A4KB 4FEMA 5HHMB 4L2LA 3RWHB 3VFSB 1UOVA 3BN9D 4GUPA 4HPOH 4P4KD 2Z7UA 2ARJB 4L4VA 2C3GA 4UMGA 2BIMA 1J48A 1A8JH 5EZIH 5JPMA 1HNGA 3QUZD 4JEGB 2Z31D 3BYYA 4N1CA 5I71C 3HKFA 1Q0EA 4FLRA 4HIXL 5DEFA 3VXRA 5IHWA 1G0YR 5MEPA 5GGQL 4MA7H 3QXVA 5IJKA 2V9QA 3GM8A 4LLWA 1FV1A 2SODB 5C0IA 2LE9A 5B8CB 3OR6A 5I5RA 3MUGA 5F7HA 3U83A 1OK0A 2DQHL 2HFTA 4U1GB 2P45B 1WS8A 4UQ3A 3TJHC 5CFHA 1BYNA 5GJTH 5D1XA 2AI0L 4N8UA 3OHXA 3ARTA 3ZR5A 1E9QB 2KPNA 5DZPA 2ZUXA 4NEHB 2EDKA 4FS0A 5CCKH 5CCHE 1C8QA 2JCCB 1A1MA 4FOMA 5DA0B 2J3SA 2GAZB 2EDBA 1UM5L 1PLBA 3GSOA 3T6VA 5I16A 1ERNA 4NQTA 1IMHC 1EWHA 4ZSOB 5AOLA 4DFHA 3KXFB 1QFWM 2MOVA 5KBKA 3DGDA 5IFHL 4MTMA 1TZHB 4XMPH 2IAMB 2NYYD 3ME0A 4MJJA 4QLWA 3KPLA 3WFHA 3WMPA 2IBZY 4GUQA 5HI5D 4JCWA 2VH5H 3HFFA 1CC3A 4P2OB 3TTSA 1JXJA 4ZD3H 2ENJA 3GXIA 1HJCA 3AXLA 1O6SB 4JHBA 3U48A 3EFDL 2O5XH 4Y4KA 5JXAL 2PP7A 2DWYA 2ZAGA 2MPVA 1Q72H 2DIEA 1T7ZA 4NUGL 5I23A 3EDFA 4KDVA 2J8UB 2BJML 1DBMH 4IDLA 2CDFA 8FABA 5G5DA 2R2HA 1KV7A 1I1AC 2ZUWA 3HBQA 4NCDA 3S36H 4GIAA 4ZMAT 3K4AA 1A7NH 3NJIA 1N18A 2HVBA 3E6FB 4JFHD 4UILH 4YQXL 1RUPH 1U8LB 2ADJB 3NACL 3SKJH 3BEWB 4IOSD 3MGOA 4IK7A 3SBRA 3S88L 2XN9A 1TVDA 1ONQA 3QFJE 1BVNT 3JV4A 1ND0B 2AQ1A 3QRGL 4BSWB 3SPIA 4TLSA 1HL8A 1IEBA 1X7SA 2YRPA 5D2NA 2BSSA 5JW4M 2CPCA 2QLYA 5BRZD 4L4JA 4R5VA 2WIIA 1UVQA 1T5XB 4OF5A 1GKEA 4XN5A 3LPWA 1TIUA 2HRGA 4R7LA 5BZXA 1KLFB 3LTVA 3SOTA 4DUVA 2XXCB 5CR1A 5HHNB 2QHLA 4KFMA 3BQVA 1HCVA 2GCYA 5CBEA 4N0YL 4UNIA 4OJFH 3WHE1 5L2KD 5TQ2L 5JOEA 5GS3A 2O61B 1UXLA 1FH2A 1OAKH 3D25B 4JFOA 2AQQA 3S8GB 1A4BA 2AJ3A 5EEVA 4NZTH 1W2KT 3HUJB 3L1FA 4G80A 4MBOA 3S3DB 1AGCA 2UY6B 3UL4A 4Z7UE 4YLCA 3TO2B 1Z9PA 2OULB 1KDIA 3B2XA 4CSZA 1THCA 5K1NA 5D4HA 2ADIB 3QORD 5D1QD 3RB7A 5K39B 2WUBL 1YEEH 4UTBA 5LBSH 3HS0A 4XVSL 1A4JB 4ESKA 5D1ZC 1LO3L 3AY4C 4NIYE 4RDQF 4RWYH 2VQ1A 4G8GA 1RVFL 1DQQA 2IH8A 4YSPA 1WUNT 2HT3C 2KQMA 3EH1A 3UC0H 4DGVH 4WJ5B 2R7EB 1A4KA 2QVFB 4HIIB 4GRLD 4TTDC 3VFSA 3NFPA 4I0PC 4NXKA 4GQQA 4OQ1A 1RIHL 4UV7H 3OGOE 4N1HB 1X7TA 2UYLB 1QMUA 1KBGL 1P5UC 4XVTL 3CK0H 2ADFL 4JFZH 2WANA 3O3AA 3WIHA 1GMEA 4IGBA 3CIQA 3K6IA 3L3KB 4NM4L 4PJ7F 3S34L 4B9JA 5F1OB 3WUWG 1CXKA 5AW9B 4XN1A 2W92A 3RLSA 5D7IB 4A04A 1DZBA 4K8RH 1EFXB 4UZSA 3F5WB 2YSTA 3U9UA 3DOIA 2UX7A 1GAFL 1KGXA 4AI7A 1RU9H 2ZP8A 2IO5A 4TQHA 3V0JA 1BQRA 2WWOA 1E9QA 4LOVA 1RJLB 1UUNA 3MO1B 4DEPC 5I15L 1NIDA 1ASOA 2JCCA 3N04A 3QIBD 1MIML 2X4RB 3L4XA 2GAZA 2X0WA 3N40F 5CINH 2LU5A 3C2AH 3OB0K 4Z7OF 4RFOH 2AQTA 1BIIB 1KGUA 1H9DA 4ZSOA 5LCVL 5TGBB 3V9FA 2EILB 4AW7A 1TZHA 2FK9A 5I1JH 1QEWA 3N9GL 2OYLA 2RB8A 1MCPH 3FL7A 4FC3E 5HHME 4KNQA 3P0YH 4ZUWA 2EXWC 4ATTA 4IEFB 4TUOB 1O6SA 5DD3L 1PD0A 1ZIBA 1A02N 4PJGB 5KANG 2WTOA 1TTGA 3HBZA 5IW3A 1HT6A 1QFPA 1DSWA 4KY2A 1F4YL 2J8UA 3MV01 3DXAB 1IZKA 3QQ4A 5E6ZA 2BIHA 3EZJB 1V7ML 3U9PL 2H3KA 2ITCB 2A2QT 3P0GB 3QXAB 3KWUA 4H5SB 4LDEB 2FTAA 1JGLH 4AEEA 4NQEB 1U8LA 3BZEB 5EH1A 3BEWA 4GY4A 2WKLA 4P9HC 4JY5H 2NY4B 5KBLA 5CO1A 3KGUA 2QHRL 4PB9H 1JI1A 1TCRB 2CJSA 4H13C 4Y7MA 5GZOA 4Z8FH 1M9SA 1NCTA 1Q1JL 2E56A 3N41B 1CN4A 3KXFE 2XI9A 4LIQE 3LNGA 2J4WH 5F3HA 2XU9A 5T5FL 4HALA 1R5VB 1IAII 1T5XA 5BQ7A 2K0RA 4O9HH 1TJGH 1KLFA 2NY1B 4F57L 3EJSA 5HHNA 1SVCP 4WWPA 3QUGA 4G7YL 4ODBD 1LE9A 4HIQA 2X4PB 2DYPD 3C8DA 5I8CB 1MW1A 2O61A 1QFWH 4JBSA 3H54A 2VOTA 4WUUD 5E03A 1UWGH 2NY6C 1X3DA 5C0BB 3UBXI 4L29B 4OD1L 2WQXA 3HUJA 3KVPA 4P9HH 2UY6A 1E5AA 2VMEA 4OD3H 4ZW6A 1T4KB 2Z92B 3WN6A 1A6AA 4KU1A 3CFNA 1BMZA 3UBXB 4OJAA 4XPBH 2ITFA 1UZ6E 2QQNL 2P49B 4Q89A 3QC6X 3U4EB 1ZHKB 4F20A 2ADIA 3G04B 4EIZC 5K39A 5DK3A 4FEIA 3ZYZA 1KACB 3NK3A 1AR1D 4M8UA 1A4JA 2JSFA 1RFDH 4JRYD 4ZOEA 2P5EA 4LF3B 3H9HB 2WMPB 4Q7DA 5CSZB 2O6EA 4WJ5A 3GI8H 1OP5H 5KZCD 1AZVA 5EZJA 3OB0H 2VLJE 4QPEA 5E6UB 4H8WL 3WDHA 2W65B 4I77H 2R1YB 3U9WA 2P47B 4E9XA 3EXJA 4ORZC 4ABWA 5D7LB 2IPUK 4D94A 3H3BC 4P49A 1DN0B 1I8MB 5AKRA 1WBYA 3QG6B 4MAYD 4N8CH 3M86A 3CVIL 2QKIC 3CHXA 3MOBL 3D4GA 2GY7B 4ZS6C 3EHBD 1U2CA 4LGPB 1M42A 1JFQH 1QSZA 3GJFB 3M7FB 4F58L 2Y1ZA 3FHEA 2OZ4L 4NGHL 1XR9B 1VCAA 2CLRA 2HLEB 1EFXA 3KHOA 4L3ED 3UAJA 4I0CC 5F7WC 2KZKA 4BEIA 1A7RH 2IG2L 4Q74A 1KDJA 1YG9A 2AABL 4PGCB 3CH1A 4HWNA 5C7ZA 3C6LD 4ZTPL 4HQQH 2Z1KA 2FECI 3MA7B 1IBYA 4LCIL 4ODVL 2X4RA 1FNSL 1JL8A 3S5LA 1B0RA 1E4KC 2HFFB 5EO9A 5ILTH 4AVIA 1W8NA 4KRPC 3IDGB 4H44C 4M7ZC 4P3CH 4EN3D 3SO3B 5MEQA 1PVHA 5IT2L 3EBHA 4DO4A 1SVBA 3BRDA 4JKWA 2WM0A 1N67A 1U8NB 1YN6B 4N2IA 5I17B 4XMLH 3BT2L 4MMXB 1WICA 2AMUA 3O4LD 4R7NB 3H4FA 3I74A 4IEFA 1SOSA 4S1SL 3TNNB 2QGDA 1UD8A 2DQIL 5LGHL 1E6JL 4UUJB 4WDIB 1CZ8H 1OW0A 4APQD 1NC2B 3KYAA 1MCWW 1YDPB 3SGDH 4CN4A 3OKEB 3VYNA 3ARGD 5D7IE 5KOMC 3ZBMA 3WJJA 2QFRA 4BIKA 1NAML 2Z8WC 1U8PA 1AHWC 2ITCA 3MOAH 4QRUB 4ZXBB 3OKKB 4LLAA 5I73B 4NQEA 3QZNA 3ULVL 3ZTEA 5DFTA 4R7XA 1SN2A 3K6OA 2R0ZH 2C26A 5SWSD 4HUCA 1UB6B 5D4IA 3AXHA 2IANB 3AADB 4M5SA 5BOJA 4IU3A 2BVQB 1AI1H 5DD0L 2BK8A 2CH8A 3RIFK 1ZA6B 3N55A 1XGPB 3BGMA 4WO4D 1L7IH 4NIKB 3C5ZC 4GSQA 1EPFA 4LT7A 3US9A 3EDDA 3O3DB 2AXGA 5HHOD 1MCBA 3S3PA 4HUXB 3RNKB 3OKMB 3T2NL 2EDHA 4GBXD 4XMVA 1DE4B 5KBMA 2XETA 3PGCA 3T3MB 4YFDB 8PAZA 1DDTA 4DP2X 2MWCA 5I8CA 3BPLB 3PE9A 4PJGE 1IRAY 1JUFB 4S2SB 4G59C 3SYOA 4GT7A 3CG8A 4TPRH 5I2IB 5C0BA 3D08A 4GW5B 3T0AA 3HHSB 1SOKA 2EUVA 4HJIA 3IMSA 5AZ2H 1T4KA 2Z92A 5DR5L 3H6AA 3Q2CA 4FFZA 1AZUA 3DXAE 3UBXA 1DVZA 2MHAB 4NN7C 1WT5A 4XE0A 2B14A 2N0MA 1S8DA 3U4EA 2DLTA 4OZHE 4Y16C 3KL3A 1GHFL 1ZHKA 5A3IC 5F6IB 3UZEA 1TPXB 2CLVA 2VM9A 4XP9L 1FJ1B 1MCHA 5E6SB 4LPXA 4JMNA 3AUWB 5KOVC 5J9PA 4YBLB 4LCWB 1UJ3C 4LF3A 3LNIA 3OXSB 1IT9L 2WMPA 1I8LA 5CSZA 5J3HC 4DF9A 3GLEA 2BFVL 3RA7H 1RK7A 4N0CD 5EN2A 3DC0A 2Q87A 1F18A 2QADB 3I6GB 4X0KB 4XNAA 1LM8V 4OIFA 3E8VA 4IRSC 5D7LA 5E1IA 2PTUA 2LVCA 1JAEA 4R26H 1DN0A 2ROYA 3BX7C 4JJOA 1I8MA 3OMIB 1T0MB 4OCRL 2A3TA 3OC8A 3HRZC 1MFUA 4PD4J 4QOKD 4UNVA 3IN0A 3NUKA 4KOBA 2OZ4A 1S9VB 3UBHA 5E95B 4PJ5B 2EC9T 4F37K 1BF8A 1G7JA 4ADJA 3FTGA 2ZQKA 4IHBA 4AEIL 5B38G 5E8DL 3HFML 4PGCA 4PLOB 3W0WB 1GGUA 3EJUA 2QPSA 1HHIB 4DKEH 3RIFF 4GKNB 4KQ4H 3NN8A 1ETJA 3MA7A 4EI0A 3SBQA 2QPFA 3MJ7A 4A63A 2HFFA 4AEHH 5I0VA 3GSNL 2D7QA 4R8WL 2KT6A 4ZFQA 4RMVA 1DBKH 1PG7L 2I9LA 2V7HA 4XCNA 2F5BL 3RE0A 2EO1A 1ZAGA 1CMOA 3V0GA 4EAEA 3HC3H 3FFCD 3QHFL 4BUGA 1TETH 4FD0A 1A7QH 1HQ4B 1T89C 1QA9B 2KHAA 5GQBA 4ZK8A 1YN6A 3VFVB 3FN0L 3QUMH 4QRPD 5DC4B 1YY8B 1HL4A 1JTTA 2L8AA 3HPJB 3MLTB 2A99A 4HSCX 3PXLA 2Z91A 4UUJA 4WDIA 4PLNC 4P9ML 4XHJD 1HCFX 3ILPB 1QFOA 3IDXH 4GO9A 4PP2B 4OZFB 3VGDA 2X42A 1YDPA 25C8L 1WGOA 3OKEA 4MS8D 3BD4A 3GRWA 3LY6A 4EDXA 1S7UA 3NTCL 4NWTL 2HZHA 3CXHJ 4M1GL 1QSEB 4ZXBA 3WIAA 3OKKA 3MJ9H 1AO7B 2ADGA 4IS6A 1KLGA 2Z7ZA 4N5EC 3KBFA 1GGYA 4R4BB 4OM1L 1UB6A 5DUJA 2IANA 2E8YA 2WXKA 4XXDB 2RGSA 2WSKA 1V05A 4IRJA 2BVQA 1BQUA 2GVYA 1MI5E 4FQ2H 1MRCL 1ZA6A 3BKML 1XGPA 3D39B 3MODL 3KDMB 3P4NA 1IEHA 3U30B 2YUVA 2DQTH 4XB8A 1FRGL 1HOCB 3O3DA 2EH8L 3DJ9A 3LN4A 4JFDE 2VZ3A 4I3RL 4HUXA 3VXRD 2HH0L 4KKAD 1E2ZA 4WCYH 1DE4A 1JPTH 1CU4H 4HG4J 4PBWD 4HEPG 3AS2A 1CBJA 3B9KC 4G8IB 3I9AA 3C8HA 3QCVL 3T8XB 5EEUA 1BVNP 2O6PA 4YS4A 3HLKA 2CBOA 3U7YL 4HLJA 3NPZB 2BOCA 4L5FH 1UZ8B 5I0YA 5GGVL 3WBDA 4K3EL 2X2UA 1T7YA 4RMUA 5D1XD 4Z7WA 3LXBA 4YSDA 1P4BH 4XCEB 2X1WL 2C9XA 1QFUL 3LQZA 3QFJD 2E9JA 2KUTA 1TU2B 4O51B 1IM9B 3V0DA 2PCPB 2A4ZA 5DS1A 3BUIA 2ISDA 4HIXH 3ZHDA 3GIZL 4W6WB 3ZX1A 2BOLA 3T1FB 4FFWD 3QQ9D 1T7XA 2FYVA 2NLJA 5DZJA 3FT0A 5DMGD 4AV0A 4LCWA 3K0YA 3OXSA 3ZUCA 2D7TL 5FKPB 3BCDA 1HDMA 2DQHH 3IJ8A 1E27A 4KTYA 4IM8A 2H41A 4Y4KD 1FNGB 1TOXA 4X0KA 3I6GA 3O6LH 4LB8A 1XF2A 2AI0H 4NO2B 4IIQA 4F7KA 2CBMA 3UEZA 5I24A 1WAEA 1BFVL 4O02H 5JR1L 3O6FC 3IDYC 3DNKA 2HG5B 3DRQA 5DMJB 4GUOA 3KBEA 2FT8A 3I3DA 1INDH 2Y9RT 4GP4B 2XCMC 4H8UA 4L8DB 1UD4A 3VSVA 5D5MB 3E1F1 1GGTA 3AS3A 3O2DL 4PJ5A 3O41B 1Z32X 3V4PB 1NCNA 3AM8C 2XN9D 2H1PH 2EXYD 3DECA 3MTXA 4W9GC 3W0WA 4B9YA 1ZLSL 1L6PA 2BC4A 1T83C 2UXFA 5JXAH 3FU0A 5I8OH 2E7LC 2QJDA 2Q8BH 3BVVA 3LZFL 2YZ1A 2YXWA 4J6RL 4TVSa 2BJMH 1EHXA 5LB1A 3BZDA 4RAVB 1OGTA 1WFJA 1HQ4A 2BRRL 1Z9NA 3MJ8B 3VFVA 1NDMA 3PL6A 3NT0A 2AK1L 2OL3B 4YQXH 1ZDQA 1YY8A 1AQMA 3HG3A 3HPJA 3NACH 2YFNA 5I71B 1L3WA 4UI2A 4QHKJ 1DANU 3HZVA 3O3BB 4RZCB 1AXTL 3C75A 3KBPA 4PP2A 4XNUH 4OZFA 1KFGA 3TZVD 3QRGH 3IGUA 3LRHA 2GFBB 4HJTA 1I8UA 4BELD 3QDMB 3MV7A 4QD2E 3T09A 5E6IC 3PGDA 4WU5B 1RPKA 2AQPA 2HT2C 3F6JA 1B6UA 5F8RC 1D2PA 3TBYA 1AO7A 4WKZA 4TTGA 3GC3A 3MA9H 4U2ZA 5LG1A 1R75A 4R4BA 4G8GD 3TM6A 3AAZB 5AVXB 2YEVB 3GXMA 3OG6B 1WAPA 1CGUA 4GH7B 4FQLL 2PLTA 5HHMD 1D6EB 4WHTB 3NP4A 5LGKA 1E5YA 2VRQA 1U3JA 4PH8A 5J6HB 4MWFB 3GS0A 2DBJA 4W9ZA 5EF1A 2DMGA 3M45A 1BJ1J 1AY1L 1M71B 3RTLA 2F7PA 2W91A 4J4PA 2HX8A 1N6VA 2OMVB 3LEYH 3KLLA 3RL1B 1KCUH 2WLIA 3LDBC 3M8OH 3KM2A 1CL7I 1DQJB 3T8XA 3ORJA 4M03A 2QELA 3B9EA 4KROC 4U7SA 4XVSH 3R1GL 1UZ8A 3UGEA 2YBRB 1RVFH 2TSBA 4BKLB 3GZQA 5LXGH 3CDZB 3HI1A 2E59A 1FYTA 1NUDA 1SJVA 1YAIA 1I1AB 2EE3A 4B6ZA 4A7GA 4F7EA 4TQEL 5I6NA 1PNCA 1ADQL 3BAIA 4XCEA 4XNMB 1X5XA 1QSEE 1TU2A 4KK9C 4O51A 1QBAA 2PCPA 1KBGH 2BPBA 5EA0L 4YXKH 1FP5A 1TJIL 2CGRH 3KXFD 4PAZA 4XVTH 3VMPA 5ITBL 2ADFH 5CP3H 3VJ6B 2QPEB 2IAMD 3S34H 3AT8A 3T1FA 3WMSA 1FQ9C 1TEGA 2H0FA 4IBQA 3MRMB 4QHUA 3DV6B 5DFAA 1ETZB 4PY7B 3VVVA 4P2OD 4TVPD 3D39E 2HJKB 1ZLVH 5DYOA 3D0AA 2FYYA 5FKPA 2DD8L 3QNYA 3BKYL 3MLXL 3A23A 1GAFH 1AOZA 5FFLA 7CGTA 2DMHA 1XV8A 1XEDA 3IXAB 4NO2A 4EBQH 5ADOH 5DJXB 5I15H 2KL6A 1CGWA 3GSRA 3ZKND 2YD7A 1MIMH 2LT9A 3F6LA 2YIHA 3IDMB 4WKXA 3R8BB 2HG5A 4MXQD 3P73B 2N3JA 1FPTH 3V0VB 5LCVH 4L8DA 1JZ8A 3IAPA 4A2FA 5D5MA 1C16A 3E7JA 1MLBB 3N9GH 3O41A 3X2QB 2BZDA 4HKXB 4KI5F 4GAAA 3V4PA 1EJFA 1P0SE 2XPZA 3HI5L 3EYOB 1SRDA 4A2DA 4QTHA 4J3OC 4WI5A 5LBGA 1B0IA 4NZUL 5D1ZI 5DD3H 3ILEA 5GZOD 3MUUA 4R5XA 1J0KA 3A6BL 2F68X 4K4KA 1A1NB 4JFFB 1URZA 4JNXA 5D1ZB 3BCFA 5DRWB 2B77A 3F7VB 4J3OF 2Y06L 4YDMA 3W11C 1F4YH 5HGDB 3HJEA 4GSXA 5E0FA 5BVJB 2XV2A 3GZKA 1JZJA 2J43A 3MUJA 4RAVA 1W0VA 3MJ8A 4FFYH 1TJMA 2DQMA 3NZ8B 4I0PB 1N5AA 2DLGA 2OL3A 4RX4A 1AQ8A 4W81A 4NQCB 4GXVH 3C6SB 4LMQI 2JB6B 2V9RA 1P5UB 3M1CA 4HUVB 5LXVA 4HCRA 4AL8L 3U0TA 3O3BA 1VADB 1ZS8B 1BZ7B 4MJ4A 2QHRH 1T66C 1FFQA 2OBGA 4LEOB 1QBLL 4XP5H 3QDHA 1Q1JH 2X10A 2GFBA 2IFFL 3V4LA 3QQNA 5HYQB 3QDMA 4M43L 3V0WL 2VN6A 3CFUA 1ECZA 1J5DA 3LEVH 1QNZL 3LZOA 4WU5A 4Z7OB 4AYSA 3KNBB 2R1XB 3IBEA 4F57H 1JJUA 4F8LA 3AAZA 3D48R 4AZ8B 4WI8A 3D51A 2O6DA 2MRYA 3R7RA 5AW1B 1QR1B 2GITB 2X0UA 1D6EA 3BLKA 3FTWA 3DO4A 4OD1H 4H8WC 2YQ2A 5KJ7E 2OMUA 4GMTL 4JE4B 1O5DT 4PHZA 4MWFA 4HUUB 3W2DH 1B0WA 5AW8B 1M71A 1L7TL 3ZGIA 1CDJA 1J1OH 5DQJB 3RL1A 5T1DH 3OBAA 1DQJA 2DQJL 1PYWB 2WBJA 4HDIB 2WQSA 3H42L 1EFXD 4CN6A 1GVIA 2X3AA 5DVPA 2YBRA 3K6NA 1KXQA 1WPCA 3E8UL 1ADQA 2HKFL 2ZKMX 2Q20A 1P6AB 2KDYA 4IBTA 4ODHL 3LOWA 3NJMA 4H8WH 3DLQR 1QOKA 4I5BB 2AAVA 5JORA 2PTVA 1ZSDB 3I9GL 2FUQA 3EOBB 5IIEA 3CVIH 4YBQD 3MOBH 5H94A 4JHUA 4JZOB 3U1SL 2NR6D 4HWUA 1ETZA 3D9AH 4PY7A 1G0DA 4I89A 4GSRA 4PJBF 1QLRB 2W88A 4F58H 1HNFA 2HJKA 2X2HA 4FLHA 4NGHH 1RUKL 3UERA 4BH7B 5C6TL 4B5EA 4JKKA 4DEUA 4ERSL 5C0FA 2X2JA 4XOBA 2IG2H 2ENYA 2JQAA 1MJ8H 2DJSA 1YMMA 2X4UB 1VZIA 1SLXA 3L45A 3QJRB 1SXZA 3RTQC 4F8NA 2C9SA 1CXFA 1MAML 4R84A 5ICZB 3X11B 3HBGA 4GINA 4LCIH 1FNSH 4QMEA 2WXLA 5IB3A 3IDMA 2R4SH 4YC2C 3MRCB 3DXAD 3P73A 3V0VA 1CTNA 5IT2H 1F6FB 2CUIA 1MLBA 2O5YL 4KRNA 3QUYC 1OQXA 3D18B 4YSRA 4NQED 4NUQA 3ATEA 1HHHB 3MBXL 5SX5K 1WWBX 2CHXA 3CZKA 3BT2H 2NY4D 5J8OA 3A21A 4YHIA 5IBLD 5CP7B 1EZUA 4S1SH 3EJZD 5LGHH 4BJLA 5HPMB 4WFFE 1OZUA 2OW7A 3B7TA 5HJDA 1SHWA 2XVBA 4PS4H 3ETBF 1A1NA 4JFFA 4CNIA 4KO5A 1JXGA 1NGPL 5DRWA 3CC5A 4YK4C 1AR2A 4U1MB 4J1UB 5DI8B 2VLLA 4ODXB 2NY1D 3Q5YA 1T1WA 4PJ6A 1Z66A 5F7NC 3LKOB 1O7SA 2PP8A 5F96L 1S5IL 4FQJH 1VHPA 2WVUA 3EYUL 3G08B 3MJWA 1P5UA 5C0BD 3F3HA 4HUVA 2R1WB 3KYOB 4CC4C 3NIGF 5L4IA 5GZNC 5LLIC 1VADA 1CR9H 2QKIB 1FL5B 4LEOA 5DD0H 5D6DC 4A68A 1XDTT 3NZHL 2AJYL 5HYQA 1MCOH 4QKXB 3GQFA 3SKMA 1HX0A 3SGDI 4MDJB 4BZ2L 4QYOB 3KNBA 3UJJL 1KY6A 5FOJA 1IGIL 3BWAA 3KM1A 1PEZA 1SY6L 2V9UA 2GB2A 2QDVA 4L37B 3N3EA 4AZ8A 1XIWB 3MU3A 1KCKA 1BVLB 1U33A 4M7ZB 1HU8A 3IFNL 1DJSA 1DJXA 4LP8A 4LDCA 5GS1C 3UIYA 4HA1A 2WZPA 2OXGB 3FC8A 4HUNB 3C5SA 5D7LD 1OT2A 4DUXA 2ZUVA 4JR9H 1ILSA 4PJ7E 4MSWB 2BVUA 1KWGA 2SEBA 5KUKA 4UT7L 4LNVA 3TJPA 2V2XA 1R9FA 3HMWH 4NQCE 2OW6A 3QR0A 1CXEA 3CCHB 2BSTB 3FB5A 3O9WB 4MDRA 1PYWA 4EEEA 4HDIA 4JFXB 2EDOA 3TGXA 4JGUA 4OIBA 2BNQB 5T3ZL 4KZDL 1IT9H 1ASPA 5F21B 2BFVH 5FHBL 1XH3B 1RK0B 3VRJB 3US1A 3PRZA 4X6EB 1KCVH 1E42A 5E51A 4Z7OE 1F42A 1FBIL 4FADA 4I5BA 5FWQA 1VKXB 1NCCL 4P5KB 1FE8L 1JF1B 2XHNA 1NMAL 3PWPB 2GC4C 3QUKB 5DVKA 4CU7A 4X7TB 2VJXA 2EDXA 4LNRB 1UKTA 4KKBC 2Q7YB 1ZXKA 2HN7B 4JZOA 4PGEB 4HC1L 3C5ZB 1QLRA 3D0LB 4RFEA 4PCYA 3VM5A 3WKPA 3Q05A 4BH7A 5AAWC 4HWEH 4YHZL 3HS9A 5IY5B 3VX0A 4F24A 1YRKA 4AYFA 1IC7L 2EABA 5E8DH 4AQAB 4ABQA 3HFMH 4EXPX 5B8CA 2X4UA 3V4VA 3VXSB 3VFRB 5JLZB 4UQ9A 4TLUA 1NC2D 3GSVB 1I9RH 5ICZA 3CBJB 1QRKA 2VR9A 1UURA 2IFGA 1XGZA 1E7VA 2Y7SA 3FJTA 3GSNH 1J5OL 1PG7H 3PYCA 2F5BH 3II3A 5IMLB 4GG6F 5B7MA 3RL2B 1DJYA 4ZXBD 1S9KC 2ZX7A 3QHFH 2F7OA 2IDTA 1LYQA 3DX3A 4FJZA 1HHHA 3UYRL 3BHBB 5B1JA 4ELDA 3FN0H 5EBLB 1A64A 3ZXAC 4HGKC 3WFDL 2IAND 4URKA 2ATPB 1M7DB 4MD0B 2E8ZA 3NA9L 3QIUC 5HPMA 2ZOTA 3QIWA 1P2CB 5HDQL 5EEWA 2NDFA 4P9MH 5FIEA 2Y7OA 3VI4A 1JNNL 2HFGL 4U1MA 5TJWK 2BIOA 4C59B 4J1UA 3BLBA 3P9LB 5DI8A 4U7MA 3NAAL 1K5WA 3FU6A 4WEEA 3OG4B 4NWTH 4M1GH 3QQDB 1D5BB 1H6UA 4ZAKB 3KEHA 1WHPA 1NGWB 5A6IA 3JV0A 4KDWA 4IRSB 3QFDA 4P46A 1VEOA 2MIZA 4X6FB 2R1WA 3KYOA 3HC4H 1QTPA 1RL1A 3HRZB 1B4LA 1FL5A 3O0LA 3DVNA 4XCFL 3VQLA 1E8YA 3MRFB 3JZYA 3QP3A 2K7PA 3BKMH 3QUMB 3MODH 4ICWA 2FNBA 4FQQA 2ERJB 4FA6A 1O6TA 2EH8H 1ES0B 1EFQA 2F54B 4QYOA 3H56A 2WN2A 4GIPD 2HH0H 4BZYA 1R5IB 2Y7LA 2E27H 2IH9A 4YX2L 2IH3A 2C5DC 1DUZB 4NOFA 4N6QA 3RZCC 4W6XB 5AB9A 3QCVH 4LCWD 3S7GA 4FABH 3S37X 1XIWA 4BA8A 4N25A 4CVXB 3U46A 1BVLA 5F9DC 5TQ0L 3VXNA 4ES9A 1G9EA 4PW9A 3U7YH 3BLPX 4IU2B 4EDWL 2GG1A 5IGXH 5GGVH 2O93L 3MLYL 3PHAA 4K3EH 2MQGA 1U21A 1G1YA 2QADD 2Y1VA 3PXJA 5KBDA 5F71A 5T1LA 4K7PL 3LRKA 2NZ9C 4ZTOH 1QFUH 4JKNA 4DP6X 1PPIA 3HR5B 4OM0L 4A6YL 2A9NL 2I60L 1T22B 4N26A 1ROWA 3O9WA 1OAUH 4U1KB 4F5CE 5I6OA 3W5MA 5FUOL 3L6FB 1GGCL 2P80D 4PJCB 3DKHA 4PJ5D 2WNWA 3NH7L 2BSDA 2XQ0A 2BNQA 4IIZA 3GMRB 5IW6B 2NRDA 3W0WD 3QZWG 1ESOA 3BAJA 4HGWB 4R2GB 1RK0A 3JTTA 4X6EA 2IWGA 3OWRA 1MFBL 3CHRA 1S7VB 1W8OA 5CJ5A 3B3IA 2L7EA 1VKXA 2BP3A 2XV6B 4XXWC 2WYIA 4GI8A 2NX5E 3PWPA 3QUKA 2V17H 1BFVH 1A25A 1FG2B 4MVBC 5JW3H 2K8QA 2PETA 3ARDC 4HT1L 4Y9BA 4LNRA 3TEZA 2Q7YA 3EOTL 2VXSH 2HN7A 4G8EA 4HC1A 4PGEA 3L3IB 3LXCA 5IJVA 4WNJA 1NIAA 5JZ7D 3D0LA 2HVJA 3O2DH 5G4OA 2XKUA 3BRFA 3TEYA 4Z95L 5DO2D 2WKOF 2Y69B 4AQAA 4MHHG 2B1OA 3QI9B 4FFVD 3FFDB 3VFRA 5JLZA 4RSYA 3B9KB 3VW3L 2HUHA 3BH9B 2OTWA 4GKSA 4W4OA 4UTCA 1OOAA 2DZEA 3LZFH 5IMLA 3NSJA 2J12B 1QSED 3RL2A 3JXAA 1IL1B 4A2LA 4G2AA 4HUKB 3WAKA 4KMTH 1TFHA 3BHBA 2AK1H 4O02B 5CEZL 3VWJC 4F2MB 1NCJA 3P9WB 5MP6H 5EEYA 2H26B 2X87A 4LPTA 1M7DA 4MD0A 4XRCA 4HJGB 4G72B 3RDJA 3U1QA 1P2CA 2BERA 1YYCA 3D39D 2ZYSA 4JUTA 3OQRA 4XH2B 1AXTH 4ZPTB 5G55A 2XTSA 3KGRA 5EEXA 1DN2A 1JZ7A 4YDLB 3RGBA 1J86A 1YY9C 2VZTA 4F7TA 1F02I 2R83A 3UCQA 4UIMB 3ZE1F 3MRLB 1I7RA 3NSDA 1OCWL 4MX7B 3FYEB 4BFOA 1NCWL 4KKQA 1L9NA 3LH8A 1AD9B 1YECL 3L8QA 1KIUB 1PDKB 3QQDA 3W5NA 4UQBA 1D5BA 4ZAKA 4DKAA 3PABB 3SQBB 4FLQA 2QQQA 3VXSE 1A3QA 2EVGA 2D3NA 4LAQL 3IDYB 4AEFA 1A6ZA 3FQTB 1SLVA 4GQPH 4XN4A 2EUWA 1OCOB 1SXSA 3GUFA 1GY1A 1LQSR 4UCFA 3L4WA 4M29A 4POUB 1G7LA 1XZ0A 1JV5B 3ZKMD 2B39A 4ZMNA 4QXGL 3BWZA 3ZHNA 1IM9D 4L1BA 2W1NA 3KJ6L 4XNXH 1ES0A 3ZKQD 3EYVA 1AY1H 4NNXB 4LQ1A 1BECA 1DUZA 3TA4D 4GQRA 4WU7B 5D93C 3ULUL 3SY0B 1IC5L 2Y7QB 2X88A 2YRLA 3P30L 4KDTC 4NI6A 4IU2A 4PJFF 3BPCB 4Y8DC 3QJFB 5CGYD 4Y5YC 5J57B 4XI5C 2D4FA 2MSPA 2V7NB 2ZKXA 1VFBB 2GBUA 2HT4C 4TQEH 3VFGL 2XZQH 4U4IA 3T4YB 4ONHB 2BVPA 5F88A 4A6YA 1WZAA 2GBAA 5E99H 5EA0H 4OLEA 5ITBH 3IF1A 2YAQA 3NCWA 3KL0A 3S35X 3QO0B 4LCCC 4H25A 3L6FA 2YOCA 4PJCA 4QY8B 5GS0L 1O9VA 1NEZG 3CPLA 3PG2A 1E4JA 1NDGA 2FJFB 2OTUB 3JZ7A 5IW6A 4CSSA 3VI3F 1GRWA 5KYUB 4HGWA 5E6IB 2DD8H 3BKYH 2HLFD 4D3CL 3MLXH 2J8OA 1CFTA 3B2UD 2F54E 1BXAA 1NFAA 4MJ2A 1L9QA 4PP1C 4N2DA 3K6FA 4Y5XC 1D5IL 1MXDA 1E9PA 1C5BL 5LUMA 2YQGA 1UM4H 2F08A 5EUOF 4IBVA 1E8XA 2R9HD 2JLPA 5FWRA 3SDXA 1PY9A 4F8PA 2JB5L 3L3IA 2NY3C 4JO4L 3A22A 2UZIL 3SY6A 1TZIB 5GRVL 1JK8A 5L8KB 4PYGA 1LDSA 3HI5H 4AL8C 4GQZA 3KE0A 3QI9A 1K8DB 5K5YA 3CU7A 2E74C 3S5YA 3DJSA 1FORH 4NZUH 3SDDB 4CA4A 5CNHA 5CZVL 2VM3A 1JWSB 3A6BH 1WISA 3BH9A 4UV4L 3QDMD 1CGSL 5ISZB 3H2QA 5EBMB 3KJ4B 5C6WH 1VESA 2A83B 4ZOBA 4OQTA 5FYKU 4B53A 2W60A 4IMKC 4ZNEA 2Y06H 3MRRA 4LARL 3ABLB 1SBSH 2HRLA 3VSUA 1PSKH 1PTZA 3FAXA 4FTDA 3MLWL 1ET8A 3GPSA 3BVNB 4PI0A 4O02A 3KWXA 4W9EC 1GR7A 3ZZ1A 2LR4A 1AS7A 4AG4L 2X1OA 3ISRA 5FB8B 4MLIA 2HRHA 2OCJA 2RTTA 2H26A 5C0AB 5JO5B 5I5IA 1M3JA 5I18L 1MHHA 4L5FE 5AYQA 3B9AA 3UFIA 3V6OA 4Y19A 4IBZA 1YQVL 4XH2A 3EYFB 5C0NC 4ZPTA 4WWOA 1AVAA 3U82B 1QBLH 3AFLA 2HLAA 3DK0A 1EDHA 1DJZA 4OFQA 4A2EA 2IWEA 2IFFH 2GJPA 4UIMA 5DFVC 4M1CC 4M43H 3SJVE 4MX7A 4OFPA 2HUEA 1EHLL 1QNZH 4NFDA 1AD9A 1KIUA 1BVKB 3DX6A 5A2AA 3PABA 3SQBA 5HVHC 1IU1A 2QGEA 3WENA 1DQLL 1UD2A 2V2WB 2NUTB 4PWEA 4BWWA 2QKSA 1I1AD 3FQTA 3GTNA 4CU6A 3O2WH 1CXIA 3VAEA 2HA1A 4ZPVB 1KB3A 2Y3NA 1KJ3H 3B2DC 3FHQA 1SNRA 1WS7A 5K33A 3ARXA 5JIDA 2CKBL 5I1EL 1J18A 1MEXH 3G6AB 1E9OB 2P24B 3IETA 1Q38A 1L7TH 4NNXA 5KS9F 4F2ME 2G0KA 3TF4A 2VW4A 3ATBA 4WU7A 4Z7AA 2Y7QA 1PFOA 5GGRB 3L3OC 4R7VA 1AGDB 5A2IH 1W6LA 1GTFA 3W81A 4YSEA 5HDLA 5FO8B 3BPCA 7PAZA 2LAGB 1BZ8A 4LASL 4FL4B 4G1EB 4BRJA 3E8UH 2NT1A 4PWFA 3UG4A 3WNNA 1VFBA 1AMXA 4JFEA 5IK3B 2HKFH 4X6CA 2NY7L 2XXFA 4ODHH 1QACA 2F19H 4ONHA 4YHML 3ZDWA 4MQXC 4OZ4A 3V55A 3ZY7A 4JJHA 3KYMB 4PS7A 2BCKB 4G70B 1KG0B 4YR6A 4GP8B 3PQYB 4M62L 4OV5B 2YMOA 3TOPA 3D6GA 3QO0A 4FE9A 4QY8A 3U1SH 5KVEL 2BW5A 1SFDA 2JJVA 2OTUA 5BPPA 5J4MA 3ARQA 5KYUA 5C6TH 3VGEA 4ERSH 3KG5A 4WNQB 1LVEA 4I1PA 4ISVA 1X5IA 1N12A 3NK4A 5HSFA 5G4MA 3X1FA 2B9BA 4I1RA 4K8RD 4HCGA 5D1ZD 3VMOA 3ZL1A 2YD0A 1A6VL 2L3BA 1QSFB 4ES8A 3K8LA 3ZW3A 3MCKA 4EIBA 4XN2A 2ZKWA 3MV8B 2Z64C 4ODTH 4X6DF 2EIMB 4QHLB 2FLRT 1KB9J 1QPPA 4TTDD 4I0PD 1YAZA 2ZJSL 4BFGA 4L0ZA 2GPZA 1IILE 2O5YH 1J8HE 1MNUH 3V5HB 4HETA 4X98B 4UQEA 5IBTL 3P4MA 4NQCD 4QRBA 2XTJB 4KJPC 2OMXB 5HYEA 4HX1B 3SDCC 1BQLL 4IKKA 1K8DA 3APNA 3SDDA 2B15A 4U49A 3HMXH 5F9OL 1JWSA 4DAGL 2CK0L 1FWXA 4HGMA 3GINA 1ADWA 1AAJA 2QQLL 1UXSB 2A83A 2KC0A 1NGPH 5I1GL 3I6LE 5CS7A 1VFUA 4PSPA 2ZD0A 2JTDA 5HI4D 3FU5A 4WTZA 5I30H 5AOMA 3BH8A 3UTTB 1QWUA 1XCQB 4UOZA 3DI2B 2J44A 3MLZL 4WI6A 3HG1B 5TDNB 4AQ1A 2A77L 3GMOB 4PJBB 2WNGA 4DERA 4M61A 5C0AA 3EYUH 2G2NA 1QD0A 5JO5A 4EI6A 3IRPX 3N44B 2WLKA 3FCTB 3ZT7A 3ELAT 5EIVA 2EDQA 2D7PA 3IMRA 5T8IA 2XG4B 1U8HB 5JYLA 2E7DA 4AVKA 2X1XR 4MYWB 4K71B 2AJYH 1P4UA 2YD9A 2ITEA 5DD5L 5GGUB 4ZG1A 3G5XA 3PLYA 4JY6B 4BZ2H 1A7OH 3IJHB 1U91B 1KIPB 3RBSA 3UJJH 2YN5A 2Z1PA 3OKDB 1IGIH 3TV8A 4N8VB 1X6LA 2VLME 2EO9A 1SY6H 3K6SA 1V7NH 4YVNA 3CSTA 3U2JA 1S7WB 1K3ZA 2NUTA 2EC9U 2DM7A 4YC2B 3C60B 1N0XH 2FGWH 4OSUH 5ISZE 1J0JA 3C9NA 3IFNH 5DUBA 1BD2A 2CA3A 2Q7AA 1Z5YD 2GHZA 3W39A 3QUYB 1OSZB 2ZOLB 3FW6A 4J5VA 4KQ0A 5B21A 5D7EA 4A1RA 1E9OA 3DTUB 5FA3B 5JIHA 3P1VA 4UT7H 1GYCA 3PJSB 3ARFA 1H9VA 4LSQH 4QRSA 1RKRA 1H6EA 5D9SA 3IJSB 4MXVF 5GGRA 3RBGA 1AGDA 4M4PA 3GS4A 1GJUA 4H2AA 1KCBA 1T04B 3IU4H 1WTGT 5C71A 5AW7B 3AZUA 4PFEA 3RHWK 5DFWH 4BZ1L 1N26A 3CFDB 2E76C 3BQUB 5IK3A 3ZE0B 5F9JB 1KGYE 2YXVA 2E3VA 4XN8A 1FBIH 4MQSB 1NCCH 3KYMA 1FE8H 1LK3H 2BCKA 3AITA 1HOEA 1MKFA 1KG0A 4OV5A 1ZA3A 3PQYA 1HZKA 3IS1X 1HWHB 3EUUA 3O45A 1RZ7H 3FT4A 1OB0A 1EO8L 1KJ2L 3ZOAA 2YK1L 3VFTB 1KEML 1ZJBA 1QG3A 4QF1A 4N2EA 2HXAA 4A39A 4CMMB 1VPOH 4AX3A 5C0RL 2ZCKL 4YHZH 2CO4A 3HZYA 3SKOB 4I2XA 3ZZLA 4JDZA 4DKTA 4WNQA 1LO0L 2Q1EA 2A4CA 4MGXA 5LAXB 3H9ZA 3VVWA 2WQAA 5FPIA 2W0LA 4QIRA 2ICEB 2FNWA 5HYJB 1M1XB 1OPGL 1AKPA 1J5OH 4BUHA 1W91A 3KVDD 4UZGA 4R3SB 4B9IA 2XKSA 3B2VL 4LLVA 1IBGL 5JIIA 3O11B 2AP2A 3FB7B 4P57B 3V5HA 2EICA 5I6XC 3UYRH 4OLVH 5AW5B 3O81A 1RZFH 2OMXA 3C08L 5IKCA 5HGHA 4PR5B 4HX1A 1SFHA 1O75A 4M8QB 1URLA 1YCSA 1T6WA 2Y1YA 2Y7MA 2ZYIA 5HY9B 2FX7L 4ZS6D 2WNXA 2HTKD 1D2OA 3P11H 1SXAA 5HDQH 4MRCA 4ORGA 1AC0A 1JGIA 1UXSA 4WGWB 4WI4A 3G5VB 1JNNH 3G7TA 4Y9CA 4AYDC 1I7UB 1N19A 4I1NB 1DVFC 2HSIA 3WTTA 1E7UA 2BY0A 4LBEB 5GRWA 1J0HA 1TF4A 3CHQA 3AS1A 2MNJB 3O4OC 3UTTA 1J0ZA 1SJXA 1NPUA 2VM4A 2EIJB 1XIWD 5TDNA 4HJ0C 3RVXC 4PJBA 1JGUL 4AKQA 5M95B 1SJEA 1G43A 3FH7A 5GGTL 1QSFE 2FBJL 4UZUA 1JHLH 2QDWA 3BPNC 3FCTA 4R0LC 3MV8E 4XCFH 2XG4A 3DX8B 1CK0H 3GO1L 1JK9B 1FF5A 1HFUA 1NL0H 5CD5C 2OMYA 3FUHA 3MJGX 3V6ZB 5ERWA 2WWMD 4Q14A 5BO1L 2OR7A 4JQIA 4CN1A 2EYRB 5GGUA 4LU5L 3I84A 1KIPA 1A9EA 3O9WD 3OKDA 5FHAL 4GG6B 2BWIA 3L1EA 4YX2H 5J13B 5CZRA 3P77B 2IADB 1WUZA 2NXZC 2IV9A 2BNQD 1F56A 3OLIA 5CJXC