3MNDA

Crystallographic analysis of the cystosolic cu/zn superoxide dismutase from taenia solium
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
152
structure length
152
Chain Sequence
MKAVCVMRGEEGVKGVVHFTQAGDAVKVHAEFEGLKPGKHGFHVHEFGDTTQGCTSAGAHFNPHGKNHGAPDAAERHVGDLGNVTAGADGKATLDLTDKMISLTGEHSVIGRSLVIHVDPDDLGLGGHELSLITGNAGGRVACGIIGIAKSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Crystal structure of Cu / Zn superoxide dismutase from Taenia solium reveals metal-mediated self-assembly
pubmed doi rcsb
source organism Taenia solium
molecule tags Oxidoreductase
total genus 41
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3mndA00
2C9SA 2V0AA 3KBFA 1Q0EA 1SXNA 4N3UA 3RE0A 4A7TA 2WWNA 2VR8A 1IBFA 2AQQA 1YAIA 1SDYA 1TO5A 1YSOA 1XSOA 1JCVA 3ECVA 3LTVA 4BD4A 4U4IA 3KH4A 4A7UA 1SOSA 4FF9A 1EQWA 3T5WA 2Q2LA 2WYZA 3L9EA 4A7VA 2WWOA 1TO4A 1OEZW 4L05A 2AQNA 3HFFA 1E9QB 1SXSA 2C9UA 4N3TA 1U3NA 2AQSA 2SODB 1COBA 2AQRA 3QQDB 3GZQA 3K91A 3L9YA 1SXCA 1BZOA 3SODB 3H2QA 3H2PA 1UXLA 2ZKWA 4BCYA 1E9QA 3KM1A 1AZVA 1QUPA 2AQPA 1FUNA 1E9PB 1N18A 4MCNA 1MFMA 4A7SA 2ZKXA 4OH2A 4A7QA 3QQDA 2WKOF 1F18A 2APSA 1IBBA 1SDAB 1Z9PA 4B3EA 2GBVA 1HL4A 1SXBA 2Z7ZA 1KMGA 1IBDA 1PTZA 3KBEA 1OZTG 1B4TA 2WYTA 1E9PA 1S4IA 4A7GA 1CB4A 2Z7UA 1UXMA 2E47A 2NNXA 5KBMA 2VR6A 3MNDA 1SPDA 3GZOA 1OZUA 1RK7A 1Z9NA 1SXAA 2AEOA 1DSWA 3PU7A 2VR7A 1BA9A 2AQTA 2R27A 1IBHA 1IB5A 1L3NA 2K4WA 3CE1A 5KBLA 1XTLA 1E9OB 3CQQA 3HOGA 2E46A 2LU5A 1JK9B 2JLPA 1SRDA 3GTVA 1F1AA 2Z7YA 3GQFA 1EJ8A 3F7KA 1OAJA 3HW7A 2WKOA 1XTMA 5CU9A 3F7LA 1PU0A 4OJAA 2JCWA 3CQPA 1E9OA 1CBJA 3KM2A 2GBTA 1JK9A 2C9VA 3KH3A 3MKGA 3S0PA 1YAZA 2GBUA 2XJKA 2XJLA 2WZ0A 3ECUA 2WZ6A 4BCZA 1N19A 2WZ5A 1F1GA 2AF2A 2Z7WA 4A7GF 2ZKYA 3GZPA 1DO5A 3ECWA 1OALA 1F1DA 1HL5A 2ZOWA 3GTTA 5KBKA 1ESOA 1PZSA 1SXZA 1P1VA 4MCMA 1B4LA
chains in the Genus database with same CATH superfamily
3GSOB 2ITFA 5HPMA 2GSGB 1D6VH 5IWLA 4DKTA 4OVUA 2QL1A 4YBHA 1V54B 4KZEL 1H19A 1L9PA 2EICA 3GMRA 3L4TA 1HH9B 3L7EA 4KBPA 3ZGHA 1FZJA 3GLAA 4IHOA 4JM2F 4F57L 1CE6B 2EECA 1VFBB 2DWDA 3T5WA 3UBHA 3BPNC 4LLWA 3AY2A 3KEDA 4N0UE 1SM3L 4NQEA 5DFVD 4E41D 2VLRB 2P5EE 1S9YB 3F5WA 2OYPA 3NJHA 5EB9A 4MKTA 2IH3B 4LCWA 4NWTH 1KJVB 2APWA 5DMKB 2IANE 4AX3A 2QPDB 2VDQH 3P54A 2V6HA 3Q3GA 4PR5B 4AEHH 3ZKXB 1UACL 5FYJD 4Y4FD 3H2QA 3BO8A 5J6HB 2I9LA 1CI3M 4PRNA 2AQ1A 2UUDH 1L6XA 3MQIA 1LK3L 4UDTA 3FONA 4NQVA 2BY3A 2H3NA 4XMTA 3PV6A 4OUOA 1DJYA 4LGSB 3CVHB 3NCWA 2F5BL 5F9OH 5B3SB 4AZUA 3R06B 4P2OB 3Q01A 3DOIA 4HFWA 1XT5A 4WWKA 2X4TA 3HAEB 4PHXA 1BVKB 2ZCHH 4GI8A 1DQLL 2AV1A 4ZTEA 2VZUA 5DRZA 2DQGH 4ALAL 5D55A 4AEFA 1NDGB 2UXTA 5F7NC 1ITCA 1QI5A 4U1KA 3SYPA 2YD7A 3S36X 4XNZB 1AGDA 3ZDWA 3ULVC 1F3DJ 1U3YA 4AZ8B 3FBQA 4ZFGH 3TPUA 4XN2A 4F9LC 4RAUA 1LMKA 4DUVA 1QW8A 5IHZB 1FHNA 4A2MA 3VXQB 2WLHA 4X50A 1OP5K 3LYRA 1LEIA 4Z23A 4LSDA 2FX8H 1ZV9A 3GSQB 3LD8C 4OQTH 5HD8C 1A3LH 4IU2A 1N59B 4X6CA 2JJTC 2NTFA 2NY0D 2YAOA 4HF5L 3ARTA 3IETB 3K4ZA 4KHTL 4XPHL 1ZTXL 5DYOA 4AUUA 1QR1B 3VTMA 4ZMXA 2NY2D 4U1JB 1ZLUH 1U33A 3AC0A 4QTIH 1JGEB 2AXHA 2LGNA 4BFBD 1M05B 1NSNL 2V5YA 4OCWL 5DZ9A 4D0BA 5BXFA 1S2EA 2VKWA 4UQ9A 1MFDL 3ZTNL 3UTZA 5D71H 3VGEA 3MRQA 3VFGL 3I85A 1TDQA 2X5PA 1SVBA 4XB7A 3QORA 2NUTB 3HMWL 3MNMA 5JR1L 5M7QA 1WD8A 4NM4H 1O9VA 3SYQA 4DW2H 3MRIA 3SCMD 3F01A 1A4KA 3ARXA 2HKFL 1RZGA 3ARGD 3BSHA 4GXUN 4H8HA 4JO2L 2QT6A 4HT1H 2XYCA 1HKLL 4XNMB 1SHMA 5CEZH 4RGMC 2J1WA 4P2RA 5C0BB 3T2OA 2B16A 5B3JF 3QIBA 3ULVE 2DMHA 4NN6B 2OSXA 1N10A 2VXVL 5GIRB 2AEPL 4M29A 1KACB 3P77B 4X6BA 2DKUA 4LASH 1K5WA 2O6FA 4XP6H 1OXYA 3GSVB 3V0JA 1XGRA 3MLYH 4NUQA 1SLXA 4O2CB 1PIGA 4WKXA 3X13A 3FUHA 5ACLA 1MVYA 3JWDC 4WNQA 2R1XA 4FRWA 2ED7A 3CX5K 3MROA 4N0FA 1BP3B 1RFDL 4QRRB 5HDOA 3N1FC 4F58H 3HFMH 4HUKB 3U0WH 4HCGA 5LDSA 1C12A 4JM2B 3Q6FA 3W2DL 1KYOK 3QUMH 2OPCA 4XHJC 4L8SC 3SPVB 4A7QA 1KPVB 3LKOB 4JDEB 2DD8L 4YPGA 4K5OA 3LRSA 4JN1L 3SQBB 2VDNL 4LVOB 3BPOC 4GSDH 4YJZL 2W8CA 4MA1C 4YQXH 1EERB 1H8OA 3LN4B 4GRMB 5JXAL 4TLUA 2MCAA 4JFPB 5D96C 1A7RH 2MNJB 1ZK5A 4HWEL 1G0YR 4EIBA 2EYTA 4PRIE 1XF4B 3SJVE 4NNYA 4R2GD 4Z7VE 1P9MC 3QCVH 2Q3ZA 3I6LE 4G71B 4PCTA 3FFCE 5D9SA 1D7CA 3ESVF 2F1AA 2VB5A 5F0LB 1A25A 1DQKA 1YJDC 5KYYA 3B6SB 4HZLB 4Y1SA 4C56B 2XETA 3FDWA 3DECA 2FSEA 1P5UA 2ZXBA 4JQXA 4OZ4B 2NY5H 1FGNH 4LDCA 1OM3H 3FU7A 1YEDA 2WN3A 4RSVA 3SDCC 4OJAA 2DMCA 3FQWA 3KLQA 4X8XA 5C70A 4PSPA 3QH3A 4WIQA 3UBXG 3S9DB 4GBXB 3PGFH 3UTQA 2APXA 1HDMA 2VMFA 2F54B 4KZCA 3P4NB 5K9QG 3UX9B 2CAKA 3D7PA 3G5YB 3ARDB 1G7QB 4ANKA 2OR8A 3IXAB 3V6ZA 1HHKB 1FV1B 2BK8A 2ZP0T 1A4CA 2J1KA 3BSZH 3WKQA 3G3LA 3HR6A 1F90L 1XZWA 1KBWA 5TDNA 4EUPH 1IC4L 5AENA 1TQWA 3QI9D 3B5GA 1KOAA 3IBEA 4M3HA 5JLZB 4UV4L 4Z7UF 3E6FA 4YH6A 2YMXH 4ODUB 3TM6A 3AS1A 1E50A 3CVCA 4OLVH 1V5JA 3O9WD 1IM9B 2YAHA 4OLXL 5GQBA 4GKOA 3K2IA 2K3HA 1IV8A 1SF3A 4PJ5E 3VFRB 4KGLA 5C0DA 2BP3A 4HISA 4HFUH 4OFPA 2Z9TA 1BAGA 2DQDH 3GSRA 5DJCB 5DGQA 2YN3A 1QFWI 4TSAL 4WHDA 2EXYC 3DTXA 2L4OA 1RHHA 3SDAA 4MMYB 1QRNA 5JHMA 5BZXA 2GVYA 4O5LL 3OKYA 3HRZC 3N85H 4Y9BA 25C8L 4NERA 4QR7A 3L3GA 5D1ZA 3C5JA 2AK4D 2J44A 4WGWB 2XN9D 3IT8D 5AYQA 3HBQA 3K72B 3STBA 4APXA 3K80A 4DP0X 5FF6A 2CJUL 2ZOLB 1XGPB 3GMOB 4G6JH 2AQPA 2DLFL 2FX7L 5IMMB 2Y6SD 2I9TA 1FFOB 1TYJA 3TFBA 2YPLB 2RJMA 4UV7L 2NW3B 4NJ9L 1JAEA 3QEUA 3ZZQA 3UYPB 2UY6B 4ZOCA 2W38A 4JDVA 2R2BA 4KVPA 2R2HA 3TJEL 2OTUA 4UUJA 2LE9A 1QNIA 3HG1B 2VL5B 1LILA 5EDXA 2Y36H 5IJCC 1MFAL 1FL5A 2NY7L 1CDHA 1N67A 3QQ9C 4P4KB 4I5BA 3GZOA 3THML 1CGXA 2OJZH 3EZ8A 3T6VA 3F7YA 3KWUA 3AB0C 2PTVA 4I48B 4NIYE 12E8L 2YFOA 3LY6A 5LN8A 4ZG1A 1YEIL 5MEOA 4G2AA 4J39A 3RWFB 4ZPVB 4GEIA 4JVWA 5E2WL 5JHDD 3D2UA 3L2LA 3NACH 3RWCB 1QSED 4EF3A 3S36H 3C60B 5FHAL 5IFHH 5IFAH 2ESVA 2CKBA 4LOEA 2LVCA 2ITCA 4CMHB 1ORQA 1BJ1H 2WO3B 4F93B 1WGOA 5GZOC 5IR1B 4MD0B 2IFFL 4Z18A 4LHJB 2FD6H 5FYKD 5DD0L 4IU3A 3OJDA 3BXNA 3SZ6A 2WLNA 5C8JA 5IESH 1I7ZA 1I1RA 5F6HJ 5C0AE 3GSNA 1IX2A 3L13A 5E9DE 4QKXB 4Z95H 4WWPA 4ZDHB 4TXVB 3O8XD 1HS6A 3VFMB 1GS8A 4WV1C 3ZRCC 4WFEE 4X83A 3KPRB 5HDWA 5EG6C 2J55A 1ZLVK 4DP5X 4PRPE 2RBLA 4AQ1B 2NRDA 1VPOH 2FH6A 3DPBB 3JUZA 3RWGA 1MJ7L 2GSIA 5IVXA 3DETD 4FMVA 3V5KA 1A7QH 4NUGH 3W3BA 2JSFA 2V17L 1UT9A 2FWSA 4PJHA 4LIQL 1TCRA 5F6IC 2NMSA 3PFQA 5E00A 5D4JA 1VB9A 4TUJB 4Z7UB 3P4MA 4ENED 3FCGA 4DP4X 1Z9SB 5SX5K 3WMSA 2IWGA 2CQVA 4Q7DA 5SWZE 4BSJA 4F7CA 5IBUB 3II3A 1TCMA 5E9AA 2VJXA 2E7CA 4AYBA 4YLBA 1N0LB 2WUBL 1JPSH 4PY7B 2XTJD 1MNUH 3IDGA 2MPVA 3LPFA 4N2FA 5GISH 4XE5B 3CN2A 1AR1C 1P2CB 5H2BB 3I9IA 5I8OH 4PGJA 4DEPC 2PO6C 4BFFA 3HBGA 3HVDA 4Z7IA 4F8PA 4P07A 1JNNH 4JFFB 4BFIA 2VQTA 2YARA 1RU9H 5F1IB 4F37K 2D3NA 1R9FA 4Z3IA 2XKNA 2QVFB 4XNDA 4FQIH 5D2LA 5C0RL 3WJMA 3SOBL 4AY0A 3AROA 2JKRM 5E2JA 1CLOH 4OF7A 5B38A 4OIBA 4OF6A 2V2WA 4JKPH 1FZMA 5C1MB 1YMHB 4Y4KD 2CHDA 3IPBA 5EIVA 1ZT1B 1SJMA 5SV3A 1QVOB 3JZYA 3QAZB 1DQML 4BKSC 2JE8A 4KXDA 1T0OA 3OKNA 4HAGA 3QUYA 5BVJB 1HSAA 2BOBA 2Y7MA 5IROD 3L3JA 3BEWA 3ZRSA 1HOCA 8FABB 5IEHB 1JNJA 3SPGA 4WJ5B 4JX0A 1YRKA 3O6FC 2N1KA 3P9LA 4KRNA 1DL7H 2EKSA 3IMTA 1H9DA 1FQ9C 4I2XE 2C34A 1FJ1A 1GS6X 3LPOA 4IOSA 3SE9H 4U6HA 3U4AA 5C08E 3DXAA 1WE5A 5ABAA 1V3JA 4Y1AA 3UTTE 3A3YB 4LSRL 3HLKA 4PJAA 4KHXH 5HTSA 3TBSA 4MNHA 3ULVH 3TBYA 5HYJB 2Z8SA 1U8QB 1YEHH 3WHXA 3BFQG 3RJQB 5CJBA 4ZAKD 3UP6A 4X8JB 3GSWA 5MEPB 4X2UA 4BH7A 3K6IA 3QI9B 4NQSB 3MOAL 1NBVH 3NVQA 4OQTA 2X4OB 4YL9A 4RAHA 4LLVA 4XB8A 4XVUD 5DD1L 4WU5B 3ELQA 1KSRA 3UTPE 2EZ0C 1XSJA 3AG4B 4JRXA 2ODIA 1QYGH 3WFBL 4HSQA 4XNYL 1ZVSB 2IH8A 1HQ4A 5HY9B 5CCKL 4FTVA 5ESVA 3L95A 5LN4A 4RMUA 3SE4A 3MLWH 5K39A 3CZFB 1TIUA 1YY9D 2NYYD 4HU2A 4I1NB 4PVMA 2R4SL 4OFIA 5IK3B 3MV8A 2AQNA 4WHTA 4XOCA 6PAZA 1D5BB 1Q9KB 3GLDA 3CC1A 2FZ3B 4OD1H 1QR4A 4OFDA 3LSOA 3VXOA 5F44A 3S96A 5ETUB 5D1QD 5A16A 4RMTA 3DX9B 2FWLB 1UKSA 1FH2A 2CGYA 3BIKB 4EQ3A 2AK4B 2Y7OA 2AERT 4PMFA 3CZUB 5HGHB 4PRHD 4YZFE 1QUPA 5FYJL 1I8KA 1SUJA 3G5XA 1OGAE 4NZUH 3WEXA 2BNQB 5EUKB 3RWEA 2WWMC 3EJUA 3SY0B 5KTEL 1GYAA 1GYVA 1R34A 1NAMH 1ULVA 2X7LB 2H3XC 1NDMA 2BLFA 3VXSE 4CSZA 5ES4B 3K81A 3ZMEA 2VUOA 4XH2A 2NLJA 4NKIL 3D0LA 3O4LD 4EJ1C 3KLDA 1RZPA 4DTGL 1B4JL 3MC0A 2GUYA 3RIFK 3NJNA 4AC4A 2G75A 3EUDA 3V4PL 1Q9LB 4GAGL 4PTUA 5CEXB 4HOMA 4PJ7A 2A77H 5AKTA 3T2PA 3JWDH 2ZUSA 4J1UA 3CPLB 2QPUA 4ELDA 3KXFE 3U9UA 3WLWC 4GKNA 4QXVA 1TVHA 2WLLA 1NGZA 4QWWC 3GMQB 4NO3A 2B5IC 1YQVL 3QUMA 4JDZB 2J88L 2IMMA 5F9WC 4I3SL 1G4RA 5F97E 2ZWYA 1HINL 2EE6A 5GS3A 3ZHDA 2NCEA 1CDBA 2OYMA 1E9OA 4QHLA 3D4CA 3IDIB 4DPRA 3RVWD 3HIZA 4HS3B 3N43F 3WXVH 3BZFB 4JFHD 3BD4A 3GEWB 4KK9C 4XMKH 4LCWD 3SDXE 3UYOD 2MH4A 1S5IH 4HBCH 1R33A 3OSVA 1AIZA 4JQIL 4HPYL 3O3UN 1MQ8A 4NAQA 5F8RC 3U2SA 2A9ML 4G8FB 4UNIA 1J0IA 4X6DF 4B60A 1DYZA 5E5MB 5L2JB 3M1OA 4RESB 3QFJA 1I9JH 1SHWA 3W0WB 5ITBH 2VN5A 3SBWA 3QWOB 4LXFA 3O8XB 1RURH 3QNXA 2CDEB 4GMTL 1K8IB 5CBAB 1S9XA 1YJDH 3UIYA 3EGSB 4WWOA 1QLEH 2XXGA 5HHVL 4UTAL 1NLBL 2JI2A 2BOCA 2BY2A 4OUUB 3VSUA 1T6WA 4XPAH 4A55A 3RBSA 3WN5B 1I8LC 1Y18B 2WXFA 4L1TA 4OD3H 5IQ9A 3O3BB 3T6ZA 2WIIA 5DJZA 4JREB 4HWZB 1Z9MA 2X9ZA 5LHDA 4Z7WE 1S78C 3ZDYF 1T5XB 2J8UE 5LGKA 3D39E 1A6VH 4IEFA 3HEIB 4TQEH 2I5YH 2OL3L 4LCIH 3H3PH 3C8DA 4FJZA 3QDJB 5C0IB 4JN2B 4B9PA 4FQ2L 2W59A 2JK5A 3H4FA 4ODTH 4MS8C 2ZIDA 2QGCA 2APVA 5HHMD 2Q6WA 3DX3A 4WQOA 4EUPA 2HG5B 3SGDI 3RUGA 5LJYH 1KCBA 3LXAA 1BYNA 3SKJL 5LGYA 3P11L 1RK0B 2VLLA 2CG9X 3N1QC 3UZEC 1JGDB 3ZOAA 1E4JA 2HT3D 2GAZA 5TQ0H 3CCHB 4CC0A 2CA4A 2WM0A 5EIIA 1DUYA 5FCUL 3OF6A 5ERWB 2J72A 3QORD 1TJIL 1W91A 4N5ED 1PLGH 2AAAA 3R19A 4N9GA 2C7UB 3LRHA 4AL8H 2QKIB 2ZX7A 3B5TA 1QAWA 4ZW7A 1RHFA 3OWRA 4AV5A 4OKVB 3QJRB 5C2UB 5EU5A 3N9GH 5AOIA 3MNZA 3T65B 3WNPA 1FORL 3L3OA 3O6KH 4UT9H 2OP4H 3ATBA 3BGMB 4K5LA 5C9JA 1LDPL 5LQBL 5GS0D 2BNRE 5TE4L 5HI4D 3Q8FA 4YHKH 2IIJA 3QUGA 5DJDB 4LDOB 1R3KB 1B0RB 5E7BA 2E3VA 2XKUA 5FO7A 4K7PL 3ZTDC 3BN9D 2DDQH 3QXTA 1HYSD 1IGYB 3OR6B 1A02N 1ZLWH 1INQB 1NOLA 1UT1A 3N06B 3PAVA 3MPCA 4YX2H 1NJ9B 1TKWA 2NZ9C 1KBGL 1N68A 1JK9A 5EO0A 1A14L 3L3IB 2SEBA 4E5XG 3MOQA 1RZIB 2HTLC 4O02H 1A2YB 5HVHB 5J9PB 4RRPA 5HYSG 5C2BH 4LSTL 3QGVA 4X42A 1PS3A 2ZQKA 2CBMA 2DLEA 4A2LA 4TVSa 3T3ME 3ZZLA 1MJUH 4L3CB 5GGVH 5T3ZE 4QHNB 2TRHA 1UKTA 4GAYA 1XR8A 3HNTL 1M7DA 4GI6A 3N43B 3SE6A 4O51A 3WNNA 1CBVH 3TO4B 1YPZF 2AJUH 1F00I 4W9IC 1YN6B 2XRAL 3QDMB 4ZMWA 1QRKA 2WB1A 2YIHA 4X98A 2ZWNA 4X6DB 4NM8H 2BRRL 4N2NA 2HFEA 5GPRA 5IJDC 2VN4A 5HVGB 3MCG1 3SGKC 5JHAA 2B20A 5AL0A 2AI0H 4ESKA 2GUOA 2VQ1A 3LKPA 2HTKD 3K8LA 1NBQA 2O61A 3LQMA 3FO9B 4NPYA 4JJHA 1AD0A 4GG8B 2QR0A 5DT1L 5F3HB 5F93C 1MRCH 1Q9WA 4R7NA 1GSMA 5CBEA 2WTRA 3MV9B 2YEQA 5FGCE 2O5XH 4UWQB 3CMOL 4FTDA 4KFMA 3LHPL 3RVVD 1WUZA 2X1XR 3MCKA 4MZ3A 2AZUA 4RDBA 1G43A 1ICTA 3BUYB 1XGQA 4PRHB 2ZPKH 4FG0A 4N0UA 5FA4A 4OI8A 2XWXA 2BM3A 3IBOA 4JMXA 1JF6A 3ZDYB 5E08H 2D2OA 2P5EA 1R5IA 4L3EE 1Y07A 3RY4A 1TEFA 5CGYD 1S7VB 3NZ8A 3T4YB 1R3LA 2IANA 1X6NA 5EH1A 2HUHA 1A6TA 1GA2A 1JGIA 4BA0A 1GHFH 3MX0A 2IDQA 2PTTA 4EZJA 3BVWA 3NN8A 1NFKA 2E8YA 4H0GA 4BHUA 5INCA 1WT5A 2JB5H 4FC3E 4XP4H 4W4OC 2E47A 1CGUA 1UWXK 2AMUA 2ZP8A 2EH8L 4C4KT 2H8PB 4C4KO 3TCXA 1G1CA 2P5PA 5ICYA 4Q9CA 1OAYL 3HI1B 1G7PB 2AQTA 5KYWB 1Z1WA 3CHSA 3DX6B 4LRIC 1DZBA 1GC1C 2C9AA 1KZQA 2XPGB 1ZT7B 5IB5B 2RGSA 3FB8B 1PAMA 3BZ4B 2LAGB 3HKZA 1FCGA 4G72B 2VQUA 4MRCA 4WKZB 3OQRA 3PHOA 3VMOA 2ITDB 1OO2A 2JJVA 1AQKL 3P1VA 5FXCH 4CJ1A 3ME0B 3CZEA 3IXTA 1MRDL 3KG5A 3NIFF 4D9RE 1E30A 4N0YH 2YEVB 2AAVA 2YPVH 1X4YA 5GRJH 3SDAD 2PWHA 5IB2A 3P30H 4L37B 1CO1A 1QFOA 1HZHH 4R4ND 1NBYB 2ZX9A 5F8QC 1JGVH 1L0XA 4UINH 1THCA 1JIBA 2X09A 3DO3A 4WU7B 3WJJC 3D09A 1A0QH 1G9NC 4MQXC 5KZCD 2BFVL 2YMTA 3BIAX 2L04A 5F7DB 4TPRH 2CO6A 3J2PA 1YYCA 1NEUA 2QQLL 4W81A 2YUVA 2HH0L 4FP8H 3E2HB 1MLBB 1YEJL 3ZHLA 4R7DA 1AGFA 3HMXH 2Y07L 3NFNA 4TUOB 3QO1A 4FQHA 4IGBC 4BIKA 1SN0A 1QTYT 2C3HA 1W72H 4DNLA 3WJLC 1HIMH 2ZX8A 1EEUA 4JRWA 2MCPL 3IMUA 3ZJAA 3BHBA 3VRJA 3E0GA 2B08A 5CP7B 3DV4A 3WS6C 5CHNB 2HX7A 4V33A 3SDYL 1YPZB 4YE0A 4L9LB 1JZ4A 1RIUH 1VEOA 4Y8AA 5A7EA 1ZCRA 2WVTA 5LBVA 2CUAA 4U1GC 2X9YA 2OMXB 3NSXA 5B39A 1FBIL 3D2UD 4F9LA 1U8NB 2FLMA 4WK0B 2O6PA 2I25N 2DKSA 2PR4L 4X7FC 2RQEA 3UEQA 1E9QA 2QHLA 2IOIA 1LWJA 2NR6C 5MHSD 2CWRA 2XG5A 3BDYH 3SDDB 1INDL 3N0PB 4PW3A 5CFHA 3PAYA 1UD6A 5B4MC 4N20A 1HTYA 2JJTA 5DRNA 4FQQA 1M1XA 3GSUB 3I50H 4OLYH 2XWCA 4D0DB 5H35A 4BWWA 1E8YA 1CFNA 2PWDA 2V9UA 2ATPB 5D8JL 4Z7NF 4DKDC 2C9QA 3VRIB 1B4TA 1TZGH 1E9PA 1S4IA 2OCCB 3ZO0A 4JHVA 2J5LC 3P69A 1XF3B 2ARJA 4OLWH 2MCMA 2XZCL 1ZHLB 5LBSL 4BA8A 2FX9L 3RHWF 3G6AA 1EJOH 3W37A 1S7QA 4NNXA 1HHGB 2DKMA 5E1GA 3EFFA 2VXSL 1EAOA 3OKMA 5CSZA 4G7VL 3PNWB 1K8DA 1OLZA 2E7DA 3REVA 5F88A 2DWTA 5EIQA 1ADQA 4AYSA 2IDCA 1NANI 1SYVB 4ELME 3QPQC 1E7VA 4GAJL 3GRWH 3GNML 2IOMA 1I31A 2Y1ZA 3MGOB 4KROB 4ZUSB 1UM5H 1K5NA 4PRIA 3SJVA 3ULSA 5AYTA 3AG2B 4NGHL 4PBXA 5KSUA 4Z7VA 4HC1H 3QDGB 1NAMA 3FFCA 3ZR6A 1BVOA 1FH5L 1RZ8B 3V6OC 1JYXA 4Q52A 1ZK9A 4O9HL 5I2IB 1TJXA 1DQDL 3BIBX 5DD6B 1E5CA 2FJHA 2OJEB 1IFHL 1JXGA 1EH9A 4AKQA 1KPUA 1C5CL 1F02I 2OCJA 5DRWB 2F5AL 5E8OB 4XVSH 1NC2A 3WFZA 4FA8A 1QO3A 2Y7SA 3NIFB 3V52H 1UA6L 2AABH 4JE4B 4JJ5A 3CZKA 4HCFA 5EPMB 2V5MA 4TUUA 1UCBL 4HIEB 4EZLA 4HXAL 4TULH 2WLZA 4FJ6A 4JR9L 1TENA 1ZVNA 3QEQB 1I1AB 4FADA 4BZYA 3IN2A 3P3SA 4GRLC 2EACA 1DZ0A 4YXHL 3VMPA 2O5YL 4L8SA 3CLWA 2WOYA 3KWVA 4QGYA 3CZSA 5IVOA 4AMKH 4X9YA 1ASPA 4QRPB 5AZ2H 2ADGB 2YSSA 4HUVB 3FRUB 3N42F 4POYA 1BZEA 4M8QA 1KJ2H 2P5WB 5ALBH 1E4KC 2P46B 1BQHA 4ANWA 1JFQH 3KPSE 1EZLA 1JP5A 2WINA 1A7OH 2DTSA 2XV0A 3FUIA 4PJ5A 1CFVL 3P0VH 4LK4A 4Y1TA 1P9MA 4WEUD 1ETZA 1K2DA 1BZ7B 1AZVA 5DZAA 4KO6A 4F91B 3V6OE 5KSAB 5L0QB 1C16A 2WQUA 1AO7E 3ESNA 3V0DA 1AE6L 4PJGF 4XRCB 4OZFB 2WB7A 2VO5A 3F00A 4IOSD 1BZ9B 2P44B 5K1NA 5ESAA 3MJ9L 5HHNA 2GBVA 2NW2B 4AVHA 3DXAD 1NGWA 2AP2A 4TTDD 3SDCA 2AV7B 4Y1AD 3KYOB 2JXMA 4FX5A 5I9QC 2FBJL 5EZIL 3ZIMA 5E6IB 2N7SA 5KUMA 1G7LB 2PP8A 3CN0A 3M07A 3LJ3A 4LHQB 2Z6FA 2B1HH 2AANA 5E7FA 1JZHA 4W9DC 2GC7C 1SXAA 2PWEA 3DRTA 4JK0D 1EO7A 2KERA 4FNTA 1WTGT 4PJ8B 3TF4A 2HN7B 3D0VA 5LGJA 3BRGC 4ODXB 1MIEL 3CLFH 3WY3A 4DO5A 5D70H 2GHZA 5KS9E 4FKEA 4FTVD 5F96L 3V4VB 5AYUL 1CMOA 3MBXL 2CR0A 1ASQA 4TQ8A 1E28A 2KPNA 5JQ6L 1NIEA 1RLWA 3BD5A 3C08L 2V5TA 5T3ZH 3F05A 3MRRA 3QRBA 3PWLA 1K4DA 1CZ8H 3JBG7 4GIOA 2A9AA 5DJAB 2XJLA 3TFKD 2WXHA 1OAXL 5IREA 1FE8H 3PWJB 4JM4L 4X0KA 5JW3L 2UV3A 5J6SA 3BQUC 2IF7A 1ZLVH 1O7VA 4L1DA 4OI7A 2GTWA 4NO0B 3U2IA 1JYVA 4DT2A 1JZ2A 1QFWH 1NOAA 4UT9A 5TPWL 3HRZA 3RWHB 1QZ1A 4AEIL 3R18A 4J4PC 5FS5A 5CUSL 2WO4A 4OCXL 5GS2D 2PXYD 2QZQA 1KTDB 2HKAA 3IFLL 4NT6A 3Q43A 2LU7A 4QGTA 4DVRL 1P6AB 1IQDA 2MTAA 2OKMA 1L9QA 1EAPA 3FUEA 1ZAGA 5C0AA 2OW7A 4HGKC 4R97B 5E9DA 2HFGH 2XX0A 3OHXC 4DAGH 1NMAL 1HL8A 4HIHA 3HHRB 5E8NA 3VFPB 1YYLL 5HHOE 5E4OA 4D9QE 4HDIA 2F7PA 4Q0XL 2OMZA 4O02A 5TDOA 4PRPA 1AIFA 2XG4B 3WD5L 3KWTA 1IE5A 1DO6A 3JV6A 4XVJL 4BV1A 4S0TD 3SODB 5BV7L 3QHFL 3ZE2F 4PQXA 4X4ME 1X5FA 5IFJA 3ILEA 1DJZA 1U3HD 1KB5A 4MLIA 1CF1A 4BZ2L 1LM8V 2ADYA 1LEKB 5CJOH 2DQCH 3FQUA 2W0PA 2QQNL 3VXME 3N42B 3ATEA 2Z4QA 1TPXB 2DBLH 5DQJA 5BMFL 5GS1C 3LMJH 4LL9A 1WTLA 4U1NA 4TMPA 5SWZA 5DUPL 5D6CB 3H0TA 2MHAA 3VU1A 1BMZA 3NESA 4RZCA 3OWEA 3OKOB 3UZQA 3V6FB 2Q8AH 3VFTA 3BKYH 5EU6E 2WXQA 2EE9A 5ADOH 3DX1A 3LKRB 4ZMQA 3GS0A 4CDHA 3X3FL 1H6EA 1DQJA 3W39B 5GZOA 3ILDA 1T03H 2NY3B 5MEQA 2V8LA 3T2NH 3IDYC 5FAAA 4N8VB 5HDQH 1Q8MA 2XPYA 2H9GB 4MBOA 3FS9A 1E8WA 2A83A 2AJZA 1JXDA 4PJGB 5DD5H 5AVZB 1T1ZA 1RXLA 5HHPA 2OSWA 3MA9L 4N2GA 1S7XB 5E8EA 2G3MA 5BRZB 2OA9A 2E56A 5C07B 5I23A 4WV1A 5GSRB 2WYIA 3T6WA 3D0AA 4RGND 3P2DA 1WAAF 1XH1A 4YSSA 1U8HB 4M7LT 1NC4B 4L5FL 5E8PA 2VDPB 4ZQTA 5HP5A 4R83A 3BKCL 1RI8A 1HXYB 2VDLH 3IAQA 3MACL 2VISA 3MREA 1I8IB 3ERXA 4GW4A 4O58H 2YD4A 4KKCC 4G8EB 1AQMA 1XH3B 2ZKYA 4DGUA 1RUKH 1OGTB 4JFDB 2VZSA 5I5MA 4JS7A 1KENH 3ARRA 3MN8A 3HG3A 3HPLB 1UATA 4I2XA 3KLHC 2BP8B 1GC1H 3CH8A 2AJYL 4LLYA 5KJRL 1AGBB 4GIAA 1SXNA 5ENWB 3RE0A 5FKAA 5C08A 2C8NA 2ZUTA 4NLAA 3EDEA 5C09B 3UTTA 1JF1B 4UQCA 4YO0B 3L6FA 5DK0B 1MJJB 2PO6A 3BSGA 1AQHA 3QQ3B 5K9KB 5E2UH 3MLRH 1JNHB 1TVDA 3C2AH 3DOSB 3X11A 3V0AC 1EDYA 4BH8B 3I6GA 2YPVA 3FQRA 4QI3A 5I18L 3RX7A 3O2VH 3DURB 3MXVL 4WRLA 4MZIA 1OANA 5KW9H 4KJPC 4WI8A 3UCQA 4KNUA 1DBKL 1OAUL 5L88H 4KTGA 4M5ZH 4JRLA 1IKNC 2FEEI 2PW1A 4XPTH 1NTDA 5J1AA 3NSDA 1DBJH 1UB6B 4GI9A 5K9OB 1MCJA 3GJFB 5BZDB 1G9NH 1MCFA 4OCRL 2ZOUA 4ONOA 2DYRB 4XMLH 2BSBA 4OZHF 3ULUC 4FNPA 4YZWA 3QQDA 1CFQA 3RGHA 3UZVA 2E4FA 2CK0L 3HMXA 2CO4A 3WLBB 2R83A 3WSQL 4K9EL 3QVAA 2UYLA 2ENSA 3U46A 3O6FA 4OB5L 1OTTC 1FI8C 3ZE2B 3HPJB 1W72A 1BMWA 3X12B 2CLVA 4D7PA 3WYRA 3IU4H 1GTNA 4XCCL 5CCJA 4AK2A 5IJVB 3LDBB 5E2TH 1OGAA 3C6SA 1MUJA 5AVVB 3TIEA 3LNEA 4D0CB 4R4BA 3D69A 1PCXA 1RZKC 1G7IB 2GFBA 2C3GA 3WUZA 1MSPA 3FCSB 5I8CB 1BEYH 3VXSA 1NCDL 2GW5A 3MRPA 5JA9A 2K7QA 5IF0B 1FNEB 4F3FB 2PW2B 2EUZA 2QADC 3A6CH 2OFQA 4C83B 2Z7YA 4MMXB 5ICZB 2K9UA 2YC1A 4KMQA 3VCLB 2JJSC 3NGBB 4KUZH 4ETQB 4YHML 3WCYA 32C2A 1CU4H 4LP8A 2BVYA 5D5ME 1BEXA 4MJ4A 4PY8I 1NH6A 1UWEL 1P4BL 2BSEA 4LQFH 4P5TD 4Q9BA 4TS6A 4KRPD 3KXFA 4H0HB 4K8RC 2JH2A 2NY4C 4FNSA 1JNLH 2X1OA 2HKHL 5DUBA 4U6VL 3W57A 2HPOA 4V11A 4LSVH 3ULUE 3FT1A 4YXKH 1PEZA 3NCYS 3HE7D 4NI3A 1NKRA 3IFOB 1W80A 4PGBB 4XMZA 3EJZD 3KWXA 1WGVA 4WUKL 4N28A 2CDGB 2LU4A 2UX6A 1U8PB 1XGTA 4MNQE 3P0YH 4QHUB 3SDXA 2OI9C 2IPUG 5GRWA 2IAND 3S34H 1IE4A 2QFPA 2PXYB 1Y1UA 1FYTA 3GRWA 1KN4L 1AR2A 4HJEA 4QJ4B 1ILUA 5LLIC 3MTXA 3KL3A 3Q9QA 1V10A 2IPTL 4JCLA 3EW3B 1Q72H 4Q6IC 1HHIB 3DRQB 4HC1A 4R5VA 3UDWC 5CM1A 4WCYL 9CGTA 1OSPL 4IM8A 3S8FB 1J8SA 4AGNA 4AEEA 4V2BA 2F2HA 3BVNB 2CBTA 3HFFA 4YHLH 1PKQB 2SODB 3G5VA 1M6UA 2X1PA 3VFNA 4TOYL 3RDTD 1OE3A 1UYWL 2XU9A 3SKNB 1EBAA 3S37L 4BSWB 4P46C 1X5XA 4LSPL 3KDMB 5JW4M 3AG3B 1UENA 3IMRA 1AD9A 2XXFA 3RZCC 3HHMA 4G6ML 3PWPE 4QYOA 1UM4H 4Z7WA 1U3HB 1ODAA 1DJIA 2XN1A 2YUZA 1GIGL 4GKZA 1T04B 4KMLB 4POZC 3QEHB 4M7JL 3V0WL 2R8SH 1TQUA 2J8UA 3D39A 5T1KA 4DVBA 1D5XA 2FYYA 1KLUB 1G5GA 5FKPB 4JGJA 2CKBL 4S10A 1IC5H 4HS6A 1CTMA 5IBTL 9PCYA 1ROWA 2C1PA 3MBED 1KGWA 1VLXA 4IIZA 5CILL 3TT3L 3U7WH 5EN2A 4HCRH 1YNLL 3A6BL 4WY7H 1DCLA 4RFNB 1WWWX 3IVKB 1F41A 3VI3F 1NZRA 1KJ2A 4JKKA 5IW6B 4Y2DC 4OZHB 1A6UL 2VT0A 1N64L 3GSNL 4B0MM 3FFDA 1G7MA 5DVNA 1N3NB 4AVJA 1BIHA 1QFPA 4KZDH 4OCMC 5AW9B 2BJMH 4X7DC 1L9RA 2JKSA 2NT1A 3HS9A 5KOVC 4BGDA 1PX4A 3OAUH 3T4AC 3B43A 3VWKD 2VAJA 1RZJC 4UMSA 1CURA 1BCIA 1T3FB 2WWKT 2QVMA 5KSBE 2YGQA 4G7SB 3UTSB 1I8LA 1YY8A 4E5XB 4JUTA 2BNRA 3EJYC 4JFOB 5TQ2L 2XY1A 2CBOA 4UNTA 2XY2A 5BO1H 1BDYA 1ZXKA 2WZ6A 1R5WB 2C1OA 3KGUA 3P02A 1NGYB 3V0VB 2YS4A 5EORH 1KEMH 2IXQB 1CXHA 2IQ9H 3L3KA 3PG2A 3OR7B 2MOQA 5HD8D 3T09A 4LCUA 5CO1A 1BQLL 4JVUA 2WY3B 3T77B 4PD4J 4YDZA 2QPSA 1ZIBA 1D6VL 1DVTA 2KPWA 3DUSB 2AQQA 4AGPA 3FT0A 3RKDC 1HZLA 3SGDH 3JV4A 2HT4C 3KPPA 1GGCH 4PRBB 3UZEA 1AH1A 3KYMA 5IHBA 4LGRB 3FMGH 2UZXB 3NJXA 4MWFB 2P49B 5HI3C 4PP2B 5F0PB 1GGBH 4FS0A 3WHE0 4TKWA 4X4YB 5ACZB 2CHXA 4D9LL 4H1LH 5A2KH 1Z5LA 3PABB 1D7FA 3KBPA 4IRSB 5I16B 3NCMA 4NWTL 2R7EB 2VDQL 2YO3A 2X3AA 3Q5TA 4AEHL 2AJXH 3VXTA 1L0YA 3SJVD 4CVWA 1UURA 2LAAA 1KV3A 3U4BH 2YWZA 3KLAA 1P69B 4A7SA 1EEYA 3FZUC 3FFCD 3LRGA 2EO1A 2ID5A 5F9OL 1F18A 1X7SA 4K5NA 1KGYE 2ZCHL 2D31A 5C7XL 4JPWL 1CLCA 1MVUA 2DQGL 4W68A 3ZDZE 1BGXL 3SBPA 3LZFH 4WI6A 4QTHA 1ZOXA 4MJ6B 2RCSH 1NC2D 2NUPA 4ZFGL 2P8MB 2KQNA 4L3EA 4G8AC 4LSQH 1SYSB 4QRTA 2DIJA 2H26B 2N7AA 3FO2B 2NXZD 3KGSA 4G3YH 1C8QA 1PAZA 2BPBA 2FX8L 4N9OB 4YVUA 1RUMH 1A3LL 5JW4N 4U1SA 4W4NA 2A6DA 1KELH 1R24A 4OF8A 2FLRT 5IIEA 3B3IA 5I8EB 2Y5TB 3ZXAC 3VI3B 2HFFA 2JKIS 1WIOA 4QTIL 5GGUA 3ZE0F 2UZIH 1G9MC 1Q0YH 2D7TH 3SIKA 4CDGC 5IB3B 4Y0GA 5F9DC 4MA3A 4P5TB 4N6RB 3M17A 2KI6A 3VFWB 5GRXG 5D71L 1PD0A 4XNXH 3FN9A 4CC1A 3C6LC 3SGKA 1SVCP 2CLZA 3KPOA 4PJ5D 3UBGA 4F24A 2DQEH 3MFFB 4PGCB 4ZTPH 3ES6B 3GRBA 3HE7B 3T1FB 3WIIH 4NM4L 4DW2L 4X9IA 1LL1A 1MAMH 2F19H 2YUWA 2CJ3A 3MV7A 3TZVC 1IBYA 1UXSA 3TBVA 4F2ME 3CDCA 43CAA 4HT1L 4P2YA 4ZS6C 5CEZL 3QEGH 5SWSB 1HCYA 1T1WA 3V4PB 2CM6A 2PYEB 3VXUB 3C12A 4P9MH 1YAIA 4F2FA 5D6DC 1OB1B 4KTDH 3WFDH 1J8HE 3Q8EA 5IMLB 5DEGB 5IY5B 4IS6A 1G9HA 1TZIB 4Z76A 1BJ1J 3BFWA 4LASL 3NDZE 4H0LC 2BSDA 4XP6L 4OFYA 3MLYL 1DSFH 4PB9H 3DVGA 1U8KB 2G3XA 1QEWB 2BO0A 2QTEA 4S1QH 3UAFA 2XBZA 3EH4B 5DMIH 4Y4HC 3RDTB 1K9TA 1JV2A 4W4OA 5DHYA 3UTOA 1BZOA 4KXZH 1OQXA 2DY2A 1IGJB 3WL9B 2ZKMX 3L3DA 4KDWA 4NQXB 3HFML 4U49A 5GJSH 5T1LD 4JPSA 3WTYA 4N85A 2CE6A 1P7KB 1WFJA 5EC1A 3F58H 2A73B 2AHIA 4LRIA 2H47C 1IL1A 2FQGA 1J18A 2QJDA 5KOMC 3K8MA 1KPRA 1O6VA 1XIWB 2B1OA 4H5SA 2H0EA 1DJGA 4YC2B 1J1XL 1YEWA 1JWSB 5CLZA 2ATAA 4MKMA 2NYZA 1E5YA 5KANI 4NRYB 3TH2T 4YQXL 2IEPA 1ZY9A 3A23A 3FAWA 1J86A 1A7RL 4JLRB 4PJDB 3S2AA 4YEEA 4U33A 5J0BA 2V9TA 4JFVA 1XCQA 4GMSH 4WVRA 3QCVL 1NDTA 3DHUA 5G5DB 3JWNG 2GYSA 3WTTA 4JANB 1QUNA 3WJJA 3VGFA 2Y3NA 2IDUA 3BKML 3S7GA 4MASA 4E0RB 4ICXA 5C0AD 3ZKXC 1E8XA 2NY5L 1MAKA 1CDJA 1W0WA 3VWKB 1FGNL 1OM3L 3ULUH 1VSCA 1S7SB 3QFDA 4MDJB 2JKNA 1PIFA 3BWAB 4H26B 3MZTA 4WFED 5E1AA 3NMEA 5DURB 4PRPD 1YUHB 2W65A 1T0MA 3PGFL 1OCWH 4ZMAT 2VXUH 2XJKA 4IGBA 4P2OC 2WIMA 2CGZA 1TQBC 4B9KC 4YHNA 3QQ9D 4ELMA 3F83A 5CSBA 3WJLA 3DARA 3BYYA 3MKKA 3KGRA 5LO7A 1WSST 2VERN 1TEGA 3GC3A 2MOVA 3WS6A 3BSZL 1E6OH 3ZE0B 1XVSA 2NNRA 4WZ9A 4LLQA 4DZBA 1IGIL 5F7FA 5GXBB 3CHQA 4LF3B 1XFPA 3T0XA 1UA7A 5IOPA 5SWZD 1KY6A 3ZMNA 3FCUB 2YMXL 3E6HA 2ZSVB 1AMYA 2AFNA 3GMMB 4OLVL 1QFWM 2NR6A 4YHPB 3IJSB 4UQ3A 2OAAA 1Z2KA 2XV2A 1INEH 1MHHB 1N4XH 5DTFA 1ES0B 3EG9B 5INDA 5GZOD 2VIRA 2VLRE 4HFUL 1XF5A 2DQDL 3IU3A 1SN5A 1TU2A 2XCMC 4K8RH 2EDMA 1HSBB 5EBMA 3DOHA 1S9VA 3ARBC 3ABMB 1H5BB 4IQHA 4LSUH 1X5MA 3N85L 4P5MA 1IARB 4ZPTB 1Z9LA 4LP4A 3DK0A 1FZOB 4ES9A 1UXLA 1ZA6A 1EXHA 3VXRB 3G7TA 4NJAH 3I84A 4QPEA 4G6JL 1D9KD 5H37H 1EWHA 3FTZA 3QARA 3B9AA 3VGBA 1NANH 4NP9A 1SQMA 1YCSA 3GMNA 3KPSA 2HG0A 2Q3XA 5K1JA 1A9BA 5CKAA 1OCRB 1FVEB 3UBFA 3KBEA 5E6RB 2XVBA 4V1DB 4NQUA 5AVYB 1A3ZA 2BHZA 2Y36L 4N5UA 2AQ2A 4PEEA 2CM5A 1AOZA 3V6OA 2H6UA 1AO7A 2OJZL 4MDIA 4M56A 3UGEA 1E40A 2FVNA 2WAHA 4ABVA 3U30B 5C08D 1EHKB 1LE9A 2GITA 3TVMB 3UTTD 5B38G 1AR1D 1IAII 3NPSB 2N01B 1TSRA 3FTUA 3NACL 2K70A 1KXVC 2EYSB 3GUFA 3S36L 2BERA 1BBJA 1I3RA 1QWHA 3QIUB 5IFHL 4AYFB 5IFAL 1W6LA 4JM2C 2K4AA 1KTLB 4ZO8A 5C0CD 4KUCD 5ICXB 5JQIB 3WFCH 3OD3A 3AU1B 4GRLA 4R5XA 2MSPA 5LAXB 4PRAB 2EC8A 3PF2A 4FCHA 5M94B 4HCRA 4WHCA 2GJJA 4G9DA 5DS8A 3QIWD 5FYKU 2FD6L 4LVOC 3ZL1A 5IV2B 4FJYA 5KS9A 4LMQI 8CGTA 1OE2A 2VITA 1XF2A 3PP3H 5DWPA 5IESL 4MSWA 5JOFA 2CR3A 3QHTC 2W07A 1WC7A 4MTMA 5ABZA 1E4KA 3WU1A 3HZKB 2EUWA 2P8PA 4QHMB 4QNPF 1A3RH 4Z95L 1SVZA 2JIXB 4ZXBB 3G6DH 5H94B 1VACB 3EDJA 1BWMA 5C0BE 1CGYA 4FZ8H 1AGEA 1T83C 2X4QA 4OCLC 3D48R 4JFQB 1XD1A 2FL5A 1T1XA 1UZGA 1VPOL 2GIYA 1GGUA 4IOIB 4GQ9H 3VTTA 1RZJH 1LEGB 3V5HB 4UIKH 1QA9A 2GT9A 3VYPA 3ZE1F 2WMPB 1A7QL 1I1CA 4NUGL 4F7PB 3QXAA 4HJUA 2APFA 3PWVB 4P59H 3DTUB 1F58H 3N1PC 2F7QA 5I26A 2BIHA 1DVSA 4O2FA 3P4LA 4GBXC 4Y8DC 5I8KH 4X99A 4DJMA 3K71B 3K8KA 1DN2A 3PHQA 1A1NB 1DUZA 1RJCA 3OMZA 5AQ0A 1JD9A 3VXSD 4QRRE 4I9XA 4LARH 4MDRA 3WFEH 5ID0B 1UUSA 3C5ZB 4WI4A 3ARDC 4LFHD 4YMPA 1F6LL 4P49A 4XCYA 3U83A 2O6DA 5T1LB 1JPSL 1MNUL 5ESQB 4K71B 3LQAC 1WO2A 2G2RB 5HHOA 5GISL 4NSKB 3DBXA 2EZ0D 5I8OL 2BSED 1GJWA 4MZRA 4G80B 2YXWA 2X38A 3AG1B 3KXFD 3DSFH 4K94C 1JNNL 5IB1B 4OIIH 4B9IA 2R1WA 1RU9L 3BP4A 4JG5A 1NEZA 4HUXA 4KXCA 3BDBA 3HN5A 1TYEB 3NA9H 4X4MA 5TFSH 3MO1B 1CLOL 6TAAA 3VXMA 2XWTA 3KYKH 4HOWA 2WLJA 1KCWA 4JKPL 4ZW5A 3RY6C 4IBWA 4KUCF 2FUQA 3BQUA 2P24B 3FTGB 5F7AA 4KGJA 3ZZ1A 3LZOA 4C56E 3IAGC 3POCA 1NM4A 3RA7H 2ZAIA 3DX4A 1TVBB 4Z0XB 3DYPA 2F7IA 3SZKC 2V3DA 4LU5H 5IMOA 4QRSA 1FAIH 5EU6A 1ZS8B 3MRKA 1SUHA 1UJ3B 1IRAY 1CT8A 3DVIA 5A2AA 1NCAH 3BVXA 4UANA 4J4PA 1BD2D 3GT6A 2Z34A 2FJFA 4UIMA 5ANHA 3U25A 4F7TA 3CDYA 2VABB 3VD0A 2QKSA 2R59A 2F54E 3I75B 1GXEA 4LHUA 1DL7L 4C55A 2I27N 2JTYA 3ZZSA 3BP6B 1P1ZA 2BVPB 1KLFA 3SE9L 3OHXA 3OB0H 4RAVB 3WAJA 5KVDL 2HWZH 1U8OB 1X4ZA 4Z0BH 1GMIA 1FO0A 1G1OA 4JW3A 1CF8H 1KXHA 1FGVH 2Y3AA 4KHXL 3ULVL 4G1MB 2GHWB 4CU7A 3BPCB 1YEHL 4FHJA 2J4WL 1JV5A 3WLWD 2GK0B 2E6QA 3RIAK 4P4KC 3D39D 2BSSB 3KPMB 4QWWD 1NBVL 2AEIT 1P84J 5D7HA 5T1KD 3ZBMA 3BP5A 1HNFA 1ONQA 3KWWA 1MWAB 3I6KA 4HWBA 4MYPA 1DJXA 3NRFA 4Q97A 3CFBB 5DS2A 1T7XA 1QYGL 3VB8A 1ZV5A 2ATKA 3L5HA 3US1A 4KK9D 1T1YB 5GS1A 1G9MH 1WWAX 2D0FA 2Y6TE 3C60C 4K55A 2ISDA 3MLWL 3V8OA 1JWUA 1J0ZA 4PJBF 4R9HA 4LPYA 3GXMA 3LKNB 4LLUA 3UERA 4D94A 2BC4A 4GO8A 5HHQA 4N3TA 4FI6A 3S3SA 2WSPA 4UAHA 4WHYH 4CMHC 5B3JE 2P3YA 3NP3A 4OD1L 4Y9EA 2DQMA 4XMUA 5FPIA 2CDFB 3PGDB 1P7QB 4FXTA 4TLSA 4TLTA 4Y5XB 4HLJA 2EVFA 3WNJA 4L8CA 1F56A 4RSYA 5IB4A 3FHAA 3C09B 4XMPH 3ZE1B 1E4XI 2R2EA 4PCKA 1EV2E 3FF8A 2YPLE 2FQEA 4FNUA 3TPKA 1D9KB 5C0FB 4MB5A 3ZDXF 3UGUA 4NZUL 5BRPA 3GJEA 2ZE0A 3ZLQC 2BNRD 4P4RB 3HG1E 5JTWA 1QASA 4EUPG 4QKTA 3QJZA 1NAML 4AQ1C 4LLDB 4N2DA 1IBDA 1S78D 4TSCH 5KYUA 5JZ7D 4MX7B 1OK8A 1HHHB 4LPWA 1BYOA 1SJHA 4KZ0A 2IBZY 1VKXA 4UM9B 1OK0A 3FPYA 4MS8D 1OP3K 1U92A 5C7ZA 3FB6A 2XVLA 2A77L 1FL6A 1YN7B 3DIVA 3JWDL 4NP4H 4YE4H 4M1DL 5DQ9B 4D8PB 4UOQA 4GUPB 1H3PH 2BZCA 4HAKA 5L2KB 3FQTA 3NRPA 2WLMA 4ZMNA 2BVQA 5C3IA 3S88H 4P3DB 4OF3A 3L45A 1OAJA 2VZ3A 3UC0H 1IUZA 4LEOB 3TBTB 2PWGA 4N25A 3VDCA 2J8UF 1JDDA 5TGBB 3WXVL 3KPLB 5I5JA 4XMKL 3UAJC 3ZSSA 2IFGA 3CK0H 3KW8A 3PAZA 4GSQA 5SX4I 2HUEA 1ZHNA 1S5IL 4HBCL 1KEGH 3W5MA 3QIWB 1S9WB 3K0YA 1C9SA 3QXVA 3LEXB 1E4WL 2VTFA 1L7TH 3WDIA 3B9VA 4F8QA 1I7TA 1KIPB 3CSPA 4YSUA 1CCZA 4OVVA 1HE7A 1I9JL 2OTWB 5HI5C 5ITBL 1KWKA 5D5MA 2J5WA 3KPRE 1CICB 1EO8H 1RURL 1IKNA 3KYNA 1YJDL 3L8QA 3MXWL 4RRPG 5I1EH 2QGEA 3Q06A 4HK3J 1OGPA 5T1MA 1QLEL 1AQ8A 4GT7A 1D5MA 2WXPA 3BOVA 4BYHA 2P42B 4HJGB 4XPAL 4XN8A 5F7HA 4OD3L 2NZ9D 4BD4A 4F80A 1MCOH 3MRDB 1KXTB 3Q44A 4W6YB 1N6QH 3F6IA 3VQLA 5HPMB 3QWRA 3CVHH 3BYTA 2O5ZH 3F6JA 4GAAA 4Z7UE 4L3ED 3GO1L 3UABA 4MNQA 3QJXA 1WFOA 5L8KB 3HAEH 1A6VL 1DDTA 4TQEL 3N0AA 2I5YL 4LCIL 3H3PL 5TH2B 2IMNA 1KTRL 4WW2F 3CNKA 3UPAA 4YIQB 1MI5B 3ALWA 1Q0XL 3QUXB 1CYWA 4GEJA 4ODTL 3NSJA 4LLWB 3U7YH 1XR9A 4PJFF 3GHBH 3RPBA 3BAXA 3HVNA 4ORGA 4PJBB 2IPUK 2VLME 3FB7A 4JFFE 3QI9C 4U3SB 3ZTJH 5JYLA 5TQ0L 4DN4H 4Y5VB 3GLZA 1IAOB 2JJSA 1EBPA 2M2DA 4WW1B 1WZMA 4PLJC 4HX1B 4YS4A 3O3DA 3W9EB 3PWPA 1PLGL 4HUUB 2XZAL 3OKLB 4AM0B 2X4SB 3WY4A 4AL8L 1KYOJ 4D9RD 2WBKA 3FT4A 2CUHA 5AVWB 3UEZA 4H8VA 4RFEB 1QSFD 3N9GL 3ZDXB 3PXLA 3O6KL 1CGSH 4JVPA 4UT9L 1ZSDA 2OP4L 3F12B 5EZJB 4XNQB 2LU5A 5DVMA 5A2CA 3FO1B 2X9WA 4YHKL 5E6ZA 5IQNA 1W9XA 3IJ9A 4NN5B 1KIUA 4JGNA 1BX2B 1S8DA 3F7KA 3GKZA 1BD2B 2DDQL 5E99H 5H37A 3BMVA 1M3JA 1ID2A 1KCSH 3BKJH 5F21B 1OF2B 3LN5A 4YX2L 5DYOB 2J56A 3BWSA 3D05A 5CZVH 4Q6IA 1H8NA 4YXLH 3UDWA 3COOA 1FNLA 4O02L 3DO7B 5B22A 5HYJE 4J6RH 3L5WA 4LZKA 4G11A 2F7RA 5C2BL 4XZ4A 1B2YA 3UGXA 2R0ZH 1J48A 1MJUL 1MCWM 5KSBA 1N8ZB 5GGVL 4P46A 2ZOOA 4OLZH 3KZ8A 1R19A 2EEDA 4PJXB 3BH8A 3NJVA 4HK0A 4Y2OB 1CBVL 1EEZA 5EU3B 4XO9A 3RZCA 2AJUL 2Z93B 2F6AA 2CRMA 2IC2A 3EKCA 3TYFA 3MRCA 4S1DC 6FABH 1H0DB 1UD8A 3VQMA 2KL6A 3N5AA 3NFSH 1EZSA 4M48H 4RDQF 4NM8L 4XNBA 2VUKA 1W0YT 2EIEA 5FA3A 3NABL 3RRQA 5I73B 4I85A 3ARFB 2BHYA 4PAZA 4MJJA 2CPUA 4P2RB 3HN3A 3P3YA 3QIBB 1VRSA 4JCMA 3S3DB 4M6MH 6PCYA 2AK4E 2XN9E 4Y2DA 2O5XL 1HHJB 2Z0UA 2IG2H 1JPTH 1Z5HA 4AJWA 1E42A 1HAUA 4E9QA 2H6OA 2E9WA 3NBNA 5EF1A 4GW1A 4AENB 1GW6A 1PZ5A 2BNQE 2ZPKL 5BJTA 4HS8H 1SJXA 1WA2X 1PLBA 2XQ0A 4YDIH 5E08L 3SQOH 1REIA 3OB8A 1IAKB 4N0FB 3O8XC 3D3VB 3T4AA 3LVTA 5B39G 2D7PA 3FRPA 1FNGA 1G6RH 3TONA 1JHTB 1T20B 4WW2B 4CNIB 1C12B 1GHFL 2Z7ZA 4QXGH 2UWEA 2PLTA 2BCKA 2JQAA 3WN5C 4DGIH 4PJFB 3RFZB 3BJLA 3DETC 4G8IB 4XP4L 2ENPA 4JREC 4BUHA 1W8OA 2J25A 1OZUA 1T4KA 2YZ8A 1GZQB 4M6OH 5F1SA 4N0CD 5CNHA 2EADA 1UTDA 4JO1H 2R27A 1Q9OB 2FBRA 1RJLA 3DJ9A 4RNRB 3FOMB 2NR6D 4ZUVA 2CRZA 5B4MD 1Q4NX 3LQAH 2YA1A 1CQYA 3LKQB 3CVIH 4ICWA 4Q9RH 2P47B 2XTJC 1OP4A 4PV8A 5F70A 1U0QA 2VJ8A 3GXTA 2YLKA 3GSXA 1OWWA 4K0OA 4MXQC 4AGMA 4K94H 1UA3A 1PJ9A 2QSVA 4LMQE 4P2QB 4N0YL 2YPVL 5GRJL 1MPAH 3VSQA 2X4RA 4M3JA 5EV7A 3BUQA 2I07A 1HZHL 3FQNB 2CU9A 1LD9A 3ESPA 4IIQC 4JE0A 3W0WE 1JGVL 4UINL 1J5DA 1OPGH 3ZHNA 1L4IA 2QKIC 3I9PA 1BZQK 2V3FA 4ZFZA 1JHKH 5E0QA 3EFOA 1WIPA 2EEXA 4RMRA 3QPQD 4PTTA 4C47A 1U93B 2X4NB 4TPRL 3CBRA 1TTBA 4A7TA 3KPSD 3CSGA 3HLAA 3CBKB 4FP8L 5EU4A 3BP7B 2FLBT 1MCKA 3HMXL 1RIHL 4F7MA 4E9WA 3ZN6A 4GW5A 4U3CA 5FM5M 3GI8H 1G6VK 3RI5F 4PVBA 1QI3A 3L08A 1CC3A 3U6RB 1AO7D 4Z78A 5JDJA 3H7BA 4F2MA 4L05A 1X5ZA 3QB7C 1ZIAA 3QDJE 1SXSA 1I9EA 2BS9A 1B0IA 3WTWA 2BDNH 2IGTA 4TLKA 1AAJA 3APDA 1CXKA 1RIUL 4UQ2A 4QJ5B 4KKBC 5HVHC 2P45B 1J8HA 3OG4B 2LVEA 5AAMC 1TTUA 1E8ZA 3GBNH 5DDHA 2CCLA 2DWEA 3QJFB 1SFHA 5EOCJ 5E6UB 4A6YB 1QRNB 3BDYL 2HP4A 4H25B 4CMMB 1BQHG 1DQTA 5EN3A 4MS6A 4ZNCD 4GRLD 1XZ0A 1H9VA 3QRGH 3I50L 4OLYL 3AT9A 3TO4C 5IW1B 4AT6A 4UDUA 1AZBA 3TEZA 4YHZH 3UMTA 1H15B 4WI2A 3VXNB 2YPKA 5AW4B 1AS8A 3AAZB 1TZGL 2A6KA 4A38A 3C9NA 3ECBB 1A6WH 3V6BR 3WEMA 4JB9H 3N55A 4OLWL 3QUKA 5EZPA 1JJUA 1DEEA 2Z35A 3E80A 3C6LA 1EJOL 2NYYC 1QSFB 4MD5A 4FFYA 4S11A 2EDYA 3FKUS 1IEBA 4DUWA 3K7UA 5KBNC 1HN1A 4Z7QF 5M95B 3QDAA 2J73A 1CLYL 4NZDA 4E9RA 3QDHA 1YECH 1DQQB 4WI0A 2GKIA 5F7UA 3W1ZA 3TZVA 3GRWL 4A04A 3VX0A 2AXFA 2QQQA 4GKLA 4F9PC 4F5CE 1FIEA 4CUCA 3W38A 1UM5L 2WKOA 4JMNA 4JPVH 1KCRL 4WFHE 5FM8A 2OYKA 3RWDA 4CN4A 3RL2A 1G0XA 1P6FA 4APQB 1KDJA 3B7YA 1URLA 2CA3A 3IDJB 1VEMA 4HC1L 2PWFA 5A2FA 5D6DA 1KWGA 2W60B 4I7ZC 2GG1A 2LQRA 1IM3B 3T0BA 5JOPE 4ACPA 4UB0H 1EUUA 2APBA 1EHXA 4L3AA 3MLXH 1IC7L 1CK0H 1S7RA 2F74B 3WNIA 5L8LB 1ZGLM 4LOUC 4BSVB 4JRFA 4LEBA 3WNOA 3DUUB 1RZ7H 5HHOD 4Y4HA 4XVSL 4D9QD 2V5RA 2YQ3A 3V52L 2IBBA 3KCWA 2AABL 5GGRB 3CDZA 5ADPH 3MNVA 2OMYB 3QDME 4R8WH 2Y23A 2DL9A 3VDAA 4X6DE 4TULL 1UQSB 2RHEA 3JTSA 3LOWA 1TJMA 4ZRGA 4S2SA 2G9HB 5GGTH 4AMKL 3VXMD 1X9QA 2CGRH 5AZ2L 1KTJA 3GSOA 5I6NA 1HE8A 2GSGA 1GRWA 4LOVA 3VH8G 4FYSA 1L9SA 3BQUD 3MV9E 1KJ2L 4G5ZH 3ZW3A 5ALBL 5IVXB 3OSKA 1D7BA 1JFQL 1HH9A 1CXFA 5EU6D 1CE6A 2CHWA 1VFBA 1ODUA 1A7OL 4PRHE 4J4PD 4OSUH 4NOFA 3P0VL 5AZEH 2FCBA 2V9QA 3ZDYE 1CR9H 5HJ3A 1GZHC 1S9YA 1PG7X 2WQSA 2IH3A 1KJVA 5DMKA 1EMTH 4PR5A 1XGYH 3DIDA 5J6HA 5KUKA 1BOGB 1OCCB 3E2HC 1QX1A 4IKJA 5AEAA 2JB6B 2VDMH 3O4LE 4PJ9D 5AVRB 3CVHA 3M88A 5E6YA 5I0YA 2Z92B 2Z7UA 1FDLH 5FDYA 2D8KA 4R84A 3N2JA 3R06A 4P2OA 2ADFH 2CIIB 2VM4A 3HAEA 2B1HL 4LLMB 4J3SA 2ZG2A 1BVKA 5DK2B 3U4EB 5JIHA 1J7VR 3WELA 5JPMB 2R4RH 1MF2H 1NDGA 2WNWA 3K4AA 1GSKA 4C4BA 3QK0A 1UB5B 4L9LC 5I0XA 1MCSA 1JZ3A 1MZZA 3DJZA 4NHUB 4CVXB 1VEPA 3GUTB 3CLFL 3NEOA 4AZ8A 5D70L 1TQVA 1H8SA 5IHZA 3VXQA 1BG9A 2GJ6A 2KT6A 4MMZB 1F4YH 3S35X 5PCYA 3GSQA 3SDDC 3AFLA 3QUYB 1ET7A 5T3ZL 3OLDA 1N59A 1X4XA 3X3GL 1CZ8L 2G4EA 3IETA 1QR1A 2HT3C 3DK2A 4WFFD 3X1BA 4Z7QB 1TR7A 4U1JA 2YOCA 3BPLB 1FE8L 3ZU8A 3NJLA 4YL4A 1JGEA 2HRHA 1M05A 4YAQB 7FABH 2ZOWA 3BLKA 1DVZA 3ARBA 3LHAA 1QFWL 1AANA 1JXFA 1N7MH 1XB8A 1RERA 4KRLB 1P1VA 4I1PA 1QLFB 1Q0EA 3NCEB 2NUTA 4E42B 2OSLB 2RIKA 1JZGA 4L0YA 4DKAA 3JTTB 4MD4B 4LSSH 4XVTH 3NP4A 3HI6L 4QF1B 3IDMB 2HFGL 4LLVB 4DAGL 3AGVA 1RVFH 5ALCH 3BN9C 4TSBH 4XNMA 1HYSC 2LLLA 2UUDK 2YA0A 3WIHH 1YPZE 2FJUB 1QEXA 4KKCD 2E75C 4XBMA 5C0BA 2YK1H 2BP0B 2VZOA 4POUB 4Z3GA 4MYWB 5GIRA 3BVVA 5K39B 5JIQA 1CTNA 3P77A 1ZDQA 4IBYA 2VRAA 3GSVA 1QKZL 3WKPA 5JYMA 4O2CA 3WXWL 4NQCB 3KLHD 2V7NB 2X4UB 3WE6B 5DZJA 3RAJL 5CJOL 2DQCL 1HXKA 3I9AA 2ENQA 2AS5M 2BXZA 1XCTB 1X7QB 2DBLL 3MTRA 3LMJL 4QRRA 1KXVA 3JVGC 1IAIH 3AXIA 3HCVB 3IDNB 4B3EA 4PS7A 2OMTB 1I1AC 4JM2A 1J5HA 2Q8AL 3BKYL 3CX2A 5ADOL 3SPVA 1KPVA 3LKOA 4JDEA 5EA0H 2CIKB 3BCDA 4H8PA 4G82A 2MPAH 1AHWB 1T03L 3GD1C 1ZLUK 3SQBA 1EEQA 3T2NL 4XXWC 1V3MA 5T1DH 4WTZG 5HDQL 2WP3T 5CMAB 1FHGA 5D93B 1L9OA 3LN4A 3ETBF 4GRMA 5FYKH 4JFPA 3E1ZA 4XXCC 1VCAA 4GJTB 1P4UA 4RQQB 1XF4A 1P5VB 4ONGH 4E36A 2B39A 4FAAB 3QDGE 3VE0B 1T83A 1GKEA 4KH2A 4F7KA 3V8CA 1S7WB 1G6RA 3B6SA 4HZLA 5KSAC 1OTTD 2AW2A 4C56A 3NEXA 5L0QC 2ZICA 4NO3B 4LFHG 4XP9H 5MP6H 2VDLL 2XLLA 3L2MA 4OZ4A 1ZKAA 4YSCA 2GEEA 1O9WA 4G43B 2WC7A 4J3XA 4O58L 5FWRA 2WZ5A 4XPGH 4N8PA 1ROCA 5CZXC 2OYLA 1RUKL 4GBXA 4CADB 1UVQB 5J56B 1DBBL 5I76B 3NIFE 5E6IC 4Z5RB 1MW0A 3GTTA 2DF3A 2F54A 5E8DH 1KENL 3P4NA 2VH5H 3S8GB 3G5YA 3ARDA 1D5ZB 2PPCA 3IXAA 3O4OC 3QEQE 2X12A 4I77H 3V10A 4PG9B 1GC1L 1FV1A 1RUAH 3PL6B 1B2WH 4AV0A 3QBTB 5ISZA 3IKCB 3A47A 4EI5B 1CDGA 1F3JB 2VXQH 3LTVA 5J4MA 4YDJB 3AVEA 7PCYA 1X5YA 5DC0A 5JLZA 5MI0B 5E2UL 3MLRL 3OJ2C 1A1OB 4K8RD 1MREH 2IBGA 1KTBA 3C2AL 4L2LA 2P5WE 4HULB 4ODUA 3M8OH 4N2MA 4AGQA 5HDBF 4KKAC 2JMRA 1IM9A 2C9UA 1BW8A 3O2VL 2MQGA 2NNAB 5KW9L 1YDPB 3VFRA 4LESA 4I8DA 4XNUH 4ZQKB 1A5FL 2EAEA 5L88L 1VGEH 1MLCB 3EGDB 5DC2A 2R23B 3RY6A 3SO5A 4XPTL 3BH9B 3MRHB 1XMWA 5DJCA 1DBJL 2AEQH 2DLGA 1TJGH 1G9NL 1X5GA 3IKKA 5EULV 3EOTH 4RX4D 3PCYA 3U0TB 4ALAC 4MMYA 2QVKA 4JFSA 1OV8A 3F84A 1TTRA 3TYGH 1JD7A 4G6FD 1DE4B 4OQ1A 4IOFD 1CN4A 4AIEA 1MHPH 4ANUA 4YEFA 1IBBA 1QFUH 2EDRA 2CXGA 3EH1A 3K72A 1HL4A 1SXBA 3CFMA 2ZOLA 1TQSA 1TJHH 1XGPA 3GMOA 4YWGH 3WFHA 4PJ9B 1X9UA 5IMMA 2Z64C 1FFOA 1OHZA 3VD4A 2KZBA 2YPLA 1IC1A 3IU4L 1FPTH 2NW3A 2G3NA 1PG7H 4I0KA 3BN3B 5E2TL 2UY6A 4P46D 4QUOA 3U0PB 3UYPA 5DFWH 3VD5A 3VD1A 4UTBL 3Q2WA 3HG1A 3REWB 2VL5A 3HG2A 4ACTA 3VQ2C 3QJQB 1BEYL 4POZD 1O7SA 3ZT7A 4P4KA 3CFNA 4E9XA 3A6CL 2OZ4H 4I48A 2HVBA 4KUZL 2PABA 3LV3B 4TRPH 1CU4L 1QBAA 4AXWB 1ILSA 1WPCA 3IGAB 4XAKD 4HV8B 3RWFA 2C9VA 1TPXC 5F7KC 1LO4L 1NFDF 1T6BX 3C8HA 4ZPVA 2CO7B 3RWCA 4OGAD 3C60A 4Q14A 1T7ZA 4ANVA 1JNLL 1H3VA 4Y2DD 3L4UA 4LSVL 2HLAB 4ZOAA 4YXKL 4CW1B 1HL9A 5I6MA 3ATDA 4KPHH 2NT0A 1E2WA 3ILQC 5CINL 3S35H 5IR1A 2VDRB 4MD0A 5DJXB 3UFIA 3P0YL 3QZBA 3FQ2A 4HAFA 3JT2A 3EO9H 4A66A 3S34L 3CDFA 5TD4A 1T2XA 4HKZB 5LVEA 3QXDB 1F5WA 2H7WA 1E4XH 1AXIB 2ICES 3HE6B 5JO5B 3H1ZA 4JY5H 4ZDHA 4P3CH 3VFMA 2DQHH 1SZNA 3HC2A 3O3EB 4K7FB 1DJWA 3I02B 3IJEB 1JHLH 3EJYD 2PUQT 3WV0A 3KPRA 1N6VA 4IMLB 1QPXA 2K45A 4AQ1A 4CSPA 4AKPA 1V3KA 3OKEB 3ROLB 3QW9A 2X41A 4PV9B 4X98B 4E9TA 4F15B 1EDHA 4FQCL 3ZT5A 2G4GA 3L1GA 3MRGB 1UFUA 2PPAA 4P8QA 2DBJA 2NCMA 3N50A 3AS2A 5I6KA 3FT3B 4J3BA 4XMWA 4EOWH 1UM4L 4IDJH 4TUJA 4Z7UA 2A99A 3BUDA 4LPXA 4PS3A 4WNJA 4AJ0A 4MCNA 2R8SL 3RKDD 3HZMB 5LNEA 5DK3A 5HDBB 1DN0B 2HT4D 3SKUD 3MUGB 3MCKB 1KBBA 5GZNC 1IC5L 3RTQB 1N0LA 1IGCH 2V37A 4PY7A 4HHWA 3H2WA 4M8VA 5GGTA 5HI3D 2X4PA 1V8HA 3U7WL 5H2BA 2E0PA 1P2CA 4HCRL 3EH3B 4DQAA 4WK4B 4WY7L 3UAJA 4JO8A 5CJ8A 2DWYA 4KX7A 3L5XL 4ZUUB 1SY6A 3FU0A 4JFFA 4PJGE 5F1IA 5SX4H 5CR1A 3V9CA 4QXTB 1J5OH 4PWKA 2KDYA 4IBLT 1VCBC 4M4PA 4KZDL 1YMMB 3SGEI 4HVBA 2FT8A 5BRZE 1CFSB 5C07E 4BDVB 4ZX6A 4ADGA 1GPOH 1A9EB 4NC1E 1YMHA 2F0CA 3OAUL 5D7JD 2FIRT 5LKNA 1JTPA 1ZT1A 2IBZX 3PDOB 1QVOA 2XN0A 3VNYA 2L3BA 4PI0A 2A74B 1BHGA 4OF5A 5BVJA 5E9NA 1KCKA 1YEEH 3D52A 3PHOB 2BS8A 8FABA 5IEHA 2Q1EA 5F7YC 5BO1L 4WJ5A 1X44A 1I3GH 4JFDE 4KKPA 2PYFB 4TTDC 1W0VB 3INUH 4A2DA 4JFTA 1OALA 5EORL 4GXVH 4YBQC 5CLYA 2IQ9L 1CPUA 3PWUB 1I8MB 3VSVA 2PCYA 2BSTA 5JIMA 1NIAA 1ZTMA 3RJOA 5C09E 1NFDB 4DPCX 1EXGA 5HYJA 1DHKA 2X2YA 3FAXA 3AQYA 1U8QA 1JZIA 4X8JA 2Q7NA 5MEPA 1SBSH 1GGCL 1SOQA 3OGOE 3QI9A 4MMXC 4NQSA 4ZSOB 1FG2B 2M26A 4HIQA 2A6IB 3TV3H 3NGBC 3FMGL 4NKDB 4IJ3B 2X4OA 4X5XB 3MGAA 4X7EC 3C6LD 1F4WH 1N5YH 1FIGH 1GGBL 3W9DB 3A6OA 4WU5A 1WHPA 1JOIA 2RALA 3NFNB 1ZVSA 3DTDA 2P80A 2X05A 5HY9A 3NZHH 4EVNB 2EEFA 1DLFH 3CZFA 3NSFA 3TZVD 2DS4A 2AJXL 2F53D 5IK3A 3UPRB 3AT0A 3VRLF 1D5BA 3B56A 4I4WB 3JV5A 1Q9KA 5DU7A 4ZS6D 2FZ3A 5EBLB 1ITBB 3RKPA 5MENB 3EOBB 3P73B 3ESUF 5ETUA 4DESA 4G6FB 3B9DA 3DX9A 1MH5B 1NCGA 2P26A 3QS3A 3BIKA 1U8MB 4HGWB 3V9EA 2AK4A 5GS0H 3ZE2E 1U21A 5IW3A 4RIRB 2XN9A 4X80H 2PXYC 5J1TC 3BZDA 5HGHA 2XXCB 1KXQE 2PPEA 5EZOH 2Q5BA 2XG5B 1PZBA 2EIZB 2X6AA 3NYKA 4YHIB 4UZSA 4X0NA 3RWIB 4XP1H 3LZFL 1HVXA 2BNQA 5EUKA 5ANMB 2RCSL 1MCQA 4KOCA 3SY0A 1NCCH 1ORSB 1QQDB 2X7LA 2NZIA 5CJQH 4LSQL 3WGVB 1KIRB 1THAA 3TH4T 1MFNA 3HKFA 2N7BA 4G3YL 2C3XA 2HVKB 2DIEA 1RUML 5IHUH 1T0PB 4AMWA 1G1KA 4PP1D 4X4XB 1KELL 3LH2H 1M57B 2G3ZA 4XO4A 5F7BA 1Q9LA 3FSAA 5CEXA 1G1YA 4DHLA 1F45A 1NBZB 1U3HC 1L6PA 5I1KH 2UZIL 2Z65C 3CPLA 4A2HA 4WWNA 4ABUA 1IFGA 2J8OA 3GKWH 3S0PA 2A6JB 4XCFH 3GMQA 4MLSA 3LH8A 4JDZA 1BV8A 2C9PA 4XNXL 1II4E 1MXGA 3MJ7B 3ULSB 4DGVH 2DZEA 3MRFB 2QELA 5KVFH 4HIJB 1WAAE 2DQEL 3FO0H 4GO6B 3IDIA 4JG0H 2VLRD 4HS3A 5DHXB 3BZFA 4ZTPL 3WIIL 4RFNC 4YNYB 3AXLB 4GPVA 3VSTA 1MAML 2F19L 4XN7A 1AQDB 3QP3A 1KNOB 3D1MC 1DLHB 2V7HB 3B34A 2FHBA 4G8FA 3V0IA 1R1CA 5E5MA 1SGKA 5L2JA 2VR8A 3QEGL 3FBKA 1U30A 4P9ML 3W0WA 2D4FA 4OKDA 1L5GB 1VFUA 3B7SA 3FFOA 3WFDL 3QWOA 3KNBB 3O8XA 4UM8B 2CDEA 4MNGB 4JJ5B 3WIFB 3ARZA 1K8IA 1NAKH 5CBAA 1BYPA 4P2OD 3EGSA 4FLQA 4M5YH 4FA6A 2X3CA 5B7FA 3ZTCC 2WWOA 2G0LA 1DSFL 2KHAA 4PB9L 1BXUA 1U95B 1B9ZA 1F4XH 3MJ8B 4OUUA 4OZFH 2XWJB 3VFVB 5L6YL 4S1QL 3WN5A 1Y18A 3GM8A 5DMIL 3O3BA 1FVDB 3ZTEA 1QABA 4HWZA 2GC4C 3FU5A 1ETA1 2Y1VA 3QNZB 4NN7B 4Y19B 5GJSL 4IHBA 4HCIA 1T5XA 5PAZA 5A7BA 2G60L 4TL5A 3DHMA 5BZWB 1CQKA 3F58L 4PJEF 1BQHB 5HGGS 5C0IA 4JN2A 1AKPA 3MSPA 1XBDA 3LB6C 4Q8BA 4Z8FH 3F6LA 1SM3H 2HG5A 5I74B 1HAWA 2VXQA 2P7TB 4C54A 4ZFFB 1Z6JT 1RK0A 3Q9PA 3V4VH 4EI6B 4OJYA 1JGDA 2AITA 4OZHE 1UXMA 3CCHA 2PPDA 3NT0A 3B2PA 4WSGA 5T5NG 1OAKH 5K9JH 3SDCB 4AQAB 5ERWA 1EHAA 4GMSL 2Y7QB 4PWFA 4YK4B 5KBLA 3PY9A 3WDJA 4URKA 4J2XA 4IRSC 3KAAA 4R5TA 2C7UA 2EIBA 2VAAB 2QKIA 3FPXA 1VF5C 5I6OA 4OKVA 5DQDH 4J3TA 1ETJA 5D7JB 1I1FB 4PYGA 3VFSB 1UWYA 1PZ2A 2XSKA 3T65A 4ALAH 5CU9A 3ULUL 2YKKA 3UTSE 4NKMB 5HGAB 3BGMA 4X4KA 3V7AG 4M5TA 4Z7OF 3FU9A 4LNRB 5C0BD 1JZ5A 5CN2A 1CDYA 4JFXB 5FW6A 2FJSA 3ARPA 1OCWL 4BFEA 5DJDA 2X6MA 2FHCA 4W93A 1B0RA 3IRCA 2K6WA 2OZNA 5EC2B 4M02A 3S98A 5E95B 4OF0A 3OAZK 2WXRA 1GH7A 1IGYA 3OR6A 4HMDA 1UKQA 1INQA 4F5CA 3U82B 1NJ9A 1NCBH 1HL5A 2FAUA 1E6OL 1ZHBB 5CFAA 5J7CC 3L3IA 3IDXH 1RZIA 3JXAA 1A2YA 4XC3H 5J9PA 4J27A 2BVOB 2D7OA 3D4YA 4GLRI 4GP5B 1E0OB 4W1TA 4QRRD 5AAMA 3UYRH 3Q1EA 2E6PA 4AI7A 4L3CA 4PJCF 1NIFA 3S5LG 4G5AA 4QHNA 4BZ1L 3D07A 3HRZB 5IM7B 4G7RB 2HJLB 1INEL 1KFAH 1N4XL 4OAWB 1IQWH 3NSCA 2CUMA 4XMVA 2PF6A 3PNRB 3TO4A 2ZSWB 3VH8B 2WYHA 4GNKB 4UILH 1EGJH 4TVPE 1EZUA 4HQQH 1YN6A 3DIFB 2K0RA 3QDMA 4K8RL 4OLEA 4U7SA 4CGTA 3FOLB 4P5TC 4X6DA 4QY8B 1XL6A 2VLKB 2Y2WA 3KHOA 5KSVB 4PBWD 2DLHA 4LSUL 1Z3RA 1O6TA 2R69H 2ENYA 4BK8A 3CZJA 5F0JB 5T3XE 3FTVA 4N0RA 2F53B 5TDOB 3ECQA 3FO9A 4NJAL 3HE7C 4GG8A 5IEKB 5F3HA 5LNGA 4FXKB 3MV9A 1OE1A 4C56D 2I24N 4DK6A 3TA3D 2APSA 2WNKA 4F9PA 2AEWA 4UQEA 2ERJB 3BUYA 2CBPA 4WSKA 1WBXB 4PRHA 3BZEB 1V7NH 1PX3A 4GBXD 3QR0A 1P84K 2WBJB 2NNXA 3LCYA 2NY6B 2GJZB 3LH9A 2AXGB 1S7VA 1IAIM 3T4YA 2F54D 4PJEB 3TWYA 2VDPH 4S1RH 2X9XA 3LEYH 3QAQA 3ARDD 4K9JA 1NEZG 1ZLWK 4OZGF 1IBHA 1IB5A 2GIXA 4GT0A 4R3SB 4TNWK 5AOKA 3RDTC 3O4LA 4ODVH 2E9BA 5DFAA 3WGUB 4JN1H 4H1LG 2R51A 4M43H 3VI3E 5A1AA 1MDTA 1EJ8A 2H8PA 1IGTA 3JUYA 5LWYH 5I1DB 2EXWD 3HI1A 1KN2H 1G7PA 3CFEB 4ZFOA 5KYWA 1ANUA 1NCJA 3DX6A 3N3EA 4FFTA 5HYFA 2R0WH 2F68X 1IM9D 2XPGA 1ZT7A 2J2ZB 3VNZA 5IB5A 3FB8A 1QP1A 1XIWC 1JBJA 3BZ4A 1T2JA 3UCRA 4LCYB 4YC2C 1NMCC 5FV1L 1QZNA 2ITDA 3ZHFA 2X40A 2JCCF 2Z31B 3MBEC 1QATA 2AF2A 3E3QC 3ME0A 2HRPH 2FQDA 4WNSA 2O30A 2Y0SA 1CL7I 4LHUG 4IK7A 3WEBA 4ABQA 3KPQB 1LNUB 4B0MB 4U6TA 1A3RL 1J1PH 5E5LA 4Z7OB 4L37A 2I85A 4RGOH 5SWSE 2DMKA 5DUJA 1NBYA 2PYEE 4JO3H 3VXUE 5C0EB 4N3UA 4FZ8L 1ADWA 1OL0A 4EI0A 3GB7B 4WU7A 4MHHI 1GZHA 1TOXA 1YSOA 2HX9A 1XSOA 4GQ9L 2RTTA 3R1GH 3GJFH 4UIKL 2YPLD 4LBAA 5F7DA 4PS4L 2EDHA 3VWKC 3KPTA 1MFCH 4HJIA 4BQBA 4P59L 1H3UA 1F58L 4P04A 5I0VA 1MLBA 1TQTA 4U7MA 2XN2A 3CU1A 4Q74A 3HG1D 5I8KL 1ACYH 4U1IB 5LCVH 4TUOA 2Y06H 3D5OF 4LARL 3WFEL 1MNNA 3B3BA 1NCTA 4PJCB 3TCTA 1TTFA 4P4KD 1BIIB 1FN4B 3OZ9H 3LS5H 4EBQH 5CP7A 3BW9B 3RJDA 2C4FT 4P06A 1B3JA 2XWDA 3BX7C 5CHNA 4HJTA 2A0LC 1YPZA 2VC2B 5E6SB 4L9LA 5GGRY 4XO5A 4JFYB 3BH4A 2OMXA 1PSKH 2VXTH 3DSFL 3E3QE 4HKJB 5H4YA 1W2KT 1S7UB 1U8NA 2G30A 3C60D 1RCYA 3CFCH 3QZWG 4OIIL 3TS8A 5G2NA 3ILPB 4WGVB 3N41B 2NDFA 4Y16D 4O5LH 5HGDB 4PJDE 3SDDA 4LVNB 2BSRB 3NA9L 4X5RA 5TFSL 2BVTA 2X6UA 4UU9B 5DC9B 5L4MA 1YG9A 4X8GA 4ISVB 3V5DB 3GSUA 2CO2A 3BAJA 1OT4A 2EDFA 1Y0LA 4D0DA 1RK7A 4LDLB 3QUZB 2FQFA 2ATPA 2BIOA 3S3CB 2F8OA 1YYMH 3VRIA 5JHBA 3EBIA 4R6UA 3R0NA 2B4CC 4LU5L 1H5BC 1XF3A 1ZHLA 1U91B 3M1CA 3TIEB 1LXMA 1NCAL 5LUMA 2AJ3B 3BZ5A 1U8IB 1HHGA 2I7OA 1SDDB 2CXKA 4QXWA 5LAPA 1G4MA 3CXHJ 3KPRD 3A4EA 5L7XH 1N70A 3PNWA 5DI8B 3AY4C 2RA1A 1Z32X 3CVBA 1LE5B 2RD0A 4PIRF 1SYVA 1ACXA 4OZGB 2Q7YB 5GS2H 4FXGB 3OHMB 4U6XB 3MGOA 3ESOA 4ZUSA 1BZDA 4PY8J 5FDWB 2ICCA 1SMAA 4Z0BL 4KXAA 3S4SA 3ZE0E 2A1WH 2CLRB 4ZS7H 1CF8L 5JIPA 1FGVL 5DGRA 1IT9H 4ILDA 5KAQG 5CZKA 3HZ3A 1RZ8A 3EO1B 1NCUA 2ZONA 4HUCA 3L3HB 3QZPA 3SEPA 1NGPH 2ODHA 5DD6A 1XHHA 2OJEA 3ARQA 3Q2CA 5D7SH 3RQ3A 2NXZC 5F1NB 2E9IA 3U30C 3U1SH 3OXSA 5DRWA 5K69A 2JCCB 1WS7A 1JCVA 1LO5B 5E8OA 2DM2A 1OSZB 3BE1H 3NPSC 2IFFH 2WVSA 4OJDH 4W9ZA 5DJYB 4OM1H 1FCCA 1CGVA 3UAJD 3LZLA 1PL3A 3EHBB 5EPMA 3BVDB 3JVGA 2VLMD 3QIUC 4U2ZA 4A2GA