4E9XA

Multicopper oxidase mglac (data3)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
317
structure length
317
Chain Sequence
b'AEREFDMTIEEVTIKVAPGLDYKVFGFNGQVPGPLIHVQEGDDVIVNVTNNTSLPHTIHWHGVHQKGTWRSDGVPGVTQQPIEAGDSYTYKFKADRIGTLWYHCHVNVNEHVGVRGMWGPLIVDPKQPLPIEKRVTKDVIMMMSTWESAVADKYGEGGTPMNVADYFSVNAKSFPLTQPLRVKKGDVVKIRFFGAGGGIHAMHSHGHDMLVTHKDGLPLDSPYYADTVLVSPGERYDVIIEADNPGRFIFHDHVDTHVTAGGKHPGGPITVIEYDGVPVDDWYVWKDKDYDPNFFYSESLKQGYGMFDHDGFKGEFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Multicopper oxidase
molecule tags Metal binding protein
source organism Uncultured bacterium
publication title New insights into the catalytic active-site structure of multicopper oxidases
doi rcsb
total genus 95
structure length 317
sequence length 317
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9xA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9xA02
2IAAC 3DTUB 1ASQA 2ZOOA 3QJTB 4G71B 3WNIA 2DWTA 1PCSA 3SBQA 1ZDQA 3FQ1A 6PCYA 1OV8A 1RZQA 3X1GA 1DYZA 4N4YB 1RCYA 2AVFA 1URIA 1XMEB 1BQ5A 2X88A 5AZUA 5B1JA 2BZ7A 1RZPA 3FYEB 3EH4B 3WIAA 3FQ2A 3ABLB 1V55B 2WO3B 3HEIB 2EIKB 4HHGA 1MDAA 1W6WA 2ZWNA 1BAWA 3EH3B 4KNTA 1HAUA 3NSDA 1J9RA 2IDUA 2GI0A 1V10A 1AS6A 2QT6A 2FTAA 1GS8A 1ADWA 3SQRA 2B08A 2XUWA 1E30A 2HZHA 2PCYA 3QJQB 1KBWA 4GYBA 4E9WA 1JXDA 2FT7A 3PPSA 1VLXA 2J57A 2BW4A 3X1NA 4PCYA 1J9SA 2UXGA 2XWZA 1AACA 1AZNA 1ZIBA 3CG8A 3WKQA 4DP6X 1JZIA 3NJNA 5A7EA 2VW7A 2Q9OA 3N2JA 3U25A 1PZBA 1SDDB 1X9RA 5TK4A 4CSPA 2UX6A 3ZIYA 1AZCA 2N0MA 4BWUA 1E65A 1IKOP 4QLWA 3EHBB 3OMNB 1GY1A 1KCBA 2XVBA 1CYWA 1N70A 1J9TA 2CUAA 2XXFA 3FU8A 1PMYA 4G7SB 2GHZA 2GC7C 3FU7A 1TEGA 3EH5B 1WA1X 2J5WA 4DP7X 2E86A 1TU2A 3PAVA 4DP5X 2BO0A 1R1CA 1SF3A 2VW4A 3ABKB 3NJMA 1T5KA 2AZUA 3H4FA 3FSAA 4YSSA 3S3BB 2IWEA 4KOCA 4Q89A 4FA7B 2BP8A 2I7OA 1GS6X 2GSMB 1L9OA 5I26A 5E9NA 1SFDA 1XB6A 3TBBA 3SBRA 1ZDSA 2H3XC 3DKHA 5B7EA 2IDTA 1BYPA 4YL4A 5TK2A 4AKOA 1DZ0A 2YAFA 2PP8A 1X9UA 4KO6A 5IY5B 4A68A 4M3HA 2BW5A 4HIPA 5I28A 3QJSB 1NINA 4YSEA 2IWKA 3AG3B 1PLCA 2J56A 1YLBB 4DP4X 2CBPA 4W1TA 1SHXA 3TA4D 5I5MA 3AG2B 4YSDA 3V9CA 3OQRA 1A3ZA 1L9TA 1J5DA 2IWFA 2WO2B 3ABMB 5ANHA 3IE9A 4YSPA 4A2HA 1CURA 2IH9A 2QPEB 4A2GA 1GW0A 1NPNA 1OE2A 5B3SB 1SF5A 1V54B 3ZX1A 4GP8B 2BP0B 4YSCA 3AZUA 1NIEA 2CALA 2GC4C 2DYRB 2EINB 3H4HA 4G7RB 2QDVA 5PAZA 2UXVA 1KGYE 5F7BA 3CZUB 3MX0B 1PNDA 4KO7A 3C75A 2Y1AA 4KO9A 1PZAA 2FQGA 4DP1X 1E5ZA 1WS8A 4G70B 1HFUA 3PAUA 3T6ZA 2XX1A 3UAAA 3NJFA 4HCIA 1ILUA 2HLEB 1F56A 3FT0A 1BQKA 2PCFA 1A4BA 2FT6A 5F7AA 2GB2A 2FQFA 2QPDB 2XV0A 4KO5A 4BXVA 2DY2A 5I6PA 1SFHA 3AY2A 3GYRA 1OCRB 4E9SA 3JTBA 2XLLA 3GXUB 2Q5BA 1PZCA 2PPDA 4P5RA 5LDUA 1J9QA 2JXMA 2CCWA 4YVUA 3CDZB 3X1FA 4EF3A 3S8FB 2OJ1A 4JKNA 1BYOA 3NJHA 3IN2A 3S3CB 3OMIB 3T6XA 3NP3A 2ZONA 4UF7C 1NWPA 2XV2A 1KCWA 1CC3A 2YAEA 5EHFA 4M4RB 5I6LA 2P80A 2PPCA 1NTDA 1NIDA 2FT8A 1B3IA 3PCYA 2R7EB 3IEAA 1OOWA 4UAHA 1BEXA 1AR1B 1JVOA 1W8EA 4YSUA 2AANA 2TSAA 3NYKA 1ILSA 1FFTB 4UANA 3NSCA 2MRYA 1NIBA 5D4HA 2EILB 1AZUA 1KDJA 3T9WA 2BWIA 4Q8BA 5B1BB 3FSWA 3NJGA 2YAOA 1L9PA 2HX9A 7PCYA 4DP9X 3EF4A 1OCCB 4KOBA 1KDIA 4DPBX 2B3IA 1ASPA 1PLAA 5AFAA 2OV0A 2PP7A 1ASOA 1W6LA 2IDSA 2I7SA 3L45A 4GP4B 4YSRA 1KV7A 2DYSB 3ZDWA 4E9QA 2YAMA 4YSTA 2IDFA 2FNWA 3IN0A 1GSKA 1KBVA 1WA0X 2OCCB 1L9QA 1AS8A 4RH4A 4F2EA 3UABA 1BXUA 1KYAA 4A2EA 2PPEA 2VN3A 5AKRA 3T6WA 1ET7A 3NJLA 4AKQA 1AANA 1L9SA 1WAEA 1E67A 4TXVB 3KW8A 2VSMB 3NSFA 2RACA 1ET8A 1MZYA 4X4KA 1NIAA 5PCYA 4E9XA 3CVBA 3KW7A 2BP0A 5B7FA 1MG3C 2FQDA 1ETJA 4DP2X 3UACA 1AS7A 1JZGA 1FWXA 1BQRA 2CJ3A 1M9WA 7PAZA 4HHWA 1AIZA 4ZK8A 2VM3A 4KNUA 3GDCA 2TSBA 2IH8A 2DV6A 3TU6A 1HAWA 5FC9A 2UXFA 2YQBA 3WI9A 4KNSA 3OM3B 1AAJA 2BP8B 3QJRB 2JFCA 1ZV2A 3X1EA 2NRDA 2UX7A 2HX8A 1A4AA 4AX3A 4BK5C 4W9ZA 1XB3A 1IC0A 4NB7A 2XX0A 5D4JA 2MTAA 3QQXA 3RYMA 1A8ZA 1I53A 1NZRA 1M57B 4DP0X 1XB8A 2VM4A 3UAEA 2H47C 1WA2X 4PAZA 5I5IA 1PAZA 3CDZA 3PAZA 2PP9A 1BXVA 1ZPUA 2XXGA 1N68A 2AFNA 3S3DB 4AKPA 4A2DA 2BWDA 2W8CA 2FWLB 2Y69B 3QJUB 4NERA 1GR7A 2AZAA 1AG6A 1OE1A 3SBPA 4DP8X 1SJMA 2VSKB 4ENZA 4QKTA 3HB3B 4HZ1A 4YSQA 2WSDA 4FAAB 4NAJA 2YARA 1JVLA 4DPAX 1A4CA 1NDTA 1AZRA 4E9RA 5B1AB 2QDWA 4A66A 4G72B 3PLYA 1MG2C 1NICA 2PPFA 4DPCX 1M56B 1QLEB 2YAPA 1SNRA 3MBWB 4HCFA 1ID2A 1JXGA 4G7QB 1JZFA 4GP5B 5I6OA 4AI7A 3D12B 2YAQA 1EHKB 2LLNA 2BZCA 3FU7B 1NWOA 3NP4A 1JXFA 3CVCA 4WTQA 2IDQA 3NSYA 3H56A 4GY4A 1AG0A 1QNIA 2XYBA 3IBOA 3WG7B 3FYIB 5I6MA 1A65A 2H5UA 1GS7A 4CSZA 1NIFA 1UATA 1MZZA 4A67A 1IBYA 2XU9A 3CVDA 1AQ8A 2PPAA 3JT2A 1OF0A 1CUOA 2HX7A 2VMJA 5B1KA 2P80D 4N8UA 1GYCA 2BHFA 4F2FA 1EZLA 3ZBMA 1CYXA 4YSAA 2DWSA 4E9VA 4HAKA 2UXTA 2ZXWB 3NJJA 1JZHA 2EIJB 3ASOB 4P5SA 1ET5A 5B1JC 4A2FA 2PLTA 5D4IA 5I6KA 2YAHA 1JZJA 3QJVB 4AZUA 1TEFA 2VW6A 9PCYA 2XV3A 3WNJA 3AG1B 3ERXA 2EIMB 2J55A 3TASA 3NT0A 3T6VA 4BXSV 1FA4A 1OCOB 3BVDB 3FSZA 3OD3A 4YVNA 4GXFA 4L0PB 3X1BA 3DIVA 1L9RA 1IUZA 1AOZA 2GIMA 3X2QB 1TKWA 2YXVA 1BXAA 2CAKA 3ABGA 3AW5A 1OE3A 4F7KA 1PY0A 1PNCA 1PF3A 2HRHA 3G5WA 4JHUA 1ZIAA 1GY2A 4E9TA 3BQVA 1NPJA 1QHQA 2FJSA 3FPYA 3OMAB 4HALA 4K9JA 4WKXA 5I5JA 1JERA 3FU9A 1JZEA 1J5CA 3WKPA 1E5YA 2JKWA 3V9EA 3NJKA 1OCZB 2FQEA 3N55A 2HXAA 2X87A 4BWTA 3FQYA 4HCGA 2GBAA 3T71A 4E9YA 5I6NA 3FSVA 3QPKA 2HRGA 2YXWA 4BDVB 3S8GB 1SHWA 8PAZA 1IBZA 3AG4B 3UGEA 4BDVA 6PAZA 3ASNB 3NJIA 4MFHA 3FS9A 3PXLA 4JHVA 1AZBA 3UADA 1PLBA 1JOIA 2I85A 1SDDA 3TBCA 5B7MA 2A3TA 2R7EA 3FPXA 2W88A 4YSOA 4BWWA 1RKRA 1WS7A
chains in the Genus database with same CATH superfamily
2YKKA 2BOCA 3TP4A 3BZ4B 1YMMD 4XXWA 1W8OA 4Y16C 3NOIA 4JFEA 1P4BH 2ZXGA 4K3GA 4Y89A 1P84J 1TQWA 4AITA 4N4YB 2FSEA 3O2VH 1QSED 3U0WL 1ZK5A 1RIVH 3FN0H 3UTZB 1RZPA 2A4EA 3ZQ9A 1HCYA 1AHMA 4IBQA 4WUKL 4Y9EA 3LHPH 3MV7D 4AJYV 3W5NA 4MJ6B 1PPIA 1IKNC 2JK5B 3L3JB 4TS6A 2DIBA 5ESAA 3MV9E 4JFXB 2F54B 3NCMA 1HAUA 1MCOL 4KKLC 5F44A 5ICXA 3H8NA 3HS9A 3UZVB 1USZA 5DI8B 3QORD 4G9FE 3LXCA 3ZE2B 4N8PA 4JFFB 1S3KH 4ZMTA 1FFPA 4NENA 2NLJB 2DF3A 2O61B 2NTFA 1J1PH 4GG6F 4ERSH 4YHOL 1PJWA 1ZA6B 2IFFL 3QDME 2P7TB 5TGBA 5GGUB 4PRAA 4MAYA 1HL8A 2WUCH 2IPUK 3ZZLA 1MFUA 3BDYH 3U4KA 5HVHB 2VE6B 1MCOH 4WRLA 1V27A 4J39A 5EZJB 5CN2A 2ADFL 3N2JA 1UXWB 2WZ5A 2EUXA 3I75B 1BBJB 5GZOD 1CLOL 2ESVE 3QS2A 1UZ6E 2N0MA 1NGYB 2EDLA 1VF5C 2NSXA 1MWAB 4AQZA 1AVAA 4FQXA 1IBBA 2JKIS 5SX5K 4L1TA 3VWJA 4PGJA 1LHZA 2V5MA 1DBBL 2YXMA 1N70A 3HFML 3O2VL 2GJZA 4XO9A 5ILTH 3STBA 3S5ZA 4P2YA 3SOBL 3NCJL 1IBGL 4UOZA 3SPVB 2EVFA 1RZKH 4FP8H 1MFNA 3HB3D 3D52A 3ATAA 4S1DD 4XVJH 3MUUA 3CH1B 1J5OH 3Q9PA 1HE8A 1JV2B 1GYVA 4K7FB 1DFBH 1JGDA 1KACB 3JUYA 2WLLA 3NRQA 1JHTA 3OJ2C 3GKZA 5LJYH 4HA1A 1SYVA 3H53A 3KYKH 2GAZA 4TNVK 4YSSA 4G6KL 5DMGC 3NPSB 5SWZB 5B3JF 1OD7A 1JZ3A 2R2EA 1E8XA 3K1KC 4OJDH 3EKCA 2I7OA 2C34A 3VXTA 3WNNA 4MB1A 5I26A 3MRHB 4LSRH 2R1XA 4HKBA 4R7NA 2DICA 5ESQB 1IGMH 4FZEL 1A6TA 5KVFH 5B7EA 3P73A 2AQ3A 1NAKH 5D1QA 4FMVA 4X5WA 3TPKA 3HAEH 5IOPB 2DEWX 1C1EL 1A14H 3ILPA 3ZRSA 3KS0H 4K5LA 4XPBL 1DL7H 1TZOA 2VXSL 1IIIA 1KCVH 3VFTB 4QTFA 2CHDA 3M1CA 5E4IA 2WANA 2PABA 3L4XA 1EFXD 1W91A 1R3IL 4TRPL 4IOSD 4A7UA 3EYOA 1LE5B 2OTWB 3H7BA 1JWSA 3TT1H 3RU8L 2WO2B 3TN0C 1Q90A 1QACA 5EOCL 4XVUC 4KTEH 4G11A 1ZLVH 2K70A 4IGBD 4K71C 4QAWA 3ULVE 4I2XB 3VD2A 1ND0A 2WSKA 4NQDA 1FCCA 4GBXA 3NIDE 2V5RA 2EINB 2EO9A 3ZKXC 1QYGL 3AQXA 4AYFB 3ULUF 3GTTA 5KS9F 1PNDA 3HRPA 1G1KA 3BUYA 5IBUG 1MRCL 3AREB 3P2TA 4ZJ9A 3C60C 4DP1X 4GKNB 4O2CB 3ZTJH 4LP8A 3T1WA 2UUDH 3QORA 4M1CD 1WS8A 3ZDYE 4YHNB 3T6ZA 4TTDC 5B38G 3P54A 4HCIA 2PXYD 3K2IA 3BAXA 4NP9A 5CEZH 4KVNL 3VYNA 1OW0C 2JKSA 5I1KH 4R96A 3SD2A 3TLRA 4LLQB 3S98A 5EU6A 3BVTA 2OL3B 4Y4KA 3S5LG 5IGXL 3NCBB 5TDPA 1IGYB 2DWEB 4XMZA 1F3RB 3VO0A 1R75A 4S0SD 4LEOB 4ZUVB 3C2AL 4UT6H 2LAGB 4DGIH 1S9WA 4OZIF 1A1OB 1F11A 5EA0H 2AXGA 3BKCH 5HDOA 1HIML 1EEYA 1I75A 5C08B 4LLVB 5KBLA 1J9QA 5GS1B 1JF1B 2C7UB 4NQEA 4ZXBC 3LY6A 1W15A 5KANI 4XCYA 2Z91A 4ZX6A 2ARJB 5ACZB 2HKAA 2HAZA 3BGAA 4YPGA 3NSXA 4ZX3A 1FNEB 3ETBF 3V95A 3SKUD 1LDPH 5DMIL 3KPRE 4HMCA 4QO1B 1QEWA 5LGJB 2E7LA 2IALA 1SBSH 2Y5QA 1JDDA 1PZ2A 1NGZB 1HN1A 4I89A 3EH1A 5T33L 5IROD 4U1NB 1WWCA 1A0QL 4UM9A 3VI3E 2EUZA 1GRWA 2OL3L 5IHUH 4UANA 4HLEA 3L4VA 5GRJL 1NIBA 3KDMA 4JS7A 4R3SB 2CO4A 1N4XH 3BFOA 3H1ZA 4KRPC 5CGYC 3WFCL 2BRRH 4AEFA 1BA9A 3BQUD 4NNYB 5E6RB 5E9DA 2ADIB 4G42A 4HJ1A 4QRSA 1FNFA 5BUGA 2HX9A 1AJ7L 4JQVC 5FFOA 3SDYH 3QUZA 4JLRB 3UYRH 4DNLA 5HYJB 2WNGA 1R24A 3UBHA 4IIQA 1AD9A 2NY5H 2IADA 4MXVE 1M3IA 1KBBA 4L9LC 3VDAA 3ZDWA 1NGQH 2LGNA 3AVEA 1WA0X 1ZLEA 2VN4A 1WT5A 3T4AC 4HMEA 3QNFA 3LZRA 2CHWA 3BAIA 1HYRC 1Q9OA 2QSCL 2WIIB 3K6IA 3CTTA 2WBJB 1U6AH 1ICTA 3EADA 2J12B 4QRTB 3UJIL 3VYOA 1M2OA 5TDNB 4JQXC 4AKQA 2J8UA 1T4KB 4J6IA 4MAUH 5B39G 7CGTA 1T3FA 3EDJA 1QRNE 2GJ6A 3QIBB 1FL5A 1TETH 4PJ9B 5B7FA 4ZTOL 2CM5A 4A2MA 3GSXA 3L4YA 4D3CH 1A21A 4P5TA 1UVQA 1R3HA 2ZKXA 3DX2A 2WZ6A 1EHAA 5F2FA 3IJHA 3ZYOA 1NGZA 2KBGA 2EIDA 4HKXA 4NRXB 4NRZA 4XPFL 3ULUD 1IRAY 1IE4A 1IEBA 2E46A 5D1XE 4X6DB 1Z3GL 2NRDA 1A6WH 5ICZB 3TJEH 3CD4A 2WJ7A 4H8QA 3UG3A 3MUGA 2Y3NA 5HJDA 5JHLH 4HLJA 4OZHA 4BFIA 1EZVX 3S34L 1K4CB 4BKLA 3HC4L 3C6LC 5CP3A 5IVXF 3O4OB 4JG5A 5E9DD 2CKBA 2R56H 1WA2X 3FB7B 2EE3A 3PGFH 3LKPA 1AMYA 3TTSA 4AKPA 4YZFE 3LNEA 5CNHA 4BHUI 4E41B 1PYWB 3ZW3A 3LQZB 1WD9A 2XZQL 5I6XB 2J1KA 3SPIA 2IDCA 3HB3B 5ISZE 2WSDA 1S4IA 4NAJA 3AU1A 4E9RA 2OAAA 1FBIH 3NZ8A 2XG5A 5CIPB 2F6AA 1OB0A 1Q0EA 2VAAA 4RRPA 1X5IA 1E4WL 1HCFX 4APQD 4IU3B 3NZSA 1KIPB 4JDVA 4QRSB 4UV4L 1KIQA 4IM8A 3HZYB 3MLVL 3B2UD 2X2IA 2NTFB 5CD5D 2LABA 2ZUWA 2WLHA 4MNHB 4NXKA 4ZAKD 2HT3D 3FU7B 5CD3B 2VLKB 1D5BA 4FABH 4PGEA 3AABA 1E8YA 4RFOL 4XC3H 4GKZB 4PJ8A 4GY4A 5K69A 3IJ9A 2X1QA 2I24N 4BUQA 3GHPA 2IALB 3WLWC 2PYED 3TWCL 2O5ZH 3ARGA 3U83A 4LXFA 2WWKT 5DC0A 5F93C 4W9KC 4HIJA 4LCCA 5CZKA 4JN2B 4I1NB 3H85A 4P9MH 1U3YA 4TSAH 4WKZA 2V2TA 2V9UA 2X5PA 3B7YA 2NNFA 3JTSB 5E6IC 1J7VR 3WAKA 3ZE1E 2WWNA 4P46D 1VGEH 1MFEH 2HLFD 5HI5C 3QIUC 1AFVH 1WJ3A 3L4CA 3TH4T 1UM5L 3EYUH 1XBRA 3HS0B 5T1LA 1MVUA 5JZ7D 4FNLL 4X4YA 2KH2B 5IHWA 2DWSA 4HHAA 3QIUA 4AQ8A 4RMTA 2FHCA 4KAQH 4A2FA 5I9QC 3WXWH 5CM1A 3U9UB 1JCVA 2ZSVB 5C09B 1S7WB 3VXRD 4JKPH 2WOYA 4P46A 2VW6A 4KDTC 4UTAA 3D0LB 5IESH 4M5YL 1YNKL 4FXKA 3ZRFC 5I30L 3EYUL 1ROWA 4WAFA 3NH7L 1CF1A 2VL5A 4PG9A 1U8QB 1S5HA 1ZVHA 3HR5B 2Z34A 4G6FD 3V5DA 3U7WH 4LVHC 2F19H 5ITFB 5TE7L 5I2IB 2ENPA 5CD3A 1MREH 2CAKA 3OKMB 4UBDD 5D9SB 1JE6A 4F3FA 2OXGB 3ARBA 1FVDA 4EQ2A 2OM5A 2AQQA 3GRGA 3EUUA 2EVGA 1NCUA 1GIGH 3GBNL 4OLVL 4LASL 1NPJA 4CAGA 2BSED 4ZUWB 2XTJE 1SLWA 1EFQA 1NEUA 1S5IH 2NZ9C 3L17A 3BZDA 2G5BB 3ZKNC 4F8OA 3SSGA 4XNDA 4QD2E 1IGFL 1CLCA 3QZWA 3CVHL 2BLFA 5AOMA 4LOEA 1G6RA 1E7UA 5GXBB 3GMRB 5IQOA 1U3HA 2HT4D 3WYRA 1DBKL 1TYEB 3KBFA 4HUWA 4PS4H 4EMZA 1VRSA 3CPLA 4HUUA 4CMMB 2X6BA 8PAZA 3O8XA 3ZUCA 3MGTB 4FZ8L 3KWWB 3NJIA 3QZMA 1V3JA 3C6LA 4K8RL 1SDDA 2D0GA 1G9NH 2ZUUA 5I8CA 4WJ5A 5C3TA 3H9ZA 3M6DA 5DZPA 1TTFA 5JO5A 1OAXL 4ANUA 4WV1B 2VR9A 3K71B 2UWEE 4AVJA 2FHBA 4OVVA 5E99L 3AM8A 3FTSA 4LVNC 4H2AA 5FYJL 2X7LB 3QNYA 5EF0A 2NYYD 3C5ZC 2O6PA 3QAZB 2CDEA 2WXNA 3FN3A 4YHKH 2QLVB 3QO1B 5DD0H 2ADJB 1WRFA 5DJXB 2ZSWA 1T7VA 3JYCA 2EUVA 4H40A 2V9RA 3FT3A 5HHXL 4J3VA 5G5DA 3PGCA 3ZT6A 3VXSE 3QQ9C 3QDAA 5FUOL 1W0WA 2B1HL 3EH4B 3FYEB 4TYUA 3TVMA 4L1BA 3TT1L 1F1AA 2GAZB 1UYWH 3QZBA 2WXGA 3ZPDA 4HISA 2F54A 2VZUA 3D9AH 1XGYL 2FWOA 1ZHNB 4KZ0A 3FFCB 3MBEC 2JI3A 3P4MA 2X4PA 5IG7A 4NNXB 3QFGA 2BVUA 4XPBH 4F7PA 3HG3A 4IKIA 1TETL 1OSZB 3CFKA 1O6SB 2M8XA 2MCMA 2VDRH 4QIRA 4PCYA 1U3ZA 4E2OA 1CGYA 3KLAA 5EORH 1NC2D 3MLWL 1U6AL 5D96C 3WGVB 4D9LH 4DP6X 4L9DA 4AQ1B 4YJZL 3STLB 4AWJC 3HI6H 1UD5A 5GISH 4U2YA 5LNDA 2XVLA 2EC9U 3M07A 5AAWA 4ZSOA 5MEPA 2EDNA 5ECJE 1L7TH 5IEHB 1FUNA 5EO1A 4AG4H 1I3GL 3CHQA 5DD5L 3OAUL 4CSPA 4ZYKA 1AZCA 1JGUH 3B2MA 3VXME 4QLWA 5GPRA 1WO2A 1A6VH 1INDH 1KCBA 3PP3H 1E6OH 2BHZA 4R0LA 4JRLA 1BV8A 3MRFB 4EIBA 3QYMA 2WXRA 1EHNA 2Y7MA 3I50H 1J9TA 1JVKA 1P1ZB 4HJTA 4RA3A 1I1RA 3VXSB 3U6XA 5C0GB 3IAPA 3ROLB 3TTYA 1D5MB 2J2ZB 1PYWA 3GSUA 3SOBH 4XXDA 3SDDC 1DBML 1MIML 4BRJA 4M7ZC 4NZDA 2BNQB 4QTIL 3QUHA 1XGRB 2PW1A 2L7EA 1P6WA 4ZFOA 1E43A 1MW1A 2ATKA 2CKNA 1NDGA 3QIBD 4KMTL 5IQ7H 1XH0A 3KL3A 1E4KC 2BP5M 4MA1C 4WWNA 3TBBA 1CXEA 5A6MA 1QHPA 3SBRA 4K7PY 1JYNA 5B1CA 1ZDSA 3NMEA 5E51A 2DJSA 3ROLA 1DUZA 4OJAA 5D7KD 1CLZH 2MHAA 3SGEH 1DQMH 2NNCA 8CGTA 3P3TA 4UNVA 1HL9A 2CA3A 2X1PA 3MUHL 3Q2NA 4WY7L 5E2VL 5EF2A 5EULV 3HZ3A 1MRFL 2X6UA 5I8EB 2Z7YA 5G2NA 3AADB 3DO7B 2QHLA 1THCA 2GCYA 3AG3B 4GW4B 2M26A 1OALA 2F08A 5H35A 3GSNL 1IC5L 5EBMB 4G9FB 4ZW3A 2X44D 4DP4X 4GO9A 4B9IA 1BVNP 4OCNC 1O5PA 1FZKB 2B5IC 3K72B 2MEJB 3EJZC 2EDKA 1H8LA 1MXDA 4JFVA 4NGHH 3PQYB 1UWYA 1I7ZB 2HLAB 2GJRA 4QOKD 4XCCL 3VRLE 5CEZL 5F7LB 1FYTD 5C0DB 4Y9GA 1ML0A 1AGDB 2A9MH 2COQA 3MRNB 2JKRM 2YLKA 2F8XC 3QUMA 1QFUH 4PSRA 3WS6A 1RLWA 4FXGC 3Q44A 2AXFB 2B1AH 3H4HA 2YQGA 3SYCA 2AXJA 2DQTL 4XMTA 5I1CH 2J25A 1TTCA 5TJWK 5KTEH 2E76C 4L8CA 4M7JL 4KO7A 3ZOAA 5TF1L 5HGAA 2Q7NA 2IANB 2XVGA 1E5ZA 1DTUA 3AUWB 3FTYA 2DMKA 3O3EB 4BZ1A 3FOMA 3MCKA 3ISRA 4HIEB 2YPVH 1XF5B 3KEHA 2N7AA 5FYLL 4BV1A 4BZ2L 4Z7OF 5FFLA 2OMWA 3KVPA 4K3JH 3FQXB 5HYJE 3F7VB 2B3RA 3G6JA 1HSAB 3Q13A 5KAQF 3C87A 2F61A 3EGDB 4ODTL 5F7AA 3DMMD 5LWYL 4PV8A 3L5XH 4NNPH 2Q20A 5C0IB 1R3IH 2XIIA 4I9WD 2A6JA 1JPFA 1NGWB 2PN5A 1USQA 5F7EL 5AYUH 4K5PA 2OMVA 4HMDA 4F8QA 5DEJA 2ESVD 4FG6D 4LF3A 3V4VA 2YPLB 2ATAA 3CDZB 1I4FB 1A14L 2ALWA 3D9AL 2JV6A 4JKNA 4L4VB 4CMMA 4NNPL 4G8IA 1R9FA 1RVFH 1SUHA 1SYVB 2YBGA 3PWJB 1H15B 3NIFB 4P57A 4PJFA 5C0ND 3JWNE 5TDOB 1A4JB 2OJZL 2Z64C 4QF1B 1IZJA 2VC2B 4MD5B 4M4RB 5A2FA 4G6ML 5AWNH 4N2BA 4DK5A 1D3CA 5C0RL 2DI9A 2XN9A 3BVVA 1HL4A 1WZKA 1EUUA 2FK9A 3DV4B 2QVTA 4A39A 3S96B 1B0RB 4LHUA 3QI9A 1U8LA 4YSUA 3ZY7A 1OAXH 3MMEA 1CFNB 1SYSB 4XBEH 4OF5A 3IU3B 3T9WA 1NOFA 1GHFH 1G9NL 4XZUB 3NJGA 4ES8A 5JQIB 5BUPA 5MEQB 4AYFA 1GYUA 4NRYB 5F8RC 5SWSA 1F3JA 1URZA 5E56A 3O9WA 1BM3H 4DP9X 2HKFH 1NGXB 4JO3H 5DC4B 3MRDB 3SE4C 3VXUD 4F7EA 4L3EB 5BRQA 2R2HA 4XCCH 2IDSA 5FGSA 4DN4H 4HSQA 2EKSA 2WBJD 4XWOD 1IFHH 1Z9NA 4EBQL 4F58H 4L9LB 3CVHH 1GJWA 3ARBC 3PWLA 3TBVB 2F8VA 4Z7VE 2E8ZA 3AU1B 1UCBL 2EAEA 4ODSH 1NLDL 2X9WA 3UABA 3FBKA 3VSUA 4JFYB 1LE5A 2AEPL 1AXTH 1KIQB 2ED9A 1PU0A 4TVPD 4IRJC 1L9SA 4JFFD 3B4NA 3B9KC 3TCXA 2HYMA 4G5ZL 4OV6F 5HYJD 3PWVB 3QCVL 2IPUG 2RACA 1ET8A 4QHKJ 5T5FL 5TE4H 3TO4A 1UTDA 3LDBB 1H19A 4GAJL 4DGVH 3EJPA 3ZDZE 5IMKB 4P2CG 4HK3N 2GTZB 1J88A 5KYWB 5J6GB 4YFDB 4K7PH 1TNMA 2J1XA 5EZOL 1MUJB 4GMTL 3RILA 1NBVH 7PAZA 3KXFB 4H0HB 1U8CA 3EO1B 4B0MM 2YZ1A 5FUZL 4DN3L 4MQSB 1CTNA 3LHPL 1YN6A 5F0LB 5BXFA 3UC0L 2Y2YA 2DEXX 4OAWB 1JIBA 4HQQL 4ECNA 1G1CA 4AX3A 3UEQA 3QHTC 3S88L 3RX5A 1IC0A 6FABH 4Y4FC 2NW3B 1V8HA 1G7IB 3V0EA 4JHAL 4M48L 1X44A 3IMSA 3JXAA 3QARA 2D03H 5KVEE 1Z9SA 1F1DA 3F8UB 3G6JB 1UKQA 4ZG1A 5ICUA 3CFMA 3N6YA 1OARH 1N68A 2AFNA 5HDQL 5C2BH 5IEKB 5EEWA 2B4CC 4JKLA 1X7QB 4I0PD 5FV2A 3ZE2F 1ZE3H 3C8DA 1DLFL 1KYOJ 1KTDB 4YC2B 1A7BA 1I3GH 3B8SA 4XBGB 5DD5H 3AT8A 4WI6A 4S1DC 5ITBL 5J11B 1WWBX 5JOPE 2JQAA 1IKFL 1TEYA 5E8NB 3T2LA 1T21B 3F7YA 3QIWC 2WQUA 2OI9C 3RDTB 4CSTA 5KYNA 4YK4B 2P5EA 5DUMH 3C60B 3KNBB 2DQUL 3E0GA 2YAPA 3GJEB 3Q2LA 5D6DA 4RFOH 4YHIB 2JSFA 3LRSB 3B9AA 4NX0A 3DO7A 2VDRB 1UJTA 2YUXA 5LDSA 3NGBB 5GS2D 4B27A 25C8L 5CJOH 3VXPA 2V5YA 1HCVA 2BJML 1A7PH 2GIXA 3RY6C 3PHAA 4AMWA 3NBNA 1FZKA 5H37H 3BKJL 2C9SA 3QQ9D 4A55A 5I6MA 2O5XH 1AD9B 2ZICA 3V0WL 2GEQA 3B2XA 2YD8A 2FO1A 2H45A 4PJ7E 4RFNB 2GBTA 1OQXA 4UOQA 1AHKA 5DMJB 5FYKE 3CH8A 1AQ8A 3MRKB 1D7DA 4AVKA 5F6IC 2NXZC 1FNEA 4Z7WE 1E0OB 5DJ2A 2QGDA 4HC1A 3ULAB 4N8UA 3BEVB 3K0WA 3L95B 3WU1A 4ZFOB 4Y16A 4OI8A 4OIIH 2K0RA 5KEZA 1U21A 5T5NG 2EIJB 5B1JC 4X2UA 2UYLB 4YIQA 4BK5A 4LK4A 4RCAA 5ICYB 1TCRA 4XPHH 4KDVA 5F8QC 4XMLH 2AEQH 2WQXA 4U1KA 2KQMA 3H9HB 2O5XL 4Y4HD 2WLJA 4NC0B 4F5CA 2Z91B 1SUJA 1HXYA 1KEMH 2GK2A 2NUPB 1MJ8H 1A64A 4KK6D 3FQUA 4D3CL 1AE6H 3VW3H 2HN7B 2E4TA 5GGVL 1QSFA 2ZCLH 3VE0B 2EEFA 1IUZA 5F3FA 5C2UB 5BQDA 1UWXK 4TLTA 2W0FB 3ABGA 1BXAA 4BELD 2WWKO 2PXYC 4OLXL 2DMGA 2ZX7A 1PNCA 3GB7B 3QC6X 1CICB 3RKDC 2ZKHH 3HZVB 3TIDB 4X5XA 3U4EA 4PWFA 4K9JA 1ZLSH 1P7KA 5CILL 3FU9A 3WKPA 2ZX9A 1QFHA 3CHPA 5A6LA 1S6NA 1BREA 1ECZA 4LCVA 3UBFA 5B38A 1AH1A 1CE6B 2VXVH 3CQFA 2D2CC 3T71A 5HDQH 4J12A 4ZFGH 5HPMB 3NH7H 5FHAH 1XT5A 3E6FB 1MCBA 2J1ZA 4RNRB 2EICA 3GHBH 4R4NC 1JG9A 3PXLA 3D07A 3QDHA 2IPTH 4J1UB 2PWDA 4M5YH 4TSCH 4DEWA 1P1VA 1DANU 1PLBA 1Q4NX 2WXHA 5JIMA 2F8IA 2VT0A 2OYKA 5DYFA 1RKRA 4M6OL 2XHNA 4MLIA 3TZVB 2L4OA 3B6SA 5F7DB 1ASQA 5KYXB 4Q97A 3O6KH 1LXMA 3DYMA 2Z9TA 4YZFF 1MW0A 1MNUH 3SHSA 4N0UB 1GZQA 6PCYA 1RZQA 2GTQA 2N4IA 2EDTA 3A6CL 3IGKA 2VC2L 3IFLH 3ECBA 1JV5A 4MA8L 5CMAB 5AZUA 1LWHA 1S78C 4K15A 1SM3H 4YBLB 1WAAE 3WIAA 2AEIT 1FO0B 1RIUL 1U8IB 2GI7A 2R2EB 1V55B 2WO3B 4P9ML 5IWLC 4JCWA 4WVRA 4G82A 1MDAA 4JQIA 4WWKD 2QZ5A 2A6JB 3NSDA 1O9WA 2R69A 4AIZB 3MU3A 2UWEA 3ILEA 5CKGA 3QAQA 1DBAH 2BVYA 3TO4B 3IE4A 4HYTB 2HZHA 4DGIL 2EYSB 3AXLB 1Y6MR 4A7SA 3UP6A 4RA0C 3ZJAA 4QRUB 3JV4B 4X6DE 3O2DA 4OSUL 2ZCLL 3WNOA 1AC6A 1P5VA 1FFRA 3CG8A 4F3FB 3AB0B 2KMWA 1NAMB 2TRYA 1AQDB 4OT1H 2IGTA 1HQRA 3P1VA 3K8LA 2Q9OA 5AUMA 4Q7DA 1SBBA 3BFQG 4XBPB 2Q86A 1MRCH 4JN2A 1BZ9A 1D5RA 2AJVH 2YOAA 3ZKMC 2BSBA 5GZOC 4XBEL 3OWEA 1I82A 1NBYA 2JCCA 3OMNB 4CU6A 1NGXA 1U3JA 3LPGA 4O4YL 4X8XA 4F9PA 4H5SB 1OVZA 3EDKA 2Y6TE 2CO7B 4JFED 4JUTA 2XWCA 2YD4A 3CGTA 1XIWB 1EAPA 1Q1PA 4NKQB 4OIIL 5GRVK 5LAXA 4R97B 3IJYB 3UAJA 2R1XB 4HKBB 3G5YB 5GS3A 2ZOLB 2Y9RT 4L8SA 3D3VD 3P4OA 3QIUB 2J5WA 2NY4B 1EO5A 4MA3A 3PJSA 1JPEA 1LWJA 3PWNA 2VJ0A 3Q7JA 3RIFF 2VLJD 1XD1A 3SPHA 4ELDA 7TAAA 2FJFA 1HXYB 2NUPA 5DJZB 1QFWM 5FA4B 3PS6A 3NJXA 1TU2B 3NN8B 3R0MA 4HT1L 5MP6L 2APFA 3JWNG 4LOUD 4U49A 3LQMA 1WZ1L 1KB3A 1A7PL 3EYVA 3GXTA 3EFOB 2H3XC 1CT8B 3DKHA 4MB3A 4JZJA 4MX7B 4NWTL 3K6SA 1CQKA 2YO3A 2UZIL 4YL4A 1DVXA 3GMPB 2VXQL 4GFXA 2F1BA 1MHEB 2PP8A 4UB0L 4QHNA 4FEMA 4OQTH 4X0KA 4JHBA 3IBEA 5I74C 3T04D 4GIOA 1N0LB 1BIIA 2NX5A 3FCTA 3UYPB 4HIHB 5FYLH 5FCUH 5AAMC 3UGXA 1HK6A 2OMUA 3DRQB 3ISWA 4EN3D 1OB1B 5E2TH 4N86A 1IKFH 3MRBA 4G6KH 3FTWA 3MLRH 5FEBA 5J9PA 4FKHA 2W80C 2X3CA 4OZIE 1JCKA 4ZI8A 1SMAA 3ARDC 1U3NA 2IWFA 3QUXD 4PEEA 4TMPA 1ZLUH 3PABB 4OJFH 1CFQA 2IJ0C 2O1AA 35C8H 5LO7A 4LP5A 2NCMA 2QPEB 5BZWB 3KJ6H 4MDIA 2ZOUA 3HI5H 1A3RL 3UTTE 2YMXH 3MAWA 5DK3A 3IAQA 4XP1L 3SDCB 4PBWD 3F6LA 4GBXC 1CFMA 1NIEA 3S4SG 1G1OA 4P3DA 2F53E 6FABL 3OZ9H 3HFMH 5ILTL 5EOQL 3ZKXB 2V5TA 4TQPA 3W39A 2VABB 5I1IH 3FCGA 1X5HA 2UXVA 1KGYE 5IB4B 2CBQA 5AD0A 1MCEA 3KNBA 3MRMB 4JL1A 3TL5A 2GABA 3ULUE 1WFNA 4JFTA 1J0IA 3BPCB 5FGBA 3E9UA 4WF7A 4FQLH 5AYTA 5ICZA 2XX1A 1EX0A 2EXSA 4GMTH 3FT0A 5SX4I 4LVNB 2Q2EB 1PX4A 4MCYA 1G7JA 2EDDA 1F2XK 1JTTA 1ZLUK 2FJUB 4N9GB 1PGRB 3N06B 3LZFL 1DQML 4R83A 5CGYD 4UV7L 4GT0A 4DAGL 5KJRH 3WE1A 3ZVVA 2LV4A 1NANI 4GUPB 4Q0XL 4MA7H 1BD2E 2EYSA 4OZHE 4X7SL 3LV3B 2AQ2A 2YBRA 4CDHA 2QVIA 5GS1C 3I9AA 3FCSB 4K07A 4IKNA 4YVUA 4ZFZB 4HEPA 1HH9A 2DRUA 4JZOB 4PTUA 5C08E 4M6NL 1QEXA 43CAA 4E5XG 4LZKA 2BOBA 5FLUA 1NJ9B 1M7IA 2HT2C 2OTPA 3GJFK 3NJHA 4O2FA 3ZIMA 4M8VA 4XMVA 3S3CB 5GQBA 4M62L 4XOEA 1U93A 2WKGA 4WUKH 5GIRA 1DQQA 3P30H 4MMYA 4L1HA 3RWCB 3ARWA 1W16A 3W2DH 2PPCA 1ACXA 4N5EC 4TUKL 3WY2A 1DQKA 1FN4B 1AQKH 3PUCA 5C07D 5IMLA 2OZNA 2WTRA 1GOHA 1TVBA 1E27B 5C0AE 4G1EA 3L5JA 5EN2A 1ADQH 1QP1A 4HX1B 4XMPH 2WYZA 2J5LC 4IBTA 3QK0A 3FH5A 2Y7QA 4WLCA 1W72A 4Y1AA 4ZUSA 3QUYB 1JWUA 1U8HB 3TZVA 4LAJH 1N19A 3FB8B 3HG5A 3UTSA 3P40A 4ENED 4HBCL 2YAOA 2X9ZA 1GC1H 3AT9A 4JFQA 4B41A 3F12A 4F8NA 2WKOA 1ZLVK 4XRCB 3KPOB 3VD1A 1YC8A 3MO1B 4JRXD 3JVGC 3QJHA 2OJZH 1KC5H 5C0FA 4I1PA 1MCHA 5KSAA 1ID5I 5CP3H 2BNRA 5MHSD 4ZQTA 2HJFB 4E9QA 2YAMA 1XGPB 4KTGA 3MRDA 4JDTL 1IGIH 1GL4B 2DQDL 1U36A 4S10A 4A04A 2OXGA 1L9QA 2C3XA 1DEEB 1KBKA 5BJTB 4N2EA 4ZX5A 4H0GA 4RFEA 4PRBA 3X17A 3L3IB 1RULH 4U1IB 5D1ZI 4FFWC 1LNUB 1ET7A 5F9OH 4TKWA 5E1IA 2WZ0A 2NY3B 4AENA 4ZS6D 3HW7A 4LHUB 4XRCA 2F8OA 1WC7A 2H41A 3AS2A 3QXAA 4LLUB 4TPRL 1QFWI 1FYTE 4JDEA 4HWZB 5E5MB 1QI4A 2Q87A 4AGLA 2P8PB 2Y7LA 3KPLB 4K3JL 4NYLB 3PL6C 5E6UB 5EU6E 4HZLA 5HHXH 4QUOA 5GJSL 2GBVA 5K59F 2DI8A 2OP4L 1AIZA 1H15A 1SMDA 3IDMB 3PWPD 4P57B 4Q6IA 4YDIH 4OCYL 3ZXAC 1OCWL 4LSDA 1D9KD 3K2UH 4AEIL 1HAWA 2ZXEB 3H7BB 1DBJH 5E99H 4YXKH 2I5YH 3CHOA 5LCVA 2AS5M 4K3DH 1I9EA 3KWXA 2ZF9A 3S3PA 3IJSB 2MCPH 5E4EC 4AENB 1U93B 2H3NA 4QRPB 3K0YA 3EYSL 4TUKH 4KKZA 2H47C 4W4OA 1BVNT 4MMXA 2PP9A 1ZPUA 1XSJA 2NQ3A 1FO0H 1KXTB 4P49A 3C60D 5I6XC 1F8TH 3QJOA 2C26A 5DFVC 4JO5A 2VDQH 5CLWA 3L4WA 3DVNB 4HZ1A 1F6LL 4BE5A 4MKMA 4HU2A 4XH2B 4G83A 1AZRA 3FOMB 5B1AB 1JYWA 2DWDA 5HDBF 5HP5A 2D3JA 2KERA 4DPCX 2OI9B 1P5VB 1XF1A 1SPDA 4CILA 3DV4A 4QT5B 1Q9WB 5DJ0B 4HCFA 2QGCA 2G3MA 3RGVB 4WY7H 5T3XD 1RK1B 3AXLA 5EIQA 2FYVA 4CMHC 4BQ6A 3OR6B 4HFUH 5MHSE 2Y6SC 3LRSA 4ONOA 1N5AA 3KS0J 1QNIA 4J3OD 3NQKA 5IQ7L 1UGNA 5JORB 4BFNA 1EXGA 1FL6B 3HHSB 1UJ3A 1IILE 2QV4A 5IESL 3BH9B 3P9MA 1EFXB 1RZJL 4M5ZL 3WIHH 1N5YH 1KIUA 2AQNA 2Z4TA 1NIFA 4C57C 4YHLL 5CFHA 3ARFB 3BQUA 5AVSB 2Y2TA 1KTDA 3IDNB 3NCFB 3NK3A 2PPAA 4S1QH 3SO5A 3WXWL 1CFQB 1DBMH 1OEZW 3EDDA 5IMMA 1RHHA 1U8OA 1MH5A 3BAKA 3MJ7B 1X5XA 3BPOC 1RHFA 4UIKL 4XWGH 4YSAA 2K7PA 1IMHC 1QLEH 3NPSC 2UXTA 3BP5A 3DUHA 3I6GA 3FRUA 4NZRH 4PPTA 1UD2A 4Q9RH 2VDOH 1MLBA 2EP6A 3NCWA 4WHYH 1TEFA 4MMZC 4I0KA 1OK8A 1SJXA 3L16A 4HETA 5D2NA 2HH0H 1XZ0B 4NC1C 2XV3A 1F18A 2NPLX 2VDMH 4KHXH 3WNJA 1G7JB 3ZL2A 3MDJA 2W9EL 2ESVA 3ETTA 2V2WB 3JBG7 3O3DA 4BXSV 4D9LL 3GZKA 1QSFD 1TJGL 1R3JB 4NHCL 2VZTA 4OGYH 2A9CA 4U33A 3GEFA 4FC3E 2EECA 1QTSA 4NZTL 1FG9C 1AYOA 4X7EC 3X2QB 3ARGB 4KI5C 2EDXA 1UXSA 3APNA 1ZVYA 5HY9A 3N50A 2OMTA 4PU2A 2P3YA 1PF3A 4LVOC 4U1LA 2HRHA 3BFWA 2XTLA 5EEXA 4ANXA 1D7FA 4CDGC 1T22A 3B7UX 1H3WM 5CFAA 2R1WB 1P69B 1XCTA 5MP6H 4ACPA 1JERA 3TA3C 5IJKA 1KYOK 1NCBL 4G9FA 4LHUD 5HI4C 1E5YA 4U1GC 3SKJL 4KPHL 4OW6A 2EXYD 2JVUA 4BKTC 2BY0A 4C83B 1WDAA 5GRWA 1NCDL 4OJEH 5FUOH 3TT3L 2GY5A 4BDVB 1EZVY 2BS9A 4AUUA 1Z66A 4YGVB 1JTPA 2EDOA 2HRLA 2HTKC 2RCSL 3EYFA 4YHKL 5HI4D 4QHLA 3T2OA 1TUPA 3QO0A 3U2SB 1NM4A 3BLPX 4XBPA 4AL8H 5I76A 1JOIA 1WPCA 3HOGA 1OP3K 4AXWA 2LR4A 1S7XA 4LCWA 5JHLL 2DQJH 1AGBB 2ZAHA 1CK0H 1AQDA 4IGBA 3D05A 4MNQA 1WG3A 5IVZB 3GBEA 1ZGLP 1JUFB 1KT2B 4ACTA 4BKLB 5M95B 1KIRB 4TLSA 3OKEA 3MXVH 4EVNB 4Z3FA 1R33A 2YMOA 2VDNL 1P4LB 3CVHA 3MV01 3QHFL 4MJIE 1KYDA 4OF3A 1A7RH 3BESR 2A5UA 1MJJA 4NQEB 3RP1A 4JPKH 2DKMA 4QF1A 5TF0A 4ZTOH 3TV8A 4TULL 3WKML 4HV8B 3GUTA 3SN6N 3X3GH 2F53A 5J8OA 1KPRA 4QTHA 1DN0A 3CFQA 4J4PA 4NXSA 5IM7A 1V3LA 4NQXA 3U79A 1A6UL 2CPUA 1BG9A 1GIGL 4PRHA 2CJSA 1ZVSB 2A9AA 2ICWA 5C0AD 4K23L 4ZYKB 3RGVD 4FCHA 1NCAH 4PYHA 5JPNC 4GYBA 2BH0A 3RDTC 4YX2H 3GSOA 3D33A 5IJKC 1DVTA 4N2HA 4QRTA 5LCVL 2CK0H 5DD6A 3NACH 1IARB 2UXGA 5HI3C 4GKNA 4O2CA 1AZNA 4AQ1C 3WUWB 1N18A 1JTOA 2NY5L 2FX9H 3P4NA 1HS6A 5K9JH 4G6AC 4PJ6A 4NQSA 4IBWA 3AQYA 1HC1A 5I30H 4BE6A 3MGAA 1PG7X 3KBHE 1TQBC 1FYHB 1Z3RA 2ZX5A 2YGPA 3EG9B 4YO0B 4BSWB 4FXGA 3I3BA 1IB5A 1K2DA 3CQQA 8FABA 3ORJA 2NR6A 4F2MA 4F57H 1KJMA 1J05B 4LFHG 3EFFA 1DLHB 5FB8A 3N1GC 4Y1AB 4Y1TA 2XXFA 3C5XA 4ONHB 5B39A 2NR6C 3V4VL 2CUHA 3H3PL 2NXZB 3ARFD 4QHUB 1EERB 3JV6B 3K6FA 4PP2A 4JFWA 3BRFA 3I9IA 4DP7X 3SJVE 1BFOB 2NY4C 1BHGA 2MCG1 3PF2A 3VFTA 1J18A 2EO1A 4LKCB 3ABKB 43C9B 2O6DA 3HMXA 5DFVD 5J6SA 3VXOB 3NA9H 2ZG3A 5FM4A 2K4AA 2Z7ZA 4UMSA 3CXDL 3FF7A 3C12A 4NDMB 4G7VH 3CBJB 3II3A 3ESNA 4PJEF 1GS6X 4LFHD 5TTRA 3LPWA 1SFDA 2HJLA 3OAZK 4I48A 3HG1D 3FQUB 2EDRA 1S7RA 2WJ5A 2WMPB 3H2WA 4NBYB 5IQLA 1WCBA 4AVHA 1N6QH 1IAOB 5FO8B 3DLQR 3TFKD 4X4XB 5F7DA 3F01A 4AKOA 1T66D 4IMLB 4MZ3A 4NZFA 5I1JH 2J8UF 1AE6L 4Y19D 2IBBA 4ZD3L 3S37H 4J5VA 1EJ8A 3AQDA 1E4WH 3IB4A 4YWGL 2DLHA 2R0LL 5T3ZE 2XXCB 2F54E 2WLLB 4R4BA 2AV7B 2EDFA 4JM2D 4NQCE 4AXWB 1SHXA 5DJ8B 4KMQA 3R06A 4W9GC 4EI6A 1NGPL 3SDAC 2Z0UA 4MHHG 4L37A 4P5TD 2Z8SA 4APXB 1CE6A 4H4NA 3O3AB 1WYJA 4LIQL 1BMZA 3HUJF 1EZSA 4DFHA 5CKAA 1EO7A 3ALWA 3P77B 5DJCA 3IXAA 3G6JF 1QKZL 1T2XA 1XGUB 4HJGA 1IV8A 1BZ7B 2ZKMX 3MJGX 3X11A 5KBNC 2CALA 4I3SH 2BSSA 2OQJB 2GC4C 5L6YH 3X12A 2DD8L 3ECWA 3DUSB 1YY9D 4KY1H 2QDVA 3DTDA 1EDYA 1G4MA 3JWDC 1ZE3C 3B3IB 2AJUL 1MHHB 1ZSHA 2WQSA 3ZKMD 1IAIL 5I73C 3SE8H 1UA6L 5KUMA 5IB2A 2XICA 3PV6A 3MYJB 4AQOA 3V52L 4U31A 1CDYA 3VX0A 4JAMA 4LL9A 1TJIH 3D3VA 2Z31C 2V3EA 3G6AA 2O61A 2NLJA 5CJOL 2W65A 1JXKA 2YD7A 4IDJL 2CO6B 2J3SA 3UZVA 1JGEB 3DIDA 1NLBL 1AHWC 2Q8BH 2IVFC 2QLYA 4R2GC 4LPYA 4ZOEA 4CADA 2YD3A 4XBMA 1KJVA 5F1SA 2IH1A 2Q5BA 3VFSA 1VA9A 2P45B 3VGAB 2Y5EA 3HRZA 5HGHB 4ZODA 4WI0A 43CAB 4A7GF 3VD4A 4HKZB 2V7NB 5I1HL 2H6OA 1BAGA 4ZAKC 4KU1A 4TVPH 1EJOL 2MQGA 3ZQXA 3KMDA 3HRZC 3ARZA 1KV3A 4PJDE 2GHWB 3DETC 3T6XA 2A9DA 3D39E 4Q9QL 3KHOA 1UM4H 3FOLA 5D7LA 1NSNL 4JKKA 5D1ZA 4D8PA 3IDGA 5LQBL 5JA9A 1Z6JT 4I18B 1QNZH 3CDGA 2P80A 3VFWA 3HNTL 4OI7A 3NCYS 3BAEL 4M48H 5C0CD 1RZKL 4FP8L 2V33A 4GKLA 1IBGH 4WFHD 3VQLA 1PDKB 4E41E 4XVOA 2BRRL 1T2JA 1G94A 5FKAA 4PY8I 5I17A 2TSAA 3H2PA 2Y23A 3EIFA 1ILSA 3T77B 2C3VA 3NSCA 4PGCA 3QDGD 2IAMB 2XG5B 2ERJB 5CZVL 5ADPH 4JPQA 1FIGH 5T33H 4UDUB 4PJGB 2A0LC 3TF7C 2A74C 1HDMB 3BN9D 4FLHA 2WLMA 5E0FA 4Z78B 5I8OL 3ARGD 2HWZH 5KZCD 4O2EB 1OAUH 1OT4A 4PJHB 3RL1B 2ZCKH 3EF4A 2RGSA 5E8DH 1WH0A 3LX9A 3VXQA 4H0LC 3ZGHA 2OV0A 3FFCD 3NCCB 3OVUB 3PWUA 4AV0A 4YDZA 2IGFL 3DO4A 4AC2A 2KPNA 4K3HA 4XPTH 4LLYB 3COOA 1JMXA 5CJXA 2OCCB 4G5ZH 4F7TA 3K4DA 1NKGA 1P2CA 2VB5A 2GSGA 2E47A 4RH4A 2ZF8A 4OQ1A 2GSIA 1BXUA 4FQ2H 4AIEA 3UBXB 2PPEA 4A2EA 2VN3A 5MI0B 5DJ0A 1TZIB 5C0CA 5EA0L 2FLBT 5FFGA 1XR9A 4L4JA 4N90D 4E42B 4PIBA 1BLNB 2KQNA 1OGAB 3KW8A 4QOKA 3NSFA 2J4WL 3NEXA 2LHAA 5TPWH 2E9JA 3BH8B 2QQKH 2W92A 4QXUH 4HOMA 2JE8A 1MY5A 3BAJA 3GMPA 2FB4L 1NBZA 2H6PB 3CN2A 3QUXC 3B5TA 5DJCB 1Q9LA 5EFIB 3V4LA 5JA8B 3APMA 4OGAC 5EDSA 1GOFA 3QUYD 2OR9H 3UBXI 3TEZA 2DI7A 2VM3A 4MDJA 4APXA 5L2KE 1GSMA 2TSBA 3REWA 3N44F 1MJUL 4J3OH 1TJHL 1MN4A 2D7MA 2YQBA 1OO2A 1D9KA 1G9EA 5B3JE 3MBXL 2VDKB 1A6AA 1MPAL 1B2YA 3BT2L 1JF1A 1UXMA 4EJ1C 1UM6L 1K8IA 5F6HJ 4BK5C 3HMWL 3BWAB 5F7UA 1BZ8A 1TG8A 4PJBA 4DVRL 3EZJB 4O5LH 4RQQA 3RLSA 1LMIA 1VAHA 4L8BA 3D51A 1CFBA 5HHQA 1D5IH 1KCLA 5L4JA 4G6MH 1HI6A 5AWNL 1MAML 5I5IA 2IADB 2WVVB 3S3DB 1J8KA 1RVFL 2BPBA 2AZAA 1OE1A 2EIEA 1SJMA 2LTQC 3EOYG 1KGIA 4ENZA 5D72H 4YSQA 1R0AH 2J44A 5CZXC 4LO9A 2WQWA 1CQYA 4K2UH 5CINL 1Z9PA 5A2LH 2OYPA 3RZCC 4DEUA 1KXTA 4HH8A 4R5XA 2YOCA 4X9FA 5F72S 3VXOA 4G72B 1XGPA 4OGZA 5HDLA 3W9DA 4IRJA 2ED7A 5D6DC 2ZWZA 2EYTB 5HDRA 5DZAA 2OR8A 4JO1L 4CBPA 4BQCA 4D0DA 2V17H 3WL9B 3KLQA 5LNEA 1T03H 1SXZA 2B16A 3L3IA 3INUH 4U1IA 1NAKL 4Y2DD 3MCKB 3WNKA 4KQ4L 4UM8A 5J3HD 1QLFB 3MBED 1I1AA 2LFGA 3L13A 3V7MA 5AVYB 4GSRA 1XF4A 3LZQA 4GG6E 2BIQA 4TL5A 4X99B 3L4TA 2QQNH 3VG0H 4LSQH 4XNXL 1DLHA 1KCSL 1AGCB 2E7CA 1MFAH 4JRXA 3IMWA 4UTBA 4FQIH 1I8IB 4NO0B 4O9HH 4L3AA 1G9NC 3CVIL 1TVHA 5C07A 3D50A 3G5XA 4MTMA 3DROA 4KJWD 3QIWD 5E5MA 4I9WE 4JR9L 1I8LA 2ZSWB 3GJFB 5HD8C 5CJ5A 2XKSA 3P0VL 1CUOA 3HC3L 4N22A 5DQJB 4PP1C 2UYLA 3CZGA 3O6LH 2WBJC 2AMUA 1QFUL 5LBVA 2CKBB 5F7FA 2VOTA 4Z7VA 4L29B 5DT1L 2A9ML 4NN6C 3PP4L 3OHMB 1SOSA 1ET5A 1HKFA 1U8MA 4FCAA 4X6BB 2A1WL 4TQIA 2ZCHH 2W9LA 3C6EA 1J0YA 3GNML 2YAHA 3T0ED 1BW8A 3I2CL 2YC1A 4AW7A 1JZ8A 1IC5H 2B0SH 1OP3H 3RWJA 3ERXA 3ZHLA 2DH2A 4PMEA 3UJTH 1M7IB 4K3EH 3DROB 1N6VA 3GXFA 1JK8B 1U3HB 1V7NH 2ERJC 1MRFH 3BVDB 4PY7A 4ADGA 4I87A 3HLAB 1MFMA 2IFFH 5H94B 4NAQA 3DDFA 4Z5RA 1XCWA 5I1AA 4P23C 3TFBA 2GSIB 3O81A 5KSVB 2ZPKL 1YMMA 2E9GA 4HJIA 3W9EA 1J1PL 2XTJB 3CN4A 3B9KA 3OX8B 2VO5A 4FF9A 4HX1A 1E28B 4DESA 1UCTA 4EQ3A 5JPMB 3C08L 1PIFA 3CC1A 5AYQA 3NZHH 1G6VK 2EEAA 5D7IB 3NJKA 3RA7L 1YY9C 2PR4L 4OJCA 2WGXA 3MLYH 4HGWA 1LYQA 1OSEA 4UUJB 3KYMA 5DF0A 4ZUTA 1GAFH 2H4EA 2X3BA 4S1RL 2NYYC 1DUYA 4RGNB 2Z8RA 1O7SA 4GLRH 3VI4B 4P3CL 3D0LA 2AV1B 4M9PA 1PZSA 2B4CL 4DJMA 5IB1B 1AD0B 3P3SA 2ZX6A 2DKUA 2CDFA 4C58B 5C09E 2ADIA 4G42B 4KKBC 4HZAA 5FW6A 4OM1H 5A2KH 2XBDA 4ANWA 1BF2A 2B2XL 3G6JE 3FUMA 4OZGF 1YYMH 3HBQA 4BIKA 4HIIA 1NBQA 4QDGA 4EIUA 2YSTA 1TCRB 3NA4A 3Q6GL 5E08L 3FQ1A 3FUHA 3F05A 4Q14A 5KN5B 1KTLA 3UTQA 5CUSH 4OLEA 4HVBA 4QO1A 1XMEB 1JV2A 2X88A 4ODHL 3VFMA 3EFOA 1GTNA 3L3OA 1S3RA 4RWHA 3FK3A 4APQA 2G60H 1ZRUA 2CJTA 3VFSB 3TJHC 2VDRL 1MJ7H 2JB5L 5JHDD 2FNBA 1OTUC 3SPVA 1E40A 2VJ8A 4NM4H 4JO2L 1N7MH 1KXVC 4PJ8B 2AQ1A 3HS0C 2WP3O 5J12C 3S5LA 3FONB 2IH3A 1EQWA 3LB6D 4XHQA 3BKYH 1KN4H 1MFBH 3DYPA 2CIIB 5FHBH 3WTTA 5HPOA 2OPCA 1IGCL 1T22B 3CZKA 2XN2A 3HPLA 4PIRF 4NWUH 5DHMC 1MFBL 3VXPB 3MJ7A 5EEVA 3RGVC 4GS7B 2ATPB 4E5XA 4HWEH 4PJAE 3IFNL 1TZGH 1JZIA 1CI5A 2VISB 2W91A 3KYOA 4C83A 5AB9A 3N5AA 3KCPA 4UQDA 1J12A 4P5MA 2VW7A 4KKLD 1GA2A 4U1HA 1C9SA 1JAEA 1SDDB 1R3JA 2IFGA 3GGWA 3KGUA 1MJ7L 2JB5H 1AQMA 3NDZE 1EFXA 2WUBL 3QEQA 2VSDA 4KROB 1IEHA 1UOWA 3QR2A 4I77L 5C08D 3SCMB 3GSQA 1IM3B 5E2UH 1C5BL 3VFOB 2FSDA 2BNRE 1JMZA 4ODHH 1QBBA 4AE0A 5HY9B 1U91A 4ZPTB 3U82B 5I1LA 3GBDA 5AW7B 2FATH 2NT1A 1HNFA 3H6JA 3RE0A 5SV3A 3QG6A 1DDHA 1T89A 3WFEH 2X28A 1XX9C 5J1SC 5EWIH 3BP5B 1MCCA 1AO7B 4GXUM 1QFWH 3H42L 4QXGH 4ZXBB 5H94A 3RIAF 3SPCA 1TU2A 4GFTB 3GWJA 3S3JA 3TO4D 2DIJA 5CN3A 2C1PB 1BFSA 2WC7A 4LLWA 4X6CA 5CS7A 5EU7E 4UIMA 1DQDL 3IMUA 3KLHC 1J11A 3ELQA 2WW8A 2X0VA 3FQRA 1S7TB 1ROCA 5C0AA 4Q89A 2XQYK 4JKWA 1C12B 4IKLA 5E8EA 5JMOC 2AI0L 1UGKA 1AKJD 2AQTA 3R7QA 2VR5A 4B9GA 5L88H 1DQIA 2OZ4H 3NRPA 1T3FB 1I7UA 5D5MB 3V4PL 4AM0A 5C0FB 3WE6A 4K5MA 4IDLA 3ZK0A 3Q6FB 1BYPA 1E5CA 4X9IA 4RAHA 2R1YB 4HUMB 3OQ3B 1GH7A 3OF6A 5I8KL 1BPVA 2DM2A 3VYPA 1NINA 2XQ0A 3DOSA 4FFVC 1OZUA 3RFZB 1KBGL 5C6WH 4WJG3 3GLEA 5DD3L 4GRWE 4WHDA 3U1SL 2QTVA 3GK8L 4MAZA 1S7TA 4C56A 4W1TA 3ULSB 1TDQA 5I5MA 1HINH 2CGRH 5BMFH 3O3EA 1P7QB 4DK3A 3SEPA 5IJVA 2ZJSL 3EFDH 1SY6A 2GVYA 1U8KB 3FB5B 1JHTB 5HYIA 1U8NB 4R8WH 2IH9A 2GEEA 3HPJB 1FAKT 1OE2A 2ZNWA 2E9WA 1CGSH 3UTTA 3DJSA 4NN5C 5F88B 1KJMB 2GUYA 1RK1A 2A4CA 3U36B 3QG6B 1XCQB 4F80A 4UWQB 2PUQT 1AR1D 4AYMC 2BIMA 3EG9A 2NXZD 3JZYA 4YO0A 4BZYA 2BNQD 5KVEL 4OZIA 2QTEA 3HE7D 1HT6A 1YEKH 1ZWIB 5ABAA 1Z32X 3HC0B 3OKMA 3KHQA 5D9SA 1B2WH 4LDEB 3T0AA 1TTAA 3FO0H 2IG2L 1LM8V 4TSAL 1QI5A 1JHKL 2ZP0T 4V11A 2VXTH 4UYQA 1M53A 4A6YA 2EEXA 3HR5A 4BZ2A 3L3KB 3RVTC 4PJ7F 3GXIA 2X2UA 4QJ4B 4CU8A 4RISL 1R5WB 5EEYA 1F56A 2NY2B 2ARWA 4ORGB 2HN7A 1E4JA 3MBWA 5ETUB 4KRNA 2XWBA 4MJJA 4D9QE 2I9TA 3IMRA 3EHBC 1F4XL 4FLSA 2KPWA 5CSBA 2X4SB 1QMUA 4UZUA 4GI8A 1FNSL 3D1MC 2AK1H 1HZHH 3HG1E 3GYRA 2IV8A 4JDZA 4NAMA 1XTMA 3ZDZF 1EUTA 1BBDL 2OW7A 4RFNC 4LSSH 2CLRA 4NIKB 2WM0A 2OJEB 1NCWL 2ZWSA 3DMMB 4Z8FL 4DZBA 1FBIL 4EDWL 2CE6A 2Y72A 3X1FA 1A7NL 2PYEB 1QFPA 1HWWA 2BC4A 5HHPA 3T3PB 2EDYA 2PWGA 1JPGA 1NCOA 1ZSDB 2JIXB 1GVIA 2C9XA 2V3DA 4V2CB 2JK5A 3L3JA 1N8ZA 2XV2A 4IRZH 1GGCL 1RZFH 4BFEA 3OKLB 1AYRA 1F90H 4YDVB 3MV9D 3GMNA 1XO8A 5FYKL 1ED3B 1NAML 4DERA 4JFOB 5DC2A 4KRPD 3V5HB 2XA8L 4MVBD 3Q8CA 3LNIA 1A25A 3OLGA 2AANA 4HC1H 1KJ2L 3RB5A 3CSYA 5FUCE 3F12B 1UB6B 4Q58C 1UVQB 1DEDA 3ARBD 5F9DC 3ML9A 4Z3TA 2OSLB 1H5BA 5KBMA 5AOKA 2GT9A 4JPWL 1ZY9A 2VDNB 4B97A 4NPYB 1DQJB 3VI3F 1N8OE 1VPOH 2GFBB 4NSKB 5EB9A 3WMPA 2BNRB 3ZYZA 4O5LL 3BN3B 1YYCA 2XTJD 2BP3A 3HZMB 3GIZL 2WD0A 4XN2A 3MCLH 1VESA 3KPNA 4PRNA 5DHYB 3UCQA 5AFAA 4HIQA 5CCJA 2J7LA 1OSPL 2A83B 1SLUA 2WIMA 3UYOD 1YEIL 5AZEH 2HPTA 1WFUA 3QRBA 5BVJA 1KBVA 3UZEA 5LVEA 3QQNA 5E95B 3GMOA 4N8CL 3DNKA 2VH5L 1AS8A 1IBFA 4MAUL 5D7IA 3TGXA 5TQ2L 1UA7A 4N6RA 3QWRA 5F1NB 3QXWA 2EO7A 2YGNA 1ACCA 2F74B 2DMHA 3RRQA 2FB4H 1FL3A 1UEMA 1T1ZA 5A2BA 5AKRA 3VGGA 4QXUL 4BRVA 3C8KB 3L1OH 1WAEA 1YQVH 2ILLA 5JW3H 4ZFZA 3LMJH 3LHAA 1HEJC 5FKAB 5D1ZD 5DJ2B 1BVLB 1SMOA 2GFBA 2RJMA 4DKFH 4OFKA 3BVXA 1Q9LB 3GRWL 4PJ9C 1TLKA 3KBPA 2JCWA 5CU9A 1RZKC 2DL2A 5I0YA 2QPFA 2YEZA 2P5PA 5BS0E 3B2UC 3FC8A 4E0RB 1LK2B 3FNKA 3GLZA 1BQRA 4UT9A 1M9WA 2FZ3A 4TUJB 5D1ZB 4D8PB 1U8JA 2CLZB 4J8RA 3J8F7 5J13C 3TEWA 4XMWA 3WN5B 1AAJA 1M71A 5INDB 3WEXA 4XCFH 5IMMB 2K8MA 1JP5A 2OL3H 1FPTL 2OMUB 3DRQA 3HBZA 4MQ7A 1DDHB 3RY4A 5IW1A 1GGIH 4RSVA 5DEFA 5ID0B 5KYUB 4E41D 3CU7A 4Q4EA 3PDDA 4I5BA 3B1TA 2D0HA 4MZIA 3L7EA 2FGWL 2C7UA 2CNYA 2D4FA 5EG6C 1LP9A 4KK9D 3QIUD 1BVZA 3RL1A 2R69H 4L3EE 4Y2NA 5I76B 3CCHA 1EAOA 4GUOA 3P3YA 5EZJA 1MRDL 4JDZB 2I60H 3TIEB 3MRFA 4PUBL 2FYYA 2XQYG 4G8GE 4L4TE 4U3CA 2KHAA 1IL1A 1WFIA 4C56E 4QLRA 3MNMA 2WYIA 1PX8A 2YA2A 5TFSL 3UEZA 4LCIL 4OFIA 1Q1JH 3TBSA 1OZTG 2V3FA 4G7QB 4URKA 4L8DA 1THAA 2Z31B 3KDMB 2VRKA 2C4FT 4FYSA 4H26B 3L1OL 4LHQB 1ACZA 4KNQA 1SRDA 4L05A 4WW2F 3L9BA 3BWSA 3WL9A 1IJNA 1ONQB 3D85B 1M4KA 3VD5A 3V0IA 1SDYA 5IFJB 4MX7A 5TQ2H 1PL3A 1QSEA 3EO1A 1EDHA 1M7DA 4XCEB 3RVTD 3RWHB 3STZA 4F7PB 1O5DT 4NPJA 3RB7A 3FU6A 4M7LL 1FZJB 1U58B 4NCC1 3SE6A 1MZZA 1XXDC 5I16A 2BCKA 4CC0A 3SBWA 1BLIA 1ZV5A 2YHGA 4KZDL 4WIQA 3VNZA 3ARRA 3V52H 1YNTA 1YEFL 4NO3B 4PWEA 3OAZH 3VA2C 3L6FB 1YYLH 4MJ5B 4NFCA 3ZBMA 3MLPA 1ZHKA 4I18C 3GLDA 3G9VA 5SX5H 2NMSA 3SGDI 4XNYL 5DZOA 1KEGH 2DYPA 1PZUB 12E8H 1U3HD 2BVOB 3RU8H 2C3HA 2KLTA 3MV7A 1NM9A 1CBVH 3QNYB 3UAJD 4XVTH 4QXTB 4Q4IA 5DS2A 4F37F 5I19L 4NJ9H 1WSST 3F84A 4NDMA 1PD0A 2X4NA 3O2DL 3AGVA 4PJDF 3S3SA 1F90L 5IF0A 4IOSA 1I85C 2XXMB 3CLFH 5JOPD 2X4RA 3SDCD 4BM7A 1FGVH 4AQEA 3VWJD 1D6VL 1YEWA 2JKJA 4JG0H 3V5KA 4XC1L 1NAMA 2DLEA 3MSPA 4NKOA 3DOHA 1J1XL 3T3MB 3WFHA 1MW2A 5A16A 1TZHB 2YGVA 3MI6A 4GG6B 4LHUG 2ITFA 3A5VA 2QVFB 3F58H 3RWDB 2E7MA 1RJZA 2C7FA 3S37L 1OP5K 3RURA 3WGUB 2RR3A 1QHQA 4HALA 1I9RH 2K9FB 1I8UA 2XRAH 4A7QA 4TOYL 2Q3XA 3EJRA 4MD5A 3KYKL 3SQBB 5LGHH 4Q9BA 4MNGA 3KYNB 3BSHA 4MNQE 4H25A 5IJVB 2GJZB 2WB1A 2AJYL 4PBDA 3U0PA 1LO5A 3GZOA 3QIWB 4LCWE 2C9VA 5CHNB 1SXAA 1FJ1B 1QTPA 3V5KB 1VZIA 4P0DA 1T0NB 2PTTB 4AQEB 1JI1A 3KPPB 1QI3A 4WEUD 3GGWB 3QEQB 2XZZA 5B7MA 2YA0A 4HS3A 2VL5B 4PG9B 1U92B 5EBMA 5E1HB 4MHHI 3QZPA 5KSUA 3L81A 3AS3A 2AK4E 1UD4A 3KCPB 1CLVA 3KCWA 3HNSH 5CGMA 2O6EA 4R7XA 4OFDA 4X5XB 5MENA 3GI9L 4DGYH 1S9XA 3RBGA 4G9DA 2GYSA 2ADFH 1S7WA 1BOGA 5FF6A 1KLUA 4JO4L 3BVNB 1MSPA 4JPIA 3QAZC 5DEGA 4EN3A 3MRHA 3RHWK 1ETA1 1RP8A 2B8OT 3BDYL 3DXAE 2R59A 4HBQA 5A2IH 4MJ5A 1DE4A 2GBUA 1XR8A 4ODVH 5BMFL 4EOWL 1CDJA 4PVBA 1F6FB 5J7CC 1YEGL 4IRZA 1G5AA 2ZWNA 4YHOH 2X40A 5HYFA 1K3IA 5CP7B 4L5FE 4P05A 2AVGA 2CKBL 4ZXBA 5D93B 1P5UA 2WXKA 4PJ8C 1WLHA 4X8JB 3HRZB 2PW1B 4FXGB 2DQIH 3DA0A 5KVDH 4LLUA 2KDGA 2FSEB 5DEZA 4WU7A 2V5SA 2W81C 1E4HA 1WF5A 2WNKA 3CMOH 3EBIA 3G5ZA 3PPSA 4WU5A 5L88L 3VG9B 4RX4D 1KB9K 3CN3A 2PF6A 4LSVL 5GZNC 3FN0L 5SWSE 3VI4E 1HH6A 4FFZL 2WXOA 3V4PA 2ZCZA 2OYMA 1HSBA 5FWQA 2VABA 3Q8EA 5IK3B 3RL2A 2WBWB 1EXUA 1P4BL 3TH2T 4QWWD 4P4RB 5EU6D 1K5WA 1JRHH 2ZOWA 1ZGLM 4QRPD 1D6EA 3WIIH 4AT6B 1GPOH 2BNRD 2DQEH 4KKAC 4S0TD 4MYWB 1HILB 2E4FA 4M02A 2DTML 2JI2A 1F6AA 4R3SA 1P1ZA 4XB8A 3JWOH 3N1FC 1J0JA 2HFFA 1F3DJ 4U1KB 4MNQD 4IOFC 2VDNH 2VLRA 3BEWB 3BIBX 3MRRA 3M86A 3ATBA 5G4OA 4KITB 1H0DA 3G5ZB 4FYRA 5DRNA 3LSOA 4PJFE 2CSPA 1CD0A 4JPSA 5C0JB 4KKCD 1QLRB 1MCSA 5EU4A 4LEBA 3JT0A 3D25A 2IQAA 4AMXA 1OP9A 4DKEH 2NX5B 2BDNH 1A1NA 3T3ME 3E8UL 4MDJB 4R4ND 3LIZL 4LSTH 3GSVB 4RWYH 2RCSH 5E5UB 4ZUUA 1T0OA 4EZLA 4HPYL 4KOCA 2Y6SD 1QABA 2Y07H 1NAMH 5AAMA 4CRPA 2MOGA 5GS1A 2XCMC 5E9NA 5GIRB 2YFOA 1MELA 2JELL 3WELA 4Y2OA 1ZLDA 2RMNA 4AYGA 5HDBB 2EYRB 3U0TB 1LGVA 1RUMH 3CWGA 1GGYA 2P4AB 3P4MB 5TQ0L 5DS8B 4Q6IC 1T66C 1UWGL 4BSVB 3Q48A 3PHSA 2WAQA 4F91B 3ZL4L 3BKYL 3IGLA 4L4VE 4J2QA 5EU5A 2WXPA 2BW5A 3PQYD 5T8IA 3F5WB 4H88H 3TNNA 2HRPL 4FMKA 4IHBA 1BBDH 2YD0A 3PG2A 1T7XA 4YSEA 5C0EA 4AUJA 4J3BA 2DWXA 2A9BA 1INQB 3QORC 4OCLC 2NR6D 4NZTH 4ZDHB 3E8UH 5IVXB 4LL1A 4P9HH 1J5DA 4YE4H 1T0NA 3AREA 2YN3A 3QS3A 1WAPA 4WEBH 4Y5VB 4YSPA 2BIIA 4A6YH 2V4LA 1X5KA 3PDOA 2CO3A 4DKAA 4FA8A 1NPNA 1G9MC 4U3HA 4Z78A 5J6GA 3IMBA 4ESKA 1M1SA 5E2WH 2Z1PA 4PB9H 5K9KA 4LDOB 1UA3A 3K4AA 4JZNB 4GP8B 3MV9A 4KHXL 5E23A 4KKQA 1JHKH 3O6FA 4M1DL 5KBDA 1SEQL 2LTQB 4ZO8A 3UO1L 3VCLB 3HB3C 4RAVA 1KZQA 1YYML 3R4RA 1ORSA 3B9KB 3CFNA 3FTXA 5PAZA 2EXTA 2FIKB 3H2QA 4IBVA 3RJDA 4Z7NF 4M1GH 3PNWA 3C75A 2FQGA 4KXAA 4K55A 3QRGL 4OZFG 2G3XA 5F7WC 3S7GA 2NQDA 4OZ4A 2ODIA 1AZZC 3MOBL 1MIEH 4ODXA 1Y0LB 5E03A 5DSCB 4LOVA 4NHUB 4EUPA 3ELAT 3RZWA 3W0WA 5JPNA 1NEZA 1RUKH 1FE8L 2ORBH 2EKJA 4H8WL 2DQFA 3EJCA 5D5ME 5GGSB 3QA3B 2VXUL 4K9EC 2X4UA 5I75B 2FQFA 5IR1A 1RJZB 3MRBB 5KVDE 4AIZA 2J8HA 2QFRA 4GAGL 3K71A 4YEFA 4Y4KD 4GI9A 5HGHA 3VB8A 2WB7A 4ANVA 3S4SB 3TYGL 1CMOA 1RFDH 4CC1A 2X05A 3LJ3A 3VQ1C 1U8MB 4R97C 4X4MA 1L7IL 1RUPH 4APQC 1TQCB 4L5FH 4K0OA 2VERA 4NCC2 4N68A 3ZTNL 2ICWB 2YJLA 3OSVA 2DQGH 1XF3B 5D2LA 1OAKH 2H2SC 3T3MF 2HFGH 1RFDL 2JXMA 5H2BB 3S36L 2V2XB 1JPST 1KXVA 3MZGB 1NANH 2YLHA 4PSPA 5LXGH 5DRWA 5CHNA 3UTSE 1E2WA 5CAYB 2NY2D 1M7UA 5KOVC 4KQ0A 2NY0C 3MV8B 4W68A 4Y1AE 5FK9B 3WCYA 4EI5D 3KYNA 4FG0A 5L4IA 1CXFA 4FLRA 4QRPE 3OXSA 5J11C 2PETA 1H3TA 1U33A 2AGJL 1IZKA 4OZGE 3B3IA 4CGUB 1CE1L 2H8PB 3ATFA 1Q9WA 3KH4A 2QPUA 3PJSB 1IQWH 2Z1KA 2M1KA 3HNSL 3VTAA 1FFTB 2Q10A 2GPZA 4NKIH 1S8DA 2ISDA 3HI1A 1KDJA 1ZT7B 4KH2A 3GSRA 3QEUA 4LCWB 3W57A 2SODB 3SQOH 4X6FA 1KF9B 5E2WL 1K8DB 5EU3B 5L4MA 1G7PA 3IF1B 4E36A 4KOBA 1KDIA 4E42A 5LB1A 3VXUB 2W0KA 4TTDD 3QJZA 1ZEAL 3ZDXB 4WEBL 4OB5L 2M83A 4NS0A 4KKRA 4YE4L 3SGEI 4UM9D 1NOAA 4QYAA 4YS4A 4KK6C 3SYQA 2WUBH 4U05A 1QSEE 2YD6A 3WY4A 1G7MB 4UZGA 5EEUA 4M8QB 2OXHB 3U2IA 4ZO6A 3U9WA 2G0LA 5D70H 1KNOA 2AJ3B 3DX8B 4EXKA 2XWEA 3A0OA 1QVOA 5FO8A 3HG4A 2QSVA 1PY9A 4HCRL 3ZDXE 2XA3A 1K8IB 1E27A 1TVBB 3O0RH 5EEZA 5F9OL 4XNZC 3FH8A 2P5WA 3A4AA 2DDQH 2DW5A 4L4TD 1MF2L 4N25A 3ZT5A 3GC3A 3T77A 1JZGA 4FTVA 1IEBB 1MXGA 3SDXF 4YHYB 3RWHA 4MXVF 3STZB 1N7ML 1IAKB 1GGBH 3WIFA 1E3ZA 3DJRA 1R0AL 1DVFC 2UXFA 4CW1A 4Q2ZB 2G60L 3BD4A 5D2LB 3T0DA 1UXLA 4TUJA 3QUML 2CUIA 5C0AB 4HIEA 4WDIA 1HX0A 2F1EA 2MNJB 4XP9L 4OZ4B 3VD0A 1WWWX 5B8CA 1TMQA 2W60B 5F1IA 2MTAA 1G4RA 3QQXA 3TBYB 1ZT1A 4ODUB 5B21A 3PAYA 4DZ8A 5INDA 1OXYA 4KROD 4NZJA 5T3ZD 1DANT 2FIKA 3UROR 4IU3A 1YEFH 4YZWA 1I3UA 2VLJE 2XVKA 2VLME 4PJCF 3MJ8B 2KLRA 4M43L 5D7JD 1FNGB 2BWDA 1BJMA 3BZEA 2WLZA 4N2LA 1N0XL 4HXAH 5IBTL 4P3CH 1IC7L 4TQ8A 5FECA 3FO9A 1MWAA 4GQRA 4IYKA 1CFSB 2E3VA 5FIEA 5I1GH 1CJYA 1M56B 2HUEA 4JW3A 4QXVA 1T1WA 3BW9B 5E8OB 3TCLA 5GRXG 1J48A 3P11H 3DTXB 3U4BL 3N0AA 3RDTA 5C0EB 2YPLE 1RL1A 3RWEB 3PV6B 1IO4C 4M6NH 3NZHL 4LQ1A 2WSPA 3KH3A 4HFWB 3SY0B 3RWCA 5CCKL 2GT9B 1CICA 4TQEH 2OKMA 4NRZB 2EH8H 2YXFA 4KKAD 2EVJA 4GQQA 4WW1A 3IBOA 3BHBA 2E27H 1FZOA 4FNTA 4MB5A 4MMXC 3OPZH 1PZDA 5DHYA 1LL1A 4N2AA 3T1FB 3Q06A 4XH2A 3GUTB 5D6CB 3D2UD 4XPTL 5J1TC 1IM9B 3BISA 4G80B 3LVTA 5F0JB 2EEBA 1DQJA 1CB4A 1INEH 1NEZG 2VDQB 3L4UA 1NC2B 1JZDC 1P4LA 3CVHB 5DD1L 2XY2A 5E6YA 4DW2H 1I3RA 2N7BA 3TBTA 2MKLC 4X6BA 4X0KB 4L37B 1BQLL 1HU8A 1D9KC 2MHAB 3IGUA 4PJ9D 3PHQA 3QRFM 1RZGB 3MV11 3E6HA 5D8JL 2YN5A 5IP4A 1FL3B 4OCXH 3L3DB 2OULB 3PPEA 3PP3K 2X12A 4YDNA 2NNXA 1S7UA 5I1IL 5EUKA 2KC0A 2BOLA 3B5GA 4JRYE 1FVCB 3QJVB 1X5FA 3RAJL 2YIHA 1EGJL 1T04B 1PY4A 1SOQA 1I9IH 3OSKA 1HKLH 1TPXB 4F20A 4X83A 3ASWA 3OPZL 4R4FL 2X6VA 3G04B 3P0VH 5L2JA 1IU1A 4LLQA 1Q94B 4TNWF 4JR9H 1QVOB 3UMTA 5FAAA 3PYCA 3DX1A 3T0EC 4P3DB 4NQTA 5IB2B 4Q9QH 1XF4B 1ZJBA 2A6KA 4YVNA 2ZUYA 5E9DB 2F58H 4DKFL 2AJSH 4QJ5B 1TKWA 4TVPL 2YXVA 1I1AD 1A1OA 3RIKA 5L9DH 3ARSA 1J0KA 3NEEA 2AXWA 3NDYE 4YBQD 3S36X 2XI9A 5C7XL 3H9SE 3HG1A 3QDJE 4PP1D 1A7QL 1GY2A 3UTOA 3HC0A 1A3QA 4GSUA 3KL5A 5EO1B 1TSRA 5JUEH 1OD9A 1E8ZA 2HMIC 4JM2B 3P3RA 1CDUA 1D6VH 1LD9B 4NUJB 4IDJH 3I9GL 1T03L 5GGRY 2VDOB 1QO3B 4XNQA 1UZ8B 2PO6D 4JHZA 4P59L 3ZYJA 3WEMA 1F58H 4GW5A 1T21A 3VWKC 3DSFH 3OB0H 1DR9A 1PAMA 3GIVA 4HF5L 3RNKB 5C6TL 1N64L 5IT2L 2VLKD 1RIHH 4H25B 4ZNEE 1J8HB 5J3HC 2LQRA 3OZKA 4MJIA 2UUDK 2ADGB 5DRXA 3ULVL 1HE7A 1FNGA 5IIEB 2DLGA 1MCRA 1FZMB 2K45A 4BWWA 1WS7A 3QO1A 3BWAA 3RVXC 4FQ1H 3U6RA 4WFGE 4LEOA 1VJSA 2FWOB 4ZUVA 1HHGA 2XKNA 4NKMB 3ULVH 2XA8H 3GSWB 2Q76A 4AIXA 4OLZH 1I8MB 3FB5A 1YYLL 3RX8A 1A3LL 1GGBL 1UWXH 3X1GA 5C6TH 3MLUH 5IT2H 2CCVA 3FT2B 3DSFL 2C9RA 2ZD0A 5DMKA 2J6EA 4PS8A 2XTSA 4D7BA 4LNVA 4O58H 1YN6B 3BCFA 4PJHF 4X9YA 1LMKA 1QRNB 5DVPA 5AW2B 4YBLC 3BVNA 1KLUB 3I9GH 5GGRA 1EHLH 4L3CA 5M7QA 2EIKB 3ARDB 4J3WA 2WO4A 4HCRH 4N20A 5DK0B 2R1YA 1QSFE 1U30A 5A1AA 2B39A 5SWZD 1Q0XH 1ZWIA 3CFIC 4KNTA 4EDWH 1N5AB 1J9RA 4PREA 3NEOA 1AS6A 5I15L 5D70L 4LNRA 1HHGB 3OAYH 4PWIA 4GBXB 4F5CE 3LS4H 4KJWC 1E30A 1IGTB 1VKXB 1CD9B 4KXBA 4KUCF 3KDPB 2QPSA 3KWWA 4KK8D 4ZPVA 3DBXA 1XVSA 1T83C 1Q1JL 3L6FA 1YA5A 3PHOB 3QISA 5TFSH 3IDXH 1R3LB 1E8WA 2G30A 3ATDA 4KUZL 1EXHA 1BXXA 3ULSA 1HHHA 1KELL 4UT9L 1U95A 4NBXB 3JV4A 5DGRA 5C9KA 1UHVA 3CXDH 1TQTA 2CNZA 3MRLB 1IVLA 1T20A 4P04A 1TIUA 3CNKA 3ZIYA 1UXWA 5AKSA 5FUCC 1CL7H 3QNXA 5IHHA 5IKCB 1PLGL 4RGNE 5DURB 4LNRB 4AYBA 3PE9A 3S97C 1YEKL 2X4NB 2XVBA 2DPKA 3D87B 3B43A 2ALAA 2K8QA 4KXDA 5A16B 3BGMB 3KPRA 3DIFA 2NX5D 4U1SB 4F7CB 2A74A 3RNQA 1YEHL 4G7SB 4NOFA 5D71H 3FU7A 1L3WA 1OGTA 2XPGB 3DK2A 1BVKB 4XGZB 3KZ8A 3OJVC 5DD1H 2ZWKA 1YNLL 3OKNB 3TH3T 4M6OH 5E9DE 5EUOB 3B2DC 1INEL 5HHQB 3EXLA 1B4JL 3AMKA 4ZO7A 7FABH 5LLIC 4LLAA 1ERNA 1LO2H 3FSAA 4QXTA 2IPTL 5CIPA 3S5YA 1RI8A 2V9QA 3WLBB 5K9OA 1HZKA 2QKSA 3HPLB 1IFRA 4B7LA 1L0PA 5DUPH 1IJ9A 3IM1A 5I8KH 4LOUC 3US9A 3NACL 3V7AG 3N3EA 3W1ZA 3WUWG 3TYGH 1JNNL 3MA7A 3HS0A 3IPEA 1EJOH 4B3EA 3E6FA 2IDTA 3KPTA 5FV1L 5C97A 5T1KB 3BLKA 1DSFH 2Y7SA 1BCIA 3BSZL 3KPRD 4BFIB