2W0KA

Crystal structure of the recombinant variable domain 6jal2
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
111
structure length
111
Chain Sequence
b'NFMLTQPHSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGSSPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSNHVVFGGGTKLTVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords V1-22 PROTEIN
publication title A Single Mutation at the Sheet Switch Region Results in Conformational Changes Favoring Lambda6 Light-Chain Fibrillogenesis.
pubmed doi rcsb
molecule tags Immune system
total genus 24
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w0kA00
1NBVL 3HZYB 1ZA3B 2DQHL 4D0DB 3G5XB 4I0PC 5E08H 3HS0A 4XI5D 4K7PH 3UAJD 4ISVB 4O51A 4NQCE 2ERJB 2J88L 4QYOA 4BFIA 1C5BL 4GRMA 3UO1L 5T3ZD 4BSJA 1NGQL 4HEPG 4LCWD 5TE4L 4LSRL 2QSVA 3P77B 5HI4C 3L3JA 4LCCA 3ZKXC 5C8JA 4LLDB 3RUGA 3O3EA 4M1CD 1R3JB 5D1ZA 2YUZA 4OLZL 4WU7A 2NXYB 4M1DL 4EVNB 3N1QC 2Z4QB 15C8L 1U42A 2PXYD 3F65A 3OKMB 3LKSA 2WINB 1CGYA 4JFFA 1MRDL 1JBJA 1NUNB 2PYED 2FB4L 4Z0XB 3WLBB 1HHIA 1EJ6A 4RGMC 3KR3L 4ZFZA 5E9DA 3DVNB 5DSCB 5T3XL 1EA9C 1LO4H 3D9AH 3ETBF 3D39B 3PIQB 1ONQB 3EW3B 1YNLH 3QG7H 1D5MA 1MLCA 1V7ML 3RWIB 2JIXA 1Z9SA 3FQWB 4HLZH 3MXWL 4YX2L 1BLNA 2G75A 3PQYA 4LVEA 1JP5A 3G5VB 5F7NC 1T7VA 3VGEA 4JM4H 2D4FA 3NFPA 3O41B 1IAMA 4XHJD 5FECB 5MP6L 4KH2A 1X5KA 2E7CA 2I24N 3QQ3A 1QFOA 1HHKB 5GRZA 1MCWM 1CBVH 5MEQA 5J4MA 2F9BT 2G9HB 2H8PA 1GZQA 1TQCB 5DTFA 4MJIE 1U8OB 3FT2A 1T1XA 1JNLH 4J8RB 4ZO7A 5I0ZA 3E1F1 1UKSA 3ARYA 1H5BB 1F4WH 2BERA 3LN5A 1XCQA 1VB9A 1EAPB 4NO0D 4MA8H 5L9DH 1BX2A 3ARRA 4LHUD 1J8HD 3VFVB 4L8CA 3BHBA 2WLZA 3RRQA 3ZDYF 3TNMA 1AKJB 4RMQA 3IJSA 4N8CL 3HE6B 2UUDK 2DTMH 4MLSA 3O9WD 4M93C 5MI0C 2DM7A 3RBGA 2VITB 3W9EB 2P5WB 3H9SB 4L4VA 4LVNB 3LCYA 3C6LC 3OKOA 5FO9A 3EDEA 3NGBB 1MJ7L 3GSVB 1JUFA 4UV7H 4HF5L 2BMKB 5BZDB 1YYLL 2P24A 3GSNA 4HKBB 2GAZA 1EERB 1QZ1A 4BZ1L 4P2YA 4KUZH 2R4SL 2IH1A 2Z92A 3KXFB 1P7HL 2FHCA 4X4XB 3CD4A 2D7QA 3FB7B 2CMRL 1VFOA 2B1HH 3IXTA 1YUHA 3JTTA 4OTXH 5KS9E 3QJFA 1EXUB 1WWBX 3ARGA 4PLKD 2QEJA 2XPGB 3EJZD 3O81A 1B88A 4NCDA 5DXWA 3DRQB 5EO0A 5CD3A 4DVBA 4IOIA 3O6MH 4DZBB 1OAUL 1P4LA 2H2SC 1ZHBA 2H32H 2MHAB 4NNYB 5DR5H 3AB0B 4PJDE 3EAKA 1QRNA 4JKPL 4OM0H 1W72L 1Y6NR 3NZ8A 3QHFL 1U93B 4MNGB 3G6AA 4G8FA 2X4SB 2Q8AH 2VXTL 4ELKA 2GSIB 1NLDL 1S7TA 4M3KB 1IC5L 2GUOA 4N1HB 4YEFA 2FX9L 4HG4J 2F53D 3ULUL 3HRZB 1OARH 4HJJH 4LQFH 4HUMB 4FZ8H 4RMRA 2HYMA 1RVFH 1KT2A 4HK3N 4K9EH 4U1IA 4DJMA 4U6HA 3CU7A 4LAQL 1KPRA 1U8MA 4ZOCA 2AEPL 2RFXB 3QIWD 1LO5A 2Z31A 2GT9B 1R5WA 1SYSB 1BFVL 1PKQA 3IAPA 4KY1H 1OTTD 4GW1A 2W9DH 4MJID 2WWKT 2DAVA 2V9RA 4GXVL 1JTTA 3KHQA 4IJ3B 3IFPA 1DQLH 3UTZB 3FN9A 1CXLA 5FO7B 4XNXH 4Z78A 4BH8A 1RURL 1MLBA 1WBXA 2VL5B 2ZUTA 4QF1A 3GO1H 3RWJA 2YEZA 2OXGA 1IEAA 4PYGA 1MFEL 3EDDA 3MZGB 1DVFC 3GSNH 4R90H 4P3DB 3IS0X 4EQ3A 4Z77B 2NY0B 4N8PA 1I9IL 5D2LB 3T0XA 2IFFH 1QFWL 1FNAA 3QQNA 1RZGA 1VGEH 2ADJB 5E8OA 5JPMB 3BP4B 3G9AB 1WFUA 3N85L 4DUXA 1IGTB 5FF6A 1SEQH 2WBJB 5GS0H 5AYUH 4MLIA 4IHOA 1UM5H 3HZVA 1WF5A 3S37X 1U8NB 2XZQL 5E9DE 3AY4C 3BP5A 3S97C 1JMZA 2DJSA 5IV2B 5I1IH 1F11A 3VRIB 1QR1A 1EV2E 2X7LB 3Q0HA 1EVTC 1SVZA 5K9KA 4H88H 1JGUH 2YD3A 4NKOA 1HHJB 3SKJL 3X13B 1MOEA 1YMHA 5DUBA 4P2OD 3TPUA 2NQCA 2VQTA 2VZ3A 3BH9A 3EZ8A 3ZMRA 1P6FA 4EUPA 3WXWL 5JOPD 3S7GA 4FHBD 3HPLB 1JPST 3OPZL 3QEUA 1ZMYA 4JFQA 1KNOB 3VWJD 2ZNWA 3LHPL 5B8CA 4YDIH 43C9A 2CK2A 4DK6A 2ZOKB 3HMXL 1MAMH 1QO3B 3FB6B 2C9AA 5IWLC 1X5HA 1CICB 3HC3H 4J4PA 32C2A 5IMKA 3JXAA 3Q6GH 2HJLB 3MRHB 2NR6D 1RJZB 4M9PA 4XP1H 3QWQB 4KU1A 2APXA 2ED9A 3CUPA 3SDXF 1MI5E 5B3JE 1VDGA 3MUGA 1JZ6A 5BMFH 4Y0GA 5DWUL 1T22A 1AE6H 4U0RC 1U2CA 3GHBL 4F8QA 1CE1H 3P4LA 3C87A 1OT2A 2BNQA 1UH4A 2DKUA 4YXHH 4P5KB 8FABA 1LO2H 1A8JH 2VDRL 5IW1B 3VGBA 3EOTH 5A1AA 3C8KB 4DCQA 3HZKB 3I2CL 1F6LL 1OCWH 4ENEC 1QKZH 3BJLA 1BBDL 1EFQA 4UIMB 3P0YH 4DZ8B 2ITCB 1FGNL 3UPRB 1YEKH 4U3XA 1FVDA 4YFLI 2XWJA 5I74B 1IM9B 4ZFOB 2ICES 1S8DB 1G6RA 5EZOH 2ZJSH 2FJGB 3CC5A 4I77L 3OB0K 1DQQB 4MXWH 4C57C 5CINH 1Q8MA 1A6TA 2ZNXA 3DX6B 2EXWC 3BIAX 3IXAB 4ZUSB 1B4JH 2LU4A 5D1ZD 1TETL 1JF5A 1XIWB 5DJYA 3CDFA 3MBXL 5FUZH 1JIBA 4N5EC 3EOYG 4QXGL 4OZIA 3WKMH 5IR1B 2VABA 3MLUH 4JFFD 3FFDB 3K46A 4I3SL 1UJTA 4OLWL 3G5ZA 4NZTH 4F37K 4M62H 3N06B 2NY2B 4JDTL 2GJ6E 4Y5YB 1JGVL 4ZS6C 1ZLWK 4JZJC 3IKCB 5E9DD 2VLRA 5BV7L 5C0GA 5KOMC 4D0BB 1JZ5A 3G5YB 2OXHA 1DBBH 1MCQA 4J3XA 4XPHL 3WFEL 4APQB 4EDXB 5FA4B 4N9OB 5HHOE 3E8UH 5K9OA 1Z6JT 1NC2A 3H0TB 2AGJH 2JIXD 4NJAL 3CFCL 3PQYD 3B83A 1AXTL 3DIFA 1OP5H 3U7WH 4Z7OF 3A6CH 1U8JA 1A5FL 4OUUB 4HWEL 5GZNC 3MCLH 1QLRB 4PJXB 2IANA 3VH8A 4J12A 5I17B 5JQHC 3O4LB 2Q6WB 3L5XH 4JPWL 3U48A 2QADD 3CSYB 4XX1E 4QRTB 2FATH 2A1WL 3FB5A 3KPPB 3TJHD 4BSWB 3IDXL 2OMBA 5A2LH 4AEHL 1KCUH 2SEBA 4JRYB 3SQBA 1E4WH 4M4RA 1M6OA 4CNIA 4FFWD 1JF1B 3EO0A 3T08A 4JDVA 4S1DC 4X4ZA 1S7QB 4HMCA 4G8IA 2ADIA 5CKAA 3K8KA 4XRCA 1SBSH 3I3BA 5HHVH 1JYXA 1JE6A 2V9QA 3LQZA 3V79C 4KUCD 4NQDE 1UZ6E 2KH2B 4ODSL 5DJ8B 3DYOA 2HTLD 3TBVB 1HSBB 4MCYA 2YWZA 1GGIL 3Q5YA 4LSQH 1G6RH 4CGTA 2CRZA 4Y5VC 1BFTA 4GS7B 2VQUA 4HFUL 1WFOA 4OF3A 4L4VD 3G08B 2J3SA 1VERA 3H3KA 3IFLH 1L0XA 2A9ML 2W92A 1G9ML 1GVIA 2FO4B 2QSCL 4JFYA 5F3HA 4IMKC 1NAKH 1QACA 4XBGA 5D71H 1S7RA 2R0LH 1T2JA 5CKGA 1ITCA 1FO0L 5CP7A 2VXVH 5HPOA 1UWGL 4HXAL 1T04B 1ZHNA 5I76B 4M7LL 5GS0D 4HWZA 3IETA 5BVJB 8CGTA 4FP8L 4YXKH 4G9FE 2BRQA 3HAEH 3MOAL 2IBZY 3OAZH 4XVSL 3MRRA 2VO5A 4JLRB 1TZIA 5CZXC 1RZ8B 2HG5B 4ELMF 3RTQB 5GRJH 5FA3B 4PRIA 3UJTL 5C0AE 5F93C 5JQ6H 1QRND 1RY7B 3PHOB 5HYJB 4G8GB 3EO9L 1RU9L 1BF2A 5HHNA 4K3GA 3CFEB 3GSXB 3RWEA 2QQLH 2VLJA 2DWEB 4XCFH 2VISB 5HDQH 3U4AA 4X4ME 4W70A 2ZZUT 1TDQA 3BZEB 2QQQA 1R24A 4NC2B 1CN4A 1U8KB 4ZD3H 5AWNH 3ROLB 4XPBL 5C70A 3ZYIA 3LDBC 1BZ9B 1MQKH 4I9WE 4KMTL 1XGQA 3ZYJA 3UYRL 2I60H 4LF3A 3U9PL 1J1XH 1FBIL 4BKLB 3FONA 4XAKE 4KKBC 1FV1A 4ZS7L 4ZXBA 4JFOB 2W9LA 3PHQB 3X11A 1KF9B 4PJ5A 2Z31D 4F7TA 4QGTA 2YD4A 1BIIB 5GGQH 3F5WB 1BEYL 2GYSA 3CIQA 3GMNB 1ZVSA 2ZUVA 3GSOB 4M6MH 4X5XA 4WW2F 4X8XA 3L1OL 2QBWA 4XMKL 1QBML 3GBNH 3DSNA 4ZYKA 5EOTB 1NC4A 1X9QA 3O3AB 4QTHB 3QWOB 1F3DH 5KVDL 3VG0H 1KN2H 5ALBL 5DVKA 2OQJB 4JVUA 5CCKH 1INDH 5IG7A 2OR8A 5FM8A 1DZBA 4CVUA 3P0VH 5F88A 5L7XH 5I1EH 1FFNA 4HPYH 5I16B 2NX5E 5I18L 1TZGL 3SDAA 2ATKB 3V0VA 3VFNB 3QPQC 3BXNA 1UYWL 4QRPB 4DN4H 4PRPE 4OD1L 1DN0B 5EU3A 3LKPB 4K94C 1WCBA 3UTSB 5IGXL 2BC4B 4F15C 2HAZA 2QHRL 5EIIA 1DDHB 5IMMA 3ROOA 5FM5O 4X98A 3KYNB 1F58H 3KYOB 3QUYA 4YDVB 4KKNA 1RK0A 2XWBB 4JFZL 5DHVB 1W0YT 1YA5A 1CGSL 2NY5C 1QG3A 3S36H 1QRKA 3QUMB 5D2NA 4ZDHB 4PB9H 3S35X 5DRZB 1I8MB 4HS8L 3L3IB 3VI3F 5IHBA 1GPOH 4G8EA 1FAIH 2Q3AA 3HKFA 3RU8L 3BWAB 1PG7L 3ARDB 1EUTA 4O2FA 4EZMA 1IC4H 1MIML 1YMME 2X4QA 1DBMH 2AV1B 3V0WH 4Z0BH 4U6XA 5EOQL 5IMLB 3C08L 4M4PA 4PJ7B 5C0AD 1E4JA 5DO2D 5DUPH 1KEGL 4FFVD 2HLAA 2VDQH 4QOKE 4YK4B 2IANE 4UTBH 2ZOLA 4O2CB 3VXPA 1UEYA 1JI1A 1J5OH 1A14L 3VXNB 2MPAH 3B2VH 1UM6L 3C6LD 5ETUA 4J4PD 3GHEH 3T2PA 2P8PB 3X3GH 3CFKB 4GMSL 5IB5A 2P8LB 3VWKB 3MV9A 1S9XA 3HC4L 1FZKB 1W8OA 1AO7A 1KEMH 5E1HB 1FVCA 4QKXB 2VLKB 5C6TL 2R4RH 3MFFB 1D6VH 4IRSA 4Y1AB 2VQ1B 1I3RB 3DX9A 3WD5L 4YHPA 1FL3A 1QA9B 5J6GA 3UDWC 1IAIH 1JRHH 3BGAA 4XPAH 5TGBB 3EHBD 1F97A 3PDGA 1QSVA 5HI5D 5BJTA 1QHOA 5KOVC 3DI2B 1K8DB 2XN9A 5GRVL 4LPXA 3WMSA 5J6HA 5I8EB 4KI5D 4P4KC 4JQXA 4DVRH 1S5HB 4B5EA 5HHME 4I8DA 4WJ5B 1UKTA 3G6JF 3GMMB 1VEMA 5SWZE 2HKFH 2M26A 1OQOA 3O6LH 2HT2D 1FCCA 3HE7B 4Y19E 3LD8C 2FWOB 2QKIA 4NQSA 1FFOB 3SCMB 2FJHA 1I1YA 4P5MB 4GLRI 4JN2B 4RSVA 3WIIH 4E5XB 4HIJB 3PXHA 2DQCH 5EBGA 4I48B 4P9HC 4TN9A 4KDTA 2EKJA 5DMIL 4HULB 1CF8H 1A22B 1G6VK 3SPVA 2AJZA 4PRIE 3WCYA 3FT3A 1ACYH 3P4OB 2JLLA 2BSTB 3HUJF 2GW5A 2VLRD 3O11B 2C26A 3TP4A 1LP9F 1H3WM 5B39B 1F00I 3O6FC 4KKCC 4G5ZL 2R1XA 3D3VB 1NC2D 5HDOA 3CX2A 2O26U 3T3PF 4GFTB 5JR1H 1J12A 1U58B 1Q9LB 5TQ2L 5I1HL 3H8NA 3E6FB 3PL6C 4Q6YA 5FUOL 1G7MB 1JWUB 4D0CB 2IAND 2WM0A 4M6OL 2EDEA 4WW2C 1NGWA 3WUWB 4ZUVB 2GTWA 3HNVL 4PJ5E 2HFFB 1XF1A 4LKXB 1QLFB 1IGML 1NDMB 1RULL 3T8XB 1MQ8A 3OWEA 5F7WC 1I1RA 2NY1C 3H7BB 3QXAB 4PRBB 1TVDA 2B20A 1VGKA 1IL1B 4QRUB 3VFPA 4JRXE 3V6ZA 3HZYA 2GFBB 4XVTL 1ZA3A 1G0DA 4D0DA 3G5XA 1JNNH 3MQIA 3OJ2C 3W5NA 2AERT 4OZ4B 2AXGA 4PRNB 3FO1A 2P7TB 4ISVA 4YBQC 3CDCA 3AM8A 4HH9B 4M6NL 1JPSH 3KYKL 5BOZG 1EJOH 5C07E 2DLIA 4XP4L 3P77A 5I1KH 4GRWH 2ID5A 1TNMA 4RFEB 2XZAL 5F3BA 1QD0A 1KELL 4JM2B 1BIHA 1R3JA 5D7SH 2PCPB 4FABH 1FAKT 4KXZI 2JJWA 3W11C 1UWXK 4XPFL 4NHUA 3LIZL 3PGFL 4EVNA 2LU7A 2Z4QA 5JLZB 1X5GA 3ZL4H 3OKMA 3VE0A 4OGAC 4EDWH 5HHMD 2WINA 4PGEA 3TH4T 1UB6B 5FYJL 2R1YB 1CLOH 1XR9B 4IIQC 4Z0XA 4UTAL 3WLBA 1WQVT 5DYOB 4V2CB 1CE6B 2ZCKL 3DVNA 5DSCA 1DBAH 4G6JL 1WAAA 4MJ5B 3D39A 1K4CB 3PIQA 5LWYH 3VXSB 1ONQA 2IADB 1PAMA 1ORQB 4LLVB 1UJ3C 5C71A 1H8OA 5LJYH 3RWIA 2ORBH 4N0CC 3TYFB 3FQWA 3X14A 3G5VA 4UIKH 3O2WL 1UA6L 4PRID 3C9NB 4NGHH 3DV4B 3O41A 5J12B 4EQ2A 2E5EA 5FECA 1AHWC 3A6OA 1JI2A 4P23B 5B39G 2DQIH 1A2YB 2YPLE 3AREC 4XCCH 4BQ6A 3VXUB 4JGJA 2DQDH 2EE3A 4HIHB 2G9HA 2VLJD 5I66B 1MREH 1WWCA 5EWIH 3AGVA 2EDWA 4JGUA 4JANB 5A16A 1BJ1H 1DQJB 2K9UA 2YPKB 3EYUH 5J11B 1AI1L 4AH2B 3MV9E 1MY5A 4A6YH 1QFHA 4FQ2L 4AEFA 3IVKB 4KJYB 1H5BA 2E3VA 5I1GH 3T04D 4MJ6B 4K94H 2OI9C 1AO7E 4LCIL 4Z5RA 3STBA 3VFVA 4ZXBD 4OZGF 2ZKHL 2FEEI 2NY4B 3WV0A 4WW1B 1YQ2A 5EULV 4DN3L 1EEZB 4PJ5D 4AY0A 1AKJA 3HMWH 5C09B 1DQDL 3VG9C 2VH5L 5F9AC 2NY5H 4UQ2B 3TBSB 4XP6H 3FAWA 1AFVL 5IHZA 2ZP0T 1XF3B 2VITA 4JRXD 3W9EA 2P5WA 5K33A 3H9SA 4NUJB 3KHOA 3TBYB 1NC4D 3ZE1F 4DW2L 1S5IL 3GSVA 5B22A 3MJ9A 2BMKA 2AKRB 3VXRE 5BZDA 4GRWE 4HKBA 5F1KC 1NLBH 2MKLC 1TJGL 3HI6H 1YNKL 3ALPA 4IDLA 5C07D 4YHYC 3SDXE 4MVBC 4BUHA 2PR4L 3MSPA 4QCIB 3KXFA 3VGHA 4X4XA 2FH8A 3BX7C 3SDAD 1KSRA 1HSAB 1EXUA 4X5WA 3B3IA 3MLWL 5GZND 4DTGL 2XPGA 4GQPH 3UTTE 3LRGA 3DRQA 5F70A 3GSWB 1MY7A 4WUKH 5KTEH 3ARBB 4TVPD 4M61B 1GL4B 1REIA 2JJUA 1FNSL 4K3JL 4YQXL 3NFNB 1ZKAA 4P2RB 3QUYD 3F7RA 4YBLB 5F44A 2MHAA 4NNYA 4JHWL 1HXYB 3QG6B 4P2QB 3T0DA 5IIEB 4N0RA 3FHQA 1U93A 3VGAB 3WL9B 4MNGA 4LLMB 2X4SA 3O3UN 3RY6C 4ODTL 2GSIA 3AAZB 4S1DD 4OSUL 2B2XH 3K7UA 5E7BA 1H3PL 2AEQH 1DLFL 5EOCJ 5FYLH 4JG1L 1JJUA 3H6JA 3HRZA 3QNZB 4NRYB 1CLYL 3CK0L 2OR7A 1NAML 1CGUA 2DWDB 2CUMA 4PGCB 4LCUB 3S6CA 5L88L 1TVHB 3H7LA 5J13C 3ZKND 1MH5A 2FO1A 5C2BL 5IEHB 2FHBA 2GT9A 4R97C 3ULUF 2N7AA 5DA0B 1JHLH 4NT6B 1T80A 1SYSA 4QXUL 3VXQB 5CFHA 5F72S 1GOHA 4Y89A 4J3SA 3VW3H 1U3HB 2NZ9C 3C5JB 3MV9D 1JGEB 4MA7L 4RZCB 2OZ4A 5DEZA 1J18A 2DI7A 3UTZA 4C58B 2YBRA 4MB4A 5FO7A 3VGDA 1AO7D 2XRAL 2VL5A 4UINH 2N4IA 5D5MF 5DUML 4IRSD 2ZUUA 1NMBH 4NFBA 4O58H 1A1OB 4Z7OE 1BZ7B 3OJDB 4M48L 4KI5F 4P3DA 3B9KC 4Z77A 1DANT 3LEYL 5D2LA 4HV8A 5CBEB 3GIVB 3WFBL 3FZUD 3N0PB 2ADJA 4LCYB 3A67H 5JPMA 2XN9D 2A6JB 2F74B 1NMAH 4ALAL 4QRRB 1IGTA 3NCJL 4Z8FL 1N6QL 2Y6SD 2VDKL 3D69B 3HCVB 3DO7B 3MLSH 2WBJA 3NCYP 4XVJH 3ZHLA 4NKIL 5TF1L 2E7LC 2W60B 1U8NA 2HVKB 5CGYC 4OZIF 5BO1L 5K9JH 5KN5B 5IV2A 1WAAE 4L3EE 4Y16B 3VRIA 1YY9D 3EYSH 2WIMA 2X7LA 5DMGC 1XGYL 1ES0B 4JY6B 3NABH 5FCUL 3H3PH 3LV3B 1HHJA 3X13A 1MF2H 1W8NA 4YGAB 2G5BB 2VZ1A 2BSSB 4PJBE 2Y36L 5CEZH 1UQSA 4LIQH 3HPLA 1RJYA 5HGAB 1YQVL 1GIGH 3LS5L 2ICWI 3H9HB 2VZTA 5CJOH 4PJGE 2VLLB 4BK4A 5IB4A 3VFWB 1QO3A 3FB6A 2WUCL 1CICA 1M7DB 1YEIH 3QISA 4FQQB 4NNPH 2RAMA 4CDGC 1LE5B 1RJZA 4QEGA 3WIHH 4NO2B 5EG6C 5ERWB 4ZTOH 4CMHC 4MXQD 4K7FB 2ILLA 4R7DB 4LEXH 4S1RH 4JY5H 5SWQB 5DI8B 1IGIH 2A77L 3EDJA 4D8PB 1YEEH 4JN1H 1A6WH 4P5KA 5CJ5A 3PUCA 5IW1A 4PJFB 3C8KA 3DARA 3HZKA 4LP5A 4UIMA 4K8RD 4Z18A 5F6HI 4DZ8A 2ITCA 6CGTA 2P5WE 3UPRA 2EIZB 2HMIC 1L0QA 1A3RH 2F15A 1MCJA 1IM9A 1NEUA 4ZFOA 3HN3A 3A0OA 3ZT6A 3VXTB 1DLHB 2CRMA 3BZ4B 2M8XA 4ERSL 1S8DA 7FABL 4Y4FC 4G6FD 2FJGA 3LB6D 3KPRE 1DQQA 3CSPA 4ZTPL 4GRLC 3FOLB 3F6LA 4Y8DC 3D1MC 5D7LE 3DX6A 4ZUUB 4N0UB 5D96C 5EUOE 5JXEA 1HINH 3BO8B 3IXAA 4ZUSA 1S7XB 1KOAA 2KQNA 3LH2H 4U1LB 2P42B 1XIWA 3ESUF 3SBWC 4HJ0D 1ZWIA 2HLFD 5FYKL 1TXKA 4YHOL 3CXHJ 4RGOL 5SV3A 1EO8L 5TDOA 5AZEL 5IR1A 3IGAB 3FFDA 1S9YB 1TENA 3CU1A 4R26L 1IKNC 4WV1B 4LMQE 4Y5YA 4X6DE 3KJ4C 4FQPA 4BFBD 3IKCA 5SX4I 4KTDL 4ODVL 5JXAL 4ZUWB 3D39D 4D0BA 5KJRH 3PWLA 3G5YA 2IAMC 4S0TD 4YEEA 2PUQT 4EDXA 3E6HB 4APQA 4Z7NE 5CEZE 3ES6B 4LIQE 4LHJB 5FA4A 1ULVA 2W9EL 3MV7B 4GKNB 4M43H 1Q1JL 3H0TA 3VI4F 5AZ2H 5B3NA 3LEVH 1VKXB 5HI3D 4PUBL 2RHEA 1JYWA 3ULUC 4OUUA 1NJ9A 1EO5A 4N1CA 4OUOA 1QLRA 4PG9B 5E03A 3VRJB 4PJXA 1SY6L 3VFGL 1WZLA 1LDPL 3GIZH 3WFCH 5I17A 2KPNA 3O4LA 1P1ZB 5FYLD 3SGEI 3CSYA 3NTCL 1CVRA 4QRTA 3ARSA 1WIPA 4BSWA 3KPLB 5TFSH 1I85A 5HYSB 2IMMA 4JRYA 1MSPA 4LDLB 1ZLSL 1JF1A 4CJ1A 4HPOL 1R5IB 3ZT7A 5GSRA 2E7LA 3PP4H 3L3OB 2R23B 3CXDL 3TBWB 3V52H 4PJIF 1SVCP 5ENWB 2YS4A 3MRKB 5DJ8A 1AKJD 3GKWH 2DLHA 1A1MB 3TBVA 1HSBA 2AJUL 3KPOB 5CAYB 3RIFF 2DB8A 3IDUA 2ENYA 2YZ8A 4WIQA 2P5WD 1MHEB 3QO0B 3QFJB 3G08A 4KI1A 2CGRH 1AD0B 1AGDB 3UTQB 1F4YL 5TPWH 2VXUH 4RFNB 5J0BA 1DR9A 4XTRC 2FO4A 1A7OH 1EGJL 3KPRD 4JFEE 3WEXB 5KSAC 1INQB 4S1QL 1NMCC 1WIUA 4H25B 1IAIM 3MNWB 3O6FD 3KXFD 1S7WB 1CFVL 2BRRH 5IT2H 4AYFA 2V7NB 1KYOJ 1T04A 5I76A 3NZHL 2A0LD 5BVJA 2Z91A 3C8HA 4OZHB 3NCEB 3NN8B 9CGTA 1U92B 4JLRA 1YYMH 2HG5A 4U1KB 5T5FH 4FZEH 5FA3A 4M7LT 2AABL 2E6PA 2XA8H 2W65B 1NBVH 2DQHH 1RIHL 2ZUWA 3PHOA 5HYJA 4G8GA 2R56H 3NCFB 4YFDB 2J88H 1F2XK 1BFSA 4Q9QL 1A47A 3CFEA 3GSXA 3UO1H 1Z9MA 2DWEA 2VISA 3O8XC 4GW4B 5C08B 5TE4H 4KK6C 4LSRH 4KGJA 2BFVL 2DIAA 3BZEA 1CIDA 1U8KA 2K7PA 4Z7VB 3ROLA 5GGRY 1BZ9A 3WS3B 2P1YA 35C8L 4YC2C 3VU2A 4OLZH 4M1DH 4OF5A 4BKLA 3RVWD 2B4CL 1ZT1B 3DVGB 4GUPB 15C8H 4WO4B 3KNBB 1T66C 4JFOA 3FRUB 3PHQA 3TO2A 4FMFA 4UAOC 5DQ9B 2K3TA 1MRDH 5HYSG 1BIIA 1OSPL 3SBWA 2UZYB 3F5WA 2FB4H 3TESA 5TDNB 3IAQA 3GSOA 2J12B 3WNMA 4LKCB 5ID1B 3ZKMD 4G6AC 2IPTL 5I19L 5T3XH 3X14B 1FFRA 3HUJE 5ELIA 5EOTA 2J4WL 1NFIB 4Y4HC 1BVLB 5FDYA 3U30B 3O3AA 4QTHA 1P4IL 4MB5A 4MYWB 1IGFL 5TF0A 4YDKL 2F8OA 2GK0B 1FL5B 3ALXA 2OQJA 3T3PE 4YX2H 3MXWH 5GJSL 1PG7W 1I7TB 5IVNA 3TIEB 3FQRA 2E7MA 4TULL 5I16A 4N0CD 2ATKA 2F58L 4DKEL 3JV0A 4QRPA 1DN0A 3LKPA 4TVSa 3UTSA 4CN6A 4JPKL 2BC4A 2H3NB 1DDHA 4D9RE 4WU5B 3ARED 1H15B 2EDKA 1JZ2A 1QOKA 3KYNA 3KYOA 2WBJD 1I9JL 2XWBA 3SDCC 5IHLB 2JB6B 3INUL 2PW2B 4NYLB 5DGRA 4OD3L 4UILL 3QUMA 1NCWL 5CLTA 4ZDHA 2ARJQ 1GJIA 1LD9B 4X7SL 4UQ3A 1FNLA 3B5TA 5DRZA 1I8MA 5DJCB 1LNUB 2XOTA 3L3IA 5BV7C 4RMUA 3BWAA 3ARDA 3IT8D 4KJWC 4N8CH 4OFYA 3QDJE 4KK5C 4Y2DC 4HWBL 4OGYL 2AV1A 3MNVB 4MS8C 4F7MB 2J1KA 1RPQA 2MMXA 5IMLA 4MD0B 4PJ7A 2EYSB 3FMGL 4JPVL 4NZJA 1MJ7H 4PJXE 2WBKA 2J6EA 4O2CA 3TBTB 4KKLD 4HF5H 1YYLH 4GAYB 3VXNA 3GM0A 2ZG3A 4LGPB 2DQEL 1CICD 2DJ4A 1R3LA 2P8PA 4BZ1H 3CFKA 3LN4B 3EFFB 2R4SH 2P8LA 4XNZB 3VWKA 2WV3A 4HT1L 1J0IA 1FZKA 3GSUB 4YO0B 2FR4A 2CMRH 2B39A 3GJFH 4MZ3A 1CZ8H 4HH8A 1R5VA 2VLKA 3BOVA 5FXCH 3OKNB 3QNYB 3MFFA 1FZMB 4Y1AA 4FG6D 3ARTA 1I3RA 5T3XE 2ZUQB 1OAUH 4L1HA 2F5AH 3IRZA 5LAXB 5TGBA 4PYHA 1ZEAH 1W72H 3QHFH 1OP3K 1MCPH 3TT3L 1IM9D 1K8DA 1BJMA 5I8EA 2VXTH 4CW1B 3AVEA 1IT9L 3RDTB 1B2WL 1V3LA 1S5HA 1IC5H 4TUKL 4WJ5A 2CKBB 4F58L 3GMMA 2FX9H 1G9MC 2V5SA 2AJXL 1NUDA 3ULUH 3HE7A 4WHYG 4R96B 2FWOA 4U3CA 3CVHL 1UCBL 1FFOA 1HYRC 2HKHL 1G84A 4N8VB 4NN6C 4P5MA 5IW6B 4JN2A 4E5XA 4HIJA 4OZGE 1MPAL 3SKNB 4RGNC 2AEPH 1XIWD 2A6IA 3QQ9D 4LSDA 4I48A 3PWPE 3VDCA 3DXAE 1BFVH 1SQ2N 4OCSL 4P3CL 5A2IH 4F33B 2GSGB 1YY8B 3LRSB 1N3NB 3STLB 3TV3L 4YXLL 4PJ8B 2NY2D 2EICA 1PD6A 3KPNB 3P4OA 5E6ZA 5C0NC 4URTB 3BD3A 4YPGA 1FG2B 2N7BA 2BSTA 1RURH 4XPTL 1K3IA 1FPTH 3ORJA 3O11A 5E4IA 5FHBH 5B39A 1X5JA 1FZJB 1MJJB 2AXJA 4APQD 3E3QC 1MFEH 4L9LC 3D3VA 4HD9A 5DF0A 4Y4KB 2KKQA 4YAQB 1XH3B 1HNFA 1FSKC 2D31B 1U58A 2DIBA 1Q9LA 1WZMA 4MDJB 1I9IH 1QFWH 2R2BB 3E6FA 5DVLA 1G7MA 2VR4A 3PWVB 4NM8L 4LSTH 4D0CA 3CMGA 4LLUB 2RB8A 3O4LD 4NRXB 4WI7A 3WUWA 4ZUVA 3N85H 1AJ7L 4MNQE 2HFFA 4LKXA 2HT3D 1NDMA 4CN1A 1NCUA 2NYYD 3T8XA 1IQWL 3KWWB 2X70B 4GAFB 2KZ1B 5DS8B 3H7BA 3QXAA 4PRBA 3TNNB 3K2UL 4JRYD 3R8QA 1K6QL 2XZQH 1RK1B 3TA3C 4M5YL 4OZ4A 1ED3A 4OFDA 4PRNA 1U8IA 2P7TA 3RWFA 2IWGA 4UB0L 4HH9A 5E8NB 3SKJH 4JY4B 4K2UH 5T3XD 3MRIB 4S0SD 2VAAB 1OAZL 1QVOA 3WXWH 1Q38A 1RMFL 4RFEA 4NN5B 3QQ4A 3OPZH 4JB9L 4JM2A 3SOBL 2PCPA 3LHPH 1KC5L 4G7VL 1ZT4B 1HK6A 3HMXH 1B6DA 2GEEA 5JNYB 4TTDC 3ULUE 5JLZA 3CFBB 3Q48A 5BW7A 4NUGH 1UB6A 1XF2B 1OPGL 2R1YA 1T20B 1XR9A 2R9HC 4X0KB 1HKLL 1SM3L 1DE4B 2BVOB 3CZFB 5DYOA 1CE6A 3SKUD 4FTVB 3R4DA 4JKMA 3AROA 1QR4A 3T0WA 5DWUH 2BCKB 2DM4A 3KPTA 1AR1C 1K4DB 4MJ5A 1RIVL 1K4CA 5D5ME 3GHBH 3VXSA 1ORQA 5L8JB 4JKKA 1HNGA 2K1MA 1T21B 2GI7A 2VDRH 1S78C 1FYTE 4HBCH 4EI5B 4QTIH 1RQ5A 4OF8A 3I2CH 1IC1A 1BBDH 3C9NA 5D93C 1FGNH 4OCXL 3WNLA 3DV4A 3B2UC 5JA8B 4POUB 4P23A 2VR5A 3QEGL 4G8GD 1A2YA 1SEBB 3VXUA 5E6IB 3DHJA 3DMMC 4L1DA 4HIHA 3RGVC 2X6MA 5I66A 2F5BL 2HMID 1BWWA 4I77H 2FIRT 4JANA 4LQ1A 2YPKA 1ETZB 2BY1A 3AU1B 5EUKB 4GSDL 4BQ9A 1OQXA 4AH2A 4Y4FD 5CEXA 2BDNL 2X9WA 3IVKA 3V8OA 4KJYA 5IVZB 2QTEA 4MJ6A 3MGTB 1XF4A 4KZDL 4D9QE 3MBXH 2DIJA 4WW1A 4QXGH 1EEZA 4H0GA 4L8DB 4RWYH 5C09A 4I3SH 2B1AL 5FEBA 3KDMB 4OLWH 4UQ2A 1VEOA 4TUOB 5CMAB 1QHPA 3TBSA 4YDLB 1OGTA 4JDTH 1JGVH 1XF3A 3LMJL 2EO9A 2XXCB 1UKQA 2OR9L 2DMCA 3ARWA 5JDSB 4NUJA 5BV7H 4DEPB 5DRWB 4RA0C 1OAQL 4MMXC 3WFEH 4XPHH 4JHZA 3L6FB 1FLTX 4LRIC 4NQCB 4OD2B 3RKDD 2VLME 4C55A 5D2LF 3OG6B 3MPCA 2KDGA 4NJAH 2IAMD 3CFCH 1NFDE 1AXTH 2YD7A 1QBAA 4O9HH 4QCIA 2Y07L 4HWEH 3ILPB 1HSAA 4WFHD 5CGTA 4JPWH 3MUY1 5KSBE 2WWMC 4XNQB 2A1WH 2D7OA 3GSWA 1VFAB 1WICA 2IJ0C 4MMZC 5HVGB 2AI0L 3HNSL 4M61A 1VESA 3IDXH 4AEHH 3QUXB 3NFNA 3GMLB 4P2RA 4ZOAA 3WS6A 5IHUL 3BUYB 1HXYA 4NOBA 3QG6A 4P2QA 1SMOA 1T5WA 3T1FB 5IIEA 2DLTA 4WWKB 5E2TL 3L3HB 4JREB 3WL9A 4LLMA 3TA3A 4IRJC 4QHLB 4H0HB 3ARDD 4ODSH 4PRHE 4OFYD 3VJ6B 1FYTD 3THML 1OD7A 1FDLL 4FQCL 4EIGB 4EN3C 1CL7L 3QNZA 1TIUA 3MLPA 2X4RB 1WITA 4HFUH 3BN9C 4PGCA 3RA7L 1U95B 4LCUA 3HB3D 1TVHA 2F19L 2GHWB 2YHGA 3FO0L 4LGSB 5E99L 1C08B 5IEHA 2A9MH 4PG2A 1IMHC 1G9MH 2QSCH 3QIWB 3VXQA 4KRPC 1EZVY 1F4AA 5HXMA 1CTNA 1U3HA 3C5JA 3VWKD 3SE3A 1YNTB 4MJIB 1JGEA 4RZCA 4RNRB 1FO0H 3DTXB 4HC1A 5IF0B 1KUMA 4MDIB 5L2KE 5IBTL 4M7LH 2VLKD 4FP8H 5MENE 2EE6A 4Y1AD 4XVSH 1KB9J 3BP6B 1A1OA 4O02L 1HH6B 3OXRB 1BZ7A 3I3DA 2XTLA 3OJDA 1ZLVK 3ZLQC 2QQNL 4K07A 3EO9H 4N68A 1RU9H 5CBEA 3GIVA 3QUZC 3S4SB 3IYLW 4LCYA 4JQIL 3IU4L 1U41A 5F7MC 3KYMB 2V5MA 1T1YB 4KJPD 2A6JA 2F74A 3GSRB 4QRRA 5T1DL 3BAEL 2VLMD 3D69A 3HCVA 3DO7A 3O4OC 1XFPA 3BEWB 1Y0LB 3QCUL 1ND0B 1Y6MR 3K4AA 4XPBH 1Z0MA 2YUVA 3HE7D 4KROB 4M9OA 3U4EB 2W60A 4KMTH 5C0CE 5T1KB 2BHYA 3UYRH 1WLHA 4NO5B 4NQVB 4YFLF 2HVKA 3U9PH 1FBIH 4DGIL 5KN5A 1MUJB 4XC3L 4ZS7H 2D4DA 4Y16A 4PJIE 3VXSE 3PABB 1ES0A 4JY6A 2F54E 3L7FB 3MREB 5BXFB 4Q0XL 1DEDA 1D6EB 1WZ1L 1VFUA 3LV3A 1RUQH 3SGJA 5FB8B 5KS9B 1JZ4A 4F80A 1BEYH 1J0HA 2G5BA 2JK5B 3ULSB 1CDYA 5J3HC 2BSSA 1G0XA 1QBMH 5SWSE 5HGAA 3BMWA 4RFNC 3H9HA 4PJDB 2VLLA 3N1GC 1B0GB 4XZUB 3VWJB 5KVDH 2GCYB 4WI6A 5ALBH 4YHML 4FQQA 3OAUH 4KK9C 1LE5A 3D3VD 2NXZB 4F9PC 1EEUA 3PWNB 3U79A 3KPSA 5ERWA 1X5FA 1TZGH 4HKZB 4P48A 4AMKL 4K7FA 3AS3A 4R7DA 5EB9A 2NW3B 3QNXB 5SWQA 1UYWH 4OD1H 4P5TC 1HQ4B 4D8PA 5IGXH 3QI9B 1GCFA 4LAJH 2QHRH 1MCBA 2O5ZH 2PO6C 5IBLC 1D5XB 4RGNE 2UZXB 3GEWB 4PJFA 4ZAKB 4X6CE 3MMEB 4JFZH 3ZSSA 3NA9L 4F9LC 2PYFB 4H26B 4OM1L 5HVHC 3DURB 4ZQKA 3WE6B 2EIZA 1O7VA 1LEIB 4S1SL 4HS8H 3ISWA 3V5HB 1JTPA 3RU8H 3VXTA 1DLHA 3BZ4A 1PG7H 5IMOB 4LP4A 4U1JB 2OYPA 2EDJA 1FE8L 1WVZA 2EDXA 3BE1L 5F89A 1IVLA 5EOQH 3DSFL 5ILTL 3C08H 1KEGH 3E3QE 4PJ9B 3S4SG 1FGVL 3MRBB 4ZUUA 4N0UA 4U1NB 4KK5D 1WV7T 3L3JB 4JM2D 3BO8A 5C8JB 5CUSH 4POYA 1A14H 3SE4A 1QBLL 1ACZA 4N90E 1I1AC 1IGCL 1P9MA 1G7HB 1QNZL 3VD5A 1AD9B 2G60H 3C5ZC 3IGAA 2L4OA 4GMSH 1VADB 5K93A 4KWUA 2GIYA 3HC4H 3MO1B 4WV1A 2EEBA 2Z93A 2NY7L 4ZFZB 5C6TH 4FFYL 1CDIA 5E9DB 3VXSD 1KIQB 2HTKD 3E6HA 3WD5H 25C8L 3ES6A 4WCYL 3MV7A 4GKNA 1FIGL 5HVWA 4PS4L 4WTZG 4UOJA 5FM5M 4R3SB 1D5MB 3O45B 4TQEH 2H32B 2HJKB 4JO3L 2CIIB 3VA6A 3GRWA 3PXJA 4X6BB 3BDBA 2JIXB 3V4UH 4C59B 2CIKB 3RIFK 3B9DA 4PG9A 5AG9A 3VRJA 1RV6X 2NW2A 2MWCA 4P23D 1HOCB 4HLZG 2HJFB 3VFUB 3TIDB 4OCRL 3VXUD 1RZKL 3K1DA 3QPXL 2OTPA 4O2EB 5IB2B 3KPLA 2HVJB 5T1MB 2H8PB 3OXSB 4QGYA 4PRAB 5EBWB 4L8BB 5J7CC 3FT2B 4WFFE 3F7QA 1YEJL 4JAMB 4RISL 1MI5B 1R5IA 4LL9A 3L3OA 3BH8B 2FYYB 4PV8B 3TBWA 5HGHB 2NY4D 3WFHB 5ENWA 3GKZA 5DMIH 3QT2A 4X9FA 1E4KA 3S88L 5KVMC 3MRKA 5C09D 4KMLB 1A1MA 3CSBA 2COQA 3KPOA 4NC1C 4WEUD 3T2QA 3IJSB 1ZXQA 5D7IE 2BHZA 4M3JA 2JJSA 2QSQA 4AQOA 1H3XA 1MHEA 1PX3A 3K4DA 3QO0A 2W91A 3QFJA 1AD0A 2DL9A 4GG6E 5BQ7B 3BPNC 1AGDA 3UTQA 5FO9B 4KZEL 2DQUL 3QCVH 3GM8A 4QRQB 1UADC 3WEXA 1INQA 3G9VA 5E2UL 2O5YH 4KMQA 3MNWA 1S7WA 4ODWB 5F9WC 3HHRB 4YR6A 5I1HH 1M7IB 3FKUS 1T6VN 2VDLL 4UT6H 1OT1A 4W4NA 4M6OH 1JPFB 2BY3A 1FP5A 4C4KO 4WNQB 5GZOC 3HNVH 1JHKL 2X1OA 4OZHA 1YUHB 1RULH 1IGMH 3PGDB 3NN8A 3QJFB 4HXBL 3IF1B 2D7MA 5I71B 1U92A 3SDYL 5KW9L 2Y06L 4FS0A 5F7KC 4OBSA 4DVBB 4P2RD 2W65A 4XVTH 1XGRB 4IOIB 1DEEB 4YGVB 2D9CA 1CXKA 1A1NA 1O7SA 3A6BL 2I07B 2DBLL 4P2QD 5EU4B 4J3TA 5L0QB 3SDDC 2GJ6B 3IS1X 4MD5B 1FNHA 3KYKH 4C83B 4M02A 3TA3D 2ZCHL 4BFEA 3EGSB 5C08A 4GW4A 4R6UA 4G8FB 4ORGB 4U6VL 4I0PB 4BFGA 2XTJC 1KIPB 5HHOB 3IKKA 2X44D 3KPSE 3K80A 4Z7VA 2XZAH 2BVQB 1KELH 5ESVA 4X7EC 3WS3A 1FLRL 3UPAA 4YZFF 1YECL 3LIZH 3PGFH 4W4OC 1ZT1A 3DVGA 4WO4A 3KNBA 4U2ZA 3MYJB 4TSCL 3FRUA 5FOBB 3ZKXB 2AJYL 1YN7B 5DQ9A 3WLWC 5BRZE 5FYJH 4IMLA 5I1CL 5I30L 5TDNA 5HJ3B 4CAGA 1I1AA 4LKCA 5ID1A 1FH5L 1U3HD 4WFFD 4G6JH 4PD4J 3CSGA 2Y23A 1NFIA 1BAFL 1BVLA 4JJ5B 3WJLC 3EBAA 4NOFA 4BA8A 4WGWB 1UEMA 1H3VA 5I75C 6FABL 4Z78B 1WBXB 1MLBB 2Z8VC 2YR3A 4RGMB 2GK0A 5D6DC 1I7TA 1UVQB 5IFHL 4U1MB 3O2WH 1UA6H 5JUEL 3TIEA 4NQDB 1P5VA 1IEBB 1S78D 1BOYA 1V3JA 1NGPL 4IOFC 2NPLX 2DQTL 3HI5L 1I3UA 4XCNB 4BYHA 1ADQL 1KLGB 3VD4A 4M7KL 1MFAH 2H3NA 4N0YH 1ZAGA 4QRRD 4OV6F 4WU5A 3OAYH 1H15A 1IAOA 1AI1H 3J8F7 4ODBD 3QDGE 5FF6B 5H37H 4HUVB 3P40A 1BWMA 4FQ2H 4J3VA 2JB6A 5I1LB 4HJGB 5HGGS 4ZO9A 2JJVA 4NYLA 2PW2A 1LD9A 4LCIH 1YEFL 3TFKD 2ZKHH 1OGAE 4Y16D 5DJCA 1LNUA 4PJCF 4XP9L 4DN3H 3P11H 3QDMA 1SJHB 1DQDH 3S98A 2VH5H 4XMPL 1HDMB 5GGRB 4G9FB 1AFVH 2R15A 3MNVA 3TPUB 4KVNH 4X99B 5FIEA 4MD0A 2EYSA 3MOBL 1GGCL 3TPKA 1KTLB 3BH9B 4LLYB 4QHNB 3QJHB 5KZCB 4DW2H 1S5IH 5C0AB 2ZG1A 3TBTA 3UJIL 1L7IL 3EOAA 4GAYA 3TO4C 4MQXD 5MI0B 4M93B 43C9B 1TJGH 1YNKH 5GS1C 4CVWA 5KAQF 4UUJB 2EDOA 3F62A 3C6LB 3LN4A 3EFFA 2PR4H 3OKYA 1Z5LB 1U3YA 3KPSD 5LCVL 3MBEC 2NTSP 1Q0YL 3GSUA 4YO0A 5C0DB 2NLJB 1E0OB 4QNPF 5FYJE 5GRYA 2DM3A 3MLWH 4YHIB 4DTGH 3OKNA 5JHDE 2ICEB 3QNYA 2NY6C 3TYGL 1FZMA 4XX1G 2C3HA 5I1AA 5T3ZL 1T1ZB 1FNSH 4K3JH 4YQXH 3ARFC 4PPTA 4JHWH 3V5KB 5DC9B 4JVPA 5LAXA 5L2JB 1C7TA 5J1SC 4OZFH 3DPBA 1BQHB 3MROB 4CW1A 3ZE2F 4ODTH 1SMAA 3RDTA 2VN7A 1S9KC 4OSUH 4K3HA 1H3PH 1N0LA 2CKBA 4PTUB 4R0LC 1DLFH 1K3ZA 1G6RB 2C4XA 4JG1H 5BOPA 2OL3L 1YEHL 1CQKA 2EC9U 1LHZA 4AIZB 1CLYH 3CK0H 3BKCL 1NAMH 5ACLA 3QXTA 5IVXE 4N8VA 5GRXG 5L88H 4L9DA 2FBOJ 5IW6A 2NX5B 3SKNA 5C2BH 5BVPH 3WNKA 3MRNB 4I0KA 4QXUH 5DEGB 1M71B 3EUUA 4PRPB 4F33A 1T83C 2GSGA 1YY8A 2DS4A 3LRSA 1N3NA 1RD6A 3STLA 3QDGD 2E7HA 2YD1A 4I13B 4LPVA 4PJ8A 3AMLA 4MA7H 2EKSB 3Q1SL 3IDYC 3KPNA 2X2YA 3IJHA 4XB7A 3TVMC 1FG2A 1NEZB 3L5WB 1YDPB 1XR8B 3HAEB 4FQLL 5DUMH 1MHPL 2D03L 2JELL 3REVB 1FZJA 1MJJA 3ZKQD 1U8PB 3MV7D 3BYYA 2DI9A 3WJLA 1CDBA 3OKDB 4Y4KA 4KVCL 4M48H 2E9BA 5F8QC 1XH3A 4YAQA 5I15H 3CLFL 1YMMB 1JMXA 4W81A 3LEYH 1A7QL 2R2BA 3U0WL 3WFBH 1U8JB 3BKYL 1X5LA 1BD2A 2CDFB 4NRXA 5GJTL 4QOKB 2B4CC 1DVFB 2IANB 4ALAH 4Z8FH 4JCMA 1N6QH 2VDKH 4P9MH 4NC0B 3BISA 1UACL 3KWWA 2X70A 4NKIH 1KG0B 5DS8A 4C4KT 5EC1A 4F37F 1MWAL 3U0TB 3HFML 1RK1A 5BO1H 3WKNA 3L95B 1XGYH 3ZT5A 3C2AL 4RMTA 5JHDD 2X1QA 4LPCA 5E8NA 5FCUH 5IESL 4JQVA 4JY4A 1V05A 2ADIB 1EHAA 1ZA6A 1OOAA 2QR0B 1ERNA 3MRIA 2VAAA 4MSWB 1J86A 3L5JA 3NH7H 2Y36H 4NKMA 1BQHG 3IFOB 1AGCB 2K7QA 4FQJL 1YQVH 3V2AR 2X9XA 3LS5H 4D2NA 1YZZA 4UZGA 2Q3ZA 1RUML 3QFJD 3M17B 5JNYA 4I5BB 3UZVB 2WUCH 1XT5A 2HH0L 1QYGL 4PY8I 4WUUA 3IAGC 2FSEB 3SEPA 1PY4A 4KPHL 1XF2A 1T20A 2JB5L 4RMSA 5CJXA 4MX7B 1DE4A 2BVOA 1MELA 3CZFA 1EIBA 5SWZB 4R7NA 4FTVA 1RI8A 4Y19B 1CCZA 2IG2L 2A77H 4XWGL 1S7RB 5D7KD 4FQIL 5CP7B 1BQSA 5CD5D 1T21A 5CZVL 3QDME 2V2XB 1A6ZB 2RCSL 2OS7A 2IMNA 4EI5A 1HKFA 4L4TA 4G80B 3MV11 3T0VA 5T33L 4U0RB 3S9DB 2C3XA 1Q72H 3V6ZB 1NEZG 4PJEF 5IBLD 4DKFL 3BRDA 3ARFA 4PRIB 1LEKB 3HAEG 4NC1E 5C0EB 1SEBA 4H0IA 5E6IA 1HWGB 1JZ3A 7FABH 4LSUL 4PJAE 3RVTD 5HHNB 5FGBA 5C08D 4R4NC 4ZTPH 1ETZA 3AU1A 5EUKA 2OK0H 4HLJA 3T2NL 5IVZA 5D8JL 3BI9X 3IFNL 3MGTA 1E6OL 5HD8D 1NFKA 3ULVF 1CFTB 4OQTL 1IAII 4DQOL 4JFPB 3DROB 5FYKH 4JFHE 2X4NB 4UBDD 2DDQL 3FONB 4YHOH 4RGOH 1FV1B 1EO8H 5AZEH 4L8DA 4G3YL 3KDMA 3NCMA 1NUGA 5DK3A 4TUOA 3P9LA 5CMAA 4KHTL 4R26H 4N1EA 3UPCA 1OW0A 2D3VA 4Q9RH 1I1AD 2ZUYA 1P7QB 3JWDL 5JDSA 4KTDH 1DANU 4ODVH 1X4XA 5J56B 4JRXB 3VA2C 5DRWA 2PNDA 1NC4B 4RX4A 1CR9L 3L6FA 1UGNA 2W9EH 4NQCA 4OD2A 4H1LH 2FH6A 1Q1JH 4JZJB 1IILE 5F71A 4PUBH 1XCTB 4G6ML 2HT4C 5C07B 5DFTA 3D5OF 3MRCB 3ILPA 2ITDB 3UTPE 2XTJE 1SY6H 1AQKH 3FQTA 4CVZA 3U9UB 3VFGH 1LDPH 4ETQB 3SY0A 3DI3B 3C60C 3NTCH 5E1AB 4XNQA 3RVVC 2IBBA 2YWYA 3QUXA 5TDPB 3GMLA 3BUYA 4GMTL 3L3GA 3UJJL 1ZLSH 1X5XA 2HFTA 2H2PD 1RK0B 4HPOH 4AL8L 3T1FA 3MUZ1 4WWKA 5EDXA 3TN0C 4FN0A 3L3HA 3CXDH 3OKKB 4LLAA 2R39A 3QDMD 3RWDB 5BS0E 1S7VB 2AJUH 3MJ7B 3VJ6A 2ZUXA 3N1PC 3RAJH 4HCRL 2RIKA 5DJ0B 1KXQE 1LO0L 3MXVL 2X4RA 3EJYC 4LSVL 5I8KL 3T1WA 1U95A 1BVKA 2ZG2A 2IQAA 1ITBB 1BD2E 1P5UA 4DKDC 2JJTC 1DBKL 4FQHA 2ZOLB 5B38B 1QSFE 2YPLB 1UG9A 3QIWA 1EGJH 4PJHE 4Y5VB 4S1QH 4PR5A 5F8RC 3MRGB 2H6PB 1PVHA 2Y7QB 5FYKE 5L9DL 1TQBC 1YNTA 2UWEE 1CFVH 4RNRA 1QP1A 3DTXA 5IF0A 2UUDH 3MV9B 1U3ZA 4TSBL 1S9XB 3NZHH 4RAHA 4EI6B 3DBXB 2N1KA 1AO7B 4LARH 1CDCA 3BP6A 1DUZA 3OXRA 2EYTB 5D1QC 4YJZL 3EYQC 1T0MB 1RIHH 2VTFA 5J6GB 2XY1A 4MAYC 1RZIB 4KTYA 3S4SA 5DFVD 1N5YL 1KACB 4POZC 3QH3B 5JPNB 3KYMA 1T1YA 5F7EL 1CK0L 2V5RA 3RDTD 3GSRA 4TRPL 2JCCE 4LLWB 5C6PB 3VXRB 2BFVH 4WUUE 4GRWB 3RVXD 2LVCA 1WT5C 5LGKA 4XC1L 3BEWA 1Y0LA 1ND0A 5FKAB 1MFDL 2P49B 5T1KA 35C8H 4NO5A 4NQVA 4WFGD 3SDXB 1HYSD 3DUUB 1MUJA 5HYQB 2B4CH 5B4MD 4NQSB 3QIBC 4NHCH 3TH2T 1I1YB 3PABA 4L3CA 1RFDL 5FGSA 4HIEB 3L7FA 3MREA 4UNUA 5BXFA 1D6EA 5KS9A 3LDBB 5FB8A 1OSPH 3S5LB 3VFSB 3UTTB 4L4TE 5F7LB 2JK5A 3ULSA 3EYVB 1BMGA 4WI8A 3OF6A 4H5SA 2IPTH 5I19H 1CFNB 4PJ8D 2MTPA 3I02B 2J4WH 2Q8AL 5M7QA 4PJDA 1A6UL 4K7PX 4LLQB 1P4IH 2FJFB 4XZUA 3VWJA 1IGFH 2GCYA 5ECJE 4YDKH 3V7AE 4TOYL 4HJJL 4LQFL 5GJSH 1BQLL 4YIQB 3OKEA 4ZFFB 3PWNA 4Y4KD 4YHLL 1G9NL 4TULH 4HKZA 2Y5TB 1U8HB 3PP3K 2F58H 4DKEH 4WI3A 3QNXA 2NW3A 3MRDB 5B38G 1HQ4A 3VFRA 2DQJL 4JPKH 4KY1L 3QI9A 1BD2D 1JVKA 5C0JB 1DBJL 3FQUA 5DT1L 3OMZA 3FB8B 4HKXB 4LRNL 4IOFD 5CHNB 1GRWA 1TLKA 4ZAKA 4A6YB 1B6UA 1I9JH 1NGYA 5I73C 3MMEA 4ODXB 2PYFA 4H26A 2X4UB 5FYKD 3DURA 3INUH 3WE6A 4Z7WE 2IPUG 4OD3H 4UILH 2CDEB 1NCWH 4F15B 2W0PA 3RIAF 3D0VA 5TH2B 4KKAC 1LEIA 4BZ2L 5E94B 3V5HA 1J0YA 4GLRH 4N9GB 2AXGB 3QCTL 3TM6A 3B8SA 3FO1B 4NFCA 5IMOA 4U1JA 3F8UB 3QA3B 3GSNL 3QHZL 1YJDH 4NSKB 4HWBH 4OGYH 4RAUA 2Z35B 4G6FB 1MCNA 3GGWB 3GB7A 4G6KL 3BIBX 4PJ9A 1PGRB 3MRBA 3FMGH 4JPVH 4YZFE 4U1NA 2IEPA 2WMPA 4PLJD 5F3BB 3BZFB 3JVGA 2OCFD 3GK8L 5GS0L 2DQEH 4NHUB 1G7HA 1AD9A 2APVA 4WUUD 1UM5L 4OFVA 3VE0B 5D6CB 1VADA 4HT1H 5EO9B 4ODUB 3MO1A 4PGEB 3LKNB 3PWJB 4FTVD 4OF0A 1E4XL 4XPGL 3BPCB 4MAUH 5GGTA 5C0BE 3S5LG 2CD0A 3DYMA 1KIQA 4L3EB 4R3SA 3O45A 4UNTA 2H32A 2HJKA 4EI5D 2CIIA 5KVGL 1ZSDB 2IF7A 4L4TD 5E00B 4X6BA 4DGVL 1I8KB 2CIKA 4PJBB 3ARFD 3BQUC 4K3DL 3STZB 3TT3H 3WO4C 1LEGA 2D0FA 1HOCA 1WBZB 2HJFA 3VFUA 1IT9H 3TIDA 4U6YA 1B2WH 5E6ID 5KBNC 3TCLB 4PJGB 4TUKH 1KV3A 3W5MA 4O2EA 4QXTA 4F58H 1XGPB 2AJXH 3D18B 5IB2A 4YHNB 3NPSC 4KTEL 2HVJA 5IJKA 5T1MA 1MJ8L 1S7UB 1X5ZA 3OXSA 1UCBH 5A16B 3S37L 4PRAA 5EBWA 2HKHH 4L8BA 4X83A 4P4KB 2DQFB 4JAMA 3RFZC 3ILQC 1MPAH 3KLHC 4QO1A 4ETYA 1MI5A 1AGEB 4PJCE 3BH8A 2ATPB 2FYYA 4PV8A 5LQBL 3JUZA 5HGHA 4KXZH 3WFHA 4OCSH 4MB3A 3LD8B 4Z5RB 4LFHD 1B9ZA 5E5RB 4NQEA 3T77A 3TV3H 1HN1A 4YXLH 1DL7L 1XGUB 3OB0H 2EDBA 5IHZB 3MTRA 3SGKC 1TTUA 4XPTH 1N7ML 1RUKH 3DUSB 4NN7C 5BQ7A 4PY7A 3B9AA 2ZSWB 1ZTXL 4RX4D 1FQ9C 4NQCD 4HS6B 4QRQA 2C5DC 4G7YH 2BVYA 4FXKB 4YBHA 3RVUD 3RWCB 2V17H 4LMQI 5GHWL 5I6XC 4BK5A 5E24E 3KPRB 2C4FT 3BD4A 3DNKA 4ODWA 2X09A 3V6FB 5CZKA 1M7IA 3ZYOA 4XWOD 3O6FB 4QNPE 4I3RL 4NM8H 5D7LB 3WKML 1JPFA 5EUOB 4FXGB 4OB5L 1ZLWH 4WNQA 1AJ7H 2YK1L 3PGDA 4X5WB 3IF1A 3B3IB 5K9QG 1IQWH 3PL6B 1NL0L 1KCKA 5GGTH 2J5LC 3M1BB 3QUXD 3LPGA 1WK0A 3MLZL 4PLOB 3K2UH 4GBXC 4WW2B 2P46B 1XGRA 3OBAA 1DEEA 1D9KC 4JDZB 2QL1A 4YGVA 5GRWA 1RHHB 1PLGH 4M5YH 1D7FA 1EO7A 2I07A 2LQRA 5EU4A 1DBBL 1L7TL 2GJ6A 5IFJB 4X6DB 4WWKD 3ZE2E 4MD5A 4MQ7B 4UB0H 4AENB 3JZ7A 4C83A 2NY1B 3CJJA 1D5BA 3EGSA 3U7WL 4ORGA 1OAZH 1A7BA 4MWFB 4I2XB 4I0PA 4K71C 2D0GA 1KIPA 5HHOA 1QQDB 5ANME 1F4XL 1RMFH 2BVQA 1MCKA 3IJYB 2EDLA 4JB9H 1T6WA 2B7DT 1SJVA 3FHAA 1T5XB 4G7VH 5JHLL 3HLAA 3NIFF 4B41A 1V7NL 3MYJA 5FOBA 3FFCB 2NCMA 1FIEA 4QT5B 1MH5B 1YN7A 1QPPA 4C56E 3DUHA 3ZSTA 1CXIA 3BYTA 2A9NL 1OPGH 3CZJA 1SM3H 5HJ3A 3CFDB 5DC0A 4YDJB 3MFGB 4M00A 1RIVH 2ZSVB 3AS1A 1KB5B 4JJ5A 4GAJH 4IIQB 1BGXL 2YBRB 3NCBB 1G6RL 2BY0A 4LPTA 3QXVA 5CS7A 5GRUH 1UVQA 4U1MA 4W6XB 4NQDA 1KGCE 1IEBA 4OCXH 4PGZA 1PZ5B 4Y5XC 2Z8WC 1UJ3B 3REWB 1G1CA 3QEGH 4CKVX 1FRGL 4TPRH 4XCNA 3GMRB 1KLGA 3EDKA 4HV8B 2F5BH 2HRPL 4UDUB 1H0DA 4GSDH 1AHWB 1GXEA 4HUVA 1IQDA 2BDNH 1M7XA 3AREB 4JFEB 5I1LA 4HJGA 4KROD 2VKXA 4R4ND 5T1KD 4KZDH 1TFHA 2UY6A 3LVEA 5E8DL 3U6RA 1HH9B 1SJHA 3EO1B 3BGFC 3BGMB 2X9YA 1HDMA 5GGRA 2OI9B 4G9FA 1W2KT 3KJ6L 3LMJH 3OF6D 4X99A 2C1OB 2OR9H 1KTLA 4LLYA 4QHNA 3QJHA 4X8JB 1UQSB 5CLWA 3P4MB 5C0AA 4XBPB 1RJYB 3VG9B 1UH2A 1E6JL 4XCFL 4NQTA 4Z7UF 5KSUB 1RZKC 2CRYA 5IB4B 4PP1D 5DVNA 4UUJA 3C6LA 1MQKL 2M1KA 3G6JB 5FKPB 2NXZD 1Z5LA 2Y07H 1J1XL 4X4MA 3W39B 5IP4A 4M8VA 1F42A 2AJ3B 2XICA 5C0DA 5A2FA 2NLJA 3KVQA 1GGBL 4PGJA 5JW4N 2HT4D 2VXQH 3PV7A 2F8XC 4XT1C 5DMKB 4YHIA 5CWSB 4YHYB 2ICEA 1LDSA 1A6AB 3QI9D 1LILA 3HNSH 1T1ZA 5K59E 4NQEE 4ZAKD 5IHUH 4PJEE 3V5KA 12E8L 5JZ7D 5L2JA 3ZHDA 4HHAB 1BQHA 3MROA 1UXSB 2APWA 5E2TH 1KIRB 5JDJA 4AEEA 3HUJB 5IFAH 1OLZA 4PTUA 3RP1A 3THMH 1LGVA 1OLLA 1FDLH 4FQCH 4HPYL 2X4TB 1J11A 1KJ3H 1CL7H 4AIZA 2CLRB 1KGCD 1MAKA 1W0VB 4PJ9D 3RA7H 3KLDA 3QAZC 2F19H 3FO0H 5E99H 3DX8B 4OLXH 5C0IA 2BNRB 3U1SL 1HIML 2NX5A 3MRNA 5FYJU 1CGVA 2FRGP 5DEGA 1M71A 1R0AL 4PRPA 1ZWIB 2GITB 5J13B 3DETC 2VWEC 3DVFA 5TDOB 2VDML 2EKSA 5L6YH 1YPZA 5IW3A 4R97B 5ID0B 5J1TC 5HY9B 3R1GL 5IBTH 1NEZA 3L5WA 1YDPA 1XR8A 4EEEA 4HAGA 3HAEA 4UU9B 3REVA 1U8PA 4NDMB 4Z0BL 3PWLB 3D87B 2W0KA 4O02H 4ZO8A 5D72L 5D1XC 3OKDA 2FLRT 3T4AA 3OJMB 4L29B 3QDJB 1YMMA 4UTBL 2LAAA 1R6VA 2Z8RA 1NJ9B 4JQIH 4M7JL 3HG1B 3IU4H 2CDFA 4QOKA 1DVFA 5T1DH 3BAEH 1AXSB 3B9KB 3DVIA 5KVEL 2DOCA 1KJVB 3Q5TA 1OTSC 3QCUH 4POZD 4NM4H 1KG0A 1VPOL 4M03A 3U0TA 4HZAA 4RA3A 1P84K 5D7JC 1CXEA 3WXVL 1GC1L 4XC3H 4ZSOE 4DGIH 1C12B 3S35L 1JV5B 3VGGA 3L95A 1D6VL 1F8TL 1GAFL 1N26A 3BPOC 1MI5D 4ONGL 4Q0XH 2OP4L 5I2IB 1WZ1H 5GSRB 1IAIL 1E28B 3TGXA 2QR0A 3AY4A 1EHLL 4MSWA 4DUVA 3D85B 2IBGA 4NQED 4R4FH 3SQOL 1AGCA 3IFOA 4U31A 1EBAA 3LKQB 3OGOE 2BSRB 1CG9B 5H35A 2B0SL 4DVRL 3M17A 4I5BA 4YHMH 4FRWA 3T0EC 1BREA 3QEQE 1FCGA 3OX8B 4ZNEA 2FSEA 3RX7A 4TVPL 3MJGX 5DHXB 4MX7A 4AMKH 4CMMB 5SWZA 5JW4M 2ESVE 1EFXA 2C7UB 4Y19A 5IWLA 4F57L 2FEDC 3GMOB 3V6OC 1JL8A 5EU6B 4CMHB 2EZ0C 4OZGB 1G7IB 2A38A 3QIUC 2V2XA 3EDFA 4KK8C 1A6ZA 3SGEH 1I1FB 1YEGL 2EC8A 3PWPB 3DXAB 1UB5A 2Z91B 1HQRB 4G80A 3NA9H 1GSMA 5TE7L 4OM1H 2PKDA 1KBGL 1CGTA 1OVZA 5FOJA 1NQBA 2CLZA 1CFQA 2UVEA 1LEKA 4S1SH 5CIPH 5C0EA 2GJ6D 4OCYL 4QLRA 3FAXA 4LOUD 2E27L 4HGWB 3WJJC 3ZDXE 2WAHA 1FE8H 2ZPKL 5CP3H 3BE1H 4I0PD 1VENA 3DSFH 5HHOD 1MFNA 1FGVH 2EXYC 4XCYB 3EFDL 4LEOB 4Y4FB 5I9QC 1CFTA 4JFPA 2YA2A 3DROA 4P46C 1QBLH 1HHHB 1BM3L 2X4NA 4GRLB 3FQXB 5HI4D 4XI5C 1IGCH 3UAJC 3WN5C 1KJMB 1QNZH 4X80L 5D96B 3TO2B 4MNQB 5EH1A 5IJVB 3RX8A 1A9EA 3GJFB 1P7QA 2O61B 5DMJB 3GFUA 1F6FB 5JOFB 5EU7C 3S36X 1T89C 4Z7QE 1JPSL 4FFYH 4JRXA 1I8LC 1EJOL 2EH7H 4M1CC 2VL4A 25C8H 4WCYH 1FIGH 3B6SB 4PS4H 3SGDI 1N5AB 3KJ4B 4JZJA 1SHMA 1BECA 1UWXH 3F58L 4JO3H 4PTTB 5LGJA 4E41A 4NKQB 2PXYC 5LBSH 1RZFL 5FV1L 1XCTA 4YUEL 4FABL 2Q8BL 4NQDD 2Q76B 5C07A 1W72B 2IAMB 3MRCA 2ITDA 2D7TL 1GGUA 4P49A 3FQRB 3U9UA 3MRQB 1A6VL 4ETQA 1X7QB 4OCRH 4Z95L 5GGSB 1RZKH 3QPXH 4I18C 3MLYL 5E1AA 4NIKB 1GHFL 2MCPL 1IBGL 4KQ3L 3ARXA 5TDPA 4X4YB 1F02I 1I3VA 4OGXL 1YPZE 1YEJH 5IROC 3SJVE 1O0VA 2ESVD 4JHAL 2J8UF 5KS9F 3O2VH 4RISH 3FO2B 5IBUB 1K85A 4GW5B 2EEDA 1LE9B 2KBGA 3RX5A 1ZHLB 2ORBL 3OKKA 4XHJC 1B0RB 4ODHL 5D5MB 1WBYA 4UQ3B 3S88H 4RDQF 1MEXL 3RWDA 1S7VA 3MJ7A 4NGHL 1CDGA 4G9FD 1VFMA 4O5LL 1S7SB 2OTUB 5DJ0A 1FYTB 3OB8A 4MA1C 1MCIA 2AW2A 2YPVL 5KZCD 3V4PL 3X3FH 1OSZB 4KZEH 3TZVC 2EIDA 5B38A 2DQUH 2YPLA 4Y5VA 1C1EH 4X6EB 2X4OB 3MRGA 5JORB 2H6PA 4M5ZL 4H8WL 2Y7QA 1D5IL 1R3LB 4OLUL 4HIXL 2MQ0A 4K8RL 3O9WC 1PYWB 2P5EE 3VXOB 5KSAB 4I9WD 4Q9CA 1IFHL 2FR4B 1JHKH 1H8SA 1NMCB 4EI6A 4IMKA 3DBXA 4I0CC 4JPIB 4CU7A 5IKCB 2NY5L 2EDTA 4XAKD 5E2WL 1N59B 1R5VB 3SDYH 2VDNL 5KW9H 5C7XL 2Y06H 1IARB 2EYTA 4LHQB 4LVHC 1T0MA 4Q6IC 3C5SB 3A6BH 2DBLH 4LSPL 1RZIA 4UNVA 1KPVB 1JGDB 1JGLL 2ZCHH 3QH3A 3QEHB 5JPNA 4OI8A 2H2SD 4M7ZC 4LLWA 3DX7B 3VXRA 4PLKC 4ZNEE 4U7KA 5ICZA 3RUGF 2FL5B 3Q5OA 5ITBL 4XH2B 5FKAA 4GG8B 3IDNB 3RZCC 2MQCA 1FLRH 1NFDB 5FYKU 3SDXA 1YECH 1JPTL 3DUUA 1N64L 3O8XB 5HHQB 5HYQA 1WEJL 2ARWA 3VFMB 2NX5D 4TSCH 5KTEL 4ZOBA 2E8YA 4HIEA 3T2OA 2AJYH 4LASL 2VB5A 3PE9A 4ZNCD 1ZE3C 2XQBL 5I1CH 4PRPD 5I30H 3S5LA 5KSBB 2A6IB 3VFSA 3ZDYE 4YC2B 3UTTA 2CUHA 3EYVA 2C3WA 2ADFH 2V6HA 1QFUL 5F9JB 5IBUG 1NDGB 1CFNA 3C09C 2BOCB 3ELAT 1OAKL 3WHE0 4AG4L 4B7IA 3NIDF 1NBZA 3C2SA 3I02A 3BPLC 4YHZL 4UAOB 2V2TB 4YFEA 1BAFH 1P4BL 4J7RA 3RIAK 2VYRE 4LLQA 3K2MC 4YPGB 2FJFA 4MQTB 5DEFB 3SE8L 5FYLL 1EBPA 4U6TA 1F6AB 1RIUL 5F1SA 4OFIA 4YIQA 5IFHH 1KIUA 3MLXL 4ZFFA 3MJ8B 4PRHB 2DYPB 3QFDA 4Y4HB 3PJSB 1OTTC 2Y5TA 1U8HA 1YMMD 1AH1A 4NBZB 1NGPH 1X44A 2OLDA 1R3HA 3HI5H 3MRDA 1B0WA 1BFOB 1JHLL 1R3IL 5SX5K 1ADQH 1X6LA 4M7KH 1AC6A 5C0JA 4QOKD 4F3FB 1DVFD 1ZLUK 4XMLL 3FB8A 4HKXA 4KJQC 5CHNA 4AJ0A 4A6YA 4I18A 4ODXA 2FX8L 5TE6L 5B3JF 2YD2A 2X4UA 3I9GL 5JA9A 4UMGA 1WFNA 2CDEA 1YEFH 3MX0A 5TH2A 2VWEE 2WIIA 3JUYA 3JWDC 5E94A 5F96L 4KUCF 4N9GA 5L2KB 1ED3B 3MJ9L 1U8IB 4KHXL 4UI2A 3SDCB 1T7ZA 4EIZC 3QA3A 2FD6H 3RWFB 4NSKA 4XMPH 1IGYB 3TCXA 1A4JB 3LKOB 5MENB 4E41E 2Z35A 2DMBA 2I26N 3GGWA 1LWRA 3MOBH 2NY3C 5BV7B 1QVOB 1BF8A 3JWOL 1XF5B 1I7ZB 3NIFE 1MHHB 3UJIH 3BZFA 3QQ4B 1L7IH 4Y2DB 3TWCL 5CJQH 3SO3C 4GQ9L 5IOPB 1TVBB 4MJ2A 2V7HB 3Q6FA 1WJ3A 1TJHL 4X9IA 3MLTB 4DUWA 4L8SC 1QBBA 3TZVA 5D6CA 5EO9A 5F7YC 1A7RL 1N6UA 4ODUA 5DDHA 5LCVH 4Z9KB 1F4HA 2EC9T 3LKNA 1Q0YH 2AJSL 3PWJA 5LGHL 3UMTA 5SWZD 1EVUA 2R29L 1EFXD 4Y19D 1OAXH 5C0CB 3H3PL 3BPCA 3NCYS 1D5ZA 5DZOA 1T7XA 4HMEA 1MF2L 3GNMH 2AXHA 3EYFB 3TYGH 1F5WA 4L3EA 5T3ZH 4PJIB 1OM3L 1Z3GH 3RPKA 3MGOB 2HA1A 4YPJA 4ONOA 2F54B 2HRLA 3MR9B 1ZSDA 5E00A 3M8OL 1I8KA 4V1DE 5CJOL 1J8KA 3CFJB 2NR6C 4PJBA 2EDYA 3STZA 4TNVK 5J1AA 4FQ1H 1WBZA 5SWSB 3UDWA 3CXHK 2H9GA 3TCLA 4P59L 4PJGA 5C92A 4U1SB 4ENED 1XGPA 3D18A 4RRPG 2OL3H 4YHNA 3BKCH 3RY4A 3DECA 3T0EE 1S7UA 5E2VL 1I7RB 1JK8B 4FQXC 4NKDB 1TNNA 2FX7L 4P4KA 2DQFA 1J88A 4HX1B 4XP5L 2OZ4L 4RIRB 5CEXB 5JMOC 2G2RB 1Q0XH 3RZCA 3BKJL 1AGEA 4OIBA 2DRUA 2ATPA 1XF4B 4E9LA 3WUWG 1I75A 4LU5L 4DFHA 3V6OE 3P9MB 1MIEL 2EXWD 4NN6B 5CBAB 4LVOC 3O3BB 1C5CL 4RGNB 4ELMA 3I75B 5EZJB 5F1IB 3Q1SH 1JWSB 1FO0B 4AIXA 1Q94B 4PB0L 4X6CB 1P7QD 3QHTC 5ADOL 1XGUA 1OGTB 4N5ED 4EOWH 4G9DB 4LCCC 1KTDB 3DUSA 3RJQB 4FQLH 3V8CA 1MHPH 4WEMB 5F1NB 2JELH 1UZ6F 2ZSWA 1TZHB 5D1ZC 5IK3B 3ARPA 1CT8B 2X4PB 2VMFA 1BBJA 3KLAB 4ZS6D 5E2JA 4HS6A 5IB3B 1JZ8A 1CLZH 4FXKA 3RWCA 4KVCH 2I27N 4E41D 3CLFH 3Q2CA 3KPRA 1PFCA 3V6FA 1A7QH 2FZ3B 3U0WH 3O6FA 2LV4A 4LSSL 1VHPA 5D7LA 5FGRA 4L9LB 1I4FB 5EUOA 4FXGA 5GJTH 1CU4L 2C1PB 3RWGB 1ZOXA 1FSKB 4P2CG 1UACH 3PL6A 4YWGL 2Q87A 3M1BA 1MWAH 5INCB 3HFMH 1UENA 1YC8A 3B5GA 1NANH 4WW2A 4JDZA 2R2EB 1RHHA 4GKSB 4HGKC 4M1GL 5T3ZE 1CD9B 4LCWE 5IFJA 4X6DA 3C2AH 5DHYB 4MQ7A 3KLSA 1T5WB 1N6VA 4AENA 3K4ZA 3MGAA 5IQ7L 3QRFM 3TA3B 4MWFA 4BSVB 4I2XA 3VRLF 1T2QL 2QADC 1QQDA 1EEYB 1MCFA 4FQJH 1ZVYA 3IJYA 1RSFA 3TJHC 3F12A 1G9NC 1KYOK 1RUMH 2WNGA 1T5XA 5M94B 4FNLL 4FFWC 1FJ1B 3FFCA 4U2YA 2PYEE 5E4EC 2XG5A 2HH0H 3F7YB 4QT5A 3CNKA 3S34L 1MVUA 5GGVY 3WIHA 2YPLD 4N0FB 1UWEL 4KPHH 4P4RB 2XYCA 5FHAL 1CXFA 3T0ED 4FA8A 5JW5B 3QXWA 2HTLC 4X7DC 2EDRA 4L8SA 3CFDA 4YDJA 2XKUA 3V52L 2IG2H 2ZSVA 4NWUL 5JIHA 4XWGH 1KB5A 2FECI 5DLML 3V4VL 1KPUA 2UY7A 3GKWL 4IIQA 4ZFOL 5CZVH 5F9DC 4P9HH 2RCSH 2MOVA 5T33H 1NCAL 2DLGA 1AY1L 3LPFA 5IM7B 4DKFH 1PZ5A 2B5IC 1OB1B 1UJ3A 4R2GC 3MRMB 3REWA 5JW3L 4CL7A 5D7IB 2MNUA 2XQYG 3L5IA 3GMRA 5CZXD 4LSUH 4OCMC 1KJ2A 4HKJB 4GG6B 5D93B 4UDUA 4OT1L 3ARGC 5GS0C 3VXRD 1AHWA 2EO1A 3T2NH 4S10A 3AREA 2YXMA 1J8HE 4JFEA 3DMMB 3H42L 1P53A 3WO3B 2W1NA 3RGVB 3IFNH 1E6OH 4RBPK 5C9KA 1AGFA 4OQTH 5I8CB 4DQOH 3IU3B 2R69L 1V3KA 2DDQH 1MCEA 4HW6A 5E0QA 1HH9A 3EO1A 3QXUA 4OFPA 2VSCA 3BGMA 4W6WB 4HDIA 4P46D 4KHTH 3UTTD 2J8HA 3MACL 4KKBD 5ICXB 1OHQA 2VDPH 2R56L 3VMOA 2C1OA 2ED8A 2VJXA 3JWDH 2HN7B 1D3CA 2YC1B 3PNWB 4X8JA 5AEAA 3P4MA 4XBPA 4Z76B 1KCVL 1CR9H 2EECA 5DK2A 2YOCA 5EORL 1J1OL 2WQ8A 2ARJB 1F13A 5KSUA 1AGBB 4JG0L 3NIGF 4G6MH 3G6JA 2Z31C 5FKPA 2EIBA 5EIQA 1B4RA 3GI8L 3W39A 5C3TA 4PBWD 2AJ3A 3JV6A 3KPSB 1U8LB 4JFDE 5E8PB 3MLRL 5EO1B 2YMXL 4CJ0A 3WSQH 5L8LB 5DMKA 5CWSA 1A6AA 3D0LA 5AUMB 5JIPA 1KB5H 5I1JL 1S9VB 2DN7A 3U7AA 5DD0L 4GMTH 4ELME 2DD8H 3QPQD 3UJJH 5BRZB 3FQNB 3N9GL 1N8ZB 4JZOB 3HNTL 4AL8H 4DOHE 1Y6KR 4HHAA 5LXGL 1UXSA 1T1WB 1KIRA 4ZQKB 3MCKB 4FFZL 3HUJA 1LO3H 3P3YA 1G7PB 2F53E 4J3UA 1U3JA 4QHUB 4ESKA 1LP9A 5FO8B 4QRSB 2X4TA 4HCRH 5CEYB 1VFBB 4HBQA 2YD8A 4XHQA 1LO0H 1KJ2H 3MXVH 4LSVH 4JE4B 2CLRA 4RMVA 1W0VA 4DFIA 5F89B 5I8KH 2DMKA 4IRJB 5BZWA 3RY6A 3W82A 3DX8A 2BNRA 1AR2A 4EN3B 1DBKH 3RZWA 4ZFGL 4JO1L 2EDNA 2GITA 3TZVD 2A74B 4GKZB 5DD1L 4CVXB 3KS0H 2WBWB 3QDGB 2A83B 4NP4L 5ID0A 5HY9A 4LBEB 4TSBH 3MUJA 5DQDL 4UT7L 4KRPB 3O2DA 5DO2C 5HGBB 4UU9A 4FFVC 1NGZB 2Z93B 1OGAB 4NDMA 4L3ED 3S3JA 4NFDA 5B8CC 3QR2A 4I2XE 4AT6A 3OZ9L 4L29A 1WFTA 2IH3B 1KCSL 2NZIA 3QDJA 4J4PC 2O5XL 3P9WB 1B3JA 5ESAB 4KRLB 2IGFL 1P7KB 1N5YH 3VDBA 5EPMB 3WDIA 4F8TA 3HG1A 3FFCE 5F7EH 1CK0H 2NW2B 5JIKA 4TRPH 4XGZB 1AXSA 3B9KA 4U1GC 3OJVC 1KJVA 2PN5A 4XC1H 1A4KB 3QUZB 1ZS8B 1MNUH 1MFDH 1CZ8L 4OQ1A 2J8UE 2Q1EA 3ZTJH 2RBLA 3GUTB 4UV4L 5C0FA 4P4KD 1C12A 1JV5A 2C3VB 3UC0L 5I8OL 5EZIH 4JFDD 5FGCE 1RFDH 3O4OB 3EHBC 4WI5A 3RZCD 1PKOA 5HI5C 5I2IA 4QWWC 3VI3E 5DRXB 5JOPE 3HTLX 1OP3H 1E28A 4AZ8A 5JHDB 2F5AL 2CSPA 4KI5C 1I8IB 3FJTA 1NBYB 3D85A 3QZWB 1J1PL 1ZEAL 3CX5J 1KFAL 1MCPL 4TNWF 5EN2B 3LKQA 2BSRA 4NO3B 2HT2C 1A6UH 1CG9A 1Z2KA 4PGBB 1UT9A 1WZKA 5DJ6B 5A2KH 1FNFA 4TOYH 3MODL 1BQLH 4WI9A 3OX8A 1G0YR 3CPLB 3KPMB 4YHLH 1G9NH 1TPXC 2DL2A 3UX9B 3I6GB 2BJML 4CMMA 4OJFL 2HFGL 5ITFB 2C7UA 4KKCD 5IVXB 3GMOA 2E7BA 5INDB 5D7LD 1OWRM 2DQJH 3QUML 4YR6B 5F7FA 1DBJH 4X7FC 1Q9OB 5DT1H 2EH8L 3NVQA 5EU6A 4OZGA 1G7IA 4LRNH 1A7NL 4OLYL 2X40A 3GSQA 4RWHA 3GMPA 2XY2A 1I1FA 3OR7B 3EJJX 1IGJB 3O2DH 3PWPA 3DXAA 1F3RB 1HQRA 4HWNA 3PL6D 3BVNB 1N4XL 2VZOA 4P5TB 2JKXA 1NPUA 4U0QB 4KJQD 2LTQC 3U7YL 1FPTL 2R0WH 2PO6B 5FHBL 1PJ9A 3JWNC 5GSVB 2BK8A 2I9LB 2Q20A 1J0ZA 4KAQL 3SE9L 3UCRA 4BZ2H 1A1NB 3QCTH 2J6EL 4HGWA 2CDGA 2NY1D 5HVHB 3BDYL 3QHZH 1CVSC 3RUGE 1WUNT 1C5BH 1NGQH 2APBA 5CEZD 3G6JE 3P4NA 3MZTA 3OSKA 4G6KH 1A0QL 4XCYA 4LSTL 4YBQD 1L0YA 4AIOA 1DJSA 4LEOA 3AS0A 4HZLB 4Y4FA 3FN0L 5ESVB 4WRLA 4JFFE 3GK8H 2NY3D 1HHHA 4GRLA 3FFCD 3FQXA 1KJMA 2E9WA 4PFEA 4KQ4L 2QQKL 3F6IA 4MNQA 5HHXL 3KPQB 1J0JA 5IJVA 3W11D 4IMLB 4F7PB 3NIDE 3GJFA 2O61A 1XAUA 2YSSB 1Y18B 5JOFA 1I1AB 1E4XH 4XPGH 3KR3H 4OGAD 3C5ZB 3VMNA 4K2UL 2UYLB 4U4BA 2OSLB 1J0KA 2CPCA 1IKNA 3PQYE 3QZWG 3B6SA 1LP9E 1N5AA 5D70L 3PDOB 4PTTA 5KVGH 1V7MH 5I0DA 4DGVH 1RUPL 2AQ1A 4OZFB 4JEGB 2Q76A 1W72A 2IAMA 4ZPVB 1LMKA 4KV5F 4K3DH 3CAFA 2BNRE 3MRQA 2AK4B 4GRWF 3JTSB 1X7QA 2PTUA 5MP6H 3AXLB 4NUGL 5GGSA 3RY5A 1BHGA 5F6IC 1HHGB 2XFXB 4WEBL 3LZFL 4R4BB 4KTEH 3CLEL 1NAMB 4X4YA 1MJ8H 4U7MA 4WHTA 3S37H 3WIFB 4NCC2 1RZJL 1IAOB 4JFED 1KXTB 1IAKB 5C0RL 4MXVF 1DN2A 1EDQA 4H20L 3FO2A 1WISA 4GW5A 4GH7B 1LE9A 5EBLB 5LQBH 1UXWB 1ZHLA 4FQXD 5H37G 1B0RA 4HBCL 4QTIL 3TJEL 5D5MA 2WK2A 1A3QA 3QDMB 4L4VE 1S7SA 2OTUA 1EEQA 1FYTA 1DL7H 1JFQL 3MNZB 5D4QA 1N7MH 3RPIB 3AC0A 3WNPA 1OSZA 5MEOB 3HG1E 2GJJA 1ZTXH 1NCTA 4X6EA 4ZXBC 3EOAB 2X4OA 4PJAB 5GHWH 5JORA 3LOWA 1BVZA 1Q9WB 3BPNB 2UVFA 3ZTNL 3U4BL 5ISZB 4IM8A 4I3RH 2E9IA 1PSKL 4WTXA 2D9QB 1PYWA 1GC1C 3L3DB 4OB5H 3VXOA 5KSAA 4RWYL 2YK1H 5IKCA 4JPIA 4MVBD 1N59A 5F9WB 1NL0H 2FDBP 1QRNE 3MLZH 5I1AB 5F7DB 5GGVL 3VFOB 3LS4L 4MCZB 3C5SA 4EUPH 3QULB 1L7TH 3QBTB 4JKPH 1ZGLB 1KPV