4E9XA

Multicopper oxidase mglac (data3)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
317
structure length
317
Chain Sequence
AEREFDMTIEEVTIKVAPGLDYKVFGFNGQVPGPLIHVQEGDDVIVNVTNNTSLPHTIHWHGVHQKGTWRSDGVPGVTQQPIEAGDSYTYKFKADRIGTLWYHCHVNVNEHVGVRGMWGPLIVDPKQPLPIEKRVTKDVIMMMSTWESAVADKYGEGGTPMNVADYFSVNAKSFPLTQPLRVKKGDVVKIRFFGAGGGIHAMHSHGHDMLVTHKDGLPLDSPYYADTVLVSPGERYDVIIEADNPGRFIFHDHVDTHVTAGGKHPGGPITVIEYDGVPVDDWYVWKDKDYDPNFFYSESLKQGYGMFDHDGFKGEFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Multicopper oxidase
publication title New insights into the catalytic active-site structure of multicopper oxidases
doi rcsb
source organism Uncultured bacterium
total genus 95
structure length 317
sequence length 317
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9xA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9xA02
1OE1A 1URIA 2HRGA 1SFDA 2I7OA 1OCCB 4F2EA 4JHVA 1FFTB 4EF3A 1NICA 1MG3C 1ET5A 4A67A 1KDIA 2GIMA 4BXVA 4PAZA 1NIDA 1BQKA 4G71B 3AW5A 2ZWNA 2IDFA 4N8UA 4MFHA 3FPYA 5B1BB 4HAKA 3FSZA 1MG2C 3H56A 4KO6A 1SNRA 2BP0B 3NP3A 4F2FA 2IDUA 1IBZA 3NJJA 4P5SA 2AZUA 3EF4A 1ZIAA 3HB3B 1E30A 1AG0A 5I5IA 2FT6A 1AZRA 3EH5B 1VLXA 4YSPA 1EHKB 2YAFA 4UAHA 1BYPA 1TEFA 2CJ3A 2IDQA 2Q9OA 4HCFA 5FC9A 2DWTA 3CVCA 2PP7A 5I26A 5AKRA 1BQ5A 3V9CA 3H4HA 6PCYA 3FQ1A 1AZCA 4KO5A 1M57B 2PPDA 3NJFA 2VSKB 1GS7A 2OCCB 4G7QB 4HZ1A 3NJIA 4ENZA 4KOCA 1E5ZA 4DP4X 2GC7C 4DPAX 3X1NA 2QPEB 3NJMA 5E9NA 4AX3A 4HALA 2VN3A 7PAZA 4K9JA 3U25A 2BW5A 4AZUA 1QHQA 1SJMA 5I6PA 1PMYA 1SHXA 2XVBA 3WKPA 2XXFA 4PCYA 1A65A 3PLYA 3DIVA 3NJLA 1KV7A 5TK2A 1ET8A 4L0PB 4AKQA 3FSAA 2VW7A 4DP6X 4E9VA 1KCBA 1ASOA 4E9RA 2UXVA 2BWIA 2EILB 1NIFA 1ASPA 3IE9A 3QJVB 3UACA 1AACA 2BP8A 2XWZA 3UAEA 1PZCA 4BXSV 1L9PA 1HFUA 1I53A 1B3IA 1SHWA 2JXMA 2UXFA 5I6LA 4GYBA 2R7EB 2XXGA 4YSTA 2YAQA 3JTBA 3T9WA 3S8FB 2R7EA 4QKTA 1MDAA 1NPNA 2H3XC 3GDCA 1WA1X 3ZX1A 4KNSA 3X1FA 2VW4A 4BDVA 1OCZB 1UATA 2DV6A 1XB3A 2AFNA 3QPKA 4YL4A 4YSRA 1IBYA 5B1KA 4AI7A 2XX1A 4YSQA 1NINA 1KDJA 1SDDB 2GI0A 1R1CA 1AZUA 4DP2X 1PF3A 3NJGA 4KNTA 2AZAA 1AOZA 5B1AB 5B7MA 1SDDA 2J56A 5I6MA 1M9WA 5A7EA 1NWOA 2MRYA 4A66A 4BWUA 4DP7X 2QT6A 3TA4D 1RCYA 3ZBMA 2CBPA 1JOIA 1RZQA 2FQGA 6PAZA 3FU8A 3FS9A 1ADWA 4QLWA 1PZBA 1V55B 3NJNA 3EH3B 1DZ0A 2CCWA 4BK5C 1IC0A 3CVDA 1TKWA 1ZDQA 2YARA 2AVFA 2GB2A 2HZHA 4A2DA 3WI9A 4HIPA 1AZNA 1SF5A 1GY1A 1L9RA 2VM4A 1AQ8A 3SQRA 4DP8X 1N68A 2XV2A 1WS7A 1OCRB 2W8CA 4YSAA 1ILSA 1PLCA 3AG4B 3MX0B 2PCFA 3C75A 3H4FA 4DP0X 1J5CA 3NT0A 1JZFA 1CUOA 3IN2A 2QDWA 1V54B 3UADA 1ET7A 4M3HA 1WS8A 2RACA 3OMNB 5F7BA 4DP5X 1ZV2A 3IEAA 2XYBA 3JT2A 1AZBA 4AKOA 1CYWA 2PPEA 2DYRB 3FU7A 4YVNA 3NJKA 5B7FA 4A2EA 4N4YB 4A68A 1JZEA 2GHZA 3S3CB 2FJSA 2YQBA 1BYOA 2IWEA 5PCYA 4NAJA 2ZOOA 1BEXA 1AIZA 2J55A 2EIJB 2FT7A 1NIBA 2HX9A 3QJRB 3S8GB 2MTAA 1PY0A 4WKXA 1AR1B 2YAEA 1PLAA 1RKRA 3CVBA 4HCIA 2YAPA 3CDZB 2B08A 3WNJA 1GW0A 1AS7A 2VW6A 4W9ZA 1JXGA 3ABGA 3CDZA 3HEIB 2WO3B 3WKQA 1TEGA 3PAUA 2XV0A 2FTAA 3NJHA 2JFCA 2HRHA 2UX7A 3DKHA 1CURA 3ZDWA 4YSCA 3T6XA 1F56A 2A3TA 2DYSB 3ASOB 4G7RB 1JZJA 1JZIA 2BP8B 3BVDB 2BO0A 2WO2B 2FT8A 2PPCA 2LLNA 1A4BA 2UXGA 3AG1B 5I5MA 4Q89A 3DTUB 3AG3B 2W88A 4KO9A 1ZDSA 2JKWA 2ZONA 3KW7A 4YSOA 4E9XA 3GYRA 3KW8A 4P5RA 2IDTA 4FAAB 1NIAA 8PAZA 2PPFA 1KBWA 1PZAA 4BDVB 3X1GA 1RZPA 1L9TA 2Q5BA 2HLEB 4AKPA 3RYMA 2FNWA 2HX8A 2E86A 3FPXA 4G72B 4YSEA 2B3IA 4Q8BA 4CSZA 4DPBX 1MZZA 5I6NA 1HAWA 1NIEA 1XB8A 1L9OA 2CALA 3QQXA 4UANA 3S3BB 1NDTA 1BAWA 1YLBB 3D12B 3PCYA 1BXUA 1QNIA 3OMIB 3T6VA 3UAAA 3T6ZA 4KNUA 2FWLB 2GBAA 3MBWB 3N55A 4KOBA 4DPCX 1MZYA 3ABMB 1J9TA 3FT0A 1JXFA 1ETJA 3QJUB 1OCOB 3WIAA 1AS8A 3EHBB 3X2QB 3T71A 2QDVA 1V10A 2DWSA 1AG6A 1GS8A 1JZHA 4M4RB 5D4IA 1IKOP 5IY5B 4GP5B 3EH4B 3FSVA 4UF7C 2PP8A 4A2FA 1TU2A 5AFAA 3PAZA 3T6WA 2VMJA 4YVUA 1ZIBA 2H5UA 4A2HA 2N0MA 3IN0A 4YSSA 4FA7B 1BQRA 3OD3A 5LDUA 1OE3A 4YSDA 2X88A 1NTDA 4E9SA 3FQYA 1X9UA 1ILUA 4E9QA 2CUAA 4F7KA 2IWFA 4TXVB 3L45A 1M56B 4HHGA 1OV8A 1BXVA 2X87A 4JKNA 1E65A 1AANA 3FU7B 1SF3A 1NPJA 1E67A 5I28A 4JHUA 2XLLA 1DYZA 3PPSA 5D4JA 9PCYA 2BW4A 4GP8B 2YAHA 1ASQA 5AZUA 3X1BA 1AAJA 2OJ1A 1JXDA 1PAZA 1XB6A 2TSAA 2YXVA 3QJQB 1OF0A 1N70A 1PCSA 2IAAC 2PCYA 3V9EA 3NSYA 3ABLB 2DY2A 3BQVA 4E9TA 3AY2A 1WAEA 2PLTA 3SBPA 2GC4C 2BP0A 1WA2X 3OQRA 1J9QA 1FWXA 1PNCA 1FA4A 3OM3B 5I6KA 2CAKA 1NZRA 3PAVA 4DP9X 3CZUB 1A3ZA 1W8EA 2XV3A 1CC3A 1XMEB 1KBVA 1HAUA 1A4CA 1AS6A 2WSDA 2HXAA 4X4KA 3GXUB 3SBQA 4E9WA 3CG8A 2XX0A 2UXTA 3QJSB 2BZ7A 2UX6A 2YAMA 4NERA 3TBCA 5F7AA 1ZPUA 1E5YA 4HCGA 3FU9A 4KO7A 4RH4A 5B1JC 3UGEA 2XUWA 3TASA 2P80A 4BWWA 1GS6X 2BWDA 1OE2A 2P80D 1L9QA 2XU9A 1EZLA 1W6WA 1GY2A 3FQ2A 4GY4A 3TBBA 1JVOA 1JZGA 4A2GA 4E9YA 7PCYA 1JERA 1X9RA 2PP9A 4HHWA 1JVLA 5I5JA 3NP4A 2FQEA 2IH8A 1KYAA 3SBRA 1A8ZA 5EHFA 3G5WA 2YAOA 3TU6A 2GSMB 5PAZA 1ID2A 1WA0X 1NWPA 3NYKA 3NSDA 2NRDA 1J9SA 2J5WA 3NSCA 4GXFA 3QJTB 1SFHA 1KCWA 1A4AA 2J57A 3FYIB 3N2JA 1GR7A 1KGYE 1QLEB 1GYCA 2EINB 2OV0A 1PLBA 2AANA 2I7SA 3FSWA 3X1EA 5D4HA 3ZIYA 2I85A 2IWKA 3AG2B 2PPAA 5B1JA 1J5DA 2FQDA 4G7SB 1CYXA 2VM3A 3PXLA 4BWTA 1GSKA 5B7EA 3UABA 3OMAB 5I6OA 2HX7A 3IBOA 1T5KA 1IUZA 1PNDA 2TSBA 2H47C 2IH9A 4WTQA 3S3DB 2Y1AA 4GP4B 2IDSA 3NSFA 2QPDB 5ANHA 4G70B 3ERXA 2VSMB 3AZUA 2YXWA 1W6LA 2FQFA 5TK4A 3WG7B 4NB7A 5B3SB 2BHFA 2ZXWB 1J9RA 4YSUA 3ASNB 1OOWA 2EIMB 3WNIA 4DP1X 1L9SA 2Y69B 2EIKB 1BXAA 4W1TA 4CSPA 4ZK8A 3ABKB 3FYEB 2BZCA
chains in the Genus database with same CATH superfamily
5CKAA 5ALBL 4F2ME 1MFCL 4FKKA 2IALB 1WZLA 3V5DA 4UZSA 4W93A 3A6OA 1T1WB 2UWEF 4Z5RA 2AJSH 3LKSA 4ZFZA 4R4FH 3MRKB 2BDNH 4GB9A 2CNYA 1Z3GL 4KXDA 3RBSA 2MQCA 3D30A 3L1FA 3NACH 1CCZA 2EDTA 2Q87A 3GTVA 1VKXA 2FSEA 2OXGA 1V27A 2F54A 4L4TE 4FN0A 1T7WA 4D3CH 3HR6A 5DYOB 3BP7A 1A66A 3BT0A 3VRLE 2OSXA 5ERWA 3VMOA 1ODUA 1KGWA 3VDCA 3EH5B 4UM9D 1C08A 2WCPA 4KRNA 2MJWA 5FC9A 4X4ZA 3DMMC 5ENWA 4QY8A 1FZJA 1JNHB 5SWZB 4HVBA 2UZYA 1A6TB 4X9YA 6PCYA 3X3FL 5EMYA 1R3IL 1JPTL 2AF2A 4K2UH 1Q4NX 2OCCB 4MJIE 4DCQB 1A4KA 4ENZA 5IR1A 3O4LD 3DVIA 2R69H 2KS0A 1EQWA 3BKYH 5I6XB 1AKJA 1RU9L 2VN3A 4K9JA 1T04A 1PDKA 5CLZA 1SOSA 3TGXA 3O6LL 3U0PA 4OF6A 3BO8B 2X9WA 1ZKAA 3W2DL 3DX9A 2JIXA 3ZL4L 4YDIL 3ULVH 4FQLH 2FHFA 3PYCA 4F7TA 3HW7A 1VZGA 1XR8A 2XZCH 2J1XA 3R06A 2APVA 3B7RL 4JFTA 2ZCLH 2CD0A 4DO5A 4H0LC 5GJTL 4UT6A 2AEQH 4N8PA 4OQ1A 5IB4A 1A4JB 4OUOA 1SGKA 1ZGLM 5BW7A 2XG4B 1PJ9A 4HU2A 1V7NH 3GMNB 4ZMWA 1CD9B 3N1GC 4QRPA 3QJVB 5TE6H 3OKMB 4JREC 2Q6WB 3LKPB 1AXTL 5E95B 2B7DT 3O4OC 4AGMA 5JQ6H 1L9PA 3DROA 2BHUA 4QOKD 3RGVD 3LRKA 1SHWA 1ZE3H 3BVUA 3FQNB 3H2WA 1X3DA 4MQXC 1JMXA 2NY2B 1KTCA 3GIZH 4JVWA 3S37H 1VGKB 1FIGL 4JRXD 4ZQKA 3BWAB 5LNEA 5C0DB 3SDDA 1SYSB 4BYHA 3UAFA 3VD5A 2JCWA 4JG5A 4HZAA 4AH2B 1UADC 4O5LH 1DFBH 3ZSTA 3C8HA 1IAKB 1X5KA 1OP9A 2Y72A 3N0AA 3SE4A 4WSKA 3TV3L 2OMTA 4JQXA 2KT6A 3K81A 4N2CA 4UT7L 3MLTB 3VXPA 4Z76B 1AD0B 1XGQA 4RMRA 1ZS2A 3HHSB 4KNTA 3EZJB 4GRLB 3QQ9D 3IPEA 2ZWZA 4K94L 5GGRY 1YDPA 1I7RB 4M1CC 3IGLA 2BHYA 1LYQA 4YQXH 4JKPH 4NJ9L 3BAIA 5F9WB 2FQGA 4G1MA 4EVNA 5LCVH 5C0IA 5JPNB 3W81A 5FPIA 4K71B 5E5MA 2MCMA 1CYGA 5ICYB 4L3CA 3D0VA 2BOLA 1IC0A 4F91B 3E8UH 3O6FB 5IQ9B 3IXTA 2EDYA 1Z5HA 1N3NA 4LRNL 3LZFH 4FTVB 1GGTA 3MOAL 1AZNA 1IAMA 1SZNA 3CHOA 1S7WB 2R1YA 2WLZA 1MJ8L 4BK8A 3WEXA 1H5BB 1F45A 1QW9A 3KPSD 4KZ0A 5KZCD 5E1QA 1PLCA 5DEZA 3BP6A 2JCCB 1D2OA 2GFBB 2ZXAA 3GS0A 4XNXL 4Y5VC 2WTRB 4AQEA 1YJDC 1QQDA 1XBRA 3MJWA 1CICD 3BAXA 1MHPH 3TJEL 3C5ZB 4JHZA 2CHWA 1MH5B 1AZBA 3APFA 3C2AL 3L54A 5DWUH 4KRPD 1OAQH 3RUGE 3M1BA 5L0QC 2ADYA 5T3XL 2D4DA 3ULUD 3CFCL 2VMDA 2DYRB 4HZLB 1RZJL 3RVXD 4Y9GA 1CLZH 5LBSH 1I8AA 1NAKL 1EFXA 1IGMH 2Y23A 4JAMA 4EMZA 1BYOA 1ORQB 3CH8A 5PCYA 3EFFA 3UIYA 3WENA 4JUSA 5D5ME 5FV2A 1KJ2A 2BY0A 2X4UB 3NAAL 2CO7A 1DVTA 2HX9A 1G5AA 1NAMB 4KK9D 4NUPA 3TFKD 2MNJB 4Y4KC 5SWZD 4D9LH 1SN0A 1T6BX 4Y4HB 2YAEA 2PKDA 5AZ2L 1AJ7L 3MSPA 1E5UI 4JFYA 4M4PA 5K1VA 5SWSE 4MCYB 2Y1YA 4OLXH 1ZEAH 1S7SB 3CQQA 3U0WL 1ZRUA 3HI6L 5GGRB 4L2YA 9CGTA 3HFMH 4GS7B 1P2CB 1DQJB 3BGMB 4Z95H 1QLEL 4MB4A 4JY5H 3AFLA 4HBQA 4AIEA 3E0GA 1DVSA 1OM3H 5T1DH 1ZGLP 4JKLA 2HPTA 4P5TC 2VDML 3EUUA 3ZMEA 1NDMA 2DQMA 3WE1A 3VFUA 1OP5K 1FJ1A 3FMGL 3SDXA 1ZDSA 2WYIA 2ZX7A 1UCBL 4YEFA 5EOQL 4BHUA 4N6QA 1LEGB 4PJEE 3Q13A 4KUCD 1FBIH 3DX6B 1BQLL 1NIAA 1FGVL 4EXKA 5KTEH 2Q7AA 3U30C 1QSFB 1G7IA 2B77A 2DH2A 4KFZC 4UTBL 5DK0B 5A3IC 1L9TA 1NC4D 4X0KB 2NY2D 3RIAF 4C4BA 1INQA 1WK0A 2WXMA 1EAJA 3QJOA 4A04A 1CE1H 2KYIA 3FUMA 4X5XB 4X98A 1MNUH 3MODL 2HKFH 3DI3B 1UZ8B 2MPVA 1WFOA 2ZPKL 4F7MB 1M7DA 4GMTH 1MFDL 2XN9B 3VE0A 1GRWA 4M48L 3FAWA 1NCJA 3ROLA 1HILA 2IBGA 2R1WA 3C6LA 3HIZA 2RAMA 4KDVA 4IJ3B 4ZT1A 2NMSA 2E7BA 2DDQH 3RB5A 2WQWA 1QUPA 1DANU 5E8EA 3MBWB 3IDMA 3SE9L 3HG4A 1G9MC 1V3KA 3FZUD 1WSST 5J06A 4HLEA 4HJSA 1K2DB 2QHRL 3WY4A 4LNRB 1XT5A 2XRAH 3BXNA 4P2RA 5JR1L 1Q0YL 2IGLA 3WMSA 1NPUA 3TVMC 4XNZB 3T71A 4ELDA 3R19A 4I2XB 2EC9T 2ESVA 4P23C 5CUSH 4AVKA 1Z66A 1BJMA 3MV8E 2RCSL 4URKA 4TM9A 1QRND 1K9TA 2EYRA 1O6SB 1PTZA 4PJ7F 5LGHL 2VDQH 4MA7H 1QZ1A 5I8OL 5HPOA 3BDYL 1KXTA 3CH1A 1U3HC 3EO0B 5E4AA 4NZ8A 1VFMA 3K5RA 3VAEA 4TPRL 4A2HA 2ED7A 1HL4A 4RISH 5F21B 1SXCA 4WFGD 1U8OA 4I48B 3F7RA 5LDUA 5DA0B 3KXFA 3DA0A 1VFAB 2IWGA 3G6JA 3PV6A 1Y6MR 3D0LB 2OYLA 2DYPB 1OK8A 1CGSH 4AYFA 1LM8V 4FFYL 2IV8A 1D5BB 2BIQA 2PO6A 3AACA 1LP9A 3SJVE 2IH1B 3I9AA 5CM1A 2Q76B 3JWDL 4JFSA 1WICA 4OM0H 4Y16C 3V6OC 9PCYA 5F7UA 4N0RA 4DZ8A 5IHWA 1NBCA 2OJ1A 1XB6A 4LAQH 5CJQH 5B4MC 1SOKA 5AALA 1BF5A 2B15A 3HMWL 1HEJC 4OLEA 2P5EB 5H94B 2NY7H 4LCWB 1UA6L 4JPVH 3JWNC 4E9TA 1WAEA 1P6AB 1QVOB 2X53A 4GQZA 4M8RA 2ZF8A 4GW1A 2DLFH 3QDMB 1MY5A 3WFZA 4XHJC 1IBGH 1ONQA 4U3SA 4QHNA 5I1CL 3F6IA 5D1QD 4Y4HD 1TTRA 3GLDA 3QYMA 3HBPA 1U6AL 3CQPA 4YZFF 5KBPA 5LG1A 3CZUB 2R0WH 4UQ2A 4EQ3A 3WJLA 1USZA 3HUJF 4N2KA 3O3UN 5KSVB 1JSYA 2WSDA 4NQED 4GRWF 3SKJH 4NRYB 4X80L 1YYCA 5EU3A 2QKIB 3L5XL 1QAWA 2JJTA 4XXCC 2W59A 4BSVA 4XP9H 4H8WH 4BQBA 2R9HC 4I77L 4I3SL 3JV4B 5FHBH 3UPRB 4PJDB 4I89A 1PKQA 3CLEL 1BQHG 1MFMA 1E5BA 1WEJH 4U6XA 1JZ4A 1QKZL 4LLAA 1S7QA 5AL8A 4DK6A 3B9KD 2X3CA 3BUYB 4P5KB 4MZ2A 1I3GH 3EYFA 1PZ3A 3JWOC 4BRJA 5ID1B 3APNA 4E9YA 5LXGH 1KPRB 4QRSA 2WB1A 5J13C 1JVLA 4X5RA 1ZHNA 2LT9A 3IDGA 4ONFL 4RMUA 1DVXA 2IQAB 4Y19A 2OA9A 4AV4A 4MS6A 5F7EH 5BJTB 4S1DD 1VCAA 1XH0A 4KK8D 1QTSA 4MSWB 1DQVA 1SXBA 1DE4A 1ID2A 1DBKH 2C34A 3W0WB 3NSDA 5MHSE 2P43B 4XXDA 1JPGA 3AXIA 4PRHE 2J5WA 1J8HB 3UYPB 2XN9D 1SFHA 3FH8A 5I8EA 3IAGC 2JQMA 4MCZA 3PUUA 2QLYA 3ETBJ 4P0DA 3FYIB 4CU8A 4UILL 2CR0A 5I1IH 1VF5C 2BNQE 3ZIYA 5KVGH 1C7SA 2J1WA 5FYKE 3D4CA 4Y7OC 4ZAKA 3D05A 1YN7A 3IDJB 4KQ3H 4OAWA 5F7DB 2C9VA 1BFVL 2W0FB 4BZ1A 1K72A 3OAZK 3LN4B 2FYYA 4JQIA 3D2UD 3SE3A 1FZMB 5ALCL 4UIKL 5LAXA 4E41A 4HOXA 4ZFOL 2OMZB 3GSOB 3IJ8A 4O9HH 4WUKH 4ETQA 2P8LB 2WP3T 5D1ZI 1E0OB 4PTUB 5DUMH 3NSFA 3RWDA 1ACCA 5IIEB 4HAFA 3JV6A 1JGLH 2XG5A 1JXKA 1S3KH 2W0PA 4L48A 2A6KB 1N0XH 1U2CA 3FTSA 2OTWB 2Q2EB 3HS0B 4TOYL 2EXTA 1Q90A 5TDPA 2XDHA 1DZBA 4PGCB 2VQ4A 4Q6IC 4XRCB 4FFVD 5DJZB 2OL3A 3IB4A 1J0HA 2HT2C 3VD9A 4NQDB 1F11B 2YOAA 2CLZB 5A2CA 1A6VH 3MUGA 5FK9B 4AYMC 4ODTL 2DYPD 2N56A 2JJUA 3EOBA 4OKVA 4MHHI 3P9LB 3WDJA 5H37H 3TPUB 1QASA 2JJTC 4M1DL 2NZ9C 4NCC2 3AREA 1ET5A 2WOBA 5D71L 3MJ9H 1J1OL 4BXVA 3RRQA 4TUUA 3N42F 2SEBB 1NGXA 2CUIA 3ULSB 4N8UA 2HRPH 3BW9A 4MFHA 1PIFA 4IK7A 2NQ3A 1F90L 3VI3B 3ZUCA 5JQIB 1F6AA 1R4XA 4PLNC 2HSIA 3P0YL 2FJHA 1T66D 2P5ED 5TGBA 1FNSL 2VRAA 3FB8B 1QEWA 1W8OA 5ITBL 1OP3H 4OLYH 5F72S 4POZC 3MOQA 2DLIA 2VDKB 4IGBD 4RWYL 1RJYA 1EO5A 2X4NB 5I26A 2DQEH 3TN0D 4UNIA 4D8PA 2V7NB 3RFZB 3T2LA 2NXZB 1UT2A 3LH2L 3K80A 2A77L 3KH4A 4HS3B 3N1FC 2P28B 4O2CB 1KC5H 4DPAX 1QFHA 3VFTB 4KZEH 3IGFA 4RAHA 3U25A 3BOVA 3W37A 2O5ZL 1WO2A 4UINL 4J3OD 5I6PA 3G7TA 3TIDB 5BUGA 2UY6A 3BZFA 1RPKA 4IBVA 5JXAH 3M7OA 4FNRA 3EUDA 5GZNC 1JPSL 2KI6A 4PUBL 1UWFA 3BD5A 2B1OA 3SE3C 4AXWA 2ZD0A 2ICEB 3SKMA 5J6GA 3DX1A 4LCYA 1M71A 2WUCH 1EHNA 1O6TA 2B59A 2FIKB 2FSDA 2P8MA 4NEHB 1TO5A 2MTPA 1Y07A 2H2SC 1T83A 1URLA 4F27A 4JDZB 2UUDK 4GSQA 3FCUB 3S0PA 2JXMA 3IKCA 4XAKD 3LEXA 4KHTH 4QXTA 2ZYIA 3FUHA 3LDBC 4MD5B 1XQ4A 4RAVA 1VENA 5EUOA 1OTSC 5DEGA 5HTSA 3DX7B 4TMPA 5EDXA 3S96A 5FGBA 3VQMA 4A6YH 4R84A 2Z0UA 4L4TA 1B4TA 4LEEA 2D31B 4MXWH 4UV7H 2OMXA 1P4IH 4ENED 3RZCA 1ETB1 3L2NA 2UZIL 4OJFH 5CHNA 2DQDL 2APSA 1OT2A 1WH0A 1XR9A 3FT2B 4FJYA 3OHXA 3LNHA 4P2OD 2Y07L 1G7JA 3W9EB 4G6KL 5IB2B 5L6YH 2UVFA 3NZ8A 1T21B 1IEBA 3CJJA 3OKLB 4W68A 1XBDA 3GMLB 3TNMA 1I8UA 1MWAH 4GI6A 4OD3L 5DEFB 3RILA 3ATFA 1QG3A 1IAOA 4FQIL 4R96B 5AG9A 5MP6L 4NUGL 1UFUA 5EIQA 3TCTA 3FU8A 3RWCB 2QEJA 3DHUA 4JM2A 2BIIA 4BBWA 3LXCA 1HEHC 4QMEA 4ZUVA 2D0HA 2IAMC 1WGOA 1OAJA 2GB2A 3PQYD 4WLCA 1GPOH 5A2AA 3WNMA 2EXYD 3O8XC 3RNKA 2XQ0A 3ZMNA 4NQDD 1EJOH 4JN2A 3MPCA 4TQEL 1BZ7B 3TXAA 1UWGH 1XIWB 4LHUD 1OB1B 4RDQG 2PCFB 4RAUA 3SQRA 1OCRB 1SRDA 5IFJA 2VH5L 1KPVA 3NIGF 2WXIA 1S7VA 2DI8A 1MF2H 4M61A 5FYLE 1M05B 4H8VA 3ZW3A 4BELD 5JHAA 4N2NA 3IU3A 1FPTH 1V54B 2B2XL 2ZX6A 3N91A 4KKAD 1INDL 2GKIA 2YUXA 3CGTA 2OZ4A 1NANH 1I7ZA 1OKEA 3B6SB 3RVWD 3LHPL 5D2NC 5F7FA 3RE0A 5HDQL 5I18L 2CO1A 2COVD 5CSZA 5HYSB 3A23A 3H3BC 4JO5A 4ZOBA 1E9PA 3MCLL 2GTQA 5ICZA 5JZ7C 5D6DA 5DMJB 4YN3A 4NQQA 3IFOA 5HVFB 2EDKA 1Q9LA 2Y4SA 3ZGIA 5I0ZA 3WJMB 1ML0A 4L8BB 4ODHH 4NM8L 3TA3B 3RWEA 3UDWA 4JO4L 4KJQD 3B2PA 3L4VA 3QG6B 2DQCL 2IBZY 1X7SA 1V7ML 3DV6A 5C70A 2G30A 2WCSA 5DJ6B 4ZX6A 3NTCL 2WSPA 1DVQA 1ZLWK 2AJXH 4U0RC 1J48A 1AS7A 4C4KT 1FE8L 1SPDA 4XTRC 3RZCC 4N0FA 5BRZE 2XV0A 4GFXA 4KKRA 3ZE1F 1OVZA 1W72L 1P1ZB 2GK0A 2R2BA 3HMXA 4DGIH 4Z3HA 1JNNH 2XPZA 1JGEA 4AC4A 5BRPA 3ETTA 2DYSB 4RZCA 1DQQA 1MUJA 5LN8A 1TCMA 2VDNH 4AYID 1XGPB 2COQA 1G6VK 3C60D 3MRPA 2PPCA 4OF8A 4TTGA 1E4WL 1EJ8A 4OJDH 3WXWH 3SDYL 4RMVA 3UTSA 2D7PA 3WUWB 5FA3A 3AG3B 3CHXA 2NY5L 1TITA 2N3JA 4U1JB 4G9FB 4JBSA 3KW7A 2H1LM 1A3LL 1OW0A 1T89A 4M02A 1CF1A 2VZTA 2WBJA 3S36H 5HYQA 4WTWA 5IKCB 1K5WA 1KGUA 1P5VB 2CJUH 2JMRA 1IT9H 2XHNA 3PDGA 3TC9A 4N5ED 2WXNA 4P2QB 3I75A 1GHFH 1LO5B 3PL6D 1MRFL 3F84A 3JVGA 4G9DA 4HV8B 2F53E 4HGWA 4P5MA 5AAWC 5IHUH 1SLXA 1I3RA 1DUYA 1B0GA 1IKNC 2B9BA 3MV11 1T0MA 4K7FB 4S1SL 5HGAB 1P7KA 2AJZA 3KBEA 4WY7H 5I6NA 4YHIB 2PYED 1CFNA 2X2IA 3SQOH 5EBMB 1DL7L 4NC1C 3TT3H 3H54A 5EZLA 3FH7A 1EJ6A 1BXUA 1QNIA 1BZ8A 3FN0L 3OMIB 3UAAA 3ZKMC 3EBAA 2NNFA 3K91A 1E7VA 1ZHLB 1MHCB 1UWXH 3ZO9A 1YN6A 1J9TA 2ZXGA 4OIFA 4I1NB 2HH0H 2ATKB 2AXGA 2O6CA 1I1AB 1NFDB 3S35L 5GS0C 3LKOB 4PRDA 3WIAA 2X4TA 1QOKA 3ECVA 5C0CE 4LNVA 3MLPA 5SWSA 4ABVA 2VLLA 2GIXA 3VXNA 3CFKB 1TEYA 2M83A 1IKOP 4LEXL 4K3EL 4PGZA 2CPCA 3UZQA 2NNXA 5CN2A 4X6CE 2DMHA 2ENJA 3L3HA 4GQ9H 5IBLC 3T6WA 3MGTB 3ZT7A 1P6WA 2VZ3A 4LU5L 2AV1A 3KJ4B 5JOFB 4LLDB 4U49A 3IN0A 4EKXA 4LGPB 2D3NA 4MMYA 1R3KB 1YY9D 1AO7D 5E8NA 1P4BL 1T4KB 3JYCA 2ZJSL 1KTRL 2EXWC 5DHDA 1HESA 2ZOLB 4ACPA 1B0RA 3ZVVA 2F8VA 4W6YB 1MLBA 1BOGA 4P46A 1MCCA 2IWFA 4X6DB 1HHHA 4AQZA 1EUUA 1R46A 4HXAH 4O02B 5HVGB 1U8PB 4HDIA 4Z7UB 4G6ML 3K8MA 1YNTF 2XLLA 1UB5A 2KC0A 2BY1A 4XC3H 4WK0B 2VISB 4HOMA 3JZYA 2AMGA 3HPLA 1JXDA 2F15A 4JPWL 2OMWB 3CN3A 3CZJA 1OW0C 3PWUA 2VXQA 4YDLB 1N70A 1T89C 2X9YA 3WHE1 3TF7C 5I0WA 1IQDB 3ABLB 3IFLL 3BPNB 2AQNA 3BT2H 3RY6C 3O2VL 1P4LA 2BVEA 4AL8C 5ISZB 3AY2A 2P42B 3L3KA 2VDPB 3RL1A 5CD3A 5GQBA 4NWUH 1N5AA 1I8KB 2AQQA 3RAJL 4YXHH 3NZUA 4NZTH 2CGRH 3KLQA 5JORB 3MRMB 4YXLL 1RIHL 4PJGA 5GGVL 3VI4B 4TUOB 2N1TE 1DJHA 3K2IA 3HAEA 4J3OH 3D39D 3QP3A 4JM0A 4BA8A 1CVRA 3BIKB 4HKXB 4HWBA 4MNQA 4BFFA 3STBA 3FB6A 4JR9H 2XX0A 3LEYH 5ID0B 3MV8A 3QXAB 3KGTA 3QJSB 3WKNA 2XWCA 3A22A 3B1UA 4JFPA 3TO4B 3KM1A 4N9OB 5C0BE 1Z9SB 5AVVB 3DWTA 2OR8A 3QUYB 2YIHA 1MCRA 1OK0A 1A3RL 2ORBL 2JB5H 4QHKJ 2BVOB 1LMKA 2G2RA 3CFDA 1KLFA 3EZ8A 4KKNA 3RX5A 2DMCA 1K4CB 5E8PA 1DSFL 1BFOA 1H19A 1S4IA 3MV9D 5KYWA 1FVCA 2XU9A 5CN3A 3O2DL 2VDLH 1O5PA 4XPFH 1QP1A 3EYQC 2VLRB 3QEQE 1GJIA 1WCQA 3LS4L 3V5HA 2WIMA 3B9AA 2A7BA 2R0KL 4RSVA 4LCCA 3NFSL 3SCMB 3SSGA 2FQEA 3FUEA 4KBPA 4WKZA 1KYAA 3AB0B 3SJVA 2VLJB 2YUVA 2Z1KA 2H0JA 5I1EL 2X40A 4WO4A 1FHGA 2VQ1A 5SX5H 4AWJC 1IAIH 3MREB 5D7IB 3STLA 3GO1H 2NYYC 4HH9B 4TLKA 3AMLA 3Q8FA 2X4RA 4PLKD 4CW1A 2IAND 3QIUB 2Z1PA 2YPVL 4JO2L 4TNWK 4JFXA 4Z7WB 3O9WB 5D72H 1MI5B 3D9AL 5TD4A 3Q2WA 2G5BB 2HFFA 4AOFA 3RKPA 1T20B 3EOAA 4MNGA 1OGAD 1WLHA 4AE1A 5CEZD 3WLWD 1E8YA 3NABL 1X5JA 1UGKA 3P54A 1DR9A 1IUZA 1ADQH 1AY1H 2GYSA 2ZUWA 5FYJH 3ZTCC 5DJ8A 2X0VA 4MA1B 1YY8A 3NFPA 5F89A 3IJSA 2C9PA 4FEIA 3Q2VA 2ZXWB 3E80A 2WTPA 1E9OB 1HZHL 1SBSL 2HT4C 4OZFH 2VXSL 5C0NC 4EN3D 1OOWA 2ZYHA 5IFAH 3BH8A 4X8JA 1W0WB 5DUBA 5F1NA 4QLRA 5IOPA 3B56A 4NUJB 3QPXL 3QNZA 1S9YA 3BVNB 4R5XA 3V5DB 4OF7A 1MAMH 1URIA 1NEZG 5D7JA 3LKSB 4ZFZB 4R7NA 3AVEA 4X7DC 2C9QA 1T0OA 1PGRB 3WUWA 3QORB 3HPJA 3QZWA 4OZHA 3CSGA 1WZ1L 1JXJA 1MCQA 4GINA 4KJYA 5JMRA 3PABA 1VKXB 2FSEB 4QRFA 1BQKA 3ARWA 3QVAA 4OH2A 2IDFA 1QUNB 4KXZH 2WWNA 4OM1H 4XXWC 3QHFL 3PREA 3S34L 1WDAA 3NIDE 1U0QA 5BVPL 3MTXA 4PRIA 1TJMA 1IU1A 5JW4Q 3QUZB 4PRHA 2Z8SA 4HJIA 1C08B 1G4RA 1O7SA 1AG0A 4BE5A 4EIBA 3DUUB 2R8SL 2V5RA 5I5IA 3KPRD 3I6KA 1QFWH 3TBYA 4B9JA 1UD6A 2BNQA 2UZYB 4J7RA 4APQC 3S5YA 5KBKA 4P2YA 4OGXH 4PJ5D 3H4HA 5IR1B 4LQFH 2GJ6A 4B5ZA 2VAJA 4PVNA 4TULH 4HZ1A 1ULVA 4KOCA 4FHJA 4DP4X 1PDKB 4H26A 3QUMA 3RVTD 2R29L 3U0PB 5DZJA 2ZOTA 1YEDA 5EEZA 3DX9B 2JIXB 2YMXL 4HFUH 1HU8A 4F7TB 2CDFA 1XR8B 1KLUA 3C08L 3R06B 1O9WA 4YHOL 4PRNA 3F58L 5L9DL 3MLXH 1CDYA 5E08H 2VSCA 1G1CA 1P7QB 4JKMA 3GBMH 5IB4B 5T1LA 2VW7A 4YDKH 4XPAH 2AXWA 2EVHA 3CDGA 5ECGA 2PN5A 5IMKA 1KCBA 3T2OA 2AJVL 2YD1A 4QRPB 1NIFA 1WAPA 3EFDL 1J12A 4JFZH 2ZKHH 4XGZA 4NQCE 1ZA6A 3CHRA 3DROB 3MRNB 3NCYP 3S2CA 4P3WA 2DI9A 4QT5A 2LLLA 2LU3A 1I53A 3FK3A 3IPBA 4FZ8L 4K7PL 1Z2KA 3E1ZA 3DMMD 3QWQB 5C09D 5GRVL 3Q8BA 4ZQKB 2R7EA 1J87A 3SDDB 2Y9RT 1HT6A 3M07A 3MV7B 2EYTA 4DEWA 1UM6L 1S5IH 4NI3A 4HEPA 1E42A 1F6LL 2WXFA 3X1FA 1OARL 3B2UD 5DC4B 2OMTB 2A1WH 5CIPH 3VXPB 3OX8B 3QIUD 5EU7E 2E8YA 4PLJD 5F6HI 4G8AC 1I9RH 6TAAA 2X12A 2AJ3B 2XZQL 2YGNA 2OR9H 1M7IB 5G4OA 1YDPB 1PF3A 2BVPA 3CIAA 1MCPH 4ZOAA 4JZJA 4GW4A 2WNWA 3VYNA 5HHMD 5DD1L 4JANA 3FT3B 3CX5J 1BD2A 4EVNB 5C0IB 4BCZA 3F01A 5TQ0H 5JA8B 2VDQB 3NZHH 4L3CB 3FS9A 3DGCR 5EEXA 3MXVL 1ACYL 5JHDA 3NJNA 3EH3B 4FMKA 4LSQL 5C2BH 3IXTB 2RH0A 3MLZH 3CWGA 3DPDA 3CVDA 1J5HA 4WFED 2YARA 4S0SD 3LKRA 5CAYB 3J07A 3EH1A 2R1YB 4DO4A 4ETYA 5GS1A 2FWSA 1D5XA 1RJCA 4B9YA 4J6IA 3TBTB 4RRPG 5DJXA 1JHLL 4HFWB 2CSPA 4WHCA 3BP6B 3VMPA 3MOBH 4XAWL 4NM4H 1EJFA 2FO4A 1F6FB 3PGFL 5I30H 1QSEE 1RUQH 3VGAB 1CFMA 4K5OA 4AQEB 3K2UL 3SQBA 1JZFA 4R83A 4L4VE 1RIUL 3UAJC 1QQDB 2E4TA 4R8WL 4YHMH 2CHNA 2GHWB 2EE3A 4N2LA 5JOEA 2OYPA 5FCSH 1KJVB 1TMCB 2HYMA 3MMEA 1E3ZA 4YLBA 1YAZA 1IFGA 3IMVA 4CNIA 5J1TC 3LEVH 2W9LA 4M1CD 1NMBL 2X4OA 2F54D 1MXDA 3M1BB 4L3FA 3T3MB 2ZSWB 2QMKA 2VN5A 5HJ3B 5LB1A 4NQSB 1EFXB 2G3NA 3CIQA 5HJGA 4M93C 5D55A 1BJ1H 3EFFB 2G2PA 5IEKB 1NFIA 2VLMD 3KGRA 1KJ2B 1CDBA 2QQLL 1RULL 4NZRH 2IWEA 1O5DT 4LLWA 1Q9OA 5DK2A 3GB7A 3GRBA 2J55A 2NUTA 2QV4A 2DM2A 2R4RL 5TE7L 1FNGB 3EO9H 5IROC 3MUHL 4N8CH 5FW8A 1KGCE 4N0YL 3CVBA 1KCRH 2H3KA 3DJSA 1AKJD 2VZSA 4OI7A 5AQ0A 1FLRL 5IK3A 1A21A 1UWEL 3ABGA 1SUHA 3MRBB 3IKKA 4MMXA 1KTJA 5DMGC 2HRHA 5C3IA 3UTQA 2Q0ZX 3O11A 3GSXA 1RL1A 1U2HA 2ZCZA 3ZYOA 3F7VA 3K6NA 3JSSA 3M88A 1J8RA 3MRDA 4G7RB 1JZIA 1GGCH 3QEGL 1NDMB 3CTTA 4PS8A 4TS6A 4ODXA 2FLRT 3VFUB 1FJ1B 1YNKL 3F12A 4QRPD 4OGZA 2AEOA 2X2JA 3SDXB 5FM4A 3V52H 2BERA 4R7XA 2OKMA 2GEQA 3OGCA 4ZO7A 1DBJL 2H7WA 2W88A 5BQ7B 2DN7A 3GYRA 1D6VH 4QHLA 5AW0B 4PIBA 1G7IB 4U1MA 3QUGA 15C8L 1U8NA 3ARGC 5C08B 1TG8A 5DD3H 1INQB 1GGIH 2K45A 2ZOKB 3BCDA 4X98B 3SDDD 3V9FA 1UZGA 4C47A 2FWOA 4U1KA 1SVZA 4JFQA 3N44F 3VE0B 2Y5QA 1I1YA 1Z0MA 4FQXA 5E94A 3ROLB 1XB8A 2R1WB 3C6LB 2CK0H 1QTYT 4X50A 1OT1A 4W81A 4JDEA 4ZX4A 5E8EB 3IDMB 3QNYA 5ICXB 2ZWSA 5C1MB 1IC7H 2PR4H 4ZFGL 1Y1UA 1U3NA 4P5TD 3RUGF 1G84A 3BXNB 4P2RB 1E6OL 2Y5TA 2Z7UA 1QBML 3VXRB 4X7SH 2QADD 3CFNA 5IW6A 4UZGA 4WU7A 2ESVB 2RBLA 2DWDB 2E4FA 4HJJL 1ZSDA 4XP4H 4BUHA 1T7VA 1IKFH 3ARTA 5EFIA 3U1QA 5D5MF 3SEPA 1U8JA 1N5YH 3OXRA 5J9PA 3CH1B 1KXTB 4A2FA 5BRZA 3FHQA 1TQUA 5A3ID 4GKNA 1TQWA 1Z9NA 2G9HA 4QYAA 3H7LA 3PAZA 1A7RH 4M7LL 2GSIA 3OAUH 1TQBB 1UJTA 2ZWKA 3HZKA 4MXVE 2H5UA 2YRLA 4H8PA 2ZKXA 3G6JB 1BQRA 4NJAL 2GT9B 4PJ9C 3AAZA 3PV6B 1LO0L 4LARL 4PJ8C 4TRPH 3UJIL 2N7BA 4XBEH 2IPKA 1E3XA 4AYFB 1JDCA 2NY4C 3MA9L 4ANKA 1KBPA 1RLBA 1YQVH 4FXGC 2PO6B 1OAZH 5F1OB 1HWWA 1LP9B 4TXVB 5F9AC 4UNVA 2DS4A 4JG0H 3V0WH 3VGBA 4JHUA 4LL1A 4MCMA 2X2UA 4QI3A 1SJHB 3PPSA 4DZ8B 1SXNA 2BP3A 4LGRB 1WG3A 4PJEF 1SLWA 2ZG3A 3ESOA 4FQQA 4PY8I 2F53A 1E6JH 2WN2A 4UQIM 5AZUA 3TJHC 4BQ8A 1I8LA 1T2JA 3LHAA 4GRWH 5HYEA 3FFCD 3GI9L 3ALWA 2IAAC 5C0RL 3UGXA 4FG4A 1WT5A 3V6ZA 5M95B 2WQUA 1BGXH 2ZE0A 3KLLA 3MV01 4GW1B 4BUGA 4BD4A 5K59F 1U3HD 1AZVA 1SJVA 4QHNB 1YEIH 4UUJA 3FQTA 1FP5A 1R5IB 4UQ2B 3L9EA 3IXAA 4CU6A 5AWNH 4EIGB 3T8XA 4L5FE 5DFVC 4LEBA 4MRCA 4DK3A 3JUZA 1DVFB 5E2TL 5C0CA 4LSRL 4NNPL 5AW3B 4BSVB 4NNYB 1YUHA 4C8XA 3HBGA 2DQTH 5IHBA 5E6IA 2A6DA 2VE6B 4X6CA 4OZ4A 3T0DA 1CFSA 4XNBA 4Z9KB 1MFEH 3A4DA 5CZRA 4Y2DA 2M1KA 2DTSA 1S7QB 2K6WA 4MA8H 2XFGB 2D3VA 3WYRA 3KYMA 3EYFB 4L2LA 4ZUTA 5D1ZA 4C83A 3LQAC 1T7ZA 4QF1A 1EZLA 1BJ1J 1GY2A 2RQEA 3MNWA 4GY4A 1ZHNB 3DYMA 1DO6A 3IDGB 1WBZA 4IMLA 3SBWA 3I85A 4ALAC 2PP9A 4DQAA 3LN5B 3NIFE 4M3JA 1DE4B 3ZKXB 4FNQA 4XXDB 1J10A 1JPGB 1A6ZA 1D5ZB 3NEXA 1Q1JH 2PF6A 1S46A 4PV9A 3WN5C 3EJUA 5K69A 5D7LB 5I8EB 4JFFE 1C1EH 3C6LD 3U2SB 1OQXA 1J0JA 3OR7A 1UH3A 4O00A 3U2JA 1I7UA 2R9HD 3LD8C 4ZAKB 1YN7B 4PJIB 1AP2A 3GRGA 3LS5L 2AJSL 1TMQA 3QIBB 4R4FL 5BVJB 1FH5H 2FYYB 12E8H 1J5DA 3QJFB 1FH2A 5LAXB 4E41B 2KKQA 5I1AA 5D7HA 1WQVT 1KJMB 4KMLB 2ESVD 3GI8L 5I6OA 1CPUA 4TV3A 4ZFFA 3L08A 2DQUH 3RWDB 5AD0A 4R97C 4YX2L 3JV6B 3D3VB 3S3DB 2XG5B 4UYQA 4GP4B 3ALPA 3F2LA 4D3CL 4Z3JA 2C4FT 1JP5A 5KSAA 1UT9A 5EN3A 3COOA 3AZUA 4Y88A 4P9ML 2OL3B 4NX0A 5KBMA 4QYOA 1WCBB 3VCLA 3MUGB 1BOYA 3KXFD 1RFDH 4U0QB 5C0BA 3ASNB 3L3OA 3UYOD 3EOBB 2E47A 1JGVH 5DRNB 5BV7L 3E6FB 2EC8A 4OKVB 1U8QA 4HS6A 4UMGA 2CDGB 2NR6C 1UYWH 1VADA 1IGFH 2AQRA 3KVDD 3AREB 2B4CL 3AM8A 4NO2A 3R4DA 4IBTA 4R6UA 2VLKE 3QEQA 4Y4FA 3GK8H 5HDRA 2FLBT 1KG0A 1GGUA 1NGXB 2AI0H 5DXWA 1KEGH 4OZGE 4XZ4A 4FQLL 4DZBA 4UB0H 1ZJAA 4IS6B 1F6AB 3FPYA 1YNLL 2ZCLL 3QJZA 3RDJA 1MG2C 4G7VL 4MVBC 2FJHB 4L8CB 3Q5TA 5TJWK 3K7UA 2AEQL 2WCGA 4M8UA 5TGBB 4CADB 3I6SA 1QEWB 2A4EA 1V7NL 3RIKA 1N7MH 2DQHH 5TE6L 3HG2A 2DL2A 5GGTA 5HYJB 5DCCA 2CA4A 2EDJA 5JQ6L 3RX7A 4F57H 3MLRL 2YHGA 3GM0A 4TQIA 4EIZC 4ELKA 2NX5A 2XVGA 2EIZB 3NA9H 3VA2C 2F5AH 5A2BA 4AEEA 5K9JL 3GIZL 3S37L 3CMGA 4JY6A 4EDWL 1YEKL 2VSKB 1HNYA 1ZHKB 1CFTA 1YJDH 2OYMA 4XMKH 1V05A 3ZR6A 3SO3C 1TJIL 1A9EA 3ZE2E 2NZ9D 5JA9A 2V5TA 1DFBL 1KTDB 2UY6B 5I1GH 3VH8A 1HC1A 3BD3A 4XN2A 5KG9A 3ATDA 1SHXA 3AC0A 3LMJH 3T04D 2E5EA 2F08A 4FLRA 2NSXA 4NN6B 4DKTA 3VD4A 3GJEA 4U1HA 4AXWB 5J12C 3H3KA 4Y9FA 5J6GB 4LCYB 4QRRD 4JDVB 2B59B 1BZOA 2P8MB 1LDPL 3W39A 4GQRA 3BISA 1XSOA 4YQXL 4JKPL 3CHSA 4G8IA 3WTVA 3ZZ1A 1AACA 4LHQB 4Z0BH 5FO7B 3IKCB 5JDJA 2X6AA 3LEXB 1MN4A 5D2LE 3G6DL 5LCVL 1D7CA 4POZD 4RAVB 4PJXF 2UXFA 4Y19D 3L1GA 2K7PA 1OO2A 5EUOB 4H44C 3E8UL 3N41F 2JJSA 3I9GL 4X6BB 4UCFA 4LPVA 5I1JL 1FC1A 1IM9D 4UTAH 3S96B 3GDCA 3UZVA 1FFPA 2F1EA 3LZFL 3OAYH 3LQMA 2X05A 5LBGA 5I74C 3DXAE 3Q8CA 5CHNB 5DI8A 5FM8A 3GXMA 4OFPA 4Y1AE 4GG6E 2VERN 3HRZC 4TQHA 3TP4A 3MUUA 4DTGH 1XR9B 3EJZD 4Y4FC 2N7SA 1AD9A 1G7JB 1BPVA 3I6GA 3NZ8B 1IEBB 2XV6B 4P8QA 3O3BB 4KTGA 3TNMB 3WIIH 4PBDA 1IAOB 3INUH 1U41A 1C12B 4BUQA 1RK0A 3KVQA 1MHPL 3ZSSA 2FJGB 3L3GA 1IARB 4U7SA 3ARFA 1ZGLA 3QDGE 4AZ8B 2H2SD 4JM2B 5DWUL 4ZUVB 4MB1A 1E7UA 5D7KE 1S3RA 2QGDA 2Z31A 2ICWJ 2WBKA 1DBBH 2I9LA 1JN6A 1IGML 2DI7A 1G43A 1AE6L 3RNKB 1P6FA 1OTSD 3T4AA 4XN8A 3RWGB 4JN2B 1P69B 4Z7OB 5AB2A 4R4BB 2WNGA 4XPHH 2DIJA 4DVRH 1UWYA 5IFJB 1ED3A 2UYLB 1AGDA 1YO4A 2RQ8A 1FORH 32C2B 1KPVB 1ROWA 1G7LA 4M6AA 1JGDA 3VFRA 4YSAA 3DIDA 1S7VB 4POUB 4M61B 4EPSA 4EJ1C 1G9MH 4DP0X 1A6AA 3NT0A 1I75A 2VDOH 3MX0A 2D7NA 3MLWL 3DO4A 1I7ZB 3EDKA 4ZQTA 2QDWA 5DFWH 1JBJA 2C1PA 5EEUA 2IGTA 2H6OA 3IMSA 4JFUA 4KC3B 4KZDH 5J57B 5CSZB 3VWJA 4PJBE 2ADGA 3ZGHA 4JY5L 5CBEA 5CF3A 4AQOA 4POYA 1E9PB 2XTJC 4AUJA 3VB8A 4ZZKA 1RK7A 1EDQA 3IFOB 1W0VA 3QR1A 2ARJA 1F3RB 2B39A 1Q9LB 1S8DB 3PWPE 3MCYA 1E90A 3MCKA 8PAZA 2OZNA 3ZHLA 4ABQA 3QIWA 1JGUL 3WIHL 1MPAH 4N1EA 1RZFL 2FJSA 1QATA 4I18C 3IRZA 2QR0B 3QQDA 2Z91A 2O61A 2ZOOA 3DV6B 3QFJE 3OXSA 2A9CA 3LZRA 3OL2A 4XVUC 3QZOA 5GSVA 1N19A 5HSFA 3AT9A 1G7PA 2V3FA 3BYYA 5E6UB 4JFED 4FA8A 3NOIA 1CE1L 5T3ZL 2B08A 2VXVH 5K9OA 1HDMB 3VSUA 3VXOA 3GEWB 4N0FB 1MNUL 2D73A 2YEVB 4O2FA 2XBZA 1JXGA 1DVZA 2GK0B 2R2BB 4GBXA 4R3SA 5C6WH 1JGEB 2F58H 3Q44A 1I9IH 3CZGA 5EOCH 4GMTL 2HKHH 3GDBA 3LIZH 2JFCA 5JHLH 1IC1A 5IREA 1YQ2A 4M5SA 2OMYA 3ARQA 2PWEA 1XCTB 2QTVA 2DDQL 4WJ5B 4N87A 2EECA 2QSCL 3MRPB 3MDJA 4FQ1H 3BIAX 3UTSB 5FA3B 2WO2B 4JO1H 2LLNA 5I5MA 3ARFC 1TVHA 2X0WA 4YBLB 5JZ7D 2VDLB 2XRAL 3JWNH 4G6FB 3AADB 1KEMH 5BNXD 2JKWA 2WBJB 2YXMA 5HYQB 1DBMH 4Z3IA 2WXJA 4FAAB 5CUSL 1QSEA 2Y24A 4G42B 4NZUH 1WWBX 3POHA 5IUSA 2J8OA 3I75B 1MCNA 4L4VA 1PEZA 4MA7L 4TNEA 4P5MB 3ZU8A 2R1XA 4G1EA 1YMHA 4ICXA 2Q5BA 1UXMA 2IV9A 3ELAT 1GOHA 2L4OA 4RGNB 1DUYB 2CZNA 5CP7A 1T0MB 1P7KB 2AJZB 3J7HA 1W80A 4CSZA 2OQJA 3DX3A 4L4TD 3H0TA 4XTRD 1WFTA 4YZWA 3RZCD 3DYOA 4ODUA 1Z9PA 5EZLB 4BH8A 2VYRE 4NNXA 2MNUA 3TZVA 4J3VA 1CGSL 2JB6A 4KROC 4PGJA 2HJKA 2DEWX 1YN6B 2V9TA 1GL4B 2GBAA 2YN5A 2CUMA 2DOCA 4XPBL 4ZO9A 1OP3K 3FKUS 1CIUA 2AXGB 2G3MA 3VNYA 2A73A 4D9QE 1IL1B 4GUOA 4PRDB 3JWOH 3QJUB 4I9XA 2X4TB 3KBHE 4ZUUA 4OM0L 1P53A 3BWUC 2VLLB 3K74B 4MJID 3VXNB 1QA9A 2L7EA 2XTLA 3EHBB 5E2VL 5CGMA 1NJ9B 2UWEB 1X5LA 2I5YH 4PFEA 5CJQL 1IBDA 5D4IA 3UZQB 4OTXH 1PQZA 3L3HB 3WSQL 5EPMA 2XTSA 3BAWA 3B5TA 2AV1B 2NY7L 4IOIA 5H2BA 2WGNB 1KTBA 1ZIBA 2B8OT 2BMKA 3AUWB 4MMYB 3VXSB 3V0EA 2DLFL 2FBOJ 2X38A 4IK6A 5DFAA 3M1CA 5E4EC 4K7PX 4PD4K 4OJEH 4ZW5A 1OY3B 1NUGA 1B0RB 4LVEA 2R0WL 4J3OG 1MLBB 3A67H 1BOGB 2CWRA 4HK3J 4H40A 4P46B 4RRPM 5GGQL 3ZPDA 2DLEA 1HHHB 4P4RA 3I9IA 3OQ3B 3SKJL 2X6VA 4G6JH 4JMXA 3NN8A 4XPTH 5IMLA 3SPGA 2FUQA 1E65A 1F1DA 5ESVA 1UB5B 1CDIA 3QUXB 4XP9L 5HGBA 1TOXA 5GGUA 4K07A 5FHBL 1B6UA 3HPLB 5GS0D 1C5BH 4MX7A 5E56A 4LDOB 1EZVY 2FEDD 3PWUB 4NBYB 3UO1H 2AK1H 1MCSA 3HRPA 4N6RA 2YSSB 5HDBB 5F7KC 4PS7A 4M5ZH 1ZTXH 2H1PL 4YDJA 5AOJA 5KVFE 3V9EA 5DLMH 3L3KB 3NSYA 3KWUA 5CD3B 3BSZH 1NCGA 1I3GL 1N5AB 1WBYA 4ANUA 3UYRH 3FRPG 3HC4H 1KFAL 4PJGB 2NY6B 3PAVA 5AB1A 2ZCHH 3CV5A 3HAEB 2EXWD 3OKOA 3FT1A 3US0A 4HIHA 4MNQB 1N0LB 4RNRB 4MAYC 2QPSA 3FB6B 2BK8A 2J8UF 3DURA 4ZXBA 3BIBX 3MV8B 3E8VA 5L2JA 5A6LA 4XNMA 1BVNP 5ALBH 4M56A 1MFCH 3V4VH 5D96B 1JD9A 1U8LB 3D07A 3BC9A 4R7DA 3CU1A 2LFGA 4HCGA 4NFDA 2EH8H 3FB7B 4JFDE 1NC2A 2G2RB 2GTZA 5D93B 1KLFB 1BBJB 3RNQA 2EZ0D 5E8PB 1FG9C 2EYSB 3UGEA 2O6DA 1GZQA 4ATWA 3UPAA 1FVCB 1YPZF 2FEEL 4KNQA 3VXMD 1GS6X 3E3QE 3AUVA 4FTVE 2YGQA 1HE8A 3V5HB 1JRHI 2WY3B 4HYTB 3DPBA 3L5HA 4HD9A 4WUKL 3K4AA 1G0XA 2DPKA 4PVBA 4LCCB 2NNAA 2VR4A 5DHVA 5DUML 1O9ZA 4WKZB 1TT6A 3H3PH 1KB9J 2V6HA 1HHIA 4AEIH 1JGLL 4LHUG 1SN2A 3QWRA 3SJVB 1ORSA 1S3KL 2H2PC 2JCCE 4Z7VA 1N0XL 4OZFG 4WO4B 2VQ1B 5DJYA 1A8ZA 3BAYA 3RU8H 2QFPA 2NY3C 3EGXA 4IRJA 4ELME 1WA0X 4P2AA 2X4RB 3K71A 1FZOA 4CW1B 1CN4A 1I1FA 1A6VL 4MD4A 1JPTH 1NKRA 5IVXF 3CSYB 1AOHA 3EFOA 4APXA 3L4XA 1QX1A 3G5YA 3QC6X 5EOCJ 2CQVA 3L3IA 4UT9L 2YLKA 1B90A 3CSTA 1KWKA 4CJ1A 2HFFB 1T03L 1QBAA 3W38A 3EOAB 4F7EA 2GY5A 2YWZA 4MNGB 4KGLA 4U33A 4HSAC 5GGSY 4OLWH 3MJ9L 2HVJA 3HZVB 1A6UH 3ZUNC 5DJAA 1TTAA 2F9BT 2XZAH 2PMZA 5K1JA 5SWSD 1NGYA 3S7GA 2UVEA 3ULUL 2HRPL 5GJTH 3GGWB 4YDNA 5DJ8B 1MRDL 5I75B 3ZQWA 4U05A 1YY8B 3BWSA 5F89B 3IJSB 5KEZA 2NY0B 3FNKA 5C8JA 3FQUA 4DGVL 1H3XA 3AY4C 1ZLDA 4WK2B 1J11A 4YXKH 5D4QA 3DX0A 4UTBA 1IV8A 3V0IA 3HB3C 5FAAA 3BH8B 4X8JB 1XL4A 1KN4H 5J1SC 2E7LA 4AQ1C 5DUBB 5F1NB 2YGPA 5HDOA 5IOPB 2EO9A 2DICA 2DQEL 2BSCA 2HJFA 4KDWA 3JTSA 3VWKC 2VKWA 1FSKB 5D7JB 3LYRA 3KL5A 3H9SA 4P46D 3GWJA 3F3HA 4WVRA 3V7MA 3HPJB 4TSCH 2CPUA 4J6RH 1KC5L 3HE7B 4MDIA 4OZHB 3QXDB 5EIVA 4AW7A 3RDTA 4F2EA 4KZEL 4XB8A 1TUPA 1NICA 3BP5A 2GIMA 5BV7C 2P8PA 1TZHA 4UT7H 5JXAL 3MJ8A 1HHJB 3ASWA 5T5NF 2WZPA 3CFJA 4HC1H 1QSFE 2FHCA 2A9BA 2B4CC 4IRSA 2QGCA 4PRIB 5IM7A 1TVBA 4Z23A 5EUKA 4ERSL 4ORGA 2H32A 3C5SB 3DV4A 2WUCL 2GI7A 1H3VA 3EF4A 5F9JA 2ENSA 1XF5A 3I6KB 3TBYB 3MLUH 4BK5A 2YA1A 1X7TA 4N1HB 1J1XL 1PS3A 3QH3A 1EHKB 2HT4D 1UACH 1E4KC 1AKPA 4KHTL 2B5IC 5JPMC 2GJ6B 2RMNA 3WNLA 4EI5C 1L5GB 2ARJQ 1UWXK 2C8NA 4FNTA 1A5FH 1M57B 3QUMB 2W65A 3I2CH 1YEDB 1KV3A 2V3DA 3CFTA 1U33A 2CDFB 3MV8D 4C56E 5E9NA 2V2WA 4A6YL 1KLUB 2YQ3A 3STZA 4WWKC 4PRNB 4BFIA 4MXWL 1MFBH 1P4IL 4F33A 3OWEA 3B2XA 4OJFL 2XXCB 1OPGL 3U1SH 2XXFA 4I2XE 5T1LB 3ARDB 1NKOA 3CDGB 4XNXH 1PY9A 4GQQA 1ET8A 2VNCA 3VGEA 4N0CC 3FULA 3RL2A 1OWWA 3NUKA 4DP6X 5IBTL 2K4WA 5L6YL 3GUTA 4XGZB 2BC4A 5CCGE 2GBVA 3FTWA 1ZA6B 1MWAL 3EJJX 4KKCC 3NCYS 1ASPA 4NO5B 5E6YA 2YK1H 3J27A 2IPUG 4L8SB 5EZOL 2YEZA 1KPUA 3CFCH 4XX5A 4YE4L 3U9PL 4L1HA 2HT3C 3J8F7 3VRJB 1OB0A 1NAKH 3UFIA 4Z7QB 2I9TA 2F8OA 2R7EB 2PR9A 1HTYA 3SJVD 5HHQB 3RWFB 2WQVA 5IHZA 2EYTB 4OGAC 4NAQA 1OAYH 2Q8BH 1HXMA 1GPOL 3BAKA 3NAAH 4OZGA 2E9JA 4N8VG 4CAGA 1EJOL 3J2PA 4B60A 3ZR5A 5K33A 1UWGL 3L4YA 1PLGH 4ZOCA 2ED6A 2BOCA 1YMMB 2K7QA 1QRKA 4R0LA 4NFBA 2BY3A 4A1RA 5B1KA 1GVIA 1Q1PA 4FQJH 2ED9A 3HI6H 1NINA 1KDJA 4ZDHB 1MF2L 4H13C 4GW4B 4Z7AA 4HMCA 1FPTL 4UQ9A 1XSIA 1AQHA 4JANB 1XTMA 3AGVA 4LCWE 4HIXH 3MBEB 1BD2B 2KPNA 1UT1A 1IZKA 4RMWA 1NWOA 2AQ3A 4CJ0A 1U8IA 1YUKB 2JJWA 2MRYA 4OCMC 4CGUB 3CCHA 3QDME 3BQUA 3ZBMA 5JHDB 4FLOA 1YC8A 2NYZA 1PD1A 4GUPA 5F3HB 1TTGA 1ADWA 2EDNA 4QLWA 1QHOA 5AVSB 3S97C 1UCBH 5EOQH 4UQCA 4BK5C 3LKRB 4XO9A 1TKWA 2M26A 1ETZA 4ODHL 2A74B 5GS1B 3FAXA 1BQLH 4LBEA 1FGVH 1IE4A 1D5XB 4L9LA 3BKCH 5DJXB 4A2DA 5I2IA 1ZLSH 1LL1A 1N2RA 2W60A 1L9RA 1LO2L 2FO4B 3V4PH 3FHAA 3KLSA 4OR1A 3WNOA 3GHPA 3CX5K 3MODH 4PJDE 4ZBJA 3L6FB 5GSRA 2VZ1A 4HJGA 1MJUH 2ZPKH 3B5GA 3KLKA 3MMEB 1U92A 3Q9QA 3RVVD 5KJRH 3M7FB 5D2LA 1OF2A 2APWA 5GS0H 1JNNL 4ZSOE 2X4OB 4ZMZA 1FG2A 1S7RA 3X3GH 1CU4H 4IRZH 1AQKH 1SBBA 4PU2A 2RACA 4HWZA 4L3EA 4BFJA 5MHSD 2ITCA 1GYUA 2VDNL 1RSYA 3BZ4A 4AKOA 1LWRA 4AE0A 4PRHD 4ZFOA 1NFIB 1HI6B 1Q0YH 2AEIT 5SX5K 3N50A 4WI7A 3W0WE 5IESH 3FTGA 4LLWB 5IBUB 4Y1AA 4YO0A 4IU3A 2BNQD 1H3WM 2G5RA 4JG1H 1J8HE 2RCSH 2FX9H 1XH3B 5DS2A 1KXQE 3BWUF 3PNWA 3S36L 5LGHH 5FYKD 2CBOA 2CJUL 2G0LA 3CX2A 5KSBE 1IT9L 2VN4A 4QTHB 1GHFL 1N6UA 3U0TA 5IK3B 1DDTA 3FO0L 1PLAA 4TPRH 4HCIA 3WNJA 5EZIH 5IHUL 1LE9A 3U4AA 3D8MA 4MMXB 1S78D 2ZUSA 5LWYL 4DK5A 4WY7L 3UAJD 3WKQA 3UTQB 4XN4A 3O11B 2FAUA 3QT2A 4UOW0 3F7VB 3TT3L 5G4NA 4FFYH 4NN7B 4YSCA 1U93A 5T1LD 4PLOB 4F1ZA 3F12B 4LP8A 2BP8B 5JIKA 3DARA 5CBAA 3OGCB 1A4BA 2ENYA 3LB6D 4NKIL 3BQUC 3VX0A 2L8AA 3X17A 2BSSB 4LSSL 3ZKSD 4AL8H 1S7XA 4DKDC 4QHLB 4U1MB 4DHLA 3ZL2A 1GCFA 4LCIH 1RUKH 2WVTA 4YDZA 3F7YA 1L3WA 4U7MA 4Q6KA 2WYHA 4WZ9A 4MASA 2FWOB 3K8KA 4DJMA 4U1KB 2Y7QB 4JFQB 2ZUTA 4PGDB 3DSFH 3BN9D 3HC2A 4FQXB 1I1YB 3SDCC 4YH6A 5E94B 3WY1A 5B8CA 4PJBA 2VUKA 2YGVA 2WVSA 4O58H 3WFHB 5HHOA 2Q1EA 3KPMA 4GLRH 5DMGD 2J43A 4KXAA 1HCVA 3QNYB 5KANG 3PWPA 5LBVA 3HLAA 1RSFA 3WL9B 4KKLC 2Y5TB 4JG9A 43C9A 4L37A 4GFTB 3VSQA 3VSTA 4OFDA 4HXAL 2ZICA 5IW6B 2VXUH 3GTNA 3BP4A 2X7LB 3QFJA 4GAGH 1ZSDB 4I3SH 1H9VA 2GITA 2IXQA 4I77H 3T0XA 4UMSA 5EFIB 4WEBH 2APBA 3II2A 3P3TA 4S0HA 3OC8A 1R5VB 1U8JB 2ZX5A 3QFDA 4ZUWA 3OXRB 5J9PB 3K72A 4JZOA 5SWQA 4PP1C 3NVQA 4F5CE 4GKNB 1O75A 2G9HB 3X11A 3CFBA 3N42B 2YPKA 3LXAA 3HZKB 5I15H 2PWHA 5DUPH 1CFVH 3BT2L 4F7PA 4OW6A 5JW3H 1OAXH 2OK0H 1XF2B 1KT2A 2AJYL 2XA8H 2KUTA 2IPKB 4J28A 5FYKU 5JNYA 4E0RA 3L4WA 3ECWA 4NZTL 1JVKA 1HXYA 2CGRL 5JHBA 2UZPA 4AW4A 4HP5A 4E9SA 1QI3A 4M7JL 4AENA 1SOQA 3OR6A 4XNUH 1ILUA 1IGTA 1A7BA 4YIQA 3MGAA 2ERJB 4PS3A 1G1OA 4ABWA 3BVXA 2O5XH 4JR9L 4H8QA 3QUKA 2BXZA 4KZCA 1X5IA 3BMWA 5AENA 3H42H 4FQQB 1IIKA 2VERA 1RJLB 2Y1VA 4LMQI 1JPST 2YKLH 3V0DA 3WJJA 2XKUA 3S3PA 4V2CB 2JQAA 5IQMA 5CR1A 4PCKA 3WLBA 3U7WH 3V6ZB 1OZUA 4FYTA 2HTKC 5IV2A 1HL9A 2Q10A 1A6WH 2DY2A 4XPFL 4OVVA 2J5LC 3QO0A 1JL8A 4UUJB 2ADFL 3FQTB 4KUZL 3SBPA 2GBUA 1F58H 1WJ3A 5J8OA 3IXAB 2WINA 1J9QA 1PNCA 5EH1A 3SZ6A 1K4DA 4XVJH 1FO0L 1RI8A 3LIUA 4PJ8D 3ESUF 3T8XB 3GSNH 3RGVC 1EHAA 2NY4D 2H1XA 5DVMA 1TTBA 2Z8VC 1KBVA 2I69A 2Y7MA 2NDFA 4TVPE 3S3JA 1YUHB 3GO1L 5EDSA 3V6FA 4YFLF 5EO9A 1A6TA 4TSAL 2A6DB 5E6IB 2W9DH 4X6CB 4OZ4B 1CFSB 5EC2A 4Y2DB 4M1DH 2LTQB 3OMZA 1XF4A 3GJFH 4LSUH 5TF0A 3ZHFA 3O0RH 4D0BA 3V8CA 2CDEA 2YZ8A 1GKEA 2P7TB 2WTOA 1UJ3C 3KYMB 4ZUTB 3TJHD 5D1ZB 2M8XA 5B1JC 4C83B 2UV3A 1MJ7H 3BO8A 5FA4B 4Y4KB 1OOAA 3MNWB 3QQ9C 4QRTA 4UDUA 3FCSB 3WCYA 5FYLD 4IMLB 1KYOK 1ADQL 1AY1L 2PXYC 1JVOA 1IX2A 3UO8B 2IQ9L 4PJHA 1JERA 5IW3A 3NQIA 4N3TA 3R18A 3L95B 1BX2B 3T65A 1A6ZB 3O81A 4GNKB 2H41A 1Z7JA 4IIZA 4PV9B 3OKMA 3IJEB 4FQXD 3SBRA 3IJYB 3G5WA 2YAOA 4A63A 1DQDH 2OM5A 3BUPA 4V11A 5IFAL 2LLGA 1JFQH 1I7UB 3LH2H 3LPWA 2Y2YA 3QDAA 3CXHJ 3F85A 4ACTA 2FLMA 2XYCA 1J0YA 5C3LD 1MAML 1OGTB 2MH4A 3LKQB 4O51A 1TQCB 1KCSH 2ATPA 2AANA 1SYSA 2WLYA 4AEFA 4F20A 3FO2A 4H8HA 4YBHA 5I5RA 5I1AB 1W16A 3WTYA 1G0DA 3HR5B 3FU6A 2FQDA 4G7SB 4LOUD 2EE9A 2P5PA 5C92A 3LRLA 3WFEH 4PUBH 4MJHA 5AD0B 3I6LE 2R23A 4X9GA 3BUBA 4W9LC 3HHSA 1LDSA 4G8GE 2QQNH 4XCEA 4C55A 5KSAB 4J12A 5BRZD 5BXFA 1CICC 3QBTB 4DF9A 3M8OL 3IJHA 4H0GA 2F6AA 1W15A 3WTUA 2ROXA 1AQDA 3AU1B 1JV2A 1G6RH 2YXWA 3LX9A 4KRPC 4QYOB 3ZYZA 2QSQA 3Q05A 2R83A 4PH8A 3RVXC 4IU2B 4FG2A 3L3OB 5ADOH 2Q3XA 4HLJA 3U6XA 3P02A 5ICYA 1U8QB 4HS6B 2IGFH 4JFDA 3RPIA 1VADB 3DHPA 5IQ9A 4LQFL 3IVKB 2VDOB 5AKTA 1VZHA 2F8IA 4NO2B 4PVLA 4KK9C 5J11B 2DIEA 1SFDA 3WEOA 3PHSA 3TVMB 1D2PA 4JHVA 1KG0B 1S7WA 1EXUB 3RBGA 3U4BH 2LV4A 3VQ2C 1L7IL 4G9FE 4HFUL 4DZBB 4PS4H 3APCA 3B7SA 5DMIH 2EDFA 4G71B 2F53D 5E08L 2KHAA 2DJMA 5C7XL 4G6KH 1DJSA 2WKOF 3HG1A 4DQOH 3MRHB 4P2QE 1DJXA 4NBZB 5F7WC 4ELMA 1OPOA 2QPUA 3GSRA 5FV1L 4JFZL 4EOWH 2ZKHL 3KEHA 4P5SA 1KN2L 2AZUA 5FW6A 5FYKH 2V2TA 1KELL 2FECL 3VQLA 4AGOA 1QI5A 2XZZA 5FUOH 2NX5B 4L1SA 4QJ3B 5JIMA 1AIFA 4LVOB 4UV4H 1RY7B 4IIQA 4J3BA 2XNAA 1FNLA 4JY6B 2DQJH 1Q72H 2UZXB 4WK4B 3ECUA 3KLDA 4ZFQA 3A24A 2BS8A 4HBCL 5C0CD 2VRKA 1A9EB 4IKNA 1S5IL 4G3YH 4Y0GA 2NNCA 2NY2C 5I73B 5EZPA 2QPEB 4N9GA 4XNAA 1Z9OA 1NFDE 1R6VA 5E6ID 1XSJA 2A1WL 1J0IA 3GJEB 2DBLH 3NJXA 3PLYA 1I9RL 3WU1A 2B2XH 4Y2LA 1B4JL 5TK2A 3AXHA 1JK9A 5GGRA 3W39B 1HNGA 1EEZB 3CVHL 4E5XG 4E9VA 3U4EA 4BEIA 1NSNH 4G8IB 3BGMA 1E2VA 5I18H 3KL3A 3F65A 1JIBA 4GRLC 1I8IA 4QAMB 3FZUC 3IE9A 1PZCA 5TQ0L 3MXWH 1EAPA 3T1WA 5FM5O 4WNSA 5C2BL 2ZWYA 3MLZL 4YSTA 5F9WC 3EYUH 4U1GB 5DRZA 3UZVB 1FFPB 5JPNC 1NGZB 4PW9A 1N6QH 4Z6AT 3QI9A 4K71C 4ZS7H 4X6DE 2DQCH 2V5YA 1JUFB 1O7VA 4K73A 3GRWH 3P11H 1N18A 5DI8B 3O6FC 1T0PB 1DUZA 3NIDB 4Z7UE 2DMGA 5FF6A 2D3LA 3PWVB 3E3QC 3MOBL 2H8PA 1AD9B 4YL4A 1FE8H 5E70A 2ZCKH 5I30L 1RUQL 4AV0A 5BRQA 2CG9X 1KXHA 1H5BC 1W72H 3DIFA 4YHML 3O6ML 2BSDA 4OFVA 3ZE0E 3U1PA 1QO3A 4RSYA 4XMLH 1RK0B 2MCPH 3AQYA 4MS8C 3L3GB 4WFFE 4XVTH 5ISZE 5T1JA 3BPCA 3LEVL 1ZGLB 3WHXB 5C0JA 4A66A 2VJ0A 4IBSA 1RCYA 3MBWA 5KSAD 1MVUB 2Z31B 2MQGA 3SDYH 4HS8L 1PFOA 1WZMA 3C5ZC 1JN6B 2HPOA 1X4YA 1XFPA 2VUOA 2CCWA 4OD2A 4WV1A 4UOZA 4C56A 1QR1A 5J7CC 4HPYL 1PFCA 5ILTL 3VU2A 2JKXA 3ZDZF 4NZRL 1IJ9A 5C0BD 3ULVE 1U21A 4HUWA 1ED3B 4I5BA 1AGDB 1OT4A 1H9DA 1E4JA 1NUFA 4X6EA 4XX1E 2NOYA 1JF1A 5T5FL 1JGDB 3VFRB 4U1SA 1MRFH 1O6SA 3ZE2F 3AXLB 3EO9L 4NO0D 4N8CL 3O3AA 1JG9A 1A6AB 1JV5B 2VITB 5KVDE 3AG4B 3MX0B 3ZRCC 3H8NA 4Z78B 3QEQD 5JLZB 3C75A 4Y4FD 4Y4HC 5D1QC 1GTNA 3VTTA 3K6IA 2NTFA 1DL7H 4G6AC 3D06A 4NWTL 2J6EH 3VWJB 4QNPF 2ADGB 4N24A 3NRFA 4I87A 4EE2A 2VLRE 5DZOA 3P9WB 2F7IA 1CGUA 1SJXA 1W0VB 4XN9A 1D5BA 2ARJB 4GS7C 4P48A 1OD9A 3MCKB 1CYWA 5DZLA 5CLWA 1H3UA 4Y8DC 2VLJE 3V52L 3S5LB 2ZXQA 3D4ZA 3NJKA 4Y8AA 3QQDB 3KPNA 5CNHA 3VG9B 3IDYB 5D7IE 3S6CA 1D6VL 3OXSB 4LMQE 3NCBB 5GSVB 5JUEH 5DVKA 1G7PB 2EAEA 1AIZA 5E9DD 1GGIL 1NBZA 3UL4A 3Q2NA 5K9OB 4LU5H 4EZLA 2EIEA 2HN7A 4WKXA 4O2FB 1V5JA 4Z7WE 3W1ZA 4GG6F 1MI5E 4PM1A 4YHZH 2AP2A 2JKSA 1RKRA 4X4XA 4R3SB 5F8QC 3SO5A 2AQ2A 3FUIA 2BSEA 3MRJA 3CDZA 2W0LA 3D69B 5IOKA 3R8QA 2CK0L 2C7FA 3PAUA 2OMYB 2YOCA 3P1VA 2UX7A 3WNNA 3JXAA 3ZDWA 3S9DB 5BUAA 1KENH 4HQQH 2OMBA 4LHJB 1IC7L 4WENB 1M1XB 4ONGH 4RMBA 1TVHB 2CCVA 5CEZL 4IJ3C 4NRYA 5DZ9A 2QVKA 5FYLH 2QKIA 3ROOA 2EKJA 4RX4D 2PW2B 4PJDA 2DZEA 3FU5A 5LGKA 4L4VB 1JGIA 2G60H 4Q9QH 5IGXL 1YMHB 3NK4A 4OQTH 1FVEA 4OB5H 4XNZC 3RHWF 1GH7A 3E1F1 1F3JA 4OGQC 5E5LA 4ZSOA 3OAUL 4Y9EA 2OQJB 1Y0LA 4HWUA 4FRWA 2E0PA 5I1KH 4ODUB 1DSWA 4BH8B 4NFCA 2YA2A 1KPRA 5IP4A 5DZVA 1M9SA 1X5YA 4TRPL 4NNXB 3HVDA 4XBEL 2BNUA 2JB6B 1A2YB 3ZHDA 4FFVC 1YLBB 2R29A 2OYKA 1OIOA 4AC2A 2H9GA 2D7TH 4AUYA 1QTPA 4LP5A 3W0WA 1OANA 1OAZL 1THCA 4OCLC 2A73B 4LPCA 2QJDA 4P2CG 2DWYA 4Q2ZA 3RA7H 3UYPA 4ZNEA 1KXQA 4ZUUB 3LQAH 4YC2B 1UG9A 1QA9B 3ARFD 4JG0L 1IGCL 1TQVA 3V0WL 2JF1A 5KSBA 2BSBA 4UOJA 4ALAH 1PQZB 3QCTH 1E6JL 1AG6A 1JZHA 1NFAA 3K1DA 5CCKL 3IDJA 5F7DA 4KGJA 4IOIB 4PREA 5H2BB 3FSVA 5C07D 3HNSH 3TYGH 3UTTE 4L23A 2BMKB 3O2DH 4K8RD 3LS4H 2OMZA 1HYSC 2FB4H 1T66C 3PG2A 1PZSA 2P8LA 2XQYG 4YOKA 4PTUA 1KXVC 2ZG1A 4ABUA 1YEIL 5IIEA 2J8HA 5I1EH 5TDOA 3RP1A 3HS0A 4NQCD 3ZYIA 1FGNH 3QRBA 4DPRA 1RXLA 5AWNL 2Z4TA 4IGBC 4PBWD 5KS9F 3NN8B 4JEGB 4XRCA 5DJZA 2D9CA 1EGJL 5ESVB 3SYPA 5EWIL 4TLUA 2BS71 5EOTA 1AQMA 4X9HA 4HHGA 3VWJD 5EU6A 5DMKB 2YPVH 5GGUB 4WGVB 3KVPA 4W9HC 2DQTL 2VXTL 1DYZA 2YUWA 3CDCA 1IGJA 3CNKA 4JN1H 2XOTA 1MFEL 4GP8B 4N6RB 2CKBH 1AR2A 2A9ML 4YDJB 3QIWD 3FTZA 3OAYK 1WBYB 3MV7E 4H25A 2PCYA 3HA0A 5I66B 1BBDH 1CDCA 1VFOA 3ILQD 3SD5A 4AGLA 2HWZH 4LCUB 2PLTA 4D9RE 1RUMH 1N64H 5EBWA 2O4EA 5IW1A 3OKOB 2B9AA 4HIHB 1HZHH 4GBXD 2N59A 4FL4B 5E2UH 4KMQA 5E4OA 1Q1JL 3GHBH 4ZXBB 1NM9A 3GPEA 2FK9A 3RVUD 2Z64C 5L2JB 1F41A 2EDOA 4XNMB 4LSTL 5GJSH 1NCAH 1G7HB 4E36A 3T0EA 4R9HA 2AERT 3ENEA 4R7DB 4F5CA 4JHAH 5AB9A 2F74A 1R34A 4HS3A 3OAWA 2GTZB 3D25A 4J1UB 2EDWA 1JD7A 4O2CA 3PXHA 5CXPA 3RNQB 1W2KT 3WS6A 4TQ8A 2EDHA 3LRMA 1GZQB 4L9DA 3VFMA 1FH5L 12E8L 4P49A 2WZ0A 5GRWA 3S88H 3VDAA 1IGIL 2BWDA 3QHFH 1PU0A 1QSED 3VXQA 2NNAB 2I25N 4WEUD 5DHVB 3F00A 4KXCA 4QHKI 1ID5I 5J6HA 2DQUL 4EAEA 1CIDA 3MHZA 2K8MA 4U0RB 1AHMA 4HIIA 2Q7NA 2F5BL 3WFCH 1ORSB 4Z7VB 3SHSA 2RIKA 3IFNH 1W91A 2R8SH 2VR3A 5AVTB 3EGXB 4IRJB 4V1DA 4YS4A 4R7LA 7TAAA 3E38A 3K71B 4JDZA 3FH5A 4MD4B 4XVSH 3FT4A 4MAYD 1RFDL 3HS0C 3VD3A 4PJAE 2HKAA 3EFOB 3KD4A 1RHHA 4APXB 3MRCA 4MD5A 5E7BA 5IFHL 3HFFA 5DJ0B 3TZVD 5DHMC 3L3IB 2EXYC 2ZQKA 4N2EA 3V0VA 4F3FB 4YHPB 1QI4A 1UYWL 3HJEA 3T3ME 4I0KA 1IGFL 3PIQB 1QLEB 3DX7A 4YNYB 2YMXH 3FSWA 1KYUA 2HVJB 2X0UA 2IWKA 5DJAB 3OKNA 3GK8L 3C08H 3IS1X 1D9KA 2EDBA 2VDMB 3G08A 2AI0L 3SDAA 2D31A 1KOAA 2VR8A 3PHOA 5L9DH 1PX3A 1KGCD 1KEGL 4ANVA 3BCFA 4Y5XA 1S7TA 3B9VA 4UB0L 2D2CC 4IBLT 1T5KA 1PNDA 2TSBA 2AJVH 3TX4A 2IH9A 5C8JB 3FQUB 2WKLA 3OKLA 5ANHA 4Y1SA 3GMLA 3IJ7A 3SYOA 3C12A 2H2PD 4HF5H 2XJLA 3SE8H 4R96A 5CP3H 5I16A 4K7PH 2WAQA 1E40A 2IPTH 4F57L 3RWCA 3VD2A 4JX0A 4KTEH 2HJFB 4DKEH 5CZVH 4W70A 4A7GF 2CR6A 3JTSB 2JI3A 3H9SB 1MLCB 3AT8A 4DP1X 1XAUA 4KJQC 1JNLL 1UM6H 4GPVA 4MDIB 4GG8A 4QR7A 4TF4A 3RDTB 1OARH 1FYTE 1YJDL 4XMKL 4NOBA 2CNZA 3RFZC 4H2CA 3BP5B 1BZ7A 1VERA 4N0UE 1XIWA 2P8PB 1TZHB 4PQXA 5I1GL 3D09A 3MJ8B 4P4KA 3KBFA 3GIVA 3NIFB 4FLHA 3CFJB 4PAZA 3LMJL 1II4E 4YE0A 4IRSB 3I84A 3VB9A 4E68A 4GEIA 5J0BA 1OAKH 1TVBB 5C08E 1M05A 4XWGL 5EUKB 3V10A 4DW2H 4ORGB 5DD1H 1I9JH 2H32B 3DV4B 1CF8H 4EI6B 2Z65C 5F9JB 1Z6JT 5AW4B 1XF5B 4F2FA 3DK2A 2NLJA 4NZFA 3GF8A 2JCCF 1ZIAA 3IK2A 3VA6A 4Z0BL 5HYSA 2ICEC 5GZNA 1NFKA 3GC3A 3HB3D 5I0VA 4HCFA 4LPUA 5KVGE 4BKSC 2PP7A 3B5HA 4M7KH 4NS0A 4HIQA 1OLLA 2VC2H 2W65B 4UTAL 3EXJA 4L8BA 3VWKD 1ZSHA 5TQ2L 3TA3A 4ZXBD 1HE7A 1EX0A 4N5EC 2BVTA 3STZB 2CBQA 2APTA 1X9QA 3C8KA 3PL6C 3QG6A 1GGYA 3VXRE 4BFIB 4G8GA 7PAZA 3HHRB 1FF5A 2Y36H 4DTGL 3CBRA 4GSDH 5CJXC 1PMYA 1NC2D 1A65A 3BH9A 1ZANH 3RL2B 3GUTB 1PD6A 3LZLA 3M1OA 2AK4A 2BC4B 4WNQA 3FUDA 4CN6A 1RZKL 1SLUA 4F9LA 4OZIE 3A5VA 1XGUA 3OJDB 1NMBH 1KPUB 2FYVA 4LLYA 3P3RA 5KYYA 2I9TB 3EYSH 5DC0A 3RKDD 5IHZB 4JGNA 1MWOA 1VSCA 2XXGA 3LSOA 1DBBL 3T6QC 1HXMB 4WW2A 2C26A 2Z3FA 4EI5D 4U1JA 4G9FA 4M7LT 5A2FA 3S8FB 1LP9E 2J2ZA 2BXYA 2DD8H 3HBZA 3A0OA 1FL3B 4IBQA 1Z5LB 4NN5C 5IKCA 2BOCB 4DVRL 5DO2D 4N0YH 4R0LB 1FORL 1H8NA 3G04B 1FLRH 2Y2WA 3C87A 1UWEH 1UCTA 4HV8A 4B5EA 5HI3C 4ZNCD 1G9ML 4GSUA 1YY9C 1MELA 3NPSB 1AZUA 1KB5H 3QEHB 3V5KA 1CTOA 4N0CD 1U8IB 3UBHA 4KZDL 5KJ7E 3BJLA 1E8XA 4DO6A 4HETA 2BX5A 2GJJA 2F68X 2XQYK 3B4NA 1MHCA 4B6ZA 3AS3A 3HZYA 1TKWB 2HT3D 2LU7A 4PWKA 2FX8L 4LBEB 5GS2D 3ZIMA 1F42A 2I26N 1CL7I 2ATKA 1ZXKA 2JKJA 2R4SH 4L9LB 4PRAB 1NFDA 3T5WA 5I17A 4JHBA 5BZWA 4B9PA 2V8LA 5I2IB 15C8H 3FCGA 1N2RB 2W60B 2RB8A 3IDUA 5D7SH 5D6CB 1SF5A 5I8KH 3VW3H 2DM4A 2YXFA 2XV2A 1OXYA 2W8CA 4LSVH 2J21A 5GSRB 4HJGB 3MGTA 4HUXA 2J1YA 1KF9B 2VXVL 3RDTD 1U92B 1DDHA 2R2HA 4PGBB 4ZPTA 5JOFA 3H4FA 5D2LB 3PJSA 1IAII 2F58L 1FG2B 5EOCL 1I9IL 1S7RB 5JHLL 3LIZL 1R5WA 4HIEA 5JQHC 1R3KA 1IGYB 4HWZB 4KJWD 4L3EB 4MMZA 2ITCB 2V5SA 3B2DC 3ATEA 3BZ4B 3HE6A 2BCKB 5BOPA 2WV3A 35C8H 2PW1A 4ZFOB 5FB8A 5AVYB 2CJTA