1GGCH

Major antigen-induced domain rearrangements in an antibody
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
215
structure length
215
Chain Sequence
b'QVQLQESGPGILQPSQTLSLTCSFSGFSLSTYGMGVSWIRQPSGKGLEWLAHIFWDGDKRYNPSLKSRLKISKDTSNNQVFLKITSVDTADTATYYCVQEGYIYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A-KAPPA 50.1 FAB (LIGHT CHAIN)
publication title Major antigen-induced domain rearrangements in an antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 35
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1993-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ggcH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ggcH01
2Z93B 1T5XB 1NCBL 3MA7B 4WTWA 4FQIH 3VFOB 1V8HA 1WEJL 4NWTH 1S7UA 1S9WA 1IQWH 3T65A 4XWOD 1N64L 1QQDA 3I50H 3VFRA 4P46A 4LGSB 3P9MA 3NZ8B 4CN6A 4V1DB 4ZTPH 1JMXA 3JV6A 4XMKH 1F11A 4KUCF 3KPRA 2ZSVB 4APQA 5IEHA 4NCDA 4S1SL 4XPBL 2ORBH 3JUZA 4JRYA 1RUPL 3NFSH 3TN0D 3JSSA 3QWOB 2BP3A 4LAQL 5KN5B 3QIBC 1NFIA 1RZKC 4G9FE 1CBVH 5T1LD 2EYRA 3GMPA 1Q94A 2VH5H 1QEWA 3PP3H 3LKPB 2Z8VC 4YIQB 1X4YA 3GMQA 3D18B 3EDDA 2VAAA 4B53A 4HIHB 3UTTA 1A5FH 2OLDA 1ZT1B 5EIQA 2OTPA 4ZODA 2AS5M 2ZKHH 4S0TD 3X13B 2FX9H 2YA0A 2GSIA 2QSCH 4S1DC 1HXYA 4MA1C 1R6VA 3OHXA 2VDNL 4BSVB 1T0MB 3MJ8A 1QR1A 4MCZA 1CS6A 1B9ZA 5DMJB 3EJZC 1G9ML 1MFCL 5C92A 4ZXBA 5GGTH 5IHBA 1JHTB 2HJFA 2WBJA 2IF7A 4J8RA 4EDWH 5FA4B 4HJGB 2FX8H 2VSDA 4FXKA 3PIQB 2DMBA 3KXFD 1IGYA 5IQ9B 4OAWB 5A43C 4GLRH 2NY1D 3U79A 5IF0A 4KK8C 3LHPH 4XPFH 3N0PB 4OZFG 4ZNEA 5DA4A 3WCYA 2IQ9H 3QJFB 1D9KD 2J88L 3FMGL 3U9UA 1S7VA 3DVIA 4H26A 3ILQD 5FYLH 4UILH 1XGPB 4XHQA 5E99H 3PQYB 3GI9H 1G1CA 3OSKA 1HQ4B 4FG6C 1A6UL 4X5LA 3VW3L 3TF7C 1VPOH 1BLNA 1KB5H 4ZUVB 1QSFB 3SKNB 2BDNH 4K3DL 5FECA 1DTUA 5J3HC 4W6WB 1SQ2N 2IBZX 3WIIL 3QHZH 1TZIA 1MFBL 3QUYC 2APVA 3U30B 2A73A 3BH9B 1ZLUH 4PV8B 1X5KA 4G6AD 5E2TH 1BF8A 3BI9X 3G5ZA 3MXWL 4HQQL 3SCMC 5JUEL 3U0PB 4LGRB 1OT1A 1IAII 3RWGB 1NANI 4F8TA 2I5YH 4MDIB 3V5KA 2XPGA 3LS5H 1WZMA 5HHNB 3LEVL 5HGDB 2RCSH 3TM6A 3SQBA 2UVFA 2JLLA 4PRDA 3ETBF 3OKEA 3TPUB 1WAAF 3P3YA 3UJTH 2GFBA 3G6AB 1OW0C 5E2VL 4I3RL 2W9EL 4AENB 3P4OB 3N1MC 1C5BH 1K2DA 3MRBA 4U1JA 5E8OB 5CHNB 4OCSL 2J4WH 3QDJE 4KTEL 5CP3A 4UT6H 2B1HH 4JFFE 5GS1B 3O45A 2X1PA 3ARDB 3BSZH 4HC1A 1CF8L 4XCEB 12E8L 1IGML 2BSSA 1IVLA 2VITB 1QD0A 1XF4A 4M03A 3EOAB 1G1YA 5GIRA 2FATL 4TUKL 3PHOA 1OP3H 1QBLH 4HT1H 4PYHA 2DQGH 2WQ8A 4J2XA 3KYMA 4NHUA 2YD8A 3QXDA 4OFDA 3NCCB 2BNUB 2X4RB 1S7SB 5E00A 3ZYOA 1HYSD 4NUJB 3G04A 3MYJB 4CAGA 3PWPE 5MERB 5SWQA 5AD0B 4NZTL 3GKWL 1K85A 1NAML 1XF5A 2VLJA 1M71B 4H0IA 1OM3L 3C6LB 2AXFA 4YK4B 5KSUA 4MJ5B 3QHTC 4PJ8C 2ZP0T 3QXUA 4AM0A 1QFWL 5D93B 3O9WB 4B7LA 2FJGA 2NXYC 4KJQD 2YWZA 3BP7B 1LE5B 1TVBB 4JZJC 5FHAH 4P48A 1UENA 1YPZE 3ARVA 4JDVA 2IPKA 1BIIA 5CSBA 3MJ9H 1ODAA 2B7DT 4OZFB 1O0VA 4AIXA 2P5ED 2V2WA 5D1ZD 4NJAL 1OTTD 4YFLF 5FHBH 3NFPB 2BHUA 4NNPL 5IR1B 1R0AH 2D7QA 2BRRH 4X8JA 1OP5K 5IMLA 1IEBA 2GK0A 2RIKA 2QSTA 3LKRB 3HE6D 5DR5L 1BFTA 4G8IA 1KB5A 3V95A 1FSKC 4AIOA 5KJRL 3GI8H 3EYQD 3AS3A 4FP8H 2XRAH 4H1LA 1OLLA 4NN5B 4KK9C 2EIEA 3GRWH 2VXSH 5EA0L 3MV9A 1I8KA 5JDSB 3V4VH 4ZS6C 2H9GB 4X5WB 5CCKH 2EDYA 4JFEE 4LLQB 1FIGL 4O58L 4JAMB 5DD3L 1JYXA 4KKAC 4JFHE 5CEZD 4Y4KD 1G7JA 1J5OL 3MNZB 1FFNB 4L8SC 3IFPB 3MRQB 4XP6L 1CIDA 1IFHL 5E2WL 2HFEB 4PJIB 1UXWA 4QEGA 1PQZA 2WZPD 4Z0XB 4I3GA 4JPVH 4YO0A 4EJ1C 3SDAC 3WMSA 2EIBA 5JHDE 5ACZA 1BIHA 3P0YH 2QEJA 4GKZB 2F54B 4JQVA 4M6OL 3BMVA 3RRQA 1YEDB 5HY9B 2NQCA 2DIAA 4OTXH 1QO3A 3HG1D 3RVWC 1WFNA 4IRJB 3D85A 1ZLSL 1QLRB 3QAZB 1HE7A 5DD6B 1H15A 5IIEB 2L7UA 3REVA 5D7KD 4GAJL 1W0WA 4O5LL 3C5ZB 2V17H 1MRDL 4X7CC 4YHML 3OJ2C 2NTFB 5CSZA 4YXKL 3TH2T 4NJ9H 3NIFF 3AS1A 1R3LB 4G6KH 4P3DA 3SDDD 1JZ6A 3G5XA 5F6HJ 2G2RA 3ULUC 1JHLH 1F45A 3V6BR 3U0TA 3MCKB 1DCLA 1CGTA 3DETD 5D72L 4PJ5E 1X4XA 1KPVA 4P4KD 4AQOA 4WEMB 2HT2C 4PLKC 2F53E 3EYOB 1I1CA 3L7FB 4ORGA 4CDHA 3BX7C 3W2DH 3RAJL 3RDTD 3V4UH 2ESVE 5F7MC 4ALAL 2R56L 1AY1L 1INQB 1K8IA 2QADB 1F3JA 2OQJA 1DFBH 1VFUA 2VUYA 1FYTE 1DBJL 3BQUC 4POZC 3FOMB 2ED9A 1HSAB 2C4FU 3ZZ1A 5J89A 3ULUF 3N85H 2VQUA 3HAEA 3WD5H 4MVBD 3RVWD 3BPNC 2EE6A 1VKXA 1X7QA 2DMCA 3MBEA 3GMLA 1IT9H 2PO6B 4QXWA 3UPAA 3RU8L 2BCKB 3CVHL 1JPFB 1AJ7L 1A6VL 4OGYL 4Q9CA 5HDQL 2J8UA 4AT6B 1OAUH 2GSGB 3GHBH 3PXJA 4JFYB 2XG4A 4DZ8A 1NFKA 4WHTA 4CMMB 4MAYD 4X4MA 3VDAA 3GB7A 2H41A 5EU3B 1KJ3H 3T09A 5IOPB 3TESA 1CL7I 1CE1H 4XRCB 4M8VA 5DA0B 1AO7E 1KLFA 3TJEH 1UA6H 3IXAB 5KZCD 3MRJA 3C6SA 3MACL 3GIZL 4M1DH 5C0AB 2EDEA 2G5RA 3BVNA 4PREA 1HQRB 3IFNH 2WP3O 4LAJH 3WYRA 5JOPD 1INEH 2X41A 4MNQE 5F9JA 1ZVSB 1VFAB 5FCUL 4FQ1H 2Z31C 4JFXA 5AWNH 2YSSA 3D9AL 4OFYA 3RWDA 3U2SB 3NZHH 3O6FB 3S35L 2D31B 1Q9KA 1WV7T 5MEOB 2MOVA 4EVNA 1N6QH 1ZMYA 4YHZL 3UO1H 5F93C 2OZ4A 2PTTA 3VXQA 2RQ8A 3B43A 3ECBB 5D1XA 2F8XC 1R5WB 5DZNA 1GL4B 2DQIL 4DKFL 3CSGA 4OI9A 4U1SA 4K94C 4O4YH 4HGWB 2R9HD 2IQAA 3AREC 4J4PA 4QHKJ 4WI9A 4DGYH 3BWAA 2VXQL 4G8EA 4F7MA 1EA9C 4JHWL 4NQEB 5CP7A 4IRSA 4ESKA 1QSEE 3QG7L 4NO5B 3U83A 4Z7QF 3O6MH 1T21A 3QUYB 4Y4HC 1X6NA 3AMKA 1MCDA 1U8JB 3E2HB 4ONHA 1E28B 1F4YL 4QY8A 1N59B 5JZ7D 4HUXB 4WO4B 3QO0B 2VC2H 2BY2A 3SCMB 3QI9C 1C5DB 4Y1AA 1EFXD 4KDTC 4HZLB 3T0ED 4JN2A 4HAFA 4PGJA 3FFDB 3WNNA 5GJTH 2I9TA 4O9HH 4RAVB 4U6YA 3DURA 2DIJA 5TE4H 4ODWA 1EAJA 2XZQH 2WNGA 4DW2H 4UQ3B 1A3LH 3V6ZA 1DN0A 3CLEH 4RGOH 1I7ZA 4WEBL 4ZUTA 3SDCD 2KKQA 2HMID 2UZYB 2FWOA 5B8CA 3ROLA 2VYRE 2JIXA 3L1OL 3KPQB 4OV5B 3UBXB 4OCXL 5T33L 3BKCL 3U4EA 1T1YB 1AXTH 4PLJC 1H3PL 1AD0A 3FQTB 1D5IH 1NC4A 4UV7L 4KVCH 3V52L 2YN5A 4EN3C 1BBDL 3BPCA 4I2XE 3RBGA 2BSRB 3WE6A 2DQCL 1HWGB 4Z5RB 2OL3B 5EOQH 5T3ZL 2A74B 3MPCA 2W0FB 1DLHA 1WICA 3A67L 3PE9A 5HHPB 3QA3A 1A3QA 3KPPB 2A1WH 3QPXH 2CR6A 5IVXF 4UBDD 4UOJA 1ZSDB 4QXGH 4O2CB 3HTLX 2NY6D 4L8BA 1XAUA 4PJ8B 4XPTH 1QTYT 5I17B 2VB5A 4GH7B 2XQYK 5DEFB 5DDHA 2HYMA 1UH2A 1WQVT 5HVHC 4JZJB 3U4AA 4GS7B 5FGBA 3FZUD 4HK0A 4WFGD 2Q76B 3VI4F 1IZKA 5JOFB 2EXYC 3RVVC 5EU6B 5FB8A 3S6CA 1Z9MA 2QQKH 1FLTX 6FABH 3NAAL 3WDIA 1DQJA 4AL8H 1J0HA 4PLJD 2E7LA 2QSVA 3BP4A 3T2NH 1WLHA 2B8OT 2D9CA 1QFOA 2C1PB 5FKAB 4XCNB 1OCWL 1EX0A 4HFWB 4NQSA 3IB4A 3PDGA 1T1WA 1MIEH 4GXVH 4Q74A 4YXLL 2NLJB 4JFZL 2DYPB 4N0FA 4KI5C 1U3ZA 3LRGA 1LO5B 1ONQB 2ZOKB 3UZVB 3WIFB 5FV2A 4P9HH 4OLVH 3UAJC 2WUBL 4LLWA 4LPVA 4HGMA 5KW9H 1SJXA 2EDFA 1XZ0B 2P45B 1UQSA 4NO3A 3B6SB 2HT3C 3PWVB 5EBMA 2AJXH 5AG8A 1EDQA 4PJ9C 1JZ3A 1HDMA 4WU7B 4I18C 1FNSH 1DBMH 4X7DC 2GY5A 2OR9H 4F33A 3F7QA 5CZXD 2ZSWA 3UTTE 2X9YA 3UTPE 4KRLB 2NY2C 2QKIB 1CDUA 4G42B 5IKCA 1CLCA 2XY2A 3O0RL 4X6CA 3EW3B 4Z77B 3OKDB 2XIDA 2R2BA 3ZKND 1AR1D 4RA0C 1UM6H 2R0WL 1F02I 2FGWH 3MOAL 5L88L 2JELH 4LARL 4BH7A 3AB0B 1CD8A 1CXFA 3U4BH 1BECA 5JORB 1YYML 1UVQA 1RZ8A 3BP6A 1HNGA 5FA3A 5I9QB 3TLRA 4N1HB 5ANMB 5GRZA 5GGQL 3IVKA 1SEQH 1Y18A 1U3HA 3KJ6L 5FUOH 5E24E 2VLKE 3QCVH 1FL3A 4N5EC 1FCGA 2YBRA 1CG9A 3H9ZA 4RGMC 5BS0D 4WNQB 4HS8H 4ZUUA 3PWLA 3C5SB 3D0LA 5IM7B 3SJVB 4CKVX 1KJ2B 2JB5L 4I0PA 4K2UH 4FNLH 2Y36H 3Q1SH 3ZO0A 1MF2H 2BHZA 3CX2A 3BZ4B 3GZKA 2BVPB 4I77L 3VWKB 2HAZA 5AUMB 4HKZA 2HH0H 4IEFB 4MNHA 4RMUA 1JF1A 5I16B 1P4BH 4OLWL 2IMMA 1LP9B 2V5YA 3MRFA 4GBXC 3T1WA 5ADPL 4QGYA 3TBTA 4R0LA 4LNVA 1JWSB 1UFUA 3G08B 1FVEB 3KHOA 3VWJA 3HS0B 3BQUB 2AEPL 4JO3L 5LXGH 2IEPA 5CUSH 1U91A 2X4OB 5D2LE 3FFCD 4FXGA 2XN9A 3VGEA 4U7SA 1A1OB 4IS6A 4AK1A 2V2TA 4XTRD 3HPJA 4P2OD 1DZBA 2FO1A 1MJ8H 3GJFB 3VXSA 4TOYL 2W0KA 1ND0A 4Y16A 4UDTA 1I7UA 2HKHL 3MBXL 2ITCB 2AV7B 5DVKA 4RMQA 1HCFX 5HPMA 3W0WD 4HJJL 2HVKA 5FGCB 5ITBH 2XTJC 3K46A 4F15C 5EPMA 5LGHL 1FLRH 1TTGA 5EBWA 3BP5B 2B0SH 3OGCA 4XXCC 1JNNH 4MYWB 5CFHA 5A3ID 3RTQD 1ZT4B 3L5IA 4ERSH 2H32H 1MCQA 4PRBB 4UB0H 1YN6A 4K55A 3IXTB 5D1QC 4XCFL 1PG7L 5E5RB 4WCYH 3EOBA 1NLBL 2P24A 4ODVL 4Q9BA 5D8JL 4M7JH 4DUWA 5A16A 3FB6A 1J0ZA 2IH1B 1DBAH 2R0KL 4OZIA 3UYRH 4PB0L 4QT5B 2D4FA 2R1WB 1U8IA 4QO1A 2A6IB 5EOCL 5D6DC 4YPJA 3FB8A 3QUXD 3E3QC 2FJHB 5F21B 4XVUD 3OG6B 2Y23A 3AU1A 3IDJB 3D48R 1RFDL 2AEQH 1OSZA 1NAKH 3IDNA 3IJSB 1H5BA 4L4VD 1MH5A 4HS6A 3S36X 3MV8D 3O8XB 2XTJD 3R0MA 1Y0LB 3JV4A 5EO0A 4KJPC 5DUPH 2DJUA 4UZGA 4LVHC 3QT2A 3MRRA 5F6IC 2XWJA 5EBLA 4Y4HB 1S3KL 4XBGB 5DJ8A 4EUPA 2YD9A 4R96A 1RJYA 2JK5A 4Y2OA 1A7NL 1KPRB 1AGFB 3T0WA 4XNQB 5HYJB 4U1IA 5D1QD 1H3WM 2R4SL 1F3RB 4LHUA 4XWGH 3LMJH 3H3PL 3V0AC 1EGJL 2XWBB 1G6RB 3BKMH 4I5BA 2VXVH 4MMZC 1CLZH 1AGBA 3DVNA 4XGZA 1MIML 1T4KB 2BSTB 3FB7A 5DQDH 1KXQE 1OP5H 2AVGA 3K2UL 1NGQH 4ZS7H 4IIQB 3D25A 1DDHA 1M05A 4O2EB 1KGCD 1A9BB 1IBGL 2X7LA 5IVXB 4FQXC 1XGYL 1A22B 2LVCA 2AJYH 4WFFD 4J6RL 2CDGA 1FL6A 3GK8H 3IFLH 5BMFL 5C07B 3WUWG 4DVRH 4N8CL 4EN3B 2AK1H 1N5AB 4JG0L 1J88A 4OCMC 4GMTL 5FDWA 3FO1B 5C1MB 1A6PA 4KZEH 1J18A 3BRFA 1OSPH 5I1IH 4HF5L 3MLRH 4K07A 3U48A 1AGEA 4XMLH 2CO7B 3R06B 3LKNA 4NZDA 1IAIL 1T2JA 1UWGH 4JO1L 1SJHA 4JEGB 3QDJB 4X4YB 5GRVL 5DF0A 4D0DB 1UEYA 4P3CH 5C0JB 1B3JA 4XT1C 3QULB 4NKMB 1JHKL 4CJ0A 4K3JL 3MJGX 1KLUB 3SDYL 3TEUA 1P9MA 3DARA 1S7QA 2F74A 1J1OL 4PJBA 4M6MH 4PR5B 4BUHA 1CFTA 4X7TB 2VWEE 3W9DA 1CQYA 1NCTA 4EXKA 1JK8A 4PRNA 4L3ED 1NCWH 2OX5A 5K93A 3VCLA 4JKPH 5C8JA 3PWPB 2E3VA 1IMHC 5BVPH 3QUKB 1BZ9B 1JI1A 3M1BB 4JG1H 3RPKA 3T2QA 2J5LB 1XR8A 1B4JH 3BE1H 1R3HB 4OGXL 3JVGA 2Z4QA 4RNRB 3PQYD 2NXZC 3UBXI 4JDZB 3VFTA 3AC0A 1AE6L 4AYFA 2Y6SD 1WBXA 4FQJL 4G9DA 1U36A 3MXVH 3N50A 4BZ2L 3LSOA 1J05A 2Z8WC 4AIZA 4D9QD 1F6AA 1QSFD 4P5TA 1YPZB 4TSAL 3O2WL 4X4XB 4X6BA 2NY5L 4KK5D 3EZ8A 4FZEH 2H2SD 3WBDA 2QR0A 3K4DA 3K81A 3WS3B 1TETH 3BIAX 4BFIA 4YFLI 3GHEL 2DLFH 5HJ3B 4Z7UA 4OFVA 5EN2B 4P46C 1OPGH 3DHJA 4PJ9B 3BHBB 4PRHB 2J8UE 2J7LA 3MGTA 4EQ3A 2EIZB 1FNEA 5GS0C 4RISH 2IANB 3TJHC 4AEEA 2BXYA 3LRSB 4W68A 2E9JA 4JY6A 4OF5A 1F6FB 4OKVB 2PYFA 5DJXB 3RUGE 1CFSA 4GRMB 4YHPB 4JFEB 1WC7B 4DN3L 1GVIA 5FO7A 2CDFB 4XP5H 1V3KA 2BVQA 5KSBE 3VRJA 4LSRH 1N2RA 5I1GL 1T0PB 3EDKA 1NKOA 5DSCA 2NXZD 3S36H 5ESVB 1NL0H 3MA9L 1KTRL 2H3NA 2O5ZH 35C8L 3C9NA 4U7KA 5IHZA 2FR4A 2ZPKH 3GM8A 1AHWA 2AI0H 2XKSA 1T03H 3C5JB 1XGUA 1D3CA 4LU5L 1Z6JT 5LCVL 1PG7W 4NFCA 4RGMB 3GM0A 4OT1L 1IKFH 4N0UE 3C60B 1EZVX 1UWEL 5C0CA 1XR9A 1P7HL 4OM0H 3T0DA 4L1DA 4DK6A 2JCCE 3F62A 5I75B 2LU3A 3DX7B 2GITB 5I15H 1HKLH 4ZTOH 4LPXA 5DK2B 1V5JA 5DRWB 1FVCA 3RKPA 3BT2H 1U8LA 1UB5A 3I3EA 5K9OA 5C3LD 1F2XK 4ONGH 5KS9E 4YX2H 2VKWA 3C6LD 4CNIA 1JYNA 1CWVA 4XNZC 4PUBL 3O9WD 2DQDH 2CSPA 4M7LT 4NBYB 3SDXF 1NBQA 2ID5A 2QQLH 4X6EB 2V9QA 1AKJA 4R7DB 1EMTL 4QXUH 1FFPA 4U0QB 2YPLA 2HJLB 1DVFB 4PJ5B 1F90L 3U9PH 3I3DA 5D7LE 3TNMB 5I8KL 4R3SB 3SGDI 4R7NA 5IBTH 5DJAB 1FO0H 3GGWB 4GRLA 4K8RH 4O51A 4OLYL 1BVZA 3T4AA 5C0RH 4JQIL 1FBIL 4UQ2A 5FO9A 2NY0C 1RK0A 1HHJA 4LSTL 5KAQF 4PV9B 2OR7A 3S88H 4NP4H 2MHAA 5FO8A 5JQHC 5K9QG 3FL7A 2EKSB 5IBUG 4NOBA 1S78C 1SYVB 3F7YA 4D2NA 5JW3H 5GGRA 4JCMA 4L4TA 5DMKA 5BXFA 4P2RA 4XC3L 2G9HA 2O5YL 3S3PA 1U58A 2QQQA 2E27L 3MRMB 4D0BA 1CR9L 1CXLA 5JW5B 1B2WL 2F54D 3LEYH 3SY0A 4RFOH 5I8OL 4ZYKB 1DBKH 3TIEB 4RFEA 2R4RH 1GZQA 1CT8B 4LF3B 5DUML 3ARRA 2IH3B 3CFJB 5F96H 2ICWJ 2CRYA 2H8PA 4KPHH 5ICXA 5HDBE 4YHNB 4HLZH 4ZFFB 1O7VA 3KJ4C 1XGQA 4JJ5A 4NNXA 2Y5TB 4OLEA 3C5ZD 3FO9B 4MLSA 2FD6L 3P4MA 5DS8A 4LVHB 4NQXA 5DMGD 4JR9H 4YBQD 5CBAB 1FV1A 3PXHA 5F6IB 1KF9B 3KPSA 5IW6B 5DVLA 1UZ6E 3M8OH 5B39B 5GSRB 2PYEA 3KYOB 5DRNA 1DBBL 1CDCA 3GMMB 4RGNC 5F1NA 3Q5OA 5L7XH 4N8VA 5IK3B 4O02H 4HPYH 1RIUL 2ZG1A 5DQJB 5IG7B 4GO6B 2QADD 4LCIH 3D2UA 5JO5A 5T3XD 1HHGA 2WWKT 3VE0B 3I9GL 4YWGH 1EEYA 2EH7L 3BESR 4ISVA 5BV7L 4ZAKA 25C8L 2DBLH 4YEFA 3MRHB 1QSEB 1WBYA 4HV8B 1KCVH 3BKJL 4OQTH 3WFCL 1MCCA 4RMVA 4K23L 2PO6D 4XPHH 4OCYH 3V7MA 4F8QA 1KN4L 1IC7H 1AR2A 2FBJH 4MQ7A 3X3FH 3T0BA 4JVUA 3QNYA 1NUDA 1A14L 3EOTL 3CLFL 1HEZB 2ERJB 2ZCLL 1UJ3B 4QRSA 1EO8H 1DR9A 5HGBA 4G8GE 1UCBL 1NMAH 4XC1L 3DOSA 3C8HA 3QEUB 5GJSH 2ITDB 3WL9A 3RL2B 1EEZA 3MRPB 3GSVA 3MJ6A 4S11A 2MCG1 3VMOA 4RQQB 3U46A 4Y0GA 4JRXA 1BM3H 1T2QL 5IBUB 3BYYA 5HD8D 2FHBA 2O61B 3IS1X 1JI2A 4YHKH 1C08A 3ZKXC 4X6CE 1YDPB 2NY4C 4G8FB 5C0AD 3KYNB 1FORL 4KXZI 4F7PB 4LLUB 3TVMB 4F9PC 3GMOA 5GGUA 3DUSB 2AQ3A 3LDBC 4OCLC 1U8HA 2X44D 5JPNB 1F58H 3QFJA 4XPAH 5CIPA 1I8IB 1KG0A 3QWRD 3L5HA 2CKBA 1ES0A 1BX2A 3H2WA 2EYTA 2YRZA 3DRTB 2LVEA 3VXNB 4PJHF 2PCPA 4F57L 2AK4A 4ZDHB 3TO2B 3O6FD 2UZIH 5DVMA 4DTGL 4KFZC 5IGXL 2DBJA 1DUZA 4M7KL 4GUPB 5I8CA 4NKOB 5I1JH 3RJDA 4KHTH 2A6KB 4JDTH 1QFUL 5DLML 3UTQA 3VD9A 3UTSA 2G5BA 3QFDB 2C5DC 3OJDA 2WAHA 3SKOA 2X4SB 2GK2A 3VXME 3HI6L 2JJSA 4K3HA 4NQED 5C08E 5K9JL 1NCBH 1GGIL 1WEJH 1S7UB 2OK0L 1UADC 5E8EA 1S9WB 3BKYL 5MHSE 3ZHKA 3EYUL 3VXSE 4FTVA 1QQDB 5DT1L 4WO4D 5CBEA 1N64H 2C3VA 2HRLA 4F9LC 1U8QB 1NDGA 5IFJA 4CU8A 3VXPA 3ZE0F 3P9MB 1A1MA 1MFDL 1YNKL 1EPFA 1I3UA 2D7TL 1LMKA 3JV6B 4J12A 1F11B 3KPRB 3FT3A 3VGAC 1IQDA 3ZDZF 4APQB 5IEHB 3C08L 1JTOA 5FUCE 4XH2A 2QJDA 2UY6A 4OZHA 4S1SH 4XPBH 1W0YT 3OAYH 5GHWL 1RUPH 5IW1A 1A8JH 3WNKA 1ZE3C 3FHAA 1NFIB 4LAQH 1KTKE 3Q6FA 8CGTA 1T0NA 2PXYA 4HLZG 3MBEC 4G3YL 1W72A 5H2BA 3QDGE 4YLQT 3GMPB 4N8PA 1Q94B 3EFFA 2DRUA 1QEWB 4KV5F 1U6AL 2H26A 2FB4L 4TNWF 3RFZC 2VLLA 1CFNA 4AEHL 3GMQB 1YZZA 2VAAB 5ITFA 5E4EC 3RA7H 3UTTB 1N6VA 2YXMA 4DVBA 1YA5A 4Y8AA 1K6QL 1CFQA 1N8ZA 4HG4J 5BRZA 5JLZA 1FDLL 2GSIB 3WHXA 1HXYB 2OTUA 3OHXB 3OAZK 1NH6A 4TPRL 3MJ8B 4MCZB 2VDNH 4WW2A 3CH8A 4PJGA 4ZD3L 3GIVA 3E6FA 4ZXBB 1S7WA 5F3HA 5BZWA 1MFCH 4ONFL 5FV1L 4W4OA 4M9OA 1YECL 2HJFB 5L8LB 2WBJB 1JPGB 4F58H 4FXKB 2D9QB 4C56A 4Z78A 5TFSH 1AQDB 1IGYB 1YN7A 2IBZY 5DD5L 5EU6D 4HUKB 4YGVA 5FDYA 5IF0B 4E41D 4KVNL 2DI8A 3WLWD 3H3BC 3GEWB 5C0EA 2QV2A 5GZOC 5D7IE 4HK3N 3CNKA 3U9UB 2AJZB 2J88H 3FMGH 1RZJC 1S7VB 4H26B 3I02A 1R3KA 4L8DA 1AXIB 1BEYL 5ABDE 4L29A 4JHZA 3P4NA 1A6UH 1BLNB 3VW3H 2DYPD 3PJSB 5ISZA 5FECB 4IRSC 3QNZA 1LE9A 4ONOA 1P1ZA 2R69L 1TZIB 5CJOL 4B50A 4GRWF 3WIIH 1CICA 3FTGA 2GJJA 1MFBH 5HYSG 4A2LA 4LCYA 2DKSA 3QEHA 3G5ZB 1PKOA 3MXWH 4HQQH 4DAGL 5JUEH 2EEBA 2XPGB 3W39A 4HMEA 4Z7VE 5T3ZE 3EGSA 1X5FA 3QJHA 3LEVH 2UWEF 5GQBA 2WK2A 4PRDB 4U1KA 3GBML 3OKEB 1T22A 5H94A 2GFBB 4PY7A 2EC9T 2J6EL 4M43H 2W60A 4KROC 1YEGL 5E2VH 3QXTA 4I3RH 1HXMA 2W9EH 1K2DB 3MRBB 1J8HA 4U1JB 1DQLL 1JPSL 3CFEA 1MJUL 1S8DA 4KTEH 2FIKA 4PRIA 3CK0L 4LOUC 1UWXK 1MCFA 3O45B 3RHWF 3VGHA 3JWOH 2X89D 4Y19A 4H0GA 2BSSB 1XF4B 12E8H 1IGMH 2I60L 5B38G 2CRZA 1VA9A 1N6UA 4Z7WE 1NFDA 1JJUA 3NABL 5GIRB 2DM4A 4NC0B 4R4ND 2FATH 4TUKH 3FO0L 3QIWA 3SJVD 3KYMB 4NHUB 3QXDB 4X8XA 5E00B 4FFVD 3WN5A 4TULL 3VWKD 4HWZB 2QQNL 4CGTA 5LGKA 4FFWD 2X1OA 2A6JA 1RUAH 5SWQB 3K4AA 5T3XL 3HZKA 4YQXL 1X5GA 3GKWH 1NAMH 1OVZA 3CU1A 3G6JE 1XF5B 2VLJB 3P9LA 4KDVA 1U8KA 2AXFB 3ARBB 5KSUB 1OM3H 1MVUA 3BD5A 1RZKL 4J3VA 4WWKA 1QFWH 2FJGB 3IDYC 1CGUA 4PJXA 3TZVA 4LMQI 2P4AB 3FOLA 1FCCA 4JDVB 4NBZB 1BIIB 4PJFA 3WLBA 3FQWB 3W5MA 5DFTA 2V2WB 4ZUSA 4LOUD 4M7ZC 5EIIA 4MA3A 1UH3A 3MLYL 3O4LA 3LS4H 4X8JB 2E7LC 5F7NC 4NNPH 3S35X 5FK9A 4YXHL 4OCRL 5IMLB 1IEBB 2GK0B 4U7MA 2VAJA 3BFOA 3F7PC 2ZCKL 4G8IB 3FQRA 1U9KA 4RDQG 5CD5D 1YC8A 2D7PA 3L3HA 4H1LB 4KUZL 5I1EL 2C3XA 5JMRA 2D7OA 4OBSA 4NKIL 3HG1E 5EORL 2D2OA 3WFBL 5DJYA 4PJAF 4R4BA 3MV9B 1I8KB 5EA0H 5D7KE 3EJJX 4N68A 3ZKXB 4DFIA 1V3LA 4G9FD 1L6XA 2WINB 4O58H 3ZT7A 1FIGH 5DD3H 2FEEI 2H6PA 1G7JB 2BOCA 4DEPC 4YBLB 3RI5K 1ZA6A 1J5OH 2P8LA 1IFHH 5C0IB 4P23C 3K3QA 3L3OA 1PQZB 4MZ2A 1MJJA 4LRNL 2DM7A 5LWYL 3T04D 3FQNA 1RHHA 1Z9SA 4YO0B 5CJ5A 1MEXL 3QCUL 4HIXH 2HJKA 4WV1C 2XG5A 5GRVK 5ACZB 5F7UA 1DJSA 1HILA 2BVTA 2P5WA 3Q5TA 4M6OH 4M62L 4Y4FB 4ZPTA 3NA4A 1G7IA 1QO3B 5DHVA 1TLKA 3D85B 1FAIL 4ZG1A 1H15B 2GYSA 1ZLSH 3WO4C 1W0WB 3QUMA 4HDIA 3O8XD 3ZKMC 3ZSTA 5B38B 4GAJH 2EICA 4G43A 5IMKB 5CSZB 4O5LH 1MRDH 4YHMH 3WXVH 4YXKH 4LDOB 2B1AL 3T2OA 2PUQT 4L3CA 3ZDYE 1U3HC 3QHFL 2IPTH 1RUML 2OBGA 2FX7L 2G2RB 4UT7L 3LB6D 3ARGA 3U0TB 4X83A 2BVUA 3WHE1 1Q0YL 3WIHL 2YPLE 2DN7A 3QCTH 4JFDA 5D72H 1NCNA 1KPVB 3RVXD 2W92A 2E7BA 3BOVA 3WXWL 4ORGB 2ICWA 4KK6D 3CGTA 4TNVK 3RAJH 1HH6A 4LCCA 3CUPA 5I66A 1UB6A 3B5HA 1F3JB 3DYOA 2OQJB 3TWCL 4ALAH 2R56H 1AY1H 3X14A 4U2ZA 4R0LC 4UIKL 2HWZL 4YHIB 1OY3B 4OI8A 5TQ0L 1DBJH 3IJHB 1FFQA 2XWTA 3HAEB 4MZ3A 1HI6A 2E8YA 5IVOA 1VKXB 1I9IL 1KBGL 3MBEB 5A2FA 3GMLB 1UT9A 3IDMB 4QWWD 1S5IL 1RQ5A 4LVNB 3RU8H 5F7DA 3CVHH 3NVQA 5C07D 3X12A 2PW2A 5F3BA 4L4TE 2J8UB 1AJ7H 1A6VH 1U8OB 5KTEH 5HDQH 2OL3L 5J13B 4DZ8B 4WHTB 1JRHI 5E4EB 1SY6L 3GB7B 5T1KA 3O3UN 1KFAL 2SEBA 5ILTL 3RX8A 4WW1B 4P9HC 1H0DA 1NKRA 2W9DL 1L7TL 1YNLL 1DEEA 3QDJD 3QZWA 1KTDA 3MRJB 4JFFD 5HYIA 5I76A 3CU7A 1IGIH 3MACH 4RX4D 1K5NA 2K3TA 3GIZH 3BVNB 4GQ9L 5F9WC 4UNTA 2HTLC 1A47A 5EUOA 3QNXA 2GKIA 5HGGS 4PJ7A 1R5VB 4MS8D 5F9JB 5J12C 1P4LB 4EI5A 3HFML 5DC0A 3TBSA 4JPIA 1Z3GL 3HMWL 5FCUH 1OB1A 1YMMA 3JUYA 2ZUTA 4GSDL 4JFXB 2YSSB 4M1CC 3RWDB 3SGEH 3D9AH 4L5FL 4GRWB 5EDXA 3T0EE 3KHQA 4U3CA 3PWPD 1M7IA 5F7EL 1Q9KB 3S35H 3VFVA 3U7WL 1WITA 3QSKB 4EVNB 3BRGC 4LASL 4BQ6A 2PTTB 4YHZH 4MDJB 2ATPA 3VXQB 4KI1A 5D1XB 1YY9C 5D2NE 1H5BC 3STZA 4OLXL 4HIIB 4OV6F 4DKFH 2DQIH 1E6JL 5SV4A 3MGAA 3B8SA 5D70L 2IQAB 5EOTA 3GNML 3BWAB 2ZUUA 4G8EB 4W4NA 5HI4D 4F7MB 5CP7B 2VXQH 4IRSB 3PNWB 4JHWH 4R8WH 4OZGF 4Z7NE 5I74C 4PBXA 4OZIF 3ARSA 3QG7H 4PJCE 1J1XL 1YQ2A 1T21B 3RQ3A 4RAHA 1YEHL 1J10A 4XAKD 4ONHB 2HTLD 4QY8B 5DC9B 3I6KA 2E7MA 1F4YH 1YNTA 5C0NC 3TN0A 5DO2D 4PRHD 4Y1AB 4JN1L 4L9LA 4FQLL 4PD4J 4JN2B 3AFLA 1G9NL 5ALBL 3VRLF 4U6YB 3B9DA 3DURB 5T1LA 4ODWB 2CMRL 4WI7A 3V6ZB 4KROB 4JFED 1DN0B 2Q3AA 5I30L 1EJOL 5FEBA 1I7ZB 4ZUTB 3BN9C 4WEBH 2FWOB 4QRRA 3FQXA 5B8CB 1UM4L 4TVSa 4X9FA 3ROLB 43C9A 1OWRM 5DRXB 2VNCA 2JIXB 4X9HA 3OKYA 3UC0L 3ULUL 4HCRA 5EU4A 5C9KA 3L1OH 5F70A 1HCVA 4OCXH 3BKCH 1AD0B 1KEGL 1K9TA 3CFCL 5E4IA 1KJ2L 1ORQA 2KZ1B 3BPCB 4UV7H 3V52H 3C60D 4R4FL 5K59E 3WE6B 1SMAA 4Z76A 2KL6A 3L3KA 2DQCH 2X70A 4TN9A 1DLHB 5H35A 3NCFB 1OGAA 3WKML 1CK0L 1KB9J 3A67H 2Q8AL 1QBBA 2O26U 3QIBA 3AROA 15C8L 3HB3D 4LP5A 4L8BB 2XXMB 5EC1A 2HTKD 2MWCA 3WDJA 3KXFA 1CU4H 3UTSE 4ZNCD 5D5MA 2FEDC 1OTSD 1TCMA 1DP0A 5DDHB 1FGVH 1P9MC 2AQ1A 5B3JF 2F9BT 3DNKA 3UTZA 4HK0B 3RZCB 3O4OB 4F7TA 4HUWA 1NCDL 1DVFD 1NMBL 4M6AA 4PRAA 4PJ5D 2P46B 3MQIA 4RWHA 1QSZA 5FB8B 2F53D 3HR6A 1EUUA 3NAAH 3QXAA 1IAOA 2EDJA 3FT2A 5E8PA 3BP4B 1LK3L 1KNOA 2RB8A 1BJ1J 4I48A 1QNZL 5DI8A 1D6VL 2CDEA 43CAA 5DWUL 1BF2A 3MRCB 2X40A 1EXUA 3VXRA 5JR1L 4KMQA 4JE4B 4NQSB 1XCTA 2K7QA 1OCWH 4AZ8A 4N0FB 4P5TC 4YXLH 5C0BA 4JFZH 2NX5A 4LPCA 3D3VA 1JMZA 1WFUA 2VL5A 4LLWB 2WUBH 2VDLL 2GIYA 4IMLA 4U33A 2FLRT 2ED7A 2BMKA 2EDHA 1T20A 1UQSB 4F7EA 1WZ1L 4NO3B 4LLYA 2CUHA 3DSNA 3B2UD 4PBWD 5EBMB 4YDLC 2XACC 1HDMB 5GGSB 4QF1A 3T08A 3THML 1ZWIA 1MUJA 4FQCH 4F33B 1AO7D 2ZSWB 4HBQA 4OF6A 3QDME 5IKCB 4HJ0C 2JTDA 1GOGA 2EE9A 2OJZH 4X6CB 3RWFA 1I1AD 2R2BB 3O0RH 4KY1L 4MD4A 1FG2A 2R0WH 4BH7B 3UYPA 3OX8A 3MOAH 4MHHG 1TJGL 1A6AA 5L88H 2NW3A 1NGWA 4LARH 1UVQB 1RZ8B 3BP6B 1GAFL 5FA3B 4Z7UF 1YYMH 1AH1A 2BOBA 4AG4L 3IVKB 1Y18B 1U3HB 5JXED 5GGQH 2KZWA 1M7DA 3VFNA 1FL3B 3WIHA 1BFSA 1CG9B 5ACMA 4ZUUB 3PWLB 3D0LB 2V9RA 4I0PB 4YZFF 2Y25A 1VACA 2NZ9D 2JB5H 3BW9A 5CSGA 5GS2H 4HKZB 4WY7H 2MPAL 4MNHB 1JF1B 1OW0A 2E5EA 4I77H 1G6RL 3F65A 1HHKA 4X6FB 1X5ZA 4EQ2A 4QHNA 3TBTB 1BQHG 5ADPH 1TXKA 1Q72L 2KQMA 3VWJB 2P5EA 3VXMB 5D1ZA 3GSUA 1E4WL 1U91B 2AEPH 4FXGB 4JO3H 2XN9B 4MWFB 1FL5A 2FYYA 4QOKA 1G9EA 5C0DA 1QSED 4IS6B 4V2CB 2V2TB 3HPJB 3EJYC 4W70A 3KPNA 3HE6A 3CVHB 4OD2B 3VXSB 3SE4C 4NQCA 3HHRB 4EZMA 4Y16B 4TOYH 4UDTB 5DJCB 3B9AA 1AP2B 5IEKA 4HBCH 4XVJL 2HKHH 4GRLC 3MBXH 1JZ7A 2V5MA 2Y4SA 5ELIA 3LKOA 2WBKA 3L3JA 5HPMB 4PTUB 2WIMA 2HVKB 4QRTA 4L1HA 4JZNA 5L0QB 5EPMB 1KC5L 4QHLA 2D4DA 4BQ9A 4JO4L 2UUDH 1G7PA 5LGHH 1PBYA 3V7AE 3ARTA 3K1KC 5EBWB 1Z5LA 1MCNA 3OGCB 5FOBA 3TVMD 1HK6A 2VZ1A 2YZ8A 2EECA 5JW4Q 5F9WB 4G6FB 5HI5D 4F37K 1JF6A 1S7RA 5KG9B 2ADGA 1YN6B 5ESAA 3QYCA 2EKJA 4PGBA 2N7BA 4LLVA 4Q6IA 3EOBB 2P24B 3LN4A 4XCFH 1PG7H 3VGFA 1NLBH 4ODVH 5A16B 4DQOL 3FB6B 1X5AA 1MHCA 3CFDA 4J3SA 3RIAK 2W0LA 1ETZA 2YD4A 1I4FA 2R0KH 1UWXH 4V1DE 3KYKL 4PB0H 3LH2L 1U8IB 5J1SC 1P5UA 1IM3A 3FB8B 5HI3C 1U92A 5EOCH 3BPOB 3BAEL 1H8OA 3CIQA 4X6DA 3AU1B 1VFBA 1T7WA 1OSZB 3IDNB 3QEQA 1RFDH 2DLGA 1H5BB 2GJZA 5AAWA 3BISA 1MH5B 4HS6B 4MCYA 2WWKO 3ZE1F 4XI5D 5DXWA 4NQTA 4L8SA 4F3FA 3JV4B 3CC5A 5EO0B 4P4KA 4J3UA 1UKTA 5KSAD 2X09A 4M02A 5CKGA 1FPTL 4XAWL 5B4MC 1P5VA 3MRRB 1QLFA 3EYFA 1VHPA 2XWJB 5EBLB 5DJ8B 3NOIA 4EUPB 5L2KA 1S3KH 1NJ9B 3NIGE 1JUFA 1WWWX 1ORSA 3OKMB 4R96B 1RJYB 2JK5B 4MB5A 4NQVA 3HA0A 5D7IB 4JB9L 4U1GC 3T77A 1A7NH 4U1IB 3SE3C 4BSJA 4Y5VC 1RUKL 5C7XL 4AH2A 1MCBA 4LHUB 3OKOA 2R4SH 4YC2C 4YNYA 3H3PH 3CMOL 3VGDA 4I5BB 5ESQA 4APQD 3RNQA 1UACL 1EGJH 3BGMA 3S5LA 1AGBB 2XZCL 3DVNB 2CO6B 3O2DH 3FB7B 1MIMH 1SJEA 4HUMB 3CZFA 3D25B 1Z0NA 3K2UH 3O6KL 3VA2C 1M05B 5JXAL 3DLQR 2XQBL 2X7LB 4PGDB 3ALWA 4N0RA 4K8RC 1IBGH 1MLBA 4OF0A 4NT6B 2CDGB 1XGYH 1FL6B 4J6RH 4J3TA 4IBLT 3DRQA 4R97B 4Y5XC 4OGAC 2EDQA 4JKLA 5BMFH 2CK2A 2H2PD 1U2HA 4JFQB 2Q1EA 4N8CH 5CKAA 4Z7VB 5CGTA 1RZ7L 3UTTD 5FDWB 3UTPD 4CMHC 3L95A 4LBEA 4JG0H 4GMTH 5E1AA 4OFKA 3IRPX 2YZ1A 4MNGA 1MHHA 2OP4H 5D96C 4HF5H 4OCNC 2AAVA 3FRUA 1GCFA 1AGEB 4LL9A 2ZUQC 3LKNB 3K1DA 1FNFA 2WWMD 2YHGA 4OZ4A 1QHOA 1SJHB 2V5TA 4H20L 1IAIH 1NANH 4JO1H 2WIIA 1DUYA 1VCAA 3U7YL 3HE7D 4ZXBD 2VLKD 5IQ7L 1JHKH 2LABA 4K3JH 4GXUN 4P4RA 3SDYH 5I1KH 2C3GA 1S7QB 1KV3A 2WBJD 3WV0A 4FA8A 3UTOA 2F74B 4GKSA 4PJDA 4PJBB 4IJ3C 1J1OH 1CFTB 2VDOL 1NGPL 4K8RD 2RJMA 3W9DB 3B9KC 2LQRA 1JK8B 3S97C 3VCLB 5C8JB 4A6YA 5HGAA 5I19L 3PV7A 1RZGA 4CBPA 1AD9A 1XR8B 3RWCA 3G6JB 1MQ8A 3K4ZA 1EEUA 1BQUA 2Z4QB 3FAWA 4OGXH 5A40E 3VFTB 3F7VB 3E0GA 1LEKA 1WBXB 5C3TA 4G9DB 1UGNA 1BPVA 1EHNA 2GT9A 3LSOB 4FQJH 1J05B 3DUUA 5DK3A 1XCQA 1Q38A 4U0RB 4BZ2H 4X6BB 2NYYC 3O2WH 4TSAH 4GG6E 1EFXA 2NY5H 3F7RA 4OFPA 2XA8L 1Q1JL 2QR0B 4HG4K 3NCBB 4BFIB 2Z35A 2Z31A 1O7SA 3RPIB 3BIKA 5DD0L 2KPNA 3GHEH 3OV6A 4PTTA 2VTFA 1FQ9C 3I75A 3HC0B 3E6HA 3S4SA 3VFWA 1ADQL 3WNOA 3NN8B 1ZT7B 4CW1B 3MNWA 3QUZD 2R1YA 3HCVB 1VGEL 1FNEB 3NGBB 4JREB 1C1EL 2EZ0D 4JY6B 1XGRA 3RY5A 1A4KA 1T66D 3O3EA 4I3SL 4X9BA 3CJJA 4DCQA 2PYFB 3AREA 1SYSA 1CFSB 4N0YL 2F5AL 5FO7B 2BVQB 3UYOD 4DN3H 5JW4R 5HBBA 4NN6B 1J0JA 2H3NB 3IAGC 5IJVA 2ADJA 5IHZB 35C8H 1QZ1A 2FR4B 4MXVE 1AHWB 1YQVL 1XGUB 3QI9A 1NEZA 4XBEH 1ZHLA 4ELKA 5LCVH 2FEEL 1YEEL 4OT1H 3BEWA 3BJ91 4K3GA 4ZO6A 4JM2C 1XR9B 1YMME 1UWEH 4OZHF 1U41A 1JFQH 2EDWA 1MPAL 3MROA 5HHXL 2R29L 1RI8A 5CWSA 3L9RA 5FAAA 1FVCB 1K8DA 4PRPA 4HWBA 4OIIL 2IGFL 1U8LB 1UB5B 4GW4A 1VENA 5D7JD 5K9OB 4N8VG 4YDKL 3CDYA 3ARBD 2YPKA 4CNIB 1F00I 3CSPA 2OXHA 1RUQL 2XI9A 4W6YB 1PKQE 5DHYA 3LOWA 1AKJB 4XNMA 1DQDL 3FT4A 1FNHA 1FFPB 4PJIE 4JM2F 4XX1E 2GUOA 2D0FA 2YPLB 3KS0H 1FGNL 1F4WL 5SX5K 4H88L 3QEGL 3VH8A 5DURB 1F90H 1FG9C 3BH8B 4KWUA 3DVGA 5DHXB 3RIFF 2VISA 5I8KH 2RFXA 4KTDL 4GRLB 4O51B 4XP4L 3T4AB 1W8OA 1JGUL 4OLYH 4TTDC 3OTTA 4PJGF 1A21A 2YD3A 4JQIH 4UQ2B 3WNLA 5JQ6L 1FBIH 2C7UA 3MV9D 1RK0B 3T1FA 1MCPL 1NCAL 5GZNC 5HHVL 1HHJB 2IAMD 4M93B 4LSTH 3MLSL 2MHAB 5DRZA 5FO8B 5LKNA 2VWEC 2P43B 1MJ7L 1GIGL 4U49A 3F7YB 4QRRE 4LQFL 3RWIA 2L0DA 2VZSA 5IMOA 2W65B 4L4TB 3HN3A 5BXFB 5DMKB 4LSVL 1IL1A 4P2RB 2G9HB 4XC3H 2VABA 1U58B 2O5YH 3VMNA 3B2VL 3RGVD 3NIDF 3CCHA 3HI1A 4D0BB 2E27H 5HYQA 3OZ9L 3GSNA 3GSOA 4RA3A 1PZ5A 4TUOB 1HZHL 2VDMH 1CR9H 1B0GA 5KSVA 1JNLL 3SY0B 1B2WH 5DZLA 1S9YA 5I8OH 1GZQB 4Y4FD 5DJ0A 1GZPA 5BZDA 5DUMH 5T3XE 5ICXB 1JRHL 4PFEA 4FXLA 3NTCL 1NGYA 5BS0A 1PDKA 2B2XL 1XGQB 2P44B 4JJ5B 2NR6D 4NNXB 4GOSA 1CL7H 2GAZB 3W11D 5GRJL 3P4MB 3FKUS 5DS8B 4NQXB 3W5NA 4GFTB 2FD6H 1FV1B 3W9EA 3KPSB 5INCA 3O41A 4X0KA 5INDB 4I18A 1TJIL 3NCEB 2PYEB 1CVSC 5DRNB 3QIWC 3CXHJ 3QIUC 4YH6A 3JTSA 1DBBH 5F1NB 4DFHA 5GS0L 3UEZA 4N8VB 3VFUA 1NMCC 1CDIA 3DGGA 2EO9A 1RIUH 3D2UB 3ARFC 3OXRA 5JO5B 3QQ3B 5I73B 1YJDC 4NYLB 1EEYB 5C0AE 3I9GH 4ISVB 4ZAKB 1MWAA 3CX5J 4KKBC 2EH7H 4Y2DC 1NFDF 1WBYB 25C8H 4HK3J 4ODSL 4YHOL 3DMMC 3TZVC 3WFCH 2X10A 1GJIA 2NX5E 2VUOA 3SE8L 4K23H 4X7SL 3W0WA 3D3VE 2J8OA 5BW7A 4MQ7B 1MLCA 4MHHI 3HI5L 1KN4H 3CFIC 3QNYB 1RZFL 2VERN 1A14H 3EOTH 3CLFH 4QRSB 5HGBB 1ACZA 1Z9LA 2ZCLH 3L3GA 4Q58C 3WL9B 1CGXA 1UCBH 4XC1H 2X4TA 4CMHB 1EEZB 3GSVB 1UYWL 3VXTA 3REWA 1PSKL 2ADIA 3QP3A 5D96B 5H37H 3U46B 4JRXB 3RTQA 4QHMA 3VFMA 4LRIC 3IU3A 4PJXF 1T2QH 1JZ4A 2DQHL 4RMTA 3I6LE 2EEAA 1C08B 3N9GL 4WTXA 4PJFF 3MLVL 1P6FA 1WAAE 1IAMA 3C87A 4M5YL 1SMOA 1WBZB 3GBNL 3GMOB 4YDVA 5GGUB 1U8HB 3TFKC 4NQDE 4EOWL 2NNAA 5CIPB 3RKDC 1KG0B 2CKBB 1LNUB 3QUXA 4WU5A 1BX2B 4XNXL 3T3PF 4IJ3B 3MRNA 3S9DB 2EYTB 2ICEB 2APWA 2PCPB 1ZLVH 2WANA 4OFYD 3QPQD 3SKMA 1OF2A 3MV8A 4WTZG 3JBG7 3QISA 5F1IA 4DTGH 3V0VA 5F6HI 3MA7A 5I8CB 4GKNA 5D7SL 3LZFL 4XHJC 3JWOC 4FFZL 5D1XD 1QFUH 4PP1D 3UTQB 4XXCA 3UTSB 1ZOXA 2G5BB 3PWNA 3OJDB 4YDIL 1OTUC 3Q2CA 4J4PD 1Q8MA 4NPYA 5I6XC 2GTZA 3TO4C 5D1QA 3HI6H 4QOKE 3DTXA 2N4IA 3DXAA 4XNUL 5E6IC 5D7LD 1BD2A 3ARGC 1GGIH 2ZG2A 4P2QA 5E8EB 2OK0H 2BK8A 4ZQKB 4NQCE 4ENEC 4FTVB 4RRPA 3EYUH 5CBEB 4UDUA 2X1XR 2C3VB 5DT1H 3ZL4L 3BJLA 1UXSA 5AYQA 3IFOA 4Y1AD 1NDGB 2VLRA 5IFJB 3VXPB 4E5XA 4LKXB 5EUKA 1MNUL 4LCCC 1YNKH 1MFDH 4XBPA 1Z9OA 2D7TH 4NUGH 3V0WL 4QNPF 3ZSSA 3FT3B 3H0TA 1IQDB 5BVJA 1ROWA 1U95A 4U3XA 3LCYA 2BY0A 3C08H 4U31A 2ICCA 2GY7B 5IW1B 2NY3C 3CXDL 5GHWH 1HYRC 4LCWA 1T0NB 2PXYB 4HC1L 1F97A 4J7RA 1OWWA 3V8OA 1W72B 2VLME 5H2BB 4G3YH 1GPOL 4YHYC 3EFFB 2PW1A 3X13A 2KH2B 1LO0L 2B5IC 2W1NA 1XEDA 2H26B 5EU6E 1KCSL 4QCIA 1U6AH 2FB4H 4LIQL 1RVFL 1BAFL 3ARUA 5ITFB 4AEHH 4N0CD 5CGYD 3DJ9A 2Q86A 2A9ML 4DVBB 2BVYA 1T2XA 1CFQB 1BQLL 4ZOCA 1N8ZB 2ZNXA 4JFOB 5BRZB 5GGSY 5JLZB 3AUVA 4LKCB 3HPLA 4NO2A 1LGVA 2DOCA 4BKLB 4C57C 3TA3D 1FDLH 3WHXB 2OTUB 4CDGC 3X3GL 1Q9LA 3AM8C 4U05A 3SN6N 4DK3A 4OAWA 4WW2B 2DICA 4TPRH 5TE7L 4L3EA 3E6FB 1S7WB 2VKXA 5F3HB 5BZWB 4PD4K 4ZD3H 4LSQL 3ZLQC 4ONFH 2DL9A 1BJMA 2ENYA 2NY3D 4KJWC 1YECH 3RZCD 1L9MA 3ALXA 3ULVC 1FHGA 5CILL 4EI5C 4NZRL 4C56B 2VQ1A 3NIFE 4Z78B 1MFAL 3MLWH 4IM8A 1YN7B 1WTLA 4QHKI 4OI7A 3J8F7 1KIQA 3EO1A 4YGVB 5DD5H 1MCLA 1KB5L 5L2KE 5C0EB 3MUJA 4D8PA 4KVNH 3SKNA 1AC6A 4LGPB 4G7YL 2VDPL 2YXFA 4JZOA 3I02B 3GSWA 4L8DB 1TITA 3I85A 4KMLB 4JO2L 5H37G 1D5BA 1DEDA 3O6LH 1BEYH 4L29B 4MX7A 2Q7YA 4M3JA 4XWOC 3P4NB 5TE6L 3KLDA 5IMMA 4PJ7F 3ULVF 5ISZB 5ANME 1MQKL 1TQBC 4MJ6A 3QNZB 1LE9B 4KKLD 3NPZB 3QQ9D 3AXLB 1HINL 3ULUE 1KB9K 1CICB 3FTGB 2R69H 5SX4I 3RWEB 4D9RD 4NDMA 1B0RA 4P99A 3QEHB 3LN9A 4KJWD 3P4OA 2FNBA 3TN0C 1YEFL 1U93B 4MQXD 1WFTA 4WGVB 4L9LC 3W39B 4AQ1B 4DAGH 5C0FB 1GOFA 5DUBA 3WUZA 3H9SA 3EGSB 4WHYH 5JHLL 3BZFA 4U1KB 3GJEB 4WUKL 5H94B 3GBMH 4PY7B 5IB2B 3T3ME 4DUVA 2W60B 3JV5A 5F9DC 1D5ZA 2L7JA 2DTSA 1YEGH 1HXMB 3EYSH 1J8HB 1QBLL 1Q0XL 3QRGH 1ZANL 3CFEB 1KCLA 1S8DB 2DQGL 1JPSH 4U6XA 1MJUH 2FIKB 1INDL 4PRIB 4QRUA 4BFGA 3CK0H 2F19L 4Y19B 4FMFA 5T1DL 3FRPA 1MCIA 3O3AB 2R15A 3MYJA 3D39A 3PHQA 2BX5A 2JJUA 2I60H 1NFDB 1VFMA 4I13B 1RK1A 3EO9L 4B41A 3QIWB 2EDOA 1RURH 4I0PD 3FO0H 2YEZB 1L7IL 4MJ5A 3ZYJA 2QTEA 5FYJL 3WN5B 2OXGA 5AZ2L 5FGCE 4IOIA 4TULH 2EYSA 3QG6A 1LE5A 2A6JB 2QQNH 2EXWD 5F89B 3PL6D 1UZ8B 3HZKB 3MJ9L 3V4PL 3O3DB 4HEME 5T3XH 4ELMF 4OZFA 4YQXH 4PB9H 4S10A 5BV7B 3VWJD 3P9LB 3VXMD 5BJTA 1U8KB 5C08D 1MVUB 2XN9D 2NY1C 3NFPA 1X4ZA 4WWKB 1RZKH 4R2GB 5E94B 4PJXB 2ZJSL 5C6TH 3SDXA 5MHSD 1D9KC 3FOLB 2VJXA 1KXVC 4U3HA 4PJFB 3P73A 3VXSD 3WLBB 3ILQC 5LQBL 4Y16D 4ZUSB 1CQKA 4LFHD 1WZLA 1WWBX 5EIIB 1PEWA 4WI5A 3U82B 1X5IA 3KLAA 2JJVA 3MLYH 2X1WL 4Z7QE 5FK9B 1TPXC 3OBAA 4YXHH 4OCRH 3FQRB 4LLQA 5LJYH 4JAMA 3TNNA 1TTFA 3L3HB 3U6RA 4KUZH 5D5MF 3DGCR 5I1EH 1KCUL 5DJYB 4FQQA 4NKIH 5EORH 3WFBH 4R4BB 4Z8FL 2Q8BL 2DS4A 1F6LL 4PY8J 1T89A 4ZSOA 3I84A 4G6AC 3PDOA 3G5YA 4CADA 5HSFA 4MAUL 3RL1A 3RY6A 2CLVA 3QDGD 3MZTA 2H6PB 2DQJL 2F54A 3QXVA 3EYVA 2P8PA 4G6FD 4WUUA 3QZWG 1ZA6B 1CGSL 1YEDA 2P8LB 1JWUA 5DJ6A 3L3OB 1HWHB 1WIPA 4TYUA 1MJJB 3ZTNL 1SBSL 4KRNA 1OGTA 2YUWA 3FN9A 4R6UA 3FQNB 1RHHB 4LRNH 5HYJE 5LWYH 2HJKB 3QCUH 3WKNA 3RVUC 4PGZA 3LEXA 2CIIA 2OZ4L 1RZJL 3C5ZA 5EZIL 3BGFC 3GMNA 4WI4A 3MV7A 4QYOA 4W81A 4GG8A 4M62H 2ATKA 4ZPTB 4KGJA 1G7IB 1R3LA 2VDKH 5DHVB 1WGOA 3TH4T 3I2CL 4PGCA 2FZ3A 4BK5A 3VXUA 3QUMB 4HDIB 4RAUA 3IKKA 4G43B 4OJFL 5IVXE 3GUTB 4I9WD 1QOKA 1AQKH 3F6LA 2B1AH 1HYSC 4J3OC 5C07E 1RUMH 4YEEA 4BUGA 1RSFA 4N9GA 4UT7H 3S37L 1IRAY 4HIJA 4YE4L 5E9DA 4UOW1 3G5VA 1Q0YH 2VE6A 4XX1G 4BZ1L 3VI4E 5A2KH 3WD5L 1G7LB 1MREH 1G0XA 3WXWH 2ICWB 4KJQC 5MEQA 4LCCB 3CUPB 5I66B 2CD0A 1UB6B 1MFNA 1GOHA 4NIKB 3X14B 4ZOBA 3RVUD 3TWCH 4WHYG 3STBA 1CCZA 1KT2A 3R8QA 1C8PA 2HWZH 4HWUA 5D1ZC 3VG9C 1OTTC 4C83A 2XZAL 3UJJL 4GG6B 5TQ0H 3T0AA 1P4IL 2XWTB 1JIBA 4UT9L 1HI6B 2AJ3A 5EFIB 4HUVA 2IC2A 3HE6C 1SVZA 4V2BA 1I9IH 1KBGH 5E2JA 3TYGH 3EYQC 2BVOB 4JCLA 4YAQA 3CSBA 8FABA 5F7DB 1S5IH 2DMKA 3X12B 2PW2B 5F3BB 4KAQL 1P2CA 3NPSC 2CXKA 3FONA 3P30L 4ZFGL 5T3ZD 4M1DL 2OL3H 5GGTA 5T1KB 1SY6H 4XP9H 5IB1A 3HUJA 4HXAH 1MELA 2SEBB 5A2LH 4BFBD 3OJVC 1KFAH 4LDEB 4Y4KC 3WFEL 1I9JL 2GJ6E 5ILTH 1QUNA 1H0DB 2GCYA 5GRUH 2ZWLT 3QWRA 1DEEB 2W9DH 1L7TH 1YNLH 4KKCC 3QZWB 1KTDB 2O5XL 3G6DL 1ZVSA 4ZO8A 5I76B 1K5NB 2QLVB 1QRNE 4WFHE 4NN7B 4RFNB 2FDBP 4H5SA 4G6JL 4GQ9H 1FRGL 5EUOB 5IWLC 2C26A 3QNXB 4RWYL 4PJ7B 4XAKE 4HFUL 4Q6IC 4C54A 3B5GA 5I71B 4JFPA 3TBSB 4JPIB 3A6CH 3HFMH 1OB1B 1YMMB 1ZLWH 1Z3GH 4PRHE 4GSDH 4L3AA 4ODTL 1IM9D 2X42A 3UPRB 2QHRL 4PJHA 3F12B 1M7IB 3C2AH 2IANE 3OL2A 4L5FH 3VFVB 5F9AC 5F7EH 1ITCA 3U7WH 4KGLA 2ATPB 4LASH 1WSST 3SDDC 1JGVL 5IVNA 3STZB 4F9PA 1LVEA 3DETC 1ZGLP 4OLXH 2XTLA 4NFDA 1PKQB 5EOTB 1E6JH 1I85C 4B5EA 4WO4A 1L4IA 3EHBD 4P4KC 5CZVH 5D70H 3GNMH 1I1FA 5D71L 3KPOA 2PTUA 2WM0A 4U6VH 5KVMC 3KLHD 4KKCD 4HZLA 3EOYG 3RDTC 5E08L 3HLAA 1J1XH 4RAVA 3TYFA 4MD5A 5J1TC 3V5HA 1NGZA 1YEHH 4EI6A 4JPKL 2EDDA 5BO1L 3I6KB 4WFED 2AP2A 2BJML 1Z2KA 3CDGA 3OXSA 4X6DF 4DN4L 1YNTB 3TN0B 3EFDL 4NBXB 1M6OB 4MVBC 4JN1H 1J12A 4FQLH 1EO5A 3ESVF 4UUJA 3Q3GA 1G9NH 5ALBH 5T1LB 3BN3B 3SGDH 1FC1A 1OAXL 2CMRH 5DK0A 5I30H 1EJOH 1H9VA 4GT7A 3MTRA 4QRRB 5MENE 43C9B 4KJYA 2R0LH 4MAYC 4UNUA 1UM4H 3PWUA 4BK4A 4ODXA 1TQCC 3UC0H 4XB8A 3ULUH 3RWHA 4D9LL 2GEEA 3BEVB 4F9LA 4NSKA 1ULVA 3KPPA 1KEGH 1ORQB 5GS2D 3CFBA 5IT2L 3F6IA 3CFCH 1KJ2H 1T7ZA 4TSBL 4ZOAA 4R4FH 4Z76B 3F8UB 5C0GA 1CGYA 5H35B 2X70B 3CPLB 4YGAB 1QHPA 3MJ9A 1OGAB 1H3VA 4MA8L 1TVHA 3WKMH 1CK0H 1HIML 2Q8AH 3QIBB 2Q76A 3LY6A 5J9PA 15C8H 5EC1B 5C09E 3KXFB 4GAGL 3ZE2F 2OS7A 5D5MB 2NY1B 1Y6MR 4E41A 1AKJD 1MCHA 3PABA 3DX9A 3GRWA 3GJFH 5F1OB 1TZGL 1A7BA 4F7TB 2YPLD 4HUWB 4PRAB 3UBXG 1XFPA 3MLUL 3WJJC 1NCDH 1NMBH 4ZFOA 1BD2E 4R90L 4TRPL 5DURD 4P2QE 5HVGB 1V7NL 4XCNA 4F2MB 1UH4A 4LMQE 2R9HC 1IAOB 3FT2B 1X6LA 5E8PB 1KNOB 4I48B 2MKLC 3B3IA 5DI8B 1LK3H 1ONQA 3L6FA 2CDEB 2D7NA 43CAB 1QNZH 3E3QE 3GFUA 3WIFA 1D6VH 4MA1B 5DWUH 4KU1A 2YPVL 4PYGA 2HT4D 1EXUB 5E70A 1KJVA 4MXWL 3VXRB 5IV2A 4JPWL 4X7FC 3QWQB 5JR1H 1XCTB 5DTFA 5JZ7C 3B6SA 3L3DA 3QR2A 4XNYH 5C0BB 4PJDF 3PWVA 1BOYA 2NX5B 5ALCL 3D3VB 2VL5B 3T0EC 1PVHA 1I7TA 4IMLB 2P42B 1GHFL 4L4TD 2VDLH 2Y07L 5DJDA 5T5NF 4Q9QL 1T20B 4F7EB 2E8ZA 3OKLA 4LLYB 4Z77A 4KRPD 4WI8A 5L6YL 1WZ1H 2FGWL 2OMNA 4KC3B 4QF1B 1ZWIB 1MUJB 3KR3L 4K71C 3SDCC 2HMIC 3THMH 1MCOL 5CGMA 3EIFA 4LSDA 3HMXH 3O81A 2V7HA 2CLRA 2X89A 2UWEA 3RWFB 1CDYA 1CVRA 4KY1H 4MD4B 1FG2B 1Q9WA 3OX8B 1C12B 1A6AB 2NW3B 1NGWB 3WO3B 5FYKD 1TJGH 4NQDB 3Q1SL 3SJVA 4ODBD 4YDJA 1GAFH 2BOBB 2BVPA 2V2XA 4PJEA 4AG4H 5AUMA 5J1AA 2Q6WA 1M7DB 1XIWD 3VFNB 3HR5A 3TT1L 4Y5YC 4KXZH 2YN3A 1C5CL 2PYED 4UBDC 1FVEA 2A0LD 1E4KC 5CUSL 5KVGL 5TDPA 2NY6C 4K7FA 1VACB 5IFHL 1A1OA 2F15A 1WT5C 4HWEL 4FQHA 5E03A 1IE5A 4HIEA 1HSBA 2MPAH 1ED3A 1HHKB 1KOAA 1G6RH 1RU9L 2ZG3A 3NFNA 1MJ8L 4QHNB 3WFDL 3FZUC 4HXBL 1BP3B 3SPVA 4HMDA 1YYLL 3JWNC 2P5EB 5D1ZB 3GSUB 1Q72H 1GGYA 3VG9B 4N90E 4ZAKD 1E4WH 1FL5B 2FYYB 4QOKB 4U1HB 5C0DB 3LN5A 3KPNB 3UCRA 3IDXL 2HLFD 4NQCB 5ACLA 2EDBA 5TGBA 1BBJA 5IEKB 1CE6A 1LK2A 5IW3A 3PP3K 4XVJH 3OPZH 1P6AB 1UM5L 3WNPA 4G9FA 3LKOB 3L3JB 3VI3F 1XMWA 4QRTB 2NY5C 4JRXD 3H9SE 4CL7A 4JZNB 2R23B 4MXQD 5MP6L 4QHLB 1ZK9A 2HVJA 4WCYL 2E7CA 1KC5H 4PJAA 1QLEH 1G7PB 2DLTA 2NXYB 1LQSR 4JO4H 5L8KB 2YC1A 3PP4L 3STLA 1Z5LB 3CXHK 3R1GL 3ES6B 4DKEL 1MCSA 2G60L 2WLZA 1BHGA 2UY7A 1S7RB 1OAZH 5CZXC 2ICWI 1G7HA 2ADGB 2P7TA 5ESAB 1CGVA 4UINL 4PGBB 4Q6IB 4LLVB 2FJHA 3UROR 3LN4B 1KIPA 1D5MA 2CQVA 3IDJA 5I1CL 2VIRA 4OM1L 3ZKNC 3NA9L 1AR1C 1FSKB 3CFDB 3LD8C 3CX5K 3IJSA 3V6FA 1ETZB 1EJ6A 4P49A 4UAOC 1I4FB 2EDKA 3MJ7A 4OLUL 4QTIL 3S7GA 4D0CB 4J3WA 1BJ1H 1N5YL 5L2JB 4JHBA 1RV6X 3KYKH 3LH2H 3KPRE 2A83A 3B9VA 1U92B 5EULV 3FB5A 2GQHA 3ARZA 3MODL 5TQ2L 4X6DB 1VEOA 3BAEH 4JRYE 1VFBB 2X4PA 4X80H 1CZ8H 1J11A 2A77L 3QEQB 2DB8A 3UTSD 5EU7C 4XBGA 4MCYB 3ME0A 1AI1L 1J1PH 2DWDA 4L8SB 4F3FB 2EDLA 3CC5B 5C2UB 1KPRA 4P4KB 3F58L 5JW4N 1T6VN 2CIKA 1QFPA 3CDFA 4P23A 2ZUSA 1GGBL 1F13A 1QSVA 1FPTH 3VMPA 1QLFB 3EYFB 4M8QA 3SDXE 3SDAB 5C70A 4UTAL 2R8SL 2ARWA 4WV1A 1XT5A 2HFGL 1CLZL 3HZVA 5L2KB 1JUFB 1ORSB 3RNKA 5F8QC 2AABH 4NQVB 3T77B 1NGQL 1ZLUK 4HWNA 4ZS7L 2DKUA 4JB9H 4KI5F 3QH3A 4AH2B 5LAXA 1RUKH 3OKOB 4IHOA 3VRIB 4XTRC 4LVOC 5C7XH 4P2OC 4YNYB 1CLOL 5ESQB 2ED8A 3OR6A 3RNQB 3CMOH 4WDIA 3BGMB 1CTOA 3IFLL 3S5LB 1UACH 3L3IA 1IGTA 3OF6A 5TJWK 2XZCH 3Q6GL 3B8YA 2MSPA 3CZFB 4X98A 1QRKA 1N5AA 2PXYD 5ID0A 3O6KH 4HHAA 5JXAH 5KANI 2AGJL 1F4AA 1MLBB 2XQBH 3PWJA 5C2BL 3MLRL 4M6NL 5BW7C 3VDBA 2B4CL 1UG9A 3UDWC 5TPWH 4WI6A 5DGRA 5IB3A 3QDJA 2ILLA 1D7FA 1JPTL 4OUUA 2O93L 2DQTL 4ZNEE 4JFFA 4P3CL 4D0DA 4KKNA 2WV3A 1OP3K 1EV2E 4LBEB 1RZ7H 4LCUA 4RX4A 5C0JA 3QDMD 5T1MA 3CFKA 4MNGB 1MHHB 4CVUA 4NKMA 5HVFB 5A3IC 3RTQC 4PIRF 3FRUB 4ZO7A 3MUY1 4LPYA 3D6GA 4NRZA 1WCBA 2W07A 3SHSA 4OZ4B 3BPNB 2WIIB 1DUYB 4X7TA 5DFWH 5J0BA 4CU7A 3D69A 3NCYS 1NCWL 2CLZA 4TNWK 4P4RB 4GAFB 1NBZA 1BVLA 1B4JL 3MRDA 3QUXC 4GKSB 4LVEA 2BY3A 4PJDB 4C56D 4XVUC 1ZKAA 1KIRB 5SWZA 1CXIA 2VDOH 5EO1A 3K8KA 1NGPH 5E9DE 3MFFA 3TBVA 2ZOLB 1R24B 2OTWA 4P57B 4A6YB 1RZGB 2R1XB 4FZEL 5I19H 1AD9B 2GW5A 4ODHH 3RWCB 3TV3L 5CEYA 2X4QA 1ZTXL 4OD1L 4DZBA 4UTBL 3WS6C 1GGUA 1LEKB 1MCWW 2GT9B 2ENSA 3DUUB 4TSCL 1XCQB 4JM4L 5ISZD 1KN2L 1L6ZA 3B83A 4RISL 3W82A 2XA8H 1R3IL 1Q1JH 2Z35B 3MV11 4OZGA 3LRSA 2Z31B 3OR7A 4MLIA 3BIKB 4PTTB 3S4SB 4RGNE 4YHPA 3VFWB 4LIQE 1MAJA 4C55A 1ADQH 4LSRL 2W0PA 4XVTL 3MNWB 4K71B 2R1YB 3TPKA 4U1NB 1PX3A 5I0ZA 3WUWA 3Q0HA 2VDRL 1A7QL 5T5FL 1C1EH 1XGRB 5E7FA 2ZPKL 1A4KB 3O3EB 4YUEL 1EBPA 4HS3A 4DCQB 2VLJE 1SYSB 3AREB 4I3SH 3SE9L 5CJ8A 5JHDA 3MLZL 1P7KB 5FYKL 1J8HD 4N0YH 5CEXA 2F5AH 3DIFA 1D6EB 1IEAB 5EO9A 5HXMA 5J56B 5IJVB 1KENH 2ADJB 1XH3A 3GSXA 3CH1A 3QI9B 1NEZB 1ZHLB 3BT2L 4ELKB 4HUUA 4NM4H 4FHBD 2GTWA 3P4LA 5J8OA 4V1DD 3BEWB 1YEEH 3MGOA 5F9OL 1CGWA 5DFVD 4NKDA 3MRIA 3MROB 4PJHE 5HHXH 1IKNC 3L9RB 3MV9E 1U3YA 3ESUF 1K8DB 2R29H 4OF3A 4PRPB 4R7DA 5SWSA 1IC5L 4GW4B 4OIIH 1NUGA 2IGFH 5EZLA 3BDYH 3Q5YA 3RHWK 4YDKH 2YPKB 4KQ3L 2F53A 3LKSA 4WWKD 1LEGA 4R2GD 1RUQH 5DHYB 2E7HA 3MLXH 4HPOL 2ESVA 2HLAA 4XNMB 3WSQL 4O2FB 3FT4B 5FIEA 4YFEA 5GRYA 1ZGLA 2GUOB 5IUSA 3MUHL 3VD7A 1FYTA 2YOCA 3VH8B 4EKXA 1FGNH 4H88H 3QEGH 3DVGB 3JXAA 2Y6SC 3KLSA 2FCBA 2VISB 4PV9A 4NOFA 2RFXB 1A6WH 1MI5A 4XVSL 1BFOA 4KTDH 1HHHA 1T83A 2YKLL 4KK5C 4XP4H 2H32A 5IBLD 2E9IA 2H2SC 2XXCB 1JGUH 3U1SL 5J6GA 3DX6A 2C7UB 3T1FB 1P7QB 2AJUL 3ZE0E 4PP2A 5JQ6H 3C2SA 1EAPA 3JV0A 1NCAH 4RIRB 5HHVH 3OAUL 5HVHB 5DRZB 3LQAL 3MLSH 3ZDZE 3NCMA 4RFOL 1MJ7H 1TDQA 4OUOA 1FZOA 1GIGH 2CUIA 2CKBL 4WJ5A 4NFBA 3RWIB 5IMOB 3T2PA 1AO7A 4LQFH 2EO1A 5JNYA 1CT8A 4LF3A 4LSVH 4NO0B 3CFJA 4LLMA 1I1AA 3CCHB 4BQ8A 1GC1C 3UX9B 3UP1A 4U1LA 1DQTA 5HYQB 3GSOB 2FLBT 3GSNB 1PZ5B 3X11A 4UAOB 4ZFFA 3OZ9H 4KV5E 4RZCA 1B0GB 2GJ6B 3V5DA 2WMPA 1HZHH 4HZAA 5FYJE 3RVTC 1S9YB 1JNLH 3RWJA 1KCKA 1BJ8A 5DJ0B 2DQEL 1GZPB 3QQ4A 4MNQA 1MY7A 2Y7QA 5BZDB 3VG0L 1BZ7A 3GBLA 4QTHA 2OCFD 1JRHH 1QRNB 3M8OL 2CJUL 1NGYB 1BGXL 3IRZA 5TH2B 2B2XH 5L7XL 1DANU 4LNRA 5GRJH 4KZDL 4IRZL 5LVEA 5IK3A 4LLDB 4OGZA 1F42A 3W9EB 2K7PA 5IG7A 1WCQA 4HLJA 4LSUL 4OCWL 5INCB 2XFXA 3TCLB 3O41B 4X0KB 3CVIL 4I18B 2DL2A 4YWGL 1TJIH 1TNMA 3C6LC 4X4ME 4YK4C 3JTSB 5J11C 2NY2B 3SEPA 2YK1L 5D93C 3O9WC 5EZJA 1EHLH 1KCVL 2AV1A 4E9LA 1QSEA 3MRKA 5A1AA 5GS0H 1CD9B 4HV8A 3VFUB 1DQQA 4KDWA 3DPBA 2XKNA 1PFCA 3DGGB 1AGCA 1HNFA 1IC7L 3OXRB 2CRMA 7FABL 1ACYL 3RVTD 2H1PH 4MSWA 5F8RC 4HX1A 3LKQA 1MWAB 3ARDD 4YR6A 3GSQA 3KPMA 1TIUA 1RJCA 4CVXB 1W72L 3QEUA 1AIFB 4ODSH 4YHOH 2CGRL 2BHYA 3MRPA 4ZUWA 1XF2B 2BXZA 1H8SA 4NN5C 3W0WB 3GMRA 3NACL 1MLCB 4K9EL 3HI5H 4QRPA 5DMYA 3L5XH 1MY5A 1RZFH 5GISL 1DQML 2VDQL 1NCCL 3L3GB 4GRWE 5ENWA 1YDPA 5B39G 5MEPA 2X4TB 4GBXB 4F7CA 1IGJA 5HHOA 5T1KD 3D1MC 1UYWH 3VXTB 4NWUL 4WEUD 2AKRB 5JPNA 1PSKH 2OJEB 4QHMB 3RTQB 3VFMB 5HYEA 3IU3B 1KULA 5F7LB 4LEOA 3TC9A 1I8IA 4MGXA 3HC3L 5IJKC 2DQHH 4I2XA 1T89C 4P5KB 2UWEE 1VDGA 1JNJA 5MENB 3MLVH 4DKDC 4GW5A 1OD7A 3RY6C 3HRPA 3SE4A 4M5YH 3GBNH 4ZDHA 3TO2A 1XGTA 3H9HA 4NRYB 2NNAB 4EOWH 4NKOA 3QUXB 2DQUL 5DYOA 5EC2A 2A6KA 4WU5B 2I07A 1F4HA 1YMMD 1EUTA 4Y1AE 4NKQB 3H7LA 3SKMB 1OF2B 3MV8B 3AY4C 3ZDXF 2XTJB 3C5ZC 1PEZA 4F15B 2EDNA 3V0VB 1MAKA 5KSAA 4GKNB 3P2TA 5DMGC 4OIAA 1FZKA 4YBQC 3MRLA 5D7SH 3LZFH 5C09B 4FFZH 3K7UA 1EHXA 3PWNB 4OD3L 4YDIH 4NPYB 1U8QA 5HTSA 2GTZB 4EBQL 2XV6B 5D1QB 1JVKA 5GXBB 3DTXB 4Z0BL 2W91A 5KVFL 3DXAB 1BD2B 1OT2A 4NHCL 4P2QB 4XNUH 1T3FA 2QADC 3V6OC 4P9ML 2MCPL 1KPUA 3ROOA 2IPUK 4UI2A 5EBGA 1A9EA 4UDUB 4IOFD 4EDXA 1UXSB 4POYA 3IFOB 2VLRB 2IALA 3ZL4H 3DROA 4E5XB 2KQNA 4X9GA 5EUKB 2FHFA 3JTTA 3SBWC 4IRJD 4XBPB 3MOBL 3IDIA 1MNUH 3H0TB 2PO6C 3V0WH 4OF8A 5DMIL 5BVJB 2UYLB 5IB5A 3M45A 2HP4A 1U95B 2DD8L 4KUCD 1MRCH 5EU5A 4HH9B 1MCWM 2VN4A 5E56A 5CP3H 2VXUL 1E6OL 1CN4A 4PJAE 3CXDH 4LCWB 3MX0A 4QRRD 3RA7L 5JIPA 3IS0X 4HC1H 1GPOH 2M26A 2PW1B 4NC1E 5E8NA 4JGJA 4HUNB 1ZGLM 1LO0H 4QCIB 1JPST 3S3SA 3DX8A 3SE3A 5HD8C 1AFVL 1KCSH 2P48B 4Y5VA 4OQ1A 4LIQH 1RVFH 1BAFH 3FRPG 5FYJU 2Q86B 5EH1A 4DWHA 2A9MH 3GO1L 3TCXA 3H6JA 3HE7A 3RGHA 2VLKA 1QP1A 1OGAD 1BQLH 1XF1A 1RIVL 1YJDL 3V2AR 1ZHBA 3HPLB 4NO2B 4F58L 3QIBD 1JPGA 5TFSL 4Z7OF 1Q9LB 3W81A 3X3GH 1FO0A 1AQDA 1ZAGA 4FQXB 5IFAL 4ZPVA 4ETQA 4L3EB 3O6FC 5TE7H 4M61A 5M95B 1TZHA 2NCMA 4CN4A 4Y5XA 4LSQH 2JJTA 1C7TA 2AJZA 4D9RE 3HUJF 1KTLA 2EEDA 2I26N 2VQ1B 1WISA 4JY4A 3L5WA 4QKXB 4NZRH 5CILH 5D2LA 3OGOE 1KIQB 3EO1B 1MFAH 4D8PB 5CZKA 3UPCA 3GSRA 3MR9B 4H1LH 3PJSA 1FYHB 1OL0A 4JZOB 4ACPA 4G7YH 4S1DD 2VDPH 3GSWB 2P1YA 3VFPA 5M94B 1HN1A 3VXRD 1A1NA 1D5BB 4TVPL 3D87B 3EJZD 4MX7B 4JO2H 3E2HC 2Q7YB 5KVEL 2EC9U 4EXPX 5IMMB 4WO4C 5C0BD 5TE6H 1F4XL 3MMEA 5KBNC 2NX5D 4MJ6B 2D3VA 3D3VD 1MQKH 4L8CA 3QUZA 2Z92B 2VN7A 1CXEA 2Z9TA 4CVZA 3B9KA 4UV4L 1HINH 3S37X 1HH9B 5KAQG 3IT8D 4M43L 1JGEB 4KK8D 4N1CA 2UZXB 3FO2A 3OB8A 4NDMB 1B0RB 4G7VL 5CJQL 4BYHA 2AQ2A 1LD9A 4LK4A 1YEFH 1JF5A 4Q9RH 1DLFL 5DUBB 3H9SB 5B3NA 3DWTA 2NXZB 1JN6A 1QPPA 4K7PY 3BZFB 3JWOL 5CLWA 1N7ML 4FG6D 3I6LD 5JHLH 2NMSA 3BMWA 4HKXB 2XNAB 4WUKH 2NW2A 2PTVA 1LDPL 3QUML 1IGCH 1D5ZB 1N3NA 2BNRA 3P0VL 4H25A 2XN9E 1D5XA 5J3HD 4IMKC 3DBXA 1Q0XH 4BJLA 1ZANH 4NQDD 3PGFL 4U6XB 5JA9A 1CD0A 3QUYD 4QRUB 3IETA 1INDH 1HHIA 2BFVL 3T65B 4HWZA 5E1HB 2F19H 1RUAL 5T1DH 3PHQB 3D39B 4LPTA 3VFRB 4P46B 3NMEA 3I6GA 3SCMD 3AAZA 1WFOA 5D7JA 1RK1B 4CRPA 4GXUM 1NLDL 4S1RL 5SWZE 3EO9H 3ARBA 5J11B 5I1LA 4OQTA 1NC2A 1L7IH 3LV3A 4H8WL 5FYJH 4IOIB 5AZ2H 2EYSB 4JRYB 3QG6B 4QLRA 1MFEL 4GS7C 5IROA 2VQTA 3V4PH 3IGAA 1SM3L 3FQWA 5BJTB 1A7OL 4Z95L 3HAEH 3LS4L 4QOKD 2EYRB 4MB3A 1NCUA 4UMGA 3WLWC 2LTQC 3SDXB 1YEJL 2ZJSH 3P73B 3R8BB 1PY9A 4NQCD 3ZYIA 3LQMA 3HNVL 5TDNA 5LQBH 2QL1A 3ISWA 4JM2A 4OZGE 3KLAB 4OZIE 2IAMA 2XQYG 2LU4A 5CLTA 5GS3A 5HYSA 3JZ7A 2YD6A 3TNNB 2WINA 5ETUA 1BOGA 1QA9A 1EIBA 5I1AA 3U6RB 1FH5L 2LU7A 4FQQB 3P77A 1QR1B 4XNZB 4PJ8D 1KCUH 4U6HA 2Z8SA 4JGUA 5C0IA 4WI2A 2YUVA 4Z8FH 4KMTL 2Q8BH 4F80A 2NXYD 3P40A 1G9MH 4HAGA 5E2UL 4ZSOB 5BQ7A 2AJSL 3O11A 3VRLE 3RGVA 3PDOB 4HIXL 3G5YB 3SOBL 1SVCP 4CADB 4I9WE 2VLMD 4J8RB 5GSVA 3RL1B 2CLVB 1KSRA 4MAUH 3FJTA 1N4XL 3EYVB 2P8PB 1IILE 4WUUB 5F7WC 5AZEL 2PKDA 2DQJH 3ULVL 1MCJA 4WGWB 1CGSH 4Y4FA 5D4QA 1RJZA 1JWUB 5DJ6B 3TGXA 1T80A 1G9NC 1OGTB 3JWDL 3ZTNH 1SBSH 2XOTA 1TCRA 5FFLA 4GRWH 2BERA 3AB0C 3MRGA 4FQ2L 3LEXB 2CIIB 4KK9D 5B38A 1FAKT 1U8PA 1A64A 3WXVL 5IMKA 2NY0B 2OZ4H 1RZJH 3GMNB 5I9QC 3P9WB 3MV7B 4QYOB 5EZIH 2HFFA 4GG8B 2ATKB 2IPTL 2DTML 2YRLA 4H1LG 4ZS6D 1GGCL 4ODUA 1A2YA 4PGCB 4DKAA 3I2CH 2FZ3B 3QEQD 4KKAD 4M1GL 5SWSE 3QCTL 4K3DH 3VXUB 3KWWA 4R4NC 3BO8A 3KYAA 4RAUB 3H3KA 5F7KC 2A73B 4OJFH 3VDCA 4FFVC 1PYWA 2F5BL 3VWKC 3KDMA 1HOCA 3O3BA 4FFWC 4TQEL 3SDAD 1E27A 4N9GB 2Q87A 4HIJB 5E9DB 3S37H 3G5VB 3V5KB 4QXTA 5L2KD 2E6PA 3AS2A 1UJTA 4YE4H 2VE6B 4YHIA 3INUL 5B3JE 1JCKA 3DVFA 3ULSA 1BFVL 3IJHA 4BZ1H 5HHQA 1CI5A 4UU9A 1T04A 5MEQB 1QYGL 1M1SA 1MI5E 2I25N 5IB4A 1MCKA 4NM8L 1VESA 3IDMA 3CDCA 2IBGA 3KJ4B 1FNAA 1KT2B 4OCSH 4X7EC 4PJEF 3ILPA 2ADFL 2FSEA 5KTEL 4C83B 1LP9F 1U8OA 3NCJL 2XZAH 3MFGB 3UJJH 2RGSA 1CF8H 2AJ3B 1P4IH 1KLGA 4UT9H 5ID1A 4HCRL 3ULUD 4HUVB 3T3MF 5H8DA 4B7IA 3BZEA 5CD5C 3PHOB 2MTPA 4YAQB 1FFOA 4WW1A 1P53A 4PJBE 8FABB 3RUGA 4RGNB 3QIUA 2HT2D 5E5MA 4PLKD