4E9XA

Multicopper oxidase mglac (data3)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
317
structure length
317
Chain Sequence
AEREFDMTIEEVTIKVAPGLDYKVFGFNGQVPGPLIHVQEGDDVIVNVTNNTSLPHTIHWHGVHQKGTWRSDGVPGVTQQPIEAGDSYTYKFKADRIGTLWYHCHVNVNEHVGVRGMWGPLIVDPKQPLPIEKRVTKDVIMMMSTWESAVADKYGEGGTPMNVADYFSVNAKSFPLTQPLRVKKGDVVKIRFFGAGGGIHAMHSHGHDMLVTHKDGLPLDSPYYADTVLVSPGERYDVIIEADNPGRFIFHDHVDTHVTAGGKHPGGPITVIEYDGVPVDDWYVWKDKDYDPNFFYSESLKQGYGMFDHDGFKGEFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title New insights into the catalytic active-site structure of multicopper oxidases
doi rcsb
source organism Uncultured bacterium
molecule tags Metal binding protein
molecule keywords Multicopper oxidase
total genus 95
structure length 317
sequence length 317
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9xA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9xA02
4DPBX 2XV0A 3WIAA 1ILSA 2JXMA 4JHUA 2EILB 3QJQB 3ABKB 2VM4A 2P80D 4AI7A 4KOCA 2BP0B 4NERA 1JVOA 3FQYA 4YVUA 3NSYA 4N4YB 2OCCB 3HEIB 4A2DA 2HRGA 3MX0B 3N55A 1WAEA 4WTQA 3UAEA 1NINA 2HX9A 2UX6A 1MG2C 2HX8A 3ABGA 3AY2A 5B1BB 1ADWA 1GS8A 3CG8A 1W6WA 3H56A 1WS7A 3UAAA 3WKPA 1ZV2A 3QJUB 3GDCA 3GXUB 1E65A 2DYSB 4KO9A 2MTAA 1J9SA 1AS7A 1NPNA 3KW7A 2B3IA 3PLYA 3BQVA 1TEFA 4DP4X 4E9TA 4YSEA 2IWFA 1AZUA 4DP1X 1ET7A 2W8CA 4YSPA 1AZNA 1A8ZA 3T6ZA 3EH3B 5B7EA 3FQ1A 3MBWB 3NP4A 3BVDB 3NYKA 2Y1AA 1JOIA 1IC0A 1PNCA 3NJFA 4G7RB 1BYOA 3RYMA 3OQRA 2ZWNA 4YSTA 1QLEB 1NWPA 1AG6A 2GBAA 4AKQA 3FSAA 1BQ5A 1ILUA 2EIMB 3FSVA 5I6LA 3SBPA 4DPCX 5I6OA 1M56B 1NIBA 2Q5BA 1MZZA 3TA4D 2UXVA 1SJMA 1A65A 3S3BB 3ZIYA 4FA7B 1FWXA 2AVFA 2XX1A 3OMNB 2J57A 5IY5B 1M57B 3AG4B 1A4CA 4AKOA 4WKXA 1N70A 3ZDWA 1HAUA 3NJLA 2GC7C 8PAZA 3X1FA 3PAVA 2XUWA 1W8EA 1JERA 3EH4B 2HX7A 3CDZB 1KYAA 2EIKB 3CVDA 1XB3A 3NJKA 3FYEB 1ASQA 1OE1A 1SDDA 2VW4A 4CSPA 3EF4A 5I26A 2BO0A 4BK5C 2BZCA 1MZYA 3FT0A 4AX3A 4DP8X 1MG3C 5A7EA 1BAWA 2E86A 4M3HA 4E9XA 2I85A 3NSDA 1NIFA 2VSKB 4W1TA 2CJ3A 5D4JA 2FWLB 4F2EA 1SFHA 1JZFA 3QJRB 1SF3A 3SBRA 5PAZA 2AZAA 4N8UA 2HZHA 1J5DA 1BXVA 3FS9A 2UXTA 2FQDA 3ASNB 1RKRA 1VLXA 2YAMA 2BP8A 4GY4A 2YXVA 1KBVA 1IBYA 1PZBA 2BP8B 4GP8B 3DIVA 3T9WA 2VMJA 2MRYA 3IE9A 1WA0X 1B3IA 1ASOA 4BDVA 4KOBA 1J9QA 1V10A 1SDDB 1PMYA 4YSSA 2PPAA 3QJSB 3WI9A 2VSMB 3IBOA 2PCFA 1CURA 1AQ8A 1QHQA 1RZPA 2UXGA 2CALA 4NAJA 3NSFA 1JXFA 3PPSA 5I5JA 1L9SA 1ET8A 1AS8A 2XXFA 2FTAA 3WNIA 3WG7B 3L45A 4E9QA 1IKOP 3D12B 5I28A 5ANHA 4DP9X 3UACA 4TXVB 1CC3A 4F7KA 1NIDA 2IH9A 2PPFA 2VN3A 2J55A 2XLLA 5B1JC 2QPEB 4HCIA 2DWSA 2HXAA 3NJGA 4E9YA 2GHZA 1NICA 1OCZB 2WSDA 3ABMB 3NJJA 4HHWA 3CVBA 4K9JA 2PPCA 2QDVA 2AANA 2P80A 4HZ1A 2QT6A 3TASA 2IWKA 2HLEB 3S8FB 2BW4A 4AKPA 3U25A 1TEGA 1E30A 3CZUB 4QKTA 1I53A 1CUOA 2IDFA 2PLTA 2IH8A 2VW6A 3S3DB 1OCOB 3S3CB 1HAWA 5E9NA 3G5WA 3EHBB 1E5YA 1NDTA 1J9RA 1V55B 5B3SB 2J5WA 1JZIA 3QJTB 1X9RA 4UAHA 4YSQA 2OV0A 2DYRB 4A68A 3NJMA 4YSDA 1NIAA 3HB3B 2Y69B 2CBPA 1IUZA 1ZIAA 2YAQA 4A2HA 3X1BA 2GSMB 1ET5A 2PP7A 1BXUA 1BYPA 1L9PA 1AZBA 1HFUA 4GYBA 2UX7A 3FU7B 1GS6X 1ETJA 2IWEA 2XWZA 1ASPA 1L9OA 1XMEB 3EH5B 2PP9A 3AZUA 4UF7C 4PCYA 4A2FA 4F2FA 4HHGA 3ASOB 4MFHA 2YAFA 3GYRA 5B1AB 2PPEA 2YAHA 1GS7A 3AG1B 1PLAA 2BHFA 5B1JA 1V54B 4A2GA 4EF3A 4FAAB 2TSAA 2XX0A 3TBBA 1GYCA 1PLCA 2GIMA 3PCYA 1X9UA 3H4HA 1CYWA 3OD3A 1JZJA 2QPDB 3QJVB 1PCSA 1GR7A 1MDAA 3SQRA 2FNWA 1A3ZA 5I6KA 2VW7A 4HCFA 4QLWA 2XV3A 1OE3A 2ZOOA 1AZRA 4ZK8A 3CDZA 1FA4A 3UADA 2FQEA 2FT8A 1OCRB 4A66A 1BQRA 4HAKA 4DPAX 2CAKA 1TKWA 3AG2B 1GSKA 4GXFA 3JTBA 4YVNA 5B7MA 3NT0A 4A2EA 4W9ZA 3FU7A 2XU9A 3X2QB 3WNJA 2BZ7A 1KCWA 3WKQA 1WA1X 1W6LA 4DP6X 2BWDA 3PAZA 4YSUA 1ID2A 1ZDQA 2WO3B 3NSCA 1PAZA 6PCYA 1PLBA 2X88A 3NJHA 3PAUA 1OF0A 3T71A 2PCYA 1PZCA 1ZIBA 1AOZA 4A67A 1KBWA 2FQGA 3FU9A 4KNTA 2X87A 1SHWA 2N0MA 2YXWA 2PP8A 3SBQA 1PZAA 1AIZA 3DKHA 3S8GB 1JZGA 1L9RA 1L9QA 1BXAA 2XVBA 4KNUA 3DTUB 2UXFA 2FJSA 3FPYA 3ZX1A 4KO6A 5TK4A 1E67A 3AW5A 4HIPA 1IBZA 3IN0A 1WS8A 3UABA 4Q89A 4BXVA 1SHXA 5I5MA 1NZRA 4UANA 1AG0A 3V9EA 3AG3B 4E9WA 1R1CA 4G71B 1WA2X 3ABLB 2BWIA 2HRHA 5I6MA 4X4KA 4G7QB 3N2JA 4KO7A 3UGEA 5AKRA 3TBCA 3C75A 4E9RA 2Q9OA 5I6NA 2IDUA 4YSCA 2YAPA 4PAZA 2YARA 5AZUA 3T6VA 1A4AA 3OM3B 5B1KA 3T6WA 3X1EA 3NP3A 4KNSA 1FFTB 4JKNA 4YSRA 5F7BA 4E9VA 2JKWA 1ZDSA 4P5SA 1PY0A 2BW5A 1ZPUA 2AZUA 2CCWA 5AFAA 1BQKA 4M4RB 3X1NA 2XXGA 2GC4C 1JZHA 4G7SB 3FQ2A 2W88A 4YSAA 2YAOA 2XYBA 4HALA 5FC9A 2DY2A 4JHVA 2VM3A 1SNRA 5TK2A 1KDIA 1UATA 4BDVB 2H3XC 3H4FA 4AZUA 3JT2A 4E9SA 1JXDA 1NTDA 1KV7A 2JFCA 1A4BA 1J9TA 3NJIA 2I7SA 2IDSA 1NIEA 1XB8A 3QPKA 3TU6A 2I7OA 4Q8BA 1DZ0A 2IDTA 1CYXA 4G72B 4DP5X 1TU2A 3KW8A 2EINB 1N68A 2RACA 4ENZA 6PAZA 4BWTA 2OJ1A 1OCCB 3ERXA 1KGYE 3FSWA 1XB6A 1PF3A 4GP4B 4GP5B 1SF5A 3FU8A 1JVLA 2H5UA 4DP0X 3PXLA 2FT6A 2R7EA 1QNIA 4YL4A 5F7AA 1GY1A 1GW0A 1AANA 1M9WA 2FT7A 5LDUA 2WO2B 5I6PA 4G70B 2R7EB 3QQXA 1AS6A 1AAJA 3V9CA 1BEXA 1EZLA 2QDWA 1SFDA 5D4IA 5EHFA 1T5KA 4YSOA 5B7FA 4RH4A 3X1GA 2BP0A 3FPXA 1JXGA 2DWTA 4P5RA 3FSZA 2AFNA 1RZQA 2DV6A 2ZXWB 1OE2A 4HCGA 7PAZA 4CSZA 4BXSV 1F56A 2ZONA 3CVCA 1PNDA 4DP7X 2H47C 1YLBB 2EIJB 2FQFA 9PCYA 2NRDA 4L0PB 3IEAA 2A3TA 1JZEA 2J56A 1URIA 2IAAC 1NPJA 4NB7A 1GY2A 5D4HA 7PCYA 3T6XA 1RCYA 3OMIB 4KO5A 1OOWA 4DP2X 2XV2A 1KDJA 2CUAA 2PPDA 1NWOA 2LLNA 2B08A 1KCBA 1AACA 1L9TA 2IDQA 3OMAB 1E5ZA 2TSBA 3ZBMA 1EHKB 4BWUA 2YAEA 2YQBA 5I5IA 1OV8A 5PCYA 1J5CA 3IN2A 3FYIB 3NJNA 1DYZA 4BWWA 1AR1B 2GI0A 1AZCA 2GB2A
chains in the Genus database with same CATH superfamily
4BRVA 1JTTA 1EERB 2ODIA 4LOUC 2X70A 4XP5L 4XNXH 3ZO0A 4WHCA 3MBXL 3ARPA 4LLAA 1U21A 3L8QA 4YVUA 3NSYA 3DXAE 5DK2A 2XWTA 3FH7A 2GJ6E 3X12B 2YOAA 5HJ3B 1G7IB 4RMRA 3E9TA 3UEQA 5C3LD 2Y2YA 3HIZA 1F58L 3PWJA 4N85A 4WQOA 1YEEL 4NN7B 3VXNB 4YZWA 2MOVA 3BKCH 3MRKA 3H56A 1NFKA 3T6QC 3QWOA 1W0VA 2CLRB 2HRPL 5E99L 2VR9A 3QDMD 3TLRA 3UTSD 4EBQH 3DO4A 2MTAA 1J9SA 3ARXA 2UWEB 1SEQL 4MLIA 3WO4C 2V2XA 2G9KA 4YSEA 4JFFE 4E5XB 3QO1A 2VERA 2W8CA 3B6SA 1U3ZA 2WQRA 3G3LA 5IHLB 3RIAK 4D9RE 1BLNA 1FNHA 1XZWA 4LF3B 5F71A 4Y2OA 1YNLL 1Y6NR 4M4PA 1QHPA 1BM3H 1PNCA 3NIFE 1Y18B 2CK0L 3VNZA 1UD4A 4JM2C 3Q13A 4FG6D 4J8RB 2ZUUA 1W0YT 4GSDL 3NCFB 2OX5B 4BKLB 3CDGB 1IBHA 3TPKA 1WIPA 2EIMB 3QXVA 3TVMB 3IS1X 4JZJB 3QRFM 1HH9B 1BLIA 3F12A 5LCVL 1IVTA 1E7VA 3B7SA 4IGBA 2E7DA 2MH4A 2C4XA 4R5VA 1IEHA 1AGFA 3WYRA 4PG2A 1M57B 2EYSB 1KCRH 1F4XH 1XF1A 1AO7A 1KPUA 1I1RA 1AGDA 5EDSA 4LLDB 2C7FA 3BQUB 5CLYA 1HKLH 1DL7L 2EO9A 3RWIA 1OM3L 2NY5C 1WFUA 4X5WB 3E8VA 4IU3A 4J1UB 4YXKL 5HHVH 1A3LL 1F86A 1I1FA 2B77A 1FDLL 1S5HB 1QFPA 5CWSB 1ASQA 3ARZA 2VW4A 5FLUA 2WMPB 3DX8A 3LRSB 2VR8A 5J3HD 4H8WH 2DI8A 1K8DA 5CILL 4Z3FA 3V4PB 3BEVB 2AJYL 3FQUB 3PQYA 3HJEA 1JRHL 4PJ8A 2EKSB 1B4TA 1OAUH 1G0YR 3NFNB 5TFSH 4UYPA 3L4XA 1U6AL 2CJ3A 2B2XL 5E1GA 5D4JA 2OMBA 1SFHA 1A22B 1EO8L 1BZ8A 4M1DL 1PKQA 4KKQA 5I1EH 4PJGF 3TFKC 2IOIA 1XGQB 4YO0A 1MCPL 1IEBA 1GYAA 4N0CC 2EVFA 4Q9RH 4YGVA 2WUCL 2VRAA 1U2CA 3S35H 3S6CA 4ODXA 4NKDA 5JNYA 1I8IA 2PETA 5SX5K 3FTYA 4UOJA 3ZTDC 1FN4B 2FEEI 5CCJA 2V4LA 2P5WB 1X9QA 4L37B 1CTMA 1FCGA 2NY4B 1HIML 4MVBC 3IVKA 1R34A 5KVGH 3T9WA 3ZDZF 2BDNL 3MSPA 4R90L 3E6HB 4RZCB 1WA0X 1M71A 3J27A 4XRCB 2XZZA 4LOEA 4WW1A 1U0QA 5D5MB 1E2WA 4G8GB 3CX2A 4AYEC 3RKDD 3ENEA 3MOAL 2CR0A 3THML 3LN5B 4N9GA 1X4XA 4QHKJ 4HKJB 4OJCA 2K9UA 5HJDA 3MKGA 3BOVA 3B7RL 1U6AH 1K4DB 1B88A 4DN4H 3QUXA 1G6RB 1G9MH 2DWEA 4QGYA 4OAWB 3WDHA 3KLHC 1A7QH 1RPQA 1L9SA 5I5JA 2DH2A 4NZRH 5BOJA 3V6BR 1G1CA 3Q06A 4AITA 2HTLC 1E4JA 1DQVA 2GFBA 4AEEA 3HOGA 4GAJH 2DQHL 4HEMA 4OLUL 3HG0A 3NFPB 5FA4A 2X2HA 4MJIB 2VXVL 3MGAA 3FTSA 3NCEB 5ADPH 4KX8A 5DRXA 1ITBB 2PXYB 2Q7YB 2PWDA 2OJEB 5JHLL 4KY2A 2A7BA 3BESR 1DQQA 1XMWA 1VZIA 4GEIA 4Q9RL 3UG3A 5F89B 3V8OA 2UY7A 3F85A 4FQXC 2P80A 1Y0LA 1O9ZA 3KYOA 4EIZC 4WFEE 1FFRA 5EBLB 1OSYA 5TDPA 2NY2B 3GMNA 1CUOA 3KPQB 4QHMB 5HHOA 3MJ9H 3T0VA 3UBHA 3OKEA 5DA4A 3L7FA 2AJYH 2HUEA 4L1LA 2O6PA 3SPHA 3U0WH 2PMZA 3ES6A 3CHPA 2BSTB 4QHLA 3D0AA 3S34L 1ZKAA 3SE4A 1P2CA 2A9AA 2GVYA 4J6IA 5AAMA 5BXFA 1NMAH 5L8JB 3FQTA 2NX5D 1CDIA 3LVEA 4OQTH 5MENB 2GQHA 5E23A 2FJHA 2I32A 3KGTA 4JDEB 4UT9H 4FZEL 4U4IA 4PV8A 1XSIA 3AITA 3I9GH 3CGTA 5CN1A 3VXOA 1L9PA 4M7KL 4HBCL 4LVNB 1A1OA 3VUAA 1KYDA 2MQ0A 4NCC2 1N64L 2PO6A 2QELA 3QIWB 2P7TB 1NEZB 4XMZA 3RRQA 4ZX4A 1H3XA 4J3OD 3SO5A 1RUAH 2ZCHH 3HC0B 3R0NA 3E1F1 1Z66A 1GZQB 3P2TA 4JG1H 5E4IA 5LG1A 3FFCA 4RQQA 3SJVE 4Y4FC 4IK7A 1NGYB 3VWKC 2X10A 1U8PB 2H2PD 1PY9A 4AM0Q 3NZHH 3AC0A 1OCWH 3BUYA 3IRCA 1TTRA 4GMTL 1FL6A 3T0ED 3O8XA 3U0WL 4UQ3A 3L1GA 1R33A 3EDEA 4IDJL 2R23B 1MDAA 3FO0L 3H9HA 4LKCB 4O2FB 1JPFA 4ZOAA 5AVXB 2AGJL 1D5IH 2MFNA 1DN2A 1WWBX 4C47A 1FCCA 1GZHC 3N40F 3LSOB 1MI5E 3VFSB 4MQXC 1BOGA 3VGAC 2CBQA 1UXSA 1M2VA 2NT1A 3HZKB 4LSUL 2QKIA 1UB5A 3QS2A 3BI9X 4OD1H 3L9RA 1B0IA 2F54B 3GSOB 4ORGB 5HYJD 4O5LL 43CAA 1K5WA 5I76B 2AI0H 1UGNA 3NT0A 4J6RH 4N90E 4OT1L 3K7UA 4GBXD 4MJJA 3SQOH 1L6ZA 2X70B 3QUML 4RFNC 1DTUA 2BNRA 3CFJA 1YJDC 1BFOB 5I0ZA 1D9KA 1MAKA 1T6VN 4K5MA 5J3HC 1OSPH 2X9XA 5D7LE 2W9EL 5E1HB 3VYOA 2G3XA 4YSUA 5INDA 1NCBH 4DVBB 2J8UB 3KPSE 1CFTA 1FFNB 1KZYA 2Y07H 1RZFH 5F1IB 2HVKB 1A9BA 3HMWH 2DH3A 2K6WA 2Y22A 2XIBA 2Z65C 2F15A 2CA4A 5TTRA 1T04A 4MBOA 4I0PA 3GMPA 4I5BB 3SQBB 3D48R 5CFHA 4H44C 1UD3A 2ZPKH 1L7TH 3VRIA 1RK7A 1JWUB 2K0RA 5LCVA 2DB8A 3VJ6B 4E5XA 3WFDL 5AUMB 2XTJE 1KNOA 2ZCKH 3C8HA 3UBXA 4G9FD 3CU1A 4ZT1A 5BRZA 1XH1A 4QWWC 3I02A 4UANA 2P8PB 3KGRA 1D5IL 3L4CA 3QNYA 1KWGA 2WWNA 3QXDB 2VQ1A 3EXLA 3NCJL 5EOCL 4G71B 5KN5A 3VW3H 4H25B 1VFBB 5FF6A 3VGFA 4PJAA 5AKRA 1SN2A 2IVFC 4PJ6A 1QSFE 2YO3A 5D7SL 5EA0L 4XMUA 1R3HB 4NQCA 4HKZB 3SQOL 4EE2A 2R2BA 4HC1A 4K3DH 4MB4A 1F42A 1NAMB 4WHTA 1DDHB 2X41A 2XXGA 5F6HI 1JZHA 1H6TA 1WAAF 2J4WL 3CLFL 1F4HA 3FL7A 1KJVA 2A4ZA 5TE7L 4AQ1C 4Y9CA 3AQDA 2WYIA 3QULA 2ADJB 4PRPE 1GGTA 3C6LA 1Z5LA 2DY2A 4A7GF 2ADYA 4LVEA 1DBMH 1UXWB 4JUTA 3PDOA 5TK2A 1N5AA 4M9OA 3T1FB 4IKNA 3SKMA 1CLZH 4P4KB 3FUDA 4XB3A 4RAVA 3JUZA 4JY6B 3TBVA 4Z7WA 1A4BA 1HKFA 3FZUD 1I8KA 1MRCH 4LMQE 4ZNCD 2I7SA 4ZXBC 4F37K 4R4NC 3MKKA 4D9RD 2VDNB 4PR5B 3Q0HA 1E27A 5FECB 3LIZL 3EW3B 1J0ZA 4XT1C 4PWEA 4HS8L 4Y5XC 5JR1L 3PXHA 4MXVF 2CU9A 3OJDB 4IJ3B 2J1YA 4RRPG 2BOBA 5LGHL 1SLUA 2ITDA 1NMCC 3GMRB 2VL5A 2XPGA 3CN1A 3IJEA 4HUXB 3D0VB 4YX2L 1QNIA 1T1ZB 1XGQA 3RWCB 5G4NA 1R3JA 1GW0A 1QHOA 4P2OB 6TAAA 5GRYA 5K9JL 3RBGA 1DEEA 1OZUA 2JIXA 1HI6B 3LTVA 3ZKXB 1GOFA 1TJIL 1J8HE 2QDWA 3WFBL 1T5KA 2C5DC 3HZMB 5DHVA 3TJHC 3PWUB 3X3GL 2YA1A 1KN4H 3TIDA 4Z5RA 3ZKND 4DKFL 3NCWA 3E0GA 4AQOA 2G3MA 1U8QB 2DV6A 3KYMA 3IMBA 1BA9A 5DC9B 1OO2A 2IGFH 3RVWD 5F7EL 2XG5B 2Z93A 2ZONA 1G43A 2RMNA 3GJFA 3S4SG 1BQLH 3DX3A 4HPYH 5D2NE 1SUJA 2C9UA 2WJ7A 3L3OA 4HZLA 4Z3IA 1SOKA 4JRXD 5FGBC 2Z4QB 1M05A 5IQMA 4RAUB 4OAWA 5GGTH 1NPJA 2IH1B 3MGOA 1KGUA 1EX0A 2DQFB 1XWVA 1XHHA 4G9DA 3WXVL 5D4QA 4LFHD 2X44D 1I8LC 2BDNH 2IDQA 2X38A 3QQNA 5JORB 1ULVA 1IM9D 3K4ZA 2OPCA 4JREB 3C5JB 2YQGA 4WNJA 1OV8A 4PVMA 3KBPA 1AKJD 4IRSC 4BWWA 3CQFA 3WFCL 3K6FA 4JRFA 2V2TB 3ZOAA 3H3KA 4UOW1 3HW7A 5DJ6A 1YVLA 5CCHE 1ILSA 4O9HH 4JHUA 1YEJH 4OIBA 2XN9D 3NOIA 1P4BL 2E75C 4PTTA 2YEVB 4W4NA 1X44A 2UY7B 3V0HA 4LOVA 4TKWA 4K15A 2E9WA 3CXHJ 1F1DA 1BFTA 1NINA 1PLGL 3O2VH 4KK8D 3T2OA 4ABQA 5EZIH 4F91B 4AG4H 2BM3A 5G2NA 5T3ZH 3TCLA 4N1HB 5HHOB 3QZWG 1WS7A 4Y5VA 2FX8L 4N8CH 2WXRA 3BGFC 4PRBA 5C0FA 2JTDA 4N3TA 2Q86B 2BY2A 1J0HA 3PNWB 2CR6A 3RI5F 5C3IA 5IROD 5IMMA 1EO5A 3DK2A 1CGSH 5B38B 2OTWB 3EH3B 4MAYB 4JDEA 4E42B 1V7ML 4QRSA 3CFDA 4B9YA 5EU5A 3NJFA 1IC0A 3AS3A 3VWJD 3R06A 3O3EB 2YLHA 3SGKC 5GS1B 5JW4M 2CMRH 2YGNA 4FA6A 4W9FC 3G5ZB 1MSPA 3ILPB 3P4MB 1OAYL 5T1DL 4YQXH 2X6UA 2HG5A 3I50H 4I18B 4OLYH 3ECVA 3F00A 5ERWA 5F7UA 4NT6A 3HE6D 2VISA 3NIDB 1AJ7L 3VFMB 3AM8A 4HV8A 4OIIH 5E8OA 1B90A 1UD2A 1OK0A 4UYQA 2VZ3A 2WP3T 4YEFA 3OLIA 1UZ6F 5D72H 3AG4B 1CD1A 1A3QA 5IVNA 3VYPA 2R23A 1HAUA 1CVSC 1NDGA 3TT3H 1ED3A 1GVIA 3QYCA 4F7EA 1RD6A 3AXLA 3GT6A 2GC7C 3IRPX 2BHYA 3UAFA 3GJFH 5I74B 4PJDE 3T77B 1C16A 2BP5M 2ATAA 2DQEL 1CB4A 1ZT4A 4MNGB 4XMWA 4DH2A 5M94B 1A6AB 2BVOA 1ADQL 3QQDA 1FVEB 3L9RB 3NJKA 4LXFA 5GGSY 3EZ8A 4CSPA 2CO6A 5KYNA 3UAJC 5F9OL 4KMTL 4N25A 2NY7H 5CINL 3NJXA 3ARVA 3O4OC 4KUCF 4L18A 4JM2B 1M3IA 1FNGB 4UCFA 4KXBA 4RGOL 2YKKA 1KCSH 5F93C 3QIBD 3W11D 4Z7WF 4ZUWA 1WITA 5DURD 4D9QD 3CH8A 2IAMC 4IU2A 3PUUA 5AVTB 1XIWA 5CEZH 4GO9A 4HEPA 2WXNA 4W93A 5C08A 1HYSC 1A9BB 4LGPB 3SYOA 2W0PA 2K3HA 2LLGA 2CHDA 4CN4A 2EIEA 5DWPA 3ECBB 2VMFA 4NSKA 1T04B 5D7HA 3ULUL 3FB8A 4Y2DD 2IFFH 1EMTH 5T1MB 4L1TA 4JB9L 1OOAA 5JIPA 3EGDA 1QRNE 5FHAL 4M8RA 3SDXA 1TVHA 2D3LA 4GP8B 3MRPA 1WBXA 3DIVA 1S7VA 4X9IA 1TVBA 4HX1B 4PY8I 1CXFA 4GKSB 3K6NA 1NL0L 4DK6A 4XC1H 1NCWL 2XA3A 1KB3A 4I13B 5EIVA 3Q01A 3BKCL 2D7TH 1OZTG 1YEKH 2EE9A 3CVHA 3HZ3A 3AS2A 3OG4B 4L4VB 3QJSB 2CZNA 4G11A 1WBYA 4PJCB 2NLJB 2V33A 3O3AA 3TT3L 4QIRA 4JZOB 2FBJH 3UTSB 1R3HA 2OL3A 5CUSH 3M8OH 3MROA 3IT8D 2R9HC 3V79C 1AJ7H 2WW8A 2NW2B 4GXVH 3CSGA 3BO8B 3OB0K 4ZDHB 2FSDA 3GMOA 3MA9L 3KLAB 5G4OA 3UDWA 2R0LH 2OA9A 2FHCA 4K3EL 3TNMA 2EDEA 2QPEB 4PJDB 1OGSA 5FUZL 2A9ML 4P8QA 3G7TA 1R3IL 1IV8A 3ABMB 5DC0A 5F88B 5KANI 1JYWA 4AEIH 4U6YB 1G5AA 4OFYA 5BQDA 1F13A 1E4WH 1J8HA 4Y9FA 4ZMQA 1SBBA 1J8RA 1P0SE 1U8KA 5D6DA 1E27B 4QKTA 2VDKL 2WKOF 2C1OB 2W07B 3B9KC 2NY6B 4WSGA 4OY9A 5LB1A 5IF0A 4JO1H 4JGMA 1P5UA 4E5XG 4RMBA 2ITDB 1T89C 2UY6A 3IGAA 5ESQA 3WXVH 2VLKE 2HLFC 1DLFL 4JFOB 4JRXB 4KQ3L 1IIIA 3NIGF 2N7SA 2XWBB 5DJ2A 1R3JB 1HZHL 3GDBA 3T8XB 3HI6H 5IV2B 2GSMB 3KEHA 4XCEB 1FNFA 2HT4D 5EB9A 4FGMA 3BJLA 4BQ9A 4KVNH 4MA7L 3HC4H 1IT9H 2YD7A 1DLHB 5T3XH 1ETJA 2XXMB 3Q8EA 4F2FA 1V05A 1ND0B 3EH5B 1EBAA 3F7VA 3L16A 3MX0A 4K7PH 5L4MA 3WFZA 3AJ7A 1Q72H 4HHGA 3AT9A 4PGJA 3KPMB 3LXBA 1EEQA 1TPXC 3KG5A 4JUSA 4RGNE 3AG1B 1EEUA 1PLAA 3KLDA 3M1BB 4HGKC 2B0SH 4JPWL 4MD0A 1SQMA 4XI5D 4HIIA 5DK0A 3MLVL 2BFVL 3IB4A 4GAFB 3VQLA 4F37F 4Z8FL 3SKOA 1G87A 3JWNG 1G7IA 4X98A 2WKLA 2L3BA 1RZJC 2QFPA 2QPDB 3QJVB 4XPBH 2Z4QA 2P8LA 4RAUA 1ZT1A 3RWJB 1RY7B 3GI9L 4V2CB 3WD5H 4IS6A 3WXWL 4QLWA 3MDJA 5I0XA 1NMBL 1JYVA 1KZQA 1RLWA 1Q9KA 4F33B 1GYUA 2A77L 2YWYA 1NC4B 3HS0A 4UT7H 2A6IA 5DD1H 5CKGA 4KITB 4LAJH 5DLML 4J3OG 3AG2B 4QHUA 1XCTB 2DEYX 4JW3A 2QQNH 1R5VA 5GJTL 1UWGH 1S7QB 4MAYD 2EE3A 4AGLA 3CDFA 1QBMH 3L5WB 1NPUA 3I6SA 5DS8A 1M1XA 5GGVY 3WFBH 1UH3A 4ALAH 4DGIH 2WO3B 2B9BA 2LABA 4RGMC 5D1XA 4HQQH 3CDGA 4LP4A 1AD9A 2CO7A 4I48A 4LCWA 2Z64C 3MZTA 2GCYB 5TE7H 4HU2A 4Z7AA 3N43B 3TV3L 3C5ZD 3QZWB 5F7NC 3SBQA 4HIJB 2VSCA 1MH5A 3IDIA 4BELD 2K1MA 4NRXB 3EKCA 5E4EC 2VXQH 2B7DT 1HCZA 1U36A 4MJID 3FPYA 2NR6A 2QBWA 4R84A 1LEKA 2FECI 5H35A 1JWSB 4ODVL 2BNQE 3FT2B 1EXGA 2XTSA 4XCFL 4NAQA 2VLJE 5CN2A 3U1SL 1KTKE 4N0YH 1EO7A 2Q8AH 3HPJB 3A5VA 5F70A 4NKMA 2WGNB 1KCVL 3DPBB 4XO4A 4F5CA 1ACYH 5BZWA 1KWKA 1UWGL 4CA4A 1WC7B 3CFMA 3TBWB 5DHXB 1MVUB 4KROD 3C09B 2F5BH 2ILLA 1I9RH 2VDLL 4OFYD 3DA0A 1BIHA 3BD4A 2ZPKL 3HPLA 2IGLA 2NSMA 1HNFA 1LD9B 1P7QA 3U9UB 1UH2A 3B3IA 1NBQA 3ULUE 2LLLA 3PY9A 2WB7A 3RVUC 1OQOA 3VH8B 3DLQR 3ZR5A 1U3HB 1TQCC 2X5PA 3ARUA 1LGVA 2HB0A 4Z8FH 3WUWG 1IC7H 2OMUA 5HDQH 1AIFA 1NFIA 5JW5A 1NFDB 3BPOB 1HJBC 4XBMA 4DZ8B 1YEDB 3QDJB 2FIKA 4FP8L 4ICWA 1UATA 1XF4B 3ZK0A 4ZRGA 1KGCD 5IBLC 2D0HA 4GSXA 4FQCH 3ZDXE 1YNTB 1JUFB 4LVOB 3QQDB 5L88L 3D0LA 4S1RH 3BAWA 4K5OA 1U3YA 4NQDA 4TQEH 1YCSA 3LEXB 4NNXB 5IK3B 2J6WA 3U7YL 3WAJA 1FE8H 4PSRA 4OFPA 4WTWA 3T5WA 1KJMA 3L81A 2B14A 1T2XA 2EINB 2V5SA 5AVRB 2EDRA 1K6QL 3WLBA 4ELDA 1ZHKB 1TU2B 1F41A 1GGBH 4UB0L 5JW3H 4O51B 2RIKA 4ZUWB 2XBDA 2HTLD 1CTOA 2ICEA 2F5BL 3LXCA 3VYNA 4WO4A 2OMTA 5C0BA 1KTJA 5IQ7H 3VFOA 5I16B 1BG9A 5DZJA 1VPOH 3MTRA 3WKML 1JF1A 1F97A 5F6IC 5DDHB 4WHYH 3FB8B 2XQBH 3V6ZB 3SJVB 1SFDA 4J39A 2O6FA 1WE5A 3OAUH 1S9YB 4JKPH 2Q7YA 4OZ4A 3VI4F 1BVZA 3PWLA 2XJLA 2VZVA 2H47C 5C8JA 5DEFA 3LOWA 3ZU8A 5JW4Q 4CN6A 3K6SA 4CMHB 5EG6C 1MJJA 4ZS7L 4L1SA 1NAKH 3OKEB 3QB7C 4TUJA 5ID0B 1F2QA 2WN3A 4WSKA 5DR5L 4J12A 2X4UA 5I8OH 3HFMH 3MPCA 4QHLB 4D0CB 2DMHA 5E7FA 1MCKA 1EHKB 2NW2A 4XXCA 1BLNB 4TL4A 4ZDHA 5KYXA 1O7SA 4KMLB 4YH6A 1NJ9B 4GRWE 4P5TB 4XZUB 1Z0NA 1TTBA 4YE4H 1EH9A 2IJ0C 1WZ1H 1NOFA 2JXMA 3AUWB 3UTQA 1N64H 5H8DA 2N0KA 3QUMB 4L8SC 2AJSL 2ZJSH 3O6FC 1QFWI 4B9ZA 2RQ8A 2B1HL 3V7MA 5F3BA 2HRGA 2G9HA 5AVQB 1NCAH 4L4VD 1HH9A 2PR4H 2UX6A 3NSJA 3GSNL 4PJXA 5CNHA 3BVUA 2YN3A 2W81C 2WLLB 1NGYA 3SE3C 3DUHA 1U8PA 2D7NA 4FXKB 4TUKH 5F7MC 4JDVA 4DESA 4DSYA 1RIHL 3FFCD 3C5ZC 3BQUA 4R7NA 4DUWA 3JV6A 4R4FL 5FCSH 2B1OA 5I0VA 2OR9L 5DK3A 2V0AA 2A77H 2CLVA 1I9JH 4BH8B 3T6ZA 3LSOA 1T0MA 2WXKA 3GLZA 4OZIF 3QHTC 4QOKB 4KQ3H 2CUIA 1RQ5A 5E00A 3FT1A 2R4SH 3JSSA 3JZYA 3THMH 1SYVB 1J8KA 2F54A 2J73A 3GSOA 3QQ3A 4ORGA 2VYRE 4HD5A 4GW5B 1RIVH 5FYJD 3FOMA 1A7NL 5HI3C 3VM5A 1MCWM 2XWTB 4N2EA 2BCKA 4RFOH 1I1YB 1KLFA 3EBGA 2DQHH 3L95A 3Q2WA 4KVCL 1U30A 5DK0B 5EOQL 4B9KC 4ZNEA 1SJMA 1WT5A 3FUKA 4XTRD 3BKMH 3LNHA 5I0DA 1AHWC 1JHLL 4LCUB 4P2AA 2PWGA 2EVIA 2HT3C 5JZ7C 2CDEB 1N70A 2WWMC 2APWA 3IGKA 2Q7AA 3GGWA 4RVBA 1LO5A 2IBZX 1RZKC 3EJSA 1CXIA 8PAZA 4NP4L 3RAJH 3PHAA 2V2XB 2IIJA 2WXPA 3ARFA 4UM9A 4Z7VB 5BOPA 1TJHH 3MUJA 3S5LB 4GINA 1KYAA 5FFGA 2X1XR 4NPYB 2WCPA 4XVSH 2PW1A 3HS0B 3QAZB 3H1ZA 5IEKA 3VJ6A 5K1NA 2VC2B 1AOHA 3S36H 5DJZA 3VH8G 1J1PL 3OMZA 4LSSH 1T20A 5FGCE 3T0AA 2X3AA 3K5RA 5DFVD 5KBPA 1T2JA 2FWLB 3FN9A 1EDYA 5F7HA 1DN0A 3QJRB 2JB5L 4QT5A 1AD9B 2CO7B 3G9AB 4I48B 4H5SA 4NNYA 4I18C 5PAZA 3RJQB 1N8OE 3VD1A 1X7QB 1EZVY 35C8H 5F21B 4IDLA 2VKWA 2ZZUT 4PJIA 4HKZA 1HCFX 1C7TA 2FK9A 4RNRB 4JPSA 5J12B 3ULUH 1RZ8B 3O3BB 1JPGA 2VXUH 5ICYB 1FG2B 1M7XA 1QW9A 1NC4D 2ADJA 2W0LA 3MHZA 1LO0H 4JFPB 1N5AB 1H8SA 2P1YA 3BFWA 1S5HA 5CUSL 3ZHLA 1NGWB 3NZSA 2ZSWB 4H1LB 1W0WB 2JK5B 1H3UA 1KN2H 4JFXA 4PJ7E 4YHMH 4HUWB 1LJMA 3MRGB 3UPAA 1U41A 1LWJA 4Z0BL 3BKYH 5KVDH 1LK2B 2BNQA 4EI5C 1QBBA 5ALBH 3MRMA 5C07B 3VXSA 4L5FE 4ZFQA 1EVUA 2OSXA 3B3IB 4CNIB 5DHDA 2F68X 3L2LA 4L8DB 4M6AA 4YDVB 5FOJA 1FO0L 5TQ2H 3OJDA 4IEFB 1NL0H 1OEZW 4NS0A 4TPRL 2KLSA 3WG7B 4KKBC 4OD2B 1JV5A 4YGVB 4AL8H 3NZ8B 1XF2A 3H9SD 5F3FA 5FPIA 4JFED 2BHUA 3TA3D 1XCXA 4U3SA 4APQB 1FN4A 4XVTL 3GSVB 3ULVC 3QDJA 2G30A 4FFZL 4R96A 3O6KL 3QEQB 1HI6A 2APSA 2BNRE 2HXAA 1O9WA 3MXWL 1MFUA 3REWA 4BYHA 4MSWB 1OCZB 1VZGA 2WSDA 2F7OA 5JHLA 2PPCA 2JV6A 1R24A 5E6YA 4LLUA 5DHVB 2AANA 4PJHF 2YUZA 1TXKA 2WWKT 1RURH 4RQQB 3ELQA 4WW1B 5T33L 1T2QH 3K2UL 4XXWC 1BECA 2YUVA 3FN3A 5MEPA 3CZUB 4TSBH 4WJ5B 1T03L 4WK4B 4HKJA 1F6AA 5FX3A 3VFTA 1FZMA 4EZJA 4EIUA 3GK8L 2LTQB 2GG1A 3D4CA 4X6CA 2AXFB 2ZP9A 1WH0A 1AXSA 4HZLB 2DQJH 1JZIA 3QORB 1U3HD 2FRGP 4X4MA 1PG7L 4OLUH 3D50A 5HHNA 2JJUA 5DJAB 1ICTA 4YBQD 1RPKA 4U1LB 1MFAL 2NNCA 4HXAL 3D3VA 1MJ7H 4B9IA 3PGCA 5E2UH 1YMMB 1GJUA 4HWBA 5CLTA 4JANB 3TX4A 3HC4L 5DRXB 2XETA 5L6YL 4YK4C 1XMEB 4UF7C 2PP9A 1BFOA 1JGUL 2B39A 3MNVA 4YHPA 1QFWL 3B5TA 2YAFA 3KPSD 1JWMB 1TJXA 4N0UA 3UJIH 2KYIA 5H37H 1CFQA 1CGYA 2Y6SD 1WUNT 2BHFA 2BFGA 4EXKA 4GG6A 1CFTB 1FFNA 4K3GA 1OTSC 2TSAA 2YMOA 5F1IA 2GEEA 3CPUA 5AG9A 4JDZA 1AGBA 3FCSA 4IIZA 2E9JA 1TJHL 1UHVA 3OD3A 5DEFB 5JMOC 4FQLH 5IESL 1SBSL 4K23L 3QUYA 4URTB 4AQZA 3QBTB 1TYEB 3B9KB 3FU3A 2XCMC 5SWZB 1S8DB 3D87B 3EDJA 4LCCC 1R5IB 4ZO7A 1P1ZA 3EYVB 3ZDZB 3BZFB 3RL2B 4NZUH 4P4RB 5T5FH 5I1LB 2X4UB 1MF2H 1HWGB 1WK0A 3LMJH 3UBXB 1CFNB 4CKVX 2HLAA 2FT8A 4PU2A 2EAEA 5EZJB 1YQVH 3NCXA 3PNWA 4PV9B 4QTIL 2JCCA 3SZ6A 2VT0A 4XZUA 2E6JA 3CHOA 3K81A 2WJ5A 3K2KA 4XMKH 4HIQA 2V3FA 3CXDH 4MBRA 4TLKA 4QOKD 4AGPA 1CXKA 3WHXA 4X9FA 4FFYH 3SD2A 1W6LA 3MJ8B 4PJAB 4DP6X 1QSFD 2JJWA 2DWYA 3R06B 1ZS2A 3M7OA 3II3A 3T0DA 4JFZH 1JIBA 1X5HA 3MLUL 3FTWA 1Q1JH 4L3EE 3ILPA 3LAFA 3J07A 1FHGA 2XWEA 4OJAA 3MUY1 2R2BB 1KV3A 1VGKB 1OARH 2FLMA 2Z92A 1FVDA 4L3CB 4GEJA 3RDTB 1GTFA 4LRIA 3WUZA 1DDHA 1N7ML 3DKHA 1XGYH 5CBEB 4HV8B 3SPGA 2ZCZA 3FQWA 4JPIB 4P04A 3W0WA 2F19L 4ORZC 1GA2A 3BRGC 4OKVB 5C0CB 1I9EA 2K70A 1Z5LB 3DDGA 3ZX1A 1FH5H 4PMFA 2BNUB 5EWIL 3DJRA 5DZLA 3HN3A 3VFSA 2L04A 2DJSA 4ZUUA 1EJOL 4P4KA 1IZJA 5TK4A 1OVZA 3AXLB 4G8EB 3PIQA 4UILL 3VFUB 5HYJA 2OMZB 3VFVB 1KB5H 1MW0A 4GQ9H 5FAAA 1BBJA 1Z6JT 4XPAL 1C16B 1XDTT 1L0YA 3DYOA 1A6AA 2BVOB 1QVOA 4QXVA 43CAB 3QZLA 4YX2H 1R1CA 4NCC1 2EICA 1ECZA 3ISYA 4MDRA 4DK3A 2J8UF 4J3XA 1BMZA 1WZ1L 1BJMA 3LZNA 4YHNA 2XN9A 5I6NA 5KUMA 5AW0B 3FOMB 5KVEE 4HC1H 4HS8H 5JR1H 2R2HB 4JM2A 3I6GB 2IGFL 4YZFF 2P26A 5C09D 4YDKL 3LRKA 1T83C 3H8NA 2IH3B 4CJ0A 2HVKA 2R27A 2NTFB 1CVRA 1KGWA 2OL3H 1DEEB 1U8JB 5EZLB 3BN3B 2ZSVB 4PVLA 4PWJA 3ARBA 1AXTL 4HJ1A 4CILA 2NDGA 1Z9NA 4JQXC 8FABB 3N42F 1KIPA 4P57B 4UM9B 4PTUB 1XGRA 3BCFA 1MCNA 1Q8MA 1ZANH 3BE1H 5DZNA 4L8CA 1KNOB 3F05A 2Q10A 3MREB 1EHAA 5FO8B 5IEKB 1SOXA 2GTWB 1XSJA 3NIDF 4Q8BA 3L3IB 3V8CA 4DP5X 3MJ7A 3CUPB 4JRXE 4PJAE 5DJZB 2OYLA 5D7SH 1M05B 2XQBL 4U1SA 1WBYB 2YGOA 2HG0A 1PF3A 3AMLA 2DQFA 1ORSB 1CGWA 2V9QA 4S10A 3NH7H 4PJEB 1Q94B 4TNWK 4AY0A 2FT6A 4QT5B 3MLZH 2AHIA 5IG7B 3KHOA 3WIHA 4HLEA 1B2YA 1JHKH 1UYWH 1AR1C 1YJDH 1ZLEA 3U4BL 4PJIB 1U3HC 5EIIB 4UQ9A 2ITCA 2P44B 4R7DB 3KM2A 2CMRL 1J5OL 3ZRCC 4W4OA 5HYFA 1JYXA 2ICWJ 1EZLA 1JV2A 3C6LB 5FKPB 3S2AA 2GYSA 2BSDA 4YDZA 1WGVA 1WRFA 4WW2B 2OXHB 4EDXB 3PABA 1EJ8A 1RULL 3IWUA 1B0RB 1FG2A 4I0CC 4JE4B 4NZDA 3OV6A 3FPXA 4F8PA 4QF1A 3OGOE 3MN8A 4GO8A 4JFPA 2ZXWB 4XCNA 1OWWA 4JQVA 4MVBD 3UMNA 3JWOL 3MCYA 3VACA 4U6YA 4UNTA 3KPSA 3ZE2F 4JFDA 3NPSB 3N1MC 5AW5B 2B0SL 2DQCH 3LH2L 4JFXB 5JHDD 1FYTA 3Q3GA 1DUZB 1BBDL 5CN3A 1D6EB 2CRZA 1DHKA 3RVTC 4E36A 5AWNL 1ZLUK 1DBAL 1CDHA 5C07A 3VXSB 1BIIB 5KS9A 1URIA 2OTUA 1HH6B 3CFKA 1D2PA 4Z7WE 2VL5B 3STZB 4NYLB 4P49A 2X2YA 1KDJA 2Q86A 4IEFA 3D0VA 3GTNA 4GKZA 4LEOA 3SGKA 1MRDL 5D1QE 4EDWL 4M29A 2FVNA 5IVXE 2CUMA 1HZHH 1J5OH 1AFVH 4QRSB 1Z5YD 4YXLL 3FYIB 2G3ZA 1SM3L 4ZAKB 2EYRA 3K46A 3LKRA 2NR6C 3AQZA 4WFGE 5ETUA 1KTBA 1S46A 4DPBX 3WIAA 4ZG1A 1FL5B 2QQLH 5BOZG 2PWEA 3MLZL 5TPWL 3CCHB 3V0WL 1OHQA 4P9HH 2FX7L 3LRMA 3KYKL 1N8ZA 5DEZA 2L8AA 4XVTH 3RPBA 4JM4H 2OCCB 4LLUB 2ENSA 1F2XK 1J1OH 4IYKA 1WAEA 4WTQA 3ZDYE 3EFFB 3CSYB 4NT6B 1GSMA 2ERJB 2HX9A 2XG5A 4HUCA 3W5MA 3OVUB 1ADWA 2VXQL 2VO8A 3L3OB 4BFOA 3H7BB 3QFJD 2BC4B 3QJUB 5IMOA 3PWJB 5L8KB 5A2IH 5FUCE 5F96L 5SX5H 2M8XA 1ED3B 5C3TA 4KO9A 3SPVB 1G9HA 3FB7B 3IYLW 3MGOB 3M1CA 5DZ9A 1JTOA 1ZWIA 1CD8A 1E4XI 2OR9H 1ZT1B 2VH5L 3EO9H 5HGHA 4DP1X 4YSPA 3VNYA 4WNQA 2O4EA 5D2NA 5FW6A 3PGDA 5SWZD 3FN0H 4HISA 4I9WE 3SY6A 4FA8A 5FA3B 3G9VA 4DAGH 3HS8A 2WNWA 4F57L 4F92B 2N3JA 1EHLL 4LSPH 5EDXA 1TNMA 1FORL 4BH7B 5JW4N 2MKLC 2NUPB 5CU9A 3VQ1C 3OSKA 5KYYB 3OQ3B 3QPXH 5TGBB 4WDIB 4XC3H 1GRWA 4WUUE 1R5VB 3T65B 3U36A 2VR5A 4X80L 5CJQH 4B9PA 3MNVB 4PB0L 3TFKD 4JQIL 2EUWA 1JGVL 1N19A 2F8XC 1RU9H 3BSZH 3KBHE 4QRAA 5I6LA 1FGVH 3L9EA 1OAXH 2OX5A 4A38A 5I6OA 5AENA 2EXYD 1MZZA 2ZNWA 2PTTB 2D7TL 5J6SA 1F1AA 3TA4D 4PJ9A 5CEYB 2J8UE 1CF1A 1OP9A 2Q8BL 2WQ8A 2JI2A 2EH7L 3OMNB 1FFOA 4BK5A 4MD4A 2GCYA 2K3TA 2H32A 5GGTA 4ZMOA 2V17H 1ZLUH 5C0FB 1A1NA 3A3YB 5FGCB 1OF2A 2DWDA 4CVUA 3ARGD 1P1ZB 4JM2F 1EJOH 3JWNH 3EGXA 4ODBD 1WBXB 3L3JA 3UERA 4NQSA 4R2GD 1WCQA 3IMSA 4LLDA 1JDCA 2OMWA 1MFEH 3FQRA 1CBVL 1ZEAL 4N20A 1EBPA 2EP6A 4Z3GA 4XNZB 3HPJA 1N7MH 4NJAL 4GRLC 3FFOA 1E50A 5IM7B 3U6RA 4BQ8A 2O1AA 2V9UA 1MIML 4XMXA 3WHXB 2UVFA 1BF8A 3HG3A 5H37G 4AX3A 3RDJA 2E86A 2E9IA 1FIEA 2WIIB 3G5ZA 4GB9A 1JMZA 3DHMA 1DVFC 3EOBB 3DVIA 5AZ2L 3NACH 1DQIA 1LP9E 4Y19D 4F2EA 3ISRA 4HSAC 4N22A 2CHZA 2A9BA 4L05A 5E8OB 1VGKA 2Z92B 4F24A 2FO8A 5L2JB 2VC2L 1I1AC 4MTMA 3HR6A 1PKQB 4AE1A 1T21A 5D55A 2A6KB 5C09B 3GMLB 3K6OA 1K9TA 2EEFA 4MNHA 1IEBB 3ZE1F 32C2B 4P5KB 5HI5C 2ZP8A 4RAHA 3BKYL 5KVDL 4F7EB 4K0OA 3E38A 1DCLA 2YXVA 2VCOA 4RSVA 4W81A 1KBVA 3BHBA 4G2AA 3BWAA 1IC5L 1HN1A 2YPLE 4BZ2L 4M6NH 1JNLL 3ZDXF 1UTDA 5GS0D 1CN4A 1MAMH 3V95A 4BDVA 1IM3D 3JXAA 2EVJA 1RK1A 1J9QA 3MGTB 3T04D 2VAJA 4QUOA 2FEDD 3OHXA 4X6DA 4D94A 3RPKA 1TYRA 3RA7L 4YHOL 2P8MB 3IGFA 3LN4A 5TDNB 3RTQC 3VFRA 1XCQA 2FB4H 3BT2L 1MJUL 4FABH 1AQ8A 1WEJL 2JQZA 2CALA 5SV3A 3GIVA 1A64A 3Q2CA 4BBWA 5KVFL 4BD4A 3HNTL 3CZKA 2O5ZH 1PEWA 2SODB 4XX1G 4NJ9H 2UY6B 3IGAB 2R2HA 3UJJL 3FT3B 1HESA 4M8QA 5JQIB 3IJ8A 1I9IL 3F62A 2B4CH 3W9DA 3BC9A 4G1EB 4MB5A 3R7RA 3MRRA 2ED8A 5J89A 4XN5A 3QCVH 4I3RL 4LLVB 2FD6H 1RUPH 5CHNA 1QRNB 1NIDA 2O5XL 4L5FL 2R0WL 1SHMA 2NXYB 3TEYA 3NFPA 4MMZA 4Q74A 1KACB 3IPEA 1HQ4B 3F7VB 1HEJC 3HBQA 3C6EA 4M1GL 1NEPA 1GGYA 1V3LA 1HL8A 3PWPA 1S7VB 2DQJL 4KRNA 2PXYA 3HHSB 2VDOL 3M1BA 3X12A 3MREA 1DQQB 3QR1A 3O4LA 5DUBA 3UP6A 5IB5A 4BQBA 3S8WA 4JB9H 4MCZA 4JO2L 3U25A 5MHSD 4FS0A 4QY8B 1T03H 2OXGB 5MI0B 2WLJA 3DO3A 2WTRB 3I85A 5HHQA 3MV01 2CLRA 5JMRA 1T1YB 5FUCC 1MCHA 2GHWB 2YD5A 1EDQA 1W16A 2G4GA 3Q6FA 1LP9B 3ZYIA 1IZKA 3C08L 2H3KA 2UVEA 3ES6B 1MWAA 3QDGE 1G1OA 5IG7A 3HB3B 2MMXA 2XG4A 4Y4KC 3ARED 4C4UA 5C09E 5H4ZA 4IRJC 2C3WA 5DA0B 4O2CB 1D7FA 4A2HA 3FQTB 2WBJB 3ATEA 1BYPA 3PP4L 5B1CA 1A3RH 4K94L 3QEHA 3NDYE 3BD3A 1VEPA 4OIFA 4FYTA 1TIUA 2HLFD 2IO5A 2YPLB 5E99H 3VCLB 3MV11 4L9LB 2RQEA 2OXHA 4PREB 4WGVB 4EDXA 3T0EE 4KI5F 2ZCLH 1WFIA 2YSSB 1ZXKA 3DJZA 3UG4A 3INOA 1GS7A 1XH2A 1QQDB 2WGXA 3WO3B 4ALAL 1G0XA 5IFHL 4AQAB 1UT2A 1LO2H 4OF3A 2A4CA 1U8KB 1RUMH 4LEXL 4ZTOH 2GT9B 3DXAA 3PCYA 2G9HB 1LWHA 4WUUD 1SJEB 4HK3N 5I17B 4AUYA 1T3FA 5GGQL 1ZLWK 1PCSA 3BAKA 4D9LL 5JO5B 2L7QA 4TUKL 3C08H 5C0BD 1XTMA 1AO7B 1KPUB 4FL4B 4U4BA 1U92B 3TWCH 2X4OB 1J12A 1TJIH 1D2OA 5BRZD 2HVJB 3MBWA 3CDYA 1OE3A 2VJXA 4IU3B 2WZ5A 2NQCA 3MYZA 2QLYA 4ZAKA 3A23A 3QO0A 3I6LD 1CXLA 4GXFA 4MB3A 2QKIB 3MUGA 1TFPA 4J28A 4G6AD 2DIJA 1LO4L 4CC4C 4PB9H 5E00B 3RVXD 5AWNH 1KCWA 5I76A 2BSRA 4JPWH 2P5PA 4LPXA 3LHPH 4NHUB 4QR7A 5C07D 1KLGA 4JKKA 3TO2A 1JD7A 1ZGLP 3P73B 4G7VL 3QI9C 5ELIA 3UOAB 4DJMA 1DP0A 4PHXA 4G6JL 2QSCH 1OARL 4H8UA 5HDOA 3C2SA 2FSEB 2ITEA 5EZOH 1I7TB 2MCMA 2XVBA 3MFFB 4Y19E 3CZJA 5T3ZL 3S3SA 1EUUA 2P5WA 5I8CB 3B7YA 1RJCA 4CVXB 1CS6A 3ULVE 3LS4H 3QRBA 5TH2B 3GMPB 3SQBA 3DUSA 1DLFH 1C7SA 2AV1A 2NY3C 3GGWB 2BSEA 1WS8A 3E2HB 2UZPA 4KTEH 1IGJA 5FCUH 3S5LA 5FDYA 4FF9A 3ARDD 3EH2A 4M7ZC 2PW1B 4EN3A 5KYYA 1WA2X 4TNGA 3ABLB 3RNKB 3NBNA 2EDLA 3U36B 3WLBB 3C75A 3WY4A 4DW2L 2YARA 3ISWA 1PQZA 1ESOA 1A4AA 3P77A 4ZMTA 5JQ6H 5E6ZA 4N87A 1EO8H 1PKOA 5CD5C 1JCKA 2A9MH 5DYOA 5AW3B 5K5YA 2VC2H 3LEVH 3TF7C 5I16A 3LH9A 2D2CC 2AZUA 2CCWA 4FQHB 5CKAA 3U2SA 4MJIA 1OGPA 1T7WA 2A9NL 3B9VA 3STBA 3NN8A 3SJVA 4AJYV 4D3CH 1EJFA 3BP4A 5J6GB 5EN3A 1R47A 1F0LA 1K8IA 2QHRL 3SDDC 4HWEL 1UD8A 1OT4A 4JFDD 5F89A 5ADOH 5KSAC 1PU0A 3O9WD 1HILB 2HMIC 5BZWB 2EH8H 3KYOB 4MHHG 4R7XA 3F5WA 5E2UL 2BINA 4IMKC 5TQ0H 4HJSA 1MVUA 3PYCA 3ZQXA 1YDPB 2CCLA 5HVHC 3SBWA 2CNYA 3VFGH 4B3VA 4S1SH 2OMVB 5T1LB 3A4EA 3OGCA 3PFQA 3NCCB 3HPLB 3K6SB 5FB8A 5ICXA 4WFHD 5TE4H 4PB9L 1ZE3C 3FCTA 2AABH 1PD1A 1CG9B 3IKCB 1OP3H 1P2CB 3QT2A 3HZYA 4XPTH 1IFHH 2BOBB 5F7AA 3AQYA 3FW6A 1EAJA 5FGSA 5LGKA 3B2PA 3LZRA 2FT7A 1IKFL 4ZS6C 3ZSTA 4G3YL 5I1AA 3KJ4C 2M26A 1JTPA 3UTPD 1C5BL 1HHHB 1NA8A 4G6FD 4AUJA 1NFIB 5JW5B 5D2LE 4FTVD 1SLXA 4UZGA 5IEHB 3WTTA 1OY3B 1QABA 3AREC 1FAKT 2FIKB 3QDGD 4LARH 4ODTL 2DLFL 4RESB 1I75A 1L5GA 1IBBA 3ARQA 3JVGC 1NEZA 3UTQB 3PG2A 4IRZA 5L9DH 2EECA 4WV1B 1HXYA 1SXBA 4NOFA 4WI2A 1VESA 5AB0A 3DURA 3X1GA 3PXJA 1BMGA 1UC6A 3HZMA 4AYGA 1MHCA 1PSKH 1D3CA 5FFLA 2ESVB 1RK1B 4XP4L 2DYPA 5DD6B 4FQ2L 4MZRA 4PJXB 4NNXA 5IK3A 3DIFA 3OF6D 3VFRB 1M53A 2A74C 2XA8L 3O8XB 4XHJD 3CHSA 1I3GH 3H9HB 4XPHL 5BZZA 2A3TA 1QSZA 5HPMA 3W3BA 5IHUH 2DTML 3IAPA 1YEWA 2MHAA 4FLQA 5D4HA 5MP6L 5J1TC 4KJWC 3JV6B 1LO3L 4KKBD 2XV2A 2PXYC 5DUML 2YD4A 2PPDA 3NABL 1AACA 5DQJA 2TSBA 5CIPA 3RX5A 1DQLH 2C34A 2YAEA 1O9VA 4QOKA 1KTCA 3FU0A 3RDTC 2MCPL 2E47A 2VABB 4Z95H 4F1SA 4HUMB 3N44B 2GPZA 5E8DL 1E3ZA 4PSPA 5FO2A 3C9NB 3V0WH 4GW5A 2XIIA 3BIAX 4KOCA 1IM3B 2X4SB 5GZNA 1G6RH 5IJKC 1CQKA 4CC0A 2YPLD 5DC2A 1UB6B 1KLFB 3SDCC 3R19A 2GKIA 3RWDB 4Y5YC 1JWMA 1HXKA 2HX8A 1HQRA 4N0UB 5F1OB 3VDAA 1RPUA 3G5VB 1SRDA 5J8OA 2JVUA 4PS4L 5I8KH 2VDOH 3FONB 2R1WB 1P5VA 3O81A 3VB8A 2VSDA 5IMKA 3OTTA 5CGYD 4FEMA 3MC0A 1LP9A 2OMYA 4OCWL 1TQWA 4E41D 5JQHC 4L29A 1ROCA 4N2AA 3VRIB 3H0TB 4AT6B 5HDBF 3O9WA 4OVVA 1J1PH 1IC1A 3PWVA 4JG5A 5SWSE 1OB0A 3WTSA 4LHUG 4HWBL 1DE4A 4NXSA 5BRZB 5AVZB 2FATH 4BJLA 3BVDB 2IOOA 2EYTB 3F7PC 4OZIE 3EO1B 4JY5L 2LFGA 1DJSA 4G8FA 5KN5B 1H6FA 1MHPH 1ZSHA 4TNWF 4FNRA 5GGRY 3VCLA 1MLBA 3KNBA 5LNDA 5KYUB 1G9ML 2IBGA 1T20B 4FFVC 4N5ED 4DPCX 2D73A 4DFIA 3G6JF 2J1KA 3GXMA 1ROWA 1SXZA 3S0PA 1YJDL 4U3XA 1A7OL 5I17A 1QFUL 4UT6A 1UJ3B 3W38A 2WLLA 2AMGA 4A04A 4MB1A 1N6VA 2VISB 1J0YA 4UTBL 1TFHA 3O6KH 1E9PB 4K07A 3ZT6A 3RVVC 3ZTCC 3ARDA 1RMFL 1RZ8A 4ZMXA 1C8PA 4AVHA 1UXWA 4R4ND 4RMWA 4HS6B 4FJ6A 4JPIA 2JKRM 4LBEA 4XNZC 5AW1B 4TV3A 3T1FA 4NO5A 3HI1B 4D8OA 3OBAA 2NCMA 2MSPA 1OAQL 3EJJX 3WO4B 3CDZB 4JZNB 2EIKB 3CVDA 4BH8A 1OGAA 3MRCB 4G9FA 4OI8A 3AQXA 3NABH 3OJVC 4JRYE 5HJGA 4D9QE 3CV5A 3NA9L 1XAUA 5TDOB 3QWNA 3EF4A 5I26A 5FECA 1FVEA 4PVBA 3FSOA 4BK5C 1N4XH 3A47A 2EUVA 3UZVB 1FPTH 1TZGH 2DQIH 3PP4H 4NPJA 1CGTA 1J05A 3G5YB 3MLWL 3FT0A 3MRMB 2KHAA 3O41B 3T8VA 3CVHL 1BREA 3VXSD 4OUOA 1TR7A 4HEPG 4N0UE 1I1YA 3FHEA 2VRQA 2R4RH 2EZ0D 2WZPD 3VFWA 3MR9A 3UPCA 4N28A 4IRSD 3OKMB 4P2OA 2HZHA 5F3HB 5DVLA 1AO7D 4GXUM 4CJ1A 1CMOA 5DLMH 1RKRA 1U3NA 5D9SB 3GWJA 2EQDA 1U8JA 2YQ2A 3H6AA 4GY4A 1LO5B 4POZD 4ZAKD 5EZLA 1P7HL 2DDQH 2IV9A 3I3EA 1MVFA 4XMLL 2FR4A 3BEWA 5KG9B 5D7IA 5GRZA 3DUSB 4Z5RB 4PJAF 5EF1A 1TLMA 1TO4A 1R24B 4NPYA 1JGEA 2PYEE 3CC5B 4PTUA 3IDXH 3MRPB 4OZIB 4FQXD 3LKSB 3IJ9A 4WJ5A 4TTDC 4YSSA 1CJYA 2G2RA 2DBLL 1EPFA 1S9VA 3CLEL 3N9GH 4OCYL 4ZFGH 1CR9H 2IFFL 1RUPL 5FYLE 2PCFA 4FN0A 1TTUA 2R51A 5D1QA 3DJTA 3MLXH 3CVHB 4NLAA 3HG4A 1Y7VA 1P53A 4XH2A 5I0YA 1DJXA 2HCZX 4ZPTA 4N2FA 1JRHI 2BSBA 2AK4E 3P77B 4IW4C 5I1HL 5C0JB 1P84J 1VGEL 5E2WL 3ZKMC 3WNIA 2X1OA 5FLVA 1DQDL 5DT1L 5JORA 1O6TA 1CZ8H 1YECH 5EU7C 1AC6A 1WD9A 4CVZA 1G4RA 4OM0H 1IFGA 5C0NC 1QBLL 1KIRA 4KFMA 1UZ8A 1Q0YL 4LPVA 2Z8SA 1NGZB 4NUPA 1N2RB 3QZNA 1JPGB 4DZBA 4E9YA 4HAGA 4HS3A 1K8IB 4TVSa 4GT0A 1EAOA 2C3HA 5DRNB 3UZEC 3CU7A 4K9JA 4M03A 2QDVA 4KHXH 5C2BL 2ZSWA 4H1LA 3UTOA 5AOLA 3GO1H 4G6KH 4N5UA 1FLTX 1AGBB 3FCSB 1YDPA 4LDEB 4Q52A 5IMLB 2X4TA 2GJRA 3NCJH 1MF2L 2K4WA 5DJYB 4AQ8C 3S3CB 2VLLB 1DCEA 5FB8B 3B9KA 5A2BA 2O61B 1E0OB 4F7MA 2YBRB 3OWEA 5LHDA 4YDVA 1CG9A 2FO4A 4M8UA 2DYRB 2N7AA 3GBMH 4PGZA 3DOIA 4P4RA 3RL2A 1AR1D 2VDPH 4DVRH 5B38A 1CFNA 3KL3A 4JRXA 2VXTL 1CWVA 4XVJL 5IFJB 2PP7A 3JTTA 1KYOJ 1MIMH 2N59A 1HFUA 5IEHA 2KQNA 4J23A 2NCEA 4OB5L 3VDBA 3HHMA 4G5AA 2OJZL 3QEQA 4DN3H 1L9OA 1X5LA 5EU3B 1TVDA 5IQLA 2CK2A 2Z91A 1F5WA 3H3PL 1TCMA 5FM4A 3ETBF 4KK9C 1DLHA 2V5YA 4MAZA 2HG5B 1FGNL 3CK0H 1MHCB 5D1ZB 2VDNL 4FLRA 4R8WL 1YMHB 1IAIM 4ZSOA 3GXFA 5DD6A 2BSSA 1GYCA 2X2JA 4AMXA 2TRYA 4FXGB 4KZEL 5MEPB 1MCIA 4S1DC 4MJ2A 3RDTA 1G7LB 1H9VA 5C97A 4LSVH 3WN5B 4DNLA 1BMWA 3ECQA 2BVQB 1S5IL 2FX8H 4N8CL 4OKVA 3A21A 1AY1L 2YRPA 3H7BA 2JIXD 5JUEL 2BNUA 1O5DT 3D85D 4MD5A 2XV3A 4WW2F 4K3JL 3RVUD 1NCCL 3S96A 4OLXL 1GMIA 5E8EB 5D7KE 1QI3A 4Y9BA 1ORQB 4FTVB 3CH1A 3NZUA 3BUPA 4H40A 1A6VL 4P2RB 4Y4HD 1DQMH 4YGAB 4Z95L 3K4AA 3KWWB 5ALCH 3VMNA 2FZ3A 1SDAB 3K2MC 3ZE2B 4JANA 4GMSH 5CD5D 3GMMA 2X9YA 1EAQA 4QHUB 5DF0A 4LVNC 4LIQH 4G43B 2MCPH 3MXWH 1HE7A 1M6OA 2ICWB 3ZIMA 4KI5D 5I71C 1A6TA 3IFOB 4AXWA 2A6DB 5CMAA 3RWDA 5DUMH 2FQGA 1MY7A 2Z1PA 1KELH 2UZYB 3ZUCA 4AL8L 4NBZB 3Q6GL 5E9DA 1RK0A 3MBED 3DGDA 1R17A 2DL9A 2EO7A 3BSHA 1E9OA 3I9GL 3VWKA 3P9LB 2IANB 5DFTA 3DTUB 3QSKB 5DXWA 1E5AA 1MH5B 5LUMA 2GTZB 4MD4B 4Y1AE 1TMQA 5ENWA 4PJGA 1ZMYA 1PFCA 3V4PH 3FTVA 4L8CB 3PWVB 1KCUH 1MCDA 1LHZA 1MQKH 5H35B 1QKZH 3GHPA 4UM8B 5DSCA 2VDRL 1NZRA 2AVGA 2J21A 1YQ2A 2PKDA 3D5OF 3QJOA 1HEHC 1WVZA 3V0VB 3DPBA 3BYYA 4L4VA 1GGBL 4UT7L 5DD1L 1MLBB 2DLGA 2HRHA 3KNBB 1RUQH 4X7CC 3N2JA 3KPPB 4FQXA 4JLRA 3QR2A 4WI9A 5KVEL 4PJ9D 4LK4A 3B8YA 5DI8A 2BX5A 2OS7A 1IKFH 3VG0H 1WZMA 3E9UA 1P7QB 1X6LA 4BSWB 2NY5L 1UASA 3BH9A 2XKNA 3OLDA 4P05A 2MEJB 1U8CB 3CIQA 3F64A 3OR7A 4BA0A 4I0PD 4C83B 3BO8A 3TESA 1UJ3A 2LU4A 3PGFH 2CHWA 4QTHB 2GC4C 5E5LA 2VDMB 3GHEL 2KZBA 1GJWA 1VKXB 3HRZC 3QUZA 2P52A 2W91A 3TZVD 1SEBB 3GMLA 2NYYD 4NFCA 3V2AR 4LBEB 1NFDA 1G5GA 5BS0E 4QRTB 5F88A 3HAEA 3QEGL 3PIQB 4OR1A 3VFUA 4AYSA 4JZNA 2ARJQ 4HWEH 3UBXG 4UAOC 1PAMA 5AW6B 3MRCA 4P2QE 4W9JC 5EF0A 5GSVA 4Y4KB 2Z31B 2QV2A 4MA8H 3INUH 2VDOB 4TN9A 4ELKA 1WZAA 5AYTA 3GZOA 4ZW8A 3Q3GB 4B96A 4G72B 5D71H 4MZIA 1KGCE 5C0AE 1BW8A 1BZ9A 4B9CA 1QR1B 1J05B 2CO2A 5EBWA 1V7NL 1MJUH 3ZMEA 5TDNA 5KS9B 5FYKH 1XCQB 4M93B 1G9NC 3HG2A 3ZHNA 1HINL 1UM5L 4JKPL 4Q97A 4QRRE 1A6WH 3GHBH 4O51A 4Q0XH 1TQTA 2YRZA 2NY6C 1M9WA 2BRQA 5DJ0A 5IV2A 5KBLA 5DHYA 3CZGA 5IVZB 1C08B 4OH2A 1N5YH 3SDAA 3EFOA 4AGOA 4G1EA 4LLWB 3FB6A 5EU4B 3U9WA 3VFOB 3WAKA 3DOSA 5D4IA 3NVQA 4F1ZA 1S4IA 3WLWD 8FABA 5CLWA 5IBTL 1ND0A 2PABA 3H2PA 4ZMLA 3VXMD 3VXTA 5I1JL 1RV6X 3TP4A 3KPMA 1N8ZB 2Y2TA 2ENJA 2ZYIA 5MP6H 1MCFA 2DWTA 3FH8A 4MS6A 4V11A 3CC5A 4CSZA 4U6TA 5IW1B 3TONA 5I18L 1QLRB 4LVHB 3HHSA 4O00A 4B6ZA 4GAAA 5C0AA 1PIFA 3MJ7B 4ZOCA 3SDCD 4IIQA 1VDGA 4H8WL 3ARWA 4HF5H 1BWMA 4XN9A 1XBDA 4R4FH 3LDBB 1A7PL 2ZUQB 5D1XD 5EMYA 5C8JB 4I1PA 4U1SB 4ONGL 2J56A 5EORL 1I7ZA 7PCYA 2ROYA 3DGCR 4IRSB 2OP4L 1IBGH 3KD4A 5C0JA 3I6KA 3WTUA 2ZWSA 1RUKH 2B1AL 1MXGA 4IRJD 4NRZA 1FO0A 2VUYA 1NC4A 4NN5B 2A6IB 1JGLH 4XNBA 2VKXA 5AVSB 1MFMA 5EIIA 2F7PA 1YN6A 3AVEA 5KYXB 1HHKB 2DN7A 2JI1A 3VGHA 2R8SL 4PWHA 3N5AA 2PUQT 2Z7WA 3Q6GH 4AENA 3PFUA 3UBFA 2YBGA 2P80D 4BE6A 2X9WA 2ZYHA 1QPXA 4NKIH 1AHWA 3DC0A 1BP3B 4PREA 1SXCA 5D7JD 4LAQH 2W60B 1RZ7L 3N0AA 3U46B 3KPSB 1QQDA 4U49A 2D7MA 5IMLA 1SXSA 2E7LC 3QJFA 3KBFA 1YNLH 1BPVA 3IK2A 4HFWB 4MJ6A 5CSZA 5GRVL 1LEKB 3WHE1 1E2ZA 3IDJA 1MCCA 2EXTA 4H1LG 1Z3GH 2VERN 3DHPA 2DIAA 4OLXH 2B3RA 5HGGS 4BFIB 1AZNA 3V0GA 3ATAA 1S3KH 2OMWB 4PN6A 4R7NB 2GITB 3GBDA 3FQRB 3APMA 3D85B 3QHFL 4M6OH 3MRDA 2UYLA 1FG9C 4J3OC 3JTTB 2I26N 1C9SA 5ETUB 4F20A 1T0MB 3TBYB 2Y36L 1FL5A 1B4JL 1UUNA 2WSPA 3L1FA 2ZWNA 3TJPA 3QO0B 1SOSA 2F7QA 3CCHA 4OZHE 5AL8A 1A7RL 1JZ2A 3NRPA 5BVPH 1GHFH 3IFNH 2CKBH 3TTYA 4F2MA 1ZTXL 3ULVH 3GM8A 3EGSB 3D51A 5LWYH 3CSYA 1YMHA 4OF6A 4ZSOB 1UM6H 3H3PH 4FXGA 1A65A 3JWNC 3VVVA 3DMMA 2A38A 3LKOA 4LKXB 3PDDA 1T21B 4YDNA 4P9HL 1NKOA 5IY5B 2BC4A 3ARDC 5FYJE 3AXHA 3K8LA 4MNQA 4NCDA 1HOEA 3GNMH 3MBEB 1ZY9A 2NXZB 4KFZC 3QGVA 1ZWIB 4QI3A 1CT8B 1OAJA 3LS4L 4DCQA 2C7UB 5D2NB 3ARFC 4GUQA 4QYOB 1ORQA 2MTPA 3QZMA 3UAJA 3KVPA 3LEXA 1J0JA 1MAJA 1YYCA 3EIFA 3SSGA 2EUZA 4ZQKB 2BO0A 3GMMB 3TYGH 1RERA 3Q05A 5A3IC 2H0FA 25C8H 2ORBH 3EYUH 5CIPH 5DZPA 3TPUB 3T65A 1JN6B 1BVKA 1RHFA 4DP8X 2J2ZA 4Z76B 3BT0A 2E76C 3VDCA 2HTKD 3LNGA 4A1RA 1ZLSH 4HAFA 2YPVL 4M8QB 3AADB 1TTAA 4GBXC 4CN1A 2H0EA 6FABH 1HZKA 4MYPA 4QRPE 4PJ9B 4FNLH 1LO4H 1RZGA 3L5HA 3P30L 3A22A 5JTWA 2ATKB 1NUNB 4QHKI 1BXVA 5LBSH 3WNPA 5B3NA 2QKIC 3S9DB 2I27N 3EYSL 3DRTA 1QRNA 2G0KA 3COOA 1NAML 1OF2B 4ZZKA 1MLCB 5KVEH 4X7TB 2ZOKB 4UQDA 2H1PL 4J3SA 1PZBA 3GLEA 5CGTA 4EN2A 4XWGH 3A6CL 4LCVA 4YDIL 4MS8D 5I1HH 3D4GA 3WTYA 1B3IA 4ZXBD 5G55A 3O4LB 5DUBB 4AJ0A 2P42B 4KQ4H 3WTXA 4KH9A 4Z7QF 4ELMF 3TIEA 1INDH 3JQOB 5FO7A 1YQVL 2YD2A 1XF3B 1CR9L 5DD5H 3QDME 3WTWA 3N9GL 1TQCB 2Z31D 4X5PA 4N0YL 1DSYA 2YPKA 1IFRA 1GJIA 4BCXA 4TM9A 2Z9TA 3F6JA 5C08D 1WWAX 4JFFD 1ZD6A 4L2LA 1BFVH 2BNQB 4XE0A 4N2CA 2DAVA 2CKBL 2XXFA 1AQKH 5ID0A 2WQVA 4PJ8D 2OW6A 3IMRA 1HNYA 4BCZA 4CNIA 4E41B 3HFFA 3Q8AA 3OR7B 4D0CA 3T1WA 3OHMB 2YEZA 3N50A 4U0RC 1R3LB 4DP9X 5AKSA 1F3JA 4QTHA 3MLTA 3QK0A 2WINB 1U2HA 3RU8H 4QRBA 1OGAD 4Q6IC 2XA8H 4UDTA 1XF2B 3OXRA 1BAGA 1AZVA 1CK0H 3T4AA 3BWAB 3NIDE 4FHKA 4TUUA 2RB8A 2AEPH 1FIGL 4NLHA 1J0KA 5F3BB 4KUZL 5GQBA 2KMWA 1NH6A 1MFEL 1OTTC 4GFTB 1F4WH 5FW7A 2VXUL 5CEZE 1MCBA 4ZO8A 2BW4A 2GT9A 3DXAB 4N6QA 2BNRD 1XGZA 2ESVA 4TULH 2GJPA 2GBVA 3V4VH 2IDFA 3TN0C 5L8LB 2R0KH 5C0BE 2VW6A 1QTSA 3QXAB 43C9A 1OSZB 3KLKA 4ZD3H 4JDVB 1QFHA 4HMEA 4J3UA 1F6AB 1AQKL 4XC1L 1V55B 3LX9A 4M62H 1SVCP 1WDAA 5IR1B 3A0OA 2YOCA 2AXFA 3W9DB 4YZFE 4X80H 3P11L 1DDTA 2G5UA 1EA9C 5IQ9A 3RG1C 3X1BA 1ET5A 1CCZA 2CUHA 3A67L 1XZ0A 3CE1A 4QTFA 5DVNA 4K55A 4QXWA 2Y23A 7FABH 1YMMA 4NWTL 1XH0A 2GUYA 1TF4A 2YGVA 1R46A 3DPDA 4TUOA 1IBGL 2PO6C 4RRPM 4IOSD 5IW6A 4J5VA 3AGWA 3HNTH 5BNXD 3KPRE 4B95C 3ZRSA 3K6IA 2LVEA 1FRGL 4P23C 2EIBA 3H9ZA 3QUKB 5DK2B 1PLCA 5L0QC 1X9UA 1UB6A 2CIIA 5LBSL 3S7GA 1FAIL 1FZKA 4MKMA 4N3UA 4KRPC 1GC1L 1HQRB 3CSPA 4BFEA 2AV7A 3SKJH 1JHLH 3BFQG 4WI5A 1OAQH 2Y0SA 1CFSB 1A0QH 1ZVSA 2YPVA 4GAGL 1MFNA 1I7UA 3Q6FB 4XTRC 1W0VB 1KLUB 1BD2E 2JELH 2VLJD 3QUYB 4CVXA 1EV2E 3DV4A 4HH8A 3U2IA 4HOZA 1CDYA 4F7CA 1S8DA 2C1PA 1HU8A 4NRZB 4O4YL 2F5AH 3BIKA 4ISVA 2MNUA 4AT6A 4I7ZC 4O2CA 4XX5A 1T1WB 2AXJA 1VCAA 4JN2A 5E0FA 4KDTA 4P48A 5TPWH 4XOBA 1FNSH 3PWPE 2DQUH 3RNKA 3VMOA 4WI3A 3FU5A 3ULUD 4M1DH 3HVNA 3N41F 2YJQA 5F1NB 4PI0A 3I50L 15C8L 3N1FC 3T71A 4AOFA 4HEME 4IBUA 4PJBB 1X7QA 2N0MA 4BCYA 4BA8A 3GZKA 4K9EH 3NUKA 5E5MB 1IL1A 3C5SA 4FQCL 3QJFB 2CJSA 2EIZB 1N59B 3WE6B 4OZFH 3B4NA 4PGBA 3FO1B 5HYSA 3DDFA 1OK8A 4YS4A 2EYSA 2IV8A 3FQWB 1XAKA 3W0WB 1M7DB 2HJKA 5SWSA 1E67A 3EF7A 4ZO6A 5CO1A 3IJYA 5ABDE 3BP7A 5F97E 3CJJA 2X0UA 2JKLA 2V37A 2LHAA 2AQ3A 3P11H 3LZQA 4NO5B 4ZUUB 3X11A 1W0WA 2JK5A 5D1QD 3ELAT 4ANWA 1X5IA 1AG0A 3QUXD 4HCRH 2YD9A 3ARYA 3U7WL 2R83A 4OLWL 4Z7UE 5LGHH 3BWUF 2CPUA 4IJTA 2FYYB 4AW7A 5EUOB 1LK2A 1U4EA 5I6MA 1QVOB 2Y9RT 3GNML 3JYCA 4EVNB 1KF9B 2OSYA 3UGEA 5ICXB 2BSRB 4NPKA 5BV7C 4YSCA 3QDHA 3VG0L 4H88H 1UYWL 2BOLA 5I8OL 4P06A 5HHXH 1XGPA 2ED9A 2HWZH 4L1DA 3DETC 4TQHA 3I2CL 1M2OA 2V3EA 3ZKMD 4QAWA 3L2NA 5BZXA 2WAQA 5SWQB 2NTFA 3RY4A 3VRLE 1I7TA 1F00I 5FOBA 1AGEB 2DF3A 5FYLH 4EO5A 3RWGB 5KW9H 2LAGB 1TNNA 4MJIE 4Z7NB 5B3JE 3DWTA 2VR4A 3K5SA 1ZANL 3Q2NA 4L1BA 1NTDA 3FULA 3GSRB 1SY6A 4W70A 2CBTA 5EEXA 5CEXB 5SWZE 2G2PA 3OAYK 5IGXH 2DYPB 3HE7B 3RKPA 1CL7I 2NQDA 1KULA 2WM0A 4UBDD 4XB8A 4RLDA 3B2UD 1FZMB 3OZ9L 4HVBA 3GJEB 3QXWA 1KFAL 1QNZH 3FO9A 3LKSA 2J2ZB 2ZP0T 4LBAA 5EOCH 3ARTA 1D7BA 2QVIA 2PCFB 5JYMA 3MV8E 3BAYA 5ISZE 4B5EA 2Q3ZA 3BLKA 5IHZB 1JVLA 2ADFL 3QC5X 2ZWZA 4Z7OF 2DLIA 4MMXC 1A7OH 2WKOA 4C56A 4PJEA 4GMSL 3PGCB 3II2A 3D30A 4M7LL 4PVNA 3T3PE 1HE8A 3EXJA 3FOLA 3RI5K 2XRAL 3QORC 4P9MH 3W5NA 5ECGA 5A2KH 4HOMA 4CVZB 3LEYL 5EHFA 3GXIA 5KTEL 3D2UD 4MJ4A 4NNPH 1QD0A 5B7FA 5L7XL 3GSQB 3CWGA 5BZDA 4XN4A 4HFUH 4YHPB 1YEGL 5EC2B 1G1KA 1NBVH 3IDNA 3Q5OA 4X7EC 2AFNA 1AKPA 1HILA 1MKFA 1B0RA 4FQ1L 2WXLA 3ZTJH 3F5WB 5B39G 6FABL 1S5IH 4RGNB 1IGCH 4XCNB 1BYNA 1BBDH 3TIEB 1Y0LB 3LH2H 3QZOA 5AOMA 4ZYKA 5D7LA 2XOTA 5T1LA 4RDBA 5JA8B 4ONGH 1JZEA 2MPAL 3KPQA 4OGAC 5SWZA 2EDMA 2WVSA 1INEH 5HI5D 5AAMC 3EYVA 4J4PC 2IAND 2H0JA 1HL4A 2QHRH 4E41A 2WTPA 3T3ME 3LRHA 1TJMA 4OLZH 4QRPD 1MCRA 3NJNA 2JCCB 4EKJA 4K5LA 4FG0A 1F4AA 5AKTA 4HUVA 2K6ZA 2R9HD 1L5GB 3RIFK 5KYUA 2EILB 3T4AB 1UWYA 1NBYB 4CKQA 4WKZB 4DW2H 1XSKA 1NGXB 3D39D 3SYQA 1UKQA 1WIOA 2J7LA 3HMXL 3IGLA 4GRMA 3SE9H 5FM5M 2P7TA 2RCSH 4FXKC 4JO3H 3L08A 4GRLA 3UAEA 2Y6TE 4A7VA 4ODVH 2OSWA 2X89A 3KLLA 1U3JA 5F7YC 4L9DA 1AD0B 1X4YA 3S35L 3FUMA 3FCUB 3VW3L 3EZJB 3C8DA 2H41A 3UYRH 3WKPA 3T0EA 5CBEA 4TMPA 2KLTA 3QXAA 4OZFB 43C9B 2COQA 1KTLA 3FMGH 5LAXA 5L4JA 4K23H 3BQUC 3SGEI 1P84K 3BUYB 4LLQA 3RGVA 3B83A 3LDBC 3D69B 4UB0H 5JW3L 3IDYC 5DHEA 5HYJB 2QGCA 4FG4A 1LMIA 3MA7A 5B3JF 5C7XL 1UA6H 1P4IH 3F65A 3QCUL 5FK9B 5ES4B 3DX0A 3S96B 5LJYH 1NANI 2DQGL 3U7YH 4XP4H 3S2CA 5F8RC 3HZKA 1ZS8A 3QA3B 1QLFA 1G7PA 4OM0L 5EFIA 3ZDYF 3WFEL 1XZ0B 3B8SA 1BYOA 3T8MA 3VFNB 1PZDA 1BZ7A 4YSTA 2J8HA 4HSQA 3IDMB 3G5YA 1NWPA 3QEGH 4FFWC 5D93C 4TVPE 4AKQA 2F1AA 4DK5A 5IVXF 3O41A 1T0OA 4ELME 4Z7QE 1ILUA 4PW4A 4IKLA 1D9KB 1N10A 3PGFL 3SYCA 3FUJA 3TEUA 3KPLA 4E0RB 5INDB 3GRWL 4Z7IA 1WTGT 4G3YH 1Y6MR 1C5CL 5DFAA 5CEZD 3CLEH 5I2IB 3FONA 2W9DL 1FWXA 1LTXA 2AVFA 2Q76B 4WI8A 3ZL4H 1TEYA 3F2LA 4AQEB 3M88A 3QVAA 2XRAH 3TOPA 1H19A 5E9DB 1CFSA 1ZVSB 3FRPG 4MCNA 5EUOF 2WLKA 1I7UB 4FI8A 4FNSA 3NK4A 1RUQL 3ESNA 5I82A 3CD4A 4JO4H 2Q2EB 4P57A 4XP9H 1YO4A 5F1KC 3VGGA 2HX7A 4U31A 2DDQL 2DWDB 4XMLH 4N2IA 4BGDA 1AR2A 3BIKB 4ISVB 2ADIB 4RBPK 4HKBB 3GSXB 3LHAA 4OZIA 4JN2B 3P3TA 2NOYA 3AABA 3EO1A 2EVGA 4HT1L 4FFZH 4G8FB 5IUCA 1N0XL 4HKXB 1O7VA 4RCAA 5D1QB 2WLYA 2VQ1B 4JCMA 5C2UB 1UCBL 5A7EA 2GEQA 1ZRUA 2UZIH 4GUPB 4G6AC 4QDGA 1W80A 1SUHA 4XCFH 4H25A 4XH2B 3U1SH 1JZ7A 1INQA 1U93A 3RVXC 3GC3A 4LPCA 3D09A 2X1PA 2WIIA 4WWKB 2Y7QA 1D5BB 3WS6A 3WMPA 4HOXA 2NDFA 3AS1A 4M5TA 2OCFD 3FS9A 4GUOA 3RIAF 2A4EA 2J71A 3BH9B 3P1VA 5DD0L 3X14B 2ITCB 4DTGL 1INDL 4LLYA 1KIRB 4O2EB 4UMSA 3ARBD 3MODL 1UZ8B 1NAMA 3NDZE 2XN9E 4WHTB 1JV2B 1NGZA 5FKPA 3T0WA 5C09A 3F7LA 3OPUA 4XBGB 4BZ2A 3PABB 1AP2A 4I77H 5I71B 3S36X 1QRKA 4EEEA 4XWGL 5HDBB 1EAPA 2BVPB 1ZHLB 1CICD 3FNKA 4JG0L 4PJHA 5I1KL 3N04A 4PJEF 1KBKA 3HJ0A 1L7IL 3QXTA 1R3KB 2P24B 3TBVB 4JFDB 4V1DE 3CPLA 3EYSH 3WI9A 4EI5A 4WU7A 3KXFE 1D6EA 5I0WA 2FYYA 1PCXA 4CADA 1PX3A 5IVXA 4ELKB 1KBGH 2EKJA 4DGYL 2J6EH 1KPVA 4PY7A 3ZMNA 4WEMB 3U7WH 4OF8A 4HBQA 1JXFA 4F7MB 1QUNB 3ULAB 2WQXA 2FO1A 4MRCA 1XQ4A 4OCMC 4U1GB 4MNQD 2R56H 3P3SA 1G7JB 2E56A 4LEOB 4S1RL 5CCGE 3L45A 3UIYA 1VFUA 1IKOP 4WLCA 2DZEA 5F3HA 5FUOH 4X6BB 3P0YL 4TXVB 4HXAH 2VN3A 3BVNB 4ZODA 3W0WD 2XLLA 2DI7A 1YY9C 2E46A 3HG5A 3FAXA 1AGEA 5B1JC 3MNWA 4BFRA 3ZN6A 1A6PA 2FR4B 5IROC 4ENED 1KXVC 2NY1C 3NJJA 4W9EC 1CE1L 3WV0A 1HQ4A 5DCCA 5EO1B 3SOTA 4ZMWA 3LH8A 2X7LA 3FQ4A 4IOIB 3IU3A