4OCWH

Crystal structure of human fab cap256-vrc26.06, a potent v1v2-directed hiv-1 neutralizing antibody
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
256
structure length
251
Chain Sequence
EVQLIESGGGVVQPGRSLRLSCGASGFSFNNYGMHWVRQAPGKGLEWVAGISFAGIKKYYGTSVKGRFTISRDNSKNNFYLQMNSLRVEDTALYYCARDLRELECEEWTLNYDRGPCVDPRGVAGSFDVWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKGLEVLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CAP256-VRC26.06 light chain
publication title Developmental pathway for potent V1V2-directed HIV-neutralizing antibodies.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 251
sequence length 256
ec nomenclature
pdb deposition date 2014-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ocwH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ocwH01
2Y5EA 1WFNA 3RDTD 1FGVL 4UV4H 4BFIB 2IADA 3KJ6L 3SE3C 4HUVB 2H9GB 3WO4C 2D31B 4O5LH 3CVHB 4UV7H 3IJSA 1L7TL 5FEBA 1KSRA 3BH8A 4RGNE 4OD1H 3DURA 1B0RB 3HI1B 2M8XA 5HI3D 4XMKH 1VPOH 3MODH 5E2TL 2HT2C 4OQTH 3QHFL 4FFYL 2NY7H 2Q8AL 1VDGA 2J4WL 4ZSOA 3IFOB 5DURB 4HUVA 3UO1H 2H9GA 3HG1B 2D31A 5HDOA 1EJOL 3CVHA 3GMMA 3L95B 1RURH 5E2WL 3QXUA 3BIKA 1F2XK 3D9AL 3HI1A 5B4MD 2JE8A 4IHOB 1HEZB 2F8OA 1WICA 3EJZC 5K59E 2IPKB 3OJVC 2F8XC 3NPSB 1A7QH 1JGUL 3NZ8B 4ODVL 4M8QB 2Z92A 5EU7C 4OD2A 1XZ0A 4EI5A 1I1AB 5E2JA 5TH2B 1L9MA 3IFOA 5FOJA 3KYKH 1D9KA 4YHMH 2G60H 5EZOL 1GVIA 5EOCJ 3ARDB 3L95A 2F5AH 1ADQH 1HEZA 3C5ZC 1UM6L 1V3LA 2AK4B 3LQMA 5AD0B 3I6LE 1I1AA 2VUYA 4J8RA 3ZMRA 4P23A 4N1EA 1FYTB 5TH2A 4DN4L 1U92B 3K1DA 2IQ9H 1MFBL 3DI3B 4Y5XC 5GGRY 3ARDA 3AFLA 4KQ4L 2AK1H 1OAYH 4MX7B 4N68A 1CBVL 4D9LH 4Q74A 4LSTH 4QOKD 4OM1L 2AK4A 1N6VA 5AD0A 4MA7H 4X6EB 4YHKL 5GS1B 2FSEA 1RZFL 3PP3K 1U92A 3K8LA 5DUBA 4N9GB 2YUWA 3U9PL 3QUXC 4MX7A 4U2ZA 2DQIH 1T7YA 4YZFF 1PZUB 4PJ7F 1FGVH 5GS1A 2HWZL 4Y2DB 4HWBL 3KJ6H 2D7TL 2EDJA 4MJIE 2APFA 4N9GA 1L7TH 2FX9L 4HWEL 2OYPA 1UENA 3G5XB 4L29B 4P57B 3Q1SL 4MXWL 2PTVA 1I8KB 4FFYH 2Q8AH 2NZ9D 4L4TE 4QXWA 4Y16C 1X6NA 1DP0A 5DQDL 4Y2DA 3D2UB 4R4FL 5EBMB 3U0TB 1BF2A 1BQHA 1EJOH 2YS4A 1VGKB 2EE9A 3NH7H 5E2WH 3RWCB 3WNLA 4KHTH 4CVZB 3G5XA 1MEXL 4P57A 1UB5B 3JVGC 4R7DB 2NXZB 1JGUH 4ODVH 4NQCE 2HJLB 1DFBL 4E41B 2BNRB 3D39B 4MD5B 5F89A 4BSVA 3D2UA 5EZOH 3LKNA 2PUQT 5EBMA 3U0TA 3WEXA 1ZS8B 4TSCL 5MEQA 3BJLA 3RWCA 4M6OL 4TNVF 3BW9B 1FNAA 2OZ4A 3PDDA 1UB5A 5H8DA 1UM6H 2DI7A 1X5XA 3VDBA 5DO2D 4TTGA 4RZCA 2Q1EA 2BNRA 3D39A 4MD5A 2FEEI 3CLFH 3AREB 1A5FL 1EMTH 4U3HA 4DN4H 4LOUD 2QQLL 1MFBH 1MWAL 3WFZA 4FQQA 2X4RB 1NBVL 4UQ2B 4HT1H 5C08B 5CGYD 3BW9A 2XA3A 4W70A 4FHBD 3VGBA 2I24N 4OM1H 5BS0B 4XAWL 1RZFH 3T0DA 5EIIA 2ADIB 2BY2A 4H88H 1VEPA 4LGPB 3H0TB 3EDKA 5KZCD 1YEFL 2X4RA 4AT6B 1QBAA 1HQ4B 1CFNB 3S37X 4HJJL 2VKXA 3P77B 1F3JA 1NMBL 3W9DB 3CPLB 3VWKD 5BS0A 3AY4A 3QZWA 2HWZH 3UJIL 5CWSB 2ADIA 4HLZH 4LLDB 1P84J 4PG2C 1GC1C 5TF1L 3H0TA 1XF2B 3WS3A 4BZYA 4HWEH 1BAFL 2W65B 4AT6A 3QUYA 2I26N 1T6VN 2OLDA 1YN7B 1DQDL 2BHUA 1ZT4B 3Q1SH 1CFNA 2A1WL 2DLFL 4MXWH 3C2AL 4XT1C 3P77A 5MI0C 4DZBB 3W9DA 1CFBA 4ELME 4M48L 5CWSA 1X4XA 2CXKA 4LLDA 1VADB 5D71L 4R4FH 5DD0L 2OMBA 1Q8MA 4GMSL 4X0KA 2W65A 4LQ1A 4M02A 4X7CC 1YN7A 5JOFA 1ZT4A 2V9QA 3L5WB 1EHLL 1R3LB 1DFBH 5SX5H 1B4JH 3S37L 1NMAL 3N1PC 3OG6B 3FOMA 5F7UA 1EVUA 4OCNC 1YMMB 4FS0A 4M6OH 1JWMB 3QUML 4NIKB 3TO4D 1WT5A 5D70L 4F7EB 5BW7C 5T3ZE 4LPYA 1Z9OA 2AJXL 1WV7T 1Z9LA 1GJIA 2IWGA 4JFFD 1IAII 2VIRB 4ZPVA 5BV7H 4JPIB 4WFFE 1R3LA 2XOTA 1FQ9C 4QRRB 5C71A 2QQNL 1A5FH 4ZFFA 3E0GA 3S3PA 5FGCB 3KYAA 2R1YB 4FQXC 5E7FA 4ZAKC 3O9WA 3VXRB 3DX8B 2BY3A 3DV6B 1IGML 1R3HA 1QFWL 4WUUB 5BVJB 3UMTA 5CJXA 4JPIA 1MY5A 5DJXB 3IJYA 4XAWH 4QRRA 5KANI 4DGIL 4OFDA 4NN6C 1U2HA 2VE6B 3UTPE 4Y19B 1EEYA 1WBXB 4X6CB 2GKIA 3VXRA 5EOCH 3DV6A 2Z8SA 2FO4A 4M3JA 1C5BH 4Z7UB 4WUUA 1K4DA 1OAQH 3MJGX 1DE4A 1NMBH 5DJXA 1H8NA 4LLQB 3P40A 2OR7A 2XQYG 2IBBA 4G6FD 3GB7B 4JDVB 1T89A 1YEEL 4Y19A 5TF1H 1T22B 4OCWL 5E95B 4X6CA 3RUGF 2DJUA 4MJ2A 4HFWA 3LN9A 1BFTA 2DLFH 5AYQA 3GSWA 3C2AH 4Z7UA 5IB5B 4QRQB 5DRZB 5C0AD 1T20B 3I2CL 4JZNB 3HRPA 3FKUS 4LLQA 1MLBB 1KF9B 5I1CL 4JY5H 1TDQA 3GB7A 4JDVA 1HSAB 1IILE 1HH9B 3CFCL 5D71H 1CU4L 5DD0H 5DJ0B 1MPAH 2UZIL 3QRGL 4GMSH 3QQ4B 4LSRH 3QDHA 2BSED 5FCUH 3RZCC 4PJCA 3D85B 5IW3A 1XGUB 1U8IB 4QRQA 4CMHC 5DRZA 3O3BB 1CGSL 1G9NC 3BISA 2R23B 4F57L 1T20A 5E5UB 4JZNA 3WSQL 5J13B 3MMEB 1MLBA 3S37H 1NMAH 2H26B 4N1HB 1ZANL 3TNNB 5EWIL 5DJ0A 3T2QA 4HKXB 2IANA 1R3KB 3RX8A 5FDWB 2B5IC 3QUMH 2AJXH 4LBEB 3D85A 4I3GA 1XGUA 4Q9RL 2Z35B 2R23A 5FHBH 1T4KB 2XKUA 4CU7A 5A3IC 2F8VA 2IPUK 3MMEA 1DQMH 2VKWA 2FX8L 5CD5D 1R0AL 1G9EA 1OT2A 2V5TA 3CH8A 1JNHB 2XFXB 3LEVH 3UZEA 1WIOA 3DUSB 4HKXA 4QHUB 1R3KA 3T3ME 1WZ1H 5FDWA 5FM8A 3KPSB 1UCBL 3GM8A 1BEYH 1IGMH 3NGBC 3QXVA 1BD2E 4MJ4A 3VGAB 3Q48A 4JRYD 1T4KA 4DGIH 2VR5A 5GSVB 1NSNL 2OTWB 3MPCA 4MA1C 2X9YA 1JNHA 2XFXA 4F3FB 5D9SB 3DUSA 4QHUA 4NQEE 1R24B 3HR5A 5KOMC 1GIGH 2VDRL 1RUKL 3KPSA 1MHEB 3QCUL 4NHUA 1U42A 4XC3L 5F6HJ 3K80A 5J6GB 1IC4H 1CL7I 1ORQB 2DM7A 2F15A 3IAQA 3U30C 3FAWA 4NO3B 1G0XA 4ORGB 3OZ9L 1CD8A 2DIJA 2VO5A 1ES0A 1YEEH 2A9ML 4NT6A 2N7BA 1AXIB 4OCWH 2Z8RA 3BT2L 2PXYD 3BIAX 5D9SA 1JGDB 1R24A 5I19L 1TFHA 4LDOB 1MHEA 3C6LA 3C5JA 4KV5E 3WBDA 3LOWA 3WXWL 4E5XB 5J6GA 1ORQA 1IZKA 2DQJL 1CE6B 3I2CH 4HWBA 5DYOB 4NO3A 4YEFA 4ORGA 5I1CH 3JUZA 3B9DA 4PRNB 4CN6A 1ERNA 3CFCH 1CU4H 2YD9A 2UZIH 4YBHA 3QRGH 4BQ9A 5H35B 3SDDB 1GOFA 2AXGB 1QP1A 5L2JB 3MLPA 2QQKL 4ETQA 4F57H 1ZGLB 4W81A 4PJEA 5DWUL 3WSQH 5DYOA 3OR6B 5EBWB 2X1WL 2AABL 2NNAA 4NM8L 5H35A 1B0WA 3SDDA 3WFDH 2VLRE 5L2JA 4X6DF 4OLUL 2WBWB 4Q9RH 4ODHH 2XKNB 3DVNB 1FFQA 3OR6A 1V7NL 4JZJC 4UIKL 2FX8H 5EBWA 1MWAB 1KLUA 5D1QA 4JEGB 5IB1B 1BJ1J 4ZUSB 4P46C 1UCBH 4LCWB 2YXMA 3QIWC 4ZOBA 4C55A 1EV2E 4NNYB 1GAFL 4D9QD 3C60D 4JQVA 1NSNH 12E8L 3SHSA 2QR0B 1MWAA 2DICA 5E1HB 4X9HA 1CF8L 2E9BA 2G9HB 1QFPA 5IB1A 2UYLB 4APQB 3SKMB 4ZUSA 2QADC 2MFNA 3KDMA 3QCUH 4LCWA 4MAYA 4XC3H 4LEOB 2ZOLA 3ZDZF 3P4MB 4NNYA 4XVJH 2VXSL 3PV7A 3S3SA 2ZSVA 3CSPA 2A9MH 2QR0A 3WDHA 3BT2H 3L9RB 2G9HA 4APQA 3F7RA 3SKMA 4Y1AE 3ZKQD 5FUZL 4QYOB 2Z4QB 2F5BH 4UT6H 4LEOA 1UKTA 4FTVA 1MREL 2PETA 5BJTA 3P4MA 1NUDA 3VMNA 1NUFA 2JB5L 2PKDA 3KXFB 4QRTB 4AIZA 3L7EB 3B2VL 4PJ5D 1PSKL 3QIBC 2DM4A 1WAAA 3ELAT 1FFRA 4KAQL 1DVFC 4PGZA 2Z4QA 1NDGB 1RIVL 3QI9D 1EX0A 4P4RB 4JFYB 4U1GB 5IB3B 4G6AC 3KXFA 4QRTA 3AS0A 3FQWA 1JGVL 3GNMH 3L7EA 3TPKA 3O8XC 5ID1A 3QUMB 3R0MA 4JRXE 1A7PH 4POUB 1HSBB 3AAZB 5ESQB 4OLUH 3INUH 5L6YH 1NDGA 1MIML 4P4RA 5JLZB 3RKDD 5IB3A 4M6NL 5CEZE 5CJQL 3TIEB 2JJVA 4UIKH 5HYSB 1Q9OA 4YXHH 3GUTB 4H1LH 2AV1B 5LCVL 4WJ5A 5HY9B 4LSUL 3OQ3B 4L4VB 1HSBA 1FVEB 5I18L 3G04B 3NVQA 3AAZA 5ESQA 1T5XB 1CDBA 3EO0B 2EDNA 3R0NA 1CDIA 3OXRA 2J8OA 5JLZA 3MV7E 2D7OA 4LP5A 3TIEA 1P4LA 1RY7B 5HYSA 12E8H 4JFDE 1AR1D 1CF8H 4MD4A 4Y4HD 5HY9A 4NYLB 4L4VA 1FVEA 4PRBB 2DIAA 1H0DB 1RHFA 2L7UA 1T5XA 4EBQH 1SMOA 3RWIB 1MCFA 3DX9A 3Q5OA 4QRSB 1BFOB 4LSQL 4OCYL 2VQUA 3MLUH 5F1SA 4XMPL 2HTLD 4K8RH 1JYNA 3WHXB 1I7RB 3VD4A 4R8WL 1T7ZA 2WANA 2JB6A 5FUZH 5KSUA 3PABB 3NPZB 4JKPL 4IRSC 2EDLA 4PJIB 1H0DA 1MREH 3SY0A 4GMTL 1DZBA 1NGPL 4QRSA 2J6EH 2FEEL 2IBZY 1X5KA 2CDEB 2J8UF 4EUPG 3B2VH 4RBPK 3BZEB 2WSKA 4RFNB 5IV2A 1PSKH 1F97A 4WW1B 2YOCA 1P4IH 5E70A 3HFML 3PABA 4PJIA 1SEQH 2YD3A 4KC3B 3JWDH 2OR8A 1RZJL 4F33A 2FGWH 3CU7A 1YNTA 1ZLWK 5JXAL 2VQ1B 2ARJB 4L3ED 3BZEA 1OGAB 3TBWB 1TZIA 4XAKE 5DURD 4WW1A 3EYSL 2NY4C 3HG1D 3QFJE 3DYPA 5DFVC 5I6XC 2F53E 3TVMB 1X7QB 1MIMH 2CGRL 2Q86B 4M6NH 1EO8L 4U3XA 5L7XH 5D1ZC 4LSVL 1DSFL 4ZUTB 2VQ1A 5C9JB 4HPOL 2ARJA 1LVEA 3BZ4B 5D5MF 4LSUH 3TBWA 4KKBC 4OUUB 3RVXC 5ACZB 3NIGF 3AUVA 3ARDD 1X7QA 5DD5H 4JG0L 5FIEA 2Q86A 3KPQB 3JTTB 3MXVL 2AK4D 2EDYA 2MQ3A 1HILB 2EC8A 4ZUTA 2ITDB 3Q0HA 1YEJL 3AM8A 1FYTD 3BZ4A 1MI5E 4C58B 2JF1A 3QWRA 1G7QB 3AMKA 4AEFA 5IMOA 5GZOC 2Z31D 5J12B 3KPQA 3JTTA 5E6IC 5DS8B 2IBGA 2FECI 1HILA 3GJFH 2ITDA 1XR9A 3DGGA 1HYSC 4XMPH 3X11B 4YDVA 3ULUL 3WLBA 4KGLA 3H9ZA 1G7QA 1BJ1H 2FJFB 1KGCE 2F74B 3CXDH 4GMTH 1KJVA 1NGPH 3ZKMC 1AFVL 5DS8A 4WFHD 3TYGL 3WYRA 3SGKA 2NY2C 1Y0LB 1L4IA 3X11A 5DK0B 4Y2DD 2Z93A 4JFZH 4N5EC 5IOPB 1HHJB 3HFMH 4RMWA 3X13B 2FJFA 1VERA 2F74A 3VXME 1UWXK 1E4XI 2X9XA 3F58L 5JXAH 1T3FB 4KMTH 5CBAB 2EXYD 4G42B 4GG8A 3MUHL 5MP6L 1Y0LA 4YBLC 4M00A 5DK0A 4I18B 4LLWB 5C92A 4GXVH 2EIZB 5IOPA 5I71C 1JPGB 1UH4A 4C56B 2AGJL 2CGRH 4UU9B 4RMRA 5I1GL 1EO8H 4KDTC 4LCCC 3DMMB 2ITCB 4W6YB 4H1LB 4OTXL 4HPOH 3TH4T 4E41D 3D39D 4G42A 4WTWA 5E4EC 1N0LA 3T09A 4EN3D 4P9MH 3VJ6B 3EUUA 2EIZA 1D5MB 1ZA3B 3BXNB 1T2JA 2DWEB 4FQ2H 1QLRA 5IF0B 4C56A 4JG0H 3MXVH 2H32H 5GRZA 3DMMA 1HHIB 1X5FA 2ITCA 2VXUL 4LGSB 2A6DB 2EDWA 2NXYC 3V2AR 1E6OH 2H6PB 2EIDA 1YEJH 3ARED 1EAPA 4RGNC 1RUPH 1W0YT 1D5MA 5DK3A 2IG2L 1ZA3A 4GKNA 3RZWA 2OL3A 5DRXB 1ETZA 3FRPA 5IF0A 5C08D 2BVEA 3X17A 1LP9F 5EBLB 1HHIA 2A6DA 2V9RA 1OTSD 2H6PA 4ZQKB 4XP6L 4Z78B 4XPBH 3H7LA 2LU3A 1MFDH 4LVOC 4HS8H 3PWPB 1PW3A 5F7LB 4F2MB 5DRXA 4KRNA 3LS5H 2WBJB 4CGTA 2VABB 1UZ8B 5J11B 4L8CB 3T1WA 3TYGH 3H9SD 4KKNA 4ZQKA 5DJ8A 4Z78A 4DQOL 4ZYKA 4Y5YC 1PBYA 1E28A 3PL6C 1U3HB 3W82A 3OGCB 3BP4A 3QSKB 3PWPA 4PRPE 4RA3A 3WCYA 1G7MB 4F2MA 3ZE0F 5C0IB 3SCMB 5HYJD 3F58H 2VABA 4GKSB 1F58L 1RFDL 4DUVA 1HQRB 3CFEA 5ENWA 3O4OB 2R2EA 3TNMA 1U3HA 4OLZH 4MQSB 3OGCA 4P0DA 4MQTB 4DCQB 3LAFA 1G7MA 2AGJH 3SDXF 2WIIB 1FCGA 1CL7L 5DGQA 5C0IA 4Y8DC 1FRGL 4O58L 2VWEE 4GKSA 4UAOC 4MMZC 3UTOA 4CRPA 1C16A 5GS0C 3NMEA 3G6DL 4WY7L 4Z7WE 4MNGE 3GZKA 1AGDB 4OFVA 3MOAH 3TIDB 3B4NA 4M5YH 1YMMD 5JHDB 4DCQA 4HIHA 4DGVL 2GJZB 2WIIA 4UILH 5C0JA 3RPKA 4QHKI 1P7QA 1RV6X 2VXUH 2EDXA 2HG5B 1XR8B 2DMCA 3NFNB 4PJGE 5CP3H 5T1MB 1H3WM 3MFFB 3U7YL 4QRRD 2Y9RT 4TQEL 3V6ZA 4M7LL 5T3XE 1LEIB 5JNYB 1AGDA 1UB6A 2IG2H 1JK8B 4M1CC 5TJWK 3TZVC 3TIDA 4N0UB 5JHDA 3TBVB 4WHTB 1TQCB 3M45A 4JVPA 3CNKA 2CDFB 2HG5A 5JUEL 2XRAL 3IDIA 3PDOA 3RWFB 3ZHLA 3SGJA 2JJSA 5CIPB 4XP6H 1MF2L 4LAQL 5GGVH 1SMAA 4WO4C 2CRMA 1MY7A 1LEIA 5JNYA 3ZLQC 3OG4B 2DI9A 2DQDL 1JK8A 5LAXB 4UIMA 1QLFB 4N0UA 3TBYA 1W72A 1YEKH 3VXUA 4Z7VE 1EO5A 1NBQA 4WHTA 1BECA 1J0KA 1AKJB 1GH7A 2PF6A 4FQIL 3Q6FA 3GMQB 4G9FA 4WWKB 4X7EC 2CDFA 5IR1A 2DIBA 3QNZB 3VXSB 25C8H 4YUEL 3RWFA 1OWRM 2FB4H 1QBLL 5CIPA 4DQOH 4Z0XB 3M8OH 2BRRH 1H3PL 2R1WB 3QG7L 2J3SA 4FQ1L 4M93B 3SO3C 5BCAA 5LAXA 4LKXB 2N7AA 3HZKB 1AKJA 3KPRD 4WWKA 1RFDH 1E4WL 5LQBH 3DETD 3QNZA 5GZNC 3HC0A 4Z0XA 2EYRB 4OD3L 1JNNH 5A1AA 5L9DH 1VKXB 3MLRL 3QB7C 2E8YA 2X5PA 3DUHA 4LKXA 1KTDB 1CL7H 3HZKA 4QOKE 3ARGB 1ZA6B 2EE6A 1FRGH 3A6CL 2AJZB 3MRFB 5BMFL 5EO0A 2IGFL 4PJHE 1S5IH 4Y5VC 4QRUA 1SYVB 1I8MB 1LK2A 1BOGB 4JN1L 3QDJB 1VKXA 1DBBH 3EZJB 4JB9L 1KTDA 2H41A 3ARGA 4ONFL 1ZA6A 4OCXL 3QPQC 2C26A 4IRJB 4X4MA 2AJZA 4JGMA 3D1MC 2CR6A 3U7YH 3VGDA 4PJAB 4P3WA 5DK2B 5I1DB 1ZVHA 4E42A 1QUNA 4HCRL 4M7LH 4DKFL 1UH3A 3FFDB 2NQCA 7FABH 4DAGL 4P2OD 1SYVA 1JMZA 2X7LB 1I8MA 1EJ6A 4UUJA 1BOGA 2GSGB 3GO1H 1N5YL 1UWGL 3H9YA 3KPSD 3PXHA 5F44A 1A6VL 3Q3GA 2Y06L 1QSFD 2ZSWA 4QWWC 5DK2A 2OXGA 2BSRA 5I1DA 1S7VB 1MF2H 4LAQH 5GS2H 3MBXL 5IJVB 3BEWB 3T65B 3GIZL 4BQBA 2J88L 1T1WB 4MXVF 2GSGA 2DQCL 1CT8B 2JELH 4YDLB 5F1OB 4LRIA 4KK8D 4NZTL 3E6FB 3GGWB 1KC5L 4MQXC 5J0BA 4YUEH 2X1XR 3FHAA 1QBLH 3QA3B 1S7VA 1IEBA 1Z3GH 1OAXL 1H3PH 2IAMB 3QG7H 3BEWA 4PJ8C 3T65A 4FQ1H 1F8TL 4NC1E 3F5WA 5DMGC 1CT8A 2NX5B 3UAJC 2D0HA 1K8DA 3UTSB 2R2BB 4LSSL 2OI9C 1J8KA 3E6FA 3GGWA 1E4WH 2FLRT 4NZRL 5EG6C 3QA3A 4PV8B 4YC2B 4I3RL 1E4JA 3LRHA 4BSJA 4ODTL 5EU3B 1ZMYA 1IGCL 1YY9D 3UYPA 3MLRH 5I1IL 3SDDD 1GOGA 4MDIB 3RFZC 1R5VB 2GTZB 3UTSA 3A6CH 3PG2A 1PYWB 4RGMC 5BMFH 5KS9B 1UEYA 4JKWA 3E2HC 1EZVY 4X9IA 4PV8A 2E27L 4P5TB 2BRQA 5EU3A 4LIQL 1BVZA 2C3XA 4PRDB 4JN1H 1EBAA 4JB9H 3KPTA 2QSCL 2E6PA 4MDIA 2HLAA 3IFNL 1C12B 4ONFH 2BDNL 4JFEE 4OCXH 3M17B 5HDBE 4D2NA 2HYMA 4HFUL 2FX7H 4PB0H 5KS9A 5CZXD 1T83C 2D7MA 2VL4A 4DKFH 2WBKA 3EFDL 3TN0D 4DAGH 2E9JA 1X5YA 4PRDA 4PJDA 1MRDL 4HUKB 4L8DB 1UWGH 4LCWD 4PRIE 1C12A 3H3PL 4KROC 1YMHA 4GW1B 2F19L 1IAIM 2YD6A 3M17A 5DUMH 3MLZL 1J12A 3MBXH 3X3FL 4G43B 1CXFA 4XXCC 5FCSH 1UJ3B 2J7LA 2J88H 3QEUB 2RCSL 2LVEA 4L8DA 1NEZB 5HHOE 2E8ZA 4NQDE 4V2BA 4HV8B 1WTLA 3I6GB 4GW1A 1KC5H 3ARFD 1X4YA 5B38B 3MJ9H 5F96L 4KTDH 1UJ3A 3QEUA 3W0WB 2NY3B 3PQYE 4PJAF 1WF5A 4OV5B 1KXTB 3MLTB 4KXZI 4LSSH 4HV8A 3I6GA 1WTGT 2BVPB 3B9AA 3D3VD 4I3RH 3KXFD 4GG6B 1A7RL 3RI5K 3QWQB 4XWGL 3DHMA 4GO6B 4FP8L 4NJAL 1IGCH 4LMQI 4OF5A 2DB8A 4J1UA 1TZGH 3PNWB 4OV5A 3EOBB 5ICXB 3MLTA 1PG7H 5B39A 3LB6D 2FECL 2BVPA 5C0BE 3ZE2E 3T4YB 4GAJL 2PW2A 2E27H 5T1KA 3PWUA 4X83A 4LIQH 4P2RB 4HXAH 2X4PB 3TT1H 1XIWC 3VXTA 3OAYK 1S7SB 2DQUH 2QSCH 5ALBL 3PNWA 1A2YB 4RX4A 4PLJC 2X89A 3EOBA 5ICXA 1LMKA 4KMLB 1ZHKB 4LHUB 4LLUA 2WQ8A 2ZCLH 3HC4L 5DMYA 5TDOA 4CW1A 1I7TB 4HPYH 3B3IB 5DVOA 4G9DB 4H8WL 3T4YA 3EFDH 2EC9T 4FMFA 3TCLB 5FO8B 2DLEA 3MCLL 4P2RA 1KIRB 2X4PA 1I75A 5GRUL 4L4VD 5HVHC 1X5JA 4F15B 1A2YA 2HLFC 5IB2B 1E4XL 6FABL 5C0AE 4LRNL 1MCJA 1J1PL 4YWGH 5I1HL 2W9EL 2R29H 4PBVC 1CIDA 3FT2B 3B3IA 4G9DA 3X3FH 4MA3B 2R4RH 1MJ7L 2EDOA 2BK8A 5BXFB 5FO8A 1TMCB 4PJ9C 2A77L 1T0PB 5LVEA 4PGJA 4NO2A 2RCSH 1KIRA 3AROA 2IH3A 2OR9L 4QTIL 1JVKA 2QEJA 5IB2A 3QQ3B 4IDJH 4X98B 5L0QB 3LSOB 5D96B 2R4SH 3K74B 2VTFA 4PGBB 3STZB 1G7LB 2FZ3B 4MA3A 1VENA 5BXFA 4Z7OE 3OKLB 2AEQL 5F7WC 4AJ0A 3IF1A 3MV8B 3VW3L 5EB9A 5IW6B 1A7NL 1JZ5A 3K46A 4PR5B 1DBAL 3QQ3A 4L8SC 4X98A 3LSOA 4R4BA 4LVNB 3D69B 4ZUWA 4B0MM 3G6JA 3HMWL 3I6KA 3ZT5A 4PGBA 3STZA 1OW0C 2D03L 1G7LA 2FZ3A 1A7RH 3CK0L 5SWSD 1B2WL 4XWGH 4ZO7A 1KT2B 4GBXD 1LO2L 5DJCB 1NC2B 4ZOEA 4Z77B 1NFIA 1V3KA 4FP8H 4NJAH 1AGBB 3MV8A 1KB5L 4NZJA 2V17L 2XTLA 1MAMH 1CE1L 1NBZA 1MCRA 4IRZH 4PR5A 3F7PC 1IEHA 3LN5B 4FNLH 1A6ZB 2VJXA 4JRYE 5IROA 1ZHNB 1G1YA 1Z2KA 4RAVB 4NHCL 4JN2A 4GAJH 1GZQB 3TBSA 1HXMA 4POZD 1KT2A 3O6FA 1ODAA 4YQXH 4XTRC 1OGAD 1RMFH 1I3VA 4BK4A 3FQUB 1SY6L 1REIA 5C70A 4NGHL 4LPTA 2Q20A 1TLKA 3WIFB 2BMKB 3V7AE 1ND0B 1A6ZA 2QL1A 3TVMD 4NN7C 5DR5L 1ZHNA 3HC4H 4U6YA 4H8WH 4M4PA 1GZQA 3IDMB 4NN5C 2AVGA 3SQBA 3MCLH 5DVKA 1NEUA 2LU4A 5GRUH 3BSZH 2EDQA 4QRPD 4X9GA 4J7RA 3WIFA 6FABH 2BMKA 4GG6F 1ND0A 1J1PH 3G5YA 5I1HH 2W9EH 3BQUD 5CS7A 4HCRA 3X3GH 1ZT7B 3SOBL 5FM4A 1J9CT 4OF8A 1MCNA 1F6FB 1U0QA 2A77H 4R4ND 3RVUD 3ZHDA 5EDXA 1I9IL 1BZ9B 2OR9H 4QTIH 5IG7A 2RJMA 1ZTXL 1HHGB 1MCEA 2ED7A 2R69L 2H2SC 3C5ZB 4FN0A 5J56B 4WFEE 3SDCC 3WMSA 4CADA 5JOPD 5AYUH 4EQ3A 1U8QB 3DTXB 3VW3H 3P11H 2GW5A 3FZUD 5IKCB 1A7NH 4ZS6D 3EDEA 4YHYB 4HZLB 5FM5M 1WC7B 3C2SA 4Y5XB 5JIPA 2P48B 4NRYA 3MV9B 4PBWD 3HMWH 1JPSL 4L4JA 5D2LB 3CK0H 4KPHL 1LO2H 3ULSB 1U8QA 3DTXA 2V17H 5IKCA 1CE1H 1YYLH 2V7HB 4X99A 3OB0K 3TESA 1QSEB 3RWDB 1FAIH 2YD1A 4HZLA 1WC7A 1TPXC 5EO1B 1RUMH 3MV9A 5GRVL 4D9QE 3OKOA 1T7WA 4NHCH 2ICCA 5D93B 4FQCL 3ILPB 5D2LA 3J7HA 3KAAA 3U7AA 3GRWL 4UBDD 3ULSA 1SY6H 5H2BA 2V7HA 1A14L 1QSEA 4XHJC 3RWDA 3W2DH 5D7LB 4C56D 4Y4KA 1NFDB 5DR5H 1DEEB 4RMVA 3ILPA 2FYYB 2EKJA 3DV4A 1MJJA 4W4OC 4FA8A 5JQHC 5GISL 3S98A 2ED9A 4R0LC 5KW9L 3S8WA 5DMKA 1K9TA 5D7LA 2ED8A 5TE7H 1R5WA 5F7DB 1NFDA 2XNAB 1DEEA 3SOBH 4PJ5E 1FVDB 1UVQA 2B1HL 5H37H 3MV01 3MJ6A 4FQJL 4YK4C 3CFDA 4HS3A 4JPKL 1U36A 4LCYB 1NQBA 3P4NB 2LVCA 3P4LA 5F7DA 2P5WD 2YPVL 3OBAA 3HCVB 2R69H 3U79A 4M43L 1A6PA 1HNGA 3WXVL 3FB7B 3VD3A 3ECBB 4K8RD 1ZGLP 1MH5A 4PJBB 3T0EB 4P49A 4KRPB 3KLAA 2MSPA 1NGQL 5ECJE 3P4NA 2WBJD 3HCVA 3IB4A 5IVXF 3TM6A 1IGJA 1JPSH 1E0OB 3FB7A 3HPLB 1QYGL 2BVOB 1BM3H 5DTFB 2X9WA 4PJBA 3T0EA 4OFKA 4NQEA 4G8GB 2VUOA 5CMAA 4M6AA 1G7JB 2DL9A 5K33A 1D5IH 2UWEB 2ZUQB 2WQRA 1I85A 1ACYH 4RQQB 3SCMD 4LLYB 1TVBA 4FQCH 5I73B 4WW2C 1DL7L 3HPLA 3QDMA 3GRWH 3LKPA 5KN5B 5DTFA 4TTDD 3S3JA 1T66D 2GJ6E 2VLKA 4GRLA 5D7JD 4KK6D 1G7JA 2UWEA 1GPOL 4AZ8A 3KPMB 4RQQA 4LLYA 3QBTB 5E8PA 2YMXH 3CFKB 3N1MC 5A16B 5I15H 2ZWLT 4K7PY 2XZQL 4OKVB 3KJ4B 5KW9H 4RFOH 5JHDD 1BLNB 3RQ3A 3SJVD 4MJ6B 2XA8H 3QHZH 4HX1A 4M7JL 5DD6B 2UVEA 2WWKT 3KPMA 3UJJH 4JY6B 4YGVB 3CFKA 5DA4A 1ZOXA 4Q0XL 3UP1A 5A16A 4FQJH 4KVCL 3FB5B 5K9QG 5ACLA 1N5AA 3FO2B 3TA3B 3D6GA 1WFUA 1AGEB 2YPVH 1U95A 3IFLL 4QTHB 5DD6A 4M43H 3U36B 4W6WB 1XGTB 2BHYA 1JTOA 3WXVH 5F9WB 4HF5H 4JY6A 1ONQB 2KKQA 4YGVA 2XT1B 3VGEA 3B2UD 3HG1E 4IOIB 2BSTB 3ETBF 3FB5A 5HHMD 1NGQH 3FO2A 3TA3A 2IFFL 2JKXA 1U58B 2O26U 3VFOB 2C3VA 4I0PB 2Z8VC 3MUY1 4QTHA 1AKJD 1XF4B 5GSRB 1XGTA 4QGTA 1UQSB 5I0DA 1QYGH 3EIFA 1Z9MA 3VXSD 1ONQA 4HLZG 4KK9D 4YH6A 1KB5B 3ULVE 3SPVA 3O11A 5BOPA 1JI1A 3OSKA 2Y7QB 1D6VL 3BPCB 4BM7A 3BI9X 4JFHD 5K93A 5LGJB 2ICEB 3OXSB 1U58A 4XWOD 5C6WH 4KI5F 4I0PA 2ORBL 3K8KA 2AK4E 2PYEB 3L7FA 1T1XB 1XF4A 3FHQA 3WUZA 1ZLSL 1DL7H 4JANB 4XH2B 2HT3D 1KB5A 1OF2B 2I25N 2NR6C 4KU1A 4KUZL 5F72S 5GRJL 4PJEF 1C5CL 4Y1AA 4YHZL 3SKNB 5LGJA 1IC5L 1GPOH 3OXSA 4GRWH 2IPTL 3ARGD 2PYEA 1T1XA 3CVIH 1PJ9A 5JMRA 4QXGL 4UB0L 4JANA 4XH2A 2DKUA 2ERJC 4XXDB 3IXTB 3X14B 3PGCB 1SY6A 1OF2A 1K3ZA 5F70A 4OGZA 3O45B 5E08L 4FXLA 3IRZA 1TJHH 2YEZB 4LEXH 3OMZA 1GCFA 5JXED 3QDJD 3MNZA 4F7PB 2EDRA 1I1FB 3SO5A 3RZCB 4IRJD 1BZ7B 4YBQD 5IHZA 4Q0XH 3IXTA 5EN2B 4CNIB 2YPLB 4JRXA 3W39B 4KVCH 5E2VL 5D7IB 3V6BR 4JPWH 4PY8J 4UDTA 3C9NB 4J4PD 4X8XA 5IJKC 2A6KA 4F7PA 4HSQA 3IFLH 1I1FA 1WK0A 5HHXL 3T4AA 4JDZB 5A2KH 2VLJB 3QUZD 5F88A 3HZYB 4URTB 1ZLVK 4MDJB 4CNIA 4HIEA 2YPLA 3W39A 3GSNH 4MJ5B 5D7IA 2XWJB 1I1YB 2VWEC 2IFFH 3BJ91 3UTTA 4HIJB 3C9NA 3NCMA 4R2GD 3LHPH 2ICWJ 3ISWA 3MJ8B 1SBSL 2XWBB 1TTGA 1MELA 3MV7A 4E41E 2BNRE 3D39E 3K2UH 4JDZA 2E9IA 4MDJA 2WMPA 1A8JH 1D6VH 2IAMD 3NFPA 5DDHB 4LKCB 3W11C 2HT4D 1BIHA 3VI3F 1G7IB 5L2KA 2YSSB 4JHBA 2XWJA 1JYWA 2NX5D 4XVSH 2ORBH 1PKOA 1PEWA 4OF7A 4OGAD 2XWBA 4U6XB 4ENED 1RIUH 1ZLSH 4K3GA 3RGVD 4XCNA 2FL5B 2V2TA 2IQAB 3OKDB 4RRPG 5IVZA 4KUZH 5DDHA 1C5CH 4LKCA 2YSSA 4YXKL 1IC5H 4Z7NF 3UDWC 3B9VA 4R0LA 2A9NL 2IPTH 1J05A 4XCCL 4U6XA 5GIRB 1JUFB 5CZKA 5BS0E 5L88H 4UB0H 4FFVC 1WWBX 4DN3L 5D1XD 4XPTL 4PRAA 4ZXBD 1MFCH 2IQAA 3EHBD 3OKDA 5F7EL 1QRNB 5E08H 4P5TD 4WHCA 1U8PB 2K7QA 5CEXB 5FYLL 4HZAA 5CKGA 3NIFE 2GUOB 5GIRA 5GQBA 1TQBC 5MEPB 1G7PB 1H5BB 4XCYB 5HYSG 5J9PB 2CK0L 3UPAA 5DLMH 1QRNA 3PF2A 3FAXA 5E2VH 2ESVA 1PFCA 3BHBB 2KDGA 1U8PA 4LQFH 4ZTPL 4OIIL 1AR2A 2R9HC 2X10A 2VERN 2PW1B 3LEYL 2CK2A 2GUOA 4BQCA 3HZMB 2FIRT 5HHXH 1VFBB 5JW4Q 2ZCKH 1G7PA 1JN6B 1H5BA 2BOCB 2CD0A 4IIQB 4XCYA 1JZ4A 4FFZH 1YEIL 5J9PA 3R8QA 4JZJB 3MGAA 4KMQA 2YK1L 4LHJB 2YUXA 3BHBA 4OZGB 1X5HA 4DVBA 3ESVF 1SBSH 5SWZB 3AC0A 1JV5B 1LK3L 4LVHC 1D5ZA 4EIZC 4IIQA 3QH3B 1KTKE 5T1DL 1YMME 5DRWB 4KKLD 3DHJA 3W0WD 2B4CC 1PKQB 4OZGA 4K55A 3MA9L 2QHRL 5F7MC 5SWZA 3QWOA 1UWEH 3MOBL 5MENB 4QRRE 1UXWB 1OGTB 4HJGB 1WEJH 2FR4B 3JBG7 5FGCE 3B8YA 2YD8A 5I8KL 1FIGH 5DRWA 4IS6A 1MLCB 4YXKH 3VXRE 4GRWB 1S7RA 1YEDB 1JCKA 4NBYB 5HGAB 4WUUE 3DIFA 4RISL 2DQHL 2XTJD 1RJLB 4HH8A 1CQKA 5MENA 3AS3A 5HJ3B 1UXWA 3LKOB 4HJGA 5TDPA 4XPTH 4B50A 2FR4A 4Y19E 2E5EA 1NCDL 1YUHA 4NPYB 4X6CE 4P4KB 5I8CB 4P2RD 1MLCA 3VFPB 5FYLH 3QIBB 1U3YA 4Z7UE 5EUOB 5HGAA 4EEEA 3VXMA 3LEXB 4HK3J 3U9UB 3SBWA 3O41A 1DVFB 1OSPL 3BFOA 4LHUD 5HJ3A 2W38A 3LKOA 4NM4L 4WI7A 2Q87A 2CK0H 3GJEA 4ODBD 4Y4FC 3UJTH 1W2KT 4XNUL 3HNVH 4P4KA 5I8CA 1N0XL 1OY3B 3E8UL 4HJ0C 3VFPA 4PJCE 4ZNEA 5KSBB 1LHZA 1QSVA 2VXQL 3QJFA 4ZTPH 4OIIH 4PJFB 5EUOA 3C08L 1BBJB 4XB7A 4OCMC 5A2FA 1SJEA 2ZCHL 4LOUC 1LO3L 3MR9A 4MYWB 1QHPA 4XP4L 1KN2H 5GS2D 5C0CD 3DRTA 3NCBB 4I0CC 1IZJA 1YEIH 2XY1A 2IANE 1F3DH 2YK1H 1FORL 3MYZA 5KSBA 4YDKH 1YEGL 4HKBB 4QGYA 1BBJA 3KPOB 1LK3H 4XBEL 3T0WA 3T77B 1HHHA 3QQ9C 1N2RB 1S9YB 2JK5B 4TRPH 5JTWA 1F3RB 4U1SB 3LKRA 1JRHL 4IOSD 1S9KC 2YD4A 1NAMH 3RL2B 3MV8D 3MA7B 3OHXB 4N90E 2QHRH 5JW5B 4HKBA 1XCQB 4KZDH 1F4YL 4DEPB 3KPOA 3IDYC 1WIUA 4HXBL 2XI9A 3FONB 3T77A 1QPXA 3EYFA 4PJXB 3FO0L 1N2RA 1PY4A 3RWEB 1S9YA 2JK5A 3FB6B 4V1DD 3BE1L 4QHMB 4U1SA 5KSAA 3RY6C 1NC2D 3KPSE 1SM3L 3RL2A 2GAZB 3OHXA 2GCYB 2R2HA 5JW5A 1IBGL 2DQHH 1XCQA 5IMLA 2MCPL 1EFXB 4IRSB 43C9A 5K9JL 3BKYL 3P9MB 1U8MA 3FONA 1NCDH 1FPTH 3FB6A 3SGEH 1C08B 3S35X 4TYUA 4X7DC 2DWDB 3CC5B 1JWSB 2GAZA 3BIBX 5J7CC 5ALCL 2GCYA 2HJFB 4ZOCA 1VFUA 2X4QB 1CDGA 2IALB 1EFXA 3STLB 4WENB 3ARBA 4NO5B 4H1LG 3HE6C 3V5HB 5EUKB 3LPWA 1C08A 2VC2L 4DOHB 2DWDA 3CC5A 1JWSA 1S7WB 2WLYA 5IUSA 2OCFD 2HTKD 3T2PA 1YPZB 2HJFA 2X4QA 1ED3B 2IALA 3WE6B 3CH1B 3STLA 5I6XB 4PV9A 4LPXA 3RDTB 4XP4H 4D0BB 4NO5A 3QXDA 4GRWF 1EPFA 1UZ6E 2LABA 3QT2A 3RBSA 2ZG1A 3KYOB 4WDIA 2ZP0T 2O5ZH 4Z7WA 3FT4B 4WV1B 3RTQA 3HMXL 3L3IB 1V7ML 1T7XA 1ZWIB 5KSVA 3VXQA 4EZMA 2EE2A 2A6IB 4LPUA 1ED3A 4NJ9L 3VFGL 3WE6A 3CH1A 1NCWL 3BDYH 5EIVA 3RDTA 3CDFA 3MLYL 3CMOL 4ACPA 4ODSH 3SDAB 3BEVA 3C5ZD 3KYOA 3MRHB 1A7BA 2CUHA 1HKLL 2EE3A 2NY0B 5EZJB 3F12B 1BREA 1JRHH 2ZG2A 1OVZA 3FT4A 5I74C 4WV1A 5FA4B 3L3IA 4WI5A 1ZWIA 1NL0L 3W5NA 2A6IA 5F3BB 3EW3B 4BSWA 1AXSB 2VR9A 4G6MH 1NLDL 4K94L 3VRLF 1A22B 3SDAA 1RI8A 4PJFF 3MRHA 5EZJA 3LQAC 5E6IB 3F12A 3RNQB 1GGYA 1S7TA 1Z9SA 3O2WH 2P1YA 1SM3H 1UACL 1LEKA 4LCWE 2ZPKL 4E0RB 1WSST 4MHHI 2M1KA 4ZG1A 2FCBA 1IBGH 1QSED 4Z7VA 1YN6B 2MCPH 5K9JH 2P49B 2FBOJ 2OS7A 5A43C 3MRGA 4DTGL 1MCSA 2IH1B 4G6JH 2QHLA 3RNQA 4NUJB 4IJ3C 1KV3A 1INDH 1RHHB 5ALCH 4EOWL 5JPNB 1OHQA 4FTVE 2C1OB 3CFJB 1VFMA 1LO0L 1INEL 2VXTL 5ADOH 3RU8L 3CUPB 4HQQL 1OP5K 1OTTC 2IH1A 3WIHA 2VC2H 1KEGL 4WFGD 4OGYL 1WAAE 1P5VA 4Y16D 1CS6A 1RHHA 4HLJA 3TO2B 3H9HB 5JPNA 5L8JB 4NNPH 2GT9B 3CFJA 3NAAL 4GXUN 1JJUA 3FQNB 3DWTA 2EO1A 4V2CB 4EUPB 1NGWA 3KXFE 3TJEL 3ZKXB 1T03L 3CUPA 3JXAA 1H8OA 3ZKSD 1LQSR 3NTCL 3VA6A 3GEWB 3CFBB 2EKSB 4QNPF 3JTSB 1WFTA 3HMXH 4F37K 1V7MH 3VFVA 1FL5B 3TO2A 3H9HA 2GT9A 3S35H 2XPGB 1FZMB 1VEOA 4PTUA 1J5OH 1NCWH 4ONHB 4EUPA 3MLYH 3LIZL 1FLTX 3WD5L 1HKLH 2NXYB 3HI5H 3CFBA 2EKSA 4OZHF 1GGTA 3T8XB 4HH9A 3VGHA 2B7DT 3O6ML 4RGNB 1FL5A 5ADPL 5SV4A 3WIIL 4JE4B 4JHZA 2XPGA 1FZMA 3IS0X 3DXAB 4YHOL 1ULVA 1NLDH 4M6ML 4TPRL 4K94H 3S5LB 4UNUA 1HIML 4JFOA 4ZS7L 4ZODA 3RVTD 1UA6H 2Q8BL 1H15B 3I02B 4HAFA 3T8XA 4G7YL 4L4VE 1UACH 4S1SL 3CCHB 1QR1B 4G8GD 2ICWB 1NKRA 4KRLB 1NGXB 3JV4B 3DXAA 4XP5L 4K7FB 5C0GA 3CXHK 3S5LA 4DTGH 4BZ2L 3MACL 5IMMA 4D9RD 3QYCA 3MC0A 1ZAGA 2WWMC 1S9XB 1A6AA 2IJ0C 3C5SB 2H2PC 1H15A 4XBPB 3CCHA 4JM2C 1FFPA 3RHWK 4Y5YB 2P8MB 4JKLA 4EOWH 4UOW1 2J8HA 2MKWA 4H0GA 5A2JH 1INEH 1CD0A 4K7FA 4TNWK 1XAUA 5KVGL 1P6FA 3P9WB 5I1KL 3BP7B 3F6LA 1DQTA 3TPUB 5KZCB 2LAGB 4OGYH 1FG2A 5IHLB 4XBPA 1QPPA 4PJIE 1KCRH 4UNVA 3NAAH 2NY1C 4P3DB 1RULH 3VWKB 4MB5A 2XKSA 2LQRA 3GMNA 1T03H 4S1DC 5ICZB 3DX6B 4RMTA 3NTCH 3EYUL 4AY0A 4X6BA 3TPUA 5EU6B 3A0OA 5DT1H 1BIIA 4HUXB 1KB9K 3TC9A 3TA3D 4CN4A 4P3DA 1G6RL 3MRNB 3IDXH 2OK0L 3LIZH 3VWKA 5C6PB 3VG9B 3FMGL 4FXKB 2XV6B 2P5EB 3WD5H 5ICZA 2DTMH 4CN1A 1ZT1A 2Y36H 5DRNB 2W60B 1EERB 4MJIB 5ADPH 5K9QI 1JTTA 4HUXA 3WIIH 1PQZB 4YHOH 4ZAKD 4R97C 5FF6B 2X1PA 3MRNA 4M6MH 4I0PD 1K4CB 1AHWC 1W0WB 4FXKA 2GY7B 5D6DC 2P5EA 5IQ9B 1OOAA 4ZS7H 4X4YB 4NP4L 3HUJA 4JJHA 1KBGL 2UZXB 3TO4B 2E7HA 1Q38A 4S1SH 3EOAB 4YNYB 4WO4B 3BVNB 4JFFB 4HWZB 5FHAL 5FF6A 1K5NA 2E6JA 1K4CA 4NQCB 1W0WA 4BZ2H 5IQ9A 1KG0B 2KL6A 3MACH 3U83A 4OZIB 4Q58C 4PLNC 1X5IA 2AS5M 4OLXL 3TO4A 3V5KA 1Q1JL 2HN7B 4YNYA 5FAAA 1TETL 3BVNA 3ARUA 4JFFA 4HWZA 1PLGL 5I16A 4YDIL 3S36X 2JCCB 2YD2A 2QBWA 3GMPA 5KVGH 4OJFL 4OZIA 2VQTA 5JOPE 4YHLL 5I1KH 3MRRB 4HGKC 2Q7NA 2WWKO 4Y88A 4AYFA 3F7VB 1IAMA 3M1BB 5CSBA 1HH6B 4LLVB 3GMOB 2JCCA 4MVBC 4ZFOL 3GHBL 3RZCD 1KJMB 3FQXA 4IM8A 5C1MB 2JJTC 5DVNA 1CICC 5TF0A 5K59F 5HPMA 5TPWL 3PWNA 2C3GA 1KIPB 1X5LA 1GRWA 2HAZA 4XNMA 3MZGB 3F7VA 1FYHB 1G6RH 5FKAB 3M1BA 4XZUA 1HH6A 4LLVA 5B8CB 2W0KA 3GMOA 4RIRB 4Y4HC 3SKJH 3LPGA 3EYQC 1KJMA 3ZZ1A 2VLJD 1KPRB 4GS7B 1HN1A 5IWLA 1QEWB 2MMXA 4RDQF 1A1NB 2EH7H 5A3ID 5EC2B 1KIPA 4XVUD 4K3EL 3BZFB 4Q6IB 5JW4N 4C56E 5IVNA 1QBML 5JHLL 2H1PH 1NEZG 1LE5A 5F1NB 5B8CA 2HTLC 4K3JL 4RIRA 5AAMA 3IETA 5B38G 1MCOH 2LAAA 3BX7C 3OX8B 4NP4H 2D4DA 4OF0A 5HI4C 2ADFL 1IQDA 3A6BL 3FQTB 1QEWA 3L3OA 5E8EB 3BZFA 5ID0A 4Q6IA 3FFCB 4M7ZB 2EO9A 2QSVA 3DBXB 5A40E 5CGMA 5GGQH 3QCVL 3GI9H 1V5JA 4A6YH 4OLXH 4XC1L 1S8DB 3FQTA 4QXUH 1Q1JH 3FO1B 3NN8B 1KIQB 5E8EA 2Z91B 1J8HB 1WIPA 3FFCA 2EC9U 1ZLUH 2NLJA 4PLKC 3VXOB 2HFFA 2OJZH 4YDJA 4LNRB 4YDIH 5C07B 1GGIH 4OJFH 1D9KC 1YC7A 5MHSE 2VZOA 4PRHB 4QEGA 2OI9B 4YHLH 4ZTOL 4XVTL 1EFQA 1JGLL 2R0KL 1F02I 1S8DA 4ZPTB 3IYLW 3FO1A 4HC1A 1F00I 4XX1E 3UZVB 1J1XL 1AQKL 1KIQA 3PWPE 5GJSH 1HXYA 4ZD3H 3ZDYE 1KNOB 3NPSC 5E8OB 3VXOA 1W0VA 2XN9B 1I1AC 2LTQB 4P23C 4JRYA 1F4AA 4LNRA 3GHBH 4DKDC 5E5RB 3F7QA 4GKOA 4LHUG 3ULVC 4AEIL 4PRHA 2AEWA 4MXQD 5T5NF 3ARDC 2PXYB 4N0YH 5TPWH 3MLVL 4N8CL 2Q3AA 3O2DL 4R90L 1KNOA 5B21A 5AG9A 3QNYB 4OIAA 1NBYB 2FWOB 4DVRL 2WV3A 2WP3T 2XN9A 4XP1L 2M2DA 1DEDA 1BVLA 4NCC2 3SGDH 4WUKL 1P6AB 1T2XA 3HLAB 2HRLA 4RMSA 2PXYA 5HHVL 3S36H 2K9UA 1H9VA 1OWWA 3ZE1E 3RIFK 4KKAC 3QNYA 1Q0YL 1NBYA 3G08B 5GS1C 4K3JH 3MRPB 4P46D 5JPMB 1RZKC 4NFDA 2NYYD 5EOTB 3BKCH 3NOIA 2DKSA 2RFXA 3QIWD 1KULA 3A6BH 4W68A 1S3KL 3RVWD 1HHKB 5JHDE 3GI8L 3O6KL 2F9BT 4X4ZA 2W9DL 3QCVH 3V6OA 5C0FB 4OCSH 3SE8L 1SVZA 3G08A 1TVDA 1EGJL 4GFTB 3MRPA 4Y2DC 1T0NB 4R6UA 5JPMA 5HHNB 1DQQB 3PWLB 1RJCA 1E4KA 4XC1H 5D2NB 3I3DA 4LU5L 2DLTA 1Z5LB 4N0UE 1OP3H 3ZDXE 4X5XB 1FV1B 3QNXB 5I76B 2EXYC 5DD3H 4X7FC 1AIFA 35C8L 1GGBL 3RHWF 2XACC 1T0NA 3C60B 5F9DC 5HHNA 5EO9B 1DQQA 3PWLA 4I5BB 1JGLH 4XPHH 4EDXB 2R0KH 5CEZH 4TNWF 4H26A 5D2NA 1J1XH 1AQKH 2ZJSL 3HAEH 2X05A 2NXZC 4X5XA 4ELMF 1FV1A 1NCNA 5I8OH 4UTAL 2PTUA 3QIBD 3QPXL 2B1AL 1G9ML 5EOQH 1FO0L 3C60A 1DVFD 4NKMA 5EO9A 4AEIH 4PIRF 5BO1L 3OB8A 1NDMB 4I5BA 5E7BA 2O61B 5BQ7A 1KJ2H 4N8CH 3OL2A 1AE6H 1J0JA 4LSDA 3O2DH 4JFHE 3UX9B 1BMGA 5E03A 4DVRH 4X5LA 4XP1H 1XIWB 4N9OB 2WINB 2WUBH 1DTUA 2X70B 4GSDH 4WUKH 1V05A 1NDMA 3QULB 2O61A 5FYJL 5J4MA 3O3DB 5I1AA 1AGCB 2FD6L 4CU8A 1RZ8B 5TDNB 4BKLB 3PHQB 4WTZG 2HFGH 4XMKL 2WINA 2VLME 2X70A 2YUVA 4NQXA 4PJ5A 5BRZD 3UYOD 3QULA 3QUYC 1OM3L 3L1OL 4OLEA 1AGCA 1QR4A 4NRZA 3QDJE 3ARQA 3QI9A 1RZ8A 5TDNA 5F8RC 3WDJA 4RCAA 3PHQA 3MV11 4HK0B 4JHAH 3SE8H 4BKLA 5C0RH 3UPCA 3VG0H 1ZEAL 1G84A 1T7VA 1AI1L 1JF5A 4QLRA 1N26A 1CFTB 1I7ZA 5GJTL 1A9EB 2A0LC 2G60L 1HCFX 1PZ5A 2F5AL 2BCKB 35C8H 2EDTA 3BO8B 4P2QB 4IRSD 5I1LB 3ULUE 1E27B 1WT5C 2RIKA 2CLZB 1OL0A 3RPIB 2ZJSH 2GIYA 2X6MA 2YN3A 3WV0A 4PJ7A 3LCYA 1YJDC 1IL1B 2AK1L 1OAYL 3U46B 3QPXH 4ZFOB 5GGSA 3T1FB 4D9LL 2W0LA 3BO8A 2YN5A 4LSTL 1FO0H 1D5XB 5BO1H 5HHQB 4LSPL 4MA7L 1I9RL 5I1LA 3O9WC 3VWJB 4NDMA 3PV6B 2CLZA 3V6FA 4BFEA 5DHVH 3LRGA 1RU9H 5CJXC 4CDHA 2NX5E 3MNWA 1IL1A 4JGUA 3QEHB 3UTSE 3T1FA 4XPAH 2DQIL 2NY4D 2JJUA 3ESUF 4QXTB 1FCCA 4IDLA 4GAGH 5HHQA 5DFVD 3S97C 3VWJA 4KJPC 5FYJH 4XGZB 2XQYK 2E6QA 1KYOK 5F3HB 4AG4L 2DOCA 3QFDA 5D1ZD 2FD6H 1J11A 1D6EB 5DSCB 2PO6B 3RVXD 5KS9E 2Y1VA 3T3MF 1T89C 2RBLA 5JR1L 3L6FB 4L3EB 3STBA 4RNRB 1OM3H 4IOFC 3SDAD 4BFIA 4XGZA 2NY0D 2AJ3B 3L1OH 2EYSB 1OB1B 3DGCR 4PJDE 3OJ2C 1DBKH 3NH7L 5BZWB 1D6EA 4KHTL 1B0RA 5DSCA 4HEPG 3ROLB 4WI4A 2PO6A 4PFEA 2ILLA 1I3RB 1ZEAH 2P8PB 5FECB 1AI1H 4M1GL 1KCVL 3OAUL 2Y5TB 3L6FA 3DARA 4L3EA 4RNRA 5GJTH 5GZOD 5I75B 3PP3H 1TXKA 2Q6WB 1JBJA 2AJ3A 4PGDB 5E6ID 2EYSA 1OB1A 3HG1A 1KCSH 3OTTA 3LD8C 3SDCB 5TE6H 5BZWA 2IMMA 4IHOA 4I3SH 3ROLA 5JDJA 2AJYH 3RWJB 2IPKA 3P0VL 1NKOA 3V79C 5IBTL 3RJDA 2P8PA 3NZ8A 1OQOA 4M8QA 5ILTL 1FLRH 4MZ2A 1KENL 2Y5TA 3WFEL 2NW3B 3VH8B 4KV5F 3CLFL 1EMTL 3ZKMD 4RGOL 1AO7D 2APVA 3C8KB 1FL6B 4CDGC 5I30H 4LLMB 5DC0A 5FYLD 4U3CA 4HT1L 3ZO0A 2Z31B 5CCKH 5J13C 1XF5B 1IGFL 5DJYB 3HI6L 5DHYB 5F6HI 5FGBA 4LSPH 1I9RH 1UXSB 1A0QH 1QA9B 1CN4A 2NW3A 1U6AH 1FYTA 4H88L 3QO0B 4P5KB 3W0WE 3C8KA 4FQHB 3ABZA 2V6HA 2Z31A 1ZXQA 1XF5A 5DJYA 5DHYA 4POYA 4X6EA 1UXSA 3GIVB 1QA9A 1FHGA 2C3HA 3CDCA 2G5BB 3QO0A 2C4XA 4P5KA 2AJVH 4AG4H 2V7NB 2YA1A 4BH7B 3VGAC 2NTFB 4FQHA 5MEOB 3RIAF 5GPRA 1XGYL 4KI1A 3RIFF 2GTWB 4K3HA 3V4UH 5JR1H 1KJ3L 3GIVA 2AKRB 4G6KL 4U1NB 2P24B 2G5BA 2VNCA 3C6LC 4P2RE 1FJ1B 2B2XH 2NXYD 4BH7A 3KLHD 1B88A 2NTFA 2VN4A 3DO3A 1KELH 5MEOA 4L29A 4RGND 1OARL 2GTWA 2PYFB 3DXAD 4M1GH 5BVPL 1I8KA 1KCVH 3OAUH 4KI5C 4D3CL 3DOSA 3SN6N 4WCYL 4EN3B 3TBTB 1KCKA 1B4JL 2AKRA 4U1NA 4OFIA 1I9EA 1VHPA 3B83A 4HG4K 1VGKA 4CVZA 1EGJA 5HYQB 1HINL 1T21B 4R7DA 15C8L 3P0VH 3ARXA 5IBTH 2GK0B 1RZGB 1IRAY 1HWHB 1RJYB 3EDJA 5BV7L 5ILTH 2NY5L 3RUGB 2DRUA 2HJLA 1KENH 4NKIH 4E41A 1J86A 3WFEH 4EN3A 4TVPL 3CX5J 1JNLL 3SDDC 2FGZA 4RGOH 3VGFA 1DANT 4PREB 1ZS8A 5L8LB 1WWAX 5HYQA 1Q94B 1FO0B 4UZGA 1IGFH 2GK0A 1RZGA 3HI6H 1IC7L 1RJYA 3G6JE 3U7WH 5D1QC 3RUGA 1VACB 3AREA 2JIXB 1HOCB 5DHVB 3I6LD 1CTNA 2DLIA 3B9KB 3MV8E 1GXEA 5T3XH 2EEBA 4UQ2A 5EOCL 5C08A 4DK6A 1W8OA 1FO0A 3MRJB 4JQVC 1C5BL 2BERA 3TV3L 2MPAH 1OAQL 3H9SB 3CAFA 1HOCA 5H37G 3I84A 4UT7H 3B9KA 2EIEA 4MAYC 1UFUA 1EDQA 4EI6B 1HCVA 1WUNT 1RD6A 5EU6D 5D8JH 1KXVC 1GOHA 1AY1H 1XGYH 1HQ4A 5JIKA 3MRJA 4RFEB 1KACB 1JI2A 4JO2H 5HYJB 2CKBL 1ZHLB 1KJ3H 3TJHC 3CPLA 3H9SA 4G6KH 5J8OA 1FSKB 2ADJB 2P5ED 4APQC 2BNQB 4ZUVB 4JY5L 4YPGB 3R06B 1XF2A 1MPAL 4MJID 4LSRL 1RIHH 4C59B 5FCUL 3D25B 5EA0L 3LRSB 3C8DA 3JSSA 1OTUC 1OARH 4OQTA 4RFEA 5HYJA 3WJJA 4M1CD 3TZVD 5BVPH 2X42A 4D3CH 4DZBA 4WCYH 5FB8B 1HYRC 2ADJA 4HEME 2BNQA 5DA0B 1VADA 4L4TD 4YPGA 3R06A 3IKKA 1HINH 4WO4D 3D25A 2DBLL 5KOVC 1BQLL 3DYOA 15C8H 1IKNA 3L5WA 1NCAH 2NY5H 3H6JA 5FHBL 4TVPH 5HVFB 4NQCD 1JNLH 4IMKA 1DQML 5BZDB 1QTYT 4NFCA 3LEVL 1M1SA 4YXLL 4YPJA 4N0FB 1YMMA 2IFGA 1WZ1L 1ADQA 4QF1B 1JWMA 4F7EA 1BEYL 3LN4B 4HUMB 2BVQB 1IC7H 1RVFL 2VIRA 5IK3B 3ZT7A 1HZHH 4XNXH 4D8PB 1LE9B 2R1YA 3O4LB 1IM9B 4N0FA 4QF1A 1GIGL 3ZHKA 3DX8A 4ONOA 4MZ3A 2VH5L 2O5YL 3MV9E 3TV3H 3LN4A 5BVJA 4L9DA 1IC4L 4OZFH 5IK3A 5GGSY 2KUTA 5DJZB 1GL4B 5SX4I 3PGFL 5D2LE 4D8PA 5JORB 4X6DB 3QO1B 2VE6A 1LE9A 3O4LA 1WBXA 5E00B 1IM9A 4FXGB 1QSEE 4K2UL 2C4FT 3DRQB 1YEHH 4GRMB 5EH1A 3WDIA 2F54B 5E5MB 3S7GA 1AQDB 3U0PB 2E7CA 4JO1L 3KPRB 2CKBH 4N5UA 4W4NA 3VU2A 5HTSA 5DJZA 1I3UA 4ZFGL 2ZKHH 5JORA 4LIQE 4X6DA 3QO1A 2I5YH 1T22A 5E00A 5HI5D 4XMLH 4FXGA 4NCDA 4MA8L 4PRPB 5EA0H 5D7LE 3EYOB 3DRQA 4GRMA 2F54A 3QCTL 5E5MA 1XH3B 3U0PA 1FNSH 1ACZA 3KPRA 5IB5A 1NFDE 4WW2F 3L3KB 3FOLB 3C09B 4YFLF 1EHXA 1S9WB 5DVLA 1HSAA 1HH9A 2XY2A 4ODWB 1JYVA 3QQ4A 4NO0B 1LDPL 4I4WB 3WFDL 4Q97A 2DBLH 3VI4E 3EYOA 1BQLH 3FFCD 3OJDB 3NFSL 3TEUA 1U8IA 4ODHL 2VLLB 3O3BA 4DGYL 3FOLA 4RFNC 2HMIC 3OR7B 1S9WA 1NGZB 1XGRB 4MLSA 2H26A 3KR3H 4P2OB 4PGCB 3TNNA 4MQXD 2VL5B 3CD4A 4YXLH 4ODWA 4N8VG 4NWTH 4NO0A 4I4WA 1F90L 2UV3A 4TVSa 1J8HD 2VDKL 4LBEA 3OJDA 4PJ8D 1QSFB 2DQTL 2NTSP 1RVFH 2E9WA 5HD8C 2Z35A 4PJGB 5DMGD 3UAJD 3OR7A 4WFFD 5C07D 4X4XB 3R4DA 4PRHD 1XGRA 3VD9A 3WL9B 4IMLB 4PJBE 1TENA 3T0EE 1N4XL 4P2OA 4PGCA 5L8KB 4J3XA 4ODXB 4MMXC 4NRXB 4DK3A 2VH5H 2O5YH 4FQPA 1QSFA 3LQAL 5D7SL 5C6TH 3TCXA 3S96B 1RJZB 2XN9D 3AM8C 1A4JB 1OLZA 2FJHB 3PGFH 3PHSA 4XVJL 5GSVA 1B6UA 2OTWA 3QDME 3WJLA 3WL9A 3MRMB 1JL8A 3UTPD 4F3FA 2VLKE 5MERB 2C7UB 4ODXA 4K2UH 4NRXA 2UWEE 3UBXB 2F5BL 4JO1H 4UT6L 2CO6B 4JO3L 3UEZA 2V2XB 1RJZA 4ZFGH 1MHCB 1BQSA 4QCIB 1CG9B 3MRMA 4L5FH 3BRFA 2HKHH 5DHXB 5MERA 1JGDA 2C7UA 5J12C 4MA8H 1YY8B 3QCTH 1J87A 2DDQL 2NY6C 4E5XA 3DI2B 3SGKC 2V2XA 1CE6A 2GI7A 4P9HC 3TF7C 3SE4A 4KVNL 3FZUC 5KAQF 4KROD 4PRNA 3GNML 1T2QL 3CX5K 1A7PL 1M7DB 1LDPH 3BPOB 2AXGA 1YY8A 1DN0B 5BV7B 3NFSH 3INUL 4LNVA 5L6YL 2YRZA 1CLCA 1EVTC 5C8JB 1AD9B 4DGYH 1ZGLA 1IM3B 3TWCL 4AEEA 3TN0B 4YXHL 2QLVB 5INCB 3FN3A 3V8CA 8FABB 1CGXA 2YUZA 1F90H 2J8UB 2VDKH 3CDGB 2DQTH 1QBBA 3MNVB 5C8JA 2XKNA 1AD9A 2CIIB 4UBDC 3DVNA 1IM3A 4I18C 3DNKA 3IXAB 4YIQB 4G8FB 5DD1L 3TN0A 1N4XH 4MS8D 3CLEL 5INCA 2D7NA 5E9DB 4Y0GA 8FABA 3FTGB 3S4SG 2DLHA 2W59A 2J8UA 1QNZH 3DMMC 3CDGA 3O0RL 5D7SH 3ES6B 3LQAH 3ARFB 4EBQL 3UTQB 4LL9A 3IKCB 1MCHA 1HKFA 3EJJX 3IXAA 4G8FA 5CUSL 3V4PL 1SVCP 4I2XB 4DFHA 3IDJB 3MLUL 2WP3O 3QXWA 4K8RL 2OQJB 2MNUA 3VFSB 3ZSSA 2UYLA 3FTGA 4L3CB 4ONGL 3BPLB 1J10A 2CKBB 4MWFB 4JO3H 3RY4A 3ARFA 3KWWB 5D5MB 2PYEE 3UTQA 1XIWD 2VDOH 4G8IB 4U33A 2FH6A 3IKCA 2J6EL 3D3VB 4NSKB 5JA9A 4PLJD 5C3TA 1Q9LB 4I2XA 2VDNL 3HPJB 1ZGLM 3L9RA 4G5ZL 3IU4H 3VFSA 3HE7B 4PJGF 4L3CA 1P4IL 4QYOA 1SEQL 2BP3A 4MWFA 2DDQH 3L5XL 5HGHB 3B5TA 3MROB 4OB5L 3VFTB 1LEGB 1XCTB 4L1HA 3JWDL 3KWWA 5D5MA 3DJ9A 4G8IA 2FGWL 3PGDB 1OCWL 3D3VA 4KVNH 4NSKA 2HLFD 4RRPA 1T2QH 2H8PB 4KJWC 3UTZB 3U0WL 5DJ2B 1K3IA 3ALXA 4M5ZL 4G8EB 1P53A 4H25B 3LPFA 4NNXB 4PJ9D 5HGHA 3T3PE 4NQUA 3VFTA 1I1CA 1XCTA 1K6QL 4PP1C 4JFYA 4PYHA 4FG6C 1UT9A 4R96B 2ZUVA 3TWCH 2YPKB 5L7XL 1U3HC 4C54A 2H8PA 2YPLE 3QUMA 5HDLA 5DJ2A 4FQLL 5D7IE 1NC4D 1C8PA 4G8EA 4H25A 3UTTE 4NNXA 2VLRD 2APBA 3CSBA 2L4OA 5DD5L 3RA7H 4JFEB 4TTDC 4P2QD 3O4OC 1JZ7A 5CSGA 5DD1H 1XT5A 4RBPH 43CAB 2VLJE 3GUTA 1CD9B 2AI0L 1MSPA 4KK6C 3CLEH 3MBEB 2AV1A 1WWWX 3OKEB 4BZ1L 3LMJH 3MYJB 5C09B 4O9HL 4K71B 2L7JA 4O51B 4KH2A 3SQOH 5L2KE 5C3LD 3ILQD 3G04A 3O0RH 3EO0A 4B5EA 3AS1A 4PRIB 1OQXA 3K1KC 3CIQA 5FOBB 1BQUA 1ZLWH 3HRZB 5CUSH 43CAA 3U82B 3V4PH 2EDHA 1UM4L 1Z0MA 3QG6B 1SJVA 3U2SB 3MBEA 3VWJD 1UG9A 3MYJA 4YAQB 5HYFA 4NYLA 4ONGH 4PRBA 4Z7QE 1A6TB 3D0VB 1XMWA 4PJHF 4XTRD 4HULB 3CXDL 4MD0B 4NQDB 3SGJC 2JJSC 3BN3B 3RWIA 5FOBA 1BFOA 2LFGA 3HRZA 5SWSB 2VDNH 1CFVH 4GBXB 5FDYA 3U2SA 4G5ZH 1I7RA 3WHXA 4JFZL 4YAQA 3VFWB 1TQCC 5EC1B 3WFBL 1TNNA 3L5XH 4OB5H 3D0VA 3QIUB 4MD0A 1DBMH 1JF1B 2PO6D 4WEBL 2B39A 5E2UL 1R3JB 1DBJL 1OCWH 2EZ0C 1LO4L 2BVTA 2CDEA 4KMTL 5SWSA 3U6RB 3IDGB 4GBXA 1GZPB 1XF1A 3U0WH 3OGOE 2J1KA 1QRNE 3UC0H 1LP9B 2ESVE 4M5ZH 4GXVL 4WWKC 1U9KA 1K8IB 1JPFB 3CDYA 3QIUA 1BPVA 1K6QH 2FIKB 5F6IC 1QFWM 4EKXA 1R3JA 3OAZK 1JHLL 3I9GH 3H2WA 3S5LG 3U6RA 2A38A 3J8F7 1OGAA 4P9ML 1RZJC 4FQLH 1LP9A 3BWUC 4QRPB 2MOVA 2CUMA 1G6VK 4LLAA 2G2RB 3SDCD 1K8IA 1JPFA 2P4AB 4FQ2L 3BWAB 3TVMA 3BQUB 2FIKA 4OBRA 2EXWC 4HKZB 4ODUB 3IFPB 2AI0H 5CEZD 4U2YA 3D5OF 5C9JA 1E6OL 4HIIB 3KG5A 5TQ0H 4BZ1H 1RUPL 4O9HH 4OUUA 4PUBL 3ARGC 5ACZA 5EBGA 4OZGE 4QRPA 4D0CB 1UWXH 3HN3A 3BWAA 2YZ8A 3BQUA 5SWZE 4WI9A 3BN9C 2QQQA 3VDAA 3O3EB 1N3NB 3FN0H 3IFPA 4RDQG 1UM4H 3SDXB 1DUZB 4XPBL 3WLWC 1MFDL 4HS8L 1TCMA 1DQLL 1A7OH 5J1AB 4U0RB 4IJ3B 2JJWA 1CXEA 3LS5L 3WNOA 5MENE 3O3EA 2UUDK 1C5DB 3SDXA 4H0IA 5HDBF 2ZUUA 2K3TA 4LRIC 2VAJA 4NC2B 3WFBH 5J1AA 3RAJL 1J0YA 1BF8A 4WEBH 5HSFA 3ULUC 5CLWA 5E2UH 1DBJH 4L9LB 2DM3A 4P48A 1LO4H 2DJSA 1U3JA 3DSFL 3V5DB 4U31A 3REVB 4I1NB 5FUOL 3DUUB 4YDLC 2P7TB 1G7HB 1KIUA 4OLZL 1HHJA 3GSVB 4ZNEE 3X13A 5EUOE 4AENB 1EEQA 3ALWA 4L9LA 3IDNB 4JPVH 1T3FA 1JHLH 5CBAA 1FVCB 3V5DA 5C0ND 3REVA 4I18A 4LLWA 3MRQB 1JE6A 3F7YB 1BVKB 3DUUA 5KTEL 1G7HA 3A67H 3LDBB 1JPGA 3MOAL 4XAKD 4ENEC 1FNLA 5KSBE 1IGIL 4M5YL 4PJFE 4AH2B 4ZFZB 3QFJD 4AENA 4UILL 4UU9A 2F53D 4YC2C 1J0HA 2RR3A 4H1LA 1FVCA 4EVNB 3VMOA 2KQNA 1RZ7H 2FEDC 3VJ6A 1IQWH 3MRQA 4PUBH 3F7YA 3BXNA 2DWEA 4GLRH 4AH2A 3AB0B 2P5WB 3JV0A 3S88H 1IEAB 2Z8WC 2ZZUT 4P5TC 3HB3C 4EVNA 5GGVL 2R56H 2JIXD 3V0VB 5EU4B 3B9KD 4HMDA 1MI5D 1DQLH 7CGTA 3ZE2F 1N6QL 4KWUA 3CVHH 1YEKL 4O4YL 4Y89A 2P5WA 5K9KB 1ZVSB 5EBLA 4OIBA 25C8L 4PJXE 1XGPB 1KPVB 2FB4L 5FYJD 4QHLB 4XRCB 3M8OL 3UYRH 2BRRL 5EU4A 5DMIH 1BWWA 5F1KC 3RAJH 4PS4L 2COQA 2K7PA 5CGTA 3ARYA 2E7LC 4UT9H 2XG4A 2ZOKB 4WU7B 3V7MA 2WBJA 2J6EA 2YZ1A 2OZ4L 5I1EL 1UM5H 1ZVSA 1UJ3C 1WITA 1UZ8A 5LQBL 3DSFH 4L8CA 4JZOB 1XGPA 1FZKB 4U0QB 4QHLA 4YX2H 4XRCA 2BNQD 3GBNL 5FUOH 2DI8A 4TNVK 2CLVB 1JNNL 3LKSB 5D7JB 3ULVH 4WI2A 5L9DL 2EH8L 2ZOKA 2BNUB 3RX7A 3SCMA 5SX4H 1U41A 4LMQE 2NY3C 4JZOA 1HQRA 3GSUB 1S5IL 2CLVA 5KTEH 4KFZC 5D7JA 4O2FB 1UJTA 2BFVH 1IGIH 3VFUB 1DBBL 1YPZE 3SJVB 4Z7OF 1YDPB 2BNUA 4HBQA 5IFJB 5FFLA 3GSUA 2R0WL 1AHWB 1QD0A 5C9KA 3I3EA 7FABL 1RZKH 4O2FA 1ITCA 3GO1L 2EYTB 2GJZA 3SJVA 1OP9A 5C86A 1EEUA 5F8QC 4RMQA 5I8EB 5T1LB 3GJFB 1LDSA 1XR8A 3NFNA 5T1MA 5IGXL 5IFJA 2AERT 3MFFA 4L8BB 5JW4R 3O4LD 3O6LL 5HHMB 1IM9D 2APXA 5B3JE 1N6QH 3GKZA 1TZHB 3TBVA 2EYTA 4O4YH 2JELL 2NR6D 4F9LA 1WZMA 3KHOA 5T1LA 3GJFA 1UEMA 4R26H 1L0QA 5J1SC 1MCIA 1MHPH 3QDGB 1Z3GL 4HBCL 1L6ZA 4L8BA 4Q2ZB 4WEMB 5KJRH 4PS4H 3Q2CA 1QLFA 2VISB 2IBZX 1TZHA 2KPNA 1QFUL 2XZCL 1CXHA 2F54D 2OZ4H 3FCTB 5I1EH 3GMQA 2V2WB 3VXSA 1MNUL 5DQ9B 2P42B 3QDGA 1GGUA 5CJBA 4PPTA 3GBNH 3ZYOA 4KHXL 2R1WA 3P73B 4Q2ZA 5FYLE 2DBJA 1IGTB 3WNMA 1I1RA 2VISA 5D96C 1KN4L 2EH8H 3MUJA 2YRLA 3IU3B 2HH0H 4PRPD 3ZSTA 4B7IA 3BGAA 1P7KB 3FCTA 2V2WA 3DLQR 5DQ9A 5E94B 3JWOC 4JM2F 2EYRA 3P73A 2RB8A 3SE9H 3F65A 4AK1A 3JUYA 1IGTA 5IROC 4NKDB 1MCWM 4LVNC 4NO0D 5AUMB 2H32B 1I8LA 3KLDA 2J12B 1P7KA 3U4EB 3O6FC 1EK3A 2FX7L 3MRFA 4PB0L 3I85A 1JZ8A 4WHDA 2IF7A 5E94A 2IADB 2R0WH 5E24E 1MCLA 3K0WA 5JXEA 3QDJA 4NKDA 1V3JA 5JZ7C 2H32A 4X7SL 4K3DL 4JREB 4IRJA 3W11D 3U4EA 2CRYA 5DUML 5IGXH 2ENYA 3QUZB 4PJAA 4F8TA 4ZSOB 4XBGB 3FFDA 4KJYB 3S34L 1PG7X 5T3XD 3O6LH 2X7LA 1UKQA 3GMMB 5F1IB 4J4PA 3BIKB 4R2GB 1ZVYA 3DXAE 1SBBA 3E3QE 4J3SA 4OLWH 1BFVL 2Z92B 2Q3ZA 4OD2B 1XZ0B 1TVHB 3QUZA 4EI5B 3MJ9L 3BD5A 4KTDL 1I9JL 4HBCH 4XBGA 2HTKC 5IJVA 4KJYA 1WFOA 1D9KB 4FFVD 4OLVL 1T1WA 2CQVA 5F7HA 5F1IA 2XQBL 3V0WL 1QFUH 2XZCH 1FDLL 2NW2B 3K2MC 3O2VH 5D72L 4FFWD 4N0RA 1W8NA 3MJ7B 3RGVB 1MNUH 1BBDL 1TVHA 4J8RB 1YJDH 4P23B 4P2CG 4KHXH 1KLGB 1BJMA 1MHHB 2IAMA 4KZEL 3U1SH 2FNBA 5JMOC 1KN4H 1TZGL 1J1OL 2NW2A 2NX5A 5FV2A 1BWMA 3GK8H 3WS6A 4PY7B 1HI6B 2R2BA 1PG7L 1I3GL 3MJ7A 3RGVA 5D1XB 1IAOB 1VESA 4ZXBB 2FSEB 2R9HD 3QUKB 2VR4A 4XPFL 5DEZA 1KLGA 1MHHA 4YHYC 5DUBB 4HXAL 5IW1B 3TT1L 5ISZB 2DQUL 4AEHL 4LARH 4PY7A 1HI6A 1R5VA 2GTZA 4MNHB 1PYWA 1F6LL 2ZCLL 4TVPD 5HYIA 5D1XA 1IAOA 4HPYL 1WJ3A 5JDSB 4ZXBA 3BGFB 3QUKA 1FAKT 2Y23A 5EU6E 1OLLA 4P5TA 1FC2D 5IW1A 5ISZA 4ZO6A 5J3HC 4Y4KC 1F13A 1MAKA 4K3DH 4X7SH 5D93C 5HPOA 5CP3A 2MTPA 4MNHA 2QSQA 4YWGL 1E6JL 2P5EE 2R29L 2PNDA 3BPNB 5JDSA 2R4RL 3S34H 3QEQB 3HUJE 1TTFA 1BQHB 2R0ZL 5E9DD 1EA9C 3CJJA 2R2CA 4U1MB 5E2TH 4IDJL 3ZTNL 4M03A 4AQ1B 4ESKA 1P4BL 1C1EL 1BFVH 3QHFH 2E7LA 2R4SL 5C0EB 4J3VA 2J4WH 1I9JH 2QKIB 4G43A 5F89B 4BSVB 3QEQA 4P59L 3LKNB 4OLVH 3WEXB 4U7KA 1WGOA 3OAYH 5MEQB 2EDDA 2XQBH 3V0WH 1OD7A 1FDLH 3D9AH 4M7LT 1NEZA 4JFFE 4U1MA 5D72H 2GHWB 1CVRA 3B6SB 4RZCB 5B38A 1BBDH 4OZIE 2CRZA 5C0EA 4JQIL 2QKIA 4K9EC 3HNSL 4KZEH 3W0WA 4FQQB 3B43A 1M7XA 3HE7D 5FK9B 2GEEA 1MAML 3MXWL 1J1OH 4CVXB 4F80A 4IRZL 4Y4FD 4N0CC 4ZO9A 2XTJB 4FNLL 1I3GH 1UADC 3B6SA 2JCCE 4HJ0D 2OTPA 1EHNA 2YWZA 3T0EC 3KLSA 4M3KB 4KRPC 5EIIB 4OCLC 3TFKC 4XPFH 4GG6A 1L6XA 4YQXL 5M95B 3QAZC 1RMFL 2NMSA 5A2LH 2DJ4A 3BESR 1I85C 4KQ4H 5FK9A 4AEHH 4CVXA 1CBVH 1LILA 3KPPB 1GC1L 3RVTC 1F3JB 4F8QA 1QZ1A 3E1F1 4YHKH 3QZWB 1CGVA 4F9PA 4GRLC 3OF6D 1CCZA 3L5IA 3WS3B 2ZUQC 3QQ9D 1N59B 3QUYB 3U9PH 1S7SA 3BSZL 3GKWL 4NZDA 3KPPA 1DJSA 2X40A 5I73C 3ULVF 1ZHKA 3VDCA 4LHUA 1E6JH 4JFED 1P1ZB 2X1QA 4QHNB 1QFHA 5C0CB 1MRCL 3EYVB 4J2XA 1I7TA 3X3GL 5C7XL 1CZ8L 4HWBH 1P9MA 3TCLA 2D7TH 3VH8G 4F7TB 1FFNB 3MBED 2AJUL 2FX9H 2R0ZH 2DLGA 3HAEG 4X0KB 1N59A 4XNZB 5C09D 1L0XA 4H8WC 3OKMB 1EXUB 5JOFB 1BJ8A 3ZTNH 1P4BH 1C1EH 3G9VA 4PRID 4QHNA 1P1ZA 2VAAB 5C0CA 3EYVA 3FT2A 4CKVX 5FUCE 5DQDH 3KJ4C 4P59H 3FOMB 4F7TA 1FFNA 3QEGL 5AYUL 3WN5B 3T08A 1MCDA 3P11L 4L1DA 3V9FA 3FFCE 3NIDE 1MEXH 3OKMA 1EXUA 4XNYL 1HWGB 1IKFL 5HHOD 4ZPVB 3DECA 4NQDD 4JQXA 2VAAA 4CBPA 2AXHA 4JQIH 4ZFFB 1A64A 2APWA 4V1DB 3HNSH 3OKLA 3WN5A 3TA3C 2EDKA 2AW2A 3O9WB 4TSCH 5JIHA 4HD9A 1IJ9A 1J8HE 1YYLL 3MXWH 3PQYD 3HE6D 4B53A 5IW6A 1FAIL 1R3HB 1O0VA 5F9WC 1MVUB 1RUML 3QIUD 2D4FA 5C07E 3D69A 3IJYB 4PRHE 5FYJU 3N0PB 4V1DA 2QQLH 5DJCA 5F93C 1NC2A 4Z77A 1MWAH 1EEYB 5HVWA 2AJSL 1AGBA 2DYPB 4I0PC 1NBVH 3MSPA 4NQVB 2FO4B 3W2DL 3WO4B 3LN5A 1GC1H 2XN9E 1DANU 3ZYIA 1K4DB 1KCLA 1MVUA 2OBGA 1DE4B 4RAVA 4ZNCD 5SX5K 4YHNB 1EHAA 2OTUB 4RA0C 5C0BD 5M94B 2BOBB 3G9AB 3RP1A 1YEFH 5J06A 1U8LB 3FQUA 1WQVT 4GQPH 5IVXB 2DYPA 1CYGA 4HAGA 4JDTL 3GKWH 3VFNB 4HFWB 3SE3A 4NQVA 3PP4L 3GSWB 4HJJH 1ZHBB 4PY8I 5TE7L 3VE0B 1MRCH 5C7XH 1CZ8H 3UJIH 4YHNA 2OTUA 3FJTA 3G5ZB 3IDMA 2BOBA 4WGWB 2A83B 1URLA 4CAGA 1X44A 2AJUH 1BAFH 1U8LA 1G9NL 3P2TA 1F11B 3VGGA 5IVXA 3OB0H 3TGXA 2GJJA 1DQDH 3VFNA 3MRDB 4PJCB 3V6OE 2A1WH 3WFHB 2AXJA 1ZHBA 4OQ1A 2VYRE 3LD8B 4N8PA 3VE0A 2FBJL 2ICES 2ICWI 1ZT7A 3PUCA 4M48H 3G5ZA 3QEGH 2A83A 1AC6A 2IANB 5ANMB 2AV7B 1BZ9A 3SGEI 1F11A 4MHHG 4WTZA 4NKQB 5IVOA 4XNYH 3ORJA 3MRDA 1IKFH 3WFHA 1CTOA 1HHGA 4GH7B 1EHLH 3MJ9A 1CDYA 3C5ZA 1FG9C 4NOFA 1X6LA 1BM3L 3IDUA 4KJQC 5D2NE 4OCRL 4LVEA 3NIFF 5ANMA 2AV7A 4XI5D 4J3TA 5D70H 1OTTD 4P2YA 2W0PA 3WKML 1D5IL 2HP4A 3MRBB 5KVMC 4GW4B 3UPRB 4Y5XA 3QUXB 1ACYL 1Q0XL 2QQNH 2BC4B 4XVUC 5CAYB 2ZUXA 3HNTL 3QHTC 2AJSH 3MLWL 3HR5B 1CXLA 3HKFA 4OFYD 4NHUB 5F71A 1QFWH 1Z0NA 1EZVX 3MRBA 2XXMB 1B6DA 4GW4A 5EO1A 3UPRA 3W9EB 3QUXA 1R3IL 2BC4A 3RL1B 1ES0B 2YMXL 4NT6B 4OFPA 5I15L 3RVVD 4Y16B 4M1DL 5IHUL 4JDTH 1JRHI 2HRPL 1II4E 4ETYA 5FYKL 3PP4H 3C6LB 1VFAB 3C5JB 4RFOL 3VXPB 2EDBA 2XA8L 3QHZL 4KKCC 3W9EA 1Y6NR 4FOMA 4KK5C 3UJJL 3RL1A 2FYYA 2WZPD 1G9NH 4Y16A 5D6CB 4GAFB 1JZ6A 4P9HL 1JGEB 1HDMB 1H8SA 1VFAA 3VXPA 5IBLC 4AL8L 4ETQB 3S6CA 2XNAA 1T6WA 2FBJH 4PJEB 4O2EB 3JVGA 2A74B 2DTSA 2C4FU 2L0DA 4HF5L 1FVDA 3JWNC 1NH6A 4WU5B 2NNAB 4BJLA 4HIXL 5D6CA 1JGEA 1HDMA 2WWMD 4BQ6A 2H2PD 4LCYA 4MXQC 5KAQG 1H5BC 4X6CF 1CGSH 3WHE1 4JM2D 3BD4A 4O2EA 2A74A 3G5VB 3N1GC 3ECBA 5GGVY 1ZANH 4Z7UF 1KLUB 5D1QB 5EWIH 4OCRH 3PHOB 4WFED 4WU5A 1VEMA 2Y6SC 4YZFE 1R5IB 3RI5F 2A6JB 4PJ7E 1SYSB 3WKMH 4S10A 4P2QE 2HVKB 4IIQC 1Q0XH 1S78C 5DFWH 5AZEL 3G5VA 4PJCF 4PYGA 2NY1D