3MNDA

Crystallographic analysis of the cystosolic cu/zn superoxide dismutase from taenia solium
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
152
structure length
152
Chain Sequence
MKAVCVMRGEEGVKGVVHFTQAGDAVKVHAEFEGLKPGKHGFHVHEFGDTTQGCTSAGAHFNPHGKNHGAPDAAERHVGDLGNVTAGADGKATLDLTDKMISLTGEHSVIGRSLVIHVDPDDLGLGGHELSLITGNAGGRVACGIIGIAKSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Cu / Zn superoxide dismutase from Taenia solium reveals metal-mediated self-assembly
pubmed doi rcsb
source organism Taenia solium
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
total genus 41
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3mndA00
3ECVA 1OZTG 1P1VA 1HL4A 2AQTA 1N19A 3KH3A 3H2QA 1Z9PA 2WZ6A 2AQNA 1N18A 1YAZA 2AF2A 5KBKA 4A7SA 3F7LA 1OZUA 1UXMA 1XTLA 1CB4A 1QUPA 1BZOA 2GBTA 2WWNA 2GBVA 2VR8A 2GBUA 3ECUA 1RK7A 2AQSA 1DSWA 4FF9A 2WZ5A 2SODB 2AQRA 3F7KA 2NNXA 2WYTA 1XTMA 2WWOA 1SXNA 2WYZA 1L3NA 1IB5A 3GTTA 1UXLA 4A7TA 1JK9B 1E9QA 1YSOA 2Z7WA 4B3EA 3RE0A 1IBDA 3S0PA 1OALA 1IBHA 1SRDA 1F1DA 2ZKWA 1SXSA 1SXCA 1BA9A 1B4TA 2E46A 2Q2LA 1S4IA 1MFMA 4BCZA 2ZOWA 2Z7YA 1OEZW 3QQDB 1F18A 3HOGA 1E9PA 2VR6A 5KBLA 1EQWA 2APSA 3GZQA 2AQPA 3CQPA 2XJLA 2WZ0A 2LU5A 1OAJA 2XJKA 1KMGA 3L9EA 1SXAA 1PTZA 2AQQA 3KBFA 1FUNA 4OJAA 1DO5A 1SXBA 4A7UA 3CE1A 1IBFA 2Z7UA 4BD4A 4U4IA 4BCYA 3GTVA 4MCNA 3KH4A 3LTVA 2AEOA 1SOSA 1PZSA 3KM1A 3HW7A 1F1GA 3GZPA 2ZKYA 3H2PA 1ESOA 2JLPA 4A7VA 1U3NA 1HL5A 4A7GF 3L9YA 1JK9A 1IBBA 1Z9NA 1E9OA 2WKOF 2R27A 1XSOA 3HFFA 3MNDA 3MKGA 1E9PB 1TO5A 1B4LA 2C9UA 1CBJA 2C9VA 4MCMA 4A7GA 1F1AA 1SDAB 1SXZA 3CQQA 1SDYA 5KBMA 1AZVA 4N3TA 4A7QA 4L05A 4N3UA 3KBEA 2VR7A 1SPDA 3K91A 1E9QB 2Z7ZA 1COBA 1YAIA 2K4WA 3ECWA 4OH2A 1E9OB 1TO4A 5CU9A 1JCVA 3KM2A 3SODB 3T5WA 2JCWA 2C9SA 2V0AA 1Q0EA 2WKOA 3GQFA 2ZKXA 3GZOA 3PU7A 1PU0A 2E47A 1EJ8A 3QQDA
chains in the Genus database with same CATH superfamily
4ZPTA 1XGZA 4O4YH 4UUJB 1FH2A 5ICUA 5E99H 5FYKH 1IGML 4NZUH 1D7BA 1T1YB 5MEPA 3VWKA 1P7BA 1OCWH 2J5LC 5JPMB 4PY7A 3GSRA 4IOFC 2NY4D 2D2OA 4M8VA 5B3SB 3ETBJ 1YUHB 4JHWL 3FTXA 5AQ0A 1A6VH 2ZX7A 3OX8A 4PJGA 1JDDA 4ZMTA 1HX0A 4NNXB 3BT2L 5A16A 4Y89A 4C83A 1G9HA 1IV8A 1SN5A 2JKRM 2VLKD 1WWAX 5IVZB 2O61A 1XGRA 1MCQA 3FU6A 2VLJB 3GJEB 3H9YA 4LCWB 4PJDA 2E7MA 4WENB 4HXAH 3SD5A 2OJZH 2G60L 1RK0B 3L45A 2K3HA 1EUUA 1QP1A 1I8KA 3MRMA 4PGBB 1CYXA 1IBDA 2QVFB 2G2NA 1Q94A 3OVUB 4K73A 2C3HA 1RZQA 4QYOB 2PXYD 5DHMC 1E30A 3CVIL 4OCLC 4FNRA 4WFEE 2E46A 3LKSA 3L1OL 4NZ8A 4DGIL 4NC2B 5IFHH 1MJJA 1KBGH 3LRMA 1K4DB 2VM4A 2ZG2A 5I8EB 1UUNA 4X4XA 3TO4C 2ITCB 3QGVA 5B3NA 2JI1A 4MS6A 4FQ1H 4B27A 3TESA 4X4ME 5LNGA 4NBZB 2FD6L 4JM2B 4KRPB 2VLJD 4K23L 5DHYB 4PJHF 4IIQC 5FYKE 3NZHL 4HCRL 4MDIA 3S4SG 4P2QA 4UIMB 1M71A 1QOKA 3BN9D 1HH9B 1U8HA 1DCLA 4YZWA 3I9GH 1PZ5A 1EHLH 5EO1B 2X4UB 1T80A 1OPGL 1UB5B 4PRBA 5LDSA 5FGRA 2FWOA 1RJLA 2OL3B 3ZW3A 3MI6A 4HKZA 4HQQL 1ZLDA 3UMTA 3BMVA 4LPTA 4CVXA 5FR3A 1KJ2A 4JFOA 3QUZB 2V8LA 2LTQC 1G9ML 1QUNA 3ARGC 1UWEL 3O2DL 1KENH 1XSOA 4KVCL 2V7NA 3ATFA 5I76A 3D07A 5L2KB 4OGYL 2C34A 2FX9H 2QQNH 3INOA 3VSTA 3ULUD 1R33A 5T5NG 1OP5K 5H94B 3BAJA 5CN2A 3U7YL 2H9GA 4LPCA 1G1KA 1VERA 4ODUA 2QKIC 1Q90A 3B7RL 3CDGB 4N8VB 2Q87A 1AKPA 5IFJB 1ACZA 4QGYA 5AKRA 4GRLC 4B9ZA 1NOFA 3HS9A 1G7JB 3MGOA 4LBAA 2ZXDA 5IT2H 1YQVH 2XQ0A 5D7KE 4QMEA 4YBLB 4PHXA 3VFSA 3VI3B 1TZAA 3FQNA 4PRAB 4O2CB 4ONFH 2AV1B 3K5RA 4FERA 3QQ3B 5CM1A 1NWPA 2QLVB 4JHVA 1FYTD 3UZEC 3VXMD 1MVUB 2HT3C 5LBSH 3IXAA 4LRIC 5TGBB 3PNWB 2A83A 2HTKD 3O2WH 5CD3B 2F7RA 3PWPA 3VAEA 4APQA 5EIVA 1JMZA 4X5LA 4ODWB 3T3PF 2B0SL 2OM5A 2KPWA 2YQ3A 3QCUL 4I3RL 4FP8H 3DYOA 1G1YA 4QHKJ 3VXPA 3EW3B 4F37K 3O3EB 3MRQB 4YK4C 2EIEA 5DFAA 4ZUUB 3TZVD 1DN2A 3TN0A 3VYPA 1CGWA 3RX9A 4X0KA 1DEDA 3SQBA 2AK4E 2VN5A 5HD8D 1SFDA 4FQJH 4IRSC 4GUPA 3BIKA 3L5HA 2ENSA 3GSVA 3QUZD 1JPTH 2X28A 3Q6FB 3QUYD 4ELMF 2W60B 3RKDC 3ESNA 1NC2D 4IKJA 2BP0A 3S3JA 4JFZH 4PLKC 3ZDXB 4MBRA 3VNZA 3S88H 2CALA 4LKXA 4U1MA 5F6IC 1I1YA 4HHGA 3SPVA 1JV5A 1BFVH 3EBHA 4B9CA 4FJYA 3BH9B 5JXAH 4KUCD 1MLBB 1U3HD 4FQLL 3TJHD 1L9SA 2WPGA 4I3SH 1Y07A 2MFNA 3MRGB 4X6DA 2Q86A 3FU8A 1U8PA 3MCG1 1OK8A 5DUPH 1IBFA 3OKNA 3FQUA 2WXNA 1TZ8A 4J3OG 3FB8A 1TETL 1MHEB 3JT0A 3OPUA 4A04A 1BF8A 4F37F 2IALB 4RMTA 4UCFA 3ZKSD 4PS8A 5LJYH 4RAVB 3T1WA 3MLUL 4L4VB 5HYQA 4R8WH 2H32H 5G5DB 3SE3C 4DFHA 2OK0H 1U3NA 4TOYL 4HH9A 1NWOA 4X6CE 1RXLA 2PCXA 2FJFB 2FWOB 3TBVB 4MWFA 1MY5A 1U8IA 5DJYA 1OAXL 2P80D 3EYUL 4YXLH 4FTVD 4J1UA 1S7VB 4L1BA 5ETUB 2C26A 3F64A 5EHFA 1FRGL 3IJ8A 3G04A 5E2TL 4OM1H 4M3KB 4A6YL 1IBYA 2VSKB 5HDBF 1F41A 1R3JA 3MX0A 4HK0B 4L1LA 4FXTA 1W80A 3U83A 3DX3A 4NLAA 3VNYA 1QPKA 2BOCA 2IANA 1BFSA 3SGDI 4DQAA 2FR4A 2L7JA 3GMQB 3QCTL 3QI9D 3VXRE 2G30A 2DQGH 3O8XB 2AGJH 3WY1A 1SOXA 1WT5A 1I7ZA 3FU5A 1KT2A 1S7UB 1FZMB 3N85L 1KACB 1G0YR 1H19A 5IUCA 2VTFA 3L7EB 1ZTXL 4QCIA 1WGOA 2WGNB 1ORQB 1NBZA 5EZJB 3UTTD 5J9PA 2CH8A 4LLQA 2EDNA 2OMZA 2FLMA 1BD2B 4U6XB 4DTGL 3LZPA 1X7QB 2BIMA 1GHFH 1B3JA 2O5ZL 4H8WL 2YIHA 2A83B 3AS3A 4ESKA 4JPWH 4M4RB 2DQIL 5JOEA 2CBOA 4HV8A 5JW3L 3BKJH 4HD5A 1KB9J 1CK0H 2NNXA 1PG7H 2DWTA 3KEDA 3K6DA 3QZMA 4DGVL 5D6CA 1BYNA 1RZIA 1AHKA 1HSAA 4FQXB 2EUWA 1MCEA 5EZOH 3EADA 1CDHA 4X83A 4YHPA 4N6RA 2XOTA 3V4VA 5TDPA 1DQQB 3DTXB 2BNQE 4TUUA 4NUQA 3S37X 2AABH 3BW9A 1NC4A 2OTPA 4YPGA 1ACYH 3WJMA 1WAPA 4ONHB 2V5MA 1X9LA 4X8JB 1ZT7B 4YS4A 4ZXBB 1ZOXA 3GF8A 2Y7OA 2EILB 5JYLA 2TAAA 4YHKH 4H0HB 3PGDB 5BVJB 4HAFA 1T7ZA 3NCWA 5C9JA 4L4TB 4Q6KA 3IRPX 4DKEL 4PJHE 2OP4H 1ZA6A 1C08B 3WS6A 3H9SB 3L48A 3MDJA 4XX5A 5C0CD 1CI3M 1UM4L 3X1EA 3VGAC 4BQ6A 1M3JA 4X6BA 2HB0A 1P4IL 4K3JH 1T04B 3H6JA 2NY7H 2PYEA 4XN7A 5EF0A 1ZK9A 4M7KH 4PJ9C 5AVRB 4W1TA 1QHQA 1Q0YH 3UTPD 4LEXL 4GFXA 3FQXB 5EMYA 2YD1A 4M7ZC 3V0DA 5F1KC 3C5ZB 3FNKA 3DSFH 6PAZA 4FJ6A 1NDTA 3DX7A 3UJIH 2BCMA 3QEQD 1J8RA 1LXMA 4XPTL 1OCOB 4BQBA 1OXYA 5DJXB 4YO0B 2I9TA 3NN8A 3CLEH 5BZDB 3HEIB 4F24A 3T3PB 4AYGA 1BBJA 5KYWB 3N06B 4EXPX 1IM9B 1U8IB 4UNTA 3RL2B 1UZ8B 3ZYOA 1DJWA 2ED6A 2F19L 3D85A 3EH5B 1X44A 3DK2A 3HS0C 3FT1A 3MR9B 3NJLA 2PW2B 3VE0A 1NUNB 3VXRD 1QBBA 3LMJL 4MVBD 3N9GL 1XCQA 5DQDH 3FU0A 4IU2B 3UC0H 1GZQA 4JNXA 3OQ3B 4AYFB 4K4KA 2WQWA 4F15C 1UTDA 4XVSH 3TVMD 3DROB 4U1HB 1TZGH 4YHZH 3TBTA 4EXKA 4GB9A 4F7EA 3MJ9A 1YLBB 4GSUA 3CPLB 2Q10A 4PV8A 3BHBA 4HPYL 2ZSVA 5C3IA 4R6UA 2VAAA 1JRHH 4ACTA 2XTSA 3DX6A 2NYZA 1I4FB 3T0EC 1DZBA 1F3RB 3KS0H 5C8JB 1P5VB 3WELA 2EP6A 3IEAA 5LXVA 2PP7A 4OGQC 1HQ4A 2DQCH 4HV8B 4N2KA 1N0XH 3MRKA 1MEXL 3BSHA 5I9QB 4NKIL 1KJ2L 2CNZA 3FBQA 4HIPA 4MHHG 4NQQA 3S4SA 3SBWA 4G5ZL 2BMKA 1NCAH 5DSCB 1VJSA 3PRZA 1ZGLP 3FRPG 3LS4L 4GY4A 3B7YA 1JD7A 4OCSL 4R83A 1NANH 1WHOA 3CZUB 1HXKA 2PWFA 3IGUA 3MREB 5EEUA 1NICA 2A7BA 4HA1A 5EIIA 1XSJA 5JPMC 4Z78B 5SV4A 2R4RH 5TDPB 2WWMC 2WZ0A 3Q5OA 1AYRA 3FFDA 3VXUE 2FT6A 1T1YA 3FTWA 5MEPB 4DETA 1NGPL 1G5AA 2JIXA 1D9KD 5KVDL 3DHPA 4HXBH 4TVPD 2DB8A 5FGSA 5IB2A 3O3UN 3LS5L 4FNLH 4AOFA 1LEGA 3N6YA 3O4LB 2UY7A 2DLEA 3DVNA 4GAYB 3M1CA 2AZUA 5H37G 2OR8A 2XZZA 4K5NA 5LBSA 4AE1A 5T3ZD 2PO6C 2NZ9D 4ICXA 5F9OH 3IMUA 3FB7B 3PQYB 3K4AA 5EC1A 4YSUA 1EEZA 1BVNT 1HQRA 1NCIA 3U79A 4KQ0A 3CVCA 1FNEA 1FVDB 1P5UB 2MEJB 1J1XL 1LTXA 1RK1A 1KNOB 3OJDB 4RGNB 4YWGH 3MUHL 3UIZA 4R90H 3W37A 4GP8B 5J4MA 5A3IC 1WZKA 3EH2A 2BP3A 3C08L 1AY1L 1ZY9A 2MSPA 2WUBH 3PWPE 3QNZA 3IT8D 1J8HA 1HJCA 4NZDA 2QADB 3MYJB 4I0PC 2CJTA 1RLWA 3NDYE 4N26A 4W93A 1B90A 3NZ8B 3TCTA 1JGLH 3D30A 4PW3A 3V5HB 1F4AA 4TV3A 4G82A 2Y1YA 3EDKA 3CSGA 1COBA 4U6TA 2Q3ZA 2Q0ZX 3ILDA 4HAGA 5FKPB 2QTEA 4RGOH 5FK9B 2VM3A 3TEZA 4K7FB 4LSVH 4GEJA 3WL9B 3RWCB 4C56B 4EDXB 3PDOA 1WA2X 2ATKB 2OBGA 2XN1A 4LKXB 4XXWC 5AG8A 1B6DA 4MDIB 1DDTA 2K6ZA 3ZQWA 4U31A 3E6HB 5L2JB 5AZEH 4R2GC 3Q05A 3QIWC 4DW2L 1O7SA 5EA0L 2WP3T 4N25A 5IBLC 2APBA 2AF2A 3H9SE 4Y5YB 1LMKA 4I7ZC 1OT4A 1F2QA 2RCSL 1TFPA 4IU3B 4NP9A 1KGCD 2CUMA 4PBVC 2GBTA 3ARYA 4JGNA 3IU3B 5KOMC 2VLRA 5KJ7E 3HE6C 5D7JB 3FFOA 3V79C 5C6PB 4HLZH 4XE0A 4BZ1H 5SWZE 3GM0A 1PDKB 3MCYA 4MZRA 3ISYA 3IU4L 3PFQA 2J12B 1M1SA 5D2NE 3RP1A 3RZCB 1A8ZA 2ZUXA 3MO1A 3ULVE 1PIGA 5J3HC 1HQ4B 3N42B 4AC4A 2YS4A 1A6AA 3EXJA 3PP3K 1BJ8A 2IGFL 2PW1B 4DGUA 1KJ3H 4KXCA 4F58L 4GKZA 3OPZL 1JK8B 4NENA 4ODHH 2R51A 1YNTB 2XV2A 1AZRA 5K39A 2IH1B 4CU6A 2PPAA 3MLWH 5C86A 1G1CA 4WK0B 3UROR 2DIAA 1JF1B 1CDYA 2ICCA 2WAHA 3C8DA 3FDWA 4MZ2A 4PJAA 2BSSB 5IIEB 1DBJH 1GJUA 5J6GA 3AGWA 2OKMA 4PJ5E 3VXPB 4CADB 3N2JA 4NNPL 35C8L 3BSZH 3ULAB 3KYMA 3VG0L 4G8IB 1QR1B 4GAGL 2HX8A 3O6FA 4P5MA 1SYVB 2ROXA 4NJ9L 2NYYD 5DZVA 2OSXA 3GMMA 5CSZA 1QSEE 2VW4A 5G2NA 4F2MB 1H8SA 5F1NA 4WI6A 2G5BB 2A73B 4MCZB 5DQJA 3FT2A 1BZ9A 1GL4B 3BCFA 3LPWA 4A1RA 4XN9A 1U42A 2YJQA 3E8UH 3DUUB 4WW2C 5D6DA 3UYPB 4A7GA 5CEZL 1TVHA 1CICA 3OKLB 1KEML 2EC9T 3FQ1A 2WV3A 1NZRA 1Q9LA 2N7AA 2FJHA 1NAKH 1A9EB 1JHKL 3EF4A 3RWFA 1DBML 1R3KB 5FM8A 2WJ7A 5FW7A 3I50L 3VA2C 1P2CA 4ZPTB 4OGXH 3CX5K 2AJSL 5IJCC 1SJHA 5KVEL 3IETB 3S5ZA 2G0KA 4MJIA 1NC4B 3GNML 4YPGB 1FA4A 1NFDB 3QRLA 1YEKL 3FQYA 3HC3H 4GXUN 5AW8B 4RBPH 1LE5A 5DC2A 1OAYL 5DJAA 3QP3A 2YPVH 2VRKA 2Z0UA 3FU7A 3QJFA 3T0VA 1E5CA 1I3VA 2EXWD 5ID0A 4DO5A 1TENA 2CHXA 4LPYA 3MCKA 3DI3B 1FDLH 4LIQE 2VR3A 4MA3A 4PG2C 4LSPL 1JGDA 5H8DA 2ADFL 3QUYA 5G5DA 4FQ2L 4HWEH 2W07A 2X4QB 1UWGL 2OZ4H 1E4XI 4LCYB 1EMTH 3FTSA 3NIGF 3VFGH 2B8OT 1DLFH 5F3BA 1AIFB 1XV8A 1GYAA 3QJQB 2QSTA 3ECBA 1IM3D 4WW2A 4X7TB 4FF9A 3OMIB 2HG0A 3PHOB 1P4LB 4N87A 5DA4A 4QRQA 5KANI 4J3OC 2P24A 3HZMA 1E5UI 2DQEH 1II4E 2OMBA 5IF0A 3T8VA 1IC0A 4UTAH 3BUPA 3DLQR 3WXWH 4HS6B 3IVKB 4P48A 3THMH 2KZBA 3LQAH 1IIIA 1FH5H 2DWSA 5TFSL 1B0GA 4JQVA 2ZNWA 3HUJF 4MQXC 4Y4HD 1FFTB 4KVNH 4QHLA 4YO0A 4RISH 2QL1A 4BK5A 1KGIA 3CZFA 1IM9A 3AROA 3EJCA 4N20A 5FFLA 4KI5C 4OR1A 4UV4L 1BQHA 2C5DC 3Q8FA 3GS7A 4POZC 2DI7A 3T0ED 5IQOA 5HPMB 3TF4A 3L7EA 4QCIB 2Z31A 3QRGH 2A99A 1NBZB 2R83A 1XCQB 3G5VB 4WTXA 5EZJA 5J9PB 4H8WC 2IH1A 3C9NA 4YE0A 4DKTA 1ZGLB 5EO9B 2WBJC 3C5JB 3SE9L 2IFFH 2NCEA 1CZ8H 5FV1L 4XTRD 1LK3L 2UXVA 3P73A 5AVTB 4K8RD 3VTTA 4MMZB 1HKLH 5HYJA 5I9QC 4M8QA 3ULVL 1OCWL 3M8OL 4O2EA 2TRYA 2NUTB 1FNSH 1HZHH 3EDJA 4MKTA 1CU4L 4M48H 4OCXH 4XGZA 1CFNB 3DTDA 4QTFA 3QI9A 4EQ2A 3ARRA 1UZ6E 4XNYL 1AQHA 1MCOH 4AUJA 1ZLSH 4JY5L 1MW0A 1G7JA 1ED3B 2AV7A 3QWRD 4NQDB 4PS3A 2JXMA 1M1XB 3P30L 1MRDH 3DJTA 2B1AL 2JB6B 2O4EA 1NH6A 3KXFE 4OIAA 3EOTL 5T5FA 3C5SB 4NQUA 3WGVB 4LHJB 5JQ6H 5KS9A 3RY4A 4P9HL 4DAGH 5IZ7A 4CC0A 1JHTB 4TVPE 1NSNH 2XUWA 3O2VH 4XMPH 3QAQA 4RX4D 4Y4HB 1UJ3C 3PY9A 5HY9A 2E4TA 5I66A 5KVDE 3BN3B 3ECVA 1TUPA 1ITCA 3QIBA 4OIIH 1LEKA 4OCNC 4HKBB 2Z31D 5AD0A 2P5WB 3L4TA 2UY6A 3E2HB 5CMAB 4WEBL 4ZMLA 4FDWA 3VI3E 2VITB 4ELKA 1SLVA 1YPZF 5ALBH 4QRUB 2UXGA 2YR3A 3AM8A 3QWOA 3ZKQD 3FB7A 3RIFF 3BZ4B 2AEPL 2HVJA 4KJWC 4UQDA 4YNYB 3FONB 2I69A 1FPTH 1MPAL 4KDVA 1AIFA 4Q9CA 4KMLB 3TFKD 2JB5H 1TZIA 4ORGA 4M7JL 4OF5A 4W4OA 1GS8A 2EDJA 5JMRA 3E8VA 4P2RA 1A21A 3L3KB 4LNRB 2JKLA 2X10A 3ATDA 5F8RC 4YXKL 3VD4A 4RWYL 1DVXA 4ISVA 5A7BA 3QNZB 5I15H 3IDMA 3U2IA 2CKBB 5DFTA 4R5VA 1PBYA 4MNQE 3TCLA 2GSIB 4HX1A 4WGWB 4XODA 1UD2A 1NBVL 4Y16B 1KIUA 1TXKA 2A77H 3ZL4L 4I8DA 3BE1L 3N1QC 3ZQXA 2FTAA 2WXLA 4G9FD 3BPLC 2QR0A 1D5XB 1N70A 2HFGH 4BD4A 2H26B 3HJ0A 1IGIL 5FV2A 5F9JA 2XYCA 1T83A 1MFAL 1EFQA 5LCVA 1DEEA 3C5JA 1I8IB 2WYIA 3QDJD 3B5HA 5B1BB 4R7DA 2BNRA 1NFDF 1TQSA 1BD2E 5DMGD 3R7QA 1S9VA 3ARGB 1QEWA 4PJIF 2A6JB 4UU9A 1A64A 1J0YA 4B9JA 3WDHA 1NJ9B 5FUCC 2DTML 3QORB 4NQDD 1V7ML 1A25A 4WEEA 5BOJA 1XB6A 3UERA 5I6LA 4A2EA 1U8MB 4H5SB 1TR7A 4OD1H 4W9LC 1CXLA 1U3JA 4O00A 4M62H 4WO4B 4ZMAT 2ATPB 4X5QA 3VWKD 1AKJA 4G70B 4MJHA 1QG3A 4XP4L 1TYEB 2BIOA 3FFDB 3NYKA 1AD9B 3DO4A 3GINA 4NUMA 1OLLA 1IGCH 4FKKA 4PD4J 2JIXB 3SDXA 2AV7B 4LDCA 4QXGL 3ET9F 3WCYA 3NCFB 4XRCA 1JWMA 3T6QC 4XVJL 1AR1B 4JFDB 1ET7A 4XBEL 2E47A 3QZPA 5I1IH 1JZ8A 4K2UL 2F54B 3MLYL 4Y4KD 3VRLE 2FT8A 1S7XA 3X2QB 4PR5B 2G3XA 2PTVA 5C0JB 4U6XA 5FLUA 4FZ8L 1FZKB 1IZKA 3RZCC 2ESVA 4FQHB 3BPCB 2FIRT 2W38A 1AQKL 4G1MB 5A40E 3W3BA 3FTVA 4Z7VE 2XC8A 5HHVL 4ZFFA 2ICWB 3GHEL 1PLCA 4Y5VC 4CMHB 1YDPB 4LT7A 2VO8A 3T3MF 4M93B 2ARJA 4CN6A 1HYSD 4OZFG 5EU7C 4O58L 1FNGA 1MQKL 2C9RA 3HHSA 3B4NA 3DVIA 1FGVH 3KL5A 4LP8A 5FDYA 5GJTH 1OAQL 1RUKL 3H0TA 4PJFA 5BV7C 3ZKMD 5GRUH 4F2MA 5DUML 4LASL 2OAAA 4L0PB 3ZKXB 1A4KB 1A3RL 2P9RA 2FWSA 1ZT7A 2X1OA 4E36A 2DLTA 2R29A 4M5TA 3CNKA 4MD5B 3UYPA 4EN3C 1KCWA 1CICB 1ZHKA 1D5RA 3BWUF 1FO0B 1BQKA 2FATH 2Y1VA 1A6WL 4I3GA 2DOCA 1H8OA 2EXYC 4WI8A 1J0ZA 3CDYA 3KPQB 5IMOA 4LSSH 5E1AA 4WI7A 4HFUL 1NFKA 3UTSE 5AYUH 5I1CH 3MOQA 4ENEC 3CXFA 3DARA 4JKKA 4XBGA 3RLSA 4DEPB 4PWFA 3BVTA 2DDQL 5JXEC 2EDTA 3PGCA 3QDJE 5AUMA 2WXOA 4LSRH 3AY2A 1OW0C 4X80L 3NTCH 1MJ7H 4ABVA 1RZ7H 2SEBB 3JTSB 5AAWA 1MWAA 2X4OA 1RV6X 4D8PA 4F3FA 2WHVA 2VDLL 5BV7B 1IC1A 4W9HC 1JUFA 2MQGA 3BWUC 5EBLA 4YLCA 5ADOL 1B6UA 4I9XA 2XWTA 5AOKA 2BIQA 3OZ9H 1OHZA 3RVXC 1MY7A 1X4XA 3NAAL 4R7DB 1PZDA 4BIKA 5CCGE 1DE4A 1KCKA 3BGFB 4XAKD 5F7KC 2MCPH 3A6OA 3ZXAC 3PF2A 3IK2A 4HZLA 2FJGA 3QR2A 4P5TC 1JGEA 4BZYA 1H6EA 4PJGB 3AY4A 2IH3B 4KV5F 3KCWA 4MQTB 5BW7C 4OI9A 5GS0H 4HUVA 4C83B 1X4YA 3KPOB 4IYKA 3WAJA 2HRPL 1I1AA 4OB5L 4H20L 4APXA 1RL1A 2FUTA 5F9WB 4IRSA 4S0TD 3TBTB 4I88A 1E2ZA 5FHBL 3GI8H 2GJ6D 1CBVH 2IDQA 5JXEA 4HF5L 2AJZB 3ARTA 4MNQD 1KCUH 3FRPB 3FTYA 3JUZA 1H3VA 4HPOH 5J6GB 2EUZA 1Q94B 1TCMA 4IHBA 2XVLA 1UKSA 2FSDA 4JPSA 1RUAL 3R06B 3GLZA 4LLDB 1TVBB 4ZPVB 1KIRA 5DJCB 2NY2B 3R4DA 2O6EA 2HT4D 4EI5A 4XHQA 3UO8B 1IEHA 1DL7H 3CXHK 3IMWA 1B2WL 5I1LA 3VFPA 2NX5D 4M8RA 2C9AA 4RLDA 3FN0L 3X1GA 4H1LB 3TBBA 5DQJB 4XAWL 3A21A 1GY2A 4U1IB 4AMXA 5DEJA 2NY5H 1M71B 5DSCA 1V27A 3BGMA 2VDRH 1G7IA 4Z7QF 4P3CH 3ZUCA 1H5BC 4P2QE 3D3VB 4PS4H 3TXAA 5JA8B 4J28A 1V3LA 5LBVA 3GBMH 3KLQA 4JFQB 1MHHA 5JR1L 2QTVA 4YSPA 1T6BX 5HVFB 3HHMA 3VRIB 1HAWA 2R23B 1R46A 4MYWB 4PRIE 3IPFA 2V7NB 4OCWH 1E50A 1VB9A 2Q5BA 2V37A 5D1XC 1YEHL 3W2DH 1OSPH 3CDFA 1F8TH 3C5SA 3D2UB 3FC8A 5E5LA 5I1GL 5T5FL 1V7NL 1QR4A 4I87A 2JK5A 1GJIA 4JFEB 3FN3A 1EXUA 5FYLL 1CF8H 5IMOB 4LSUH 1EEZB 1HQRB 1XGYH 2MPVA 1MCDA 3MLSL 3TNNB 4HULB 2C3WA 2LU4A 4WWKC 4WDIA 4YHZL 4WLCA 2X38A 4Z77B 5IB1A 3NRFA 2FIKB 4X4MA 5FB8B 4ZOBA 1LK2B 2B16A 1X5HA 3OR7B 4XOEA 2V2XB 3JWDL 4OLUL 3TM6A 2WAQA 1E2WA 3ZTDC 4MCYB 2XXGA 3IFNH 3SPHA 3T9WA 2EDBA 1T3FA 4PJ9B 4DUVA 1G84A 1A6VL 1KB5A 4KXZI 4RRPA 4QRPD 2AJVL 1BEXA 5DZAA 2J6WA 1HEZB 3BQVA 5KAQG 5HHOA 4QEGA 7FABL 1HINL 2LOEA 4NQSA 5GZOC 4MXVF 4PCSA 2OJ1A 3Q9QA 4YNYA 5BJTA 2XNAB 5DMKB 4WTZG 5HHQB 4UB0H 2R2HA 4OAWA 2VQUA 4UTBH 1RZ8A 5C08A 2NQCA 1B88A 4PPTA 3FO1B 5IEHB 4Q6IA 4E9VA 3T3MB 3LKOA 4OCRL 4ANUA 1H9DA 1W16A 3KPSB 5DFVC 5FUZH 5I1EL 2M8XA 2DLFH 5D4JA 3RKPA 3ZMNA 4A2FA 3S3CB 2NX5A 1CGYA 3KPOA 2J6EL 1I1AB 3ZTCC 4FC3E 4UM9B 3TJEH 6CGTA 4NEHB 1KBGL 2XA3A 3N0AA 1PX4A 4AENB 3LKPB 4HOMA 4XN2A 3O9WA 4KO6A 4ZSOE 3EBAA 3FFCE 3ZX1A 1EJFA 1YN6B 1Z9PA 2WZ6A 4K94C 1CTOA 3OGCB 5KVFE 4D7PA 3F58H 3FCTA 2NUTA 5KSBE 4MNQA 1BSIA 1ZA3B 4PJDF 2XI9A 4B6ZA 3DOIA 4RWHA 1S5IH 1SEQL 5K59E 3LV3B 4OF3A 2MNUA 3CWGA 1MG2C 5GXBB 4NNYB 4K8RL 5D4HA 4ZTPL 2PCYA 1UM6H 2IMMA 4M6ML 4M7LT 4LEEA 4AM0A 4A2HA 4ZUVB 2GVYA 4YWGL 4JJ5B 1GGUA 2IV8A 3TBYA 2L04A 3L2NA 4JFSA 5IFAH 3VD0A 3AMKA 4NC1C 1LO3H 5FHAL 1FORL 5D4IA 4F57H 5HYEA 4RH4A 4UQ3A 4G59C 3JQOB 5SWQB 5CBAA 4PAZA 3UTOA 3O8XD 2WXPA 3AM8C 4OGYH 2IBZX 1ITBB 3UYRL 1MWAH 1WE5A 3X3GL 1U8MA 4H5SA 5CU5A 5B38B 3PWLA 4TN9A 4FADA 4JFQA 1EAPB 3FT4B 4ZBJA 5EU4A 1CFVH 4FL4B 4ZO8A 2YHGA 5DTFB 3IGLA 1M2VB 3EGXA 3GZQA 3LXAA 4J1UB 5DGRA 3WJLC 3EJTA 2BSSA 3KHQA 2LU5A 1AP2B 4U1SA 5AAPA 15C8L 3HFMH 2P5WA 3WKML 2VMDA 3PNRB 3WS3B 1DVQA 4XNMA 4CSTA 1KC5L 3D2UA 2HLFC 5GSRA 3FK3A 5I1HH 5LQBL 3IJEA 4GAJL 3P4OB 3KYOA 5F89A 3C6SB 5IR1B 4AQZA 3BH4A 1I3UA 1TTBA 3DV4A 5B7EA 4BFIA 1L7TH 1M57B 1SOSA 1U3HB 3SKNB 1N8ZB 4NQVA 1MFBL 4OZHE 1TZIB 1OAKL 4LMQI 4F8QA 3BP6A 3ESVF 2RCSH 2XWDA 4R3SB 2WC7A 4NRYB 4MAYA 4JEGB 5AG9A 1R5WB 4KTDH 3RDTD 1BW8A 4DEUA 1ZGLM 1CE1L 3UBFA 1GMEA 1QNZH 2CKNA 3IJSB 3MRRA 3QJHA 3BAWA 4ZW6A 5C0EA 1J05B 4QOKE 3W56A 2ZUUA 1WFJA 1E7VA 2AQ2A 2H1XA 4LLVB 4YSAA 4X4KA 3MUY1 4ERSH 5J6HB 5F3HB 3D1MC 3DJSA 1M9WA 3EYSH 4KROC 3DA0A 4ANKA 1ADQH 1W15A 1K8DB 3F3HA 3MBWA 5HGAA 4HJGB 5ID0B 2JJSC 3FYIB 3OPZH 1UZGA 4X4ZA 2VJ8A 2J8OA 3U9UA 4S0HA 4XPFH 2F5BL 4NC1E 3OM3B 5AB0A 4NQCA 4I18A 3JWOC 4NRZB 1NEUA 1Y1DA 3HNTH 3W0WE 1U8JA 2R1YA 3ZPDA 2WXQA 2YD9A 4TL5A 3UTZB 1JHLH 5HGBB 1MAJA 4PLNC 3CSBA 5EF3A 3CSTA 1DBJL 3QORC 4A2DA 4F7MB 1QFWL 3CU1A 1VZHA 3B37A 1S7QB 3CX5J 3FT0A 4NN6B 3RX8A 5AUMB 4MGXA 5FM5M 4FQPA 4FQQA 5KOVC 2MOVA 4Y4FA 3WIHH 4P2CG 1BOYA 3UBXA 2J2ZA 4R0LB 3WKPA 3KEHA 3I6KA 2WYTA 4FNSA 3LZLA 2VL5B 3WHXB 2VNCA 4MQ7B 1B0GB 5C07E 4HVBA 1AKJB 3JSSA 4UDUB 4LLMB 3LSOB 5H35A 2MQCA 4AJ0A 2MNWA 3MLVL 2XBDA 4FCHA 3U1SH 3UABA 5CD5C 3VFRA 1BZ7B 1MCPL 4JFDA 3C5ZA 1K72A 2CKBL 3G08B 4KKCC 2ZJSH 4MAYC 1H3XA 3G5VA 3U0PB 1MCNA 3SDYL 3W39A 1N68A 5CILL 1E4WL 1T5KA 1JZFA 2GIYA 2X4SB 1AG0A 4JKPL 2MIZA 4F93B 3OZKA 4A67A 1EH9A 1SMAA 2HT2C 2AQQA 2RIKA 1EA9C 2BOBA 4IS6B 3K81A 4RNRB 5HYJB 2AJUL 1CGSL 2NX5E 4AT6B 4WU7A 2GAZA 4YFLI 1IILE 4MJ4A 2P5WE 1XF3A 4QRRD 4F7PA 4LF3A 1MFDL 3NH7L 3P9MB 2QVIA 3HBZA 2V2TB 2BJMH 2EYTA 3NIDE 1WH0A 5A7EA 4GSDH 1KJMB 3HBGA 3ZKXC 2BVUA 4MLIA 1WP6A 2B9BA 2JJVA 3QJSB 3L4UA 3DXAE 4Z7WB 3N1GC 3VYOA 3ZYIA 1VACB 1QW9A 4C4UA 4GG8A 1LDPH 2ZSWB 1N5AA 1G9NC 5MEQB 5IW1B 2CLRB 4HFWA 3S5YA 4BM7A 1ADWA 3PGFH 1R4XA 1V55B 3EJJX 2HKHL 2EE6A 1SJXA 4KVPA 5I66B 2C9SA 1EERB 3CZSA 3HJEA 1ANUA 5BRPA 2YFNA 5GS1B 3QHZL 1IEAA 5TQ2H 5GS2H 4FKEA 4U49A 3JTBA 2R2CA 43CAA 2R9HC 1TLKA 1OZTG 3B2UC 2VITA 5ITFA 1KSRA 2YJLA 3PXLA 4BCXA 4JX0A 5AOJA 3QIUC 1JVOA 3IKKA 4I18B 5CN1A 5INDB 1Q1JL 3O9WC 3U4KA 3D12B 3MLPA 5BOZG 3K8MA 2A9NL 4LCWD 4P5TB 2PTUA 3V0JA 4V1DD 4QRPE 2NSQA 3IDXL 4M6OH 5JPMA 1Z66A 4Z7NF 1ZVHA 4MAZA 5DD5H 1AS8A 4NNXA 4TVPL 3TPUA 3OG4B 1E27A 3D7PA 4KZEL 1R5VB 3ELQA 3MLZL 3ARFD 5I73B 2D7NA 1JZDC 4EKXA 4NBXB 2B0SH 3W38A 1FNEB 1P5UA 1BQLH 4FP8L 2GSIA 3TF7C 4KK8D 3VH8G 1K5NB 1BWMA 3NJMA 5I18L 4EO5A 5HHQA 4GKSB 3IDYB 3LIZL 4G2AA 4KKAC 3T2PA 2CD0A 2CDEA 5JLZA 3M6DA 3FO1A 5IEHA 4R7NB 2NQDA 4P59L 4CJ0A 4BKLA 3ABLB 4UTAA 3APCA 4XWOD 1IIKA 3I9PA 4EI6A 3GHPA 8PAZA 3GB7B 4U1LB 3GRGA 1D5XA 43C9B 4Y4FD 4Z3TA 1SVZA 4KRLB 4AI7A 2H41A 3NCCB 2JKTM 1TZHA 2E6QA 2FSEA 4NKMA 1K2DA 2DMCA 4RMWA 3RGVD 2GI0A 2ARWA 2NXYC 4DK3A 1A1MA 1DVFC 1CIUA 3LKPA 3U46B 5E9DD 3UAJD 2BOBB 5D7LD 4YDNA 5HTSA 2ATKA 1W0VB 1RU9H 4HETA 4MNQB 3BGMB 4HALA 4XPGL 1MCBA 3EYOB 4HWBA 4G9FB 5HI5D 3P9MA 2V5TA 2BX5A 1RMFL 3UPRB 2VABB 2ITDB 4PJXF 1QLFB 3L5WA 3APMA 2Y07L 5DYOA 1E6OH 2H6OA 2C9VA 3GS4A 3K7UA 3NZSA 5E8EB 3VRIA 3W0WA 5E08H 4GG6E 1WAEA 4HC1L 2Z6FA 4KGLA 3SE8H 4NQXB 1ZIAA 2DWDA 2FDBP 5FFOA 3IDGB 3K91A 4JW3A 4UQ3B 4LEBA 2R2BB 2NZIA 1MW1A 3O0RH 4DUXA 4HWBL 4IRJB 2Y0SA 4U3SB 2YD7A 3GRWL 1E90A 3O6LH 4M43L 4W6YB 2K7QA 4GS7C 5C0JA 5FDWB 2VXQH 4UI2A 1KGXA 2BPBA 1J5OH 2EKSA 3MGOB 5JW4R 2YPVA 1AXIB 3VWJA 3OHXB 3CTTA 1F3DJ 2QHRH 1B2YA 2LABA 2Y3AA 3H3KA 3FOLB 3AADB 4JG1L 3AMLA 4RGMC 3V0VB 1U91B 5DMIH 3X12A 3EYFA 4U1JB 4MMXC 1BVLA 2EC8A 4U1KB 1RVFL 1Y18B 1DQTA 3KYOB 2VR8A 3IDYC 3C6SA 4G6KL 5GS3A 2P5WD 2AEIT 4NPJA 2QPFA 2YAQA 1NPUA 5EB9A 5I1AA 4Z3EA 4Y5VA 4RDQF 3MODH 1C1EH 2OCCB 4XCNB 3FH7A 3E6FB 3H9ZA 3BPNC 2GITA 2XX0A 4V11A 3ULSA 1O75A 4UT6L 5CSBA 1WC7A 2F7IA 4ZAKB 4KHXL 5ESAB 3DXAD 5KTEL 3IJSA 2ZAHA 3QJHB 1WWBX 4G5AA 3WFDL 3SGDH 1FE8H 3L6FA 1FFRA 2DS4A 4MAUH 4IBQA 5J1AA 1FSKC 2WUCL 3CZGA 3H4FA 3LHPL 3QQ9D 3RFZB 2NY3C 2C9PA 1YPZB 1YEGH 1R3IL 4WI3A 1NLBL 4F7TB 5F3HA 1NGQL 4N2LA 1BQUA 1DN0A 3KPRA 4LSVL 5HHOE 4KY2A 2FQGA 4AQ1C 1BYOA 2RGSA 1OAZH 3ROLB 3B2VH 4JM0A 1MLBA 4B9YA 4PP2B 4ZD3H 2NZ1A 1G7LA 4KZDL 2AABL 1ZVSB 4EOWL 3OF6A 1ZVNA 3BZFB 1XHHA 1HSBB 4XOAA 4QAMB 1JTPA 1K4CB 1QWUA 5F7UA 4JQVC 2X2HA 3N0PB 5CR8A 5KSAA 1D5ZA 1TJHH 2F8OA 4PJ5A 2FX8L 3GZPA 3HG5A 2CPUA 2FEDD 3T4YB 1P0SE 3VXQB 3BP7B 1X5MA 1MWOA 1QLEB 3QCVL 4YAQB 4L4VA 5FM5O 2UUDH 5JORA 4B3VA 2ADJA 2BSCA 5KYXB 3NCMA 5KVGH 1CD1B 1F1AA 4J4PD 5E00B 2VABA 3VXRB 5LN4A 3VGHA 4YHLH 1WQVT 2F58H 2DKMA 5LGJB 1Q0YL 2VR7A 2K8MA 2J5LB 4XNAA 2ODIA 1XIWC 4TQEL 4JB9H 4U1SB 2NYKA 1HKFA 3GBNH 2ZONA 4G6MH 4K7PL 5IJVB 2DWDB 2VKWA 4ZUSB 4AZUA 3KNBA 4YBHA 4DVRL 1KLGA 1OB1A 3NQKA 5D2NA 1IFHH 2HKFL 3AAZA 5HDRA 3G08A 4AEIH 3MRHB 4KC3B 4U3SA 4G80B 2NXZD 4I0KA 1BJ1J 2VH5L 1GS6X 3WOVA 2N1TE 2IH8A 4PJIE 3VQMA 3PP4H 4K3GA 1T0MA 4FGMA 3S34H 4Z8FL 1G87A 2X6VA 4GEIA 5EUOA 1T1WA 1T4WA 1AGBA 5T1MB 1PZCA 4L3CB 4ZX3A 3E80A 2YEVB 35C8H 3QZBA 4HOZA 1YC8A 4WNJA 3ESPA 2D4FA 4MYPA 4YH6A 4LRNH 1TTUA 4JANB 5HXMA 1TOXA 4JQXA 1XF5A 2EQDA 1NCHA 1IRAY 1NL0L 2CDFA 3UGXA 4Z76B 1KGWA 1BBDL 4RSYA 1NGXA 3RIAK 5HJBA 3D69B 2BDNH 5SX4H 1JNLL 4PP1D 3VQ2C 2ZXBA 5I0ZA 1NKOA 2AXFA 2XVBA 3O6FC 2XIBA 3NFNB 1N59A 5D7JC 1DBKH 1UKQA 2X9ZA 4K0OA 5IY5B 1A14L 2J7LA 4QXUH 4WHDA 3OR6B 5GGSB 2W80C 1KXVA 2DWXA 2NY2C 4CRPA 1OPGH 4HD9A 2EYRA 4PVMA 4KJPC 1TQVA 1KMGA 1UFGA 2EYSB 3LZQA 2NW2B 3H3PL 2NNFA 4Q74A 4ZW5A 4GMTL 5HGBA 1LK2A 4YQXH 5DURD 4E41D 2XZQH 3C8KA 5TE6L 4LXFA 4UBDD 5FEBA 2PYEE 2O61B 1X5YA 1GZHA 3KXFA 1XGRB 2QQNL 1TVDA 4Q52A 5KN5B 2WY3B 5BMFL 3WNJA 3MACH 4NQSB 2VUKA 5DK0B 4KKNA 5KVDH 2W95A 1E4XH 2QT6A 3IMSA 1ND0B 4FQCH 1U30A 4XNXL 4A7GF 2O5ZH 1KCBA 5ES4B 4Z7WF 3B7SA 5C70A 2W0FA 4N5UA 3TOPA 3TCXA 3T2OA 3CHRA 4GOSA 1CIDA 1E9PB 3MRBA 5E9NA 2DMHA 3AXLA 5EU5B 3SKUD 5D1QC 4CILA 3PL6D 4KTGA 2K6WA 1AXTH 1N26A 2B08A 2F53D 4YHIA 2JE8A 1AZVA 3HAEG 3REVA 1Z5YD 3SE3A 2Y5TA 3VUAA 1YHPA 2ZXAA 1U8CA 4J3UA 4X4YB 4L1SA 3JTTA 5D7KD 3LKNB 5LBSL 2VLLA 3TH3T 2ZTBA 3DUHA 4P9HC 5D71L 3ILQD 3A4FA 1ES0A 1AQ8A 1BPLB 4C47A 5M7QA 4JY6A 1U93A 2EDHA 5LWYH 2CDEB 4AEFA 5JLZB 4NWTL 5MENA 1X4ZA 3NABL 4MA8H 1DJSA 4OCWL 1CJYA 3T6VA 1U8HB 1OV8A 1A0QL 3S3DB 1CFMA 1YC7A 4DGYH 2IBBA 3GXUB 1XCWA 4XP5L 1CR9L 2FNWA 4NNYA 3O6KL 4HKZB 4EUPA 4JO8A 1S78D 1NCGA 3IKCA 4A39A 2AXJA 2B1HH 4NXSA 1UUSA 3QWQB 4PRHB 4YHNB 4P9MH 1KFGA 3LEVH 4Y16A 3V55A 4Z7OF 1WBZB 2ZAIA 1KCLA 3JUYA 4HKXA 4ZUVA 2QDWA 5INCB 2X05A 2KZ1B 4HK3N 4DP0X 2AXGB 25C8H 3CSFA 3BGFC 2Q8BH 1LGVA 2FUQA 3CFBA 2H26A 2I9TB 3VCLA 3CZEA 4WW1B 4AIZB 4XC3L 1PX3A 1FVCA 3B3IB 3K6SB 7FABH 1MIMH 2WOYA 5KUKA 2ICWJ 5IMKA 4PLJC 1RJLB 1IKNC 1VPOL 2IANE 4WWKB 2AVGA 3MV11 1RURH 4XPTH 3GYRA 5IBTL 5DYOB 4UOJA 1RUPH 1PY4A 3JVFC 2PO6A 1OTUC 5GRVK 4UINL 3STBA 2QPSA 2CBMA 5EV7A 43CAB 1NJ9A 1AZCA 1VFAA 4YOKA 5CCKH 1OGAB 4PRID 3UO1L 4KX8A 3ARQA 4HWZA 5C0CA 2LV4A 2KLRA 4IRJA 5KSVB 1YEWA 1IAMA 5H94A 4J4PA 1XWVA 3PWPB 1VCAA 2EO1A 1PTZA 1JPFA 4PWGA 1J11A 3MRLA 4HBCL 3SKNA 1N8ZA 1JZJA 1KTCA 1MKFA 5DRWA 1FZOA 5KS9E 5F0MB 3FYEB 3RY6A 2CG9X 4FHJA 4QHKI 3WAKA 2WMPA 1I1FB 3RWGA 2G3NA 4F7CA 4A7VA 3UP6A 1KN4L 1K6QL 3W5NA 5F6HJ 2ZF8A 3NSYA 3ZLQC 4DF9A 1FZKA 1NAML 2WVUA 3OJDA 5K33A 5DK0A 4KK9C 3T2NL 3LNGA 2FH8A 4NNPH 1OT2A 1FFOB 1NCCL 4HXAL 1OARL 3WE1A 3WSQL 4MCMA 1SMDA 3O45A 4F33A 1G4RA 1KCVL 2YPLE 2QPUA 2X6MA 4KPHH 4NAJA 1VKXA 4X6FB 5EO0B 4B0MB 3HB3B 1W72A 1FFPB 1Z5LA 4WGKA 4CN1A 1MCWM 2EH7L 2NQ3A 4U1LA 1L9NA 4URTB 2A9BA 3TZVC 1WZLA 1R1CA 2IFGA 1U8CB 2FQEA 5FC9A 1CXKA 4ETQA 4A2MA 5EULV 3FUHA 3ZTNH 4N28A 2MHAA 3VFWB 2ED8A 3P11L 5E2TH 3TJPA 3RWCA 4C56A 2WQXA 4BH7A 3U7WH 5D5ME 2EVFA 4WV1C 5TD4A 3QB7C 2NT0A 2IQ9H 3FFCA 3GBEA 1KBBA 2QKIB 5DEGB 4CBPA 4EIUA 5E2VL 5DO8A 4FX5A 1IGIH 3VFOB 3EOBB 3ZQ9A 2NR6A 4IIZA 5J8OA 4TSCH 3DX2A 3UZQB 3WLWC 3ARWA 1EAJA 1YEFH 4JZJB 5D93B 3VWJD 4Z7AA 5JA9A 3FSZA 1I7RA 4QT5A 3IDIB 5IQ7H 2ZCLH 2M26A 3ARBB 2OQJA 2BZDA 1Z32X 3N1MC 4D0DB 1V7MH 2I07B 5FGCE 2XKNB 5JDSB 2XBZA 3T2LA 5FDWA 1MFMA 3B43A 4LCCA 1TEFA 2XDHA 1A7PH 5KBPA 4RMRA 4YGVB 3NJKA 3LDBC 4JFTA 2NT1A 2H8PB 3HZKB 1E28A 5I6XB 3KPPB 2XPGA 6FABL 5BZWB 4D0BB 3A24A 3RB7A 4CC1A 3DDFA 4N2IA 2KMWA 4YFEA 2LLLA 3UGUA 4QHMB 2PNDA 3OZLA 4BELD 1QACA 3QAZC 1AGCA 2E74C 1OTSC 2VE6B 5JW4N 4TSBL 2PCFA 1A8JH 3QUHA 1OQXA 3UTQB 1U92A 2R1XB 4FZEL 3TASA 3QS3A 3QW9A 5BS0A 2HTLC 2W65B 4AZ8A 1GOGA 4FTDA 3KPMB 5DJ8B 5DO2D 4EUPG 2XG5B 2WO2B 5C2BH 1VLXA 3QH3B 1G0XA 1JZGA 2D0HA 4YUEH 3NA4A 2C9XA 2J55A 2PLTA 1TQCB 4IDLA 3RIKA 1S7UA 2AK4D 4M93C 5DD0H 5CFAA 5D70L 3HFFA 1NPJA 2XWRA 2ZSWA 1UM4H 4BFNA 2Q76A 2BO0A 1Q9OA 2DH3A 1KG0B 3MRIA 4OI7A 2A0LD 3V4VH 2VZOA 3A4AA 3LKQA 1RJZA 5JHLA 3D69A 3UG4A 2F68X 1F11A 5DJZA 1YNKH 1J0IA 2F9BT 4FG0A 3BKCH 4C57C 3KPRB 2X4PB 4BFFA 5A3ID 2W1NA 3BI9X 5GHWH 2XHNA 3WLBA 1F00I 3H53A 2AK4A 3LPPA 1UJ3B 2UWEA 5I75C 1G0DA 5IHLB 4FFWD 3IFOA 5GJSH 5JXAL 1BG1A 1PEWA 5DRNA 4MMYB 3KH3A 3DNKA 3HS0B 2X09A 3KD4A 2ZUQB 3HG4A 5AYUL 3MXWL 5EOCL 1SJEB 3RQ3A 4IBYA 5DQDL 4M5YH 4LPWA 32C2B 4HLJA 3BRGC 3GLAA 2H3XC 3FFCB 1BF2A 3FRUA 2NTFA 4CDGC 5F6IB 2JI3A 1HN1A 1TETH 3MU3A 5CLWA 2A6DA 2YAEA 4Q0XL 4YL4A 4QHUA 3AJ7A 5DJXA 3MOAH 5B1JC 2WWOA 5CXPA 2F61A 3VFOA 2HRHA 2VDLH 3QDMD 2ZX9A 3ECBB 1F90H 4IKNA 4AVIA 3ORJA 5BZZA 3MMEA 1NCNA 3O6ML 2A4CA 5ISZD 1LO2L 1YMMB 5E6YA 1DQJB 5D1ZC 3E8UL 1T0PB 4WSGA 5I0YA 3SYPA 4TLSA 3NJXA 5KW9H 5GS0L 4K15A 2X88A 4BJLA 2CO7B 2YBGA 1J9TA 1AI1H 3HG1E 1NEZB 2FSEB 1K8IA 4Y9BA 5AWNH 5BRZD 3ZHKA 1WV7T 4HQQH 1IM3A 4LU5L 5E2JA 5DHVB 1ZT4B 4Q6IB 5E8PB 5J3HD 2BZ7A 2UWEE 4HF5H 3WNMA 1CTNA 1SEBB 3IGFA 3LKOB 4NQCD 1JL8A 5JPNC 4Y7MA 4L3EE 2QSVA 4MTMA 5T1MA 4MCNA 1H3GA 3W82A 4O5LH 5EO9A 4H7VA 5GQBA 3VDAA 2Y7MA 2R15A 1VEMA 3LH9A 4X98B 1LP9A 3IKCB 1G6RA 3ZIMA 5FUOL 2FJSA 5GGTA 4AZ8B 2HA1A 2JTYA 4PRIA 1E4KA 4AQ8C 1HWHB 3SDAD 4N2FA 5IV2A 4BFOA 5JOFA 4XNUH 1XH3B 3V0EA 5IEKA 3DOHA 4CA4A 1FL5A 4D9RD 4JFXB 4JO5A 2D9QB 3JV0A 3ENEA 3HG0A 4IOIB 3KPSD 4WUUE 3JWOH 4ZFZB 5L8JB 5I30L 1JZEA 1IE4A 2DH2A 2BW4A 5EF1A 4YLBA 1E65A 1OAUH 3TO4B 2DZEA 4Y8AA 3NSXA 1MAMH 1T89C 3B1TA 3GSNH 4X8XA 5AAMC 2YMOA 1WCQA 4WO0A 4JPVH 2N1KA 4BSWB 5ABDE 5FF6A 2N56A 3KYNA 1PJ9A 5JHLL 3SDCB 1NGWB 3DVNB 4GAYA 1TQBB 2CUAA 5IESH 5B1JA 1HHJB 3RVWC 1X6LA 4XPHL 5ANME 5LGHH 4CU7A 3SYAA 4GRWB 4KTEL 3VXUD 3X12B 5J57B 1W0YT 3U36A 1F6AA 3BJLA 3RU8H 1FG2A 4WFHD 3WMQA 3CH1B 5DRNB 4Z78A 5IT2L 2ZKMX 3EIFA 2VQ1A 1HNYA 1DSFL 1I75A 4EVNB 1MG3C 3FAWA 2WWMD 4LFHG 1ZLWH 3SGEH 5GIRA 3ZTJG 4ELME 1A66A 5I1IL 4AH2A 3JWNE 3U0TB 3A6BH 4I13B 3L3DA 4FTVE 1RU9L 2HT3D 2EDEA 4N9GB 3IE9A 2GITB 3VI4E 3U4EA 4LLUB 4YSEA 2F6AA 2I9LB 3VXSA 3HZVA 2Y6SD 1RZFH 3I75A 3MN8A 4ZZKA 2VLLB 1B0RA 4MHHI 1U8LB 4PJEE 2EIZA 1JN6A 3LKRB 4LDOB 3FCSB 1EVUA 4HIEB 5DVMA 1D6EB 5DUPL 4JE0A 1YMMD 1T7VA 1Y6KR 2P8LA 3ZZLA 4EBQH 3BIAX 1JP5A 4ZX4A 3QG7H 5F1IA 1DQJA 3CN0A 3NP4A 4O4YL 4X6FA 3IDMB 4M1GH 3ROLA 4ZMWA 5LO7A 2LU7A 5FUZL 1SGKA 4IEFA 3BMWA 2VLRD 4R26L 3QUYC 5L6YL 4L3ED 2XFXB 3RTQA 2K9FB 5DRXB 4JRWA 5FIEA 4ZUWB 4UZSA 5ABZA 3QUXA 3OB8A 4L2YA 4MQXD 2WCGA 4Y4HC 4XCYB 3KWWA 1YEJL 3U0WL 4X2UA 2IO5A 1SEBA 5IHWA 1F86A 3N1PC 5DRZA 5HHNB 2VDLB 5BV7L 3S37H 1CDJA 2R0WL 2Y72A 2F08A 4XN8A 3AG1B 2Z3FA 3SYCA 1HEJC 4AIZA 4CSPA 2WLZA 2IOIA 4CMMA 3Q8EA 1KULA 2IAMC 3D51A 3LQMA 1PCSA 4J3XA 5IMMA 2WQRA 1PZ2A 1KIPB 2XZCH 3MCLH 5D6DC 4EEEA 3BDBA 4ZS7L 5I2IB 1TJGL 1GGIH 4D9QE 3IN2A 1MEXH 1G1OA 2JQZA 5K9JL 2HXAA 5MI0B 3N85H 4XO5A 4RFOH 2OL3L 2QVMA 3TA4D 3QZWA 2ZYIA 2EAEA 4DCQA 3ZL1A 3JWNC 5EU3B 2YEZB 1KPVA 3ETTA 3AG3B 1FE8L 3ARDA 4DN4H 3L4WA 3PQYE 3T0DA 1WFMA 1MREL 4AXWA 1BM3L 4BSWA 4EMZA 4JZNA 5HHXH 3H2QA 1BZ7A 1SN0A 1DQKA 3ATBA 5ANMB 2XKSA 4OJYA 1AGBB 2ICEA 3FOMB 5IHZB 1I9RH 5A1AA 4YBQD 3US9A 4ZAKC 3CH8A 4X6DF 4LBEB 3SDXF 1CBVL 2MWCA 3IXAB 1KBVA 4JANA 1VF5C 3QNYB 1HHKB 4HHAB 2V33A 5C0NC 1O9ZA 1SLXA 2CBTA 1FL6A 2E7HA 5BS0B 3QEQE 4PJAB 3OAUH 4TS6A 1GPOL 4U2ZA 1IGJB 4EVNA 2QPDB 2AXFB 3HMWL 1OP4A 2AW2A 4WZ9A 2DICA 2CCWA 1YSOA 3BQUC 3ABZA 4Z23A 2ALWA 2V4LA 2FHCA 5C09A 1CYWA 3BIBX 2FYVA 4HJUA 3ZDZF 1SXSA 3BVNA 3HKFA 1JCKA 3WN6A 2ZP9A 5JW3H 1SJHB 5EUOE 4OD1L 3D0LB 2IADB 2H7WA 3B7UX 4L8CB 1X5AA 4WHYG 4F8OA 1LE5B 1WUNT 1LYQA 3CXDL 3VFWA 4KGJA 3OLIA 4OZIA 4GRWH 2XJLA 5KANG 2XSKA 3GBNL 1UB6A 2J72A 5F7AA 1CU4H 1HHGA 4M48L 4OCXL 4QIRA 4F2FA 4YSQA 4TRPL 2OMNA 2FBJL 4YVNA 2FJHB 4XVJH 4KVNL 2APVA 2HJKB 2YBRB 2DYSB 5ELIA 4K3HA 3LVEA 5FGBC 4DQOL 4LCCC 3KGSA 4ZFGL 4F2ME 4KXZH 4UWQB 1GTNA 2CUHA 2Q86B 1WA0X 4E42B 3QUXB 1NFDA 1GZPA 1R24B 3D52A 4JY5H 1AE6H 3H1ZA 2OX5A 5GRJH 2HH0H 2EZ0D 2AZAA 4PLKD 4CU8A 2K9UA 1JPST 2WKOF 4LSUL 5EWIH 2EXWC 4D8PB 1F3JB 4GYBA 4MA3B 3NEXA 3PLYA 3REVB 4YC2B 5JTWA 2B4CC 1IC4L 2V2WB 1A22B 2XKNA 3S96B 3QHFH 1KV7A 1PZ3A 3TBVA 1EO7A 2QSCH 4ADIA 1GR7A 1PKQE 4IIQA 1BVOA 4P2OD 4DH2A 3MOBH 1M05B 3NQIA 3TWCH 2YUZA 4D0BA 1GTFA 5F7HA 1H8NA 3TN0C 4HUVB 1NIDA 3G04B 1J1PH 2DMKA 4JREC 3K2MC 4O2FB 3VXOA 2CHNA 4GQRA 2B7DT 2X9YA 4XI5D 3SDXE 4JRXB 4K55A 5T1LA 2WNXA 1A6WH 4DFIA 1MW2A 5EU3A 4LVOB 2R1XA 3SDYH 3V6BR 3KMDA 4P23B 2VZSA 3VMOA 3IYLW 2L7EA 1IM3B 1NGYB 1T03H 2BK8A 4ZXBC 3N44F 3QH3A 5E8PA 4XGZB 2HKAA 4Y2LA 3V0FA 1A02N 1CDIA 1CB4A 5ESQA 1UD4A 2MTAA 5AVZB 3ZZSA 5IVNA 4B53A 5HSFA 1NUDA 4Z3GA 4LNVA 3T77B 5E6ZA 4FG2A 2OCFD 2QGCA 3EGSA 5MHSE 3AWGA 3TVMA 1IC5H 3L1GA 3FBKA 1BLIA 4MJ6B 5JZ7C 4NJ9H 1N64H 5I26A 3SKJL 1EANA 1A1OA 1RFDL 2HFEA 3OWEA 2ZUQC 1RI8A 3V0IA 3E9UA 1ZD6A 3MRCB 1HL9A 4XMTA 4M02A 5C1MB 3LOWA 3FL7A 2AAAA 1G7IB 1A47A 1KLFB 1A9BB 3DTUB 3AU0A 3PUCA 9PCYA 2V7HB 1A6TB 4TXVB 3VFTB 2G60H 2DQGL 2XETA 3V4VB 2GK0A 5DMJB 2WN3A 3ARFB 2WSPA 1UT2A 2P47B 4JPIA 1ONQB 2YKLL 4JRLA 3C60B 5CGTA 4MSWA 3WUWA 5E94B 1YO4A 2ESVD 3NCBB 4PY7B 1BAGA 1G9MH 5IP4A 4PJCA 1TPXC 3MJ9L 3LNEA 5CP3H 3FTGB 4DGIH 4JDEA 4H8WH 1JF5A 4OD3H 5F71A 3QR0A 2HUHA 1HOEA 4HCGA 4MNHB 1HU8A 3V7AE 1OY3B 3O2DA 5BXFA 2DW5A 1HC1A 3H2PA 4FEIA 1I8KB 3TV8A 2OZ4L 2FD6H 3K3QA 1JPSL 2O26U 4RGOL 2BS71 4JN1H 1UASA 1GYWA 2ZT9C 3KWTA 4RA3A 4FA6A 5CGBA 1BIIB 4FXGA 3GC3A 3PHAA 5DYFA 3BZEB 4YIQB 1CLOH 3I6LD 3DX7B 3VTAA 5J1TC 3VXSE 5BRQA 5IB3A 1J87A 1BM7A 5I8EA 2AKRB 1E8WA 1QFUL 4FTVA 2XWJA 4MQSB 4JCWA 2UYLA 3SN6N 1XEDA 5ECJE 5HHMB 1N6UA 5A43C 4ABWA 4WNQB 4HEMA 1DFXA 2UUDK 2P8LB 4B9IA 3I2CH 3O4OC 4UV7L 5F9JB 1JNNL 4BZ1L 3MA7B 6TAAA 4LCWA 4PJDB 4PW4A 2I60H 3KPLB 4NB7A 5T5FH 3V4PA 1LO4H 1SHSA 3D18B 1TJIL 1QHOA 1G6RB 2Z65C 3F7LA 5EDSA 3QUZA 4L4TD 1YN6A 5CIPB 2EH8H 5H37A 4Y9CA 2Y25A 1J88A 5F8QC 3C2AL 5DURB 2F8IA 5IV2B 5JOFB 5D1QA 2WZ5A 4F58H 1T6WA 2L4OA 4Z18A 3R0MA 5D4QA 1TTGA 3HNTL 2LR4A 4UT7L 4D0DA 3WIFA 1AMYA 1U8OA 4R4NC 5JUEH 1JZ3A 4Q9QL 1IAIL 2P49B 1NFAA 1OALA 3TVMC 4NQDE 2E75C 2ZAGA 3GJFA 4NOBA 2FVNA 2OTWA 4UTBL 3TLRA 1KXHA 3PPSA 3SDCA 1YJDL 2BY0A 3D25B 3CU7A 4YAQA 4O2CA 3PQYD 2AAVA 2AV1A 2P80A 4NQEE 5KYXA 3OD3A 2VR6A 2RTTA 1C5CL 5F96L 1T5XA 3TZVA 3EOTH 3BP4B 4K5PA 1RZJC 2N7BA 1HZKA 4WJ5B 4FQHA 4H2AA 2VXVH 3BJ91 3V0AC 3T08A 4CVXB 3QIBD 1ZPLA 4YDKL 3EF7A 2IGFH 3DDGA 3L1FA 4M5ZH 4B95C 1CVRA 3ZSTA 1YEEL 3BUDA 4PB9L 3GUTA 2ZXEB 4NKDB 1ZT1A 3MSPA 4FFYL 2BWDA 3EO1A 1QO3B 3GSOB 3GBDA 5DMYA 1PJWA 1MRFH 3DBXA 2ZYHA 4ZMVA 4OB5H 1FJ1A 1HL5A 4GSXA 3O4LD 3RAJH 1U3HA 4WEMB 4XWGH 5GISH 1KYOJ 2DDQH 2VERA 4Y1SA 4JQXC 2OTUB 3MV9A 4I18C 2AEPH 4PWHA 3APFA 3C6EA 5TQ0H 1FPTL 1YEDB 3BVDB 2BP0B 2XQYA 3FQNB 1EHKB 5TTRA 2Z8VC 3Q8AA 3MRFB 1UVQA 1D9KC 4L3CA 3CCHA 2YXMA 3QJZA 4PI0A 2X4PA 4BUQA 5K93A 1AD0B 4FS0A 1LD9A 2FBOJ 1R0AH 5IQ7L 3R18A 4FEMA 1E5BA 4UQCA 2EUVA 1JCVA 5A6IA 1SBSL 2DF3A 5IHUL 2UZPA 2Z9TA 4BE5A 3TBWB 3FUMA 4YXLL 2OMYB 3ZKMC 3EBIA 3FN0H 3FUIA 1XCTB 4Q4EA 1YYLL 3FS9A 5KSBB 1QHPA 4K7FA 2XY2A 1K8DA 4OGAD 3NFNA 5F9OL 4JCLA 3DVGA 6FABH 2XRAL 3VO0A 1EHXA 3HMXA 3PHQA 1P6WA 1WCBB 2E8ZA 3BE1H 3MJ8A 4TUOB 3JWNH 1UADC 3RUGE 1QKZH 1MDAA 1DTUA 3U9PH 4IKLA 5MEOA 1FYHB 2DWEA 4M9OA 1BQ5A 2MCAA 4HPOL 4XVTH 4ORZC 4JY4A 1SN2A 2YRLA 4KJQD 4MKMA 2Y1AA 2V8MA 3RVVC 1GAFL 3K2UH 5EN2A 4G7SB 3PGCB 3QNFA 5DZJA 1ZTXH 1WLHA 1JGLL 1SLWA 2OX5B 2ADFH 4FQXC 1I8UA 1XF2A 1JVLA 3ZRSA 3QPXH 3C5ZD 2LFGA 3EGDA 4FQIH 4UILL 1UWGH 1F8TL 5I1GH 4W6XB 4KXDA 2LAAA 3QZWB 3S0PA 2QEJA 1CGUA 1AJ7L 2NW3B 2VDPB 3EFFA 2DQMA 4OFYA 5BUAA 1MUJB 1HXMB 1CZ8L 2YD3A 3ARDB 1NCBL 1QYGH 2GJ6B 3DUSA 4CSZA 1FN4A 4YVUA 3GJFB 2MCG1 3WMPA 4ONFL 1NMBL 3DETD 4PGCA 1QD0A 1PF3A 3AXLB 4S1RL 5EU5A 4D3CL 1W72H 3OL2A 4AQ1A 4NDMB 3I6GB 2OI9C 4YHIB 3RI5K 2ICEB 3D34A 4DIXA 4P05A 2WB7A 3GSWA 2XV0A 1XMEB 3KJ6L 4L8BA 4LZKA 4XPFL 4RISL 4WJ5A 1BX2B 4E0RA 1CF1A 3SOBL 1R5IA 3BOVA 3CFKB 1M42A 4PD4K 3V6ZA 4IS6A 5TJWK 3CSYB 3O4LE 4WU7B 2N59A 1AQKH 1FLTX 3BVVA 4PV9B 2B14A 4P23D 5AVQB 4LLDA 3EO1B 3G9AB 3GSOA 5I1EH 3F62A 2VMEA 3H42L 2KC0A 2V9TA 4KKRA 4UZGA 3KAAA 1W8NA 2F74B 4W9ZA 3LD8B 1GH7A 4OF0A 4GSRA 4Q8BA 4LRNL 1GIGH 3BWAA 3SPIA 4PVBA 1FAIH 1WBZA 4HKXB 3O8XA 4IRJD 4UTCA 1F90L 3VQ1C 3ZR6A 1TTAA 4M7KL 4OF7A 3BAEH 1KXTA 4LGRB 2O5YL 2B77A 3C60C 3GPEA 1FVEA 5AALA 1NDMB 4U6YA 2AJVH 1B9KA 1NANI 1X5ZA 4TUKL 2QADD 5HHPB 4ZMXA 5KJRL 4HIIA 1DBKL 3UTSD 3RDTA 5IW1A 1INQA 4N1EA 4QY8B 3EZJB 4G9FE 3PFUA 3M07A 3RFZC 1ZV2A 3CN3A 1JGVH 3IWUA 4NQED 4HUMB 2WNGA 4JKLA 2AJXH 1MRCL 3ULVC 2OMYA 3I9AA 5EOCJ 1M6UA 4MSWB 1IEAB 2ZP0T 4Q58C 3N55A 4TUJA 5C0AA 2DQJH 1LO3L 1YNLH 5FHAH 5HJGA 3GRWH 1QFHA 3IB4A 2J6EH 5CEYA 2IDCA 1WF5A 1O5DT 3DIFA 1P7KA 3LN4A 3L3DB 4YXKH 3SCMB 3A47A 3H9SD 2WWNA 4QR7A 4N8VG 4JZOA 1ZK5A 1TZGL 4HS3B 4KXBA 1XZ0B 1RERA 4B97A 4Z6AT 5C3TA 1F4HA 2QHRL 2VDKH 2EIZB 5FUOH 2V9QA 1J7VR 1ZANL 4QRSB 2VYRE 4KQ4L 1M05A 1AVAA 1NCOA 4DZ8B 1V3KA 1BQHG 2G4GA 1EAQA 1WFOA 2O5XH 1SVBA 3JBG7 4QRQB 3T8MA 4Q9RH 3WEXB 2W0PA 2Q2LA 4B41A 5B8CB 3TEWA 2ZWYA 5I1HL 2XKUA 4X6CA 1PLAA 3FQRA 3AT0A 3TFKC 4U1HA 1RZJH 1YCSA 5AW4B 3K71B 1J9QA 1G7HA 1HXMA 3GXFA 5DWPA 2ZCZA 4PW9A 3RL1B 3T6WA 4FTVB 5DT1H 2PYEB 2A3TA 2C1OA 2UYLB 3FCTB 1BQHB 4I9WD 4N90E 3K74B 5GRVL 3WU1A 3OB0H 5IB4B 2NY4B 1YG9A 2AJ3B 2NDGA 2NNRA 4MRCA 2CIIA 4Y2DD 2WUBL 3KVQA 5IROC 3T77A 1GCFA 5B7FA 3KZ8A 3MZTA 4WTQA 3BKJL 3NN8B 4YDVB 3GSQA 4PUBH 4PJXB 2CM6A 3QDGD 5C6TH 3WIIL 1UYWH 5A2KH 1JI1A 1W8EA 2IAAC 3ZL4H 3CFTA 2X40A 4G8GD 4ODSL 3V6ZB 2G4EA 3L9YA 1GSKA 1W0VA 5CLYA 4OV5A 1KC5H 3QQNA 4OZ4B 1C5DA 2HT2D 4QOKD 4YSCA 4YGAB 2VDQH 1GZQB 1B9ZA 1TYJA 3FMGH 2YAHA 2YLHA 1N0LA 5E4IA 5I71B 4GAFB 2D0GA 4PJ7E 4YE4H 1V8HA 1QLFA 3F7VA 3ILPB 4KKPA 2BSEA 3TL5A 1M2VA 1M4KA 2UVEA 2YA1A 3EGXB 3LYRA 5HDOA 5EOQH 1ONQA 3VJ6B 3QCVH 4YSSA 2ZSVB 1Y0LA 4L9DA 1AY1H 1CGTA 4G8EA 4KY1L 4PGZA 4K71B 5BW7A 2DTMH 3VXTA 5JPNA 4WK2B 4M00A 5GSRB 4L0ZA 3SDCC 1JBJA 4MRBA 3P4OA 5F89B 4ZDHB 1PEZA 4D9LH 1A3ZA 3HUJB 4LBEA 4XMKL 1RUKH 1S8DB 2BSRA 5GRUL 3UBHA 3MRKB 1QWNA 4QXGH 2QQLH 5L9DH 1LEKB 3QIBB 2H3NB 4S1DD 1GA2A 1F4XH 1L4IA 5DD1H 1AOZA 3R19A 1HH6A 5IOPA 1R3HB 4QLRA 1HK6A 3IJHA 4BZ2H 3P1VA 1N9PA 2BIPA 3D50A 3S37L 2J8UE 3WY3A 5AZEL 4BWTA 4YL9A 5L2KD 5C09B 1RSFA 1N6QH 4Y1TA 4JZOB 3VFNB 3LNHA 1T21B 4AIEA 1UXLA 1LVEA 1XB8A 4L5FE 5J6HA 2XG5A 5HYFA 2RH0A 4L2LA 4RDBA 4AM0Q 2A1WH 3BP6B 2R56L 3T3PE 1DUZA 5DLLA 2GUYA 5EF2A 1VSCA 4PI2A 3AXHA 2NSMA 4XVSL 5B38G 4ODTL 4I9WE 4N90D 3ZTEA 3PIQB 3T6ZA 3QFJB 3W57A 4EE2A 2F8XC 3B6SB 4ZOEA 3LEYL 4G8GA 3CGTA 2AP2A 4ODXA 2OJEA 3D18A 4O51A 1IKNA 4BFKA 4WV1A 5DU7A 5ESVA 1IJNA 1CURA 5F7LB 4LLVA 2Y22A 1XCTA 2OZNA 4F27A 1LP9E 2WLHA 1CS6A 4FQQB 1D9KB 1ZHNA 4FI7A 4HIQA 1QBML 5ENWA 1ZVSA 4JO2L 4OM1L 4XWOC 1WIOA 1FP5A 5E6IC 2DQCL 3FZUC 4NQEA 1SEQH 3HI5H 4UDUA 4NKIH 2B1OA 5FKPA 4LHUG 2CZNA 3BD4A 3C12A 1CGSH 3WHE0 4V2CB 1RD6A 3T65A 3T8XA 2KDGA 3DHJA 3WJLA 4D0CB 1GKEA 2OMUB 4C4BA 1MQ8A 1QSFB 3E0GA 4AQAA 2NTFB 1FORH 3QORA 4F57L 1XF2B 2VDRB 5L4IA 2WINB 4UNIA 2F7QA 1AO7E 3Q6GH 3V8OA 3S36X 4AG4H 1YZZA 3LNDA 4UT6H 1XGUA 3MLTA 5CEZE 3NAAH 2IPUG 4KNSA 2ATPA 1JF1A 3D9AH 4PGBA 4ZNEE 3MMEB 3ZE2E 1GHFL 2YO3A 2GJ6A 4HMCA 4UDTA 4BA0A 4EZKA 4H8VA 2J43A 4WKZA 1YRKA 4CADA 5IJVA 1D5IH 2H45A 4K9EL 3JYCA 3ME0B 4EN3B 1NLBH 4GT0A 4XRCB 1RIVL 3ZKNC 1P6FA 1VZGA 5I8KH 2Z34A 3RILA 1E0OB 4QD2E 3PYCA 1K4DA 4IRJC 3TVMB 1UWXK 3MO1B 2ESVB 1UH3A 3MV8E 3UTTE 5LQBH 3N43B 5E1IA 1YEKH 3HC3L 2OA9A 4YDMA 1L5GB 4NO3B 3EAKA 4PHZA 5HDBB 4Y2OB 3LIZH 3HAEB 4BK4A 4JRXE 1DVFB 8FABB 3F7PC 3IDUA 4Z7NB 2CIKB 5J13B 5DLML 3FSVA 4LLQB 1XAUA 1ETZB 2B1HL 4RMSA 4F7PB 1I8LA 2VLMD 1QTSA 5BPPA 5ACZB 2VISB 2VDOB 2CGYA 2NR6C 3CJJA 3CFEB 4I5BB 5FM4A 1ORSA 3RA7L 3SJVA 4WNSA 4DKFL 1WYJA 4LVNB 5T33L 3X3FL 1BMGA 3VYNA 1IAIM 2MQ0A 3S5LB 3WY2A 3HOGA 3DHUA 3LVTA 5C08E 2DKUA 4MD5A 5T1DL 1HSAB 1PSKH 1ZS8B 1J8HE 2OI9B 4U6YB 2FQFA 4FZ8H 1OE1A 1SYVA 3ISWA 4DW2H 5CR1A 3L9EA 3EG9B 2ENQA 2WQ8A 2H9GB 1QNIA 3ZZQA 3QDJA 1IFHL 3ZO9A 4LVNC 4MNHA 4N8VA 1NUFA 5T3ZH 2RMNA 5TE7L 2HX7A 4DEWA 3WJMB 2AK1H 4XNQA 3SSGA 1MCOL 4UINH 4K5MA 3HBQA 3DMMB 3K72B 4XH2B 1FGNH 1J1OL 5GS1A 2NY3D 3DX8B 3SE8L 3FF7A 1MLCA 2QV2A 4Y4KA 3VGGA 4OU3A 1WPCA 1OIOA 2F19H 3QIUB 4EN3D 2YMXH 3U36B 1Z9NA 1F6AB 3TA3B 2UV3A 1KB3A 2D9CA 2C1PB 3F7QA 1XZ0A 3IETA 4OFKA 1EZVX 1AS7A 2OMXB 4MJIB 2BY3A 2PWHA 1J5OL 1J0KA 3U6XS 4F9LA 2ICWI 4FYRA 1DJGA 1I1RA 3BC9A 3TIDB 4P57B 1QLRB 2ERJC 3BKYL 2Z7ZA 1RZKC 1F4WL 2X70A 2YARA 5CCJA 2GJ6E 4OH2A 2WXFA 4N9GA 4I3SL 2ALAA 2AQ1A 5CJ8A 1UD8A 3PJSA 3WEXA 4FD0A 5EZLA 3T0XA 1S9XB 4DPRA 4JAMB 1ZPUA 1E6OL 4PTTA 1CCZA 3ARFC 4RAUB 1JZHA 4XC1L 4X5XB 3LKRA 4AW7A 2DQDH 1MN4A 1P1VA 2AMUA 4NAQA 4JY6B 4XNDA 2Z35B 3D85B 2AQNA 2B1AH 5D1QE 2ORBL 5IF0B 5KBKA 1U4EA 4AV0A 5CZXC 3GDCA 4QRFA 3V2AR 2GJZB 4G5ZH 4M1DH 4AITA 4QHPA 1E4HA 3TV3H 1CTMA 1QRNE 2YGNA 4A2GA 3RUGB 3SHSA 4NT6A 1DSWA 5D5MA 2W5PA 3VXUB 4G6AC 4UM8B 4JGUA 1BXAA 2BJML 5GSVB 3DYPA 4GQ9H 2YZ8A 1EIBA 2XTJD 1T22B 5AOMA 2B15A 3DXAB 4Z7WE 3P69A 3SDCD 2X5PA 2VAAB 8FABA 3DX1A 4RAVA 4XNUL 5AW7B 3B83A 1SUHA 4W6WB 4J3BA 1S9YB 1U58B 1NEZG 3HNSL 3SO3B 3SQRA 3RDTB 4OT1L 5L0QC 3W11D 3I6SA 4LEOA 3GNMH 1LDPL 4RGNE 4N0UB 4L23A 1MHHB 3E3QC 3NT0A 4S11A 3FUFA 1AO7D 4C4KO 1XD1A 2BNUB 1MCRA 2OXGB 2E7LA 2D4DA 4MB1A 2UX6A 5GZND 3QUGA 1Y0LB 1CFBA 1DFBH 1CFNA 4N85A 2KZWA 3PP3H 1P1ZA 3L5JA 3KBFA 1UXWA 2A38A 1INDL 1CFTB 1IAKA 2H6UA 3BPOC 1Y18A 3MGTA 1P7QA 4AIXA 5KWYC 1NIFA 1L0PA 1CFVL 4PS7A 2OMTA 1TSHA 2DJ4A 1CK0L 1PZSA 4F1ZA 2NY2D 1KEGL 5AOZA 2DQEL 4NKOA 4CKVX 4HIXH 3FUJA 3F5WA 4ZYKB 3LZRA 5EUKA 3T4AB 4CBZA 5T3XD 2NNCA 1UVQB 3VGDA 5GS0C 3CC5B 3GMPA 3MA9H 4NO2A 5BRZB 3CD4A 1ET8A 2P8PB 1UD3A 4J2QA 3OGOE 5GZNA 3QWRA 3B5GA 4XNBA 1YEHH 3FQ2A 1E6JL 4HKBA 3GS0A 4NUGL 1RSYA 2J8UA 2UY6B 5ITBL 2BIHA 3PP4L 2QQQA 3FO2A 3GSRB 5F97E 1V7NH 1QPPA 3L2MA 1E8XA 5FECB 1IMHC 1RZIB 2ZCHL 4AK1A 3DVGB 2V0AA 5EO0A 4X6DE 1F56A 4L8SC 4JRYB 2QR0B 2BRRL 3V9CA 5E0FA 4NUJB 2JLLA 3SDDC 1J10A 5EZLB 5FO9B 3L16A 1FIGL 4PG9A 3QA3B 3B6SA 4PV1C 4WSKA 5PCYA 4I0CC 2VXTL 4RQQB 4IK7A 4YDJA 3HLKA 4K7PH 4URKA 4YDKH 2E86A 4OZIB 4RGNC 5B4MC 4UM9D 1YEEH 4PB9H 3LPFA 5D1XE 4LSQL 2P26A 1ZHBA 4ZG1A 2X41A 4XNYH 4M3HA 3UBXI 1Z6JT 2HJKA 2VH5H 5DFVD 3GXNA 1C08A 2XQBL 1T0OA 3VXNA 1MFNA 2NW3A 5EOCH 1H3UA 3UFIA 4RETB 3DRTB 4EDWH 4E42A 3U1PA 1TQCC 1WRFA 3MV7E 3KPNA 1KIUB 5JQ6L 4FNQA 3NJIA 5CEZD 2WOBA 3CDCA 5JHDA 3G3LA 4F8TA 5HGGS 3PAVA 1OW0A 3DO7B 3ZHNA 3MFGB 4P2QB 4UIMA 1W6LA 2AEQL 3DX9A 5AKSA 3CSPA 1KCRL 4X80H 1ADQA 4TTDD 4FN0A 5MI0C 1BVNP 1OAJA 3QUML 1WAAF 1V3JA 1DLHA 1KJ2B 1IM9D 2ADGB 2LW3A 4JFOB 5EPMB 2ZUWA 3KPPA 5DF0A 3O3DB 4IBZA 4Q6IC 4U3HA 4AMKL 5ADPH 4JFFB 4YBLC 4EPSA 4KAQH 2FATL 3EO9L 4R84A 2G75A 4HSCX 4MX7A 3ME0A 2ARJB 4QHMA 4ZS6C 4EN3A 1CT8B 5FFGA 3KNBB 4PJFE 1UXWB 4AGNA 1T83C 4FMFA 2ZOLB 3N42F 4BDVB 2NR6D 2TRHA 1MPAH 3ZT5A 1W6WA 4HFUH 2AXWA 2EABA 2F74A 1A6ZA 3AITA 5GGTL 2CXKA 4ODUB 2WXKA 3ULUL 4NO5A 5TK4A 4F7EB 3I50H 2E59A 1NGYA 2WBXA 1YNTF 4PJ8B 3M45A 2Z92B 2EEBA 1TDQA 2QV4A 3HAEA 1E42A 5I15L 4XXWA 1MJ7L 2BY1A 3QHZH 1SDAB 1R5WA 1T2QL 1HHIB 4ZMOA 1Z9MA 3QYMA 5SV3A 3MBEC 2ZG1A 5ICYA 4HIIB 2NTSP 5I1DA 4E9XA 1TSRA 4ELDA 4H1LG 4LQFH 1MVUA 1G5GA 1M7XA 1QTPA 1UWFA 2JKSA 3OAYH 1O9VA 4LAQH 3MNWB 1NCTA 4P2RE 4JDVA 3DRQA 1MCLA 2GUOA 3PU7A 4ZQTA 1MAKA 1YEIH 3CXDH 1N12A 3C87A 4JM2C 4KRPC 5DR5H 4ANWA 1MJ8L 1UURA 4WGVB 4CC4A 4D3CH 2ZOOA 4ZMYA 3WLBB 5IQ9B 3I3DA 3PWJA 4BA8A 3QYNA 4U6VL 5FOJA 4F3FB 4ABQA 3EG9A 5FA3B 1ND0A 4E41E 4LOFA 4Z5RB 3QA3A 3Q5YA 4DQOH 3MLRH 4BFBD 1F97A 3BEVA 5I0XA 5LGHL 4JQIH 4K5LA 4PEEA 5BCAA 3HR6A 4DZ8A 4K07A 1UA6L 2YUVA 2P52A 1QEXA 2VAJA 1UA7A 1A5FH 1R6VA 1OWWA 5M95B 1G9EA 3JTTB 1DVZA 4EI5C 3II3A 4P9ML 4YSOA 5FYKU 2ZKWA 1RK1B 3Q06A 1DHKA 2D7PA 5A6MA 1XF4A 1IC4H 2HWZL 2A74B 5EEYA 3JV6A 1H0DA 1IAOA 3PHOA 1NMCB 1RJYA 3JVGC 5CZXD 3FCUB 2IXQB 5JHDB 1E9PA 5T1LD 4S1QL 5TE4L 1S9WA 2AEWA 3R4RA 1Z1WA 1LNUA 3D39A 4G8FA 4HSQA 5C0DB 3CFCH 3GSNA 5HYQB 5KJRH 3BZEA 2V3EA 3B2PA 4X99A 2X1WL 1FV1A 1OQOA 4R4FL 5EOTA 2X4SA 4HS8H 2BCKA 4EZMA 1PY9A 1QA9A 4JFPA 5C07A 3LTVA 4DP8X 5I6XC 4OLWL 3W9EA 1VRSA 5ANHA 3PDOB 4YDIL 5CCKL 3BKML 4JHAH 1JZ6A 4Y4FC 2JELH 4RBPK 1M6OB 1TITA 2CIKA 5F7MC 3I02B 4BYHA 4NLHA 3SCMC 4GUQA 4FNTA 1SBBA 4LASH 1EEQA 3RGVC 3N04A 2V2TA 1ZLVH 3GIZL 4PGEA 3S6CA 4Q0XH 3MLVH 4ADJA 3F7VB 3ILPA 4OY9A 5KS9F 1Q0XH 4AL8C 3TJEL 1IKFH 1NCWH 5CIPA 1JXJA 2VL4A 4IU3A 4DP9X 3S88L 2DV6A 1VEOA 2HTLD 3T71A 2FEEL 3B8SA 1XH3A 1T22A 1A7BA 2XG4B 1A9VA 1JNLH 2ZWZA 5C09D 3MV7D 4X0NA 1E4WH 3CFBB 4OJDH 4DK5A 5B8CC 4JKPH 2CMRL 3L5XH 5I6MA 3VD9A 4FYTA 4R96B 3MUZ1 4LMQE 4ZDHA 2Q7AA 4QNPE 2BXYA 1FHGA 3RFRA 4N0UA 4PTUB 2YZ1A 1J9CT 3IPEA 4H8PA 2KPNA 5FO8A 3QISA 5I1JH 3QDAA 5DJ6A 1BOGB 3MBEB 2OXHA 2GSGA 4XP9L 1FCGA 2DRUA 4OQTL 4QXTB 4R8WL 4A7SA 5C0GB 1OTUD 1YNTA 4R4BB 4ALAC