4E9XA

Multicopper oxidase mglac (data3)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
317
structure length
317
Chain Sequence
AEREFDMTIEEVTIKVAPGLDYKVFGFNGQVPGPLIHVQEGDDVIVNVTNNTSLPHTIHWHGVHQKGTWRSDGVPGVTQQPIEAGDSYTYKFKADRIGTLWYHCHVNVNEHVGVRGMWGPLIVDPKQPLPIEKRVTKDVIMMMSTWESAVADKYGEGGTPMNVADYFSVNAKSFPLTQPLRVKKGDVVKIRFFGAGGGIHAMHSHGHDMLVTHKDGLPLDSPYYADTVLVSPGERYDVIIEADNPGRFIFHDHVDTHVTAGGKHPGGPITVIEYDGVPVDDWYVWKDKDYDPNFFYSESLKQGYGMFDHDGFKGEFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Multicopper oxidase
publication title New insights into the catalytic active-site structure of multicopper oxidases
doi rcsb
source organism Uncultured bacterium
molecule tags Metal binding protein
total genus 95
structure length 317
sequence length 317
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9xA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9xA02
1AIZA 4UF7C 4YVUA 1J5CA 2BHFA 1AZBA 3EH5B 3EH4B 4YSOA 1QNIA 2FTAA 5TK2A 3FSZA 1OCCB 2ZOOA 3FSVA 4AKOA 4HIPA 4CSPA 1J5DA 2R7EB 1HFUA 1A4AA 1JZIA 1OCRB 3T6XA 3T6WA 1ZDQA 1L9TA 1SDDA 2CAKA 3X1BA 1PAZA 1XMEB 4KOCA 6PAZA 3L45A 1J9SA 3SBPA 2P80D 3QQXA 4HCIA 3AG4B 3FU7B 1B3IA 3PAUA 4E9TA 3OMAB 2EIMB 1AS7A 1DYZA 2MRYA 4KNTA 4DP2X 4AKPA 1PZAA 3WKPA 1BEXA 2FT7A 2H3XC 2PP8A 2XVBA 4N4YB 5B1KA 4QLWA 3QJTB 4DP9X 5I6KA 3UAAA 2YAEA 2I85A 1E5YA 2CBPA 1ASOA 3FT0A 4K9JA 2FQEA 1TU2A 1KGYE 2PP7A 3MBWB 3PAVA 4E9WA 1NICA 1JZEA 2UXVA 1JXDA 2ZXWB 1JVOA 4BXVA 2VW7A 4KO6A 1AG6A 2HX7A 1GSKA 4YSPA 1PLCA 3AZUA 3NJKA 3QPKA 5I26A 4JHUA 5AFAA 1JXGA 2IDQA 1I53A 2B08A 1WAEA 1V55B 4FAAB 3S8GB 1AANA 5I6MA 1OE3A 3IN0A 4AI7A 1T5KA 4YSSA 4HALA 1FFTB 1W6WA 4E9YA 1ASPA 4GYBA 1PCSA 3DTUB 5A7EA 3FS9A 3UAEA 1WA2X 4GP5B 1BQKA 1GS6X 1SFHA 5I5JA 3PPSA 1NIEA 5EHFA 2CJ3A 4G72B 2X88A 4HCGA 2HX9A 2QPDB 1AZUA 2W88A 2QT6A 1N68A 2YAOA 2E86A 3NP4A 1GYCA 3UADA 1PZBA 2AZAA 3CDZB 4F7KA 2VW4A 1OCZB 1ZIAA 2UXTA 3FQ1A 1E65A 1A3ZA 2PCYA 4QKTA 4BDVB 1ZV2A 5F7BA 3WNIA 3GDCA 1IKOP 5B1BB 1JXFA 4YL4A 2J57A 3DKHA 2DYSB 1NPJA 1OF0A 4UAHA 4KNUA 1KDIA 4MFHA 1BQRA 3G5WA 2PPCA 4WTQA 2HRHA 4PAZA 3X1NA 4E9RA 5PCYA 2VW6A 3FQYA 3ZDWA 3QJVB 1KCWA 2J55A 1HAWA 4HHGA 3SQRA 3AG3B 4DP1X 1PNDA 3AW5A 2QDVA 3NSYA 2BP8A 5I28A 2XLLA 3ZIYA 2XYBA 2VSMB 1CURA 1WA0X 2AVFA 4BWTA 3NYKA 3MX0B 5B3SB 3S8FB 2FQGA 2GC4C 2TSBA 4NERA 2GB2A 1RKRA 1ID2A 3WG7B 1ZDSA 2JKWA 1A4CA 3ABGA 2CALA 2HX8A 3X1FA 2UX7A 1AAJA 1GW0A 4E9SA 4E9VA 1ILUA 2A3TA 4EF3A 4BXSV 2PPAA 1WS8A 1SDDB 2FT8A 3CVCA 2FQDA 2VM4A 1DZ0A 1KCBA 1ASQA 2XX0A 1ZIBA 3GXUB 4DP8X 1M56B 4RH4A 1AZCA 2Q5BA 4A2DA 1RCYA 2TSAA 2J56A 3D12B 4JKNA 1L9OA 2YARA 2I7SA 2GC7C 2YXVA 1SNRA 4YSAA 3FSWA 2XUWA 1E5ZA 2BP0A 2P80A 4W1TA 2XX1A 3OQRA 4HCFA 4DP6X 4AKQA 3DIVA 2GBAA 1JZJA 1OCOB 2XV2A 3X1EA 1NIAA 1OV8A 1EHKB 3HB3B 3KW8A 1GS7A 3PXLA 3EH3B 4YSTA 4A2GA 4BK5C 3TBBA 1TKWA 1SFDA 3NJNA 2WO3B 2DYRB 2HZHA 3FU7A 1AS8A 2PLTA 4WKXA 2J5WA 1PNCA 1TEGA 2HLEB 3T9WA 4CSZA 2IDUA 2UXGA 3V9CA 4GY4A 4A2FA 1JVLA 2OV0A 3N2JA 2W8CA 1M9WA 1HAUA 1NWOA 1MG3C 3EHBB 5I6OA 1FWXA 1AACA 3FYIB 5IY5B 4GXFA 5FC9A 2XV3A 2N0MA 1NINA 4KO7A 1BAWA 3N55A 1KBWA 3NJFA 3TA4D 3ZBMA 4ZK8A 1A4BA 4YSEA 2FWLB 5D4JA 5LDUA 4DPCX 4DP7X 2DY2A 3CG8A 4JHVA 1ADWA 2H47C 9PCYA 3QJRB 1XB6A 1NIFA 4UANA 3BVDB 4YVNA 1RZQA 3CVDA 1BXUA 1CUOA 1SHWA 2JFCA 1JOIA 1SJMA 2GI0A 1ET7A 2PPDA 1IBZA 2ZWNA 3NT0A 1IBYA 5PAZA 4DPBX 4DP0X 2YAPA 4W9ZA 1E30A 4NAJA 3ASOB 2DV6A 2BZCA 3EF4A 1SF5A 3QJSB 3FQ2A 5D4IA 2VN3A 5D4HA 2B3IA 1L9QA 5AZUA 4HAKA 3C75A 3T71A 3RYMA 7PAZA 1OOWA 2LLNA 3UGEA 1KV7A 4F2EA 2IWEA 1J9RA 3IN2A 1AQ8A 2HRGA 3NJGA 2BP8B 2H5UA 3JT2A 1SF3A 3NJHA 1CYXA 3PLYA 1IC0A 4E9XA 4KNSA 3WNJA 3NJIA 2PCFA 3X1GA 4GP4B 3NP3A 3T6VA 2EINB 1YLBB 5B1AB 3H4FA 4GP8B 3NSCA 1JZGA 1NDTA 1KBVA 2IH9A 4L0PB 2QPEB 1NZRA 3H4HA 3OD3A 3NJLA 3NJMA 1N70A 2AZUA 2CUAA 1L9RA 2XV0A 4G7SB 3X2QB 3SBQA 2X87A 2EIJB 3OM3B 5I5IA 4KO5A 3S3BB 3AG1B 1CC3A 4YSCA 1ZPUA 1X9UA 1W6LA 1MG2C 2RACA 4NB7A 3ABLB 4G7QB 2XXFA 5TK4A 4DPAX 1PY0A 2I7OA 4BWWA 1AZNA 3OMNB 1BYPA 4N8UA 5B7FA 3HEIB 2CCWA 1L9SA 1BYOA 1KYAA 3ASNB 4G71B 3FU8A 1XB3A 2YAMA 2PPEA 4A67A 3NJJA 1PF3A 3SBRA 2BWIA 1KDJA 2HXAA 2BP0B 1VLXA 2NRDA 3AY2A 4P5RA 3CVBA 1PLAA 3JTBA 1J9QA 4M4RB 2IWFA 2ZONA 1NPNA 3UACA 4G7RB 4A2EA 2BWDA 2R7EA 4A68A 3FPYA 5I6NA 2BW4A 2WSDA 1UATA 5I6PA 5ANHA 3IE9A 2BW5A 4HZ1A 2JXMA 3CZUB 1RZPA 1E67A 4M3HA 2IDTA 2GIMA 1OE2A 1AS6A 3GYRA 3KW7A 2YQBA 1GY1A 4DP5X 2AFNA 2FT6A 6PCYA 1SHXA 1TEFA 3ERXA 3WI9A 1BQ5A 3NSFA 3AG2B 1NTDA 4X4KA 4FA7B 2Y1AA 1PZCA 2YAQA 1MZZA 1URIA 5I5MA 2IDSA 3V9EA 1NIBA 1QLEB 3QJUB 4A66A 3TBCA 3QJQB 1CYWA 1F56A 3FSAA 3FU9A 2OCCB 4E9QA 3WKQA 3IEAA 4YSQA 4AX3A 5AKRA 1GY2A 1BXVA 2UX6A 4PCYA 1ILSA 1AOZA 3S3DB 4KO9A 4F2FA 2BO0A 1J9TA 2EIKB 1BXAA 2PP9A 4G70B 8PAZA 1A8ZA 4P5SA 4A2HA 1V10A 3ZX1A 4KOBA 3PAZA 2YAHA 2FNWA 1A65A 1AZRA 1XB8A 3FYEB 3NSDA 1MZYA 4YSDA 3UABA 2VSKB 1NIDA 7PCYA 2FJSA 5E9NA 1AR1B 1MDAA 5B7EA 2PPFA 1R1CA 2BZ7A 3ABMB 1JZHA 4Q89A 2OJ1A 1X9RA 2IAAC 3BQVA 4AZUA 4ENZA 1NWPA 1L9PA 2YAFA 2YXWA 3CDZA 5F7AA 1V54B 2WO2B 2XWZA 4YSRA 1W8EA 3ABKB 3FPXA 2EILB 3PCYA 4HHWA 2XU9A 1FA4A 4BDVA 1ETJA 1EZLA 2MTAA 2AANA 2Q9OA 1GS8A 5I6LA 3TU6A 1PMYA 2IH8A 2IDFA 2XXGA 2Y69B 3T6ZA 2QDWA 4TXVB 1JERA 2GSMB 4YSUA 3H56A 1OE1A 1PLBA 1ET8A 1AG0A 2IWKA 5B1JC 1ET5A 5B1JA 2GHZA 3WIAA 4Q8BA 1M57B 2VMJA 3OMIB 2UXFA 3TASA 4BWUA 1WA1X 1WS7A 1QHQA 3IBOA 1JZFA 3S3CB 1GR7A 3U25A 2DWSA 5B7MA 1IUZA 2VM3A 2FQFA 2DWTA 4DP4X
chains in the Genus database with same CATH superfamily
1Q38A 2XYCA 1KXTA 3FQXB 1VACB 2CLZA 2OKMA 2BHFA 4BZYA 3N91A 3NVQA 4ICWA 2VLRD 4X99B 1OK0A 3WELA 1Z0NA 1I9EA 4YAQA 2FIRT 2W65A 3THML 1J5DA 1FVEA 3MI6A 4E36A 1JP5A 1LHZA 2MQ0A 5CGYD 3QDMA 4GMTH 4PRHA 4U1KB 3D18B 3BHBB 2AQQA 4X83A 4JDVA 2LTQC 3AG4B 2DQHL 5JOFB 1HESA 3TL5A 3CH1B 5HJ3A 4I18C 1EFQA 4JAMB 3RFRA 1PZAA 4Y16B 3C6EA 3CQFA 2K6WA 2WBJD 5I6KA 1BVKA 3SDXA 2OZ4H 1KB5L 2B15A 1PEZA 4QHNB 1YC7A 1M1XA 1FDLL 3G08B 5JPMC 1VFAB 3JWDC 3TNMA 3PDOA 3WTYA 4BINA 3KPOA 3ZSTA 4E5XG 1KGJA 3HE6D 5G55A 4P46C 1D6EA 3ZTJH 3M1BA 1LTXA 4ZXBC 1TQBB 1OGAA 15C8L 1EXGA 2OTWB 2R27A 5FV1L 4JCMA 2Z0BA 1NCCL 1E5CA 1X5AA 3HRPA 4KVNL 5DQ9B 1T5KA 2IXQB 4NM4H 2J72A 4MXVE 4EZJA 5B21A 3DOIA 3GMPB 2O5ZL 5F7UA 4GXUM 4XI5D 4N0UA 4F9PC 4WQOA 2ZUQC 2X9YA 3D0LB 1OLLA 4NKDB 5CEYB 3BPCB 3PGDA 4MLIA 1SUHA 2NTFB 4EBQH 3FTGA 3Q44A 4I0PB 5IHBA 3L3IA 5AEAA 3EOTL 4YXKH 4UINH 4DGVL 3LH9A 5F3FA 1SGKA 2MMXA 1IGYB 2ITDA 3QH3B 3V6OE 3V52H 2UWEB 1BZ7A 3LS4L 4K94L 3VFGH 3U9UA 4HV8A 4U1SB 2X4TA 3E8UH 4HHAA 4J8RA 32C2B 4MB4A 4RFNB 1EEYB 2P44B 4P4KA 3VU2A 4G9FB 4UQDA 2WLJA 1HIML 2I25N 1BZDA 4QRUB 1YAZA 3OPZL 4NFBA 4RFOH 3GXMA 3N9GH 1LWJA 2JF1A 3UPRA 4JFOA 4XO5A 4ZQKA 3O9WA 5E8OB 2MOQA 3A67L 4KHTH 3VXUE 4A38A 2HFEB 1H19A 4LEOA 3JWNG 3MNZA 2Y1YA 1L3WA 1NFDB 1YN7A 3HKZA 5F1NB 4D0CA 1XGYH 4FTVA 3CFJB 3AG3B 1ZANH 2VE6A 1M2OA 1SJHB 5GXBB 5FLVA 4PG9B 3G5ZB 2Q7AA 3L7EA 4HIHA 2C9VA 4IM8A 1W80A 2CR6A 4LLVA 4ZTPH 3V79C 4CC4C 5I2IB 3MUUA 4KY1L 3O4LA 3VI4F 3L95A 4XBGA 4KJPC 5HD8C 1R3IH 2HG5A 4JZJC 3HVNA 2JKWA 1MH5B 1N12A 1OM9A 1RZ7H 4OIBA 4WUUB 2VSCA 1AXSA 5SWZA 4ZSOA 4EI5C 2VDQB 3FQUA 4L8SA 5HDLA 1HHGA 4WHTA 3TM6A 1ILUA 3WFEH 3VA2C 4Q58C 4IU3A 2NUPB 3IETA 3LXAA 2V9UA 3FQTA 3H2QA 3I02A 3DXAD 2PWHA 4UAOC 2NY7L 1ZIBA 4J3OF 4DP8X 5BXFB 4OFVA 1BD2E 4GG6A 1M56B 4OZGF 4KXBA 2Y6SD 3Q7JA 4YHML 1RCYA 2Y3NA 3D12B 4JKNA 1H0DB 1L9OA 1VZIA 4MA1B 3WIHA 1KT2A 4CW1A 3CHSA 2EKSB 4QRQA 5EZPA 1GKEA 3SDYH 3FSWA 2NY6C 3TBTB 1R75A 5D7JA 3SD2A 3TXAA 5GS3A 1KFGA 4ZMTA 2W07A 3CNKA 3QRGH 2YPVA 3O3UN 4AT6B 1TU2B 2B59A 4OCRH 3CFEA 4XHJD 2IAMA 2LVEA 1KLGB 4Q0XH 1S4IA 1UM4L 2AV7B 3GBNL 4X8XA 5C0AD 3T0XA 5DTFB 4EN3C 5LNGA 1E6OH 2I24N 2R1YA 3CN3A 1KWGA 1Z5HA 5LLIC 1RAMA 1OAUL 1QWUA 4PI0A 4LBEB 1CD8A 4O5LL 1D5BB 3OV6A 5HGDB 1OK8A 3MNWA 3ZVVA 3D2UD 1DQIA 4MYWB 3ZE1E 2OV0A 4PJCA 5MEQA 4G43A 2Y07H 1A47A 3AU1B 5D96B 1YPZE 1H3PL 5FF6A 1A3QA 3A3YB 5I6OA 5FK9B 3J2PA 1CFNA 3MRMB 1PSKH 2DJUA 2WM0A 1KYOJ 1L6XA 3GZKA 4NUMA 4U7MA 4KVCH 4WHYG 5IY5B 1OP5H 1OP4A 3RDTC 4X4MA 1B4JL 2Z8VC 1CIUA 3LIZL 2ISDA 3SN6N 4FFZL 3WJJC 3ZBMA 2RTTA 3APNA 3MV8D 4YIQB 3BAIA 3H6JA 5FYKU 4ODWA 3ZHFA 3CFMA 5BRPA 2BSRB 4GS7C 1K3ZA 4OVUA 5EOQL 2BK8A 4QR7A 4NC2B 2G75A 3V6FB 2R29L 2VR8A 4U1IA 2NY4C 3P4OA 4QHUA 5LCVA 1HN1A 4MA3A 3TONA 3VFVA 4PJ6A 4XXWC 5AB9A 2JI1A 3N04A 4XAKD 3I6LE 4JLRA 5IB1A 2UY7B 1NCJA 1SHWA 3QDJD 5E0FA 2VMFA 4UIKH 2AVGA 4JHAH 1CZ8L 3HE7C 5D71H 2DQIH 5AYQA 4MJ5B 1CE1L 3QO1A 4GB9A 1KCUH 4B9ZA 3FU6A 1BFTA 1KPVA 2GEEA 2WJ7A 2YAPA 2YRBA 4LO9A 4W68A 1U8HB 4X7FC 4NAJA 5C8JB 5IB3B 4JZOB 4QHPA 2OZNA 3ARDA 3EF4A 1MVFA 1SF5A 1YNLH 4I5BA 3Q05A 2OW6A 3UG4A 3CQPA 2DWYA 3C75A 4F93B 5HPMA 1CLVA 1RK0B 3Q1EA 4P5TA 3MRGB 4JHZA 1EDHA 2VLLA 3IDNB 1DSFL 4XVOA 1HDMB 1ZTMA 2AJ3A 3JT2A 4ZW3A 3CXHK 4FFWC 3PWJB 1FL5B 1EZVY 3IMTA 1ED3B 3BP6B 5KS9A 4L4TA 5AW9B 5HVGB 1UJTA 2ICCA 3SKUD 3D39A 4LMQI 1XHHA 2VJXA 4HUCA 3NJLA 1VIWA 1YEJL 1FHNA 2C9PA 4TNWF 1C1EH 3VG9B 4G7SB 1HYRC 3ESNA 4HWNA 3TX4A 1KYDA 4UTBH 4P07A 4LARL 4CMMB 4O2CA 3HMXA 3K0WA 3QUXC 4PG2C 1DLHA 4NZUH 1FNAA 4M6ML 3LRSB 4N6RA 3C5ZD 1QABA 1T5WA 2EO1A 3GZQA 3S4SA 1EZVX 4Z3FA 5I1KH 5EFIB 5HGAB 1TQCB 4OD2A 1BYOA 4TNGA 1UXSB 3EW3B 1E50A 1MKFA 2OL3H 3B2PA 1CD1B 2DQJH 5JHLA 5KSVB 3S35H 2VDRH 4N20A 4NNYB 3GMOA 5I1HL 3D1MC 3UJJH 3IGFA 1ZEAH 3Q06A 4J8QA 3JUYA 3UL4A 1UH2A 4EI6B 2B9AA 1IGTB 1QRNE 4QGTA 4JGUA 1EHXA 1SRDA 5CS7A 4YDKL 3QIWA 3LKOA 3I9AA 4C4UA 5CJ5A 1QFWL 3VI3F 3G5XA 3QRFM 2FD6H 1O0VA 1UADC 3DPBB 2QVFB 1YUKB 3KPQA 5IBLD 3MRPA 3M17A 3QZWG 1C12A 4ZOCA 2H6PA 3CDFA 5LDSA 2V17H 4LCWE 3OJVC 2ADFH 2G3XA 4PJXB 3KW7A 4U6TA 5MP6L 1OGSA 3L3DA 2WOYA 6PCYA 3T3MF 4ZTOL 3HPJB 1RH8A 3L1GA 1SXCA 1QFWI 4S1SL 1A4KB 4BJLA 1I8MA 5FUZH 1BPVA 2Z34A 5T5NG 3HG1A 8FABA 1E27B 5T3XL 2ERJC 1KELH 5F1IA 1OP3H 1XIWB 1L6ZA 3ARFA 1MAML 1ZHLB 2VLJB 2VNCA 1C7SA 4FCAA 5D1XE 1XGUA 4PD4K 3CZGA 3BUYB 1NDGA 3RWGA 3UTTE 1NANH 3ZIMA 1J9TA 4JM2C 5JPNB 2J2ZB 2E7LC 2OR8A 4MA8L 2D31B 2HSIA 4IRZA 5DJCB 4UNVA 3QEQE 1D9KB 3FTSA 1WCQA 2I07A 3ZLQC 4XVSL 1Q0YL 3GBEA 1A65A 1JRHH 3NRQA 3P30L 1QO3B 4L1TA 1XB8A 2VXTL 1COBA 1WFMA 2EIEA 1KCSH 2Q76B 4U1HA 1RIHL 3WOVA 2HJLA 2H1PL 3MRJA 5FDWA 4X6FA 2FJSA 3RVUC 1NAMH 5HDOA 3PGFH 1U4EA 3PF2A 4B27A 3HNSL 1T4KA 1T1YA 2BSTB 1YYLL 1BBDH 1QA9A 2Z31D 3TA3A 4FNSA 5HP5A 2R2EA 3EJPA 4FI7A 2P46B 4PS8A 5LXGH 1M6UA 1GMIA 1U8OB 3BOVA 2X1XR 4YN3A 2A4ZA 3ABKB 3CU7A 3TH2T 3AREC 5CEXB 3PCYA 3A4EA 3QUZB 4HHWA 4JL2A 4Q9BA 1EFXD 1JNLL 2AMUA 1AD9B 1TO4A 2P5WA 4PJ9D 4Y9BA 2BM3A 1EZLA 3CBKB 3WIIL 5K59E 5JW4N 1CICA 1MCPH 1N7MH 2X4UB 2MOVA 1FG2B 5ICZB 4PM1A 4DPRA 1BOGB 1KC5H 1CGXA 1U2YA 3FO2B 3S3PA 2QLVB 4XWOD 4LT7A 5GISH 3MRKB 5KANG 3PQYD 5D2NB 3VWKC 1DCEA 3ET9F 3EBGA 1MOEA 3EH2A 1BJ1J 4YHNB 3KJ4B 3H8NA 2P7TA 2R69A 4Z5RB 3MJ9L 4L37A 1E7UA 5T3ZE 1BF2A 1CGWA 1REIA 1T1XA 3IVKA 1F2QA 4H26A 1K72A 4P3CH 5I8OH 5MEPA 1LO3L 1HSBB 1YZZA 2OXGA 2YUXA 3HKFA 5FYJH 2ZSVA 1WA1X 3WEAA 1A64A 1M7DA 2DI8A 4ZPTB 1QSVA 4JG5A 3MRQA 5DA0B 2PXYD 2DWTA 1Z3GL 4MASA 2CK2A 3VFSB 4JS7A 4AGNA 1FYTA 5I0VA 1LO4H 2OQJA 3MNVB 4Y19A 2WZPA 3X12B 3OXRA 3R0MA 2KZWA 1VCBC 2WKOF 3JBG7 1KIUB 3R18A 4YWGH 4LKXA 3IKCA 3T65A 3AS3A 3EADA 5I82A 3X1BA 1LK3L 3RTQC 5JHDE 1R6VA 5D7EA 3P77A 3NIDB 1WZLA 1G7PB 3DYOA 3NOIA 3P4MB 4P2YA 4UOQA 4XNXL 3TBWA 5FECA 2XTJB 4ACTA 1YNTB 4NQCB 4WK0B 2VN7A 2XCMC 5D8JL 4CUCA 2EVJA 3WHXA 2AQ1A 3CC5B 2YHGA 1BD2A 3RUGA 4AM0B 1XSOA 2H3XC 3OXSB 3CU1A 5D7KD 5E2TH 1RJZB 3HUJF 3LHAA 3IRCA 1Y18B 2OX5B 3L5HA 5H37G 3MA9L 3PWPE 4QYOA 4V11A 1MCEA 4J4PD 5GRVK 5FM5M 2BNQD 1BZ9B 2DQDL 2ZXEB 3WNPA 2PF6A 1OB1B 1J5IA 4Q9QL 3ARBD 2BVQB 1ZLSL 4ABUA 4PJAA 5ESQB 2IC2A 2VUYA 3VAEA 3H2WA 1MVUB 4H1LA 4QPEA 4F5CA 5B8CA 5MEOB 1GGCL 3KYMA 4OCWL 3QPKA 3CFCH 4B60A 1HZKA 2I60H 3TYFA 2P8MB 4YHOL 2ID5A 3G5VB 2DLHA 4FQQA 4Q14A 5DJYA 1Y0LB 2VJ8A 5C6TH 4NJ9H 2EDMA 4OJAA 3I2CH 1T21A 3KLAB 3MCKA 3PAYA 2I5YL 5M7QA 5J3HC 1A6UH 5E94A 3MFFA 1CVSC 1MHCA 3T0EA 2BOBA 2AK4B 3MLSH 5F7HA 4ZUSA 3H3KA 5HYQB 2OJZH 4G72B 4EIUA 1JFHA 1GSMA 1XF4B 5C0ND 1N5YH 3QNYA 2Z7YA 4ZG1A 4NWTL 1FORH 2W88A 5C09A 2UYLA 4NNPH 2YD2A 3II3A 2D0FA 2AZAA 3HFML 1HC1A 3L2MA 3EXJA 1I1AB 4KRLB 2RAMA 4AIXA 2MQGA 3CLEL 3X3FH 3IFOB 1HHHB 5MEND 3DRTA 3OR7A 4O2FB 5F89B 3QIBB 4QI3A 3Q1SL 2J57A 4PRPB 4V2CB 5IMLA 3E6HB 3QG7L 1T2JA 4GW5A 3D2TA 1TJGH 3K2UH 4ORGA 2E46A 4AMKL 1OARL 1UB5A 2VDOL 4NUJB 5KSBA 3BKJL 2FEEL 5L9DH 2HRHA 4HJUA 3V7AG 3JV4A 4OFPA 3MGAA 4LF3B 5KVFH 1DEEA 2Z8RA 1LDSA 1XF2B 2DI9A 3DO3A 3GRWA 4A7SA 1IC4L 2EXTA 3JTTA 2O5XH 1UB6A 1EH9A 3KMDA 2VR3A 2KZBA 1XEUA 2OL3B 5L8JB 1DN2A 5FW7A 1Q9OA 2VDRB 1WC7B 3IJHB 2VITB 3GK8H 1MWAL 4CBZA 3TN0C 1U8IA 3MX0B 2OP4L 4U1MB 5BRQA 1HE8A 2FQGA 3DURA 3HBGA 2FEEI 1Q9WA 1EJ6A 4NO2B 4HC1H 3VFOA 2ALWA 3VXNA 1A4CA 1JSYA 2CALA 4Y4FA 2WQRA 1IBHA 4O02A 4HSAC 5IQNA 1ZKAA 5JW4R 3RY6A 3IM1A 1N4XL 4LVHB 2VLRE 2A1WH 1XD1A 4HG4K 1V27A 1WPCA 2G2RA 1AGCB 4JO4L 4E9VA 3PHOB 1D6VH 3E3QE 1A9EB 4EF3A 1U92A 2J21A 3DNKA 3ZKMC 3B2DC 4QRTB 2QADD 4M5ZL 5JW5B 3AQDA 1TSHA 3QXDA 3NRFA 2QSCL 3B7TA 3QEUB 1DSYA 1QLRB 3O4OB 2BERA 2A73B 4Y8AA 3EG9A 3NSJA 3ILQC 1HCVA 3SGJC 4I3SH 2D7NA 4OB5L 5G4MA 4HEME 1NKGA 4RA3A 1JPTH 4JFQB 1F11B 5GGRB 3QVAA 1SNRA 3T3ME 3OR6B 4HJ0D 1DBKH 5E8NB 3ZKXC 5C0BD 4MSWA 1K4CB 5F7FA 5FEBA 4P4RB 5DJ6A 5DZVA 1SY6H 3WTSA 3PHQB 2EIZB 4GAYA 2NYYC 5JIKA 4KKRA 3G04B 3SYQA 2XZCH 5C0EB 1OB0A 4OM1L 4F57H 3LKQB 4HFUH 4MCYB 5IIEA 1TZGL 2OMTA 3U4EB 1PQZB 5TPWH 2DYRB 3B9KD 4Q56A 4F15C 4I3GA 2LU4A 2NY3D 2J88L 3MJ8B 4PJ7B 3ABZA 4ODTH 3WFZA 4LSQH 5IHZB 3WMQA 3BAYA 4BKLA 4H8VA 3APMA 2ZWYA 3MO1B 5I76B 4P5KA 1L0XA 4YS4A 2QHRL 4IRSB 3SCMD 4KI5C 2A6KA 4KBPA 1L3NA 5AW2B 1GZHA 2SEBB 5DK2B 4JB9H 1NAMB 3MLUL 4W9KC 1ZOXA 1GL4B 4S1QL 3CCHB 3MUGA 4O58L 1XCWA 3KLDA 4R2GC 2EDRA 4N0CD 2ZKHL 1U93A 1F3JB 1RFDL 1TZOA 3MTXA 4DPCX 3M8OL 2BVYA 1HHJA 2ENJA 3O2DL 5DEFA 1HU8A 1LM8V 4FNRA 4G11A 2C3XA 3MV7B 3RNKB 1ADWA 5DUBA 1F2XK 5KBMA 4L4VD 4G8GA 1J1PL 4YNYB 1IE4A 4OIFA 5EU5B 3GB7B 4HCRH 4R7XA 4QUOA 1HHKA 4H8UA 4BE6A 4KJQC 1CUOA 3L6FB 3QUYD 5CEZH 5LKNA 3CVHL 4IS6B 2ZX8A 1V05A 3VD0A 4H2AA 1QI5A 2OSLB 3HFFA 3NH7L 1B0RA 1I1YB 1U8JA 1IBYA 1BQLL 4G8FA 1SBSL 4Y5YB 1IGCL 3FO0L 4ONHB 1UA6L 4YDNA 5DGRA 3QEQA 2J73A 5GRUH 1L0PA 4JZNB 4BFRA 4UILH 4LSSL 3UBXI 4XN2A 1J5HA 4DZBA 1CLZL 4WNQB 3GI9L 4X0KB 5BMFH 1ZVHA 3L4VA 3N0AA 2X1QA 3T4AA 2NX5A 3ZUNC 2MJWA 5EBMA 2WAHA 3TJHD 3Q5OA 1GC1L 5DRNA 1WSST 4E9XA 1T89C 3CHQA 3E80A 3RZCA 4R4FH 1MCHA 2R4RL 1FPTL 5DVNA 1Z32X 3PWLB 1X3DA 2J44A 2FHBA 2RIKA 2FJHB 5IG7A 1XMWA 2QQLH 1LLAA 4FQLL 5GS1C 3Q01A 3UTPD 1AGDA 2DZEA 2H1XA 2ZUWA 5M94B 3SBQA 4CDGC 2EIJB 3OM3B 5LGHH 5B4MC 3ECQA 4WNJA 2FCBA 4P9HC 5TE7L 5LNDA 2YPLA 1GGIL 3R7QA 5JQHC 3O3DB 4MD5B 3AC0A 1OY3B 3BFOA 1DJXA 2FEDC 4M8RA 1IEAB 3NJXA 4OUUA 1AZNA 5ITBH 1IM9D 2AABL 1F4HA 3ENEA 3DXAE 1HCFX 2Y36L 2CCWA 5H8DA 4PJEF 3ES6A 4TOYL 4QXTB 3TZVD 1E0OB 3HC4L 4NYLA 3BO8B 1PF3A 4HFWB 2WXMA 3FQXA 3NCEB 4NWUH 4N25A 1TTBA 4X99A 3CVBA 1A6WL 4M1DH 3OLGA 4NP9A 3AWEA 1KBGH 2GBTA 4F20A 3FF7A 2M8XA 4L9DA 2ORBL 4NN5C 4KTEH 3C6LD 1AHWC 3GMNA 1TJHH 1QWHA 4L9LC 3DX6B 5AZ2H 5LGJA 4APQB 4U1KA 1XR9B 1PJWA 5C0AE 3FU3A 4HOXA 3BHBA 3DLQR 4JMNA 1AFVL 2BC4B 4G6JL 3PYCA 3QJZA 5C08D 3L3OB 4FQPA 1OE2A 5KSUB 1E90A 2DF3A 3CH1A 1TTRA 2X9XA 5BS0B 3WTVA 4TPRL 2Z92A 1E5UI 1KJVA 4XCEA 1BFVH 4JAMA 2YEQA 2Y06H 2EECA 1IBGH 3ZDYF 1R5IB 4CVUA 4QF1B 2X4PB 1KJ2L 4FDWA 3NSFA 4X4KA 2Y1AA 2XBZA 3LN4B 4M6NL 4QHNA 2KL6A 3P0VL 4FG4A 4TN9A 4RISH 5ENWB 2EC9U 2NW3B 4JFZH 1QHOA 4FTDA 1X7SA 1T2QH 4PLKD 2ZAIA 5EIIG 4WGKA 3MV8E 4HWBH 1IB5A 1T20B 5EC1A 4I1RA 4BFIA 3VJ6A 2GKIA 2XZAH 3L3GB 1SMAA 3CZSA 2OA9A 5DU7A 5BZZA 1YSOA 1ZA3B 5D1QB 2V9TA 4PRBB 5C3TA 5BZDA 4XAWH 1A8ZA 3DUSB 3O6MH 3BUDA 3BAWA 2DL2A 3DWTA 5CD3B 5DQ9A 1MI5D 4JFVA 4Y9EA 4IKJA 2DJSA 2ENSA 2ENPA 4PJIF 4ZO9A 5AVWB 3O81A 1Z9SB 3E38A 4NZJA 3AMKA 4FNUA 4WFED 2OYPA 3T8MA 2ZYIA 2H4EA 1U8KB 3ULUD 2Z1KA 4XCYB 4WJKB 3D0LA 2E9JA 3KEDA 4NKDA 5EO9A 5LN8A 5CEYA 3BPCA 4HH9B 1BWMA 5GPRA 1VZHA 4LCUA 2BZ7A 4KZ0A 2NTFA 3RKDD 4TUOA 3U7YL 1ZLUH 1DO5A 5DZLA 2FLMA 3DHMA 5F8QC 2OK0H 5G4OA 3GWJA 3S5LG 3BVUA 4PJDF 4U3XA 1IGJA 4ERSL 3ASWA 3QC6X 2EILB 1WWCA 3OTTA 3FT2A 3OKNB 2GQHA 4GLRH 3C5XA 1BLNA 32C2A 4GKNB 3ZRFC 1EEYA 3C8KB 2C4FT 2Y7OA 3ETTA 5HDQH 1OF2A 2NY1C 2YC1A 3D3VB 4FQHB 3CGTA 2DMKA 2HFEA 4LHJB 3OB8A 1SN5A 4P9HL 1NFDA 1JWUA 5BO1H 1I1FB 2CRZA 5FW8A 1LQBC 4IRJD 3U1QA 1SJHA 2W91A 3G5ZA 4PG9A 3SJVD 3OMIB 4FXKB 2XXCB 1NBYA 5JOPD 5DUMH 2QMKA 2X4OB 4FF9A 2F54E 2OSXA 3ECUA 3KGRA 1JI2A 3ARGD 3WKML 1MCOH 3LZFL 4YZWA 5I2IA 1MFUA 3KWXA 3CUPB 4J3VA 1FVCB 1BZ8A 3ESUF 4N1CA 3BIKB 1G4RA 2DMGA 2VDML 4WUUA 2FTAA 3EFDH 3FSZA 4YDJB 2UZIH 4J3OH 1K6QH 4BHUA 2G3NA 1S3RA 1TCMA 3DTXB 3P0YH 4N24A 1ACYL 4JKMA 3T6WA 4KXAA 3AFLA 4G7YH 3BPNC 3HZMA 1SEQH 2ZX9A 3CDGB 5HHXH 2X89A 2IGTA 2WQXA 1HNYA 2NUPA 2CAKA 2Y24A 3SD5A 3H2PA 6PAZA 3FCSB 3OGOE 5BRZB 5BXFA 3AU0A 4ELMF 2JB5H 3ZZSA 3IGKA 3FH7A 1H0DA 2B2XH 2JCCB 4XB3A 1CR9L 3QXAB 3U4AA 4JKPH 5EOCJ 4NUGH 3L08A 3H9SA 4M7LT 2CBMA 2EKSA 4M6OH 5HY9B 3L5XL 3OVUB 1EAPB 3N41F 1PD0A 2J1YA 4XRCA 1BZEA 1BA9A 2VXVL 4AT6A 1TU2A 2ICEB 4P23A 4KDTA 3THMH 3VFTB 2ZOWA 4JDEA 3HG5A 4JCLA 4U05A 5E2VL 4UT9L 3AB0B 3TBSB 1XZWA 2PYEB 4LZKA 4LBEA 1NFAA 3TT1L 4X7TA 3U4BH 1B9KA 1D5BA 1Z66A 1JZ3A 2IGLA 2YKLH 4PJBF 3QAQA 1TYEB 1WYJA 5GRWA 2XZQL 2EEXA 3DVGB 1OT2A 2QL1A 4UB0L 5EUKB 3AU1A 4YSSA 1S6NA 3QWRD 1R24A 4N8VB 1ASPA 3K91A 1UT9A 3KLHD 3VWJD 3MRMA 1KB5H 1CI3M 1O7SA 4WTZA 1JK8B 4YE0A 4GP5B 4N86A 1AGFA 3HJEA 3JXAA 4FHBD 5CAYB 4JRXB 5C0DB 3K7UA 2V9QA 5EWIL 3KPRD 2BWQA 4YIQA 1JUFB 2BSRA 1HOEA 4F2MB 3P2TA 4MKMA 3IJ7A 3OC8A 3F7VB 5D7IF 2OTUA 4YHYB 2F8VA 4XZUA 3QCVL 4U6VL 3BQUB 2VSDA 4ETQA 3WNIA 2UY7A 2AJSH 1PPIA 4P4KC 1UWYA 5GQBA 4RQQB 4KVNH 4YL4A 1IAKB 2DYSB 3SY0B 4ZD3L 3QR0A 4PBWD 1GZQA 4X6DE 1CLOL 1BQRA 4MXQD 2O5ZH 1SZNA 1U8HA 5C8JA 1K3IA 1MY5A 1PIFA 2J5LB 2EDKA 4NQVB 3AT9A 3PQYE 4GKOA 4CVWA 4FQCH 1Q90A 4XWGH 4HGWB 2VR5A 4WO4D 3RVVD 1ETB1 1AO7B 2ZOUA 4Z7UE 1ZTXE 3CSBA 1RK0A 3Q0HA 4PWIA 2Q6WA 4DVBB 4HLZG 3MLXL 2VLKA 2PYFB 4XX1G 4DGVH 2X09A 3NSYA 1HDMA 1E28B 1G0XA 3LS4H 1K8DB 2VSMB 1FL5A 1XF5A 2YMXL 4QDGA 2GJ6B 2ZOTA 4WFHE 1ED3A 3BP6A 3L1EA 4KJYB 3VRIB 1ID2A 1M7IB 2AK1L 3D52A 4LLDB 5L4IA 3MGTB 1HSAA 2WCPA 3QCTL 3IGAB 4LVEA 2ZG2A 4OLYL 4YC2B 2CDGB 1E8WA 3NAAH 1XTMA 1EO8H 2GCYB 1TJMA 2DD8L 5AW1B 1RSFA 4L8SC 3UZQB 4ZMNA 1L7TL 1KLFB 3SGDI 1CGVA 2NMSA 1WTGT 4AIOA 4WDIB 4CMMA 1YEFH 2B16A 1BYNA 4KRPB 3DX4A 1CDBA 1R3JB 3DDFA 1UD3A 5JW3H 2OMVB 2WLMA 4K3DH 1DANT 3NA4A 5HGAA 2TSAA 2J56A 3VQ2C 1EJOL 5CIPH 3ZDYE 1DVFC 2OZ4A 5KSVA 1WT5A 3VTAA 3D07A 2N7BA 3D85A 1OSYA 1GYAA 3STZA 1ZS2A 3WD5H 4POZD 4QD2E 3B9EA 2KBGA 4A39A 1DL7L 5IMMA 4H5SB 3EIFA 3BD5A 3KYNB 1DBML 4OZFH 4XBMA 2IAMC 2GYSA 3NPSC 4XP6L 2BMKB 4HUWB 1EHKB 2P9RA 4JPIB 3EOAB 4YSTA 5B38B 4S2SA 3MLWH 5CCJA 2D3JA 5EPMB 1F3DH 3VD9A 3DPBA 5AOKA 3KWUA 2CGZA 2NY7H 2HVBA 4L1HA 2RJMA 1H5BC 1J05A 4D9LL 4JRYD 4URKA 1OAZL 4P2QD 1BREA 2AXWA 2B0SL 4ZOEA 2W8CA 5CP7B 5IHUL 3ZT6A 4HU8A 5E9AA 4YEFA 2PABA 1JF5A 2FX8H 3TF7C 4JRFA 1HILB 3EBHA 4AEEA 1CD9B 4M7LL 1B4LA 3HPJA 1FV1B 5ISZB 1B90A 1EGJH 1Q8MA 3GUFA 4GXFA 4P2RD 4HXBL 2AKRB 1A4KA 3LPFA 4B5EA 1ES0B 1IC7H 2ALAA 1Q9KB 1J87A 1E27A 2BFVL 4L1SA 2V3DA 4AGQA 5LWYL 1A4BA 3LD8C 5E8EB 4AL8L 2ODIA 1OAQH 1XIWA 3GBNH 1UM4H 1BDYA 4U7KA 5JXEA 3DX2A 1ZHLA 1IL1B 1HWHB 5K9QG 3O3EB 4TLTA 4OQTL 1R5WB 4O5LH 4KPHL 4L3AA 4RMTA 4PRID 4JR9L 4XMUA 5JPNA 1RZQA 1T3FB 2V7NB 2C26A 2J2ZA 2D31A 2J71A 3D33A 3ESPA 3L54A 3NG5A 4XNMB 4YBLB 1AXTL 1D9KA 2GI0A 1H3PH 1ET7A 2VTFA 1JGLL 1XWVA 2WZ0A 1IBZA 1FN4B 2DL9A 1UHVA 1E30A 3P73B 1FL6B 2VIRA 3AXIA 2Q76A 2QSTA 4Y2DB 3VI4B 1NGZA 2HJKB 4QNPF 3T1WA 4FFZH 5IROD 1QZNA 1DBJH 1ZVYA 3ULUF 5EH1A 4P5TC 1L9MA 3H3PL 5EOQH 3RGBA 3HA0A 5SWSD 2E9BA 2HWZH 2R29H 4QEGA 3TTYA 1JIBA 3P69A 3PLYA 3NJHA 4GW1B 4O9HL 43CAB 5ECGA 3V5KA 1WD9A 4I88A 1BMWA 4BQ9A 1P5UA 5CEXA 3NP3A 3ZMNA 3RGVB 1AD9A 1JCKA 3CFKA 2JMRA 4OZGB 1CZ8H 2YXMA 1MJ7L 4HU2A 2X4UA 1FG2A 5ICZA 2BIIA 1BOGA 2KYIA 2XG4B 2HJFB 4KKLD 4AZ8A 5FHBL 4BZ1L 4LXFA 3MRKA 1JNJA 4RDQF 1CF1A 4LHUD 2P5EB 3S3BB 4YHNA 4YSCA 4Z5RA 1QUNB 2GBVA 3VGFA 2P5PA 2YPKB 1I9RL 3IFLL 3RZWA 4ELME 2C9XA 3CSPA 3RIAK 1DSFH 2DW5A 2MCAA 3VFRB 4BQCA 4TVSa 3NDYE 3RVXD 4MMZC 1RHHB 4ZPTA 5DD1L 1ESOA 3ASNB 4IGBC 4ZFGL 5IQLA 3NCYS 4G59C 4GSUA 3GKZA 2ZUSA 3LDBB 2VRKA 5JHDB 1WE5A 2F54A 2F8IA 3B3BA 4DOHB 4PY7B 5C0BE 4DIXA 3STLA 3CHOA 5ANMA 3JTBA 2C5DC 4Y4KB 1YEJH 1R19A 3RL2B 5DHEA 5ERWA 3ZL4L 5AB0A 3QIWC 1RZKL 4F8NA 4LARH 1GMEA 4GAFB 1YNKH 5K39B 5J12C 2A6IB 3QHFL 4OKVB 5L8LB 3DSNB 5HVHB 4M6MH 3VACA 1XO8A 4M6AA 1R5VA 1HKLL 1YJDC 1G7PA 3P4MA 4DKAA 3POCA 3D05A 1TCRA 3RBGA 1YNTA 4KAQL 5C86A 1LMKA 3DUHA 1KB5B 3CC5A 4P46D 3OXSA 5I1HH 4ZXBD 1BOYA 3COOA 3KL3A 2OX5A 2Q7NA 5GS0C 3M07A 2HP4A 2V5RA 2A4CA 1U3HB 1U0QA 2BCMA 1BZ9A 1SN0A 2QTVA 5T1LD 4FEIA 3HB3C 4YDKH 2BVQA 1EQWA 5D5MF 1W0YT 2ZG3A 3SDCB 3ARFC 2BCKB 1QFWH 5I8KH 5DS8B 3GGWA 1MVUA 5FGCE 2MNWA 5D1ZC 2ED8A 1TYJA 1XH1A 2ZWKA 2AXGB 4NKQB 4AX3A 5MEOA 4W4NA 3V0FA 1MPAH 2GJPA 1LEGB 1FZKB 3DRQB 1BXAA 3LRHA 3IYLW 4J3TA 3B9DA 4UV7L 3ZDZF 3ZW3A 1U8NB 1Y0LA 4HF5H 1Z1WA 5MP6H 3LNGA 1VFBB 3KLAA 4F7CB 3VXOA 1KB9J 5JQ6L 3KD4A 4S1SH 5B39G 3LCYA 3BKCL 4AC2A 1MFEL 3EYUH 4R97C 4RFEB 4BK8A 5IB2B 2QGBA 5HYQA 5IREA 1QZ1A 5T3XH 4Y4HB 4PJ5B 1EAQA 1J1XL 4IMLB 5DDHB 2RGSA 3D9AL 4K5OA 1RZGB 4BFBD 3IFNL 3LX9A 3Q6FB 1MAMH 3TA3C 2CBTA 5E56A 2ZSWB 3F7QA 3DMMB 5IWLC 1MLCB 4X4ZA 4NS0A 1I1AA 3X13B 4XPAL 4IW4C 4WK2B 3IFOA 1N8ZB 3HS8A 3KXFD 2X1WL 1KN4L 3BEWB 1S5HA 4MA8H 4TKWA 3K2MC 4O2FA 4WWKB 1BBJB 3QIBA 1CICC 3UIZA 5LVEA 4PRPA 4XVSH 3UZVB 3E6HA 3J07A 1Q0YH 4UTBA 4NN7C 2A77L 2IDFA 1QTPA 3W0WB 4NUJA 4G9DB 3KLKA 1RIHH 2H1PH 4CGTA 2SODB 3HMXL 2ZXQA 5HD8D 4LF3A 4JM0A 1ET8A 4QJ3B 3PWNB 3HZKB 3WIAA 1YYLH 5CIPB 4EIBA 4ONFL 3BZFB 2JH2A 4MAYA 3PHAA 4FFVC 5IW1B 3A22A 1WC7A 3IJHA 3VI3B 3QA3B 5CLYA 4YHZL 3AT0A 5F0JB 3MX0A 4U1MA 4EUPH 5AUMB 3GINA 3V0IA 4YXLL 1JNLH 4DP4X 4OLUL 4JQIL 4BQBA 2EXWD 1YQVL 1S9YB 3CK0L 3U79A 4OZFB 2DDQL 3EH4B 4QLRA 2EDHA 3LY6A 2WAQA 4BEIA 1OCCB 1SM3L 2VXSL 3KHQA 4QIRA 3SIKA 3CZJA 5ABZA 3GSUB 3IGLA 1A9EA 4BKSC 5IEKB 3T3MB 2X6VA 3FNKA 4QRTA 3N43F 5H2BB 5JW5A 2ZCKL 3NZUA 1ZS8B 2WBJB 3BCDA 1SOSA 1RL1A 1O7VA 1ODUA 1QLRA 3FU7B 2A73A 5CZXC 3QXUA 2EIMB 2FSEB 3SPGA 2X2IA 4X5LA 4LIQE 2WXGA 1FI8C 3LXUX 4X9BA 2BSSB 1JPST 5FYKD 1XCXA 3ZYJA 1NCWH 3ZTCC 3BH9A 1F11A 1S7UB 4M43L 4EN3D 2BNRE 1O5PA 4N4YB 5EF2A 3EYSH 3HE6B 2Z91B 1K4CA 3GS0A 2BRRL 4P4RA 3F12B 1U91B 4NQSB 4Q6KA 2YLHA 2EIZA 1G43A 1P84J 1F3RB 1NCOA 3G04A 4PVMA 4JX0A 1GHFH 3MRLA 4K3GA 2NY0D 3LKQA 1JVOA 2VZ1A 4MCYA 3WV0A 2ZX7A 3GSNA 2EO7A 3TO4D 1XBDA 2D7PA 5I26A 3EYFB 5IHZA 4OGXL 3RDTD 4XO3A 4XNXH 3MO1A 5I76A 2BIHA 3FUDA 5I6MA 3AS2A 4DN4L 4IRSA 5D8JH 4X0NA 5EF3A 4ZYKB 1JZ5A 1OAYL 1GGBL 1B3JA 3F7YA 4XPFH 1E9PB 3FCUB 4YDLB 4HYTB 1CT8B 1MI5E 2EADA 4PLNC 3MA9H 3T0EC 1PVHA 3QFDA 5BVJB 5D1ZI 1JNNL 5EU7C 3PPSA 5CGBA 4U0QB 4Q9QH 1FO0H 4WUKL 1INEL 1ZLSH 5LQBL 5FM5O 1K9TA 4NGHH 1F3JA 4H1LG 3S2AA 5C7ZA 4UZSA 3BGMB 1QOKA 3MV7A 2WPGA 5SV4A 4UIMB 5DRWA 5EU5A 1W8OA 5TH2B 3DV6B 5B1BB 3U6RA 1FBIH 2KQNA 3UYOD 3DVNB 3L5JA 4XO4A 4JRLA 2OSLA 3BGFB 1I1YA 4FL4C 4MFHA 2F8XC 1I7ZB 2EVGA 4EIGB 3NQKA 2CJTA 3UCRA 3B5GA 4PAZA 5JO5B 3X1NA 4E9RA 4K3EH 5DC4B 4OF6A 4RCAA 5HHQB 4JZNA 1E4KA 5FYLD 3RWCB 2F53E 1V7ML 2XN1A 4HHGA 4TSCH 5DJ8A 2ZCHH 3UDWA 1N67A 2FBJL 1KJ3H 4NWTH 5J8OA 1GCFA 3UG3A 1ZWIB 4FE9A 1DJGA 4JDZB 3EJSA 6FABL 3IRPX 1QSEE 2FRGP 4FQXD 5AW6B 1T5XB 5KOMC 2IQ9L 4NNXB 4I85A 1UYWL 2ZG1A 3CLEH 3T4YB 3VMPA 4DO6A 4Z23A 2P8PB 4N8VG 2BOCB 4JY6B 5CBEB 1ULVA 3Q1SH 1I85A 3SE4C 1E4XL 4Y4FC 3QG7H 3H0TB 1AGBB 3FRUA 3PWLA 2O30A 5ABDE 3GS4A 3DXAB 2FJHA 3RY6C 4AMKH 1OARH 1CDUA 1ZTXH 3BKJH 3PL6A 4G5ZH 3LH8A 3HUJB 12E8L 1SDDB 3HC0B 2D0GA 3Q5TA 3O3DA 4MD5A 1RUQH 1IEAA 1F1GA 3GXUB 5FYKL 1LDPL 1MCJA 1IC4H 1HT6A 2NSMA 4KK8C 4Y5XB 2BIPA 4WKZB 1G7HB 1E4XI 2YEVB 4KUZL 2XWBA 5EO0B 2APWA 2OP4H 4Q2ZB 1L0QA 3RWEA 2DTML 5F9JA 4HFWA 5JUEL 4UOW1 1M71B 2GT9B 4F8QA 1QUPA 1X5ZA 4WWPA 5I73B 3L1FA 3WTUA 1DR9A 2NOYA 3FCBA 2V9RA 1N4XH 3F84A 3D2UB 4JO4H 4HZAA 2HTLD 5LAXA 1GS7A 3MAWA 3E1ZA 1UD2A 5CF3A 3A4FA 3DX6A 4JG0L 4U3SB 4APQA 4Z7OF 1XR9A 2E5EA 1AQKH 2C1PB 5LBSL 5C0CD 3HAEH 4PR5B 2VH5L 5LUMA 2BC4A 2V2WB 5E0QA 3HNVL 3F58H 3L3OA 2P28B 3V9CA 3P9MB 5FX3A 5BS0A 4AEHL 5KTEL 5AOJA 5HGBA 1DQQB 4M1GH 1FSKC 4X8CA 1JPSL 2WQ8A 1R5IA 1NWOA 4QF1A 1GZHC 2IGFL 2OMBA 1F02I 5FKPB 3H53A 4TNVK 3TVMB 2QQNL 2R8SL 1IILE 4U0RB 3LN4A 2GTZB 1K5WA 3MRFB 2J6EH 5C07D 1BECA 1BZOA 1KBWA 3N55A 3TA4D 2A38A 4B9JA 2NW2B 2V8MA 4G6AD 1DQTA 1MCCA 3KPRE 1TZGH 3L9RB 5F6IB 3QDJB 5CJ8A 3RAJL 1ONQB 2EZ0D 2FO8A 4IBWA 2BS8A 2J88H 3KYOA 4U6HA 4MNHB 4JMXA 5DCCA 3SEPA 4B9GA 4LPWA 4PS7A 3RVUD 4D7BA 1ZA3A 4PRBA 4F3FA 1VADB 1WITA 4MMYB 1BXUA 1HCYA 3FO1A 3LS5L 4KZDL 1JOIA 1PIGA 3PABB 1IKNA 5CD3A 5TQ2L 4RAUB 1UENA 5CZKA 2PPDA 4HXAH 4OSUL 1RIUH 2XQYA 2IANE 4FJYA 2VXQL 3KPPB 2W80C 1Z9SA 1S78D 4AYGA 4JREB 3MLUH 4S11A 2J43A 1WWAX 4XCYA 4CL7A 4O58H 1I3GL 4XVTL 1J5OL 4HH9A 4PTUB 3WFHB 3WJMB 2ZKHH 3T71A 4IOIA 3JTSA 2DB8A 3M8OH 2R9HC 4W9LC 3A24A 3AXHA 4O2EB 4KX7A 1P9MA 3S34L 4EUPB 3IMWA 2BP8B 1VGEL 4HPYL 2C9AA 2OM5A 1G0DA 2W92A 3VWKD 4HC1A 4RMVA 4F80A 2GHWB 1J1PH 3GUTB 5ACMA 4QRSB 3RZCC 4R3SB 4OZIA 3X1GA 4GBXA 3TJPA 1AXIB 3QCUL 4HMEA 3A0OA 4GKNA 3W9DB 5HYIA 4MJHA 3C8KA 3C09B 4ZAKB 3C5ZB 3NH7H 1SBSH 3D3VA 3UAJD 1IGCH 2WLLB 3DJRA 1UA6H 2EIBA 3FO0H 4FQHA 5ESVB 2FUTA 4XBEH 5DJ0B 4NJAL 1SHSA 4E0RB 3ABLB 2GPZA 1I1FA 3V0GA 5DR5H 2Z65C 2K8QA 3EO1B 1X5LA 2VDKH 4YLQT 2XVGA 2CIIA 4QXWA 5FWRA 2UY6B 4K9EH 3GZOA 5CR8A 3LNDA 1E4JA 1GC1H 1NBZB 2ZOKB 5EU3B 5EDSA 4MDRA 4G6FD 2XXMB 3LKPB 2BH0A 3CUPA 4PSRA 5J06A 3MJGX 1SY6A 1FVCA 4GG8B 1D5XB 3NABL 3RTQD 2HXAA 4AM0Q 4MAUL 3BIKA 4IDJL 1DQDL 3GBML 3TC9A 3V5DB 5IVXF 2GUYA 1IFRA 4YDJA 4EZKA 4XNQB 4FQLH 3MREB 5AW0B 1CWVA 3ZPDA 2WXPA 2CKNA 3ZYIA 1V8HA 4I0KA 5C2BL 1ZT1B 5DHXB 5TE7H 2O72A 3QE5A 4XTRD 5F97E 4D8PA 5EBLB 4R8WL 5FOBB 5BRZA 4MZ3A 2BP5M 2AABH 2IDTA 4D3CL 3R7RA 2YBGA 4J3OG 1D7CA 1AS6A 5DD3L 2HVJB 2JCCA 4JRYE 5DZJA 3SE3A 3DV4A 3QXAA 4P2QE 3MRBB 4Y16C 2V7HB 3HC4H 5CILL 5JMOC 1RUML 4DVRL 1AHKA 1EAPA 1JI1A 4YZFE 3IWVA 1FO0B 1XAKA 4NBYB 4Q4EA 3KPMB 4K8RC 1SOQA 3ARPA 3C60A 3DOSB 3ZRSA 4BA0A 1A6WH 4P2RE 5EV7A 2VJ0A 1UEMA 3VFTA 4YDZA 2ORBH 5JMRA 1QSZA 3U6XA 4CU6A 1W0VB 5D70L 4ZUVB 1J11A 3TBSA 1GY2A 1TQBC 2PYEA 4JGJA 5FO7B 4HCRA 4N2DA 4PCYA 4NPKA 5DURD 4G6KL 2AI0H 3G3LA 3FUEA 4XVJH 4JPQA 1BQHB 5GRVL 3CX2A 4HX1B 4TPRH 3DVGA 3NFNB 4X6BB 1U8PA 5J13B 4OI9A 4FJ6A 5EUKA 3B2VL 4X7DC 4A7GA 4AYDC 1AKJD 3V4UH 4M7JL 1T1WA 1QBAA 2EABA 1KJ2H 2M26A 5KANI 3BGAA 1TR7A 2Z31B 4WJ5B 3PHSA 1JK8A 1UG9A 4G2AA 1J7VR 4M6NH 5DYOB 4ZODA 1DJZA 2HB0A 2A9NL 4JRXA 5C0DA 5IZ7A 4K3HA 3WFCL 3QQNA 3OZKA 4Y7MA 3VFNB 1QW8A 4I1NB 1BGXH 4I0PC 1EFXB 4PJ9B 1BIIB 4PJFB 1YY9C 4F2MA 1CCZA 2WP3O 4FQIL 3U0PA 4S0HA 3Q2WA 2AS5M 3F8UB 4NQEE 3GLDA 5J4MA 3G7TA 3WDJA 3PQYB 4MZ2A 4N3UA 2QSQA 1DDHB 3RX5A 1A7OH 1IAIL 4GKSB 4LEBA 2ZNXA 4RFNC 4XXDB 2HKHL 1IAKA 5HYJA 5I6LA 1ZE3C 4OR1A 4RRPM 4PJEB 3H3BC 3H55A 1G7LA 1G7IA 4A55A 2QQKL 3FFCB 3PP3K 4IHBA 1OVZA 3HR5B 3H7BB 4PV8A 3TN0D 4LPUA 4PY8I 2VL5B 2MNUA 1TNNA 3C2AL 3FT3B 3DX7B 3N3EA 4TMPA 4HGWA 2PXYB 5KW9H 1AO7A 4FNTA 1IAII 4Q74A 3U7YH 4I13B 4DVBA 4GPVA 5FHAL 3US0A 3BISA 5D7LD 2PYFA 5IT2L 1DQLL 3RP1A 4PV9B 1T04B 2EEDA 2FGZA 3LEYL 4U2ZA 1U3YA 1A7BA 3ZKMD 3O6FA 2GJ6A 3IJEB 3VRIA 4KJYA 1KXHA 4LLDA 5C3IA 1OTUC 4FZEL 1QSEA 1AZBA 4RIRB 1YG9A 5ADOH 4IIQA 3QPQC 1YMHB 4FABL 3GSWB 4M8QA 2GCYA 2WMPB 3T04D 3OLDA 3ZDYB 1OCRB 1H3GA 1JZIA 2NYKA 1T0PB 4LSRH 1OSPL 1Y1DA 2P1YA 3HNTH 3HAEB 1KLFA 2Y2TA 3T0WA 1JZ2A 3FUIA 1C8PA 4MS8C 5AB2A 1SMOA 2J8UE 3BI9X 2K0RA 1T0MB 2P80D 4AEFA 4FMKA 1QFWM 2OMVA 5HSFA 5JZ7C 4W6YB 2DI7A 4MNQA 5E6SB 4MKTA 2BNQB 4G8EB 2C3WA 4MA1C 3WKMH 5IJBC 1G9EA 1A3RL 3ARBB 3S9DB 5T5NF 1UOWA 3AUVA 2PP8A 5I75B 1N59B 3O41B 2PETA 2CBPA 2J8OA 1EUTA 4GXUN 4PHXA 1P6FA 4HJJH 1KEGL 1B4TA 1YYCA 1T7VA 2O5YL 2VDMH 1E3ZA 1RPUA 3AITA 4K8RL 4JFFE 4GIAA 4H5SA 2AC0A 3MBWB 3KYNA 4HWBA 4KDTC 4GI8A 1ACYH 2RFXB 4HUWA 2C9UA 4LIQH 2N56A 3EOAA 3LNHA 2X10A 4JPIA 4LSPL 4PJIB 4AQ8A 5B38A 2HX7A 4QRPA 5SWQB 5EPMA 4NIYE 2VO8A 4B53A 3FT4B 1NC2D 4DSYA 5F7DB 4HJGA 3KWVA 1PKQB 2HLAB 2AQRA 1LD9B 2QVIA 4R2GD 5AQ0A 4TUKL 3LKNB 1CR9H 3L9YA 5CP7A 5D96C 1FLRL 4DGIL 5GZOA 2XKSA 4TNWK 1FE8L 3GSVA 3L5XH 4PJDB 4OGZA 4WSGA 5HJBA 4N3TA 1HILA 5D2LE 2IPTL 4PGEB 5ISZA 5HI3D 3MLYL 4PBXA 1ES0A 4AUJA 4JL1A 2IQAB 2VMEA 3BJLA 4DUXA 4PP1C 1Q9KA 3CSTA 3FB8A 5HGHB 4WFGE 5MENB 5E8EA 5BJTA 4HJ1A 4RWHA 3FU0A 4TVPD 5E2VH 3GXNA 4A2MA 4R90L 3NP4A 1GYCA 3UADA 1WGOA 1XVSA 1G1KA 3VXQA 1BP3B 3TT1H 2MKWA 1P4BH 2UXTA 3FQ1A 2F7RA 1E65A 2E9GA 1ND0B 2XZQH 2E6PA 4B3VA 1T3FA 4RZCB 4XNMA 1EZSA 2V5MA 1XEDA 3KXFE 4UB0H 4F8TA 2WQVA 3DDGA 5E5RB 3VYNA 3S5YA 3ULUH 4TSBL 1FN4A 3G5WA 1FL3B 4Z3GA 3DETD 4XC1L 1BLIA 1FL6A 1HL9A 4ORZC 4F8OA 4Y2DA 4YQXH 3VI4A 1MJ8H 3MBEA 4JM4L 1CXFA 1NLDL 1MCBA 2EC9T 2VDKB 5EWIH 4LBAA 1S46A 4G42B 2EE2A 3OB0H 1JCVA 3EDDA 4EDWL 1MW1A 2AJYH 4MGXA 2NXZD 4NQDD 3C5SB 3PFQA 1YMMD 2H2PC 2OR9L 4Z77B 2YUVA 2KLRA 5C0GB 5FR3A 1WIUA 2PWEA 3HS9A 43CAA 2N7SA 3QCVH 3S8FB 1G5AA 4P3DB 2VZSA 4AE0A 1UT1A 1PDKA 3H9YA 3EJYD 4PRDA 2K9FB 2QADB 5BQDA 5JDSA 4OI8A 1A4JB 3D69B 2IPKB 3AQYA 3HI6L 4OZGA 1Q0XL 2A6JB 4JFED 3OJMB 1CLOH 2XG4A 1MWOA 1NBQA 2HJFA 1T1ZB 3PRZA 3VG9C 4X6CF 1B6DA 4X8JA 4PJHF 2VDQL 2XIBA 4IBLT 1U36A 3SDAD 2P5EA 2YZ8A 4MQ7B 4JRWA 4K55A 1QUNA 2CO7A 2R23B 4UT7H 1ASQA 1A6VL 4UQIM 5E1IA 3QZLA 1JN6A 3SPIA 1YN6B 3MLXH 4JY5L 2QZQA 4RGND 3SGDH 1TQCC 1UWGL 2G60L 2YARA 4GRLB 3VYOA 3F05A 1F18A 2YMXH 3OKDB 4LGPB 3TP4A 2AK1H 3FQRB 1GGYA 4MWFB 3QCTH 4PJBB 4UQ9A 3OGCB 4CU8A 3B9KB 5K9JL 5HDBF 5JR1L 5FM4A 2NY3B 4Y4KA 2QKSA 4TF4A 3UMTA 2DD8H 2CRIA 1TMCB 2EEBA 1OCOB 4FLHA 1XL4A 5IKCB 4KK6D 4A7QA 1UD8A 5B1CA 2O6CA 4B9KC 3EH3B 4F37F 4L5FH 3APDA 5K39A 3SCMB 2A6IA 3HVDA 4GUPA 4OKVA 4RRPG 4EQ3A 3LXBA 1MREH 4RX4A 1AS8A 5F9WB 1RK1B 1AR2A 2XFXA 3UEZA 2BSBA 3QEHB 1J12A 5L6YL 1KJ2B 4JN2A 4N9GB 3FHAA 1I7UA 1KB5A 1J88A 2N0KA 3QNZB 2BRQA 5IBTL 1NGQL 1KB9K 2CXGA 4JANB 5D7IB 4HWEL 4L8BA 3WSQH 5DJAB 4KKNA 4JCWA 1NINA 4LE8A 4PW3A 2RB8A 5I1DB 1DL7H 4L4VB 3PG2A 1M05B 1AVAA 1IC5L 3LEVH 2R2CA 2VRAA 3VMOA 4ZW6A 3IDMB 1XIWC 4XP6H 3SDCA 4I2XA 5IMKA 4FKKA 4AEIL 3LHPL 2X9WA 5JXEC 5HHMD 1TTAA 1JZ6A 5DS8A 4AK1A 2OI9B 1ZAGA 2AXGA 4WAFA 3CG8A 3L13A 4JJ5A 5E9DB 4ODXB 3QJRB 5F21B 1RJLA 5I24A 4HMCA 3FTUA 5KSAD 4D9LH 1FZKA 4UUJA 3DRQA 5JPNC 4KK5D 4QXVA 2B0SH 4WV1B 3R8QA 4NO0A 1D5IL 3Q9PA 1GPOH 1SXSA 3UO1L 1D9KC 2AGJH 1VFBA 3QORA 5DS2A 2Z3FA 4F7CA 4NI3A 2OMUB 2WLKA 3MRHB 5E1AB 5H94B 5LHDA 1P1VA 2BZCA 4HXBH 3VD1A 2HLFC 2XIDA 5DJDB 4RFEA 2VUKA 3DJ9A 5IB2A 5LWYH 1X44A 5E6ID 4Y4HA 1IBBA 2PCXA 3MACL 3SE9L 4AL8H 4IMLA 3A21A 3EBAA 3PDGA 4KQ3L 4QOKB 5DDHA 1KV7A 1RZGA 5KVDE 3Q6FA 4I3RL 2A74B 2ZJSL 4I8DA 3VFUB 2H5UA 3DMMA 1J8SA 1WWBX 1MLCA 3LOWA 4PJ8D 4OQTH 4W9DC 4WEEA 5IFHL 3ECBB 2MSPA 1J9CT 2NNCA 4KPHH 1EXHA 5DMIL 2B14A 4JR9H 3QUZC 4MJID 4IOFC 3H1ZA 1BVNT 4H8WH 1BSIA 1UM6H 1AXTH 1BBJA 4L0PB 4ANUA 4J2QA 5KBPA 1ZVSB 2DIJA 1JGLH 5DRXB 3UZVA 4XC3L 2FJFB 3O8XD 3OAZH 3W0WA 3LYRA 1IM9B 4GMTL 3RTLA 1OGPA 5D2NC 1KTDB 2KT6A 5EU6E 4KGLA 1A02N 3KJ4C 4LPTA 4LLYA 4OCXL 3HHRB 5GSRA 2X70B 3BXNA 4F8LA 3V4LA 3MV9E 1JXKA 2BINA 2QTEA 2WBXA 3HZKA 2I7OA 5E5UB 1MLBA 4R5XA 5CIPA 2CQVA 3BZFA 4G5AA 1IE5A 4AH2B 3GMQB 2WWKO 2Z7ZA 3DUUA 1IQWH 1Q94B 2QV4A 1I8AA 3ARXA 3OKKA 3VI3A 3QA3A 3QDMD 2OMYB 3QQ9C 2VDMB 2PPEA 4GFXA 1A14H 4PRHD 5F0MB 5AUMA 4A67A 1QBLL 5C0RH 1BWWA 2MHAA 5HHOA 2F15A 5AW4B 2IH1B 4OZFA 3DI2B 1AQDB 1MJ7H 3AY2A 1NCBL 1P4IH 4X5RA 1J9QA 4UDUB 2XC8A 4F1SA 1B2WH 2IWFA 3CMOL 5C08B 4A2EA 1N6QL 1NEZG 1LXMA 4X8GA 1J0IA 1T83A 2DOCA 2WSDA 4QRRD 3HN3A 5H2BA 2M1KA 3TLRA 3ZL1A 2WIIB 1UM5L 1I9RH 1ZS8A 2WBJA 2RHEA 3PIQA 3IPBA 1Q1JL 5C0CE 1NMBL 2F6AA 4E2OA 2XTJC 3GDBA 4NM4L 2X2JA 4NQXA 5IJKC 2WP3T 2BSSA 5DD1H 1W2KT 5HI5C 2MCPL 3W39B 4ZFGH 1I4FB 3WE6B 1S7UA 1I3UA 1SHXA 3HE6A 2Z91A 1OGAD 1YEKH 1PX4A 2BY0A 2OMWB 4FKEA 4NQSA 4QGYA 3QC5X 3WUWG 1QFUH 4TS6A 4LPXA 2A83A 1V3MA 4YXKL 1BMZA 5C07E 3K8LA 1RZKH 3NIFF 4NRZB 3V52L 2RMNA 3QHFH 4JFFA 1LP9B 2XBTA 1VGKB 2Y1VA 1MI5B 1EHLL 3E8UL 1HKLH 5EEUA 4E41D 2QVTA 3EYFA 2OR7A 3CQQA 4NIKB 4NO3B 2EDYA 1C5DB 4G8IB 3KGSA 1DE4B 4KAQH 1WO2A 3PAZA 3K72A 4ZYKA 2YJQA 4MVBC 1CT8A 3CFQA 3LIZA 3A6BH 4FFZA 5GGSA 4OGYH 1SDYA 1XGYL 1JBJA 5BVJA 1ORSB 2KERA 3DHUA 1UGNA 2ZKMX 5HGGS 3RHWK 3IDGB 1CDHA 1XF1A 5D2LA 4AYFA 1WDAA 1X5GA 2R29A 2ZCLH 3ILEA 1TPXB 4D0DB 1X9RA 5HXMA 2VZTA 3CBJB 1L9PA 1LNUB 3O9WD 3BGMA 5I9QB 3HBPA 4PEEA 1I1AC 1V54B 4D9RD 3HG2A 1KF9B 1R3IL 1M53A 4UIMA 1LMIA 1RZ7L 2QSVA 1L4IA 2MTAA 5TH2A 4YFEA 3K2KA 3QIBC 1XL6A 2HG0A 2O26U 3DVNA 3TU6A 4QT5B 4B9PA 4IRJB 3MYJB 3J7HA 1I7ZA 3EYQD 3SJVB 2GSMB 5JQ6H 1W0WB 1DUZA 1KOAA 1MFEH 1A1NB 3C6SB 3O4LD 1A21A 2MKLC 1MDTA 1TDQA 2GFBA 2QEJA 3ARGB 1U2CA 3SYPA 1TUPA 3RWCA 1J1XH 1ET5A 2ZP0T 1ZSHA 2B9BA 3IFNH 2YD8A 3MCG1 3P40A 3CDYA 5SWZD 3T2QA 1ZWIA 2OXHA 4L29B 1DUYA 5CM1A 4JDZA 3ARUA 5TDOA 5F3BB 2WKOA 4J27A 4XPAH 5F1OB 5DO2C 3SDYL 3WS6A 1XGPB 3T4YA 1YQ2A 3KPSE 4MQTB 2P8PA 1CFSB 1KN4H 3A23A 2BOCA 4JY6A 4X98B 1QLFB 2LLLA 1BX2B 3BSHA 3AMLA 3GF8A 1QNIA 1ZT4B 2XIIA 3HI1A 3H0TA 3EZJB 3GI8H 1IJ9A 3G6JE 4NENB 2CDEB 2A77H 2ZX6A 4LVHC 3T08A 4J12A 4KKZA 4KRMB 3GIZH 3FT9A 4GIOA 2LAAA 1SDDA 1RU9H 5D7JD 1RI8A 1N2RB 3PGCB 2ADYA 5ES4B 1SYSA 3S5ZA 3O4OC 1T66C 3EDFA 4ONFH 3Q48A 1QWNA 4HUVB 3TEZA 5D5MB 2O61B 4MCMA 2IAMD 1B88A 2CJSA 4JFDD 4MX7A 4WKZA 1G7HA 1U33A 1CTOA 5EO0A 5LGYA 5INCB 4AJYV 2N3JA 4YHZH 2AXHA 2CLRB 4Q2ZA 5CP3H 4DETA 4KVCL 1JZDC 4DP9X 4OLUH 3V4VH 5K9OB 1MUJB 1N64H 1M71A 3CK0H 1NMAL 1ASOA 1KIRB 2DDQH 5E6RB 4N2EA 1QKZH 2WVUA 3B5HA 1JHLH 3BYTA 2VABB 3ZDZB 2FQEA 4YO0B 2VXSH 2Y7MA 5C1MB 1LK2B 3BVNB 2WXLA 3L2NA 4YK4B 4CU7A 3AWFA 3GLEA 1DQKA 4Q6IB 3DARA 1EEZB 3JWDH 4U3SA 3OAUL 2RCSH 4FOMA 1K2DB 2C1PA 3AZUA 1RIVL 3CLWA 4PR5A 2PW2B 2V2WA 2KZ1B 2Q8BH 2F2HA 1V55B 4JHAL 2DQIL 2R0LH 4EOWL 1KCUL 4IRSC 3LRLA 1DQQA 1KENH 1NSNH 3FUKA 3HN8A 3KPRB 4OM0L 1IIIA 4M43H 3X11B 2JTYA 3M46A 3PWUA 2LT9A 4BM7A 3G9AB 3FS9A 4FG6C 2OYMA 5FKPA 3UAEA 5A16B 2BRRH 3TVMA 4OQ1A 4P5MB 5ECJE 3WJJA 3B2XA 3NIGF 2GTZA 1W15A 3MRFA 1NIEA 2D03H 2APFA 4I4WB 5T1MA 2NW2A 1AZUA 1SVBA 5JA8B 3JWNH 3L9RA 1IBFA 3QDJA 3B43A 1ONQA 1S9XB 3F5WA 3ZE2F 3ARDD 2JQZA 4OGXH 2P3YA 3HBQA 5F0PB 2IH3B 4YUEL 3T8VA 4QKTA 4BDVB 1BJ8A 1VADA 2B20A 4P5TD 4QHKI 3VG0L 3WS3A 3PABA 1C1EL 4WO4B 1OAYH 4RAUA 3WYRA 3TNNB 4LEXL 1MCQA 3IMRA 1T7YA 2XFGB 5IGXL 4NUQA 3KPPA 2WYZA 4APXB 5PCYA 4AITA 2NLJB 4L4TD 1E4KC 4Y89A 3JQOB 3UDWC 4WUKH 1INEH 2XV6B 3VVVA 4GT0A 4PTUA 2E4FA 4UQ3B 3WFHA 3WJMA 5I1KL 2XWCA 3D39D 4X7EC 5CJOH 1GGTA 4DP1X 3GLZA 1DZBA 4BV1A 2R1WA 3BWSA 1BHGA 2BP8A 2OL3L 1H3TA 2XN9E 2FYYB 2L4OA 3S35L 1KYFA 2GITA 3N43B 1KB3A 4QRSA 4UOJA 4MRBA 1F58H 3INUL 1F3DJ 1JL8A 4GKLA 5IF0B 5EG6C 1I85C 3W9DA 3P11L 3IS0X 3WEXB 1NDMB 4ZAKA 5C71A 4Y2NA 3ATFA 1MFAH 3OKOA 3P4NB 5I8EB 2ADJA 1JWMA 1SDAB 1CF8L 3QUXA 3LEXB 4PG2A 4E9SA 3U0TB 5ESVA 1CQKA 3MOBL 5EF0A 3AXLA 4WJG3 5EEZA 4AQ1B 2QV2A 2X6UA 1V7MH 3CVCA 5T1KB 2FBJH 2LR4A 4IU2B 3V7MA 1XGRA 2XPYA 3VCLB 1GJUA 4AC4A 5CXPA 2YOCA 1IX2A 2CUIA 2PO6B 3B8SA 3BEVB 3RVTD 6FABH 2ZF8A 3QIWD 3MV9A 2IQ9H 1UXWB 4KKBC 5A2FA 1P4LB 1WFOA 3ZYOA 4WU7B 4GG8A 1SJEB 3QHTC 2DLFL 4YDVB 3L4ZA 1E4XH 4CVXB 2B39A 3ZQWA 3WMPA 3RGHA 4XNQA 1JGDB 1F00I 3MREA 4HCFA 3NIFE 4JRYB 3V0VA 4WHYH 1ZT1A 12E8H 3H7LA 4KI5E 4X5PA 4JQVA 2H0PA 4S0TD 4APQC 4FYRA 4R4ND 5EBLA 2F18A 3VYPA 1I1RA 1TVHB 3WN5B 5FYKH 2XQ0A 5AWNL 1TEGA 2DQMA 3HG1D 1CG9B 1NAKH 3L3OC 4CSZA 2WTPA 2J7LA 2J1ZA 4TM9A 5IVZB 3HB3D 1MQKL 5EN2B 4BGLA 1JRHL 2HVJA 2YMOA 5CD5C 4NSKB 3ARFD 3RL1A 4DQOL 1H3WM 5EC2B 3I3BA 5K1JA 3FQNB 4KITB 2DTMH 3HCVB 2F1BA 2XKUA 1FWXA 5F72S 2ODHA 1NFIB 3PUUA 4XO9A 5FC9A 2LV4A 1DO6A 1NAML 2N0MA 2NSQA 3PGFL 4KO7A 2IEPA 2JJVA 4GQRA 1EX0A 3DOSA 1KEML 2VN4A 1BBDL 3U9WA 3HOGA 3JV6B 4NT6B 1LE9B 4PRIB 4M5SA 4X7CC 5D9SB 4LNRB 5J9PA 2NQCA 3O6LL 5EEWA 5LXGL 4A63A 1W0VA 2H2SC 4M7ZB 4JG0H 5M95B 1JRHI 3VA6A 4TVPE 1YC8A 5LBSH 5JNYB 2GIXA 5FO7A 2VH5H 4JM2A 2AQ3A 3OKLB 1A6ZA 3HNVH 3PS6A 4N2HA 4RWYH 4UANA 1BQHA 4LRIC 5D1QC 1XSJA 1ZPLA 2DMHA 2FO4B 4HX1A 3ILPB 2WWKT 3NFNA 4X6BA 1ZRUA 3AM8A 2YBRB 1IKNC 2AAVA 3TA3D 1C5BH 1JPSH 2EUWA 1OALA 3BKMH 2IGFH 1CTMA 5EZOL 3STBA 4AENB 2ICWI 3NACH 5SWSB 4LSVL 2QQNH 3FB6B 2C3HA 2DJ4A 5DYOA 1KY6A 3N6YA 3LPPA 2P5WD 1CICD 2CRMA 1G5GA 4Z3HA 4PJFA 3IN2A 1Q0EA 3BH8B 3RAJH 2Q7YA 1UZ6F 1CYXA 3W11C 4GRWE 1RUAL 2G5RA 1DDHA 3CFBB 2IG2H 4BZ2L 1FLTX 1UKSA 4GKSA 1RY7B 1LEIB 3LS5H 2DM3A 4U7SA 3SKJL 3VXUD 4KZDH 5E4EB 4XXDA 3FC8A 2XQYG 3H4HA 1KCRL 4FFVD 4OSUH 3BP4B 1Y6KR 4PJEA 2VXQH 1NOLA 5DI8B 5FYLH 4JFEE 3VRLE 3FFCA 1S9KC 4YWGL 4IJ3B 3H7BA 4Z7VB 2F61A 2VL5A 3GJEA 5ID1A 5L2JB 4Q52A 1WUNT 2UZYB 4Y9GA 4E5XB 1MG2C 4XVTH 1UWXK 2YD0A 1J5OH 3DX7A 1FYTD 4DPAX 3P4LA 2JKTM 1FGVH 3UX9B 4GUOA 4GAAA 1MWAA 4FXKC 1P7KB 4RAVB 4Y19D 3S34H 2R2BB 2WZPD 1VGEH 5AD0B 4PV9A 4BH8A 3X14B 2NUTA 3ZXAC 1ZMYA 3V4VB 5AG9A 4G1MB 2F58L 3V6ZB 1DVSA 4Z7OB 5FO9A 2Y5TB 2JKSA 1W91A 1SQMA 2CMRH 3ULSB 5CJQL 3IMBA 2Q3ZA 2ROXA 3TPUA 1VLXA 4RIRA 5CZXD 1PLAA 2AJXH 1AE6L 2CBOA 3GSWA 1A7QL 3CX5J 1MW2A 2B4CL 2IOMA 2XT1B 4UDTB 1BD2D 4ZFOL 3BRFA 4NJAH 3RWFB 2B1AL 3BRGC 2I60L 4AY0A 4WU5B 1U3JA 4ES9A 2GJZB 3NFSL 2X0VA 1T0MA 2X4QB 4TLKA 2XQYK 4XNDA 3MJWA 4NJ9L 4Y1AA 5AL0A 2Y7QB 3I2CL 2BNQA 5T1LB 1AJ7L 5DD0H 3UTSB 3ARBA 1ROCA 1Y6MR 1A6UL 5EULV 2AXJA 3TEXA 4W9GC 1N59A 3BN9C 3O41A 2P45B 1BQ5A 4MAUH 1JTTA 3ARRA 1VPOL 1CE6B 1S7QB 3NIGE 4X9GA 4OU3A 3ELQA 4L05A 1HVXA 1E2ZA 1OO2A 2ICEC 1EV2E 1FORL 3CZEA 3MBWA 1GKOA 2NNFA 3BX7C 3SHSA 3KBPA 3DVFA 4OZHE 2VDNL 1P7QA 4PJIA 4HISA 3WKQA 5KAQG 4PJCF 3AB0C 3MNMA 5AKRA 3MUJA 1JHKH 3H9HB 4P9MH 5SWQA 3X3FL 3ZE2E 3VXSA 5HHME 3VSUA 3WY4A 2XACC 4R8WH 3T0ED 1AOZA 1A1MB 4OD1H 5F7DA 4J1UB 2IIJA 5DC2A 1OWWA 2BSEA 4R26H 1PKQA 2E74C 2XWXA 1LD9A 4OLZL 1M7UA 5DD3H 2E0PA 2BLFA 3LKNA 1TJGL 4YX2L 5C09D 5IEHA 3GTTA 1R3HB 1S7XA 5L9DL 1IZJA 4PREA 4DVRH 1EK3A 3D6GA 1NMCB 5E99L 2A6DB 3NCXA 1OHQA 5J56B 2M83A 4A7VA 3REWB 4MMXB 3IMVA 4ZUWB 4N8CH 5GGVL 1YEGH 2NNRA 5HGHA 1H15B 3O2DA 3KXFB 2UZXB 1FNGA 4XXCA 4UT6L 2E7MA 3UBXA 1W16A 3EJJX 1KXQE 3BQVA 4HIEA 4K7PY 4A1RA 3VH8B 4PRNA 3T0VA 1MNUL 2FIKB 2YAFA 3I6LD 3L3JB 3EJCA 4JO5A 2FGWL 1HTYA 4HKJB 3BP5A 1QAWA 4YHYC 5IB5B 4GSXA 1KV3A 2L7EA 4YHKH 4ZNEA 3BQUC 3CVHA 4LKCA 1BPLB 4F1ZA 1ETJA 4RZCA 2Y6TE 3U30B 2HYMA 4OJFL 1JGVH 3B2VH 5FO8B 2OSWA 3BWAB 3IGUA 4WEUD 1D6VL 2VKWA 1FL3A 2F1AA 3T2LA 5KUMA 3UC0H 2J5LC 2D9QB 4Z7WB 4DWHA 2A9NH 4N2MA 2CBQA 2HFTA 3CFTA 3ARSA 3EZ8A 3NZ8A 3ROOA 3WFCH 1EDQA 4G42A 4I3SL 5IVXB 4YPGA 4DJMA 2VMJA 2NZIA 3UTOA 4UAOB 3C5SA 1JPTL 4FQIH 4MA7H 1BCIA 4Z77A 1WICA 5C0GA 3CIQA 1DBKL 2WN3A 7TAAA 4PJGB 3EXLA 4JO1L 1IAIH 2WTRB 4P3DA 1CLYL 1FC1A 2H9GB 3QDME 5FPIA 2HN7B 2HKHH 1QPKA 3MRIB 1A4JA 5FA4B 4YC2C 4J2XA 3D69A 2IPKA 4IBSA 2WCGA 4FXGB 3FB7B 4FYQA 4QCIB 2QQKH 3T6XA 4QTHA 5CLZA 1ZDQA 4OLVL 4WI8A 2GY5A 2EDNA 4OJEH 1G6RL 4HK0B 4WRLA 5H37H 4MQ7A 4WGVB 4ODTL 4LLMB 4KRPC 2R23A 4KOCA 5AB1A 3L45A 3UOAB 3TT3L 1J9SA 2EDLA 3SDXE 1KYUA 1XDTT 5IQMA 1YN6A 2CGRL 4KDWA 5IT2H 1DQLH 3EGDA 3LEYH 4LPYA 2MRYA 3P9WB 2LW3A 4X5XB 5TFSH 4DP2X 4GRLA 3LN5B 4HUMB 5DFAA 4DN3L 1HWGB 3OKDA 4OZ4B 2YAEA 1C5CH 2NY0B 3S35X 3DX9B 3MRRB 2ADIA 3OGCA 3B9KA 1EWHA 1MCDA 1OTTC 2XJLA 5AL8A 5KVGH 2HT4C 2DWEA 4PIRF 3TO4B 5ACZB 5G2NA 2AHIA 2E75C 1OAKL 4KKCC 5IKCA 4F7EB 4YR6B 3WY3A 2CDFA 5CBAB 4AQ8C 2HT2C 4KO6A 4PN6A 1MCLA 3V0HA 2H45A 1D7FA 4L3EA 2VR6A 4YFLF 1E3FA 4PMFA 4TNEA 1RK1A 5J1AB 1RJYB 2I27N 3FCTB 4N0UE 4J28A 1VKXB 2D0HA 3QEHA 3U46B 1OE3A 4FFYH 1KJ2A 4N9GA 2BVOB 4DO4A 2NT1A 4XMLL 3V4PL 2X2HA 5GRYA 4LDEB 4QJ4B 3CFDB 3QNZA 3U6XS 2O5YH 2ZYHA 4BUHA 1RP9A 1SOXA 1UFGA 3Q2LA 1E4WL 2I32A 2CO2A 5BMFL 1F13A 4L4VA 4GH7B 3RY4A 3B2UC 3IDMA 3FAWA 4WK4B 5FUOL 2QT6A 3G6AB 1QASA 1AI1L 5FFLA 1QATA 3QEQD 1OCZB 3FUFA 5E9DA 2FUQA 4NUPA 3KM2A 3QUKA 5I0XA 3QDGB 3DVIA 4AQAB 4WV1A 4TUKH 4YBLC 4DGIH 5HJDA 1FLRH 4FTVE 1NPJA 2CHXA 4MXVF 4YMPA 2NX5D 1GRWA 1FE8H 3IDXL 4H4NA 2FLBT 4M9PA 5LGHL 2EDQA 2OMUA 2IPTH 3MRHA 4DKEH 5IHHA 4V1DB 2GUOA 1OPGH 1U8MA 1X9LA 2IPUG 3EFOB 1VEOA 3KPLB 4Y2DC 3RZCD 3ZDWA 5DJDA 4FQXB 2J55A 2ZIDA 1P1ZB 5DQJA 1N18A 4HS3B 3O4LE 4JFPB 1RVFH 3QZMA 4QOKA 3RU8L 4R90H 5E51A 3AW5A 3ZO0A 1FCGA 2A74A 3QZWB 4U3CA 1J0ZA 4MD0A 4X2UA 2V4LA 5SWZE 1YDPA 4ZSOE 5DS1A 3ECBA 2IJ0C 4IBZA 2V5SA 2GB2A 1FHGA 2C7UA 2G5BB 4D0BB 2X7LB 3RGVC 5AVYB 3KCPB 4J3OC 3WY2A 2AAAA 1P6WA 4M1DL 3VGGA 1ZVSA 1KBGL 4CSSA 5JW4M 4TSBH 4KROD 4GG6E 2FJFA 4GOSA 1DFBL 3P1VA 3QAZB 4XOBA 1OAXH 4HBCL 4XC1H 1XGTB 1IM9A 5JA9A 5AZ2L 1EAJA 4C59B 2O6EA 3L2LA 3UBFA 5IVNA 1NLDH 2H3NB 3L81A 4JVUA 4NC0B 1QSFB 3A47A 4A2LA 3V55A 4PRAB 4U1NB 3DSFL 3KNBB 2BVPA 4LAQH 4JFUA 4ZZFA 1T0OA 4N8PA 3GMQA 3QYNA 4QWWC 2Y06L 3L4WA 2OR9H 1V7NL 5DFWH 3ZHNA 2NZ9D 1Q94A 4U2YA 2IBZY 5JTWA 3O11B 4PSPA 4R7LA 1PAMA 2OMYA 2N59A 3G9VA 4HKXB 3SGEI 3UYPB 1BMGA 4HWUA 1DQVA 4XOEA 1Q0XH 4RISL 5F7MC 1I3RA 1T2QL 4Y4KC 4UDUA 3WLBB 4QRBA 4L9LA 1LO2L 3FTYA 3X1EA 3KW8A 4PJCE 4I9WD 4OFQA 4S10A 3TBBA 1SFDA 2XZAL