3MNDA

Crystallographic analysis of the cystosolic cu/zn superoxide dismutase from taenia solium
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
152
structure length
152
Chain Sequence
MKAVCVMRGEEGVKGVVHFTQAGDAVKVHAEFEGLKPGKHGFHVHEFGDTTQGCTSAGAHFNPHGKNHGAPDAAERHVGDLGNVTAGADGKATLDLTDKMISLTGEHSVIGRSLVIHVDPDDLGLGGHELSLITGNAGGRVACGIIGIAKSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Crystal structure of Cu / Zn superoxide dismutase from Taenia solium reveals metal-mediated self-assembly
pubmed doi rcsb
source organism Taenia solium
total genus 41
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3mndA00
1PU0A 3F7LA 1PTZA 3H2QA 3LTVA 4A7GA 3KM2A 3HFFA 1Z9PA 1XTMA 2WYTA 1QUPA 2XJKA 1E9OA 2R27A 3GZOA 1SXZA 3KBEA 3SODB 2VR6A 1B4LA 3KH4A 2WZ6A 2C9VA 2AQPA 1YAZA 1UXMA 2ZKXA 2Z7ZA 2JLPA 1E9QB 2AQNA 1IBHA 1IB5A 3RE0A 3MKGA 1SXNA 2AQQA 4OH2A 1SDYA 5KBKA 2GBUA 2WKOF 2VR7A 4BCZA 1U3NA 1N18A 2Q2LA 2WZ0A 1HL4A 4A7TA 1SXBA 2SODB 3ECWA 2AQTA 2Z7YA 2ZKYA 5KBLA 2Z7UA 3CQQA 2AQRA 2WYZA 1L3NA 3CQPA 2LU5A 4B3EA 4A7VA 3T5WA 4A7QA 1TO5A 1CB4A 2GBTA 3HOGA 1SOSA 4A7UA 1F18A 2JCWA 2AQSA 3F7KA 5KBMA 2AEOA 4N3TA 3ECVA 1E9PB 2WWOA 2E46A 1SXCA 1OZUA 3QQDA 1YSOA 2C9UA 1JCVA 2E47A 2ZOWA 4N3UA 2C9SA 4A7SA 3K91A 3GTTA 1FUNA 1JK9B 1P1VA 1SRDA 2WKOA 3L9EA 2ZKWA 3KM1A 2AF2A 2V0AA 1MFMA 1OALA 4FF9A 2WWNA 1E9QA 1RK7A 5CU9A 3L9YA 2APSA 1ESOA 3GZQA 4BCYA 4OJAA 1KMGA 4L05A 3GTVA 4A7GF 2K4WA 1F1DA 1EQWA 1YAIA 1BZOA 1SPDA 1XTLA 1OAJA 1S4IA 3KH3A 2Z7WA 3KBFA 1EJ8A 1B4TA 1BA9A 1PZSA 2GBVA 2NNXA 3H2PA 3HW7A 1Z9NA 4MCNA 4BD4A 2XJLA 2VR8A 2WZ5A 1Q0EA 1AZVA 4U4IA 1SXAA 1N19A 1DO5A 3PU7A 1CBJA 1IBDA 1DSWA 1E9OB 3CE1A 3GZPA 1E9PA 3ECUA 1IBFA 1COBA 1HL5A 1XSOA 1IBBA 1F1AA 1SXSA 1UXLA 4MCMA 1F1GA 1SDAB 3GQFA 3S0PA 3QQDB 1OZTG 1TO4A 1OEZW 3MNDA 1JK9A
chains in the Genus database with same CATH superfamily
3SY0B 2O5NA 3QW9A 4MCYA 4MZIA 2XDHA 1K85A 2XC8A 2K9UA 3QGVA 3ATDA 4LPXA 4X80L 4X5RA 2Z93A 3ROLA 3NUKA 3WMPA 1R3JB 5FDWB 4G7SB 3LPWA 2KH2B 4FNRA 5IW6B 4ZAKD 5C8JB 3SZKC 3KDMA 1A1OA 4WFFD 1ZVSB 2BNUA 2PXYA 4LSRL 2PPEA 1R5IA 4BDVA 1LQBC 2X3AA 4QRSB 5IJKC 1KBBA 5AENA 5I15L 2V2XA 5AFAA 1KLUB 3HG5A 3N41F 1NGQL 3BPCA 3ECWA 4X4YB 4O4YL 4WHTA 1HU8A 1ZA3B 1RSYA 2A38A 1VRSA 3CVCA 4L3EA 3ETTA 4BBWA 4MSWB 3PNWA 4D0DB 3M88A 1KCKA 4N0RA 2NY0B 1KENL 2BS71 32C2B 4G9DB 1NIDA 3VXUD 3IF1B 4WSKA 3UPRA 2OR8A 1E27B 3KLDA 2E47A 4ZUWA 4ODTL 2Y0SA 3MUJA 2V7HB 1A4JA 5FLUA 1NIBA 1H3TA 3Q2WA 1G6RH 3MNMA 1SRDA 5HJ3B 3CN3A 1DQJB 4LZKA 4JM0A 5I2IA 3VU2A 1CR9L 4GKZB 5I5MA 4B9PA 3WEXB 2XQ0A 1FF5A 1PZCA 4UTAA 3X11B 1T66C 3EFDL 3PWUB 3WY4A 4XBEH 1F86A 1AG6A 1CGSH 3QP3A 1YMMA 2YKLL 4AKPA 2HRLA 2YGOA 1U9KA 25C8L 3QQ9D 1II4E 3T9WA 1X9UA 3DURB 3PHAA 3O41A 1CFSA 4JO3L 5IHWA 4XP6L 3V10A 1QYGH 1KDIA 1GS7A 2GEEA 4AX3A 4S0TD 5E24E 3WTUA 3EJCA 1MG3C 2UUDK 3I3DA 2BHUA 2ZNXA 4FFYA 1L9QA 2D03H 1A6AB 1QVOA 1FL6A 2HMID 4PP1D 5BJTB 3HKFA 3K0WA 2R23A 1S7TB 2F1BA 1NLDL 1PNDA 3OHMB 1UB5A 4FQ2H 4MB3A 4JFFA 3HR5A 4N2HA 5T3XH 2GUOB 3WMSA 1Q8MA 3CC1A 3E3QE 3LKSA 1OZTG 4OAWB 1ZY9A 3L3OC 3WS3B 1MCHA 3MN8A 3PP3H 5F7LB 3V0VA 3WHE1 3VD3A 4F9PA 5I6OA 4I88A 1G7PB 4Z7WA 3RY4A 1QUPA 3MJ9A 2IBGA 1J5HA 1MZYA 1PGRB 2XG5B 3HAEA 3H3KA 3OZ9L 3GSNH 2JIXA 4BUHA 4R6UA 1HH9B 1IB5A 2CA4A 4JPIB 3UEZA 3N1MC 2DJMA 5B22A 1U36A 3BH9B 3CCHB 2YGQA 1PZBA 2BS8A 5BRZA 2ED9A 3LZRA 3QS2A 4JPQA 4J8QA 3SGDH 1FFOA 5G55A 3HUJA 1NM4A 2NNAB 3DOSA 4XPTL 1TQBC 5L0QB 3T0BA 3EFFA 5F96H 1KCRH 1MVUB 2Y22A 2PCFA 3DTUB 4BA8A 2IXQA 1JZHA 4LAQH 4GUPA 2BP5M 1RZJH 1ZXKA 4Y2OA 5EIIG 5HHOB 2ZX6A 3CFKA 2Z8VC 1TR7A 3OSVA 2ENQA 3ARSA 2P44B 2DYRB 5C6PB 1FE8H 4WUUB 3BP6A 3PWLA 1EJOL 1XGQB 5ESVB 3BAYA 1F13A 2Q7NA 4UT6L 3V52H 5KVEE 3MLXL 4JFPA 4MB1A 3PF2A 4FFZL 4X8GA 1S8DA 1O6SA 4DPAX 4KX9A 2FIRT 4W4NA 3H9YA 4ONOA 4ALAC 3QEGH 5D2LB 4PI0A 5JDJA 3ARBC 3EYQD 3GM8A 4QTHA 3S2AA 2XI9A 4CN6A 2R29L 2Y7OA 4JAMA 2VRAA 1DQMH 1UADC 4UQIM 1T04A 1M1SA 4FMVA 5CEZH 3U7WH 4XNMB 4KXDA 2FLMA 4ZX3A 1U8QB 2I24N 4J3OD 3CN4A 1FZMA 4IMLB 9CGTA 1JPFA 2HCZX 1RZ8A 2NW3B 5D1XA 4JRXA 1DJXA 1ILSA 4AL8L 3QFJE 1T1ZB 3HI1B 3MODH 4G8FA 2O5ZH 4BUQA 2DLFL 1FV1A 5DI8B 3I9IA 3UROR 1M6OB 1Z5YD 4FABH 3BFOA 1FNSH 3D5OF 2NNXA 43CAB 3ULVL 4FG6C 1U41A 1R75A 2R0ZH 1DVFB 1JD7A 1LWJA 4WJ5A 1G7JB 2FDBP 5DYOA 1U2YA 4XBGB 3HE7D 3F7QA 2R4SH 5DR5L 1IKFH 4MNGE 3QZPA 2IDQA 3ZT5A 3O6LH 3TIEA 3EOTH 2YGVA 4HU2A 4LLDB 4UQ3B 2WLLA 5L8JB 4TM9A 5JXEA 3HG3A 2YGPA 4GUCA 4I9XA 4FULA 1X5YA 5DDHA 1VFBA 1MI5A 2RJMA 3MOAL 2P80D 3G04A 3NK4A 3P4OB 4L3CA 1Z3RA 2YMXH 1C5DA 1X7TA 5T3ZH 4QY8B 3DGGA 3AXLB 4M9OA 5IMMB 5K5YA 5D93B 5FA4B 3MVSA 4H20L 1KY6A 1FNAA 1F58L 1X5AA 3U36A 4NZFA 3VDAA 2NX5A 4ONHA 3NGBC 1BQLH 1E5BA 2P5WE 3C6SA 4APQD 1SXNA 4JRYB 3ABMB 5KBKA 3AXHA 4NO2A 3FQ4A 4IOSA 1KB5A 2XKSA 3L5XL 5F3HA 2FNBA 3UH8A 1PYWB 1KIRB 1BAWA 4GO9A 3DBXB 3MKKA 4H13C 4EIUA 1J0IA 2X7LA 2ZOOA 1OO2A 3A0OA 4KHXL 3IEAA 1OM9A 4YXHH 3RUGA 5LAPA 2BPBA 1KYAA 1UYWH 1XF5B 3MRRA 4MHHG 1G5AA 4GKSB 1VGKA 1LVEA 1T7WA 1IV8A 4YSAA 2GIXA 1AI1H 2OMUA 1NFIB 4Q6KA 1KIPB 1UUSA 3KNBA 3NVQA 4LSTH 2Z31B 4N2IA 1C9SA 1PF3A 1YSOA 2BW4A 1T7ZA 1XF2A 1MF2L 2OL3B 4P2RA 4Z5RA 1FL5B 1GTFA 4ELME 2CU9A 3G6JB 4HWBL 5ESAA 5J9PB 2Y5TB 2GIYA 4AUJA 3E0GA 1WV7T 1KZYA 2G2PA 5K59F 4NSKA 3EO1B 5I1DA 3WNIA 3CVIH 4JFXA 2MCAA 1JHLH 1OD9A 4YH6A 2C26A 3RIAK 4WFFE 1CCZA 4PJCA 1G4MA 2GQHA 1MW2A 1W91A 1J5DA 3VI4B 8FABA 4JHBA 3D2UB 1V3JA 3HC0A 1BZOA 3X14B 3P9MB 2G3ZA 2YR3A 2DTMH 2H47C 3CX5K 4FYTA 4JJOA 3KPNA 4Y9BA 3G5XA 5EU6D 5JHDA 4Y1SA 5BVJA 1CUOA 3ZE1B 1DJYA 1ZLUH 3LOWA 5BRPA 5C0BD 4UBDC 5BUAA 4LL9A 4EDXB 1A1MB 1DLFH 2P46B 3V0EA 1E9OB 1KN2H 4JZJA 2R4RH 2R2HB 2OYPA 4WI6A 3B1UA 1TTAA 2XQBH 4FCAA 4HOXA 5HXMA 2ZSVB 5CJBA 3M46A 2VKXA 4HUXA 4IRZL 3DMMB 3V6OE 1KYOK 1I7UA 3S98A 5E70A 4XMLL 4DEPC 4NPYB 1CD9B 1OB0A 4FXKC 4M3KB 1A6TA 4NC1C 4DPRA 1USQA 5I8CB 3P54A 2I5YL 5EU4B 3TO2B 1ZHLA 2K0RA 2R1YB 4MD0B 4K3GA 1C08A 4XPAH 4PRIA 3WFCL 1F3RB 1XF3A 1J8RA 1KYFA 2NDFA 5I0XA 3VU1A 5IVXA 1YQ2A 1JD9A 3NQKA 1MRCH 4Y5XA 3ZTNL 4BHUA 3ASOB 3O3EA 4LIQE 2W07B 4M8UA 1RSFA 2AJYH 3PHOB 3IDJB 5DD3L 3X3GL 3NFNB 2F74B 4N8VB 5CHNA 2MJWA 1GPOL 1IC0A 3I84A 1ZT4A 1NFDE 4N2EA 3B56A 1A0QH 2O72A 1HI6B 3FT2A 4UTBL 1IE5A 1U92A 1HQ4B 1WGOA 7PAZA 2WB7A 4ADGA 4WI0A 3BISA 5PCYA 4P4RA 5IB1A 2XN9D 3PWJB 2OMXA 5EOQL 5AYUH 2EDKA 1KFAL 4BHUI 1V7ML 2FEEI 3AREB 3PGCA 3ZQ9A 3ULSB 1AXTH 4RNRA 1AO7A 3QI9D 3DJZA 3CSYA 1UJTA 5I8KL 1J0JA 1JTPA 1KNOA 2JB6A 2P7TB 3GD1C 4JO8A 4LU5L 2UX6A 4Z77B 3IJHA 2GTZB 4X4XA 3H1ZA 1U8HB 3EGXA 3O6ML 3I50H 3IKKA 1L3WA 1PG7L 4DP5X 4LSVH 1F42A 1E2VA 3Q9PA 4WY7L 2YIHA 2B77A 4ZZKA 3AZUA 1D6EB 4OM1L 2QSVA 2E27L 3PQYB 4XN8A 1RUMH 1QRNA 2G5UA 2EIZA 5BMFH 1WSST 2BSSB 3L13A 2E6JA 4LCIH 2KPWA 3NSDA 2OI9C 4MAYB 3PDOB 2E56A 2APTA 4OBRA 1L9TA 5HGDB 2GFBB 3L9BA 1E5ZA 5MEQA 1MG2C 2V8LA 3QEQB 4GB9A 1HX0A 1Q90A 2HFFA 4G5AA 4JO2L 1WA0X 3MRPA 3K1KC 4V1DB 4RETB 3MAWA 5CBAB 4HK0B 2WK2A 2AV1A 3BE1H 3K6IA 2EDQA 3IAPA 4HJ1A 2FATH 4H40A 5SV4A 3WJLC 4LSRH 1C12B 2Z92A 3BKMH 3L5IA 4WK0B 3EXJA 3CH1B 4M7JL 3V5KA 1YEJH 2EXWC 5I15H 5CNHA 4ZDHA 5CEXB 2VN6A 3GSVB 3OKEA 3OKNB 1CURA 4BV1A 4LCYA 3IFOA 5MEND 1U8CB 3ELAT 4AIEA 1QSED 4O4YH 4PGJA 2J5WA 4IRJC 5F97E 1PU0A 4PREA 4W70A 3HG0A 5B7FA 2JV6A 4G7VL 2CIKA 5FUZL 2HSIA 4PN6A 1QFWL 3RWIB 2VO8A 1I1YB 5EZPA 5MP6H 3AW5A 5F1IB 2X9ZA 2ZX8A 2NLJA 4RLDA 1AZRA 5GJSL 2YRZA 2VABB 3PL6A 4KKQA 4Y4HB 3ULUC 1AQ8A 5GGQH 4F7TB 1G7QB 4WV1A 1IIKA 3N91A 3O9WA 2FJHA 5F3BA 3QQ4B 4EN3A 4NKIL 2VQ4A 1NCWH 2XG4A 4AYDC 3IDGB 2GABA 3OPZH 5GGTA 3RLSA 4ZRGA 5C0AB 1BAFH 2P5EA 4NAMA 4GXUN 2ID5A 1CR9H 1J9RA 1SMDA 4L5FE 2HJKB 2BNQB 1AC6A 1N8ZA 3CQPA 1F11A 4KK9C 3SB3A 4FYQA 3VI3E 1YYLL 4XO3A 4I18C 5AOLA 2J2ZB 4GQZA 3QORA 3E80A 4Z7NE 5CKAA 2O93L 3PREA 2G2RB 1QZNA 5DJ2B 2Q2EB 2YKLH 4HZ1A 2OJZL 5D8JL 1MQKH 1JZ2A 25C8H 1XCQB 4G3YH 2A77L 4H8QA 4YXLL 4W68A 4XP6H 2RBLA 3T08A 3UJTH 5DJCB 2QVIA 3AITA 2EE9A 4HAGA 5DC2A 4QRUA 2JCCB 3M7OA 5LGKA 2NY3C 3OMIB 2BCMA 4MDIA 3S36X 2DDQH 3IDMA 3VMNA 2ZOTA 4QAMB 1JZ5A 1XB3A 2HFEA 3ORJA 4OFYA 2KPNA 5E94B 1YY9D 3V4PH 2JLLA 1GJUA 1NC4A 4OQTH 1DVTA 3HJ0A 3BD5A 3DJTA 3TT1H 1ESOA 4UM9A 3F5WB 4XN5A 5DZVA 2ZCKL 4NO0B 4X6DA 4X7EC 5DVKA 1WT5A 1RZGB 1ZTXE 3K6OA 3I9GH 4NKMB 4BJLA 5HPMB 4JQIH 4O51A 4F7KA 4WHDA 5D1ZI 3CHRA 4Z7UB 3QJRB 1QWHA 5T5FL 1UG9A 3SQBB 2FBOJ 3FFDA 3ABLB 2XZAH 1NEUA 1F0LA 3QG7L 4F1ZA 4XNAA 3R7QA 5DWPA 1DLHB 5D7LB 3OZ9H 5BZZA 3L4UA 2W60B 1JV2B 4FQJL 2VR9A 3IU4L 7CGTA 2OAAA 4U31A 4G5ZL 1OQXA 4QRPD 2F2HA 4YLCA 3EH5B 1DTUA 3VUAA 2X3BA 4BZ1H 2VL4A 2DPKA 3FT4A 5C0GA 2YSSB 4L0PB 4LK4A 5CEYA 5DVOA 3VQ2C 5IJKA 1JGEB 1T2QH 3KBHE 2VDKH 3T65A 1SLUA 3FPYA 3HBZA 3NPSB 5DJAA 35C8L 3HPJA 3H2QA 4K8RH 1W2KT 2C1PB 2ICEC 1R33A 4CN4A 5JHLL 2GBAA 3ARGB 1QFWM 1AS8A 1JVOA 4MYPA 1ZT7B 3ZIYA 4OT1H 1EJOH 3FN3A 4ZO7A 2ZCLL 4NLHA 3PE9A 4UT6H 3DDFA 2X44D 3S35L 1EHLL 4XPHL 3IYLW 4FFZH 4X0NA 4X8CA 3T2OA 2ATKA 2CZNA 3AWFA 3GMOB 4K94H 2J8UA 1XD0A 3UEQA 4H5SA 5K9OB 5LAXB 5F7UA 1A4KA 5I0YA 2P43B 2CRYA 1JVLA 1ED3B 3D85B 5CWSA 2FAUA 2M83A 1OCZB 1NFDF 3EHBC 3Q3GB 5C0BE 4OZHA 3NRPA 4F2MA 4NP9A 4XPGL 3VFUB 4LDLB 2WIMA 1RV6X 4AGNA 2C9QA 3NYKA 3RUGB 1I1AB 3ZX1A 3V9EA 4DVBA 1ID2A 4A67A 3BDBA 1LO4H 5FO9B 5MEPB 2P8MA 5E1AB 3MLSH 3ARXA 4Y16D 4E9LA 3IJ7A 2FX7H 4PRPB 1OT4A 4PTTB 4I0PB 3LS4L 2JE8A 4ISVB 5F1SA 2JJSC 4KUCF 4M4PA 4WW2B 3SKNA 2Y4SA 3UBXA 4PBVC 3AS0A 1RHHA 1JMZA 1BBJA 2AK4D 1S9XA 2UY7B 2KQNA 3TX4A 2ESVB 2H1LM 5B1CA 3JWDH 5JDSA 2MTPA 2AV7B 5I8EA 3WTTA 2CG9X 2ERJC 5DHMC 1S2EA 3FO2A 1LGVA 3CMGA 2CK0L 1XGYH 4G42B 2EO1A 4YWGL 1EFXB 1UM4H 4MMZB 4QRBA 5IQ9A 3QIBC 5GPRA 3CHSA 3BZ5A 3MOAH 5AAMC 3UAEA 3L3OA 3TV3L 1OGSA 3E6HA 1EO7A 4RZCB 5EULV 3U2SB 3GEWB 1I8LC 4PJIB 4Q2ZB 1P84J 2Z0UA 1Y0LB 3FO9B 5DA0B 4H20H 4R8WH 1F58H 3QJOA 3UABA 1WFTA 1YRKA 2XN9E 4OVUA 3TS8A 3A23A 3I02A 1I3RB 3BRDA 1NPNA 3CIAA 3HZ3A 1WK0A 4XNXH 1XO8A 4J3TA 1ZVHA 3L5XH 3T8XA 4FEMA 5D4QA 2DM4A 3PWPE 3ILQC 3OPUA 4X5PA 2CGRH 1DDHA 4RSVA 5F1KC 4KHXH 3WIFB 4ESKA 4DP2X 4UB0H 5JYMA 1SVCP 1PTZA 2OZ4H 3ZR5A 3GUTB 3NJKA 1FORH 1JWUA 3QDHA 2CUIA 2WAQA 5LXGH 2VR3A 1D5BA 1RZIB 5HI5C 4HLJA 4KJPD 5IFHH 4Q7DA 4I3RL 1GS8A 4XVTH 1BIIB 4F33A 1NFAA 1XVSA 1VDGA 4ABVA 2EYRA 3Q6FB 4MQ7B 1AFVH 2Q87A 1UASA 1MF2H 1GA2A 5ITFA 5JORA 4UTAL 4HWBH 4B9FA 2DBJA 5DQ9B 5A2IH 2QKSA 4DTGL 2X4RB 4LSPH 5D4IA 1NUGA 3NZUA 4IMKC 3ARBA 5GSVA 3VSUA 5EOTB 4BFFA 1IJ9A 1JXGA 4OBSA 1RP8A 3V4VH 1MFDH 3C2AL 3FOLA 3LY6A 2GJJA 1TTUA 1QAWA 4H8WL 5AL0A 1XIWC 2KLSA 3A4DA 2AGJL 3REVB 5HYJB 4E36A 4JGNA 1OWRM 4FFYL 3MO1B 3BPOC 4LPCA 3DSNA 3ARFB 3BEVB 1CD1B 3VQMA 4DKDC 3HMXA 1TXKA 5KSAD 5DD1L 4U6VL 1WWBX 4M43L 1XCWA 1T1YA 5MENE 1QSEE 3GMMB 5ITBL 1HKFA 3K4DA 1I8AA 5F6IC 3FB7B 1A5FL 3PABA 3KPSA 2D0FA 1CG9A 5KVEH 2W9DL 3TPUB 1MCSA 5EEWA 2FR4B 1DJZA 4LP5A 2HX8A 4RDQG 1L6XA 1CDCA 3D48R 5D7JD 3QDMD 1JPTL 3MJ9L 3FZUC 3QO1A 4S1RH 3V4PB 5KVDE 2YD9A 2QPSA 1YYML 1G9EA 4HHGA 4IRZH 5F7WC 1FNFA 2UWEB 3VFMB 2XVBA 4A2FA 5JPNC 1X44A 1DFXA 4XMLH 2EEXA 4NQSB 1CGVA 2I5YH 5FYLL 2UY6B 2Z8RA 5IB3A 3WFDH 4CU7A 3HZMA 3HPLA 3WLBA 2KZ1B 2GAZA 1N4XL 1V54B 1B0RB 1WS8A 5E4AA 3HRZB 3QJUB 5CGTA 5IG7B 1QSFB 1WVZA 2YC1A 1UWXK 3ZTNH 4MA8L 1HEZA 4E0RA 4FOMA 1OOAA 4W6WB 5IIEA 2CO3A 1GSMA 3C60D 4M7LT 3I2CL 2EXTA 2IJ0C 3N55A 4G70B 1ASPA 1DN2A 2TSAA 2IADB 4KK8D 4HD9A 5DD3H 2KI6A 2VISA 4NRZA 3VFNA 3VFOB 2BOCB 3MBEB 4R4ND 4ZFFA 4EI0A 5DEJA 5C0JA 1G9ML 4HIEA 5HHVL 1R17A 1Q38A 2VDKB 4LRNH 2V37A 1MCOH 4B60A 4PWEA 3IDNB 2WANA 3A3YB 1HHKB 4R2GD 1CMOA 1YEHH 2Y7NA 3BIAX 2NY4D 5EOQH 3BZEA 1V7MH 4UQ9A 3X1BA 5EFIA 2D3VA 5E95B 1BVLA 3DX7B 4JE4B 5TPWL 2OJEA 3ZDZF 3D25B 3KYOA 4YDNA 2VE6A 1K4CA 1NA8A 3BGAA 1MJJB 4OZFG 4LU5H 5I1CH 4L2YA 4KQ4H 1N9PA 2O30A 5GRYA 4TVUA 1X6NA 3O6MH 4Z3EA 1Z5LA 2VDLL 1A6UH 1XGRB 3VGGA 2D7TH 4KJWD 4GAYA 2C4FT 1NC2A 4QLRA 5IK3B 3QJHB 2AQTA 5CIPH 1QNZL 3OQ3B 5ESQB 1T4KB 1U8OB 4ZTEA 2PW1B 3FFOA 3FO1A 3IBEA 4HKXB 4K5OA 3C5ZB 3DYPA 4OM1H 2RQ8A 1CXKA 5BCAA 3V0GA 5I5JA 4PY7B 1YPZE 5HYFA 3EOBB 3IXAB 4L23A 4QRPE 2FJGA 3OJDA 4UUJA 1PCSA 3CQFA 4LVEA 2X2JA 3MREB 3QQDA 3HB3B 2J43A 4LSSH 2FYYB 2XA3A 2XXMB 1QP1A 5IFJB 2PO6D 4DGUA 3MLYL 3QZBA 4CSTA 4P46D 5E8PA 3TWYA 3BCFA 3MROA 3SPVA 5EO1A 4HV8B 4JO1L 3IJSB 3AY2A 4JKKA 2HKFH 1RURH 4ZFZB 4NOFA 4PUBL 3IXTB 4HCIA 4XNBA 1GZQB 2R1XB 3ZDYE 1DJIA 2GY5A 3PAVA 5EC1A 4FI8A 1G9NL 4IKJA 1E3FA 4H8UA 2QHRL 1F3DH 3OZKA 3NTCH 4DK5A 1KTBA 3VXSD 1G7IA 3IE9A 2ZIDA 3JTTA 5F7AA 2W9EL 4X5WB 4GQQA 1ERNA 3M1BB 3BUDA 3QFDA 4PB0H 4FXKA 1I9IH 4G7VH 4PFEA 5ERWB 1KB5L 3GINA 3KPTA 3P9LA 1QFWH 4YLBA 5KSVB 1HQRB 4PSRA 4ZODA 1KTRL 4KQ3L 3O45B 1P7KA 4IK6A 2OTWA 4AK1A 4ZMOA 5GJSH 4NZDA 2PR4L 4OV5A 1TZ8A 5GRJL 3VGDA 4DP7X 5C9JA 2HRHA 4GOSA 3HZYB 2WINB 4W93A 3NQIA 2AK4E 4BFKA 3SSGA 1KWKA 1GL4B 1JNNL 3R4RA 4BSVA 1UTDA 4R9HA 1E4JA 1YYLH 3ATEA 2OW7A 2ZONA 5DSCA 4F91B 5HTSA 1RIHL 3W0WA 2OJZH 1MFEH 4KMQA 5D8JH 3IAGC 1U8LA 2QQLL 1EAOA 2WNGA 4P2QA 1PLGL 3QUHA 4YXLH 4HUWB 4A39A 5AKTA 5CXPA 4AJWA 2DW5A 2I60H 3IK2A 3D9AL 3KD4A 2ITCA 4P2CG 1FJ1B 4H26A 1RI8A 1JGDA 2BSTB 4A63A 1DZBA 3H3PL 3S5LA 5J12B 4UOJA 1EMTL 3LPGA 4YHMH 1S7VB 1NCDL 3L3IB 3JQOB 3C6LD 4U6XA 4I85A 1TKWB 3K2KA 3MSPA 4K7PX 1GC1C 1I82A 1U42A 2YPVA 1SFHA 2ZUSA 4LIQH 5ELIA 3V4VB 3WO4C 2IH3B 2VOTA 1N0LA 1T6BX 2ZCKH 2EDDA 2Q0ZX 4X6BA 3DV4B 5ALBL 2CKNA 3ULVD 1IAOB 1EEYA 2Q8BL 2FWUA 4NKOB 2H0PA 3PWVA 1NDGA 4Y5YB 3TVMD 3UTZA 5CD3A 2H6PB 4MD5A 3IDXL 2ED7A 4ZSOA 3L1FA 2G9KA 5C0RL 1A47A 7FABL 1RULH 3QG7H 4MFHA 4XP4L 4MDJB 2P24B 3ZDXF 3CHQA 3BKYL 1OARL 1BFOA 5AKSA 3WHXB 4FQJH 2KBGA 4F58L 3CTTA 3IU4H 4QYAA 2LLGA 1BD2B 1TU2B 4FNTA 4G5ZH 5IFAL 3WJLA 3FN0L 1M05B 4FS0A 2GUYA 5FGSA 4MX7B 1TQCC 4HUCA 1LLAA 1TQVA 1P4BH 4GKNB 4E41B 1MH5A 1OW0C 2X4UA 6FABH 3LNFA 4TQPA 4F7MB 2ZWZA 1AKJA 2HWZL 5DEGB 4ZFQA 1MDAA 4H2CA 3UZQA 2FEEL 4H1LG 2NUTB 2QHLA 3BEWA 1X3DA 5KSBF 5HYQA 4POZD 3VRLE 3VXTA 2K4AA 2ZCLH 2VYRE 2OMZB 3GSUA 1B3IA 1EHLH 4XPHH 2Z4QB 3LKOB 3QFJB 5AYTA 3RY6A 3TNMA 1QO3B 1OTSC 3BWAB 5I73C 1I1FB 1HJCA 2ATAA 4V33A 1DANU 3GSRB 3MJ8A 4X98A 5FOBB 3VW3L 4O2FB 2HT3D 3OXRB 3L4VA 5B4MD 4KH9A 4U1NB 3QQNA 4XXDB 2QSQA 4JBSA 4WKZA 3TA3C 3WEOA 4HIXH 3CSBA 2YAOA 2HT2C 3KYKL 3IGFA 2MRYA 4PJFE 3JWNG 3Q2VA 2EJ1A 3HI6H 1TETH 2VXSL 3MA7B 4OSUH 3L16A 1UEMA 1BPVA 3OLDA 3KYNA 1R4XA 3LV3B 4MNGB 4I18A 2NXZB 4TNVK 3CV5A 1G1YA 4FNLH 3QDME 5FWRA 1NGWB 4FADA 4YC2C 5JQ6L 4KNUA 3O8XD 5BV7L 3VFVA 1EV2E 4LFHD 4HOZA 1P7HL 1TYRA 3O6FC 3MFFA 3QIWC 2Y7SA 1KELH 2H7WA 5EDSA 4M5TA 3W38A 2DYPA 2Z8SA 3T77A 4NQED 4AVKA 1DYZA 5CD5D 1OT2A 2EDNA 1MCWM 2UX7A 2YARA 3CAFA 2ETWA 1BOYA 2LVCA 2NW2A 3P3TA 5DMKB 3MLTA 3K4ZA 3GXNA 3QPQC 2WXMA 4G8EB 1EDHA 2P28B 4WSGA 5CIPB 3VTMA 4LDEB 2P5WB 3X12B 2XIDA 4GRMB 4KV5E 5IMOB 5DD0L 3T6ZA 2A2QT 4L4JA 4KVCL 3RWEA 1AQMA 4NO5B 5IJVB 3TV3H 3K46A 1SXCA 4Z78A 3DRQB 1FZOB 3JWOL 4OB5L 4L2LA 5IR1B 1PD0A 4GW1B 1M7IB 2E9BA 4A7SA 1JHKL 4HULB 3D05A 2HKAA 4NQDD 4DEWA 3PRZA 2D31A 3MRIA 3MR9B 4B27A 4EUPG 2ZX9A 5F9AC 2AI0L 2BC4B 3KLHD 4HSAC 4YHPB 3A6CL 1AIZA 1FAKT 3DHMA 2VQ1A 3DPBA 3FDWA 2C34A 4ZFOB 3S5ZA 4F8LA 3VXRD 4DKFL 5EZIH 1QLFB 2LOEA 4U7KA 4ELMB 4EJ1C 4G6KL 5DA4A 3BRGC 3N06B 3VD4A 2VDQB 1RZKC 2CWRA 3CLFL 5ID1A 3CLEL 4FNUA 1T7VA 4MBOA 4DP4X 1EEZB 2WWMD 3JV4A 5SWQA 2QVMA 1P5UB 4JLRA 2ICEA 5GGTL 2DLTA 4MB5A 4IDJH 4AEEA 1R24A 3LDBB 3MCKB 4QMEA 3WHE0 1CLCA 2CO2A 2KERA 2B4CH 4CDGC 1VENA 1F90L 4PJ5A 4TULH 3WAKA 1VFOA 3P30H 5T1DH 5D9SA 4NIKB 3TIDB 4OI9A 3EGSB 5DUBA 3QUMA 4AOFA 1UWXH 3PV6B 3FB6B 1ZLSH 2ZOLB 4D0CA 2Y2WA 3VA6A 4JN2A 2XV0A 1X5MA 4PVMA 3SE3C 1VACB 2JMRA 1XSIA 3C2AH 4H8WH 4G9FD 3K5RA 5GS3A 3T3ME 5D5ME 3VXPB 4NQXB 1E7UA 3MRHB 4PV8B 1S9KC 3B7RL 2G3NA 2YPKB 3ROOB 3OLGA 2WZ6A 3KPPA 1MNNA 4X9GA 5DD1H 4NN6B 1MOEA 2EICA 3RNKB 3HN5A 2MSPA 4YO0A 3VXSE 1D5MB 5ENWA 5I1JL 4IEFB 2AQNA 1BXVA 1TT6A 4LVHB 1LK2A 5BZXA 3FB5A 5E2VL 3GXTA 1QWUA 4MASA 3MRMB 3OHXB 4Q74A 2JJSA 1A5FH 1GAFL 2BM3A 2WKOF 4U3SA 4JFED 3MPCA 1SJMA 1O5PA 2FVNA 4R0LC 2NY2C 5DHEA 5HJDA 1HXYA 3KHQA 2G5BB 2MOGA 3NZ8B 1OAXL 2XYBA 1J48A 2DQJL 3CC5B 1TSHA 2AQRA 3PY9A 1K5NA 1JPTH 4KK5C 1M71B 3MV8D 4OZGA 1YYMH 1HKLL 4KRPB 5E4OA 4MNQD 4ZS6D 4P06A 4YX2L 4DW2L 5JW5B 3OTTA 4EEEA 2JK5B 4TLSA 2BVQB 1UOKA 3B2PA 5FYLH 3QIBA 1NFDB 2GTQA 3LYRA 4E9YA 4G6FD 5AAMA 4BKLA 2H5UA 1A3ZA 1KV7A 5DUJA 4KFZC 3KPRD 4OCNC 2IAMD 5M95B 4QHNB 2KKQA 3E6FA 3RKDC 4ODUB 3BIBX 1PS3A 4GYBA 1T21A 5INDA 1J11A 5KVGL 4M6ML 1L5GA 1FYTA 2UZIH 1WA1X 4UQEA 3RA7L 4AIXA 5C86A 3I2CH 3CDFA 2DYSB 4G8AC 3DTDA 1B90A 2J55A 4QJ5B 3FF8A 2QSCL 1A2YA 5CU9A 1KEGH 3P1VA 1VADB 4N22A 2V3EA 4XP1L 5GJTL 2DOCA 5H37G 3OKYA 5AVWB 1MSPA 1N3NB 2OQJA 3N1QC 4HBCL 2BWQA 5FHAH 4I89A 1FFTB 4K15A 4EI5D 2BP3A 2FJUB 3BIKA 3ZGIA 5C0CA 1P84K 1ITBB 3GB7B 3VH8B 3GMLA 5E23A 1JXJA 4DESA 1BREA 1XAKA 5TPWH 4KO6A 2XJLA 2PR9A 1TFHA 2ZXWB 1YDPA 3NPZB 3VB9A 5IUCA 4DNLA 1FDLH 1TEYA 3MTXA 1UXSB 1WPCA 4FQHB 3KJ4B 5DD6B 3WY1A 3AG3B 3G6AA 5GGSA 4PHXA 3FYEB 3RWCB 4OM0L 1A22B 3ATAA 1ETZA 3WL9A 4YBLB 3CDZA 2HT4C 3P3YA 4U6YB 4X8XA 3BAKA 3LRKA 4FKHA 3LEVH 1DVXA 1QNZH 2YXFA 3SKMA 4IMKA 4FDWA 1Q9KA 4TVPD 5FF6B 3VSVA 5EU3A 5BXFA 1BP3B 5IROC 2DI9A 4G2AA 4YHNA 5ETUA 3KPMA 4LOVA 1UD4A 1F3JB 4IGBD 5HYIA 4DKAA 3FQXB 4HK3J 1WBXB 1XIWA 5E0QA 4K3DL 3STZA 1JXDA 4XAWL 3KEDA 3X17A 2V33A 1UZ8B 2AQPA 2FEDD 4HJEA 2NY0C 2ARWA 2DQUL 3NJGA 3O2DH 4NCC1 4JM2F 3FUHA 4LEOB 3CZGA 3MLYH 5LWYH 3I6SA 2EVJA 3EZ8A 4JY5L 1HCFX 4JO1H 5SWSD 3DROA 4CBPA 1ZSDB 5I66A 5F71A 3FU3A 4P5TD 1BG1A 1WC7B 2G3XA 3WEBA 3GBLA 4FXLA 2NY7H 4PJBA 1IIIA 3NJXA 2ITFA 4MXVF 1QA9A 2N01B 2DQ6A 2WO4A 5DJ8B 4ODHL 3CNKA 4OLEA 3L3DB 3WJJC 4WNQA 2EKSA 1C16A 3BUTA 5I8OL 4U05A 5JPNA 2GSIA 4FFTA 3MGTB 5H4YA 1QW8A 5GXBB 4QLWA 1KB5H 3VI3B 3KAAA 4I5BA 1VB9A 3FCUB 4H25B 1KGXA 1L6ZA 3CFQA 3O11A 5D6CB 4Z7NB 3HE7B 4ZUTB 3ZZQA 1OP5K 4IU3A 1A64A 4B53A 2AF2A 1HHIA 4KK6D 1SJHA 2Q3XA 4S2SB 3UTQB 2A83A 3QXUA 4OLWL 2HVKB 1WA2X 4JDEB 2ZXBA 1S5IL 5DS2A 2E9JA 3F7VA 4L05A 4LEXL 4NQEE 3QNXB 4HH9B 5I76A 3D39D 1JNNH 1OAZL 1SM3L 2Q7AA 4JMNA 4WI4A 4YR6B 5D7SL 3DC0A 1O7SA 2NXYD 1JOIA 4AV4A 1DUYA 1RIHH 4ALAL 1KIQA 4C56A 4NUGH 3ZT6A 4XNUL 4APQB 1GSKA 3KGTA 2X4NB 2QQLH 3W81A 4P5KB 5HHXH 1XGUB 1NDMA 3B2MA 5GRWA 1HHHB 5LGJA 3IPFA 3D9AH 5BUPA 2ATPA 2PYED 2CBQA 3TM6A 4DFIA 4R96A 4ODXA 4AYFB 5FV1L 3CMOH 4G8IB 4PRHD 4WU7A 1NQBA 1YEEH 3H3PH 3SBWC 1H8NA 4BSWB 1EMTH 5D7IA 1MFCH 1NCDH 3HMXL 3MZGB 1J12A 5E9NA 5C0ND 3NCYS 4D9RD 2GT9B 1VHPA 1CDGA 5L0QC 1MIEH 2NPLX 5HHNB 1MUJA 1EPFA 4NQDE 2ARJB 2YN5A 3QCTH 1FIGH 3DJ9A 4MJID 5FGCE 5FKAA 3RWDA 3SOTA 2NSQA 5DRWA 3CFUA 1TLMA 1OVZA 5ALBH 5E5UB 2KMWA 3GGWB 1LE5A 2Q8BH 3RVUD 3GKZA 4Z23A 2YLHA 1XB6A 2VR4A 1YNLH 3ARTA 4OD3H 4CVZB 2YPLA 1T1WB 2E76C 3IDXH 5I0ZA 3HE6C 2BK8A 4AJYV 4YBQD 4YVUA 3LQZA 2D73A 3P3RA 3Q06A 5C0RH 1FSKB 2F08A 3LZPA 1IGJA 4YSRA 2UXGA 1BZ9A 3LSOB 3BKYH 4F58H 1H15B 4PJGF 1I7RA 4PGCB 5C0IB 3BUPA 3KL5A 5K33A 5C07E 4I4WA 3FRPB 5KBLA 5IFAH 3ZXAC 1HNFA 3B7UX 4NXSA 2VERA 2X4SA 3V7AE 3MV7E 1AHKA 3HJEA 5IBTL 3L5WB 3OWEA 5T1MA 1UQSA 1NCHA 1W0VA 5C0BB 4TTDD 2YEQA 2LHAA 2W0FB 2XNAA 3ILEA 5DJZB 5TDPA 3BDXA 4N0YL 3FONB 4G9FE 1DVFC 1KACB 4MD4B 5B1AB 3V2AR 4ZUSA 4BSJA 3JYCA 2BRQA 2VMFA 3G5YB 2BVPA 4Q14A 1E9QA 5KVFE 2YOCA 5HDLA 4JFQA 2X88A 3SDAD 5IY5B 2QQQA 3C8HA 3QZLA 2DJUA 4G11A 5FB8A 4JFEE 3EGDB 3X13A 3W1ZA 3IVKB 4N25A 3QQ3A 3N44F 4Y8DC 5ALCL 3UYPB 4U1MB 1TZHA 4EDWL 2CDEB 5G5DA 3IS1X 1WFNA 1NMBL 1AD9A 1LP9F 2IBZY 2A9AA 4GSXA 4DP6X 3ECQA 2HG0A 3V5HB 3MV8E 5D93C 5JQ6H 4MNQE 1DVUA 1YMMD 3QPXL 4M4RA 3VRJA 1MCEA 3ERXA 4DH2A 5I1LA 4N2DA 3ULVF 3DIFB 3D2TA 1M1XB 2OP4H 1UKQA 1LQSR 3WDHA 2IQAB 4FXGB 4AH2A 2EO7A 1DBBL 3KPRE 1R0AH 2VLRE 4XMPL 3M07A 1ZGLP 1U8MA 1KEML 2XN9B 3MRGB 1WS7A 3LNGA 4AMWA 2WVTA 3ABKB 2D3JA 3U48A 2J21A 2WSDA 3OSKA 1NINA 3QI9B 4HP5A 1UD3A 1F8TH 4JFFD 4KVCH 5IOPB 3D3VA 1JPGA 3PWPB 3RIAF 5GGVL 1ZA6B 2C7FA 1JDAA 2WW8A 3GK8L 3LXBA 2Z31C 2W92A 4KUZH 2P8LA 3JWOH 4O02A 2JI1A 1DQQB 2L7EA 4ILDA 1RJCA 5B38A 1JHKH 2B14A 2FL5A 3N40F 1HL4A 3G6DL 1E43A 1NWOA 1S7QB 3D50A 2M8XA 4E5XG 1RVFH 3VYNA 3SO3B 2BY2A 2BY0A 3F2LA 1LM8V 5TDOA 4DKFH 1ES0A 1IC4H 1Q9WA 4NYLA 1OE1A 2E6PA 2DQIH 1MCQA 1OB1A 4OFKA 4XE5B 5AW9B 4G6KH 1EZVX 5EZJB 2ZICA 2H45A 1A9EB 5HYSA 1OW0A 3CLEH 2IPUG 1RUKL 3RB7A 5BS0A 1X5JA 2J20A 4X6FA 5ANMA 2V2TA 5DS8A 5FO8B 3MBXL 5KAQF 3PFQA 4TVPE 3OKLB 4P4KD 2B8OT 3S96B 5EIIA 2DEYX 3LHPL 1JWMA 2ZTBA 4PJ9B 1XL6A 3D33A 5J11B 3BSZH 5AVSB 4QHPA 1HXMB 4ZBJA 3ARWA 4ZMWA 4HIJB 2PWGA 1Z1WA 2HH0L 4FP8L 2L3BA 1JL8A 1WWAX 5MENB 1QSEB 2X42A 5FPIA 3QHFL 1ZHKB 2MH4A 2X70A 4MNHB 5ACLA 3DMMC 3VQLA 5B8CB 4JPKL 3TA3A 2EYSB 5SWSE 3ALPA 5GS0D 2IWEA 3DSFL 2A99A 2H3NA 2VTFA 3K2MC 1BZ7A 3AC0A 4MXQD 1IAKB 3K71B 5AKRA 1J1PL 4RGOH 4PRBA 5FYJE 1NCCH 4TRPL 4U33A 3WG7B 2ITDA 3MUUA 1DEEA 1WD9A 5C0FB 5DMGD 3QJSB 1QLRB 1S7WB 3L3HB 5HDBB 2YPVL 2G75B 1G7MA 4Y4FD 3K6SA 1UD6A 1QMUA 5F7DB 5E2VH 3VG9B 1EGJA 1LE9B 2BWDA 4HKJA 1GAFH 3CN2A 5LGYA 1NCAH 2H0EA 2NSMA 3O6FA 5MHSD 3QIWA 4UMGA 1CFQA 5HJGA 1UZGA 1YNTA 1Y18A 1CIDA 3FQTA 3M7FB 3VWJD 1SDAB 3MACL 1OAXH 4K5LA 5ISZD 1QPXA 5IW1A 1OKEA 1OT1A 3S8GB 1RH8A 2QKIB 4QTIL 4OGXL 5HVGB 3RWFA 2B3IA 1HKLH 4LLYB 2IALA 3VD2A 3QZNA 1DJSA 2PMZA 3MUY1 4TN9A 1RZJC 2BW5A 4DW2H 4YX2H 4JPVL 4TPRH 3SODB 5EB9A 4HWZA 1WFOA 3LN5B 4U7SA 5EF3A 1U3HD 3BGMB 3AREC 4KZCA 1JYWA 1AGEB 2BOLA 3W82A 2A9ML 3T3PE 2KDYA 3C5JA 1FO0A 3VQ1C 3CN0A 4JO5A 5DT1L 3FT3B 4JX0A 3VYPA 1W8OA 4BELD 4DKEH 3H9HA 3K3QA 1YQVL 3NIDE 2W0KA 1EBAA 1OHZA 3LN4B 4OLYH 4C4BA 4N0UA 1NMAL 3RA7H 2IVFC 5CJ8A 2VQTA 1GCFA 2D4FA 2XX1A 1U6AL 2WXRA 3FMGL 2XVLA 1R3KB 4ZPTB 4A7QA 2CALA 4AQEB 1JV5B 4XP1H 1P69B 2PYEE 2C3GA 5HGAA 5LNGA 1MRDL 4PRHE 4UIMB 3P69A 4HBCH 4MAYC 4X6CA 5L8LB 4HYTB 1T5XA 1XB8A 3O2VL 2J56A 4WCYL 1V3MA 4JDTL 4X0KB 4D9RE 3FRUB 3MNZB 3ULUL 5JPMB 1TFPA 3O3BB 4CRPA 2AERT 1VZIA 3OGOE 1YPZB 4TSAH 5SX5K 2ZXQA 2BJMH 2MEJB 2OX5A 3FCTB 4MJIE 4L37B 1KBPA 3MRKA 3V0WL 4QRPB 1QZ1A 1ZV9A 4JMXA 5EBWB 1WTLA 2AAVA 3CHXA 1EXHA 4KJYA 3MGOB 3APNA 5BZDB 3QDGA 5AVYB 3EYUH 1PLBA 1JMXA 2YD5A 4OM0H 3T1FA 3VSQA 5JLZB 2MMXA 1PDKA 5I6NA 1PKQA 2DBLH 2BFGA 1KTLB 1YECL 3GJEA 3PAYA 4P2RD 4AQ8C 1PZ5B 2Z34A 1FL3A 1KF9B 2EADA 3PJLA 4JR9L 1GGBL 3Q13A 4OV6F 5T5NF 4A7GF 4XNYH 2OK0H 3BZDA 1XTLA 2QQKL 2RFXB 1OAJA 4HLZH 3SE3A 2QTEA 5HVHB 3ZDYB 3GXDA 3P4NA 2XPGB 2AXWA 3HZVB 2GCYA 3OR7A 4GNKB 4MHHI 3U4BH 5IV2B 8CGTA 1CE6B 3EYSH 4K3DH 3SN6N 1OGAB 2YHGA 4PV9A 2YEZB 2DQUH 4Q6IB 1FHGA 3GJFA 3JTSA 4Y4HC 1H6FA 2Y06L 4FKKA 1S7UB 4AQAB 4JY5H 1F1AA 4P2OA 2D7PA 4ONFH 4JJ5B 3H7BB 1CLYH 3EJRA 3BDYL 2FZ3A 1BQRA 1S9VB 4R0LA 4WZ9A 3L1OH 4WHYG 4DZBB 2KZWA 4PY8I 5CCHE 1JGUH 2VMEA 3NN8A 3B8YA 3B7YA 2MTAA 4Y16B 2LV4A 2VLKD 3UO1H 3OC8A 3CBKB 4X7TB 3RX8A 1XZ0A 2F8XC 1S9YA 1UFUA 2XWJB 2BP8B 2RQEA 4IK7A 1BZ8A 4UDTA 3P0VL 2PTTB 3DVGB 1FVCA 2AK4B 4IHOB 3VX0A 2HRPL 4RMQA 2WLJA 4BK8A 4NRXA 1VFAA 2VN5A 3BW9A 1O6TA 3QAQA 4H88H 4MDRA 2ZUWA 4YDZA 1HCYA 3FTVA 2AXFA 5ICXA 2WO2B 2A9NL 2YAQA 3ZKND 1JSYA 2A73B 4M1CC 1W72A 4X5XB 2YZ8A 4XBPB 1FVDB 1B4JH 1AACA 1YMME 2ORBH 4JVPA 1CICD 1J0HA 3X1FA 4HJGA 1KXTA 3CSPA 3VFGL 1LD9A 2AQSA 3IETB 4W9IC 1MXDA 1SM3H 1KBVA 4DOHB 3S4SB 3ZGHA 4ODWA 2UXVA 4NJAL 1UD2A 3TN0D 3QUML 3SY0A 4WK2B 3DX2A 4GSRA 3WKYA 4QRTB 3OZLA 1RXLA 2A6IB 3U7YL 1V27A 2F58L 2I85A 1KGUA 3BQUB 2BRRL 4M1DH 4L8BB 2FJSA 3LMJH 1R3JA 5FDWA 4C59B 4JFFE 1Q0XL 4ZO8A 1AO7D 4N68A 4XPFL 1MFBL 3ASNB 2D7MA 1BOGB 3K6FA 4YNYB 2WTRB 3ZKXB 5C8JA 4KZEH 2G9HB 3GS0A 1KIUB 1ZVSA 2Z65C 1RK7A 4HFWB 4YGVB 3UAAA 5LGHH 3TJHC 1ILUA 1UCBL 2XTJD 5D55A 4NZUH 4QRSA 2PKDA 1KLUA 3EZJB 3SYAA 3KBFA 3NPSC 4QIRA 3QXVA 4X4YA 1PZDA 4HEPA 1YO4A 5IROA 4EAEA 1B4RA 1IGIH 3ARGC 1ZA3A 5D1ZB 3JV6B 1QRND 3SO5A 2OTUB 4MCNA 4KNSA 3SBPA 4TNWK 4UV7L 4LCCB 5KJ4A 4MSWA 5DJDB 4GG6B 3MJWA 5C08D 2IPTL 1MIML 1MCJA 1NM9A 2YAFA 1CE1L 2AABL 1TZGL 1IBGL 3VXME 1G1OA 4G9DA 4FTVE 3IF1A 2V3FA 1E27A 1Z9LA 4NUJB 2EUWA 1BGXL 4N0CD 3MRLA 1Q4NX 2V7HA 3L9RB 3NZSA 3HIZA 4S1DC 4GO8A 4L8DB 3GYRA 5EEZA 3W56A 2D2OA 5HJ3A 1DQJA 5D70L 1TOXA 3G5VA 4DGIH 1DQIA 5JOEA 4GKZA 1YC7A 3WEXA 1XR8B 2CM6A 4FG0A 3I6KA 1I1AC 3GI9L 4NJ9L 4QRRD 2J6EH 3QCUL 4L29B 3X11A 3WJJA 3PWUA 4PJFB 3I9PA 4OCWL 4Z0BL 4LCVA 4UOZA 4I0PC 3MKGA 2H2SD 2VWEE 4NHCL 4KI5F 2VB5A 3T3PF 4WW2C 3WUWG 2ZWKA 2LAAA 2WP3T 4N0YH 1YJDC 2FD6H 2OCFD 2OKMA 3RX7A 4A7TA 2X40A 5D7JB 5GS2H 1UWGH 3SE6A 1A6AA 5I6MA 3PL6D 2Y6SC 4A66A 1N8OE 5BJTA 1S7TA 4EN3D 5MHSE 2ZP9A 3MRQB 4MMZC 4UQBA 1TPXB 2GUOA 5ALCH 2I27N 4OAWA 4YBHA 1FN4B 1R1CA 4EDWH 2APVA 4UF7C 3WS3A 2AHIA 1ZJAA 1WDAA 3S7GA 4CMMA 5LHDA 5L88H 5ISZE 3AMKA 2IWFA 5IQNA 3O3AB 2N59A 4UOW0 3KYMB 4Y0GA 3QORD 1G7PA 3C60B 4WI9A 5E8NB 4AVHA 3I3BA 3CVBA 3HLAB 2Y36L 3NA4A 2H0JA 3DXAE 4X9HA 2EXYC 4BWWA 1RY7B 2XG5A 4KXBA 3DTXB 4D0BB 4PS8A 3N85L 1HH9A 4JPIA 1JDCA 2Y5EA 4BWTA 3F7RA 4OD1L 2NZ9C 2DI7A 4KMTL 3WBDA 4F1SA 4WW1B 1N6QL 3SBWA 4URKA 3CCHA 3BH9A 2C7UB 5DLML 4IOIB 5ES4B 3QJTB 2XWCA 3E8UL 4XMPH 4R2GB 1GRWA 4R7LA 1KEMH 5E2UL 4AEHL 1ZK5A 2NY4B 2NNAA 4FERA 4OFYD 3WNMA 1MVUA 3TBCA 5IKCB 1NC4D 3QBTB 1PSKL 3U1QA 4P3WA 2VSMB 5HHOA 3W57A 5AOMA 2KLRA 3PP4L 1XL4A 5FM5M 4WUUA 1C5CL 4KVNL 1XGQA 1AYRA 3SYQA 3CD4A 3L4ZA 3OKDB 1FCCA 5C0DB 2F0CA 1KJMB 3HE6A 3V0HA 3V4UH 1MHCB 5TQ0H 1IM9D 5CINL 1T03L 3POCA 5CZRA 2P49B 3BAJA 1XBRA 3RUGE 4BK4A 5D2LA 2WSKA 3SPGA 5IHLB 5EO9B 4P05A 4HS3B 5L4IA 2CBOA 1QEXA 2FH6A 2XACC 4RRPM 4KO9A 1MLBB 1WAAA 3HG2A 1QHOA 1ZLVK 3ARQA 2CUMA 2QDWA 1K4DB 3KWUA 1PJ9A 2B1AL 3A24A 4IMLA 4L4VB 2PO6B 3UPAA 4KKAC 4LLQB 4P2RE 4BA0A 5A7EA 3ARFC 2VIRB 1HESA 1WZ1H 4P46B 3F7YB 1VPOL 2YBRB 1T1ZA 3HI1A 3BVNB 1EX0A 1XGPB 5DI8A 3GDBA 2WLKA 2B1OA 4RDBA 4DGVL 2VQUA 1M6OA 2H2PC 3L5JA 3LHPH 1L9OA 2IWKA 4OF3A 5D5MB 3T3MB 1Q72L 1Z2KA 4DGWC 1FPTL 43CAA 5TTRA 3ESVF 1EXUB 2SODB 1DVFA 4PJCE 3AUVA 2HH0H 4WEBL 2WN3A 1G7JA 3VXSB 1J8SA 1Z66A 2Z7UA 4Z9KB 2L7JA 4DP0X 4MJ5B 5AOZA 4EMZA 4WEEA 2ZAIA 2IDUA 4XOCA 3FKUS 2JI3A 3GRWA 1H3XA 2NNCA 4E9WA 1J5IA 1UWFA 4FZ8L 3MRBA 4JPKH 3BKCL 4HUVB 3K8KA 3FCSB 5EZOH 2BIIA 4EPSA 3DSFH 4LLDA 4UQ3A 4AYMC 2UXTA 1BPLB 2ZUYA 4WIQA 3KE0A 3KGUA 2HLAB 4UILH 3P4OA 3QG6B 4ABUA 3V6BR 4W9HC 3HRZC 1OAKH 3T4AB 1IU1A 2VLKE 4QY8A 4GSDH 2YPVH 4JL1A 3AXLA 2GEQA 5IMMA 3D7PA 5HHQB 3MLVH 4U3CA 1JZ4A 3GLDA 5FA4A 5C71A 2R2CA 3PPSA 5DZOA 5SX5H 4YE0A 1FNEB 4CKQA 2NY1D 4R83A 4B9ZA 1JPSL 3WIIH 1RJYB 4JRYA 3MBEC 3E8VA 4HCRA 2Z4TA 4PJAF 3UJIH 5EWIL 2PP9A 5E8DL 3VGFA 4Z7WF 1M2OA 3ZR6A 1UH4A 3WLWC 1KIRA 3H56A 3UBGA 3DBXA 1NOLA 3UOAB 1I1CA 3MUHL 4K8RC 4JPVH 1N70A 5IWLC 4KJQC 2IFGA 4PW4A 1GIGL 4MGXA 1XF5A 2X38A 4X9YA 5JA9A 2A9MH 4GKSA 2E8ZA 4QYOB 3K1DA 3CE1A 3H54A 1NFIA 4LGSB 4N8UA 1KIPA 5DZAA 5AB9A 2Z31A 3HUJF 3EUDA 4K94C 4PW9A 2G60L 2CNYA 2OL3A 3VFWB 5E1QA 5IQLA 1FL5A 4XWOC 3GLAA 1NMAH 3G6JA 4XTRC 1ZPUA 5J9PA 3SDXE 4IYKA 1IGYB 3L45A 1RCYA 1NAKL 1NEZG 1U6AH 3FMGH 5I6KA 4PJDE 1G6RA 5FUCE 3EO1A 4YMPA 1G7LA 3C5ZC 4MS8C 3ZW3A 1CGYA 2CDFB 4NUQA 1O5DT 1MRDH 3SY6A 3LQAC 1TMQA 4OGQC 4FJYA 3L5HA 4N26A 2AITA 5IGXL 2WVSA 3IWUA 3VI4A 2XTJE 3O2VH 4J1UB 3D2UA 1ZMYA 2YUZA 4WCYH 2LFEA 3EDKA 3HB3C 3X14A 3VXNB 3P9MA 4UNVA 5LN4A 2K8MA 5B3SB 4LOFA 2VDPL 1DCLA 1JNHB 1RUPL 4X4ME 3WUZA 3K8MA 2YD2A 3V0WH 1O9WA 3TA4D 1IC5L 4OCYH 2YAMA 1X7QB 4YLQT 1QRNE 1OY3B 1SF5A 4X6EB 2XZQH 4FTDA 3A22A 5JMRA 1AAJA 1S9WB 4EDXA 5CCJA 3J2PA 3JWDC 1A1MA 1YECH 3B2UD 5HD8C 5C08E 1RPQA 2R2HA 1SJXA 2GJZB 4JR9H 2XWZA 2YWZA 2ZSVA 4KOBA 2QQKH 3ARBD 5T1KB 3DMMA 4GIOA 4KROB 3RL2B 4NPYA 1GZPB 5AL8A 4AYBA 4GO6B 5I8CA 1EXGA 5EU4A 3TO2A 4CL7A 2R1YA 4MD0A 2YA2A 1HL9A 1ML0A 3VFTB 4Y5VB 5I1KH 3HG4A 3C9NB 4XOBA 4J27A 1O7DE 4NQQA 4QRRE 4YIQB 4XMTA 3OGCB 2JI2A 1GC1L 3TBSB 3VD1A 3F04A 1UXWB 1UC6A 1M9WA 3VYOA 5FM8A 3ESPA 2W07A 4N1EA 1D2OA 2QSTA 5AOKA 3BDYH 3PHOA 1BWWA 3IDJA 4NFBA 4OJAA 3KPSD 1UM5L 1AR1D 2FX9L 2H1PL 3FHAA 3GTNA 3NFNA 4FG6D 2B15A 4P48A 2F74A 4N8VA 5FFGA 4KX7A 5IUSA 4C58B 1S4IA 1JWSB 2Z7WA 3D12B 1HIML 3RGVB 4O02L 2E8YA 5FV2A 3BKJL 4QHLB 1TENA 4IIQB 2M26A 3KS0J 1HI6A 2YLKA 1SYSB 3O8XB 4XC3H 1HQ4A 3U4EB 1RLWA 5F0JB 4NQEB 1NGPL 2FGZA 3E3QC 4HG4J 5D1QE 3AREA 3EJYC 4R4FL 3DARA 1BYNA 2C9XA 5HHPB 3ULSA 1J1OL 3FSWA 2EIBA 5FS5A 5FYJH 5A16B 4F7PB 3FFCD 1OSPL 2CSPA 2P7TA 5AW0B 5MI0B 4Z77A 3SGDI 4FNPA 5J12C 2A9NH 3EOAB 1U8HA 4EQ2A 4R5XA 2X10A 3NEOA 3CSGA 5AZEL 4KZ0A 1H9VA 1QBLL 4ODSL 1RFDH 5DD5L 3P3SA 4QCIB 5F9DC 2YD1A 3NIGF 4N1HB 2E59A 1D6EA 1NCOA 2VDOL 3PQYA 4TF4A 1PIGA 1RP9A 3MC0A 4HUKB 2JKNA 4Z7VE 2BSSA 4Y5YC 2YD6A 4JHWL 4NJAH 5DO2C 3QUMH 3O3UN 4MAYA 3MXVH 3PDOA 3EXLA 1KPUB 1ORSB 4NQDB 5HGDA 4Y19B 2NUPA 4Z7QE 5CP7B 5JXAH 1I9EA 2GFBA 5FGCB 4AENB 1BDYA 3RPIB 3QEQA 3FHQA 4HJTA 4LQFL 4V1DA 3II1A 4MA1B 2DQGL 1Q0XH 3WN6A 5CZXD 4XPFH 1MFBH 2AEIT 1SLVA 4HK0A 5LO7A 4PJCF 1JGIA 2MPAH 4FCHA 3U9PH 4K3HA 3CZSA 3NCCB 4N2LA 2VJXA 2WXIA 4M61B 3CH1A 5K1JA 1NGXB 1INQB 5A7BA 1E7VA 4AQ8A 3BD4A 5CEXA 1CC3A 1G43A 1KFGA 3GLEA 3GSVA 3AQYA 3OKNA 1EGJL 2EUZA 2HLFD 3B9VA 1U8CA 1THCA 4N2FA 5C07B 2BSCA 5D4JA 5JW4M 4AYID 2XYCA 3FK3A 4WWKA 3WNOA 2WM0A 5E8EB 4O5LH 1MNUH 2UV3A 5HDOA 4Z8FH 1AZZC 3MV7B 3OD3A 1KXQA 3HZKB 1A7RL 3RWIA 1MIMH 4LMQI 3D30A 4MAUL 1I1YA 2IMNA 1AVAA 1PFOA 3RVWC 4TNVF 4P3DB 1TZGH 4I1NB 4OF7A 4XXCC 1IBGH 4Y88A 5F1IA 2WWNA 4K0OA 5FYKH 2X09A 3AQDA 5EU7E 2VABA 4Y4HA 1U8PB 2X6BA 1BGXH 3GXFA 3Q8EA 2KZKA 2H9GB 3A4AA 2OYMA 1CDJA 4F7TA 1BQHG 1G7QA 1CBVH 4G9FB 3MGAA 3QQ4A 4M3JA 1CGXA 4JHUA 3IDGA 5KYNA 1FO0L 2B9AA 5C0AA 1NL0L 1RUQL 3QUGA 1M7XA 5AD0B 2HJKA 5IVXF 2BNQA 6CGTA 3GI9H 5C7XL 3ARVA 3QCUH 1D7FA 2NXZC 1JGLH 1EEUA 2J2ZA 4JFEB 2G2RA 5DJ2A 5I1HH 5TF1L 2ZT9C 4NHCH 5J1TC 4LSQL 1BFTA 1XCQA 2O5YL 5DJCA 2AK1L 1JN6B 1GS6X 3ASWA 3MV8B 1EVUA 2JCCA 2N7SA 5FEBA 1RZKL 4FLQA 4GSQA 1AMXA 3TH4T 1VIWA 5F2FA 4GEJA 5E94A 15C8H 4PYGA 1E5AA 2WN2A 3A6BL 4UMSA 4G6FB 4ZMTA 4CC0A 1K8DB 4AW7A 1F4YH 1K6QH 1IT9L 3MOBH 3KPRB 4NO0A 2IAMB 2VLRB 1RZGA 2YXVA 1ZLVH 1NAMH 2FECL 1CGWA 1S7RA 1YN7B 3RX9A 1CT8B 4NKMA 3NSFA 5HPMA 5JMOC 3MYZA 1NKOA 2J4WL 5GIRB 2WQVA 2Z64C 2WO3B 2WZ0A 3IFNL 4Z7UA 4MTMA 1CYGA 2Y36H 4ZQKB 3VVVA 1Z0NA 3W0WD 5DMIL 4LL1A 3SKJH 1J9TA 1AC0A 1KC5L 4P2QD 1DLHA 2ADYA 1MCRA 5D7LA 4A6YH 3N85H 3HLKA 3Q9QA 2W60A 1JV2A 1XCTB 3ARRA 4OD1H 2FB4L 4KMTH 5KBPA 1N6QH 2O5XL 3HOGA 5I1GL 1U4EA 3E8UH 3B2DC 2HB0A 2QPFA 3FULA 2YSSA 3ECVA 3N42B 1I4FB 5E2UH 3ZO0A 4L18A 1U30A 3RJDA 1JGEA 4LQ1A 2PYFB 2RD0A 4NQTA 1RZFH 3N0AA 2BSED 4PWGA 1NDTA 5DEZA 3QH3B 3TOPA 1PSKH 4IBZA 4W81A 2CNZA 2XWDA 5EUOE 1P5UC 3PP4H 3ARGA 3WEMA 3LDBC 3FB8B 1C5CH 1ZT7A 1AHMA 2IDTA 3UGUA 3DO7B 3UC0H 3JUZA 5TQ2H 4F8QA 5EOCJ 2HTKC 5CINH 4OGZA 1FA4A 4M7KL 3GMOA 5L9DH 2JTYA 5IESL 4LHUG 3L3JB 4XVJH 5LAXA 3UACA 5K9OA 3NH7L 1JF6A 8PAZA 1USZA 2YUXA 3ZBMA 1ED3A 3D85A 2C9PA 2APFA 3LAFA 5A2BA 3EF7A 4U1LB 1TVHB 2CBPA 3IMUA 1ZT1B 3Q3GA 2AEQL 2N4IA 4G7RB 3VFUA 4A2GA 2B1AH 2AJSL 5IJCC 2EUVA 3SOBL 4OGYH 1I1AA 3HMWL 5GGVY 4NN6C 1W72L 1W9XA 1IEBB 4XO9A 3WEAA 5FO9A 5MEPA 2AMUA 1QFOA 5E1AA 5SWSB 4GLRI 3FQUB 4LVHC 2X4OB 2FWOB 3DYMA 4PGDB 4PRPA 4P5TB 2DZEA 4I0PA 4PTTA 2DWEB 4ISVA 3OHXC 1Q72H 4YS4A 1MCKA 3ZL2A 4M48H 4WW2A 4CU8A 5CSGA 4L9LB 1KGCD 2EVHA 2YN3A 5BOZG 2ZF9A 3E9UA 4WEBH 1CYXA 5J7CC 1OTTD 2UY7A 1CK0L 5DJYB 4YFLI 2ESVA 2XFGB 3GJFK 4J6RH 3UJJL 2AV7A 1IGFL 3U0TB 2AXHA 4KRPC 3FT9A 3HG1D 4K9EC 3QQ9C 4IW4C 3BKCH 1I53A 4TNGA 3MU3A 4F20A 1CFNB 3BYYA 3DVNB 3IJEA 4G42A 5C6TL 1EFXA 4WFGE 4ZMVA 4MMZA 3KPSE 3LZNA 2JKRM 5CGYC 1V8HA 4JRWA 2X6CA 1M3IA 2NZIA 1T80A 1K9TA 4RZCA 4KK9D 3VDBA 2DLEA 4PP1C 3Q2NA 5FUOL 3U2SA 3OMZA 4PJIA 4Q2ZA 1Y0LA 2HTLC 5FGRA 4IBSA 3Q44A 3FO9A 4F37K 5E1HB 3Q5TA 3T3PB 4X6DF 4AGPA 1G5GA 1JPSH 2C9AA 4TVSa 4QI3A 1I3RA 1MJ7L 5E8DH 3NIDB 2HKHH 2WGXA 2NXYB 3FFCE 3DJSA 1UM6L 5IMKB 3LCYA 1A6PA 2Z8WC 4PW3A 3WIFA 1LNUA 3GUTA 5EMYA 4HHAB 4M8RA 2RB8A 4MQXD 2D2CC 3TBTB 1DJWA 2AQ1A 2PYEB 3QB7C 4P57B 1RZIA 3UMNA 4UWQB 2XRAL 4PRHB 1OM3L 3K8LA 5EHFA 1K5WA 3RX5A 2WNWA 3KJ4C 3M17B 4M6OH 3US1A 2ZYIA 3Q6FA 4MQ7A 1P6FA 5DU7A 3IJYB 4C4KO 4JCMA 1A6ZB 4YBLC 2LR4A 4PJEE 2JNZA 3IMVA 3TYGH 5DQ9A 4MJIB 1QRKA 2X4RA 1F4XL 3RKPA 5B39G 4H0GA 5EOTA 5T1LB 1HYRC 3Q48A 2VH5L 2JKLA 3CBRA 4YSDA 2PP7A 1LO2H 3UGXA 3REVA 2QJDA 4MCYB 1E4HA 2K9FB 2OYLA 3SHSA 1QKZL 4XCNB 1E4KC 2J8UF 3MO1A 2WLZA 5ICZB 2XX0A 1TVDA 3ARFA 1DSWA 3BEVA 1CD1A 3EYQC 4HGKC 4QXUH 4RFOH 5B1BB 5AVVB 2NT1A 3K72B 3CIQA 4Q0XL 5KAQG 2ZG3A 2CO1A 3GMMA 4ZMZA 3HN3A 5CR1A 3BAEL 5LJYH 1F02I 2DLHA 4OZHF 3FB7A 3G08B 1DBJL 4HXBL 4J3OC 3LRMA 5DRNB 2X1PA 3T2NL 1WBZB 2NY6D 4L1HA 4LPYA 1QFHA 3TPUA 1KSRA 3R06B 2FR4A 4AV5A 3HFML 4ATWA 3CWGA 1HZHL 3PPEA 4IBLT 3BPCB 4ZZFA 1OF2B 1XF1A 3FQ2A 3V4PA 4OQTA 3A6OA 3TFKD 1A3QA 3L3KB 1ET5A 2NNFA 2UWEA 2KHAA 4P3CH 3VFMA 1YAZA 3SD2A 1X4YA 4QWWC 4HETA 5IB4B 4NQSA 1NAMB 2P45B 1JDDA 2F8IA 5F9OL 3RHWK 3EHBD 3L4XA 2UY6A 3GPEA 4JQIA 2JKSA 3SPJA 4XMWA 2MOVA 3BLKA 5CJQL 2YQ3A 1BVZA 1XH1A 3CFBB 3HE7C 4KHTH 1B0RA 4QOKD 3HRZA 4IRSD 4ZUWB 4MVBD 1GC1H 4ORZC 5IG7A 4QRFA 1QSFA 3SDAB 3CQQA 1T22B 3FPXA 4EXKA 2ENJA 1RQ5A 5EU5B 5GZOC 1DBAH 4GSUA 4PWKA 2IADA 1CB4A 1P6AB 1UM5H 2H1PH 2W88A 3NRQA 4M5ZL 3I75B 1RLBA 2F5BL 2WAHA 3GMNB 2BOCA 3VFOA 3ES6B 3MBEA 4I0CC 1FLTX 1HIMH 4O02H 2V17L 2GK2A 4BZ1A 4L1SA 3VB8A 3BKJH 3V9CA 2WXQA 3MI6A 1QBMH 3SKUD 5FKPB 1KTJA 2WQAA 3GKWH 3QZWB 2DMBA 3F83A 3QJXA 4BQ9A 2EH8L 3IDNA 5CN1A 1HHKA 4APQC 5IWLA 1Q9LB 4LOUD 3P4LA 4R4FH 2B4CC 1GGTA 3DX7A 3MV9E 3D25A 1EEQA 1MCPL 1U4FA 4QF1B 4HIQA 1MJJA 3MCLH 1OSPH 2FIKB 3K80A 4OUUB 3CU1A 2XQYA 1TJXA 3CFEB 5AZEH 4NAQA 1XGRA 4NNPL 1UB5B 2HZHA 1QEWB 5F7HA 2CUAA 3W0WE 5HHMD 1GHFL 5DD5H 3PDGA 3WIHH 4ZI8A 5IK3A 3QJHA 3D0VB 3MUZ1 4OIBA 3AB0B 1HDMB 3N9GL 4ZTPL 5ESQA 1T4KA 1U8OA 2PW1A 4HKXA 2VDOH 3C5ZA 4R7XA 1INEL 3OAUL 5E6ID 2UYLB 4EVNB 4PY7A 2WYIA 3LKQB 4JHWH 3CDGB 1WIUA 3EOBA 4S1QH 5FX3A 1A7QH 1N7MH 2CIIB 4HJUA 3KVDD 3P73B 2QELA 5DQDL 3QXTA 5AW2B 2K8QA 5DK2A 1ZANL 3MREA 5C0CD 3GRWL 1A3RL 2ADJB 3E9TA 1FSKC 5IFJA 2DWDB 3DGCR 4LQFH 3BOVA 1OGPA 1N2RB 3QYNA 3IRCA 1CQYA 2DQGH 2B59B 2EAEA 4Y2LA 4HV8A 3ABGA 3IJSA 1RZ7L 4ZFZA 3CLWA 3IXTA 1UCTA 1JZIA 1GZQA 1LO0H 2R1XA 3DOSB 4XXWA 1AOZA 3VXMB 1PCXA 5F7KC 4FTVB 2X4PB 4GW5B 3PYCA 4E9XA 4CJ1A 2VC2H 5T5NG 1EGJH 4P4KB 4ZO9A 4PWHA 3ZMEA 2J12B 4X5WA 3AGVA 2CCWA 1P7BA 3M1BA 4HCRL 4YSOA 1B2WH 3QT2A 3FT0A 5A3IC 5ERWA 1KN4H 1XIWD 1A7RH 2EEDA 2IQ9H 3DJRA 5E56A 3TZVB 4EOWL 5JNYB 2DAVA 5KSVA 1HQRA 3T6WA 3L2MA 3O45A 3BLPX 2GIMA 2DMCA 3T5WA 1VEMA 5EBLB 3RIFK 2F7IA 4KOCA 4ZO6A 1CO1A 5CILH 4Y89A 5EN3A 3HZYA 2WINA 1FO0H 1JZJA 1RUQH 1KGCE 1FIEA 2FNWA 3LZOA 4HUUB 3W9EB 4EQ3A 1NBVH 2OL3L 5C7XH 4Q56A 4OF8A 1FH2A 4Y4FB 3EFOB 3PXLA 3OAYK 2OZ4A 2CE6A 4MJ2A 4AITA 3NBNA 4FYSA 4JS7A 4WU5B 2CHWA 3HG1E 5TF1H 2JF1A 1DJGA 4LSQH 4JFOA 1MKFA 3K5SA 4E2OA 5E03A 3VWJB 5A2FA 4HUWA 3EYOB 5F1NB 2O5YH 5ISZB 4KMLB 4PJXE 2AK1H 1DN0B 5L4FA 4FXGC 1FJ1A 1GYUA 2G3MA 3O4LD 4FQXB 2BSTA 3FU0A 2ED8A 1RZKH 2RH0A 3CDCA 3DXAB 4NN7B 1S7VA 4U0QB 4XBEL 3JT0A 3L3IA 5LCVH 1CGSL 1IFHL 3CFMA 2HAZA 3UYOD 1U3HB 1TKWA 1WGVA 2R9HD 3PXHA 3PGFL 2VLLB 3A6BH 3V4VA 2Z35B 2IH3A 3QI9C 5DDHB 4C8XA 1QYGL 2GKIA 4WDIB 3DV6B 4C54A 1IT9H 5HY9B 1TJIL 5CO1A 3UTTE 2WLNA 3DV4A 5AAPA 2OJ1A 1UJ3B 4H8PA 1H19A 1IAOA 3ESUF 2FT8A 2QLYA 4NKOA 5GS1B 4W4OC 4Y5YA 4AGMA 3FQ1A 2H6PA 1MHHB 2J4WH 4LCUB 4TUJB 4DK6A 2HUHA 2ODHA 3BMVA 1IILE 1KY7A 4GQRA 1KBGH 1UXLA 1OSYA 3C6EA 4I9WD 3FTGB 4MDJA 1KC5H 2P24A 5T3XL 4LBEB 1L9NA 3SO3C 4OZIE 1E30A 5BQ7B 3H8NA 3WHXA 2HJFB 4CVWA 3UTSD 1GXEA 2BP0B 2FB4H 3JBG7 2WD0A 2FWLB 1BD2A 1TU2A 4AYEC 3EO0B 2EP6A 2X7LB 2VAAB 1M05A 1U8IB 4MX7A 1NKRA 1T6VN 3BFWA 3QUYD 5HDRA 3MV11 2ZWNA 3QARA 3GJFH 4GKNA 4OJFH 1WD8A 4E41A 3PAUA 2ZP0T 2VN7A 4F7MA 1MREH 1NBZB 5DEGA 3GWJA 2WSPA 3CXHJ 4NIYE 2NUTA 1EBPA 4FXTA 4WWOA 2EDBA 3KNBB 5DRXB 1JIBA 5HPOA 5EIVA 4ZD3L 4PJ9C 1XF2B 5J11C 1LL1A 1Y1UA 2OMZA 2YPLD 3RPBA 1AZCA 1J8HD 4XVOA 2Z4QA 3LKOA 3QFJA 1KCRL 1QO3A 1OPGH 1RUAL 3SE8L 4M7KH 3BWAA 4XXCA 5CU5A 5C09D 2MQCA 5IESH 4LAQL 1I1FA 1RZJL 2VITB 3GSRA 5FOBA 4O2FA 3OXRA 4HGMA 1FE8L 1VESA 4Q89A 4WFHD 4OCXL 4XXDA 5B8CC 1WCQA 4BRVA 5F70A 4FA6A 4JPWH 4PJCB 2F7OA 1S3KL 1YVLA 3V52L 4TUOB 2DWSA 2AEQH 1HILA 2NY5C 3B5GA 4IBVA 1EA9C 3INUL 3MA7A 2E7BA 3WKPA 1NANI 4ICWA 3H42H 3LV3A 3QEGL 4DSYA 3WFEH 4MNGA 1W72H 2VLJB 4HUMB 1PEWA 5KYWB 5HVFB 1DQML 1LO5B 1NGWA 2HP4A 3IKCB 3VG9C 5FM4A 3RWGB 1U95B 2J3SA 2EDLA 3GFUA 2LU3A 5K1VA 3PP3K 5F7BA 1ZGLB 1X5ZA 3P0GB 3TEXA 5BOJA 1BQ5A 2VLKB 1JE6A 3W39B 1OAQH 1MCCA 1CK0H 4KTYA 2CO4A 3MODL 3G9VA 3FTXA 2O5ZL 5CJOL 2QKIC 4QOKE 5DMKA 5LBVA 5C6WH 1W0WB 4GRWF 2ZUQB 4G8EA 4N9GB 1AZUA 5CIPA 4ZOAA 2P5WA 3SE9H 1EAPB 3X12A 4GRMA 4FABL 5IMOA 2C3HA 1X5XA 2ZWLT 2WZPA 4GXVL 4H8VA 2F8VA 1HVXA 4IKLA 4K7FB 3VGBA 1V10A 1C7SA 2F53D 2L7UA 4NO5A 4TMPA 2O61B 1ZV2A 2PWHA 1R47A 3K74B 1FG2B 4FJ6A 2R4SL 3DRQA 5FUOH 1QHQA 4N86A 2WQSA 1FZOA 1UA7A 1TTCA 1YY9C 4DF9A 5IR1A 2COQA 4GW1A 1M7IA 3Q8FA 3HTLX 1TO4A 4RISL 1CICB 2CGZA 3EOTL 5CM1A 2Z1KA 1JVKA 3BQVA 3MR9A 5CHNB 3ZTDC 3EKCA 2BC4A 3RTQD 1XTMA 4YHPA 1MJ7H 3GSOB 2YMXL 5D72L 4ZFOA 1A7OH 3TN0B 3DUUB 1QLFA 4TSBH 4WF7A 4ELMA 3C08L 4X9FA 2VC2B 3SKOB 4DCQB 2V5TA 3DWTA 3SDXB 3RE0A 2FO8A 5INCB 2P4AB 4PJDB 4BM7A 4QXWA 5G4NA 1BQLL 2QGEA 5JPMC 5HHME 1EEZA 2QTVA 1FFNB 5G4OA 2XRAH 4PSPA 3D3VD 4U1SB 4EZKA 3JWNE 2R7EB 1PJWA 3MCKA 4X4XB 2ZXEB 3UFIA 5HDQH 1BX2B 2XTJB 3T0VA 3EGXB 4IM8A 2CJSA 3HHMA 3AG4B 4YXHL 3TIDA 3EGSA 3ZVVA 1IUZA 1CXIA 2DL9A 2QPDB 3PV6A 4UYPA 1F4XH 3FB6A 3LNEA 2YRLA 2ZOLA 2WWOA 1QRNB 3MOQA 2R56L 2CHZA 1A65A 2OV0A 1JI2A 5HVHC 4LSTL 3HS0B 2WJ5A 1VACA 3F12B 4YHLL 1H5BB 2EDYA 1QTYT 5C08B 2JSFA 4HGWB 1QKZH 4Y9FA 3VXPA 4NQXA 3MRHA 4HW6A 4PV8A 4FMFA 3FCBA 4W9GC 4P9HH 2YPKA 2VDRH 4Q6IC 4G6ML 4J3UA 2ZOUA 4EKJA 3OXSB 3RNKA 5BS0D 3ULUF 1D5MA 4OFVA 3CVIL 3QSKB 4IEFA 2XHNA 3FAWA 4PTUB 2OCCB 3MRMA 3OHXA 1KDJA 1DBJH 4HXBH 2W65B 2HPTA 5ICUA 3H9SD 3T2NH 3LXCA 4HISA 3P77A 3GS7A 1UZ6F 1OP9A 2G5BA 2UVFA 3NZ8A 1S78C 4QRRB 2ITEA 1U3ZA 4NX0A 5BVPL 1LMIA 2FGWL 3BCDA 4G72B 3CC5A 4Y16C 3ZKMD 1KPRB 3ZDWA 1M71A 1P6WA 3WU1A 1HEJC 4R90L 4U4IA 4RWYH 1SN5A 3DHJA 5JW5A 3TA3D 2JK5A 2CIKB 2BVQA 5KS9B 5F9OH 3IRPX 4JO4H 1TCMA 2R4RL 5CJQH 3UERA 3RVVD 2Q9OA 3AM8C 2WCSA 1ADQH 3LKRB 3ARDB 1WJ3A 1I8MB 5DVNA 5DZJA 3C09B 1H3PH 3I6GB 1QACA 3RL1B 4RMRA 3M8OH 5D1QB 4W9CC 4FG4A 1J87A 4PP2B 2A9CA 1JF1B 2AZUA 3D6GA 3L1GA 4N6QA 4TSCH 5DHDA 3QIWD 3LRSB 2OMWB 4MRCA 2F5BH 2A4ZA 3H4HA 4XPAL 2P3YA 3TF4A 1VADA 1DFBL 5D96B 5F0LB 3NSCA 1RPKA 2JELH 2TAAA 3O4LE 1HOEA 3MHZA 1AGDB 1V55B 3N1GC 4Q52A 4QNPF 3ESNA 2AJYL 1EJ6A 1TNNA 3HAEG 3GB7A 1L6PA 4GQPH 3X3FH 3VH8A 4RGMB 2BWIA 4YZFE 3BQUC 1CLVA 4LHJB 1VFUA 3UBFA 4Z7VB 4PRDB 4TNWF 3VTTA 3LH8A 3IJ8A 4P5MB 3ZKXC 4FQHA 5DD6A 1UXSA 5J6GB 4MDIB 1A0QL 3ZN6A 4Z7QB 1HWWA 3RWCA 4NKQB 4YHKL 3ZE0F 1W8NA 4UV4L 4NNPH 3RZCB 3WENA 4Z76B 5EBMB 3TBYB 3RBSA 4R7DB 1GOHA 3TJEH 1GHFH 2FO4B 4U6YA 5K9JL 1EHAA 4I9WE 2R0WH 4KJPC 4CU6A 1AXTL 5AW8B 2Y25A 3N9GH 5FF6A 3WMQA 3IGAA 3IDIB 1M3JA 1YJDL 1INEH 2SEBB 3GTTA 3Q0HA 3GHEH 1A8JH 1F3JA 3B9KD 4M7LL 5D1ZC 3FQXA 3UTSE 1DBML 1FG9C 1KLFB 4AM0B 1WBXA 4NENB 4NWUH 4LCCC 2YS4A 1IM9B 3PV7A 5EF0A 1E4KA 1UZ8A 2Q3ZA 3RFRA 1ZANH 1I7ZB 3GRWH 3OAYH 1ACXA 1T0NB 1UKSA 3SBQA 4Q9RH 3BN9D 4LEOA 5LNDA 3WYRA 2IBZX 2BIQA 5HJBA 4IDLA 4WTZA 1XEDA 5BMFL 1J0ZA 1SPDA 5DUMH 3U0PB 3ZYOA 1ZSDA 2XBDA 4XB8A 1HZKA 4A37A 1WC7A 3QDGD 3IBOA 3LIZH 4BZYA 4LPWA 2DY2A 5DUPH 3QUZB 4UNIA 4C83A 3SDCD 1J8HE 2MQ3A 5JHMA 4D94A 4UQDA 5DJ8A 3O2WL 5C09E 3L3DA 2IMMA 2BXYA 3BE1L 3HBPA 1BEXA 3MGTA 2FATL 4WFHE 5FFOA 4HCRH 4XMKL 4H0HB 5AG9A 3BKML 3DA0A 1ETJA 2HX9A 3HC4L 5CSZB 1IL1B 3VI3A 4HOWA 1YEJL 4BFRA 3NIFF 3B4NA 4UT9H 4EOWH 1WHOA 4H25A 4LKXB 4MRBA 1KJVB 2JXMB 5D6CA 5D7JC 3HE7A 4OZGF 1I31A 3HVNA 4ZUTA 5LNEA 3VG0H 2DQDL 4ES9A 5E7FA 3KM2A 4J4PD 2W95A 2FWSA 3F6IA 4N2KA 3FSZA 2QGCA 3UTQA 4P2OD 4S2SA 1TSRA 5GZOA 2XN2A 4KI1A 2HVKA 3ZQXA 4LXFA 1AQDB 4UNUA 2O26U 3UP1A 1IM3B 2P80A 4PRNB 4FJZA 1TPXC 5MP6L 4YXKL 1UT2A 3WN5B 1QUNB 3QNXA 4HH9A 2UXFA 4KRLB 4N0FB 4NQCA 4PJHB 1TQUA 2OL3H 4YR6A 2IDSA 2X1QA 3TEZA 2V2WB 3ZYJA 3KGRA 5ICYB 1FH5L 4KK5D 2EKJA 5GGQL 3C60C 1ET8A 2KZBA 2NY1B 5K59E 4KK8C 1NLBL 1AGCB 1NCWL 4APQA 1J18A 2X4NA 3OPZL 4P5KA 1BAFL 2VN3A 2LT9A 5LN8A 5KBDA 1HHHA 1ZWIA 3U9UA 1LEIB 3ZMNA 2I7OA 2F53E 2BNRD 2I07B 4ZS7L 4AYFA 3GIVB 4G8IA 2I25N 1MAJA 1D7DA 4BSWA 3H55A 3ZTJH 1T7YA 2F9BT 2K7PA 4R2GC 1KYUA 5E99H 3RKDD 1IFHH 2YXWA 1QSVA 2NY4C 2GT9A 1MQKL 1EIBA 3PJSB 4G3YL 2Q76B 3PGFH 5HHNA 2NYYC 3UJTL 1DVYA 2ARJA 1TJIH 2GB2A 3GC3A 1Q9OB 4GBXB 1SN2A 1WZKA 3GGWA 3SGJC 1MCLA 1G0YR 4U1KB 2P47B 1I7TB 1AOHA 2DDQL 1T1WA 4J3SA 4LLUB 4CVZA 2VDRB 1E42A 3N43F 4KNQA 1I8UA 1SJVA 4KJWC 3H9ZA 1S7SB 1CZ8H 3V4PL 4OQTL 4NWTL 5EUOB 3I02B 1F4HA 4P23D 4JM4H 3TT1L 4WUKH 3UG4A 5K9QG 4KUCD 3LSOA 1H15A 3U46B 5C0IA 4PGCA 2J7LA 1MWAB 1ZDQA 1FRGH 3D3VE 1LHZA 3I9GL 4JFTA 3RYMA 4PJAA 4JQIL 3T8XB 4JFDD 3FRPA 4OLXH 1GKOA 2P26A 4BD4A 2XVKA 5AG8A 2XZAL 3LS5L 4N2MA 2PO6C 3Q05A 3WE6B 4UQAA 1D5BB 4P46C 1O7VA 2XTSA 2FCBA 3L5WA 3RJQB 1ORQB 1YEFH 4G1EB 1I8IB 1R3HB 3L54A 3RDTD 4FQLL 5C0BA 1F4AA 2WUCH 3VMOA