3MNDA

Crystallographic analysis of the cystosolic cu/zn superoxide dismutase from taenia solium
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
152
structure length
152
Chain Sequence
MKAVCVMRGEEGVKGVVHFTQAGDAVKVHAEFEGLKPGKHGFHVHEFGDTTQGCTSAGAHFNPHGKNHGAPDAAERHVGDLGNVTAGADGKATLDLTDKMISLTGEHSVIGRSLVIHVDPDDLGLGGHELSLITGNAGGRVACGIIGIAKSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Cu / Zn superoxide dismutase from Taenia solium reveals metal-mediated self-assembly
pubmed doi rcsb
source organism Taenia solium
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
total genus 41
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3mndA00
3GZPA 1CBJA 3MNDA 1F18A 1N18A 1QUPA 1JK9B 1BA9A 4A7SA 3RE0A 2Z7UA 4A7GA 1F1AA 2C9SA 1Z9NA 2WYZA 4A7VA 1TO4A 3KH3A 1IBFA 1E9OA 1SXSA 5KBLA 1IBBA 2K4WA 1E9QA 3PU7A 3QQDA 2GBVA 3GQFA 3GZOA 4BCZA 3KM1A 4L05A 1YAZA 2WWOA 1Z9PA 1XTMA 2NNXA 1Q0EA 2XJKA 3K91A 1SPDA 1F1GA 1E9QB 4N3TA 1OALA 2C9UA 2AQNA 2Z7YA 2GBTA 1S4IA 1XTLA 2WYTA 2AEOA 3ECWA 3L9EA 1KMGA 3F7LA 3CE1A 3HOGA 1IB5A 1JK9A 2VR7A 2AQTA 1PZSA 2ZKYA 1EQWA 4OJAA 1SOSA 3F7KA 5KBMA 3T5WA 1N19A 1RK7A 2WZ6A 3GTTA 3QQDB 2AQPA 5CU9A 1HL5A 1B4TA 2Q2LA 1ESOA 1U3NA 4A7TA 1XSOA 1YSOA 4B3EA 1E9OB 4A7GF 2AF2A 2AQRA 3ECUA 2JCWA 2V0AA 3GTVA 4A7UA 1PTZA 1DO5A 1JCVA 1UXMA 1SXNA 2Z7ZA 2WKOA 1PU0A 1HL4A 4U4IA 2ZKXA 1CB4A 2ZKWA 1F1DA 2WWNA 1EJ8A 3GZQA 3ECVA 2WKOF 3KM2A 2AQSA 3KBEA 3S0PA 4N3UA 1L3NA 1IBDA 4MCMA 2R27A 1MFMA 1YAIA 3CQPA 1SDYA 3MKGA 1E9PB 1SRDA 2APSA 2ZOWA 4MCNA 1OEZW 2AQQA 1E9PA 1BZOA 3KH4A 1SXBA 1B4LA 2C9VA 3H2PA 1SXZA 1OZUA 2GBUA 3SODB 1OZTG 4A7QA 1UXLA 2LU5A 2VR8A 4BD4A 4FF9A 1OAJA 1TO5A 2JLPA 2VR6A 2WZ5A 1IBHA 1FUNA 2XJLA 5KBKA 4OH2A 1DSWA 3CQQA 2Z7WA 2WZ0A 2E46A 2SODB 3HW7A 3LTVA 1COBA 1P1VA 1SXCA 1AZVA 3L9YA 2E47A 1SDAB 3H2QA 1SXAA 3KBFA 4BCYA 3HFFA
chains in the Genus database with same CATH superfamily
4KZCA 3SPJA 2D2OA 1QEWB 1IX2A 2X44D 3EBIA 4GT7A 1BA9A 2NY2D 1TQVA 2KL6A 5TDNA 5L2KB 1HC1A 3U4BL 3R1GL 1RQ5A 3KGTA 4HDIB 3EJYD 3GRWH 1A6WH 1IBFA 3RGVD 4Z7QB 4F37F 3US1A 3GUTA 4ZMQA 5BRPA 1UB5A 3LKQB 2PTVA 4XMKL 4L0PB 3F7PC 3N5AA 1HXYB 1E6OH 1NLBL 2J8UA 3QEUA 4ZBJA 4AL8C 1VZIA 3M6DA 2AXWA 3T77B 4YDLB 2DWXA 1J0IA 2EDHA 3N1GC 5D6CA 5FO8A 2YMTA 2HWZL 5IOPA 4HUNB 5KVEE 4OCXL 1SPDA 1OCWH 1KEMH 4Z6AT 2NY2C 3R4RA 1NCAH 5JW4R 2CA4A 3CSPA 1ZHLA 3TT1L 1E4WL 1F4WH 3H9SB 5KANG 3A0OA 2MTPA 1GS6X 4NCC1 3TNNA 1AP2B 3WHE1 1XSIA 3TF4A 1DVYA 4LSQH 3VMPA 2V5RA 1R75A 3K2UH 4KXCA 1O7SA 3V0JA 3BSZH 1XZ0B 3D85D 3LRGA 3BT0A 3ULUD 3OKOB 5EIIB 3MRBA 4KROC 4AKPA 1LDPL 4OZGF 1GGUA 1R33A 3IGAB 1L0QA 5EBGA 1F3JA 4FFYH 4LEEA 2ZZUT 3RL2B 1X7SA 4QMEA 4WHTA 4ZS7H 1FV1B 5CLZA 5IIEB 4IQHA 4NIKB 3DC0A 5DURD 4PV8A 1MFCL 1NCDH 1AGEB 1RULL 4DGYH 1P7HL 4BWUA 3GBLA 2DQJH 4G70B 1CJYA 1NCNA 2VOTA 4KKQA 1AI1L 2BJML 4LCVA 2W9DL 4DKTA 4LSRH 3CSYB 4GRLA 2DWEB 5EC2B 3LEYL 2N4IA 4NUJB 4HF5H 2BVPB 3HUJA 2CBOA 4MAYD 3V0WH 1ZE3C 2VQUA 3VXSA 3T0DA 3SO5A 5F6IB 3PWPE 1HI6A 1U91A 4Y8DC 5BOJA 1Y0LA 2UWEA 3QEGH 4F9PC 4LASH 3ZE1F 1PG7W 4ZTOH 3PWNB 1JOIA 1NCCL 5J6GA 1VADA 5CAYB 5D7IA 1MG2C 5IF0B 1J5DA 2KLSA 3AXLA 5C0CE 2X4OB 3QFJD 1LO2H 4YLCA 2JJUA 2LU7A 1BXVA 4MA7L 5C3TA 4FLHA 3FSOA 1T7WA 3Q8AA 1TEGA 4YHYC 4RA0C 1DSWA 5KVDH 4G6FB 1AGFA 2DQUH 5CGTA 2CA3A 4OR1A 3P0YL 4G80B 4ACPA 2HJKA 5JXAL 4HAKA 1KCLA 3G6JE 3IRCA 3PAZA 5IJCC 4N20A 3Q3GA 3BP5A 4WWOA 3NJHA 4IBQA 5FDYA 4YR6A 4AX3A 1LLAA 1N8OE 4QUOA 2EDWA 5HI4C 3TX4A 2X6BA 1GY2A 3P3YA 3CZLA 2YD5A 1T0NB 5I0VA 2H2SD 1Y6MR 2VDKB 3HI6H 3HHSB 5GS0D 5BXFA 2R2BA 4QXVA 4B0MM 3BUBA 4DPBX 5F2FA 2K45A 3VGAB 4HBQA 4KH2A 5EBWA 2ZWSA 5CZVH 4UNTA 5I66A 4D7PA 1E27A 2B7DT 3FQ1A 4RWHA 5CGYD 3LYRA 3FRPG 2MKLC 4GXVL 4UOW1 5DQJB 2VZOA 1A6TA 3ZTDC 4PVBA 4PJ7A 3K8KA 2NT1A 5EBMB 5FDWA 4X7TB 5AOLA 2YEZB 4M8QB 3IFNL 5BV7B 4BRJA 1BX2B 1LO0L 1U3ZA 4N2MA 5FB8B 3HKZA 5D70H 2AQTA 2YPKB 4WFHE 3V9EA 1BD2D 4JRXE 4PVLA 4QNPF 1JHTB 1V5JA 5A2KH 2IPUK 5DJCA 4Z95L 4MVBD 3GRWA 4LOEA 3DBXA 3IJEB 3COOA 4MXWL 4CVZB 1RIUH 1OARL 5E5MB 5AD0A 4M5SA 4XN1A 2IDCA 2AEQH 2GTQA 1MI5B 2EYSA 4QHLB 2QVTA 4X99A 2XWEA 1FZKA 2O5YL 1C08B 4YHKL 3C09C 3TBSA 5E1GA 2XZZA 5E9DE 3OLGA 2AQ2A 1YEEL 4KTEL 3S34L 1PZDA 2R1YB 1LMKA 1CCZA 3VFTA 3I6SA 3L2NA 3MCG1 1A1OB 1HL4A 2YUWA 4XP4H 1YECH 4WW2C 4DTGL 1CTNA 2MCPH 1JTTA 3FO2B 3ZL4H 1MFDL 2WXJA 3WNPA 3ALXA 4PMEA 4A63A 2G4GA 1NDGB 1UA3A 2UV3A 4CC0A 5HHQA 5BRZD 4TL4A 1YAIA 5TPWH 3U0PB 4OAWA 3VXSE 4OLWL 3H55A 5C09D 4KTDH 4JZOB 1QFWL 1CFTA 1PAZA 4WNJA 3AQZA 4IOSD 2OBGA 1FZJA 4F7TA 3JTTA 4GFTB 4EIBA 4U1JB 5L4FA 3RQ3A 1LQBC 1BIIB 3HTLX 3PNRB 3IMVA 4XXCC 1J88A 3VXME 3IS1X 1B2WL 5D72L 5F7MC 5HJ3B 3Q2CA 3MJ7A 5AW8B 1BQHG 1R24B 2X1XR 1KCSL 4MAZA 4ANKA 5C97A 4OSUH 2AVFA 2X4OA 3LZRA 4J8QA 3CPUA 2WQSA 1JD9A 3BAIA 3DXAB 4JE0A 1JV5A 3ZKXC 4Z77B 1V7NH 2XRAL 1FVDB 4GW1B 2VAJA 3RKPA 5J5EA 1PQZA 2F8OA 2XZAL 3MUGA 5JW5B 2FRGP 2FO4A 3VYNA 4FA8A 4FULA 4XBPA 5CEZH 3EUUA 2ATPB 2YIHA 2ZCLL 2NXYC 2HJKB 4FFZL 4JDVA 3J07A 3BAKA 1HVXA 4X5RA 1MREL 4G42A 2I24N 5TK2A 5BS0D 5CEYB 3U4EA 4AQEB 1B4JL 5F1NA 4RIRA 3D1MC 2K8MA 1LMIA 3L4WA 3RIFF 2DQEL 1ZJAA 4J6RL 3QJFB 2HTKC 4XNUH 4ZQTA 1I75A 4NQXA 1CVRA 3P4MA 3X14A 5IBLC 4CVXB 5IR1A 5I1IL 5GISL 5FXCH 4DVBB 1JZFA 4M5YH 2W5PA 1XGTB 1WFJA 2AEOA 4X4XA 2FHFA 4JCWA 5DZAA 2ODIA 5EOQL 2EH7H 1OAKH 4OT1H 1EO5A 3VFVB 4KZDH 4PEEA 2PYEA 2Z91B 1DN0B 1MCNA 1FNHA 1NEZG 1JN6B 1A9VA 3E7JA 1F97A 5J12C 1M7IB 3WTUA 3REVB 2OZ4L 3DX7A 1BYPA 1GW0A 1Q9WA 3FYIB 4GBXB 4HIEA 1EHKB 4L1LA 4LU5L 3DRQB 1KXTB 3WJJA 3CFEA 2DLEA 3MA7A 4S1RH 2CWRA 2EABA 5I8KL 5I74C 3MLYL 1AGFB 1BOYA 1ACYL 3O6FA 2QGCA 3FQRA 1GMEA 4QWWC 4CMMB 3BVUA 4UNVA 4B3VA 2QSCL 5C0DB 4XX1G 4M62L 5JYMA 1S5HA 2WQWA 2YEVB 2BSSB 3GHEH 4QEGA 3V0VB 1FPTH 1VGEH 1S7SB 3H9HA 1K3IA 4BGLA 3U2JA 1BVLA 4PRBB 1CFMA 4XO5A 1NDMA 2AQSA 2W60B 4XPBH 5LKNA 2J1WA 3NQKA 4BK8A 3PREA 2WSDA 4Z7WA 4ZRGA 3T8XB 2ICWB 5DLLA 1BZ7B 2ZUQB 3F7QA 3FO2A 1H3XA 3QHFL 1TQCC 2R83A 2WQVA 1EJFA 5GSVA 3EGSB 5IP4A 2P80A 3FC8A 2WZPD 1W72H 1JGEB 4EUPG 3B5TA 1K4DB 1NUFA 2G9HA 3V7MA 2ZWZA 1FN4B 4JDZA 5T5FH 1TVHB 1PNDA 1U8HB 1Q0YL 3T3PB 2FATH 4ES9A 5FK9A 1XF5A 3NFNA 4JY6B 3RPBA 2FBJH 1NGPH 4P4KB 3JTBA 2VISA 3F5WB 4K3HA 5DTFA 2DYPA 3VXRD 5IBUB 3RVVC 5T3XE 5L6YH 5HHME 4HP5A 3LS5L 4NZJA 2YMXH 4G1MB 5ECJE 3D30A 1MIMH 1UJTA 3KYNA 5CN1A 4MDJA 1DJZA 2XT1B 5F9AC 1AKJA 1L6PA 4B7IA 4IOIA 5KUMA 3I02B 3W56A 1WDAA 1O6SA 3FUDA 3TZVC 3ZN6A 1JYNA 3QJSB 1NCBH 4L3ED 2IH3A 3LSOB 4WEMB 3NA9L 1RUKH 4WDIB 3DWTA 2OMTB 3DECA 1N7MH 1KTLB 1KLUB 1UGKA 4Z7VE 3SZKC 4Q9CA 1NGWB 2WYHA 2WPGA 3EYUH 1W91A 2H8PB 5D1ZA 4HD9A 1C1EL 1RUAH 3FCTB 1CI5A 4ZTPL 2OSXA 3PABB 4CN4A 2GEEA 1H15B 4LHUB 2R0KH 3GIVA 3IDJB 4GIOA 3RTLA 4PJBE 2VWEC 4AYID 5F7AA 1UM6H 3NSFA 4H8WL 4WIQA 5TGBA 3RVVD 5E1HB 2WVTA 5DK0B 3C8KB 4UTBA 1OXYA 5C7XL 3R7QA 3WKML 5B1KA 2FIRT 2TSBA 1U3NA 2QT6A 3FO1A 3LKRB 2R0WL 4D3CL 4HBCL 5ETUB 1QWUA 3L8QA 3LRHA 3ARVA 1FLRL 3RDJA 1A6ZA 4FNTA 3F04A 4TVPL 1KV7A 1WUZA 3HNSL 4X4YA 5FECA 5CSBA 3DRQA 1YYCA 4PUBL 1BF5A 1U58A 3ZMEA 5G4OA 4KV5E 2VMDA 2Y25A 2GSMB 12E8H 4ZTOL 3B6SA 1MCHA 3KPPB 4KNTA 4XHJC 2AJXL 4M43L 3LQAC 4LCUA 3VSVA 4ZPVA 4H25A 5AAMC 1XGRB 2H9GB 3ZOAA 3VW3H 4MNQA 4YXKL 1T7XA 3VWJA 1G9HA 3EDKA 3OKKB 3HPLB 3MRDA 1HKLL 3OQRA 2Q86B 4BWWA 2A74B 3NPSB 1HESA 3TYFA 1FH5H 1NCDL 1OO2A 1IE5A 1YQVL 1C5BH 4JVWA 4JRYA 1CXEA 4OH2A 4QWWD 1AD9B 3ZHDA 3RHWF 5IREA 1TJGH 3KYMB 3FQ2A 4OM0L 2Q7NA 3H8NA 1YZZA 4FQJL 5F7DB 4EOWH 4ZX3A 3K0YA 1CXIA 2FEDD 4BH8B 1LDPH 4BCYA 1UM5L 5D7IF 3FFCE 4XNBA 1A1MA 2Y36H 3SDDC 3G5YA 4JG1L 2UVEA 4CW1B 1CTOA 1TKWB 4R2GD 1C12A 4HKBA 5C07D 3PGFH 2WUCL 4PI0A 1ZT7A 4FQQA 4G8GE 1M05B 2IALB 4XN7A 3AMLA 5ICXA 2CDEB 2WLLB 3OBAA 1RVFL 4ODVH 4AGQA 2E76C 4UQIM 3AC0A 1P7KA 3PNWB 1DVFB 1G87A 1IAIM 2CKBA 3MTRA 1HNGA 3E6HB 3KWXA 2J3SA 3CHSA 2X4QA 3BWUF 3VXUA 4Y4HD 3IXAA 5AW2B 2ZICA 4E68A 1MHEA 4AEEA 2F54A 1KXVA 4G6AD 4YQXH 5J3HD 2EXYD 2Z31D 2OZNA 4MCZB 4PJCB 1L9QA 3HAEG 3GMLA 5HP5A 2HKHL 5E9NA 4QF1A 5EC2A 2UZXA 1OTSD 3GRWL 4V33A 4YSAA 3CE1A 4FOMA 3OKLA 3NK3A 3SGEH 1UASA 5DFTA 1FG2A 4EI0A 1NC2D 4ZFOL 3BSGA 3NDYE 1YYLL 3Q43A 4ZUUB 1KT2B 5CD3A 1FFNA 4WDIA 3DOHA 3VGDA 3LQZA 2PW2A 4MXVF 2IDQA 3IN0A 2Q7YA 3SDCB 4PJCF 4ZS6D 1W0VB 3MV01 2EXYC 2Z31C 4CMHB 4Q0XH 5J56B 5HVWA 2XLLA 4R83A 1DSFH 3HMXL 4DZ8A 2E7MA 2BSRB 1QRKA 5BPPA 4ILDA 1T7YA 3VTMA 3MV9D 1WYJA 2GT9A 2W0FA 2OL3A 2WQUA 2IMMA 2XA8H 5B38G 3WXVL 1BF8A 4J39A 3RG1C 1RJYA 3CFMA 5GZNA 1JDDA 5AWNL 4AQOA 5D9SB 1DEEB 5CSZA 3TIEB 2PPDA 1WICA 5JHMA 1DN2A 1PCXA 2C4FU 2CR0A 1T0NA 2DV6A 1A4KA 3L5WA 4X4YB 2VERN 1LILA 1CF8L 3FFDB 4TLTA 4UIKL 1VKXB 4CN1A 1U42A 3JWNG 1VGKB 2YUXA 5I75C 2CRMA 2B59A 4HH9A 4ODVL 2JJTA 6TAAA 1U8NA 3QS2A 4U6YA 4CRPA 1CD1A 4J12A 3UZEA 2WN2A 4Z3HA 2J5LB 3PGFL 1NGWA 3EGDB 1Z9OA 2ED8A 1WHPA 4APXB 4HSAC 1NAMA 3NDZE 4DERA 1RPQA 2E47A 4GSXA 1Q1PA 2BWIA 4X6CA 4O51A 1SHMA 2OTWA 1VACB 1ZY9A 4GI8A 5H2BB 1NM9A 3JV5A 3V6ZA 4F9LC 1MELA 4LOVA 1ET5A 3GS4A 3QJFA 4PGBB 2DMCA 5KYXB 4HWBL 1QR1A 4P46C 1L3WA 3GXTA 1A1NB 2PF6A 1YDPB 2HFGH 2VUKA 5SWZB 5EEZA 4J3BA 1MNNA 2YAQA 3N85H 4O2EA 4N2OA 4P2YA 4FN0A 1FH5L 2EYTB 1RFDL 5GJTL 1S8DB 3GO1L 2XZQH 5FYKD 2G3MA 5IBLD 3DOIA 4LKXA 4KWUA 5T1JA 2C9RA 4Y1TA 1JMXA 1Z3RA 3AABA 3PU7A 4IDJL 3S98A 3VD1A 3B43A 3WSQL 4JLRA 4WCYH 4Q74A 2GVYA 1T4KB 1YUHB 1KTRL 1M3JA 5DHVB 5TF0A 2JJSC 1MCPL 4FFVC 5IHUH 2NXYD 2P8MB 4DEUA 1NL0H 3MU3A 5IKCB 1FE8H 1EERB 1XDTT 5LBSL 1QEWA 3WLWC 4LVOB 2OP4H 1YEIL 1BXAA 3HVNA 3MYJA 4O58H 4PRAB 4WI8A 3V10A 4PUBH 3RZCA 1OTUC 1JGVH 4Z7UA 2PPEA 2O30A 2DL2A 2NY7H 5AW9B 2XTLA 3D3VE 4KVCL 3OXSA 1NEZA 2VIRB 2BS71 4MD0B 2YK1L 3EZ8A 5IVXE 4GO9A 2O4EA 3DV4A 3WIIL 3G7TA 3TBVB 4E9LA 3F6LA 3CVBA 4HT1L 1C7TA 2OPCA 4NWTL 4GUOA 4AVJA 4Y1AE 1MQKL 5K1VA 1BZ8A 1OB1B 1J9SA 1AJ7H 3Q8CA 3HCVB 2FJHB 3ULUE 1TZGL 3BQVA 3ESOA 2X6CA 4AKQA 3VFWB 3RY4A 2Z65C 2NZ9D 4JDTH 3GD1C 1X6LA 4JN1L 1ZS8A 3T71A 2ZX7A 1DLHA 4HPOL 1ODUA 1MF2L 1EZLA 1JV5B 3VXTA 3KCPB 3MLVL 4JDZB 4AEIH 1P84J 3OKDA 4G72B 2R1XB 2CDEA 2HKAA 4AC2A 2B2XL 3HAEH 1OEZW 4UTAA 1PG7L 1KN2L 4ZO8A 2X1QA 2ZUQC 4MMXC 2FT8A 2HVKB 1ZDQA 2D73A 3ATEA 4HQQH 5I1HH 1XB8A 5FO2A 1DUZB 1WEJL 2ENSA 4GMTH 3THML 4I0PD 2PP8A 5F7FA 2OR8A 3QDMB 4F1ZA 4G7SB 5D7LA 1OHZA 4NSKB 4PREA 4QF1B 1JPFB 4I88A 4G7YH 4NUJA 4TSCL 3PL6D 1OOWA 2XVGA 1V8HA 3PJNA 4PG2A 1IM9B 3L3HB 3N3EA 3OD3A 4AMXA 1TSHA 3BP7B 2FATL 2XG4A 4RAHA 1DBAH 4Z3FA 4NN7C 1ETJA 4NRYA 2E7LC 2V2WA 3UYRH 1ZSDA 5EV7A 5C0GA 5KN5B 1Q0XH 2E27H 3IEAA 3INUH 4XVTH 4GBXA 4EF3A 4R90L 4AJVA 4PQXA 2VXUH 3HE6D 1SQ2N 4JHBA 4U0RB 5H4YA 3X1FA 4RIRB 3RGHA 3CFEB 2Y0SA 4JS7A 3QDJB 4PLOB 3ZE2F 4DZ8B 4YK4B 4B0MB 5TGBB 3QNYB 2GITB 4YHIB 1HHJA 3CX5J 2YQ3A 4IJTA 2AXFA 1P53A 4JDEA 3HUJB 3GMMB 4KFZC 4LCWE 4L37A 1JK8A 1UWGH 1A14L 4P04A 4XPBL 2KI6A 3VFVA 4TUOA 5HJGA 2QL1A 4HFWB 4KXZI 2OA9A 4KVNH 1JNLH 3FT2A 4KOCA 4AYFA 2EZ0C 1AXSB 5B39B 1I8IA 4I18A 3VD4A 3ZIYA 1RPUA 3FAXA 4OZGA 3RWJA 2PTUA 4IGBB 5FUCC 1IAKA 2KUTA 5HHNA 3ULSB 3OWEA 2Q2LA 2NZIA 5C6TH 4FQHB 4EXPX 5JIHA 3QUGA 5F7LB 4B9ZA 4QJ3B 4XAWH 5DD0H 1UKQA 1GGIL 2J6EL 4JHWL 1BD2E 4JRXD 5AVZB 4HUCA 3ZL2A 4U1IB 3OPUA 1OSPH 3U6XS 1T89A 4UT7L 4XHJD 3B56A 3PE9A 5T1MB 1SOQA 1N5YH 2EDTA 4Q9RL 2Q86A 1UT2A 3D12B 4MA8H 2VLJA 3GUFA 1RZIB 5EOQH 4G1EA 3VO0A 1I8KB 2YC1B 5HVHC 2FSEA 2YQGA 4MJ6B 2BY3A 4M4RA 5SWSD 4FCHA 4HIJA 2EDEA 4PSPA 1LP9A 1LK2B 4AYGA 4MZRA 1DLFL 3L95B 3NTCL 1UXSB 3BKML 3G6DH 4P9ML 1QLFB 2CHXA 2EIDA 1KTKE 3T8VA 1P4UA 4L4VE 5B8CC 1EAOA 1FZOA 2VDPH 2DKMA 1ZT1A 5E51A 2Z64C 3QS3A 3FTYA 1MREH 2CGYA 3ISWA 3HC3H 5FDWB 4N6RB 4FAAB 3AUWB 2AV7A 3LZFL 5ICUA 4ZD3H 3NJVA 3UCQA 5KVGH 3AGWA 3H3BC 4UILH 1JPEA 1LWJA 3QG7H 5FUOH 4F2EA 1Y7VA 5D93B 4BZ2H 3W38A 3KYAA 2AXGB 1RL1A 1RJLA 3QRGH 1NIEA 2X3CA 3RB5A 4P49A 3LPPA 4J28A 5CLXA 3TCLA 5BNXD 1B2WH 5D72H 5IHHA 3NACL 3HG1A 4WTXA 1WZLA 2PWEA 1AG0A 5EB9A 3TBVA 2OW6A 5GRXG 4UV7L 2XNAB 4HULB 5DD0L 3OKLB 4HEPG 3MUJA 2DEYX 4U7MA 1E9QA 3GKWH 5ETUA 4P5RA 2OM5A 5I26A 3B2UD 3L1OL 1U92A 1N59B 4P5MA 1GVIA 3CFQA 3I74A 4R84A 3K91A 4CDGC 1RURH 4YBQD 2O61A 2E56A 3T8MA 5A6MA 5F1SA 1XHHA 4DOHB 1U58B 1YECL 3GSXB 2R1XA 1AZRA 3NJFA 3ARDD 4XP4L 4OCWL 3I50H 3NCCB 3P3RA 5DYOB 1KGCD 4X5XA 1F2QA 4XMTA 1X4ZA 1YY9C 1JZ7A 4Y4KD 3E3QE 1TEFA 1AR1C 1T2QH 2H3XC 3DARA 3O4LA 2A9BA 2YN3A 4R5TA 2R7EA 5C08E 1B4TA 5ALBH 3T4YA 3X3FL 5IB2A 2VN6A 3UIZA 5I1DA 1R3KA 3GZKA 4NSKA 4PREB 2CAKA 2Z93B 4NQTA 5IVZA 1EDHA 1NC4B 1BEYL 3K6SB 4HJEA 2JTDA 4Z7IA 1MZYA 3CGTA 4H20H 4RISH 5IROA 3H53A 3OC5A 4NCC2 5BMFL 3JUZA 3DMMC 3RIAK 3WNLA 4LPWA 1N12A 2H26A 3FTSA 1D5MA 3GBEA 5HI3C 3VQ1C 2ZKWA 3IFNH 4Q9RH 4NWUH 1JJUA 1MVUB 3VFUA 4WTWA 2Q2EB 5BVPL 1T5KA 3MSPA 4TLKA 5DJ0A 1BYNA 4UQ2B 1F0LA 1TLMA 2JXMA 4GXVH 3VWJB 3NP4A 5IM7A 1SDYA 4XAWL 2ZUUA 2YGOA 4S2SB 3C5SA 4P05A 4JFFD 2D7MA 1ZWIB 3DHPA 4XRCA 3V4VA 2BVEA 4F7EA 4P99A 1KIQA 1MLBA 3V6ZB 1KGUA 4YE0A 4M29A 1X5AA 3TO4C 3S35L 3S6CA 5I1HL 4PGCB 3HKFA 4NI6A 2FSEB 5AL0A 5FC9A 5C0AB 3WAJA 2QDWA 3LZQA 1KGXA 3MLZH 2VSKB 4RAUB 5GQBA 1BOGA 4N8VA 3B9KD 3VXRB 4GSUA 1AIFA 4BE5A 2A6IA 4N2AA 1NQBA 2HFEA 2QHRL 3QIBC 5DSCA 4RQQA 1S2EA 2NY4D 3IFOA 3ZUCA 3F05A 5MENA 4FYQA 1T21A 5AAWA 4Q56A 1FYTD 5D71L 3RP1A 3V4PB 3ULSA 4HIXH 3HS0B 4K9EL 4PRAA 4G6JL 4M3HA 1PEZA 1SEQL 2F74A 2O26U 2DL9A 3ZDZE 1TYRA 2BSSA 4Y4FA 4MNHB 25C8L 3INUL 5FFLA 1P2CB 1XR8B 1YPZE 3V79C 4OLUL 1CURA 1QAWA 3O9WA 4RMBA 4BYHA 3QA3B 1XCQB 3B7TA 4ADGA 5MHSE 4OZIB 4BCZA 5EEUA 3TV3H 1UCBH 1NFIA 1DBAL 3FK3A 4KX8A 3HZVA 3UDWA 4GQQA 2D9QB 4KC3B 2NXZD 4PJBA 1RU9L 4FXGC 5EZJB 2R1YA 5KS9B 5FHBL 1TF4A 1R9FA 1K5NA 1YPZB 2BVQA 1YEIH 3F7LA 3W0WD 5AVYB 4ZG1A 1BZ7A 1KT2A 1H5BB 2ICES 3CMGA 1DEEA 1ONQA 5CSZB 3S2AA 1UWFA 4Z7VA 4ODTL 4PJGE 1ZLSH 4NZFA 4JRXB 2VO8A 3BKYH 3D85A 3WSQH 1JNHA 4G6KH 3V6OE 3BE1L 4UMSA 5C0JB 4OCNC 1OD9A 3KGRA 1P7QD 1CDYA 3L4UA 3QJVB 3BH4A 3FUIA 3MLVH 2WLHA 3R06B 3VI3E 3DVNA 4UIMB 4ONGL 3ZE1E 4B97A 2CR3A 1NINA 3VFPB 1WAAE 1IU1A 2Q7AA 3QI9C 3SDDA 2IO5A 2X4NA 4LBAA 5C2BL 4TRPL 4PJEA 1A6UL 4UU9B 1QBLH 3FT9A 3LY6A 4XVSL 1BQHA 5E00A 2CK0H 3HC2A 2TRHA 1NCAL 5EZOH 4OGZA 2CM5A 1KEML 1CGXA 1CD0A 4AL8H 5IR1B 1UH4A 5HGAB 2BPBA 4KUZL 1U8PA 4P3DB 2XN9A 3T3MF 2EUVA 4NFBA 2Q6WB 2EEXA 1QMUA 2EDNA 6CGTA 4TPRL 1A7RL 3MVSA 1SUJA 3HI1A 1THAA 3HG2A 1AQ8A 1RHHB 5IBTH 1MFUA 1SXZA 5AKVA 3HC0B 1X3DA 2FCBA 4XMKH 4RFNB 2F2HA 1KN4L 2DMBA 3LKNB 2VLMD 1UADC 4M7KH 3V55A 4EUPH 4D8PA 4JREB 1FUNA 1L9MA 1HTYA 4PJIB 4QRQA 3T0EB 4K3EL 3VG0H 2OP4L 4QAWA 2X28A 2Z8RA 4M6AA 4UBDD 4Z8FH 3L3DA 1ZXKA 4WY7H 1NL0L 1A4BA 3FQRB 1TJHH 4NP9A 1CUOA 2KPWA 1EZVX 4B96A 2RALA 3TL5A 2JKIS 5B1AB 4X6CE 3VDCA 2ZOLB 4F5CA 4HWZA 1CFVL 3KHQA 1X5GA 2C9SA 2VLKE 2R29A 3KS0J 5ALCL 3U1PA 1DBKH 3HE7B 3EAKA 5GRYA 2ICWJ 1HKFA 3W0WA 1M7IA 4IEFA 4OIAA 4HK3J 3WN6A 1IL1A 1WG3A 3IFOB 1FHGA 2GBVA 1QLRB 4QTHA 5DJYA 4ATTA 2VRQA 5D2LF 3ARDB 2P45B 2P8MA 4Q2ZB 4F15C 1NUDA 4F9PA 2C9UA 1V54B 2WO2B 4X7FC 4PJAE 4WJKB 1PKQE 1NLDL 4DP7X 1BMGA 4JFED 4UQ3B 1F3RB 1UJ3B 4U1IA 5BUPA 4U3CA 3GT6A 3U0TA 2QTVA 3PWLB 2HT2C 4N0CC 5L7XH 4HPYL 1AC6A 2UZYB 3IFLH 1ND0B 4J8RB 1DJGA 1IGYA 4Q6YA 5CXPA 3L7EA 4PTTB 1EQWA 3RU8H 1OPGH 2DN7A 4GRWB 4CC4A 3MROB 2J7LA 2VDQL 1KCUH 3PUUA 4ANUA 1MPAH 1ZPUA 1OLZA 4JE4B 5E2TH 5SX4H 3GI9H 2AW2A 2JKNA 1J5HA 2YBGA 3VXUB 4FG4A 5D55A 5L8JB 5EU7C 4BFNA 3ROOA 3ULVC 1DYZA 4U1SB 1KFAH 1MW3A 5ILTL 4WK0B 2WXPA 2CCLA 4AVIA 1DFXA 5IEKA 4G6ML 4MB5A 2VXSH 4AZ8B 4DFHA 4PJ8C 2X38A 3QPXL 2XWCA 3VXTB 1IEHA 1N0LA 1S78C 3ABMB 4IRJB 2IH3B 2O6FA 3RUGE 2C4XA 1A0QH 5E70A 3QXAA 3FN0L 3DX1A 2VDRB 2HYMA 3RFZC 4MCMA 5C0GB 4XNZB 5KWYC 2DYPB 1XCXA 3A6BL 3LVEA 4YFDB 5DO8A 1OAZL 4MQSB 3O9WB 2VLLB 1D5BA 1YEGL 1BVNP 1CLOL 4JO1H 3CU7A 1X9LA 1C8QA 1QVOA 3FMGH 1YYLH 3L1FA 1AH1A 1KB5A 2NMSA 1ZMYA 5JHAA 3AGVA 3PP3K 3N40P 3BRDA 2VSCA 1CLYH 3QZPA 1IM9A 3TN0B 3F00A 3U7WL 3B37A 2NY1C 4DQOL 5IMKB 1BP3B 1CPUA 1PD6A 1GSMA 1SDAB 1MNUH 4G8IA 5KYWB 3IGLA 3PWNA 3KBFA 2OMTA 3VD7A 2NW3B 5IFAL 3CZFA 3HA0A 3QJTB 1F4YH 3ZMRA 2CO1A 3TEXA 1WFOA 3FQNB 4IIZA 2ITEA 4XZUB 4A7GA 1HZLA 3U6RB 1KTCA 1U3HB 4CVWA 1RVFH 1CYGA 3BMVA 2MNWA 1KELL 3ZL4L 4P3WA 4MQXC 4QHKJ 4FXGB 4YH6A 5DUML 4EVNA 2DW5A 4FZ8L 2NQ3A 2XTJE 2XXMB 5DZ9A 4X5WA 4ZAKD 2X89D 1TNMA 4KUCF 4O4YL 1SJMA 2VL5A 1ZPLA 3SKJH 3A67L 2FX8L 2X4TA 3MGTA 4FQJH 1Y07A 3PQYB 4QXGH 3OPZH 2GB2A 4XC3L 3QIUB 1KBGL 5E2UL 4P3DA 1C1EH 2D7TL 1I9IL 4LLWA 1G4RA 2HG0A 4AK2A 1TETL 1IB5A 4WTZA 4ZMNA 5BO1L 3PXJA 1RMFH 3DYPA 2CGRL 3HBPA 2Z91A 1OWRM 4JFDD 3V4UH 1NSNL 5HDRA 4LCUB 1FCCA 4K7PY 1YNKH 4AQAA 2EE2A 4DK5A 2V7HB 3VNYA 3TVMB 1L5GB 5EBMA 1YUHA 2CJUL 5C0BB 1A3QA 1KXHA 1WBXA 4Z7NB 4ZMWA 1Y1UA 4DVRL 4RGOH 4Z7NE 3P77A 4HOMA 5KEZA 4JRLA 3W1ZA 1BFVH 4XP5L 3FT4A 5FR3A 3U2SB 3GXDA 3CLEL 3GSOA 1WBZA 1JV2A 4Y5YA 1M42A 4JM0A 5AAPA 3WENA 2P5WD 5HVFB 4LRIC 4NZUL 2Q76A 3DGDA 1S3RA 5DMGD 1U4FA 5IW1A 1SF5A 4JBSA 4LHQB 2R29H 2Y2WA 4UYPA 1C16A 2NYYC 3SDXB 2RCSL 4OZFA 1INDL 1RIVL 3FL7A 4HCRA 3D09A 3C8DA 2GJZA 3C75A 2VLJD 4FABH 3GSNB 3GSNL 4AC4A 4KZEL 3ZY7A 4WI9A 2EKJA 1XCTA 2AEWA 1RUAL 3TH3T 1RK1A 2W0PA 4UQ3A 2E9GA 2VDNB 4Y4FB 4RAVB 4OGXL 4KDTA 1S9YB 2Y3AA 3IJ8A 4R97C 4WRLA 4XCCL 3JV6A 3CDZB 4MD0A 4H8PA 1Q1JH 1DQTA 3SJVA 4ECNA 1AAJA 3NIFF 4P23A 2BSRA 2ZWLT 3QXTA 2CLVA 5ANME 5GS0H 1WJ3A 3MROA 2FLBT 3NFSL 3P30H 4K55A 4NKOA 2E4TA 5IB1B 1F4HA 5IESH 5T3ZD 2VITA 3T6ZA 1N64L 2FEDC 3EO0B 3OR6A 1BQUA 2R2EA 3EYOA 2WYZA 3HLAB 4FYSA 3V6FB 4BIKA 4YPJA 3I6KB 5BRZA 8CGTA 3O3EB 1NCWH 2XN2A 3TWCH 1MQ8A 1BM3L 1E67A 2PW2B 3F62A 3UC0H 1DQKA 4JFEB 5T3ZH 3MV7B 1I7UA 2ZOOA 3LZLA 1T04B 1OK8A 2ZSVA 4YPGA 2WB7A 2ISDA 3SE3C 2GG1A 2FX7L 2Z3FA 3P9LB 5TH2A 4X0NA 3OAZK 2A6KB 3OR7A 4OLYH 3KEHA 2H1PH 1SJEB 4IRSD 2Z7YA 1JZEA 3QK0A 2R23A 1LO5B 2I07A 4KZDL 1FRGH 3NABL 3IMRA 3LIZA 4BQ6A 3HE6A 2YAMA 4M93B 1WGOA 3U36A 1W72B 4BA0A 2YPVL 3D2UA 4QHKI 1U8JB 1J5IA 1O7DE 2HVJA 1AQDA 2QZQA 2VDMB 4KROB 1CICB 1HOCA 1QOKA 4IGBC 4NQXB 3PQYA 5DVOA 3B2VL 3WTWA 1KLGA 1U8PB 2ZCKH 2V3FA 1YUKB 1T0MA 3KYOA 4L23A 4UQDA 2XDHA 3QEHA 4KK5C 4RAUA 4G8IB 5DD1H 5KYWA 4JQXA 2NX5A 1CD1B 1OM3L 3BZ5A 2WY3B 1K4CA 1V7NL 2XRAH 5DA4A 5KVMC 4P5TD 4XB8A 3SDAB 3MLSH 4YJZL 2E75C 4RMQA 5IJVB 1Z7JA 2R27A 3AITA 4UINL 2EH8H 1E9PB 2Q3ZA 3VQ2C 2JI1A 1PJ9A 2BP8A 1G6RB 4MD5B 4DNLA 4QD2E 2F74B 5JOFB 3KH4A 4UUJB 3WNNA 1T66C 4KRNA 4HX1A 2LLLA 5CUSL 3SODB 3TASA 3HPLA 1ZE3H 1UXLA 3MJ9A 1QFWH 2WZAA 4NQDA 5HHOB 2GJJA 2PLTA 3WNMA 5IEHA 2BP5M 3FB5A 2ZUTA 2P9RA 1UACL 2PN5A 3G5VA 4PJ7F 4WU5A 1OM3H 3W9EA 1FWXA 1X9RA 2JIXA 2Q3XA 4OLWH 4X99B 3TYFB 4YHYB 5HHPA 3VI3F 5ICZB 4YDLC 3U9UB 1J87A 1IQWL 1HILA 3JV4A 5D1XE 5HYFA 2XFGB 4ZUVA 35C8H 1SEBB 2JLLA 4A6YB 5I6KA 1MCSA 1U8MA 2BP0B 3MAWA 3ET9F 1JXGA 2Y5QA 4J27A 3UYPA 3CC1A 3NEXA 5FUZH 3K5SA 3UEZA 3BW9A 2YXWA 5AVUB 1YLBB 2YUVA 4FEIA 3GMNA 2O5YH 4QGTA 3QZWG 1PLBA 4XGZA 1A7QH 3BLBA 3P4NA 3C5ZD 4GMSH 3RVWD 5JOEA 2COVD 5AOJA 5E2VH 2XZAH 3CLFL 3KS0H 3QZWA 2HT3D 1CMOA 3RWCA 4ELME 4TLSA 4LCWB 4PBVC 3ARDC 1HIML 4WTZG 5DRXA 3FT0A 4TTDC 1IMHC 5AD0B 1BIIA 1QNZL 4AEFA 3E8VA 1DTUA 1JRHI 1D9KB 2QDVA 3H0TB 3RWGA 1OD7A 2BOLA 5E4EB 3SDCD 3HG1B 3S8FB 4XBMA 1N64H 1QBML 4B6ZA 4XWOD 3UBXB 4AGOA 5SWSE 5K93A 3SGJA 3FPYA 2EDRA 4KTDL 4KPHL 5JW5A 5E4EC 3VFSA 4M6MH 1G1OA 4A7TA 4LARL 2MWCA 3O81A 4GEJA 1DQMH 1XIWD 2F8IA 3WO3B 3SB3A 1ZK5A 3D2UB 1ZDSA 4TS6A 5BCAA 4LQFL 2PTTB 4FNUA 5L0QC 5AW7B 3CVHA 3MLXL 2COQA 3O6MH 3NAAL 1MJ8H 2RMNA 4F58H 5BW7A 1EIBA 1NFAA 3MMEB 1JYWA 1BAFH 1LEIB 1M57B 4ZFOB 1N6UA 2IPUG 3P0YH 2CALA 2ZP8A 3EXJA 2AZUA 3K81A 2JMRA 4HFWA 1DJWA 4NZUH 1ZV9A 3LXBA 3VD9A 2GK2A 4MA7H 1X5KA 1SM3L 1OAUL 4N0UA 4GRLD 4WEBH 3TO4B 4ELMB 3MLPA 2BOCA 5BOPA 5I1JH 2J8OA 4AVKA 1E5UI 1I8LC 1T03L 4N0RA 3O4OB 3PGCA 5H94A 5HI5D 3MZTA 3LNIA 3MFGB 3EGXB 4GW5A 1HSBB 3I9AA 4N87A 2DLIA 4PVMA 2H4EA 4N4YB 4JFYB 4QTIL 1WA1X 4XNAA 4EMZA 3L4CA 4X6CB 2V3DA 3ZDXE 2BZCA 5C0IB 2AJ3B 4L2LA 2IV8A 2QFRA 4NQVB 1S5IH 3EH4B 5DLMH 1PBYA 4QDGA 2FR4A 4G1EB 3SO3C 3L3GA 3G9AB 3QCTH 3KNBB 2B5IB 1Z9SA 4D0CB 3KJ6H 4N22A 1KIUB 5F1KC 4EI6A 2FIKB 4WVRA 2W07A 2G5BB 2A1WH 2AEPH 2RIKA 2FX8H 3A67H 4J23A 5CNHA 3DRTB 4QXTB 3CFTA 1X5IA 5F1IB 1X5ZA 1AXTL 4Y5VB 2XOTA 4XNMB 4DP1X 4L8CA 3VXUE 5CP3H 4M5TA 2WVVA 3VYOA 1ADWA 4ZPTA 1E5ZA 4KRPB 1X5YA 5KVDL 5LBSA 4UT6H 1XF4B 5ICXB 4IRZH 5D2NB 3FSZA 1W8EA 5HDQH 3H7BB 2A6DA 4CU6A 4PIRF 2VISB 3HLKA 1UWEL 3T0VA 2HP4A 1CT8B 1BVKB 3ZBMA 2JF1A 3WGUB 1I1YA 4EQ3A 2FB4H 4PBXA 3QH3A 1QLFA 3MOBL 4Z3IA 3VXNB 3T2NL 1W6LA 1MKFA 4QRAA 3BH8A 2WXGA 3BP6B 4PS8A 1GZHA 3TEYA 4G7QB 3T0XA 4MXVE 3V6OA 1SEBA 3LEYH 1N0LB 4NQCE 3U4BH 2AV7B 1KTBA 2B08A 4P4RA 3TWYA 3ARED 4HCGA 3OG4B 1XFPA 1A66A 4LCYA 1CLOH 6PCYA 1JZIA 4KJQD 4YDZA 3NN8A 1OAZH 3IPFA 1A7PL 2J6EA 3IXTB 4N8CH 5GGQL 2GJPA 2VLKD 3H56A 2DQDH 4X9HA 3SQOL 3R0MA 1WT5C 3T0ED 3O2DH 3GI8L 1IM3A 4JFOB 3PWPA 4MGXA 4P23D 4MA3A 2XNAA 3QJOA 5FYKU 4PRIA 1B4RA 1E6JH 3I2CL 1N8ZA 2B1OA 4ODWB 2WXFA 5B1CA 3ZZLA 4FMVA 5JQIB 3TEWA 4TF4A 2AKRA 3E1ZA 2FX9H 3CQQA 1N26A 3RWDA 1XIWC 2VAAA 3KGUA 3D39D 3N0AA 4AXWB 2I7SA 1DANU 3FOLA 1E7UA 3KPQA 2MJWA 3B3BA 1MRCH 2J57A 4NDMB 1MCWM 1CBVL 4N5EC 1AGDB 5D4QA 4FI7A 3R7RA 3QFDB 1E6OL 4CADA 5EN3A 5IW6A 4XBEL 3E80A 1MVUA 5CZRA 4NN5B 4C58B 4KOBA 3ZKMD 3B5HA 4XI5D 3ALPA 2G60H 1NLDH 3TCXA 4YHPB 4MMYA 3MLUL 3QULB 3QUMB 4M7LL 3QIBB 3QQ9C 4WNQB 3C9NA 1BQHB 4MDIA 4E9SA 4EBQH 1H8OA 3FZUD 3IMUA 5EEVA 3OMAB 1NFKA 1YJDH 2O6CA 4L37B 3VFNB 1LEIA 4AEHH 1UB6A 4KMQA 5CZKA 3RVWC 2IBBA 1G7MB 1XF3A 5KSUA 1AKJD 1I3GH 3BGMB 1TQWA 4B9YA 3DBXB 4EI6B 5G55A 5F7DA 4X6EB 8PAZA 2JKRM 5I66B 1NWPA 5ALCH 1MI5A 1PZSA 4JM2F 2CO6B 5HYSG 3FB6B 3MRQA 3QQ9D 4XTRD 2WXKA 5CSGA 3F7KA 4U1HB 1CK0L 2CKBL 1WBYB 1QSFB 3D33A 1IFHH 5ACZB 4Y16B 2APVA 2LABA 1NKGA 3EBAA 3BRFA 4ZPTB 2LOEA 2FUTA 4JCMA 4LRNL 4FQXA 4XNYH 4P46A 4NC1E 3KBPA 1D2OA 2R2CA 4F2FA 5KSAA 1H6TA 1BFOB 1SHWA 4FFWC 2J1KA 2BLFA 1AO7B 3DVGB 2HX9A 2H0PA 2LVEA 3BT2L 1QR4A 2VLME 4WJ5A 3GBML 2YPLB 3SY0A 1NCUA 5F9OL 1UOKA 1S9YA 4HLZG 4MJIE 4P57A 1T22B 3UADA 4U1KA 1KJ2H 5TF1L 1NFIB 4X98B 3WS3B 2J43A 2X6AA 2YC1A 5K33A 2F58H 3KNBA 1FBIL 3ZTJG 5LVEA 3W5NA 2BCMA 3P2TA 4JRYB 5E5LA 4J5VA 1YYML 3LN5A 3VFGL 3W82A 4Z0BL 3KPOA 3OQ3B 4PWKA 2E6QA 1XGUB 5LCVL 2BS9A 3D4ZA 3HN8A 4ATWA 1OANA 1U2CA 5EEYA 3M88A 3MDJA 3VRIB 1HH6A 3TT3H 5EMYA 5F1OB 4UANA 4RSVA 3WDJA 4EZJA 4JFVA 2VQTA 5HI3D 2DLFH 2RH0A 3NA4A 1MFBL 4JRFA 3J2PA 3DMMB 3UZEC 1IGYB 3OKDB 2WVUA 3SPCA 3SBWA 3W2DH 2NR6C 5IMMB 1AOHA 3ZT5A 1PF3A 3BP4A 3BIAX 1RZ8B 4EXKA 4APQC 4PV9A 3FUNA 4U1JA 3PY9A 4ZYKA 3GHBL 1R3IH 4LO9A 5EO9A 2OMZB 3WXWL 3FFCA 2I9TB 2F5AL 2JELL 5KBLA 2L7JA 1VF5C 2XVBA 3S5ZA 5KSBE 3TF7C 1S7XB 3IS0X 5CLWA 1J05A 5FOJA 4OCYH 4F2MB 2YD0A 4I0CC 4M00A 1A5FL 5HHVH 4NO0B 4JJ5A 4ZXBA 4JG5A 3ZZ1A 3LZPA 1XTMA 2ITFA 4PJDA 1ZHNA 4YBQC 4P4KC 5TF1H 1KJ2L 1Q9KA 3MUHL 4MWFA 1U8KB 4E41A 1E2ZA 1JN6A 4KDWA 4ZQKB 5FLVA 1KMGA 4XN5A 1BQLL 5EBLA 1LE9B 3K74B 4LLDB 1LO4L 1S3KL 2ITDA 1X7QA 3FT3A 2X4UB 1CE1H 2DWEA 4RMTA 1TJIH 3X14B 1AP2A 2XWXA 2XXGA 4X4ME 5HGAA 1IGJA 1K8DA 2EIEA 4WI5A 3TNMB 5D5MF 2ZOLA 4J4PD 4BZ1L 2FBRA 5D1QA 3RWDB 2F19H 3TFKC 3JZ7A 4JPIA 5I1KL 3UO8B 2HRLA 3BWUC 5FM5M 1UZ6F 3UBXI 5AFAA 5C0EB 1FH2A 2HJFA 5GHWH 4NCDA 4W9EC 4HJUA 4N2HA 4XPFL 2NTSP 4LP8A 2XY2A 2IDFA 2ZKXA 3QWRD 4OZGB 4HG4J 4FGMA 5FOBB 4MAYC 2NLJB 2K70A 2WCPA 3S35H 3L3DB 2NYYD 1EZUA 1MCOL 5IKCA 4WWKA 3RDTB 3TH2T 4FXGA 3BWAA 1JGDB 2NUTB 3GJFA 3MLUH 1E4KC 4QOKE 2DM2A 3MA9H 2YD1A 5TDPA 5D7JC 3FO0H 3HBQA 1OSEA 3O3UN 5EN2A 4EDWH 3U4KA 2MH4A 3S37H 2GBUA 4H0LC 1TVHA 4H2CA 2CG9X 3AREA 5A2BA 4MZIA 1I7TA 5DK2B 2H3NA 4IKLA 4YXHH 5MENE 2ZX6A 4N9GA 1XL4A 1A3ZA 4LLWB 1NMAH 4Y2OA 1DQJB 1DVFC 3MCLL 4GKSB 4JQIL 3PHAA 3QI9B 1OP3K 1TMQA 1UEMA 3T8XA 3OJDB 2BIOA 1G7LB 3VRIA 2D3VA 1EHLL 2VDKL 5TDNB 2EE0A 5CWSA 2JTYA 5T5FA 2PWFA 1R6VA 4BWTA 1T6WA 2D9CA 3NJIA 2J2ZB 3ZDXB 3ZO0A 3QDGB 1QSEB 5ACZA 5KW9H 4H1LG 5IROC 5DJXB 2OL3H 5GRZA 2A74C 1AY1H 2R0ZH 3NPSC 3WL9B 3SO3B 3I50L 1U8HA 3VWKD 4LEOA 2CDGB 3C60C 4JJOA 4ODHL 3RNQA 2Z4QB 2EC9U 4O5LL 3V4PH 1JWMA 4PS4H 5D6CB 5IVXF 1ZRUA 4BZYA 4LGRB 1N0XL 4N8CL 1QFUH 3EDFA 5FO8B 4TVSa 5E5MA 3QDGE 4XMZA 2OQJA 5FYLL 1PIFA 2K9UA 2ZXDA 1F8TH 3QH3B 3ZKXB 1R19A 1OAYH 4V1DA 4JR9L 1NGQH 5CILL 1U95A 1ECYA 2FECL 2R4RH 3KJ4C 1FNEA 5EZJA 5A2JH 3MNMA 3F58L 1GYWA 2DQGH 4WV1A 2ROYA 1I9RL 1SBBA 4R7NA 4S1DC 1NUGA 3GS0A 3I6KA 4JJ5B 2C7UA 4FQ2H 4X42A 1EZVY 5HDWA 3APDA 4Z7VB 3KJ4B 2EVIA 2NY0B 4S1SH 3MLRH 1MHCB 2XG5B 5DK3A 5D7SH 1JFQL 4MB4A 5PCYA 4BSVA 5K5YA 2WLJA 3IJEA 3Q8EA 5TE4H 2ZXWB 2DWTA 2OR9H 4M6OL 5AKRA 5LB1A 3UEQA 1BQSA 4A2EA 4BV1A 5IJKC 2UUDH 1E28A 4R96B 3LS4H 1I8UA 3SE4C 2A9MH 4HXBL 5ISZA 4PRIB 3RBSA 4C47A 5CBEB 5I30H 4WO0A 3GIZH 3QFJA 4MASA 1L9OA 4YR6B 2R7EB 3T4YB 3MJ7B 1A1OA 2FLRT 4JANB 2A4CA 3G6DL 2XVKA 1DLFH 1IGIH 4WKZA 1UOLA 2R2HA 2KQMA 2OXGA 2VN3A 3SCMD 4XCNB 4XBGA 1MW0A 4IK7A 3VTAA 5JA8B 4DEPC 2V9UA 3QHZH 3QUZC 4LSVH 4ZXBB 4PP1C 1GZPB 5DFVD 3GEWB 3L4VA 4Z0XB 3EYQC 1ZIAA 2WXRA 4LHUG 2C9AA 4TNEA 4BQ8A 3F8UB 3DJSA 4MNQB 4AOFA 2O5NA 1A1MB 1EUUA 4JZNA 2ID5A 4YVNA 1CL7H 1JPTH 4PV1C 5EO0A 5INDB 2C1PA 3EOAA 1FHNA 5DO2C 2AXFB 3VXOB 1QUNB 3BQUD 2DJUA 8FABB 3JTSB 3NFPA 1KY6A 3RUGA 3IETA 3TBWB 1FO0B 4OQTA 3WS6A 2RD0A 3GXUB 4Q4EA 4GRMB 1DUYA 3OLIA 5JO5A 5MI0C 5I8OH 1UXWA 1VFBA 2DPKA 2WANA 2WVSA 1ORQA 1F13A 3IAPA 4AQ1B 3FXIC 4HLEA 5TFSL 1FGNL 3RZWA 4NN5C 3MRHB 1U8QA 1AYOA 4WJG3 3FF7A 2ESVD 1FZOB 2DJ4A 1M2OA 1CE6A 1A4JB 3VSTA 2A4EA 4NP4H 4PTUA 2IFFL 2XQ0A 4HU2A 3RTQB 5IB4A 3WIHL 3M45A 1WBXB 2NDGA 3BUIA 2ALWA 4ZW5A 3L9RA 3FOMA 4ONFL 4Y9BA 5T1DL 5IFHH 3FUFA 2O93L 3DIFB 1UZ6E 5DJCB 2VT0A 1EBPA 4UI2A 1CT8A 2E27L 1DQML 2ED9A 3DUUB 4YGAB 2XWTA 1T22A 3VMOA 2WJ7A 2CCVA 2GI7A 4P2RD 4B9PA 5BVJA 3EBGA 3WLBB 4M1CD 4LCCB 4PY8I 2GY5A 2FWUA 1JPGB 4X5QA 4Q9QH 3ZDZF 4WSKA 2FQEA 5K9OA 4YFEA 1UCTA 5DR5L 4UZGA 5L4JA 2NY5C 1F3DJ 2YFNA 4LKCA 1I1FB 1MCLA 4OKDA 1KJ2B 4PJGB 1AHMA 4YSQA 2DI8A 2DQIL 2CLRB 2G2PA 4DK6A 4J4PC 5H37H 1UM4H 4AXWA 5GSVB 1LK3L 2IBZY 3JWOH 3GXFA 3CIAA 3C6LA 2KT6A 3NJJA 1WO2A 3U0PA 3DV6A 4NI3A 4OCMC 4GUPB 2UZIL 3QEQD 4JPVL 3ILDA 4HK0A 4XPAL 4HMCA 4NBYB 5SX4I 5AZ2H 3ZZQA 5IW6B 2B4CH 3TN0D 4YBLC 1D7DA 3QQXA 5TQ2H 1H3VA 4UQ9A 2J56A 5ID1A 1D9KA 3Q5YA 3QIBA 5D1ZI 2BWDA 4TSBL 2XC8A 4MFHA 4WI6A 3KWUA 5K9JH 3FOLB 2WXHA 1U93B 2P7TA 1O9ZA 3LTVA 4HCFA 1HCZA 4NWTH 3VXSB 1IQWH 4DVBA 2Q3AA 3T2LA 2VC2L 1KXQA 2ZJSL 3BDBA 4K3DL 5A6IA 4PRHD 3CAFA 5I0XA 4WHCA 4D0DB 1IC4H 3MRMA 5ADPH 3SOTA 1DQLL 2WQ8A 5JYLA 2DM3A 5IUSA 3BUQA 4HMEA 2X4PA 2IPTH 4FL4B 4K71B 3VQMA 3CHRA 1I1RA 2CRZA 2JFCA 5GS2H 1PKOA 3EHBC 4UM9D 4LLDA 4KI5E 4XRCB 3T4AC 1JYVA 3MXWH 1KBBA 3ASNB 1MCPH 5IHUL 1RSFA 4NPYB 3MLSL 1R5WB 2EVFA 1VB9A 1SVBA 3P11H 1E4XI 4HOXA 5DGRA 2GBTA 3MJ9L 1NBVH 1GGCH 4NQDB 2IWEA 4U3SB 3D9AL 3LKPA 5IG7B 3GO1H 5IVZB 1KTLA 1MFAH 3AQYA 3SOBH 1G9MC 3N85L 3M1CA 5ABZA 2OMUA 4M1DL 3SDYH 3NRQA 3B9AA 3NSXA 4BQCA 4M1GL 3H9SD 1QFHA 5C3IA 2W9EH 4MZ3A 1L0YA 3U46A 4LHUA 1N6QH 4FNQA 1U8MB 1ZLVH 4GINA 4DZBA 4P2RE 3VXQB 3SPGA 1AS7A 5GZOC 3GK8H 4YWGH 3TZVB 1D5RA 4JPKL 4QRSB 5DWPA 4PAZA 3F3HA 4PH8A 2X3AA 1ORSB 2ADIA 3P2DA 4K9EC 4LT7A 3FO1B 1R34A 1XEDA 2GCYA 3CTTA 1FN4A 4G43A 4PJIF 4LPVA 4WU5B 1R5IB 1FRGL 1KACB 2IOMA 3PXLA 3LIUA 3PHSA 2MNJB 4JO5A 1SLWA 4L1HA 3RUGB 3SIKA 3FUEA 2GUYA 3NRFA 4EQ2A 3N9GL 1THCA 4NC2B 3RFZA 3AS2A 4E42B 5J6SA 2HFEB 3MRHA 5B1JA 5DSCB 1B2YA 4NHCH 1MAJA 4QRRA 1FORH 1CICC 2BVYA 2YAEA 1QKZL 3BDYL 4JFTA 2XWJB 2VH5H 1G5AA 4ODBD 3P73A 4C83B 4MB1A 4HS6A 3K0WA 4YNYA 1XV8A 2XKNB 5IESL 1JTPA 4UOQA 1G9MH 2PR4L 5IQOA 3IMSA 4OVVA 4MMZA 4I3SH 2NW2B 3FOMB 2CDGA 2E46A 1C5DB 2EIMB 1OF2B 3BPLB 5H35B 1RZ8A 2Y7SA 4PYGA 1ADQL 1UT1A 3BVNA 3I6GB 1MWOA 2XICA 2KBGA 4G59C 4O02B 5KVEL 5GGTL 5I8EA 3H0TA 2VSDA 5BZWA 5EF0A 4IU3A 2PTTA 4PRHE 4W4OA 5DD3H 5BVJB 1N18A 4ORZC 4NZTL 5F71A 4FYRA 2VQ1B 5IOKA 2EP6A 2QV2A 2ADFH 4QNPE 4UAHA 5AZUA 1NBYB 2OMXA 2Y06L 3SQRA 3AADB 3LEXB 1VZHA 2WXLA 1RIVH 1BGXH 2JQAA 2Y6SD 3NCMA 3NESA 3Q1EA 5FA4B 3GSQB 2YLKA 5CFHA 2L3BA 3L7FB 5F7UA 3GSVA 3QXDB 3WMPA 5FKPA 1X5XA 5C0EA 5I2IA 2NW3A 1OLLA 3WFEH 3RVTD 2IC2A 3P0VL 2DY2A 1KGIA 1OALA 2WGNB 4JM4L 4WZ9A 2NY1B 1G0YR 1F00I 2A6KA 3OR7B 4XN2A 4P9HC 3ZDYF 1MY5A 4C56A 1GRWA 3CLEH 1UWXK 1G9NH 3LN4A 3ES6A 3RI5F 4E9WA 3D2TA 5I15H 3HFMH 1A7NH 4JFOA 4CAGA 3H9YA 5D1XA 1EANA 1GYUA 1QQDA 4XXDB 4OD2B 1RXLA 4DHLA 2RFXA 4HWNA 1JZ4A 2FTAA 4K5NA 4DCQA 2ZKMX 3U4EB 4AQEA 5CIPH 4YIQB 4Z3GA 2R8SH 3SPHA 2HSIA 4U3SA 1NGZB 4IHOB 2BFVL 3KHOA 3X1GA 4LBEA 3RZCD 2N56A 3KPQB 4RFOH 5F0LB 1SLUA 1RMFL 3NSCA 1RZ7L 4M7LT 5AB1A 4N85A 5AUMA 5FYJE 4MJ6A 1X5JA 1BLIA 2ETWA 3SKUD 3KD4A 1WTGT 2AHIA 5I6LA 4M1CC 2QHLA 4HAGA 4WHYG 4ZMLA 2EVJA 2X9ZA 1BAWA 1VJSA 3OPZL 2ZG1A 3MBWB 4FNRA 4W9IC 5F96L 3ZSTA 2RGSA 3BN9D 2I5YL 3QYNA 4P3CL 2A77H 4P59H 2F54D 5LDUA 2ED6A 2R8SL 2J25A 3OSKA 1HSAA 4FLSA 4D8PB 1WZKA 3FQXA 2B1HL 1CGSH 2NYZA 3AU1A 4PN6A 4HPHA 1QW8A 2O6EA 3TP4A 4D9LH 2F6AA 3QUXA 4WNQA 1Y1DA 2AJXH 1FFPB 1CS6A 4M43H 4MCNA 4MD4B 1ZLWK 2L7EA 4OGYH 4ZXBC 3TXAA 2NQCA 1ES0A 5D6DC 2MTAA 2NDFA 5D7JA 9PCYA 1Q8MA 4GLRH 5LQBL 1RIHL 2VMJA 4G8AC 4Y5YB 3NZUA 2XJLA 3LXUX 5KTEL 1T3FA 2NTFB 5B39G 5HHOA 2Z7WA 4EN3C 3WFEL 4NERA 4XWOC 3LHPL 3L2LA 4HV8B 2A3TA 5IWLA 3DA0A 4IIQC 2VXVL 1C08A 3UTZB 4D9LL 5FO7B 3ZRFC 3WKMH 4PJAF 4Y1AD 3HFFA 5E6IB 4BKSC 3DX6A 4OZFB 3QAZB 4S0SD 4YNYB 3BQUC 5TTRA 5BZDA 2Y06H 2CD0A 1ZLVK 3HAEA 4UTAH 1BLNA 2EUWA 2D3LA 3BFQG 5LAPA 2ICWA 3DXAD 5ELIA 2K4AA 5DDHA 4ZTPH 3GF8A 3SZ6A 3C5ZC 2YPLA 3SY0B 4JFEE 3NVQA 1JI2A 4BFFA 2GJ6E 2LT9A 4GAGH 5C8JA 1BZEA 3CCHA 5JR1L 3K2IA 2WV3A 3A4DA 4M03A 3UAAA 1DBML 4GAJH 4X6DE 1Y6NR 4J3TA 2ZUYA 2F7OA 4KKNA 1MJ7H 1CFTB 4X6DF 5FV2A 1AXIB 5FYJH 1G9ML 2PR4H 1GH7A 5I1GH 3QPXH 3LEVH 1P4IH 1T4KA 4TNWK 4HIIA 3O4LB 4UT9L 1OKEA 2ITCB 4KJYA 5EUKA 3UZVB 4CILA 2NSMA 1G7IB 1K8IB 3CSFA 3GWJA 3HFML 5A7BA 4CBZA 1AZCA 4Y19E 3M46A 1VFMA 5M95B 1JVKA 4RX4D 3LKSB 2XKSA 4F5CE 2XQBH 5IHLB 5CJXA 3QWNA 4LCCC 2FO4B 2BFGA 3NK4A 3MHZA 4EIZC 1KJ3L 4M5ZH 5MEND 3SDXE 1QPKA 4KK6D 1MEXL 1GR7A 6FABL 3WTSA 3PPEA 1BVNT 3MGOB 3PABA 3QJQB 1P7QB 2QSTA 3KXFB 3LH2H 2Q5BA 4PJ8B 1GTNA 3WBDA 4YHNB 4P5TC 3DYOA 5IMLB 2JJWA 4IRJC 4I3RH 3SPVB 2F1AA 4JFQA 4OF7A 5AVXB 5DK0A 3JTSA 4X9FA 1KC5H 5LBVA 4XBGB 3RWFA 3LPWA 4X8GA 1FO0A 3NIDB 3ARPA 2ZOWA 1G7MA 1XF3B 4G5ZL 2EYTA 3B2DC 4PJFE 4GKZA 3SOBL 1S8DA 2FO1A 3CJJA 1JL8A 1DZ0A 3AXLB 4ADJA 4FS0A 2LU5A 1I7RB 3P9MB 3K5RA 4XO8A 3RAJH 2YGQA 3VXMB 4NO5A 5CJQL 5EBLB 4GH7B 4UDTA 1V3JA 4O51B 4OZIF 2OTWB 2WC7A 2VYRE 4FJYA 4LPYA 1S9XB 1ACYH 1RK0A 4Y2DB 5I1AB 5D1XB 4YHIA 2E7CA 3II1A 4K8RC 3V5DB 4N2EA 4DKAA 4UQAA 5I8KH 5IROD 1ES0B 2EADA 1OSZA 5MERB 4H88H 4G9FE 1K8DB 15C8L 1IGMH 4YSTA 1NAMH 4HJJL 4J6IA 4YIQA 1M56B 1ZK9A 3N9GH 5GIRB 3GEFA 1OF0A 3ZR6A 4ZAKB 4WHYH 1VCAA 4FHBD 5E94A 1BJ1J 3BZDA 5ERWB 4JB9L 2D3JA 2WQXA 4PJ5D 2B0SL 5B21A 3WS6C 2Z31B 3D18B 2CHZA 1IGFH 1H3TA 2W80C 4XMLH 4PGEB 3BZEB 3S4SG 2A9NL 3VI4A 4DGVL 3B1TA 2NYKA 1T21B 1OQOA 3U46B 2GJ6D 2GJZB 2DQFA 1JXDA 2H2SC 3AG3B 4G8FB 1YC7A 2OMVA 1F1GA 5J1SC 4XVSH 1I31A 4PJGA 4UDUB 4FZEH 2ILLA 1HHJB 2W9EL 5SV4A 4AQAB 4E0RA 4RDBA 1GC1C 1A6TB 1GA2A 2YHGA 2IBZX 1CDCA 3Q2VA 5DZJA 3KDPB 3LZNA 3CC5A 4LB8A 3VGFA 2VDLB 3UERA 4MYWB 3RX5A 4NNXA 3OG6B 1N9PA 3WAKA 2WBJB 3QUZA 3FF8A 4RZKA 4XPAH 3T77A 1CYWA 3WKPA 4LL1A 1KJMA 2ZP0T 3DURA 2H47C 5GGVL 2P5EE 2VLRE 4U31A 3DK0A 3HG1D 1CU4L 4CVZA 4LHUD 3DSNB 5JPNB 2ARWA 4B3EA 3FHAA 4IS6B 2LE9A 1TT6A 1G7LA 4YLBA 1BG9A 1TQUA 4KJYB 4RA3A 4ZO7A 5E03A 4F91B 2Z1KA 1C8PA 3DLQR 4QRUB 1UKSA 3FUJA 4ZMXA 4WI2A 2PPAA 4P07A 3RVXC 1JPFA 5EOCH 1FNSH 2MFNA 5I5IA 2X4SA 5FHBH 1EHNA 2VDQB 2FJGB 4ZO6A 4WKXA 4L3EA 3U25A 3ARGA 3DK2A 2CPCA 3OKOA 3VFTB 3FCGA 2YA2A 4MJHA 1ZTMA 5E6SB 1T1YA 4C8XA 1RHHA 3PP4H 3P9WB 1WIUA 4G2AA 1ZVSA 3QUMH 3NN8B 3C6LC 1JUFB 3WDHA 1SHSA 1AD0B 1MCCA 1HZHH 1LNUB 1W72A 1WWAX 3O3BB 4KO5A 2XPYA 1XR9B 4UB0H 1GYVA 5LXGH 4JQIA 3IU4L 1G1YA 3OVUB 3HC4H 4JHAL 3HS9A 5HHOE 5K9JL 4OZHF 1SBSH 1R4XA 4QY8A 1KPRA 2X0WA 3DTUB 2RBLA 4GSRA 1ZGLA 3BQUB 4HEPA 3WFCL 3QFJB 4Z7QE 4ZUTA 5TQ2L 3PWVB 5HGHB 1WA0X 4D0DA 5FF6B 1GC1L 2VAAB 4PGZA 4JPIB 4JQVC 4MYPA 4R97B 4OF3A 2QHRH 4JZJB 4ONHA 5E9AA 1ZT4B 3OAZH 5AW1B 3K1DA 1K6QL 2CIKB 5I6PA 4XMWA 3RE0A 3QIBD 2N59A 1GZHC 5FFGA 3QR1A 4M6NH 3QUYD 4HGWA 3MKKA 4KKBD 3UTPD 1T1ZA 4E9YA 3D25A 3VNZA 5AW5B 1ZVHA 1PCSA 2YS4A 5HXMA 2MCMA 5C09A 3E38A 4H25B 4PJ5E 2GC4C 2VLKA 4FNLH 1DL7L 1U3HD 1ROCA 3ZE0B 4JFFE 1XH3B 2YR3A 3W0WE 3U0TB 1TFPA 1UC6A 1E9QB 4PVNA 3LKPB 5B4MD 1T6VN 1E5YA 1XWVA 1SY6L 3MLWH 3QUYC 4KKBC 1MY7A 3QRLA 4KI5F 3W81A 1MHHA 2UY7B 4NPKA 1LO3H 1CGWA 1UOVA 5FGRA 4Z3EA 1JSYA 1PZ5B 3V4VL 1CDBA 4JG0H 4P8QA 3GINA 3K4AA 2EACA 2VW6A 4YSRA 1VIWA 2K7PA 5GRJL 1IC5H 4AKOA 1I1AA 1RLBA 3X3GH 5LDSA 4HDIA 3GJEB 3WUZA 1XAUA 1OT1A 4OIFA 3WFCH 2VDRH 2ADJB 1NANI 4FQQB 3BD5A 5F21B 3ZVVA 5A2AA 3Q2LA 1I53A 1FGNH 3ULVH 3IETB 2MOQA 1WC7A 2C1OA 3TBWA 1RCYA 3UAFA 5E2WH 2W0KA 1JGUH 5EU7E 3ULVE 1EH9A 4AQ8A 1I1CA 3CVDA 3HZKB 5FEBA 3ETTA 4W9FC 4HV8A 5I73C 4J1UA 5CIPA 3KWVA 3PJSB 2E8YA 1BQKA 4K2UH 4QHMA 5AW6B 3MI6A 3FQ4A 1USQA 4DGUA 5DJXA 5AVRB 2WOYA 2XPGA 2ZCHH 5AZEL 4I2XB 1GCFA 3EJUA 1BV8A 5D1QD 3EHBD 3ARBA 1INQA 3MRCA 2DQJL 4N5ED 4ZW8A 3K8LA 5IV2B 5E6RB 3F64A 2YXMA 3HW7A 3NH7H 5DVKA 1DLHB 1NCTA 2E4FA 3DUUA 4AIZA 2LFEA 2BIQA 1UURA 1A3LL 2WTRA 1K4DA 5LCVA 5C8JB 3TCTA 2TSAA 1RUQL 3Q5OA 3QAZC 4GQRA 4ODHH 4PLNC 4PJ5B 3GMQA 3GZPA 4JO2L 4RRPG 3EUDA 4LCCA 3WJLC 1F18A 1K5WA 1F02I 4I4WA 4X2UA 1SGKA 3HRPA 5F3BB 4U3XA 5FA4A 2AXJA 2WN3A 3KLLA 2BIMA 3B1UA 5I30L 1TTUA 4ZUTB 1QO3A 1OL0A 1OTTC 3RWGB 3INOA 4HIIB 3UZVA 4QOKA 3UIYA 4QRPD 5I6XB 4YZFF 1EHLH 3KPSA 3OKEA 3TT1H 4IOFC 2B3RA 1NGZA 4IHOA 3W9DB 4DAGH 2K8QA 4Y9FA 3ARGB 4DP6X 2CK2A 3LH8A 3UCRA 2X7LA 3D6GA 4X0KB 3WFHB 1CLVA 3NZHL 5L4IA 5JW3H 2C8NA 3IJ7A 4G8GB 1MUJA 2QPUA 4KI5D 1A3RH 2AK4B 2E9IA 3PYCA 5DC4B 3EGXA 1JTOA 3R06A 4CGTA 3ML9A 4OD2A 1I82A 3RRQA 3VE0A 3EH3B 3P69A 3BKJH 1G1KA 4R8WH 3VDAA 1JZ2A 1I9RH 4PJBB 5EU6D 2J6EH 3GSRB 4JK0D 4GXUM 3VM5A 2V33A 4U05A 2XV3A 5C0BA 4JANA 5MEOB 2AJ3A 1NGQL 1S7TB 4IIQA 1TTCA 4LBEB 4JW3A 2X4UA 5ENWB 1P5UB 2WNWA 1JIBA 1LYQA 3KWWB 3X2QB 4FQXC 3VXOA 1G7JB 3EJRA 4MQTB 2ENQA 5L9DL 2FVNA 3BQUA 4OI9A 1OAQL 3UH8A 3EJZC 4GRMA 4D0CA 4F8QA 3B8SA 3FTZA 1KTDB 2J8UE 5ESVB 1WRFA 3RDTD 4ALAC 3HC0A 1ZCRA 3TTSA 2ERJC 4MTMA 1E90A 4YHOL 3QR0A 5IGXL 4ELMA 4JLRB 4ABWA 2L04A 4WUUE 4LXFA 4UDTB 3BPCB 3M7FB 4TUJB 3VFOA 1D5ZA 4UAOC 5INCB 4CDHA 4MD4A 1E3ZA 2IDTA 2IDUA 2X4RA 3A47A 1CE1L 4FKEA 4I3RL 1UFUA 3IPBA 4GW5B 3FN9A 3QRBA 2H9GA 5C0AA 1G5GA 2YRZA 4G11A 4WV1C 2HLAB 5DMKA 3KXFE 5CJOL 2Y1ZA 2VXUL 5K39B 1QNIA 1GL4B 1S7UA 2VKWA 1UYWL 3QUXC 3M17A 5GRVL 1BMZA 3KWTA 1ILUA 2NY3D 4NQCD 3QA3A 2JB6A 1AFVH 5E2JA 3UJTL 5C08A 3JBG7 1LD9B 4RQQB 4OUUA 2VN5A 3NSDA 1EBAA 5LAXB 1UOWA 1GAFH 4PP1D 3S8GB 1YMMD 2AJZB 2L8AA 3X11A 5B38A 1BFTA 1EXHA 3WTTA 1Q72H 4PS7A 3C12A 4Y2DC 3SQBA 4PJIA 4QRQB 1ASQA 3DBSA 3GMOA 2EVHA 3MJ8A 5IVXA 1QRNB 3HPJA 1CTMA 2NNCA 7FABL 3UBGA 5FLUA 2R15A 5HDOA 4XC1H 3OSVA 4C4KO 5EZLB 5FW8A 4HS6B 4I0PC 3PWLA 3S3BB 4YSOA 4QXUH 4ETYA 1SJEA 2B2XH 2E7DA 4WW2A 1XF4A 1V27A 4G9FB 4B9GA 4N8UA 3HZVB 3VRLF 5KBDA 2CIIA 2FHBA 3I75B 2P48B 1MFBH 4GAGL 2XCMC 1F4XL 1Q4NX 4G6AC 5J3HC 3W5MA 2E9WA 2OV0A 2DLFL 1GPOH 5D1ZC 2VDOL 3P4OB 5JTWA 4I77L 4W6YB 3L54A 1OAXL 1PNCA 4MB3A 1U36A 3NIDF 1ZSHA 3UTTA 1ASOA 4PHZA 1EFXB 3NZSA 3G5XB 4UTAL 5IEKB 2BSEA 3DOSA 3H7LA 4XE0A 3EO9L 2X87A 5D96B 3C2AH 2R69A 4WO4D 5IQ9B 1YYMH 4GP4B 2QGEA 5CMAA 4HUKB 3HRZC 4GKZB 5C9JA 1HXYA 4OF8A 3A4FA 1WAEA 4CADB 1KCVL 1DBJH 1MI5E 1QA9A 1HE8A 3M8OH 4I9WD 5J4MA 2MMXA 3DGGA 5KAQG 2QADB 4Z1PA 1WLHA 3QPQC 4HGMA 4YSPA 4N86A 2BNQB 4JKPH 5CCKH 4PJXA 4PJ8A 2ITDB 4GYBA 1PU0A 4PJ5A 2EO7A 1ULVA 2OMWA 5MEOA 1KBVA 2Z8SA 1T1WA 1G7HA 4M56A 4F7CB 3SYPA 1NMBH 4I5BB 4Q89A 5E8EA 2VDOH 3FPXA 1IGJB 3TNMA 4CJ1A 3EYSH 4DEPB 4M7JL 3RA7H 4ZXBD 2ZWNA 1WTLA 5D93C 3SDCC 2H6OA 2VLJE 2ODHA 3L08A 3CH1B 4LEXH 4QOKB 3L4XA 3VRJA 4P3CH 3Q6FB 4RGMB 2BMKB 5AYUH 1JAEA 1HQRB 4JHUA 3FULA 4R7VA 3B2MA 4JFZL 3DHUA 4XCEB 1PX3A 4L0ZA 3VXMA 4OZGE 2X1OA 3O8XC 3FU5A 2B5IC 4XC1L 5FOBA 2J1XA 2P5EA 2R1WA 2ZF9A 2VLRA 2K0RA 3NCJL 4MJID 4F8PA 1JZJA 4MNGE 4GPVA 4TNGA 5IHZB 3WMQA 5K59E 4DKFH 5I1CL 1DQIA 2AJYH 4GRLB 4F24A 3VACA 2DQCL 4M7LH 1AG6A 3QW9A 5BUGA 1S7VB 3HNVL 1YO4A 1JPSL 4BM7A 2I9LB 1PSKH 2NR6A 1FL6A 1J1PL 5I16A 4Z7OB 1DE4B 2J72A 3JZYA 1RUML 4KRPC 3W9EB 2IGFH 3NIGE 4HWEH 4I48A 2DEWX 1W9XA 5D7IB 1CBVH 1F90L 5T33H 3O4OC 3FSWA 2XA3A 1G6VK 4KFMA 1XB3A 4QTHB 5DJYB 3ZRCC 1VEMA 3GSUA 3ZE1B 1GKOA 4BFEA 4DP5X 1E8XA 4FCAA 1IC0A 3RL1A 2ZYSA 1JP5A 1QLEL 4QRUA 5AWNH 5GS1A 4ODSH 5A40E 2HT2D 2K6YA 3GJEA 2JKSA 3I2CH 4NQDE 4A68A 1KLFB 3BRGC 4L5FL 4IOFD 4ORGB 1CK0H 1HT6A 2XA8L 1JYXA 4NUPA 4WK4B 5DRZA 5IGXH 3P77B 3S8WA 3UJJL 1UWYA 1LVEA 4PBWD 4R7XA 3RL2A 3RWCB 1JWMB 3Q13A 2WSKA 5KVEH 3P3SA 5EU4A 5LBGA 1IARB 1OAQH 3F12B 1HAUA 3GLDA 5CCJA 3C08L 5EBWB 4YX2L 4I3SL 4WNSA 1RUPH 1HZKA 1CN4A 4Y19D 2GIYA 4LVOC 2IG2L 2XBTA 1YEHL 5DZNA 4N2FA 1HAWA 3CFCL 2NSXA 4HXAL 1OGPA 2YEZA 3HG5A 1RZFH 2WZPA 4WFHD 2ZP9A 3KM2A 1CVSC 5IIEA 3MV9B 4XNQB 3ZTNH 3AZUA 1TTRA 1SFDA 3H1ZA 3JWDL 4BKLA 5HDQL 4HK0B 2FDBP 3CSYA 4GQZA 1GYCA 4D8OA 1HH9B 3CXHK 3TJEH 3FCSB 1GYAA 4IBSA 2IAMB 2VR8A 4H44C 1L7IH 4LSPH 1ZGLB 1CGVA 3QIWC 2VLKB 4LEBA 1XCWA 1ML0A 3EYOB 3HLAA 4RETB 5KJRL 3MGOA 3D5OF 1PMYA 1GOFA 4U2YA 4L2YA 4GI9A 5MEQB 2Q1EA 4DIXA 1JG9A 1V55B 1OTTD 1HYRC 1A3LH 4U6VH 2Q6WA 1A7PH 4P46D 4H8VA 1HCYA 1KJVB 1OW0A 3B7SA 4ELKA 3MBWA 5B7FA 5KVGE 4AYSA 3D9AH 1S9VB 4J7RA 1QA9B 2DMGA 2DWDA 3C2SA 3MJ9H 2W8CA 1YNLH 2DIEA 1SMOA 4GSDH 4TMPA 5DRNA 3S4SA 1PZCA 4HKXB 2GTZA 3O3DB 2X1WL 4L4VB 3FUHA 3P02A 3TESA 4OJFH 1WAAA 4ZUWB 4DFIA 1JCKA 1FIEA 1S7TA 3MLTB 4IIQB 2GITA 5SX5H 5AAMA 3DJTA 4BFKA 1S7WA 3X12A 5EG6C 2WBJD 2ZG3A 3UO1H 3N6YA 2KKQA 5I1EH 3EFOA 3B83A 4DF9A 2P44B 4HCRH 1WS7A 2YOCA 4AIEA 2FJUB 2WXNA 4LVNB 1PZ5A 4P5KB 2Q8BH 4MCYA 3S36L 2V9RA 1XGYH 2O1AA 4IRZL 5BO0D 3AU0A 1OE1A 1AGBA 2NXZB 3KEDA 4UT6L 1X5FA 3LRSA 1EJOL 3X1NA 4NO5B 2WZ6A 3TVMA 3GRGA 3HMWH 1I3RB 1M3IA 2X88A 2W92A 4DN3L 4X7TA 2VC2B 4KQ3L 4Q2ZA 5T3XL 1VERA 1E4HA 2NXZC 4DP2X 2WKGA 2A1WL 2AEPL 5FWQA 5B8CB 4GAFB 2A5UA 4A1RA 4F7KA 1JNJA 4PB0H 2Z4QA 1NPJA 43CAA 3IAQA 4LMQE 3H7BA 1AHKA 1DFBL 1RZJH 1P2CA 1XR8A 3E0GA 4QOKD 1T3FB 1KYDA 2OMYB 1U4EA 4ODUB 4RGMC 5HJBA 3JV6B 1EA9C 2EDFA 5DLML 4FXLA 2PABA 3F83A 4GNKB 1DN0A 4KPHH 5LAXA 3PWPB 3S0PA 1UA6L 1CIDA 3ILPB 5E56A 2NT0A 1CZ8H 2HRGA 4J3OH 1IVLA 4MHHI 3ULVD 1RZKH 2GJRA 3GSUB 2A6JA 4PJFB 3RVTC 3G6JF 1QYGH 5BZDB 2MQ0A 4R7NB 4P5TB 1LK3H 3JWOL 3OX8A 1JDCA 3BKCH 4YSDA 5EF3A 3T2PA 3TC9A 4OFQA 3A3YB 3EYVB 3MBEA 2Y9RT 3KVQA 5DR5H 4DUVA 4YDKH 2E5EA 4MRCA 5I1JL 2ZUSA 3IXTA 3S36X 3VAEA 3PHQA 5EHFA 3BD3A 3MXVH 5DC0A 3T08A 5FPIA 4LLYB 2NY6D 2X70B 2NY5H 3WNKA 5C71A 3IAGC 2FLMA 4JZOA 3S7GA 1OCZB 3LNEA 4HSCX 5TK4A 5F9WC 2IXQA 2WGXA 2Z92A 1U33A 4X8JA 5AKSA 5DJDB 4NENA 2D7NA 4ZUSB 4YDJA 1OCRB 4WGVB 4WUUB 3WEMA 4GAAA 1RHFA 3O6FC 3U7YH 4R3SA 4A2FA 2JH2A 2UZPA 4Y4HB 3PAYA 4YHNA 2C3WA 1ETZA 1R24A 4H5SA 1JE6A 4QJ4B 3W9DA 3RIFK 2ZOKB 2NY1D 1FNEB 3N91A 4EN3D 4DN3H 4PR5B 2BHYA 2YLHA 2HA1A 3ZLQC 1HZHL 4K94H 2H6UA 4KRPD 5JIQA 3NUKA 4JN2B 1U2HA 4HAFA 1Q0EA 2OK0H 4LARH 5AVQB 1RV6X 2AQNA 1QSZA 2AV1A 1NCIA 2LQRA 2BERA 3REVA 4DK3A 4R5VA 5HHMD 2YSTA 4L4VA 3BVVA 4K5LA 2N7SA 2DLGA 3H6AA 2ZCZA 2Y72A 1PZUB 2V17L 2AI0H 4K15A 5DMIH 5IMLA 1A25A 2XN0A 3MLTA 1AKPA 1HOCB 4MAUH 1F6FB 4XXDA 5DJZA 3WN5B 3EOTH 3ARUA 2VZSA 2P24B 3N44F 5JZ7D 1ZANL 1NFDE 5ITBH 1DUYB 1TQCB 5JO5B 1I1AC 1ITBB 1EJOH 2BSDA 4GQ9L 1AHWA 4PD4J 5D7KE 1FYHB 4OD3L 2D31B 5C70A 1I85C 4B9IA 1WH0A 1EEYB 1FGVH 1M2VA 3S36H 3X1EA 1WE5A 4WFED 4YFLF 4I18B 3QHZL 4LSVL 5I71B 4XNXL 2Q87A 3RTQA 3PGCB 5DHVA 5I1IH 5DVMA 5AB9A 4X6FA 4KNSA 4A6YA 5BUAA 4NRXA 1OOAA 3ML8A 1J1XL 5J1TC 3CVHB 3EDDA 3WFBH 4P0DA 1EDQA 5DJ0B 1SRDA 3T3ME 1WCBA 5ICYB 2IADA 4IRJD 1FAIL 3VSQA 4Y4FD 3OJVC 4NGHL 4N0YH 2XWTB 3LN9A 5E7FA 2CKNA 3HR5A 3MRJB 4PJAA 2VCOA 3ZKSD 4U1GC 2KMWA 5C7ZA 1TZOA 3MRGA 1KF9B 2Q8BL 1HOEA 1NBZB 3UJIL 3EF7A 1H6UA 5D7SL 3OKMB 5CP7B 1MJUH 3AMKA 5I1EL 1B88A 5T3ZL 5AOIA 3RILA 3PP3H 2YD6A 5JHDA 1TQBC 4GP8B 1L9TA 1RY7B 2WO3B 1EO8L 2JB5H 3LMJH 4FERA 1K72A 4PLJD 1A4JA 4WWPA 5CIPB 2QQKH 4ZPVB 5ID0A 5E6IA 2G3ZA 4FA7B 3FB7B 2WCGA 3ISYA 3MV7D 3Q3GB 4CL7A 2ADJA 1YNLL 4NNXB 3ARGD 2F53B 5MI0B 2C34A 3VA2C 3CMOL 3IGAA 1E40A 4OFYD 3T09A 2ROXA 4YO0B 2Y4SA 2HN7B 3ARBD 5FWRA 4QT5B 1CFQB 1DVTA 2A6DB 4AV0A 5FYLH 4ZSOA 2ZD0A 4FP8L 5IB5B 5I17A 4X8JB 2EIKB 1F6LL 2WWOA 4TUKH 4U6VL 3FFOA 4XOEA 4ODUA 2XJKA 4G1MA 3CDZA 2Z1PA 1L6ZA 2E86A 3WLBA 4NM4L 4IBZA 3CFCH 4MS8C 4P2RB 3G5XA 1L6XA 4UOZA 4F7CA 1DJXA 3ECWA 1J9CT 1S7XA 3D0LB 3SHSA 4NQED 1J05B 2IG2H 5CZXD 4F2MA 4ACTA 3F84A 4CKQA 3C60D 3L3HA 2MNUA 5F7BA 5A1AA 5JHBA 2CXKA 5I74B 4TQHA 1IEAB 2KPNA 1ET7A 4BCXA 2IANB 4XAKD 2FGZA 5F88B 3C08H 4ZDHA 2EQDA 3L5HA 1AACA 4AQZA 1IAII 2N0KA 3Q6GH 3VWKC 4DPAX 4XCEA 3F7YB 2NSQA 1CIUA 1FP5A 4JFDB 4LLVB 2B14A 5HDLA 2EYRB 5EU6A 1ZA6B 1T5WA 2FBOJ 3FONA 4MVBC 3RWHB 4AENA 1HWWA 4JQXC 3ZT6A