2W0KA

Crystal structure of the recombinant variable domain 6jal2
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
111
structure length
111
Chain Sequence
NFMLTQPHSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGSSPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSNHVVFGGGTKLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords V1-22 PROTEIN
publication title A Single Mutation at the Sheet Switch Region Results in Conformational Changes Favoring Lambda6 Light-Chain Fibrillogenesis.
pubmed doi rcsb
total genus 24
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w0kA00
2XKNB 4WVRA 3B2VL 5KANI 5D2NA 2BNRB 4LCWB 3FFDA 4M4RA 1RZ8A 3GSXB 5I9QB 4X5XA 4NQCD 1M71B 3PWNA 4ZFZB 2Q8AL 4CW1A 2XYCA 3TV3H 5INDB 2EYTA 3MZGB 1U8OA 4DW2L 4R4BA 5ITBH 1QSFE 2XWJB 4U6YB 1UB6A 4YK4B 3V0WH 5KS9E 2HJKA 4Z7UF 5DJZB 3EDDA 1A47A 4R2GC 4YHKH 1NC2A 4XMPL 4QRPD 1QO3A 1DLHB 3K46A 3K2MC 3EAKA 5FKPA 4LF3A 4OQTA 2HFTA 1KJ2H 4HK3J 4FTVB 4G42A 2D7NA 5GGRA 1JV5B 2Q7YA 4G9FE 1CU4L 5JA8B 4KK5C 5IEKA 4JRXE 1I9JH 2OP4L 2DIJA 4MXQD 1CE1H 1I3GH 3WFHA 5AZEH 2FO4A 4HPOL 5I71B 3HI5H 1INQA 4FFVD 2JCCF 4UIKH 4ZTPH 5CKGA 1TFHA 2LAGB 3NA9H 2FYYA 2WNGA 3LD8B 5C2BL 2Z31C 4EDWL 2BJML 3SE3A 4KQ3H 4NPYB 5IQ9B 5CZVH 4J1UB 5GGSY 4HIXL 5DD3H 3SGKC 3A6BL 4I9WD 4X98A 1P1ZB 4NNYB 1EK3A 1MVUA 2FH8A 3GKWL 3U79A 5CMAA 3CFEA 2OJEA 3O3DA 4W6XB 2EEBA 3F5WB 1I7TB 3KR3L 1BIHA 3S7GA 2NXYC 4L4VB 2V2TB 2BNRE 4LCWE 1GZPA 4J6RL 3L7EA 3GMRB 1V3LA 4HKJB 3I6LE 2JB5L 1EFQA 5I66A 2BZDA 1S9XA 3UBXA 2KZ1B 2CLVB 3CH1A 4YXHL 3EYVB 5HJ3A 2HMID 4MSWB 1UGNA 4U1SA 5DD6A 2BMKB 3RRQA 3PABB 3HR6A 1MIMH 2Y4SA 4X7SH 2AJXL 4MA8H 5CWSA 3QO0A 1IQWL 1B90A 4S11A 3E6HA 3DGGB 2YZ1A 1F4YL 3KLAA 4H26A 5FDYA 4AG4L 1CDIA 1JNLH 3MNVA 3O41A 1N64L 1MI5D 2FSEB 3VWKC 4FQLL 2G60H 5F7EH 5ILTH 3AROA 3O8XA 2AI0L 5FF6A 1QSEB 3JV4A 5EIQA 3FB5A 3Q2CA 1YEFL 4P2CG 3OKLB 1I9RH 5J12B 2X4RB 1GAFH 5CSGA 1XZ0A 1ZEAL 4X8JB 4CVZB 4MWFB 4G6JL 2GAZA 3VGHA 3TT3L 4MDJB 5F96L 5K59E 1G7MB 2PCPA 3V6OA 3G5XA 2HKHH 1IJ9A 3RTQC 1SM3H 4XP5L 3TO4C 4NCC2 3VA2C 2NZ9C 3DUUB 2K9UA 3VJ6A 4LEXH 4E5XB 1XF2B 4L4VE 4MJ5A 5TFSH 3UYRL 4L8BA 5T33L 1H3VA 1KTRL 4L3EB 1A4KA 5F8RC 1RZKH 5GJSL 3UJTH 5GQBA 3T0EB 4Z7NF 3KXFA 3CLEH 3ARQA 4C56D 5K9JH 1DUZB 2G2RA 1JZ4A 1JGEB 2IPTL 2BVYA 5C0AA 1D6EB 5FO8B 5CEZL 1E28B 5T1MB 5DWUH 2HTKD 2NY1B 3GJFB 5CJXA 4PGEA 1S7QA 1FFNB 2V7NA 3SY0A 4O2EB 3QXDA 1YY9C 1CBVH 5D6CB 2DQHL 4GG8B 1OSZA 4Y5XC 3M8OH 5FHBL 3WDIA 5E6ID 4RRPG 2A83A 4P5TB 4O5LL 1OP5K 4M6OH 4X6CB 1PAMA 5F9JB 3A0OA 4LFHG 2MHAA 4XNQA 4JEGB 2HFGH 1KLUA 1S7VB 3EFDL 1G1CA 3MOAH 3K2UL 3MC0A 4RX4A 4GRMA 2XTLA 2J5LC 1WFTA 4AIXA 3G5YA 1ZANL 4KKNA 1BHGA 5SWQA 3GMNA 1QVOA 3ZKSD 3FFCB 1FZOB 4L9LB 3QDJE 5TQ2L 3GO1L 3BQUD 3QQ4A 4I13B 5J1TC 3TCLB 4GAJH 1M4KA 4PJ7B 2DS4A 2F58H 4P4RB 4XCEB 3V5HA 4GQ9L 3IFNH 5B3JE 1BWMA 1I85C 2V5RA 5INCB 1MFAL 5KS9F 2X4SA 1DVFC 2D7PA 4E0RA 1MHCB 4C59B 1PFCA 1PG7W 5JUEL 5AYQA 1N8ZA 1J0KA 3T77B 4UUJB 4POZD 3SQBA 3P9LA 4L3EE 2IPKB 3MCG1 2NY3D 4J3WA 4PTUB 1K3ZA 4J3TA 3JTTA 4ZO6A 1HDMA 1R3JA 5GGTL 1JFQH 3VFTA 3JWDC 4N0YL 1G6RH 2B1AH 3LQAH 1G84A 1MWAB 3BUTA 1W72B 3L3GA 3ZZ1A 1ZA3A 3R0NA 4ODSL 5C09B 1SJVA 4M1DH 2OLDA 1NCUA 1A7NL 4Z0XB 2Z91A 1BEYL 4F9LC 3VXSD 4NP4H 1ZT4B 1A14L 5HYQA 4HIEB 4OZIB 1RY7B 5IVZB 2FEDC 3QDMB 2NW2B 4X6CE 5MP6L 1XIWB 5EO0A 3PUCA 2HFFB 5FOJA 4NNXA 4G9FA 1BOGB 3BDBA 1A6VL 4JRXA 1YEJL 3B5HA 1MLBA 4JN1H 5JQ6H 4YGAB 5MENA 4RA3A 1UWEH 2VZTA 1RIVH 3FFCE 4OKVB 5MEPB 5I1AB 1NGQH 4DGVL 5ABDE 3W82A 3S8WA 4PY7A 2C4FT 4PJ7E 4U6HA 3MRKA 3DV4A 3NH7H 3QNYA 3VFUA 3EYFB 1EH9A 2WAHA 2EYRB 5GGTA 1ZHKA 3MRNA 5ALBH 2HN7B 1ZGLA 2XPGA 1NSNH 5E9DB 4DAGH 4TQEL 3IDMA 3QQ9D 5B8CC 4M5YL 2FIRT 5BQ7B 5DD5H 4UB0H 4MS8D 3UBXI 5DJ8A 4ZSOA 1ZOXA 4R0LC 3GK8L 1A64A 5I0ZA 3GSXA 1KLGA 1NH6A 2DMCA 5GSRB 1M71A 5HVHB 1RZKC 2CIKB 4PUBL 3OAUL 5C09E 5GZNC 2GJ6D 5INDA 3AY4C 4PJ8C 5JR1H 1IARB 4CU8A 2XWJA 1FLRL 4WY7H 1IGYA 4U4BA 1QFWH 3ULVE 1OLZA 4OZIE 1YJDH 2ATPB 3LEYL 1DLHA 3QDME 1TIUA 4FP8L 4WCYH 1HXMB 2NMSA 3HPJB 5K59F 1ZHNA 5BOZG 5KN5B 2EYSA 1N4XL 2OI9C 5CBEA 2ENYA 3MV8E 5FGBC 1B3JA 3KG5A 5I1EL 5IT2H 1C7SA 3HRPA 2QHRH 5JW4Q 4Q6YA 4OI8A 1FE8L 2VISB 3PGDA 4EUPB 1GCFA 2IALB 4ZXBB 2ERJB 3O81A 2CJUH 3FN0L 3GSOB 4Q9BA 4RFOL 3G08A 1DBAL 1I8KA 5DJXB 4UOW0 5IQ9A 2PKDA 4J1UA 1I1CA 2NW3A 3SKUD 1FV1B 5MERB 4UU9B 2XQBL 3OR7A 4Y4KC 3HE6C 4UTBL 4H5SB 5E9DE 3WUWG 4KDWA 1G7PB 1SYVB 4F80A 1K4DB 2QQNH 1JZ7A 2NR6D 4P57B 3ZE2E 2A0LD 3CX5J 4AL8H 4NWTH 3WFBL 2A74A 4Y16B 1F90H 4XMLH 3MROB 4M93C 4L4VA 1C5BH 4XHJC 4F8TA 1HYSD 4WU7A 4FQIL 4HKJA 4YDIL 1K8IA 4HS8L 4OZFA 4X4YA 3CSPA 3LKNB 1NANI 3W39B 2CLVA 4ACPA 3GRWL 3EYVA 3VW3L 4MSWA 1JPFA 3VWJC 3LQAC 2A73A 1NAML 4F58L 2VZUA 4LCIL 4AJ0A 1HZHL 2XFXA 1JYVA 1T4KB 4QXTB 3KPSB 5I16A 3DGGA 3F65A 5B3JF 3IDNB 1UACH 2CLRB 3EZJB 1F11A 1CLZH 5D1QA 2FSEA 5D7JB 4HD9A 3F7RA 3QWQB 3CMGA 2AV7A 2V7HB 1DUYA 1RUPL 1SEBB 3MR9A 2JJSC 2R29H 5BZWB 1MNUH 3UTSE 4HLZG 1SY6L 1U6AL 5FYJU 1J0YA 1CFVH 2EDYA 3P4NB 3QFDB 3RBSA 1BVLB 4X8JA 2J12B 4MWFA 4FQHB 2ZUQB 3S37L 4MDJA 4ERSL 3QDJA 4Q2ZB 1G7MA 2WQRA 3OZ9H 4QRPB 3TFKC 3O3UN 3CNKA 3LZFL 2EXWC 5JHLL 1NFIA 4JGUA 4XVJL 3D9AL 3GRWA 4U49A 6CGTA 4YHOL 4WFEE 1XF2A 1WF5A 3IB4A 1FNLA 1FNSL 1NAMA 4S2SB 2EDNA 3SDYH 3EO9L 4X6CF 5C0FA 2P8MA 3CXDH 4IRZH 3U0TA 3GMLA 1OAQL 2OR7A 1N59B 3STLB 3OKYA 4FZ8L 4XP6L 3VFMB 1Y6NR 3DECA 4XRCB 2VZ1A 1G7HB 3L7FA 1U2CA 3TM6A 4ZFOB 4KK8D 4KROB 4JFXA 1OAXL 3RVTD 2WIMA 3O6FD 1YMMA 2XRAL 5FO8A 3WFDL 1K2DA 3LVEA 5IIEB 4IIQC 3U46A 3JBG7 1SY6A 4K7PX 5IW6A 1FFNA 2YRPA 3WD5H 1AR1D 4PJ7F 3GMPA 1FL3B 5EU6B 4J3VA 2FLBT 4GG8A 4W4OC 3KPSE 4QHMA 2JIXB 2DM2A 1KLFA 5B38B 5IVXB 4P5TA 3R8BB 5F9JA 4RMTA 1MPAH 1R5WB 1YYMH 1ONQA 3SE8L 1RMFH 2EDFA 1L7TL 1MWAL 1J8HD 5BRZA 1UQSB 1ETZB 1X5FA 5L0QC 2AV1B 4AQOA 1Q9LA 4N8CL 1Q94B 1UJ3C 3BP5B 3QUXD 5DJAA 3FFCA 3VMOA 3TWCH 5SV4A 3TIEA 4QRPE 1GGBH 1VENA 3BKCL 4BK4A 2ZJSL 1CI5A 1VA9A 1DSFL 4PJ7A 5E1AA 1D9KC 3EOBB 2EO9A 4ETYA 3T65B 4OLEA 1N7MH 2R2BB 4XTRC 1MHEB 4NOBA 4AH2B 3ULVF 3CCHB 3V8OA 4OZIF 5ICYA 4M6NH 3AREA 5GS0H 4OM0H 4WI9A 5FM4A 3CFBB 1OSPL 4R6UA 3BE1L 3JXAA 4H1LG 1U8IB 5CGYC 4LLAA 1SVZA 2DOCA 2A9NL 1JF6A 3CFKA 5JTWA 3BPNB 2AK4A 2DKMA 4PRPD 2BVOA 4KPHH 3BFOA 5I1CL 1FBIH 4D9RD 1MWAA 4LAJH 4NGHH 5FDWA 3JUZA 1YDPB 2YRLA 5C09A 3WO4B 5JIPA 2J4WH 3QAZB 4I9WE 4K3EL 5ACZB 3BKYH 4DUWA 4PG9B 4UBDC 3ES6A 1DCLA 1JGDB 4A2MA 5IVZA 1CN4A 2OTUA 2DM7A 4RAUB 3VXNA 5J57B 5LWYH 1BQLH 5D71H 1XGQB 5TPWL 3REVB 4ODVL 4BQBA 25C8H 3O4LD 3SKOB 3ZE2F 5D70L 5F44A 4TPRL 4OF5A 3MV8A 5I15L 2YUWA 4ZD3H 1HSAB 1Z0MA 4JKPH 1XCQB 4OKVA 5I1AA 4M8QA 3FO0H 3LPFA 4KKCC 1WWBX 1OTTD 4WTWA 1AQKH 1ZTXH 1WC7A 2R0KH 3CK0H 2W9DL 3F62A 4XAKD 2Z8WC 4ZUTB 3SDDC 1UG9A 3V4UH 1PY9A 2ZUTA 2WINA 1W0VA 4WW2B 2MPAL 3EYFA 3WKNA 4JDZB 2N1KA 2Q76B 1R24B 5K33A 3GBMH 1GXEA 2HN7A 5E6IB 1TETH 3CFCL 3V6BR 4RMSA 4HZLA 3V0AC 1NGZA 4LDEB 2X1QA 4X5LA 3A67H 3GJFK 1GIGL 4BQ8A 2CRZA 2BVTA 4DN3H 5CHNB 2YWZA 1QFUH 4PGCB 1C5DB 1WZ1H 3BQUB 1U42A 1QEWB 1KCVH 1XFPA 1LWRA 4XCCL 2P7TA 4R7DA 4XNUH 1KPRA 1AHWB 1YMHA 3MBXH 3OTTA 3PWVB 4YEFA 2ATPA 3B3IA 3D0VB 1FO0B 4N0UB 1PKOA 2KQMA 2ZZUT 3CFDB 4XGZA 1AGEA 5E6YA 5EUOB 4U1MA 5FYKU 4LSPH 5T1DL 3MJGX 5KN5A 1JK8B 4J3OC 3MO1A 3EO0A 3FOMB 4PR5B 2NY3B 2AEWA 1OP3K 2DTMH 1P7QD 2PR4L 2R1XB 5FUOL 4JR9H 4OT1L 2DWEB 3BEWA 4C56E 5IB1B 3WE6B 4JDVB 4MA1C 2B2XL 4LCUB 4R4FL 3UTSA 2XY1A 4GXUN 3GIZH 4LVNB 1FG9C 3GSOA 1I1AC 4DOHB 2L7JA 1FL5B 1D5BA 1I1FA 3VXQB 1VGEH 1TNNA 1CVSC 3BZFB 3OB0K 5BVJA 4OQTH 5I1HH 1UKSA 1QA9A 2JE8A 3EDKA 4HW6A 2QSCL 5ESQB 3MLSL 5LCVL 4A6YH 4R26L 1BM3L 1SYVA 3W9DB 4P57A 4AZ8A 5ICXA 3QXUA 1HXYB 3U36A 3N85H 4LKCB 4JFZL 3MXWL 1KEGL 4YGVB 5GS0C 3GBNL 5E24E 1OY3B 5TF1L 3UC0L 5DEFA 1U8PA 2XICA 1T1YA 2BHYA 3IRPX 1OLLA 3NPSB 1YYLL 1DBBH 2NY2D 4RFNC 1RZJC 3B2VH 3LKNA 3QIWD 4X99A 1G0XA 4EIZC 3T3ME 5FKAA 4Y4FD 4FFYL 1S7WB 2D0FA 4MQXD 2Q8AH 4HJGA 3D87B 4BSWA 3ZT7A 2BY0A 2AQ2A 3Q1SL 3PQYB 2DYPB 43CAB 3PF2A 4WU5B 4N0UE 3JVGC 3OGOE 4JVUA 4LSUL 1X7QB 2W1NA 3ZKMC 5EUOE 3KNBA 1HH6B 1T4KA 1U93B 4XMPH 5MI0C 3SGEI 5FV2A 3RGVB 4MNQA 1GRWA 3W0WD 2YD5A 3VG9C 3ROLB 5C07B 3M07A 1CU4H 3I2CL 1CFQA 3RL2B 2V7HA 2OP4H 2M8XA 2X4PA 1EERB 4HPOH 32C2A 3E6FB 3MMEB 2IGFL 3HNTL 4NQCA 1EEQA 4HH9B 1FNHA 3P4NA 2GJ6B 5IW3A 3PGCB 4WW1B 4CN6A 5EOTB 2HLFD 4S10A 5C2BH 3D6GA 3FMGH 4EDWH 2BJMH 1JHTB 4QRPA 2VWEC 2YOCA 3VH8A 4N1HB 1P7KA 4N9GB 4F15B 2HT4D 2UYLA 4HIXH 4Y8AA 1EA9C 3SBWC 3HUJE 3LKSB 1WISA 1UZ8A 3A6BH 5F7FA 4XNMB 3PV6B 3GKWH 5B39G 3VGEA 1Y0LA 3LDBB 1RZIA 4LFHD 3B9VA 2VXTL 2V17L 1GGIL 4WEUD 4QRUB 4XRCA 3S36L 3IRZA 3L5WB 1N6QL 3FRPA 3PNWB 4J6RH 2VLRD 3ARZA 3NZHL 3BPCB 4HJ0C 2YUXA 1SJEB 3D48R 3X3GL 2JB5H 5IIEA 3KJ4B 3IS1X 1BQUA 4LPYA 3VXRA 3IETA 4PJCE 3ARWA 5H37G 1XR9B 2Y36L 2NX5D 2HTLC 4YXHH 3IXTB 4RDQG 5DR5L 2LAAA 5B38A 4NKMA 3BKML 5C07E 5BCAA 4WUKL 2AJXH 3P30L 3OKOB 1WGOA 4GAYB 1LDSA 1LMKA 1IQWH 4N0FB 4OD1L 4Y1AD 4Y5VC 4ZS7L 4UQ2A 4GKNA 1CGSL 1F4YH 1BAFL 4P2QB 1BVZA 4AG4H 4Z5RB 4LPXA 2AV1A 1N64H 1CGWA 2AJ3B 2GJ6E 3AS0A 5EU4A 1EBAA 4FQLH 4AEFA 3TNNB 3JWOL 3C6LD 3ECBA 5GIRB 2AI0H 4NSKB 2R1YB 1YEFH 5C0RL 2A6JB 3SPVB 2GUOB 4R97C 1NANH 1ODAA 5E8EA 1QKZH 1J87A 1ZEAH 1IRAY 4D0CB 4G6JH 5EZLA 5IB5B 3TT3H 2AERT 1NBZB 1X5AA 3TBYB 1MHEA 3MYJA 3CCHA 5J6GA 1RK0B 2R0WL 3H9HB 1MI5A 4XP5H 4Q9QL 4OI7A 2IH3B 3CDFA 4ODHL 4Y19B 5F6IC 1T2JA 1TZHB 4LHUG 1QPXA 4MA7L 5C9KA 4YO0A 2YMXL 5DGQA 3E3QE 3UYRH 5FHAL 5T33H 1I1RA 3BUYA 3GNML 3MJ6A 4ODBD 5C0CD 1D6VL 1KF9B 1YN7B 5GJSH 1F6FB 5C0EA 4G8GD 3B9AA 2V9RA 5ID0B 3LKRB 1TQCC 4WNQB 2IPTH 4BKLA 5CEZH 1TJIL 4PG9A 4G43A 1NLBL 4WW2F 2BCKA 4JQVC 1JGDA 2F19L 2CDEB 4XC1L 1ES0A 1N0XL 4YBLC 1FYTB 4YBQC 3REVA 3ARBD 5D6DC 3DUSB 5FHBH 3NCMA 1RK1B 2CDFB 4O5LH 5CBAB 1U3HB 5J13B 1NEUA 3SCMD 3LQZB 4C56A 2AVGA 4YLQT 1MCBA 2PYEB 3P11L 3K2UH 3O6FB 1FO0L 1IC4L 5CSZA 3P77B 1Z5LB 5KW9L 1U91B 1T7ZA 4NRYB 5SX5H 2OJZL 2VITA 3EW3B 1GGTA 3T3MF 1FGVL 1C7TA 5TQ2H 3GO1H 4JDZA 5DA0B 1G9NH 2Q76A 5I76B 1R24A 3MRCB 4NQVB 4WI2A 2BVPA 3BW9A 4QYOB 4GQ9H 5E8PB 4EDXA 4NO3B 3NFPA 5AD0B 1HWHB 2K3TA 3C5SA 1FFQA 5EUOF 3SKMB 3ARFB 2CUIA 5JUEH 3IJHB 1LEKB 2CPCA 3O8XC 1EXUB 1R5VA 2HFEA 5SWSD 1JIBA 3QUXB 3H7BB 1ZLUK 1CGYA 1B6DA 3QHZL 2HT3C 5BV7C 3CVHB 1QEWA 3FT2B 1WEJL 4AEHL 1RHHA 5GGTH 4NKQB 4N0YH 2GSIA 4PP2A 2X89A 3ELAT 4ZOEA 4ODSH 3ARDA 1FYTE 1FO0A 1E0OB 2N4IA 1A7NH 1CG9A 1XF5B 1BEYH 3ETBF 3CFDA 5DLML 1A14H 5EUOA 2C9AA 4GMTL 2R9HC 3LS5L 3HUJF 5DJDB 4QXUL 5IF0B 4EQ2A 2HJFB 1ZVYA 2DWEA 1GJIA 3TZVC 5L2JA 1JRHL 1A6VH 4P23A 2PYEE 1BJ1J 1YEJH 3W11D 4JDVA 1I7UB 2EDEA 4DVBA 1KYOK 1RHFA 4PRPB 3DVGB 4HGWB 1P5UA 3SO3C 4NKDB 2V2XA 2VKXA 2Y5TB 3L1OL 1A6ZA 2JF1A 3HAEB 4JFED 4Y7MA 2H2PC 4DGVH 3VXSA 1CGVA 1HHGA 1HHIB 3QG7L 1OQOA 4PV8A 2X70B 4MAYD 2UUDK 4L8SA 5FCSH 5FV1L 3RJQB 3MLVL 4RMUA 1J05B 1FIGL 3G6AB 2IF7A 4PJCF 5KBNC 1XT5A 5D72L 3P40A 4WUUD 5I6XC 1EJ6A 1J8HE 3HUJA 3OBAA 4MHHG 2Q3AA 3O4LB 4L5FL 1CQKA 4YGVA 1QLRA 4TUOB 3P2TA 3GGWA 4TQEH 3HB3C 4M5YH 5KANG 3QFJD 4K71C 2NTFB 5GGVL 4OBSA 4KMQA 5HHXL 3C2SA 3L3JA 3GK8H 1G7QA 3IAPA 3QUYC 1R5IA 2XT1B 5E99L 4R2GD 1HN1A 5I8OL 5J11C 3ARSA 4PUBH 5K9KA 1QR1A 5J3HC 4G80A 1T22B 1EEYA 3K81A 1NGWA 1FLRH 1KJMB 4PJCA 5IMOB 5CLTA 2IQAB 1E4KC 2AGJL 2H1PL 3LEYH 4GKZA 5IROC 3LEXA 4FP8H 4LARL 4DZ8B 1UC6A 2WZPD 3IFLL 3RL2A 5E4EC 4NQSA 4OZFH 3QXVA 1KCLA 1N4XH 4JRYD 1MRCL 4WTXA 4PRPE 3QA3A 3WHE1 4D9RE 4AMKH 4HH9A 5E8NB 4JANA 1QRND 3PGCA 3WV0A 1NPUA 1Q0XL 2ITDB 2CR6A 5T5FL 1INDL 1FE8H 2E7HA 3T2PA 4XBEL 4TRPL 1F3JA 1XR8B 4RFOH 4RMVA 4NM4L 1DBAH 2GT9A 3C8HA 4OCXL 3ESVF 2PTTA 3SGJC 2LTQC 3WEXB 3V6FB 5KOVC 4ISVB 2ADIB 1MQKL 1OGTB 1AP2B 3CX2A 3LKSA 2XQBH 1G9NC 3O4LE 4UTBH 4LLDB 4L8CB 2NXYD 1P7QB 3QZWG 3NZ8A 4XNMA 5D1ZC 1NGPL 3WFBH 3S3SA 3IF1B 4U2ZA 1P4BL 1IC7L 2C3VB 2ITCB 4P2YA 3LKPA 3LEVL 4HAFA 3IDGB 4FQIH 3EBAA 3UDWC 4WWKB 4YDIH 3ILQD 4XAKE 5LGKA 4HS8H 1WTGT 2IADA 4LQFL 3I84A 1KV3A 1MHHB 5IVOA 1UH4A 2BFVL 4BFBD 2X7LA 1KSRA 3VW3H 3IXTA 4G7VL 4ETQB 1ZSDA 3HG1D 4F58H 1SYSA 2XY2A 4LCIH 1T89A 1HZHH 1FAIL 3VWKD 4JZOB 3OKOA 1KEML 3DXAD 4N0FA 3EYUH 4YFEA 1JHLL 3BGMB 3HNSL 3GB7A 3TLRA 2A6IA 2VDML 4JKMA 3S97C 1LE9B 3QIWB 4WTZG 5I9QC 1RUPH 1JF1B 3O6KL 4FQCL 1II4E 1SY6H 1U6AH 2A6KA 4PGBA 3TGXA 2GUOA 5C2UB 3WNMA 2D4FA 3H9SD 4YK4C 3H3KA 3RTQD 3GSQA 3VXPB 1E6JL 3TO4D 4HULB 3S37H 1NBZA 2E9BA 4ERSH 2NZ9D 5IFHL 4WHYH 4NRXA 4DCQA 4S1QL 4H88L 1CICB 4M03A 3LZFH 2QQQA 3H9HA 5JHLH 1JF5A 4XWOC 4XVJH 1EUUA 3D9AH 5ERWA 5I71C 2IH3A 1CDCA 1VFMA 4LBEA 1FNSH 1T04A 4IHOB 4HSQA 3EO9H 3RU8L 3LD8C 4U7KA 1OAQH 1KIUA 2XI9A 4FZ8H 4WWID 1YECL 4P5MB 4XP6H 5E8DL 1MFNA 3AGVA 2NLJB 3LKRA 5CUSL 2ED9A 1EHAA 1YY9D 2VIRA 3P9MA 4WNQA 5KVDL 1QFWM 5I74B 3WFDH 2LU4A 4O51B 3GHEH 5CEYB 3K8MA 1IGIL 3NFSL 1RJZA 1OTUC 4GW1A 2CXKA 2MCG1 3STZA 4WDIA 3CVHL 3OAYK 2P8PB 5BMFH 2ARJA 3SE8H 1L7TH 1MWAH 3RP1A 3QEQB 1HHKB 4PJEA 4OZHB 2VUOA 1JYNA 2N7AA 5A2LH 1FZKB 3SE4C 4D2NA 3MYZA 3BP4B 4N8CH 4F8QA 3ZL4L 2WLYA 1U91A 4OB5L 4MB4A 2IAMB 3WCYA 3RY4A 3SJVB 2NX5B 4JKWA 3VDAA 3K1DA 5E5MB 5FUCE 1DVFD 5AUMA 1N6UA 4IJ3B 3BKCH 2ZJSH 5JW5B 1DSFH 3W0WE 4QYOA 5FYLD 1P9MA 2ZUYA 1UCBL 1A2YB 5E8PA 1L6XA 3H6JA 3VRJA 1HIMH 1U8MB 4NO3A 2A9ML 1A3QA 3SKMA 4Y1AB 3ZDXE 1J8HA 3NCFB 3S98A 4M3JA 4PG2C 3BE1H 3BP6A 4DGYL 2E8ZA 3IS0X 1JRHI 5KSBA 3C6LB 2BNQD 5J12C 4ODWB 4RMRA 5C6PB 3MUHL 1KIQB 2A9NH 3IU4L 3PGFL 3CVIL 3FB6A 5DHYB 3ZTNL 1NUFA 1HILA 3CXHJ 4F7MB 4I77L 5I1CH 4KI5C 1DR9A 3Q6GH 4E9LA 5AWNL 1L9MA 2FEDD 3BMWA 3O3BB 4MX7B 1A3LL 2FATL 2UY6A 1F45A 3U6RA 2EC9T 3WXWL 4K3EH 4NKOA 4CAGA 1E4XI 1CDHA 3BJ91 3BP7A 5BO1L 4LVEA 4QRRB 5ITFB 8FABB 4P3WA 3SDCD 3CSBA 3KPLA 4YPGB 2ADJA 5TPWH 3ALPA 3TVMD 3MLUL 4ODVH 3QEQE 1OB1B 3T0EC 1JZ3A 4OZHE 1BQHA 1V5JA 4GLRH 1P2CA 3RHWF 1Z9LA 4L9DA 5D70H 1ZLVK 4GQPH 3ZMRA 2AJYH 4PRPA 3DVGA 4S1RL 4HGWA 4TPRH 4QXWA 5I15H 1A9EA 2BVEA 1X6NA 4PB0L 3RZCB 4XWGH 4MDIB 4DKAA 2Y5TA 1WIUA 2NX5E 3SJVE 2NY1C 3HAEA 4NT6B 2F53D 3QO1A 4WEMB 5C08B 4CMHB 2BOBA 2W9DH 4LSTL 3P4OA 2BOCB 3ARBB 4Y1AE 5FA4B 4P5TC 3RWHA 1RUAL 1R3IH 4ENED 1AKJD 3S9DB 4RFEA 4CVXA 5DS8A 3CFCH 4XNZC 1KTKE 3MUY1 4AM0B 3OJDA 2FCBA 4EUPH 3MA7B 5JPMB 2DQEL 2XN9A 2AKRB 1BECA 2X41A 3BSZL 1YUHA 1KNOB 1RPQA 3V2AR 4PJ8D 4ZUUB 1SBSL 5HHVL 4L9LC 4Z6AT 3ULSA 2VDKL 3MV9D 3PHOB 4G8EB 2ZCHL 5IUSA 1HEZB 3E8UH 4XT1C 1L6ZA 3ZE1E 5CCKL 2FJHA 3C60B 4XCCH 5IMOA 2IQAA 3WJJC 4QWWD 5BW7C 4LASL 4QRRE 1DFBL 4MQ7B 2ESVB 4LMQE 4U0RB 3WBDA 4Q7DA 1FZMB 3IJYB 3BRFA 3VGDA 5T1DH 4CDGC 5SWSB 5C0CE 2PR4H 3KPPA 3TPKA 4FQJH 1AC0A 5FUOH 2F8OA 4G8GE 3CSGA 4OT1H 1UM4L 3MREA 5DRZB 1S7RB 5FK9B 2PXYB 4X6EA 3QP3A 4ZPVB 2W9EL 35C8H 3M1BA 2B2XH 4R4FH 3P0VL 1ND0A 2XWBB 5LQBH 5EG6C 5C08E 4Y4KD 1KG0B 3HE6D 4BUGA 4LLQA 5EB9A 4F33A 4ZQKB 3WEXA 3ULVC 3V6FA 4AENB 1U0QA 1OGTA 1AP2A 3EYSL 1U8KB 4D3CL 3RNKB 1XIWC 4LLMB 5IB2A 2QSCH 15C8L 4DVRL 3MLSH 1T0MB 3F6LA 4WJ5B 5DO2C 4R26H 5H94A 1BM3H 1M05B 2D7OA 3NFNB 3NAAL 1N3NA 1WFNA 1WBZA 4ONGL 3OR6A 1VACB 4JFHE 4JFZH 3MXWH 2FX8L 1KEGH 2B5IB 2C3VA 3GBNH 2VZOA 4Y2OA 3LSOA 3FQXA 5TF1H 3UC0H 1NL0L 1CFTA 1S5HA 3VWJD 1YYLH 3OKKA 4ZUVA 3QEHA 4DK3A 3OX8B 5TDNA 4KJPC 1T0PB 4FFYH 3ULUC 3VA6A 4ETQA 3EHBC 1PEZA 3Q1SH 1FFOB 1R3KB 3FQRB 4HV8A 4KUCD 1A6WL 2XXMB 4LSUH 4QCIB 4ALAL 1ZHLB 3CH8A 2X4TB 3CUPA 2I9LB 5SWSE 2VLMD 2LABA 1FCCA 3EOAB 1HE7A 3HNVH 5ISZB 1NKRA 3ZDXF 4L1HA 3DIFA 3I2CH 3D69B 2YXMA 4LHUD 3MRIB 1AI1L 5HVHC 1J9CT 2OYPA 4F9PC 3PWLA 4Y4FA 2IGFH 1T66D 5F1NB 3HNTH 4OCNC 3TFKD 2XG4A 1JPSL 3HPLA 1BP3B 1EJOL 1ZLUH 1MRDL 1AGBA 3VXPA 1BZ7A 1LNUA 3TA3C 2BHZA 3RHWK 4HAGA 3QUMB 3H9ZA 4FQ1L 4QRSB 3W0WA 2JLLA 1SJHB 5E70A 2B1HH 3LKQB 3MJ8B 4KU1A 2G9HB 3B8SA 5JO5A 4GRWE 1V05A 2YXFA 3MNZA 2YD7A 2RHEA 4OV5A 1FNGB 1ACYL 4BFIA 4ZXBC 2ERJC 1QRNB 5DJ0B 2VXTH 4JFEE 1GGIH 4OZHF 1A1OB 3S36H 1HK6A 5KVFL 4BSVB 1HNFA 5CD5C 1N6QH 1CD1B 2CSPA 2OQJA 5TE6H 3NZHH 4AIZB 1L9NA 2XOTA 4J3UA 5DEGB 5I1JL 2FL5B 2Y36H 5I1LB 4X4ME 4LEOA 3RIAF 3RPIB 4D94A 4LCCA 5DHVB 3IT8D 2YPVL 4Y16C 4PBXA 2HG5A 3AB0B 2UUDH 3QFJE 5DR5H 5E94B 3BKMH 4V1DD 4WUKH 2VQTA 3P30H 2DLHA 4LKXA 5C9JB 2RJMA 1PQZB 4OD1H 4ZS7H 3T1FB 1BAFH 2VLRA 3P4LA 2JELL 3BP4A 1X9QA 1D9KD 3JWOH 2JJVA 4LP4A 4D0BA 1JWMA 5C0RH 2NX5A 3TIDA 3LIZH 4XTRD 3MGTB 2R2HB 4PRBB 2JK5B 3HG1B 2DI8A 2FD6L 3ZE1F 1A2YA 3VWKB 3MRGA 1U8MA 4HKBB 5HHPB 4EVNA 4Y1AA 2WP3O 5CGYD 4JRYE 5D7JC 2AJVL 1KTDB 2R0WH 4HT1L 5L8JB 1RURL 3FO2A 3KYMB 4LPTA 4XCNA 2OTPA 3OMZA 4H1LB 4Q9QH 1QRNE 4FFWC 1I8LC 2NY4D 3DX9B 3C6LA 1HHJA 4LRNL 4MA7H 3DLQR 3S5LB 2YMXH 3VD7A 5HGDB 2J8HA 4LNRB 5FHAH 1VKXB 3GNMH 1IM9B 2ZUQC 3H9SB 5C1MB 3DSFL 2AXFB 3SKNB 5DHYA 2R2EA 1D6VH 5CJOL 4HEPG 4F7MA 4X8XA 4HMEA 4PRID 3RTQB 3R0MA 4UBDD 2NY6B 3T4AA 1TJGL 3S3JA 4OCYL 5L7XL 5DJYA 1NLDH 5F1IA 3TYFB 4E41D 1AH1A 5HXMA 1M6OB 3VI3E 1TJIH 1NLBH 1T1XB 3RZWA 2F19H 1NBYB 3QQ3B 1MJ7L 3OJVC 3T2NH 4XC1H 2X42A 1N0XH 5J1AA 3TPUA 8FABA 1I3UA 2W59A 1MFEL 2VDOL 3WFCL 5IJKC 3ZKXB 1OB1A 2MQ0A 2YA0A 5J56B 4HKXB 1FFRA 1P7HL 4KKCD 5I1KH 3E1F1 5HHNB 1KN2L 5C0CA 3C8KB 4FQ2L 4WHDA 4LRIA 4KHTL 5T1KD 2EIZB 4KROC 3MV11 2FHFA 4G8GA 3SDDD 1GPOL 1T0NB 1CGXA 3EDJA 5JHDB 3Q48A 3P11H 3WS3A 4YIQB 1EX0A 4GG6E 2GTZB 1FO0H 1IC4H 3HG1E 5E4IA 2H3NB 5KSAC 5KW9H 4Y89A 1S7UB 5GGUB 2OJZH 1ED3A 1G7LB 4YR6A 3FQUA 2ZOKB 3TO2B 1BBJA 1FGVH 2BOCA 2X9XA 3GZKA 3L3HA 3I3BA 4TOYL 4YHLL 2BRRL 2Y9RT 2NQCA 4FQXD 2W07A 4AM0A 4OD3L 1HWGB 1T1ZB 3CX5K 4Z18A 4HQQL 1GYAA 2CRIA 3MA7A 4WFFD 5JPMA 2AKRA 3T0XA 3QHFL 3G5ZA 3SCMA 2UZIL 5ID1A 4Z8FL 2OXHA 4PJDA 1MREL 1KNOA 4N1EA 4CRPA 1SMAA 2HVKA 2Q3ZA 3IGAB 4YUEH 3H9SE 4W68A 5FM5M 4P2OA 2X1XR 4C55A 2HMIC 1BMGA 5MEOA 3QHZH 1PW3A 1FZJB 4WI7A 4GBXB 3QWOB 4OZGA 1WEJH 4AEHH 1YEDB 4NN7B 4QXGL 1EUTA 3KPOB 2WLZA 4OV6F 2VOTA 2VR4A 4N0RA 2Y7QB 3CDYA 2YD9A 4NWUL 1GGYA 5DRNA 2XZAL 3IDIB 3BN3B 3U83A 5DLMH 2XV6B 2E5EA 5I2IB 4PV9B 5SWSA 5FM8A 1UXSB 3LN4B 4GRWF 2DQGL 1I1AD 3MQIA 5ICZB 2FGWL 3KLDA 4JLRA 1QPPA 4J4PA 1JRHH 2W91A 5JHDE 1NDGA 3RIAK 4UTAL 3WO4C 5C3LD 5JZ7C 3QAZC 1ZHBB 1VADA 4LLWB 3L1OH 1H0DB 3O9WB 3QHTC 4ZQKA 3RKDC 1LD9A 1QBBA 3QG7H 5HSFA 3WUWA 4LP5A 2G5BB 5DYOA 4WJ5A 3MOBL 5FYJD 3WIIL 1CTNA 3SDCB 4ZPTB 3RDTC 5D72H 3TVMB 4DQOL 2HP4A 2HT2D 3I50L 2YPLD 5DMKB 3NFNA 1MIEL 1VACA 3RI5F 2C3HA 4OZ4B 5F93C 1F6AA 3DNKA 4H8WH 3QUML 5GGVH 1GGUA 3ARGD 4N8VG 2X2YA 4JFEA 5DRWB 5HHXH 3C9NB 2EDXA 4ELMB 1WWWX 1MVFA 3DV6B 1ITCA 4WW2C 5FYLE 3IDXL 3ZKMD 3N1MC 4MAYA 5E99H 2HA1A 5I8OH 4UILL 5E6IC 4HFWA 3GI9L 2UV3A 1FFOA 4WUUA 4NOFA 1Q9KB 4Z0BL 1FPTL 4YDVB 4YJZL 2FR4A 4X4MA 5C0BD 2AGJH 5HYJD 5BXFB 5ENWB 2H1PH 4LARH 2BNQE 3EOAA 3QFJA 5CD3B 4IMLA 1A9BA 5J7CC 2VB5A 3IFLH 3D69A 3F7QA 3MRIA 4PJ8B 5EU5A 1MRCH 4RGNB 1QNZL 1F42A 1AXSA 3BQUC 3HI1A 3N50A 1OT2A 2FWOB 4X6BA 1DDHA 4X7DC 1T5WB 5TDPB 4PYGA 1U8QB 1AHWC 1Q0XH 4G6FB 5CAYB 1H9VA 1V7ML 5T5FH 1FVDA 1INDH 3MRDA 3F8UB 4OLZL 4XBEH 5EC1B 4JPIB 4TRPH 3QUMA 3P3YA 4PTTA 4NM4H 5M94B 1VGKB 4POZC 4TNWF 1MAML 4HUUB 4UV4L 2XZQL 1SJHA 1IAOB 1MQKH 2NY3C 3FAXA 3VI3F 1D5XB 1MH5A 5FCUL 4JRYA 2Z31A 3BIBX 1NGPH 1QRNA 1CYGA 5DJ0A 3UPRB 1ZLWK 3QBTB 1P4BH 1IC7H 3PWJB 4ELME 1M7XA 4BSVA 2ADGB 3LEVH 4Y4KB 1OHQA 3SGKA 1KENL 4OIIL 5FM5O 1M7IB 2HTLD 1ZLVH 1JTOA 4NHCL 1ZGLM 4MVBD 4LQFH 1IFHL 3FB8A 2QADC 5BS0D 4NO0D 1A8JH 5DEGA 2BFVH 4F57H 4GG6F 4J3XA 3DX8B 4ZO9A 2FL5A 5FGRA 3AAZB 4G7VH 4PJXB 5IM7B 3BIKB 4U3XA 1CXEA 4EBQL 3TC9A 4U31A 4UV7L 1FAIH 5EU3A 1KEMH 3NPSC 2YUVA 4RGNE 3RFZC 1JHLH 2BHUA 3JTSA 4P2RA 4XPHL 2VDMH 3QJFA 4ONFL 5IHZB 2N56A 3O6KH 2BC4A 2VZSA 1U8NB 4FQCH 1CTOA 5EBWA 3MGTA 1B0RA 4J8RB 4GG6A 3HG1A 2ZG1A 1IAKB 1X44A 1NGXA 4OAWA 3DI2B 1JE6A 1E6JH 3BH9B 3VWKA 3L5IA 3RGVC 5HHPA 5IFHH 3LS4L 4X0KA 2DLIA 3WS6C 3F7VB 3DXAA 5SWZD 3LRSB 4S1QH 4H88H 5I30L 3S88L 3BD3A 2BP3A 4MS8C 1H3PL 1KTDA 4JZJB 4CADB 2GITB 2MOVA 2C7UB 4PFEA 4YNYA 5LVEA 4QHLA 4H1LA 4DN4L 4QRQB 4PGDB 2X4OA 4FXGB 1AIFA 4LHUB 3DX9A 1KBGL 3T8XB 4X6FB 5EFIA 5HGDA 1KJ2L 3RU8H 3UCRA 2P42B 4NC1E 1A7BA 3H9SA 5DVLA 1YZZA 1HYRC 2Z8RA 3UTZB 1YECH 4H8WC 1P4IL 3RTQA 1FL6B 4FOMA 5E8DH 4HUVA 1R3HA 3G04A 1WBYB 4JFDD 3TO4A 1CL7I 3RI5K 5CUSH 3DGCR 5A2JH 5FO7A 5HPMB 3OKMB 2A2QT 4YBQD 4F15C 3TYFA 5KVDH 2R23A 5EH1A 4HUWB 3KYNA 1TPXB 4PRAB 3QQ3A 4YHIA 5FB8B 5IFAL 4KQ3L 4S1DC 4QT5B 1IGIH 3LDBC 5GRZA 2NPLX 3KYOB 4OCSL 5T1LD 3VMNA 4I5BB 3CVHH 3E3QC 3D0LB 5FYLL 1XF4A 4ZNEE 1TVBA 4OD2A 3ZKND 3KJ4C 1B2WL 5I1DB 5IMLA 4Y5XA 5FYKD 3BRDA 5J9PB 3ZL4H 4S1SL 4OB5H 4CNIB 1KJ2A 2IQ9L 4IOIA 2VH5L 3DBXA 4JN2B 4P46C 4URTB 3JWDL 4WEBL 3RWCB 1G7JA 1NC4D 1L0QA 2VLME 2ZPKL 3NVQA 4G5ZL 4UOW1 1YEHL 4V1DB 1A6UL 4PJFB 3PJSB 2A9MH 3CU1A 3U1SL 3RX5A 1I75A 1NBQA 2P44B 3LB6D 4FMFA 3VFPB 2ZG2A 4TNWK 1M7DA 3HAEH 4O2FA 3H42L 4DGYH 4Z7QE 4P4KB 3IU4H 1I85A 5HDBE 1TVHB 3CVIH 1DVFA 5DMJB 4NO2B 1YPZA 3ZTNH 3WUZA 1EHLL 5F7EL 1WVZA 2UY7A 4I77H 1B6UA 3QT2A 3RAJL 3HC0B 4AEEA 2FJGA 1FGNL 4YBHA 3KGRA 1A3LH 1JWSB 5D7SL 2WUCL 5F88A 3WXWH 4EXPX 3IDIA 5D4QA 3WJLC 1JCKA 3PDOB 5BO1H 1JP5A 4HJJL 2X4QB 3IU3B 4O2CB 3BJLA 5IHUL 2NY4B 3WL9B 1CXHA 2BNQA 2VSDA 1LO4H 5DQ9A 4DZBB 2HKHL 3BYTA 4P9HL 2OXGA 3WIHH 5DSCA 1NCAL 2P8LB 5L88H 4LU5L 2H2PD 1R3LB 3O3AA 4S1RH 1UXWB 1WWAX 2E9JA 4Y5YB 2E6QA 3RWJA 3R4DA 4PB0H 4ELMF 1T21A 4NNPH 3VXMD 4E41B 1I1YB 1XGRB 3CZFB 4U6XA 3NCBB 3C5ZB 5DC4B 3TH2T 4IRJB 1S3KL 4JFFB 4NCC1 1MOEA 4PJHB 2VL5B 1DP0A 4V1DE 4X83A 4PJFE 4LSTH 4Y4HC 3HB3D 1T7VA 5CP7A 3TVMA 1RUAH 5IR1B 3VFSB 1L0YA 1U3HC 1UKQA 4OTXL 2Y25A 1KXVC 4KK8C 5T1KB 1CGTA 3BZEA 2DQEH 4G6ML 3Q6FB 1RJYA 5DVNA 2BSRB 3O6FC 5KZCD 3BSZH 3EYOB 1UB5B 5J3HD 5HDQL 1AGFA 2F53A 4M7LT 3D18B 4ELMA 1SBSH 1OGAA 2AP2A 5HHVH 2VDKH 3HFML 5F21B 3BWAA 8CGTA 3MOAL 2ZCHH 1DN2A 3NCJL 1AKJA 3M17B 3ZT6A 5HGAB 3LMJL 2ORBL 4FXLA 5CCKH 2ZCKL 1IGCH 4FQXB 3U0WL 4F37F 5JW4N 1BFOA 3ARFC 4EKXA 4R0LA 1YC7A 4LASH 5BXFA 5ENWA 1DFBH 2HJLB 3FT4B 5I1GL 4WV1C 5CEXA 3FTGB 5E00B 2ADFL 2CDGA 3AY4A 3QUXC 2COQA 3W2DL 4PJ8A 2YD6A 2ZUUA 1ZK9A 3MV9A 2DQUL 1UENA 3U0PB 2FWOA 1QSFD 3QI9C 3QWRD 3S36X 3RNQB 4E41E 5DFVC 2W9EH 4RBPK 2AQ3A 3DROB 3BH8A 3P0VH 1HH9B 1NFDB 4CL7A 3BN9D 1FG2A 4PJHE 5D7LB 1U92B 1I3RB 4FRWA 1DQJA 5IQ7L 5FGBA 1S8DB 3HKFA 5D1ZD 1FAKT 2Q86A 2DQTL 4D3CH 4RDQF 3LQAL 3GJEB 2ZUVA 1J0ZA 4QHUB 15C8H 4WO4D 4DVRH 1SHMA 4L4TD 2UWEB 3CFIC 3RPKA 5B39A 1YEGL 2VAAB 3HR5B 4M7ZB 5F7YC 4PJ9C 2AJSL 4ONGH 3HRZB 3NAAH 2K7QA 2QHLA 5TE4L 1GGCL 3U4BL 2FX8H 3QNZB 2WMPA 4X9IA 2ZP0T 4Y4KA 5E7FA 3HE6A 2YHGA 4Z77A 1XGUB 2I5YL 2XZZA 3MGOB 1NL0H 3J8F7 3G6DL 3B4NA 5EBLB 3L3IB 5JQ6L 4Q58C 2RFXA 2DMKA 1UWEL 3UTQA 4U1LB 1RIVL 2EDDA 3CPLA 1JI1A 2BY3A 4WFFE 3U30B 4J3SA 1XCTB 2IMMA 3MSPA 4LCWD 1JMZA 1A6WH 4ODUB 4PGZA 1WZLA 1CDUA 5LGJA 1MUJB 2AK1L 4ZDHA 4ALAH 4NQTA 5JLZA 1FVCA 3GMOB 3VWJA 4JAMA 4QOKD 3ARGB 1PG7L 2R2CA 5IHZA 4BH8A 1AI1H 3L95B 5JORB 4Z7QF 3AM8A 1NFDE 4FTVD 1CFSB 5MI0B 4CU7A 1JPSH 5D7LE 5HDBF 5L2KB 3T04D 1EJOH 4XWOD 1TTGA 1MRDH 4ODTL 3BH9A 5IEHA 5EPMB 1J88A 3C87A 3L9RB 2JJSA 2DI9A 4FQ1H 2UWEE 1BZ9A 5I8CA 3JUYA 4QHNB 4JCLA 4O00A 4QRQA 1WK0A 5LAXB 3UTTD 3T8XA 5IOPA 1ACYH 3SQOL 3UTZA 4RISL 4P3CL 1HSBB 2FZ3B 5ACMA 5ANMB 4TUJB 5KVFH 1JTTA 5HPMA 3OKMA 3SE9H 2W0FB 2DBLL 5FYJE 5EOQL 2MSPA 1A1NA 4HUWA 3ROOB 5DJ6B 5GSVB 4YAQB 4KZDL 5I1JH 3MLTA 5A16A 5A2KH 3I02A 2Q6WA 4QT5A 2HAZA 4ORGB 4PJFF 1H3GA 2YPVH 5E03A 1BPVA 3O3EB 3QULB 3NCEB 1I7ZB 4IIQA 3D0LA 1YEIL 4WWKC 4APQB 4F37K 4M61A 3I6KB 4W4OA 5I1DA 4LVOB 1FHGA 4M8VA 2JELH 3FKUS 5JIHA 1UEMA 4NO0B 1K9TA 3C2AH 2P45B 3LPWA 3IFOA 4CNIA 4L29B 4HPYL 3KPNB 4K3JH 3BDYL 1U95B 3DURA 5C0BE 5HYJE 2P5EA 4TVPD 2FD6H 5EN2B 3VMPA 2LVCA 1BWWA 1NQBA 3B6SB 4CUCA 4OIAA 1QSED 4PJFA 2DTSA 1RSFA 1UJ3A 1X6LA 2SEBA 4MB5A 2I60L 4KFZC 4MZ2A 4PJGA 2ENSA 4RMWA 2D7MA 2AJVH 4HT1H 3QIWC 2CIIB 4HWBL 1F4XL 3MUGA 3OKNB 4EI6B 1FP5A 2E7LC 5A43C 1D9KA 3T4YB 1XAUA 2AEPL 4MQXC 4PJ5B 4XVUD 1N5YL 4LRNH 4KI5D 5ANME 1MRFL 4W81A 5F8QC 3GSVB 1QG3A 4JG1L 4UDUB 4RZCB 4X7EC 3DSFH 4MCYA 1U8LA 3DETC 5CJOH 2F74B 3QG6B 2IPUG 1KTLB 2D0HA 5E6ZA 3J7HA 1CICC 5FOBB 1TJGH 1F00I 1JNHB 4TUKH 4OCYH 5L7XH 2Z8SA 3JV6B 1KYOJ 4PJHF 4L3ED 1TZIB 2CQVA 2CKBB 3T0ED 3FZUD 3MRHA 1INEL 5CIPB 4YDJA 2X4QA 1MJ7H 3IU3A 1K85A 2I07A 3WL9A 2EC8A 5GRWA 3WFCH 1MFEH 2VDOH 4Z7OE 3IDUA 3MRMA 1UEYA 4QY8B 1I3VA 3MGAA 3QRFM 1WAAE 2P8LA 2YKLH 1TENA 5IJVB 1R3LA 4M6ML 1KN2H 4XB8A 4FQ2H 4PRIA 4KHTH 3V6ZA 3ZHKA 5B3NA 1DL7H 5I74C 4YPJA 1GPOH 4HWBA 5I17A 2HT4C 4E41A 1I1YA 1XGRA 3UJIL 2BNUA 5F9AC 5IW1A 2D9CA 2Y06L 1DQDH 1OAZL 5EUKA 1LK3H 3DOSA 2GTWB 2F8XC 2E27L 1E4WL 4NZRL 4TOYH 5TGBB 2A6DA 2OSLA 5GS3A 3UEZA 1UWXK 4YHLH 3ZTJG 4G8IB 2YC1A 5T1LB 4ZUSB 4LCYA 5ESVB 4HK0A 4OD3H 3DVNB 5T1KA 2H8PB 2DI7A 4ELKB 2OTWA 4PJ5E 3QHFH 3EYQC 2XA8L 1EEZB 2VLLA 3SDDA 2UZIH 5H2BB 4Z8FH 2CK2A 1E27B 1G9MH 1MREH 1UB5A 3VFRB 1BX2B 5DUBA 1RIUL 5GS1B 1OQXA 2IAMC 1MCRA 4HUXA 1H15A 4IJ3C 1FH5L 2Z35B 1HHHA 3ABZA 3FAWA 1AGDB 4C57C 5DZLA 4XH2B 1NFDF 4TN9A 2IANB 5HGAA 1DEDA 1PZUB 4M48H 4GRWH 2BRQA 4DKFL 4GKSB 4QXGH 1DZBA 2HH0L 1A7RL 2HJLA 4AY0A 2VABB 2QKIB 3ET9F 4WI4A 2CMRL 5E00A 2XZAH 2UWEF 1MCPL 2D9QB 3C6LC 5C0DB 4DKEL 3GMMB 1Z9MA 3RX8A 2DQGH 2FGWH 1S9YB 2Y07L 1Z9OA 1BREA 1DEEA 2F5AL 4JHZA 4BQ6A 4OGZA 3VFOB 3ULVD 2PYFA 5F7DB 3DROA 4UTAH 1TTUA 3L5JA 1HH9A 1NFDA 1QOKA 1XH3B 3F12A 1RZJL 2R0LL 3QXAA 1U92A 2ICWB 1KCUH 2ID5A 2DDQL 1HKLL 2E6PA 3MV7A 1RZGB 2W0KA 2ZSVB 3GSUB 3GJEA 1AGCA 2PW2A 3QZWA 3OF6D 2UWEA 1S7SB 4HLZH 3MOBH 1MCOL 3WIIH 3FO9A 1I1AA 3SO3B 2DD8L 3HR5A 4K8RC 4DQOH 5HHOD 3I50H 4NHUB 5E1HB 2DB8A 1MIEH 2NNAB 3S35L 1IL1B 3QNZA 3RZCC 1AO7B 5FYKE 5DMGC 2PW1A 4KHXL 4KJPD 2BSSB 4IRSB 3MGOA 4G6KL 3ULUD 4D0DA 3QUMH 2WIIA 3EHBD 3VXMB 1VHPA 1TXKA 4CMHC 4OCWH 5E9DD 1J5OL 4BH7B 4JQXC 5DDHB 3HCVB 3IDXH 3ARBC 1QR4A 2DIBA 2GI7A 5C0GB 2AEQL 4QGYA 3RUGE 4UILH 3KPMA 3GI9H 2YPLA 1FPTH 5C3TA 1VFUA 2FECI 3VI4E 3LRHA 3FONA 3TESA 5E2VL 2VDPL 1TQBB 2X40A 3ARGA 3MRQA 4JREB 3MFFB 1X5KA 2YEZB 4WENB 3JVGA 3TA3D 3DVFA 1QNZH 5D8JL 4XNXL 5F70A 3A67L 1AY1L 4JO1L 1NGYA 3C60C 1FYHB 2J8OA 1V7MH 3HS0B 4LIQL 3L3DB 5EPMA 4OLZH 1EMTH 3EFFB 1FNFA 2ARWA 5C0BA 2FH6A 4U0RC 5HYJA 4M5ZL 4Z78B 5FA3B 2J1KA 2RCSL 2P43B 1AD9A 1MAMH 4BSJA 4UV4H 4QNPE 2XZQH 5ESAB 1DANU 4QHNA 3QDGD 4XNUL 5HHQB 4K7FB 2PUQT 2V9TA 5FCUH 3MBXL 4GUPB 5EO9B 5EOCJ 5CD5D 4NZUH 2PXYC 1BD2D 4Z7OF 4PLKD 3KWWB 3VXME 5F3HA 1HSBA 1WAAF 1G9MC 4K9EC 3SBWA 4U1IB 1KENH 4OIIH 4F7TB 4NHCH 2IJ0C 1C08A 4H20L 3T09A 4Y16D 2P47B 1IFHH 3RGHA 1J0IA 5HYEA 1GC1C 2Z4QA 3U9PL 2VLJA 4OM1L 4H1LH 1Y6KR 4AT6A 3CFJA 4WO4B 4L4TB 2H41A 2HVJA 2H6PA 1IMHC 2NY0D 1ZA6B 5I1HL 2B5IC 4XBPB 4UV7H 1CE6A 3O3EA 4UDTA 4ZUWA 1NCNA 4OBRA 1JYWA 2C3GA 3BPOB 4A6YL 5HGHB 3U4AA 1ZVSA 1J10A 2MKWA 1WAAA 3I6KA 4XPHH 3KPQB 2KUTA 4JHBA 3D25A 4X4ZA 1JWUB 4ONFH 3MRBB 4JGJA 5BS0A 3GUTA 4KDVA 1G0DA 3V7MA 4MHHI 3U7AA 1IE5A 1U95A 5K9OA 3T0AA 4Y5VA 5D7JD 1DBBL 2Z92B 4DKDC 2RAMA 1T20B 4FFWD 4MNHB 4RQQA 3LS4H 3T0WA 4ONHB 1QFHA 4LHQB 5I30H 3S88H 1LEGB 1H3PH 3KS0J 2IH1A 1XGPA 2CIIA 3EDFA 5J06A 4QOKB 4EI6A 4DN4H 3G5VA 5HGBA 3NCYS 3T4YA 4PD4K 4R96B 1KBGH 1S7XA 4PRHD 5DVKA 2OBGA 2EEDA 3F7YB 2J8UB 5GRXG 4MGXA 5SX4I 4UDUA 4RZCA 3W9EB 4NYLB 2F74A 4MAUL 1P4IH 4JJ5B 4A6YA 3PDDA 3CDGB 5FOBA 2XNAB 4KDTC 3GSNB 5SWZA 4RBPH 2CLZA 2VDNL 3U9UA 2O5ZH 4HWUA 4L4TE 4OLXL 2C26A 1TZIA 3G9VA 1K4CA 4WHTA 1A1MA 3FMGL 4OF3A 3BVNA 2NCMA 2BVQA 5CIPA 4OUUB 1LEIA 5FYKL 3UTTB 4KROD 5IFAH 3UYPA 1LO5A 4Z7UA 5E2WL 4CJ0A 4OCSH 1MFDL 1CLCA 3BOVA 3D2UD 1CD0A 5KSAD 5EU6D 4JQVA 1ZLSL 4UQ3B 4JFDA 5FYLH 4X4XB 1K5NB 2GSGB 4MD4A 2JIXD 5TQ0L 5EZJB 1B2WH 5D6DA 5C70A 2AABL 2JCCA 1B9ZA 5BV7L 4S1SH 4WI6A 4Z95L 2GTWA 2IQ9H 3X12B 2VH5H 3AB0C 1TCMA 1MCFA 3JWDH 4WEBH 3ZHLA 2ZPKH 5KG9B 1LDPL 4G5ZH 3RUGF 5T1LA 2I26N 4K7PY 1YEHH 3BYYA 1A6UH 2DJ4A 3DVNA 4QOKE 5BVPL 2H8PA 3HZMB 4ELKA 3ILQC 5CJ8A 3VI4F 3U1SH 1EEZA 1DLFL 1YNTB 5H2BA 2EDRA 1E27A 4L3CA 1QLFB 5EO1B 2J8UE 2RQ8A 5A3IC 4FTVE 3VE0B 1J18A 3H42H 5IMMB 5GGQL 3N06B 1NC4A 2DJSA 3BXNB 3UYOD 3RY6A 4M1CC 5GISL 4YQXL 1EHLH 2ICEB 1J0JA 3WLBB 5IWLA 1UADC 3RAJH 1A7QL 1FGNH 3KHOA 3RUGA 3RWFA 1MJJB 4RA0C 3RWGB 2QKIA 3UTTE 4Z76B 5D93B 2ZSWB 5JDSA 2GJZB 5D7SH 1IGTB 2WUCH 4JZNB 1QKZL 1LO0L 2IMNA 4QNPF 1ZGLP 1MCHA 5F1OB 1HQRA 1S9VB 5KTEL 4HJJH 4B7LA 1IQDB 5IHUH 4JFYB 4YXLL 4M9PA 5JZ7D 3VFVA 4Y8DC 2O61B 4MXVE 2FRGP 1KT2A 3UJJL 4P9HH 2IBZY 4I48B 3RKDD 2NY6C 1NCAH 3VFOA 1WBXA 4LU5H 1RZFL 2Z93B 1XH3A 3RWDA 4I0PD 4YWGH 2P24B 2D03L 1TVDA 3DRTB 2FO1A 5LGHL 2GY7B 4RAVA 3FB7A 3RDTD 3TZVA 1XGTB 1S3KH 1WFUA 4ZYKB 1CDBA 1IM3A 3ZKXC 5L8KB 3FT3A 1S7SA 2GCYA 1G7IA 5TH2A 4X6DB 3IFPB 5AZ2L 1A6AB 3VRIB 4FNLH 4OTXH 1IL1A 1KJVA 4UNVA 2QR0B 4G6MH 4WHYG 2ZKHL 3ZYJA 4N8VB 5MEQB 3VXMA 4UNUA 1BJ1H 1CXKA 5HDQH 3GIVB 5HHMD 4TVPE 4BH7A 1BLNA 3LV3B 4HWZB 5D5MB 1LE5B 4XNZB 3MRRA 3HFMH 1QSEE 5C0GA 4XVTL 3MX0A 3NCJH 1DQLH 1JGVL 2ORBH 3LMJH 1N6VA 2ZCKH 3U0WH 5HDOA 4JM2B 3WDJA 1BFSA 2APVA 2VN4A 5BJTA 5I1GH 3X14B 3QUYA 1C1EL 1G9NL 4KI5E 3PWUB 4FHBD 4KTDL 2ADFH 4NZTL 4LNVA 3W2DH 2YEZA 5GGSA 1IVLA 3OB8A 4OGAD 5C8JB 4GBXC 3DWTA 1E4KA 2DQUH 2CGRL 4DGIL 1RVFH 2R8SL 5IROA 4P3DA 4NN7C 4GW5A 3V0VB 1YA5A 2B8OT 3HS0A 4NO5B 1PDKA 3L3DA 1WT5C 2DQCL 1F6LL 3EFFA 3T0EE 4IMKC 5EA0L 4B41A 4LVHB 5D96B 4XAWL 5IQ7H 1CFNA 4X6DE 3AXLB 1I4FB 4PREA 5IV2B 2CUHA 2DQTH 4N0CC 4K7FA 4I4WB 2VXUH 4GUPA 3L6FA 3GSRA 3X17A 1MEXL 1YEGH 3T2QA 1QSFA 2ZWLT 5C0JB 3SGJA 5KS9A 4XMKL 2AJSH 4HS3A 3AVEA 5TE4H 2I27N 1GGCH 2QADD 2XWTA 3U4BH 4KAQL 3C8DA 3O9WC 2H32B 5D5ME 2AAVA 2I5YH 3BI9X 2YPKB 3G6DH 4QTIL 5D1ZA 5FO9B 3S4SA 1FJ1A 3SDCC 1U58B 1SMOA 4WO4A 3TVMC 4L4TA 4NUJB 1HQ4A 3QSKB 5AYUL 4IDLA 4F2MB 3UDWA 5HHOB 4MJ6B 4X9BA 5C0IA 4XZUB 2AK1H 3VFNA 1UWXH 5DTFA 2I25N 1BIIB 1CZ8L 2LU7A 5IBTH 3PQYD 2DYPD 3KPQA 1HI6A 3MRBA 3VFWB 2J8UF 1B4JL 1PG7H 3V95A 3P73B 4P9HC 5HI5D 3OKEB 4MD0B 3RGVD 4XCYB 1IGFL 3EGSA 4ENEC 1L0XA 2R69L 4LDLB 5C07D 4LK4A 4LLVB 2XKNA 3MRLB 3V5KB 2BNRA 4LCWA 4ODTH 1N2RB 1RV6X 4ZFZA 1N5AB 1ORSB 4OCRL 2W60B 1LEGA 1QFPA 5KAQG 2YA2A 4ZAKB 4QOKA 5IKCB 4U6YA 4RGNC 3UP1A 5DJZA 3TA3B 4U1KB 2J8UA 4BQ9A 2O26U 4FTVA 5DRXB 5JXED 1UVQB 3SQOH 3MRPB 1JV5A 4MXVF 3W9EA 4ZNCD 4HIJB 4RISH 3W81A 4P3CH 4QWWC 4JJ5A 5FUZL 2C3XA 3CDGA 5F7KC 1CIDA 1QQDB 4S0SD 1Q38A 4AMKL 2VE6B 3OKDB 4S1DD 2ZUXA 4HX1B 1Q9OB 2DBLH 5EOQH 2YSSB 5JQHC 3QDGB 5HHOE 4KZDH 4OUUA 3HZVB 3DARA 3UTTA 4NPYA 1Q8MA 3R06B 4Q6IB 4WI5A 5E2TL 4LPVA 4DTGL 1BD2B 5IK3B 2DQFB 2VERN 3WXVL 3MCLL 3ULUE 1MCCA 1KUMA 4TVPL 2ILLA 1NMCB 4NC1C 4POUB 2PO6B 2ICWI 1YEIH 1P1ZA 1ZT1B 4NNYA 4XVSL 4H0IA 4R8WL 4P46D 5GHWL 2V5YA 4OF0A 3F5WA 5TF0A 3TF7C 1I7TA 4R90L 5D9SB 2V2TA 4TTDC 1IGJB 4HPYH 4RIRB 3BZDA 3GMRA 4FS0A 1EHXA 4P2QD 4BZ1L 3VU2A 3BDYH 2NY0B 4NQXB 1QUNA 3K4ZA 3NCCB 5KG9A 4KH2A 1CVRA 4EOWL 4R4NC 4PJBB 3SE4A 5ALCL 5E5UB 1IAMA 3GHBL 4KRPB 3VD5A 3GM8A 2I60H 2VN7A 1YNTA 3U2SB 5HI3D 1QLFA 1PSKL 2BMKA 4HWBH 3PABA 5CZKA 4KI5F 1F4XH 3VE0A 3VFGL 2EKJA 1XF3B 2R4RL 4UT7H 4KZEL 1CD8A 3AM8C 2OMNA 5JNYB 2AEPH 1N5YH 1AE6L 5DK2B 3EYUL 3KDMB 2WQ8A 1MRFH 2CK0L 5C0NC 4JG1H 1QBAA 4Y19D 2NXZC 3ARUA 2PNDA 1QHPA 3EIFA 2VLKB 1QSEA 4PG2A 3QDGE 2MQ3A 4JZJC 1U8HB 1MJJA 3OKLA 1YY8B 2X4RA 3B2UD 3EOTL 1IGTA 4JZNA 3PP4L 1A6TB 4CVZA 1BD2E 3S96B 4BFEA 1S9VA 4X6DF 1INEH 1IQDA 1T66C 3TJEL 4U1GB 4PRHB 2O61A 4PBWD 3SGDI 4I48A 2QQKL 4EI5C 3IVKB 4M6MH 4DEPB 3DUUA 1KIRB 1NCCH 1KPVB 4E5XA 4PLNC 1FYTD 4JY6B 2BERA 1LK2B 1RZ7L 3B9KC 3KPTA 4L1DA 4Y4HD 3ARVA 3DRTA 5D5MF 5J1SC 3DYMA 1TPXC 3NPZB 1K8DB 1S7TB 4L3EA 3UJIH 4I3RL 4RX4D 4IM8A 5CP3A 3HTLX 1U3HD 3T0EA 2Y06H 1OAZH 4ZYKA 1ORQB 4PJBE 3FCTB 1DUZA 1X5LA 1E4WH 2E27H 1JGEA 2AJZB 2PYED 2R0ZL 4NZRH 4X6DA 1D6EA 1JNJA 1E28A 5T1MA 1A6AA 3GJFA 3D2UB 2WK2A 4O2EA 3GHEL 3NABL 5KSAB 5FECB 5HVWA 5D6CA 4QF1B 3WFZA 3GKZA 2XA8H 3UZEA 4HBQA 3BX7C 2R39A 4FMKA 1RIUH 5BMFL 3ARTA 3K7UA 4NN6B 2MKLC 4X6CA 3DO7B 3LV3A 5CZXD 1LE5A 1TZGL 3ARFD 1FH5H 1S7VA 1W72L 3DHJA 3T2OA 3F6IA 4HMDA 1NEZB 3VRLE 1H5BC 4MCZB 3GDBA 4DKFH 3ULVL 3VG0L 1FZOA 2HH0H 4L9LA 1A7RH 1JGLL 4PRHE 5IP4A 3QDHA 2CMRH 3JSSA 3R1GL 3TCLA 3TCXA 3QI9D 3A6CL 4P4RA 4XCEA 1MCPH 3CSYB 5DFVD 1HIML 4JY4B 4DKEH 3NTCL 4G8FB 4P4KC 5INCA 1MHCA 2B39A 3WJJA 5BW7A 3V79C 1BGXL 4OLVL 3T77A 4JKLA 2DMBA 2Y07H 4UUJA 4U33A 3V5DB 3CMOL 2JJUA 2IBZX 2F5AH 4BUHA 5KVGL 2IPKA 4OCLC 4XBGB 4LSSL 4OJFL 3QDAA 3RL1B 4PTUA 1RZJH 4HMCA 2R0LH 3S5LG 2DDQH 1HKLH 1AJ7L 4GJTB 4P59L 1I4FA 3ULUL 2NY4C 4PJ9D 4F3FB 4UOJA 4I4WA 3WO3B 3Q6GL 1W72A 1VSCA 3OSKA 1QLEH 2E6JA 4R7NB 3WFEL 1MCOH 4WIQA 5EU6E 3D1MC 1LP9B 4Z0XA 2DD8H 1HOCB 1ZT4A 3MRJB 4YHNB 5HYFA 4HIEA 4Y5YC 2OCFD 4OZIA 3S35H 2CO6B 2GFBB 5IVXE 4M43L 3ULUF 3QDMA 2NW2A 2F54D 4WI8A 1XIWA 2H32A 1JN6B 4I0PB 1MFCH 3DJ9A 4KHXH 5I1IL 2HFFA 2HLAB 3C5ZC 1BOGA 4G6KH 2YPKA 3AMKA 1F3DH 4IRJC 4DUVA 4ZMAT 1UH2A 3RDTB 5DURB 1J5OH 2AJYL 3MCKB 3PIQB 3IAQA 3OF6A 4XWGL 2GJJA 3QCVL 2AEQH 5MEPA 3Q5TA 2X4NB 1W0WB 4F2MA 4BYHA 4KTEH 1L7IL 5HHOA 3WIFB 1F13A 1NJ9B 4GRLC 2P48B 3TBSB 4M7KL 2VQ1B 3SKJL 1T83C 4NQDD 2FX7L 1IZJA 2EYRA 2DM4A 5E2VH 2VDPH 1R3IL 3BESR 3F58L 4RWYL 3TN0B 4XCFL 5HHMB 5E9DA 2NY7L 1J12A 1HCFX 1J86A 3LQMA 1WICA 5D8JH 2DBJA 2XTJD 5IG7B 4O4YL 4XNXH 4BM7A 1AY1H 4JO1H 5BQ7A 2P5WD 2EXYC 1A5FL 2YRZA 4FQXC 1OF2B 2Y6SD 5DQDL 4LIQH 1N2RA 3MLZL 5GSRA 4MZ3A 1RD6A 2CIKA 2MQCA 3MBEB 5A40E 4F9PA 4M5ZH 2RCSH 3E8UL 1XF1A 3H8NA 2EDOA 1XEDA 1LP9E 2B7DT 2F5BL 5I75B 2H9GB 4F7EB 3IKCB 3TA3A 1HXMA 3O6ML 3HPJA 1UVQA 3MRPA 1CWVA 1BJMA 4ZS6C 1ZWIB 1BFTA 4XXDB 1YNLL 5J0BA 1QQDA 4EN3B 4FQJL 1VFAB 5TJWK 5KVEL 2FJFB 3OKDA 5IFJB 4H20H 2YSSA 35C8L 2VISA 3MRFB 4EUPA 3QDGA 2IALA 4ZXBA 2H2SD 3U9PH 4ORZC 3O45B 1C16B 5LQBL 4OM1H 4B0MM 3UZVB 4X5WB 5JIIA 5JOFB 1KB5B 4WWKD 4M7ZC 3FQNB 4PJBF 5DJXA 3R06A 5CINL 3BKJL 4JFPB 4Z7VB 2DLTA 1KELL 1FV1A 5MERA 3BPLB 3HI6L 1WQVT 4UU9A 4FZEL 4H5SA 5HHME 2QADB 1D5MB 3TH4T 1ZT1A 3MODL 1G7PA 1K4DA 3T0VA 2NZIA 4QTHB 4R3SB 4Y16A 3MROA 3QUKB 3WN5C 5D2NB 3OHXB 2GIYA 3U30C 3FFDB 5CIPH 1OP5H 2HT2C 4LGPB 4X7CC 3PWNB 4KK6C 4CW1B 2A77L 5C6TL 4JG0H 3S34L 3W39A 4PJBA 2EYTB 5B21A 1ZXQA 1AR2A 1U8OB 4R4BB 3PXHA 1UB6B 3VRLF 4GOSA 2HJKB 1CS6A 1NC2B 3ARGC 1QO3B 3LPGA 5FKPB 4LF3B 3TYGL 1RU9L 4JM4L 5GGRB 2Q7YB 3DETD 5IEKB 4QXTA 4PJIB 3WFHB 3KPSA 1CICD 3IDNA 2CLRA 4ZFOL 3HNVL 2YK1L 3BMVA 5EDXA 1IILE 5D7JA 3OQ3B 1SEBA 4MAUH 2FYYB 5BZWA 1I8LA 4UT9H 1TDQA 4DOHE 3DSNA 2VDNH 1SEQL 4OLXH 3QFDA 4OSUL 5K9QI 1BVLA 1EBPA 4FQHA 1PYWB 1F97A 3H9YA 1MF2L 2CR3A 4IEFB 4Q2ZA 5FYKH 3T08A 5FGSA 4X98B 1FC2D 1H3UA 2DIAA 5E2WH 2B1HL 4KJWC 1MVUB 1MFDH 3EJYC 5CMAB 3CFEB 4OFYD 2OJEB 3O3DB 1KIRA 1MSPA 1ZLSH 5BZDB 4JY6A 3KPRD 5IVXF 4S2SA 3L3OB 3LKOB 2X9WA 1GZPB 1OOAA 3L7EB 1N59A 5BRZD 1S7TA 5TQ0H 3X11B 4YDKH 3STLA 5IJKA 2AABH 3VFMA 2ZCLL 5BV7H 3V9FA 1G7HA 5K93A 4Z95H 5I66B 2WW8A 5F71A 4ZFOA 4HEME 3QEQD 5TE6L 1OM3L 4GKOA 3EYQD 2H45A 3NGBB 1LDPH 5D7KE 4U1SB 5DD6B 4Q97A 3DMMD 3PQYE 5FIEA 3D2UA 4APQC 3O2VL 1M1SA 5BVPH 2IAMD 4HHAB 4XC3L 5KSAA 5EU6A 1FL3A 3SJVD 5FECA 1S9WB 3SDAC 4PJIE 5A2FA 1DLFH 4LVOC 4MVBC 2JIXA 3CIQA 3E6HB 4P46B 3KLAB 5IVXA 2CH8A 3MNVB 2FGZA 3O41B 3DO7A 1VFOA 1R5WA 5GGQH 1FN4B 5FF6B 3GEWB 1UQSA 3FB5B 1ETZA 3E2HB 1Q94A 4YQXH 1XZ0B 5GISH 3BP5A 4LDOB 2V5MA 1A7QH 3LIZL 2PCPB 1LO0H 3K1KC 3EOBA 2YUZA 1EO8L 3T65A 1LP9F 5KTEH 2R2BA 4YXLH 4AH2A 2LE9A 3FHAA 3VJ6B 4H25B 4MJ5B 2APXA 3UJJH 3CFBA 3V5DA 4L8BB 3NIDE 1G0YR 4QRRD 3BISA 4XBGA 1U8IA 1RZFH 4LLUB 1MCWM 2D03H 1MLCB 4ONOA 5LGHH 1I8MB 2G2RB 5IHBA 4K8RD 4I0KA 4F3FA 1O0VA 1CK0L 1YDPA 3RZCD 1S7QB 1MELA 2V7NB 4U7MA 3U7YL 5DMGD 3QXDB 1NLDL 5GGRY 4W4NA 4YC2B 4C83B 5AZ2H 5ACZA 1HINL 1OSZB 1KC5L 5C08D 4O02H 4YDLB 3T2NL 2A83B 2WWKT 4RAUA 1XGQA 3SDXB 2MHAB 2ZKHH 4XNQB 4Y4HB 1KLUB 1Q1JL 4QEGA 4P2QE 4R9HA 3SKOA 3RDTA 1H8NA 5I1KL 4JO4L 1ZS8B 4GRMB 2AXGB 4BK5A 1Z9SA 3I3DA 1HSAA 3ALXA 3G5YB 1XCQA 5SWQB 3GMNB 1QVOB 3MNWB 4JFHD 4CDHA 4XVTH 3QQ4B 1QFWI 2DQJL 1NJ9A 1JGVH 3V6OE 3TBSA 3PG2A 4ZOAA 3D3VD 3V5HB 4M7JL 4ZUTA 4PY8I 4WW2A 3ZKNC 3C5JB 2WBKA 4P49A 1C1EH 2X4SB 4KJQC 3ESUF 1NBVL 5GS1C 4E0RB 3IKKA 3C60D 4KTDH 5E6IA 2J2ZA 2W0LA 1N8ZB 3BD5A 4NZTH 4J7RA 2OK0L 3P9LB 3O2DL 4Y0GA 1P6AB 2ESVD 4Y19E 4DGIH 2CGRH 3RY6C 2R8SH 4YUEL 5IWLC 4WV1B 3Q3GB 1OF2A 1HDMB 1R3JB 2DQCH 5CHNA 3RWEB 4PGCA 5EA0H 1C5DA 3LB6C 3BQUA 4C4KT 4KRNA 2PXYD 2EZ0C 4XAWH 3QI9B 5LXGL 1DE4B 1AHWA 5HYQB 1EFXD 3PWVA 4PB9L 4LPUA 4Z9KB 4NBYB 3KYKL 2XXCB 5HDLA 3D0VA 3SDXE 4N0UA 1MEXH 5H35B 2VXSL 4HIIB 1WCBB 4XMKH 3BT2L 5C92A 1F4HA 1ZWIA 5GRUL 1JK8A 3FOMA 4PR5A 4XXDA 4KAQH 1BQHG 1B0GB 5MENB 2R1XA 1VFAA 5DQJB 5IB1A 4XPAL 4TULL 4O58L 4K94H 4QTIH 3WE6A 3O2DA 3MRFA 1D7FA 5HGGS 4LCUA 4PJ9B 1C16A 3V4VL 4PY7B 1FL5A 4TSBL 4X5WA 3VXQA 1NUDA 3DV4B 2OM5A 5AYUH 3VFUB 3BZFA 5JXAL 3MRNB 3MJ7B 1ZGLB 5ESQA 4IRSC 5KJRL 5EOCL 4YE4L 1E4XL 2F54B 3WDHA 1VEOA 3KHQA 2VDLL 3IDMB 3W9DA 1CZ8H 4MNQD 4JPVL 3MLWL 5F72S 4QTHA 4R3SA 1HXYA 4PJIF 2HRLA 3UTPD 3W5MA 3OAZK 4LKCA 4I2XB 1B4JH 3QUKA 5DJ8B 4ZSOB 2PF6A 3OHXA 4HUKB 3I85A 1IGFH 1KLGB 4H8WL 5DZNA 5ISZD 2R69H 2KL6A 4K3HA 5D2LB 3IYLW 1ULVA 2X9YA 4S0TD 2VKWA 3HN3A 2VL4A 1S7WA 1IGYB 3UAJC 4NQDB 1TQBC 3SO5A 4OCRH 4JREC 1KGCD 2DYPA 3PQYA 4WU5A 43CAA 1A7PL 1KN4L 2EDQA 5B4MC 3FL7A 1X7QA 4J2XA 1ZHNB 1HH6A 1U93A 3UO1L 4PJIA 2D7QA 2EYSB 5I8KL 4FABH 3RGVA 2XTJB 3HC3L 5MENE 5CBEB 3WS6A 4HDIB 1V3JA 3ROLA 1OTSC 1T7WA 5C07A 1U9KA 2P5WB 2FEEI 1FFPB 2R4SL 3NIDF 3PXJA 5FUZH 3PGDB 3E6FA 4KI1A 3MMEA 2B0SL 3NACL 5HYSG 3G08B 2GJ6A 1I8KB 4WW1A 5EOTA 3SN6N 3O6LH 1CF8L 1PYWA 2NW3B 3HZKB 5EZOH 3QR2A 3TBVB 5E7BA 1WJ3A 3VXRD 3OR7B 1JHTA 4GW4B 2F54E 1XGYH 4OCMC 5E2TH 4N9GA 2B4CL 4DTGH 5JXEA 3WXVH 2XACC 3MCLH 3CDCA 2A74B 1FORL 4TVPH 3BN9C 4I2XE 5BZDA 3B83A 2EDKA 4ZSOE 3L3OA 4XVSH 3LKOA 5DC0A 3WSQL 3PV6A 4R8WH 4WU7B 2QLVB 3X11A 5IHLB 5GHWH 5D2LE 4ZO8A 1K8IB 2UVEA 4OZFB 4XB7A 4QRUA 4X4YB 4WO4C 4R90H 3QUZD 3L5WA 1WIOA 3PNWA 4BZ1H 1WITA 3BPCA 4NQDE 3H0TB 1SJEA 1JPFB 2YZ8A 2A73B 4EOWH 5A3ID 3BPOC 2C1OB 4F57L 5H8DA 5ALCH 2EH8H 1Q72L 1OW0C 4HHAA 1XR9A 2XFXB 1S9WA 3GHBH 2D0GA 3NMEA 1DQTA 2XTJE 5I16B 4P46A 5GS2D 4D9QE 1PSKH 1QYGL 2E7CA 1F11B 5F7LB 4Y2DD 1VFBB 5D1QB 1F58L 4XX1G 3VFGH 2P5WE 2R4RH 2IFFL 4M1CD 4KZEH 3HMWL 5DUML 5CP3H 2AV7B 5I0DA 1DUYB 4GAYA 1AE6H 4JY5L 1FN4A 2EDBA 3MR9B 4YHYC 4MLSA 4P2QA 2CK0H 4I1NB 4Z5RA 1UT9A 2AJ3A 3EKCA 2LQRA 4OF8A 3TNNA 4PJAB 3SOBL 5GIRA 4NSKA 2R1YA 3GJFH 4K94C 1OAYL 1CD9B 2A6JA 4P0DA 4KKAC 3SPVA 4HC1H 3P0YL 3I6GB 3QDJB 4YFDB 1IM9D 5EIIB 3EOTH 5E08L 3RVWC 3PP4H 3LAFA 4D0CA 1NFIB 2NY6D 4HCRL 3ARRA 9CGTA 5IB5A 3QQNA 2AQ1A 3TBYA 3TJEH 3WLWD 3HE7D 4H25A 5I8EB 1RK0A 1NAMB 2EECA 3S35X 5C6WH 1QBML 4GO6B 5C0FB 4RNRB 2P8MB 2QQKH 3QIBC 3SDXF 3U0TB 3N1FC 3GMLB 3SGEH 1W8OA 4Y19A 3WJLA 1ZAGA 1TZHA 4LLUA 1QD0A 1RZ7H 3DX7B 3L7FB 1C5CL 1V7NL 3DRQB 4JJHA 4NCDA 1MLCA 3QIUD 1LO2L 1QHOA 2E3VA 1I8MA 4JFXB 4HWEL 1OP3H 1BFVL 1YMMB 4I3RH 1TJHL 1UZ6E 1YN7A 5D1XC 2QEJA 4IOFC 1QZ1A 1K2DB 3U46B 1GZQB 4C54A 5ID0A 4K2UL 5IW6B 4G6AC 2F8VA 1UM5L 2ED8A 5JHDD 3GMPB 2R0ZH 2IPUK 4C83A 3ZYIA 5M7QA 4QHMB 4KKLC 3V4PL 2CDEA 1IGML 3OB0H 3NABH 1FYTA 5GXBB 3SDXA 3KPRB 1ONQB 3DUSA 4Y4HA 4HCRA 5BRZB 1RK1A 2CDFA 2VMFA 1ERNA 1DBJH 1UM6L 1ZS8A 5CBAA 1U3HA 2AXGA 1Q9LB 1TZGH 4PJAE 5JDJA 4QHKI 5KOMC 3TT1L 3LQZA 5DJAB 1W72H 2PYEA 3MNWA 2Q8BH 4UAOB 3O6FA 3TIEB 3P77A 4K55A 1Z5LA 2NTSP 3DMMB 4NRYA 5E1AB 3ULVH 2X89D 3VG0H 1HKFA 1U41A 4X9FA 3C5JA 1H8OA 1JGLH 1FIEA 2BSED 3ARDD 4GBXD 3UX9B 2H32H 5I76A 3MRCA 3R1GH 4NQVA 5ICYB 3A6CH 3AREB 4IDJL 2K1MA 4LQ1A 4U1JB 4ODXB 5CS7A 1IZKA 3EUUA 3O11B 3NTCH 2W38A 5AD0A 3ARFA 4XP9H 4B5EA 1BGXH 4OLVH 3IJHA 1LEKA 3CMOH 3MPCA 1EXUA 4WV1A 3Q3GA 3CFKB 4P23D 5KVGH 2RBLA 1YMME 2AK4B 4LSSH 4WI3A 4OJFH 3RWEA 3QUXA 4N0CD 3OWEA 2BVOB 3H7BA 5D93C 5FDWB 3MJ9L 3CVHA 1YEEL 3FT2A 2J6EH 1AJ7H 4P59H 1CQYA 3QI9A 3ULUH 4GMSL 1DE4A 4XVUC 3BRGC 1OAUH 3ES6B 3L3KB 4NFBA 3WFEH 3O9WD 2OTUB 3VXNB 3KPRE 5HI4C 1TITA 1XF5A 2MWCA 5H35A 3EZ8A 4HIIA 1WCBA 3BO8B 5BRZE 3OG4B 5A1AA 4M43H 1WZKA 1RQ5A 1X4ZA 5DJDA 5IF0A 1NMBL 1B0GA 2HJFA 2VAJA 5KSVB 1LO4L 3MV8B 5DQJA 5I1IH 4JDTL 1RUML 3WIHL 3FZUC 2Q87A 4M8QB 5L88L 1I7UA 3QCUL 4PJ9A 5D2LF 5CJBA 4NKDA 5F1KC 1WC7B 2GY5A 3QCVH 4NNPL 2WINB 1W0VB 2QSTA 1L7IH 5DVOA 3M45A 1HHIA 3MJ7A 2X70A 3MJ9A 4M7KH 1UWGL 4HGMA 2F54A 3SKJH 4HZLB 1J05A 3VD9A 1NGZB 3G6AA 2FX7H 3INUL 5FGCB 2DL9A 2OX5A 2P1YA 3F58H 4RWYH 4XCFH 4I2XA 3O4LA 2NY7H 4TUOA 3FQWB 2V5SA 2AK4E 4I18B 2V9QA 4O4YH 4PPTA 2NTFA 3VD4A 1EO7A 5D2LA 5F9OL 4PD4J 1A5FH 4JM2C 4KXZI 4JO3L 5DQDH 1FSKB 4RGND 2P7TB 3MLZH 4R7DB 3D3VB 4PP1C 1KPRB 4NQDA 1YMHB 2HYMA 3WIHA 1JPTL 2VZVA 4PLJD 1T22A 4G6FD 2HRPH 3B3IB 5F7MC 3GBLA 1KJMA 2F5BH 4M9OA 1IGCL 4XGZB 2MNUA 1AGEB 5HY9B 5E95B 4U1MB 5JW4M 4LSVL 3MO1B 3EO0B 1MCDA 3O6MH 1KCSL 2C1PB 4HDIA 4DZ8A 4BFGA 3QXTA 2P5WA 3BEWB 5HD8C 4TSAL 1FFPA 3TNMB 1RIHL 1EHNA 4LVHC 5D96C 1YNLH 3UTSB 5KVEH 5E8NA 1F3DJ 1D5BB 1I1FB 5EBMB 3G9AB 4ZOBA 2ITDA 5DK0B 1U3JA 2V5TA 3HZKA 1MY5A 5BVJB 3TBVA 1EAJA 1UZ6F 1QA9B 4JHAL 1F3RB 1EFXB 1XR8A 3K3QA 4GW4A 3T3PE 4N90E 5CINH 3LRGA 3BKJH 5FGCE 1KELH 4ISVA 2ADIA 3HI6H 5ICXB 4FZEH 4DWHA 2YN3A 3U36B 1Z6JT 3OPZL 4LLDA 5HVFB 4L8C