1GGCH

Major antigen-induced domain rearrangements in an antibody
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
215
structure length
215
Chain Sequence
QVQLQESGPGILQPSQTLSLTCSFSGFSLSTYGMGVSWIRQPSGKGLEWLAHIFWDGDKRYNPSLKSRLKISKDTSNNQVFLKITSVDTADTATYYCVQEGYIYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A-KAPPA 50.1 FAB (LIGHT CHAIN)
publication title Major antigen-induced domain rearrangements in an antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 35
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1993-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ggcH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ggcH01
4I13B 2J8UB 1AGCA 1NLDH 3RUGE 5KSBA 5J13C 3GHEH 4JDTL 1FL5B 4L8DA 3MV01 1MIMH 1QFHA 3ARFC 3FB7B 3U7WH 4K2UH 1UGNA 1NANI 2W91A 5F1KC 1QG3A 2V2XA 4OM0H 1B6UA 1PG7L 3JWOH 3K8LA 2XXMB 2UV3A 2VLRE 5MEPA 2EC8A 3BKJL 1H3GA 2EEBA 3RWJB 5E95B 3GMQA 4HUXB 4XCNA 3MRGA 3WJLC 5E8OA 3GM8A 5K33A 4HJGB 4PJXB 5T1KB 3RVVD 4FG6D 2FJHA 2NLJB 4X7TA 4NFDA 2D4FA 5DUBB 1A3QA 4WV1A 4LVNC 4Q97A 2EE6A 4J1UA 4NJ9H 4PP2B 3GNMH 1ORSB 4XCCH 1LO5B 2K3TA 1QOKA 1BFTA 2GJZA 2EE9A 2DB8A 1OWWA 2DMCA 5GRUL 4DZBA 4EEEA 1B0RA 3WUWA 4U1JB 1WLHA 1FN4B 4F15B 2WWMC 1KCRL 3PQYA 1CE1L 3QDGA 1RZKL 1MAKA 1T7VA 2IANE 1TCRB 1ZLUH 5LGHL 3CPLA 3DX8A 4HS3A 1YECH 5DRZA 3V6ZA 2R2EA 4TSCL 1ZGLP 1WK0A 2R1WA 4M7KL 3QBTB 3OB8A 3QAZC 1ZS8B 3LPGA 5LG1A 1RPQA 4EUPB 2BNUB 1QSFD 2YS4A 3VFRA 4PJ7B 5I73B 4PB0L 1LE9A 4U49A 4LLUA 4YHNB 3D69B 4GSDL 1BWMA 1XF3A 3IU3A 1MCDA 3MV8D 5J3HC 2F19L 4GFTB 3S96B 1R3HB 5IF0B 1FVCA 4MNHB 1ZANL 2D03H 2AV1B 2VN4A 2VO5A 5HHNB 1K4CA 1DL7H 5FKPB 5KANG 5EH1A 7FABH 4HMDA 1WBZB 3CVHH 1Z5LA 4OZIE 1KCUH 5I17B 1IGIL 1A2YA 1CK0L 1NGQL 2I5YL 2ZJSH 5IHBA 2LAGB 2OJEB 3T4AB 4LOUD 1YYMH 5I16A 3GMLA 5J11C 2DDQL 1M05A 2XACC 5ALCL 5MHSD 5D6CB 2OXHA 1F8TH 4S0SD 1HKLL 1CZ8L 3T0WA 5F7MC 4JPIB 1TZIB 5DEGA 4JFZH 3T0XA 4EXPX 3BFOA 3C8KA 3FFDB 5J06A 3OAUH 1MFEL 5EO9B 4ZTPH 1I1AC 1U3HD 3O2WL 2AEIT 1BEYL 3VFVA 7CGTA 1AGEB 1RIUH 2EDEA 5D2LA 3F5WA 3TVMD 4GG6F 4TYUA 4IDLA 3NABL 3ILPA 4EI5D 5JIPA 2EXYC 3VFUB 3PHQA 3MBXL 1RFDL 3V6OA 2BY3A 2E9BA 3KPRA 4QRPD 3WDJA 5C71A 3T0DA 1EV2E 1BZ9B 2V7HA 4GRMB 2EH7L 2ZSWA 2Z8SA 2YUWA 3I2CH 3FT3B 4G8IA 2BNQA 4OZGA 4KKCC 2X4QA 3C08L 4XP6L 2A74B 3QO1B 1DQML 2XNAA 3ULVF 4HK3N 1KFAL 1TJGL 3WS6C 5BW7C 4APQA 3OKDB 3QUZD 5HI5D 1N3NA 3K46A 3RY4A 1QFWI 3P4LA 4U7KA 4KJPD 3PNWB 5TQ0L 3FFCE 4BKLA 1F6FB 5LQBH 1BM3L 1G7MA 3PQYE 1DBAH 3QDGE 3U0TB 4PYGA 3MYZA 1SM3L 3ULVD 2NY6B 1MJ8L 2GTWA 4X7DC 1YEDA 1K8DB 4WI9A 2XWJB 5MP6L 1T80A 1TXKA 1UJ3A 1DQDH 5JIIA 4JY6A 4K71B 3BO8A 4NQTA 5DD3H 4HPYL 3RQ3A 5IJKC 5C2BH 2H6PA 4Y4KD 1LNUA 2J1KA 3NCCB 1P1ZA 1IQWL 1QVOB 2HH0H 3DO3A 4NQXA 1AD0B 5CBAA 4Z76B 4XVJH 5KN5B 1K85A 3LV3B 5D6DC 1I1AA 3EO9L 2RIKA 2APWA 1XGQB 3ZO0A 3C2AL 2B1HL 4ENEC 5JW4Q 1ULVA 5H2BA 4OAWA 5IB4B 3TN0C 3RWIA 2ICEA 5TE6H 2PCPB 4CMMB 3P9LA 3GUTB 5B39G 2DRUA 2NY2D 4HIEA 5I1GH 3ULSA 1H8SA 1MUJA 5ALBH 2LTQC 3QWRA 1TDQA 2PYFB 5DJDB 4MXVF 3FN0H 5C0DB 2C3HA 4X6BA 8FABA 3RNQB 43C9A 2MWCA 5FA3B 2EDXA 1NANH 4LRNL 2EYSA 3RGHA 1WZ1H 5AUMB 5EO0A 4JFPB 2CMRH 2UWEB 4Z7UB 4OI7A 1FSKC 3I6KB 2B5IC 1FZKA 5BS0D 5K9KA 1AIFA 2FGWH 3W0WE 2AV7B 1NGXA 2DIAA 4NT6A 3FB6A 4YIQA 5E8PB 1QLFA 2IMMA 3RJQB 4LLWB 1H0DA 5JLZB 1OAQL 2H3NA 4OIAA 4OZ4B 2HFGL 3T0EA 1U8KB 1WT5C 4ZQKA 5FO9B 3O6KH 4TULH 1A1NB 1JP5A 1P6FA 3KPRE 4BFEA 4YFEA 5HPMB 3X14A 4JO1L 1XAUA 3TBYB 5A16A 4E41D 5E2WH 4JANA 3RX7A 4OZGE 3LN5B 1U3ZA 1V7ML 4HDIB 5D1XC 3O6FC 1UC6A 5D9SB 4D9LH 1K5NA 4JCLA 3UO1L 4MQSB 1T83A 2WANA 1TZGL 4QHNA 2A73A 3FO1A 2BVOA 5C0BA 5F6IB 1T1ZB 1Y0LA 3I02B 5D6DA 2YKLL 4L8SC 2LE9A 1T7ZA 1FORH 1LDPH 2BVTA 3OKLA 3BYYA 2AABH 1JYNA 4LLYB 5EA0L 5DJ8B 1AKJA 3TJHD 1OAUH 2VE6B 2OTUA 5KSBF 3SKNA 1WZMA 3LQZA 4G80A 4LARH 1IZKA 2P24B 5IB3B 4WGWB 4TTDC 2EKSB 2R23A 1HIML 4XMKH 5C0FA 2ZZUT 3BKMH 3WHE1 5EUOF 1JRHH 1P5UA 3SKOB 3GJFA 4Q9BA 4H1LH 1Q9LB 1NUDA 2CLRB 2OS7A 2MPAL 2CD0A 2VL5A 4NQUA 2O61A 3BEVB 4GUPA 1DEDA 4F2MA 4X0KB 4H20L 4MD4B 3L95B 2G75B 4X6CA 3RY5A 4RBPK 5DJ0B 1U8HB 5DF0A 4XGZB 5JMOC 2F53A 3TBTA 3BDXA 3DSNA 1JZ2A 2D7OA 3NTCL 1FFNA 4LGSB 2X1OA 1FIGH 4ONOA 1OGTA 3MGAA 5EC1A 2W9EH 3DI3B 1JPFB 4QTIL 5ANMB 4B5EA 3NCMA 4I5BA 4HBCL 2MHAA 1LD9B 4PGDB 4HFUH 3VG9C 2XICA 1X4ZA 4OUOA 4FFWC 1S78C 1F4HA 5BVJB 1P4LB 5HHVL 1A1MB 5K93A 5JORA 4RWYL 2LVEA 3C60B 4NOFA 1T1WA 1LEKB 4TUOB 4OLZL 2CIIA 3LRSA 1R5IB 2HJFB 3MBEA 5I0ZA 1A4JB 4MNGE 2P1YA 2JB6A 1F6LL 4R2GB 4OIIL 1A7OL 1BECA 3BDBA 4GBXB 3TGXA 4ZTOH 3WFCL 4F7TA 2BZDA 3CDCA 1YPZB 4NRYA 2H26B 1IAOB 1X7QB 4N8VB 1OP5K 2VLJD 5J89A 4YO0B 4POZD 3PQYD 3QDGD 4V2CB 4O2CB 1G6VK 4KJQD 1XF2B 1TMCB 3L9RA 4WHTB 3V5HA 3D39A 1HE7A 3LKQB 4GLRI 2P47B 2D2OA 3PP4L 3BP5B 1IGFL 4OKVB 1TVBB 1JBJA 4TQEL 3SDCD 4L3EA 5FA4A 3DO7A 5GS3A 2FH6A 1DN0B 4LDOB 4OT1H 3QEQB 1RIHL 5L9DH 2J88L 2FGZA 2NNAB 3S36X 1H5BC 1A7PH 4MSWB 2WBJB 1CVSC 3IAPA 3ZE0F 2AQ3A 1YUHB 2FB4H 4Y19D 1ZOXA 2KZ1B 2CRZA 4KY1L 4AY0A 4XNMB 3DV6B 3QH3B 2FX7L 5LVEA 1A0QH 3P4OA 5ISZB 5F96L 4NZDA 1RK0A 5AZEL 2Y6SD 4FA8A 3OJDB 3X12A 4OCLC 1ITCA 3C6LC 3HMWL 3SGDI 3SKMA 3FMGH 3ZTJH 4X5XA 2P8LB 2WBWB 1ORQB 1Q9WA 3TH2T 3K3QA 5D2LF 3VRLE 4OFVA 1WGOA 2GK0B 1YJDC 4HK0B 2W60A 1W8OA 5JUEL 5LAXA 3CLEH 5F8RC 4YLQT 5DJZB 4X99A 1L0QA 1OAZH 1YEJL 3L3JB 1LDSA 1A6AB 1OAKH 1PG7X 4YFLF 1RHFA 5FYKL 1S5IL 5JHDB 5EU7C 5J56B 1AR1D 3CJJA 1SEBB 4CN4A 4KU1A 3IXAA 4LQFH 1A6UL 1WBYA 3OSKA 4I77H 3KPRD 4S1SL 4RDQG 2NX5B 2VLKB 3OR7B 1INDL 4MX7B 3T65A 5C0AD 3CFEB 3IDNB 4C56A 5F97E 3BZDA 3C5JB 3CDYA 3NBNA 2BNQD 4P4RA 1KB5H 5GGRY 2G9HA 3ARYA 2G5BB 5DR5H 5HDOA 4ZS6C 1EEUA 3VGEA 3T2NL 2JJSA 1QHOA 4PUBL 1H5BA 4R4BB 4APQD 2VJXA 5ITFA 4PJDA 3DTXB 3BH8A 5C0IB 4LL9A 4P2OA 5HSFA 2BSRB 1QRNB 3GB7B 3DURA 4NSKA 3P0VL 4YFLI 2E9JA 4YNYB 4YDKH 3LKPB 4LVHC 1UB6B 1DVFC 1YEEL 5F9DC 2DQUL 5C7XL 3FO2B 4ZNEA 1Q1JH 1WWWX 1LK3L 2GY5A 4CU8A 2J8HA 4G8GB 3PWNB 5IHUH 5IV2B 2XKNB 1L7IL 1EO8L 1GHFL 1RZJL 4GW1B 1HNFA 2FZ3B 3S36H 1NFIB 4N0UB 4C55A 2NY3D 2ZCHL 1FJ1B 4I1NB 3QDJA 5I1EH 2HLAA 3I6LD 1BGXL 2BVPA 3U7AA 4UOW1 3CSBA 3WO3B 2W0FB 1NDMB 5HHOA 5CD3A 4K9EH 2Q20A 1YDPA 2DJ4A 3TFKC 2XFXA 2XN9A 3BUYA 4MA1C 4PRNB 1SBSL 2QADC 2DLTA 3QDHA 3CCHB 4KAQH 4W4NA 4W81A 3TNNB 4LAJH 3LIZL 1IAKA 4RBPH 4U1KB 2VZ3A 1F3DJ 4JDTH 3MLWL 2VXUL 4MQ7B 4W6YB 2NXZC 2OR9L 4Y4HB 1UZ6F 1VDGA 4GS7B 3V0VB 5FYKE 2X42A 3V5KA 5C9KA 1I8MA 5CMAA 1P9MC 3TCXA 5DMKB 4D9QD 4UQ3B 5HJ3B 1PG7H 4P2QA 3FT4A 2HT4D 2RFXA 4R3SA 5IVZB 4QOKB 1O0VA 3GIVB 2WIIA 5IR1A 1QR4A 3BKJH 3IJYB 4NQDA 3RWHA 4U1IA 3BGMA 3OB0H 1W72A 4MXWL 2IALA 4CW1B 3BPOC 4DGIL 1L0XA 1RVFL 1NBZB 3T0ED 2BOBB 4CVWA 1J0KA 5IG7B 1PY9A 1EX0A 4WW1B 3WEXA 3LDBC 4C83B 5JDSB 3KPMA 3FOLB 4K7FB 3V6FB 1ZEAL 1S9YB 2C3GA 1XF4B 3HRPA 2BX5A 1W72L 4PRIA 5GRUH 3ZSTA 4HS6B 3PJSB 5E9DB 1AXSB 4YBLC 3MGTB 1D6EB 3OXRB 1V3MA 1OP5H 3RVWC 4ETYA 5JA9A 1EEZB 3DGGB 3IS0X 4ZO9A 3ZDZF 4BK5A 2ADJB 2QSTA 3NOIA 2NYYD 3BGFC 5EIIB 1HSAA 5C0BD 1CE1H 2EDBA 4RIRB 3WO4B 1RZKH 4X5WB 2HJKA 5D7JD 3QUMA 3FTGB 2B39A 1A1OA 5E4EB 5JDJA 5LGHH 4F33B 5D70L 1AKJD 4OCXL 3W9EB 4KTEL 2EDTA 2F5BL 4TSCH 4X6CF 4HT1L 5E5UB 4M7KH 3ILQC 3CFBA 1F3JA 5EU6D 3QUML 5L88L 3MJ7A 4ELME 3QXAB 4DFHA 4PB0H 3O8XA 4V1DB 2GTZA 3Q3GB 4S10A 1T1YB 3K2MC 4CU7A 3EOAA 4GSDH 3B5HA 3QQ3A 5I1LB 1S9VB 2F19H 3BZFA 3QDJE 1ZANH 1FGNL 1FVDB 1P9MA 4RISL 3RP1A 3WNKA 2J5LB 4M9PA 2F53D 1EPFA 3QO0B 4Y4FB 2AEPL 2VXSL 3GJFK 5HHOE 3OWEA 1KJVB 3BP4A 3FRPA 1O7VA 1IGIH 1NGQH 1CK0H 2I5YH 3SGDH 2XN9E 3WIFA 3LRGA 3T8XB 5EU7E 2P4AB 1NFDF 1NL0L 4GW4A 1NBYB 2DDQH 3MCLL 3MRIA 5ALCH 3EZ8A 2Q1EA 3B9EA 5H94B 5L8KB 1RQ5A 2X44D 1HKLH 3DIFA 1CZ8H 2AS5M 3Q1SL 5AZ2L 5DA0B 4P49A 1GSMA 4MDJA 4WEBL 3QNXA 1J8HE 1MFEH 1BBDL 4AEFA 5F7FA 4PJ8C 2FHCA 5FIEA 3MBED 4PV8A 4X4YA 3O2WH 4MMXC 4AIZB 3WXWL 1BEYH 1CD1B 1IKNC 3UPCA 5B38A 3HZYA 3WHXB 5FV2A 1URLA 1H3WM 4P4KB 3VWJA 2PNDA 3RWGB 3NABH 4Z77A 1FGVL 4LAQL 3V9FA 4Q6YA 3MBXH 1RFDH 3RAJL 3MNWB 3VWKB 1ZT4A 4BJLA 1I7UB 3REWA 3KPNA 4U0QB 2EH7H 3CSYB 2WINB 4Y16B 5DMIL 2P45B 3C08H 4XP6H 3T2OA 1FCGA 5MEOB 3D39D 1WQVT 1DQMH 5B39B 1KB9J 2A6KB 1KFAH 1TJGH 1CQYA 1GZPB 3GDBA 3MJ9A 3RL1A 4JRXD 4X9IA 4N0FB 4L3ED 4NUGL 3HZMB 4HIJA 4Z5RB 4FXKB 2X1WL 1E28B 5CJQL 4LPCA 5TQ0H 3L1OL 1T3FA 1U42A 1BM3H 1MH5A 1MVFA 4HC1A 4JR9H 4X9GA 4DKEL 5FV1L 3MJ9L 1SM3H 5DJ6A 1MJ8H 2AGJH 2ATPA 4KJWD 4ODXB 3CXDL 3BIAX 3JV0A 3QG6B 3CFKB 5MP6H 1AQDA 2R39A 4IOSD 3O9WC 4DOHB 3IKCA 2EDLA 1XR9B 1B4JL 3KWWA 4HC1L 3SJVA 1KELL 3O3AA 4NFBA 4HPYH 3LVEA 3SDXB 4KRMB 4NKDB 1IAIM 5IMKA 3TO4B 4KDTA 4PGEB 4OF0A 2R9HC 3JTTB 4PJ8A 3QUYC 4TVPE 1U8IB 3EO9H 3D2UD 4BFIA 3C2AH 3NIGE 2B1HH 3UZVB 2XQBL 1U95A 4OBRA 4FQXB 5HVFB 3VFNB 3QDMD 4LQ1A 3PV7A 3G6JB 5IEHB 5I1KL 4NZRL 1RAMA 2VABB 3W2DL 5GGQH 4KMQA 2K9UA 4Y2DD 5DUMH 4MNQB 4NBXB 5I30L 3BQUA 1TQBC 4X4XA 2VDNL 3N85L 4OFYA 4OLEA 3N1MC 3RVUD 4L1HA 4PJ5A 4LRNH 4JZNB 1I7RA 1QSEA 3V5DB 3EDEA 4PJDF 5J8OA 2ZOLB 1XH3A 5E99L 3BIBX 4JVPA 3HE7B 4Z6AT 1TZHB 3IAQA 3JWDC 4C56D 1W0WB 1N4XL 4H88L 1Q8MA 3GSUB 3H3PL 2GSIA 1RULL 5DMJB 4PJHB 4HXBL 2ZNWA 1UEMA 4DFIA 3HUJB 3RVTC 3JSSA 5I76B 4QRSA 2A6IA 2HFGH 3TO2B 3ZKNC 1N6VA 4G9FA 4P2OD 3HMXA 2NXYB 4YDVA 3QIBB 2LV4A 2SEBB 3MMEA 1ZE3C 2HAZA 2LU3A 5I1AB 3CC5B 4JO1H 1UG9A 1DCLA 3O9WA 5J12B 3ZTJG 1V7MH 3CDGA 3F6IA 3UO1H 3O3DA 4I4WA 5DJ2B 2A2QT 1IAIL 3LOWA 1TZGH 4I18C 4P9HL 3AXLB 3O41A 2H2SD 3S5LG 1B0GA 2DWDB 4L4TD 2YKLH 3NZHL 1J0JA 1JYWA 2HG5A 5IWLC 5E2TL 5EA0H 1Q9KA 3R4DA 3QFJA 3HC4L 3MRQB 5JIKA 1VGKA 4PRHA 3QIWC 1OL0A 5EOQL 4HZLA 2DQDL 5MEND 1E4KC 4TSAL 1HIMH 2VDPL 2DKSA 3B9KC 1CGYA 2IBGA 5C92A 1D5ZA 2XN9D 3F7YA 1PFCA 5FO8B 3VFGL 1NCUA 2MPAH 2MQCA 5C1MB 2UZXB 3SJVE 1KJ2B 2Q76B 2A6DA 2PO6B 4P46A 5F9OL 4U6HB 1EJOL 4K3EL 2BC4B 5ID1A 3I50L 3SGKC 1F02I 3BPCA 3VFPB 3GJFH 2IH3A 3NTCH 2DQFA 5I75C 4R4ND 5E6ZA 1TNMA 4OLVL 1SMOA 3VGHA 1G7PB 4DWHA 4QTIH 4CVUA 1I3RA 2X9YA 5EBWB 4HBCH 4P2QD 5ESVA 3GSXA 3JWDL 1DBMH 3DV4B 5D2NC 5CEXB 5IMLA 2OQJB 3IETB 1UKSA 2VKXA 4NQDD 5HHVH 3SE4C 4L9LC 4S2SA 5ERWA 1VESA 4KI1A 4QHUA 1B90A 1TJHL 4RWYH 3FT2B 6FABL 5J6GA 4PJ5E 1JHLL 2DQEL 4LK4A 1KNOB 5T5FL 2GJ6B 5E5MB 1N8ZA 1QSEE 4OLZH 2Z8VC 4LLVA 5J1TC 1Q9OA 2HLFD 3PWPD 4H26B 4NYLB 3E0GA 1RSFA 2ORBH 1H3TA 4M61B 4ONFL 1IGML 4OIIH 3WKMH 4RRPG 4PRID 5L8JB 4LMQI 3WFCH 4JAMA 1G0XA 3AUVA 3ORJA 1AGFB 4JVUA 3PGFL 3VA2C 4IEFB 4K3HA 4OV5A 3HFMH 4R0LB 3DX7A 4PLOB 3QIWA 1E4KA 4J3OC 2ESVD 3TFKD 1VPOL 3RVXC 1U8JA 3VXQA 1JK8B 2AKRB 4N1EA 3PP4H 1IGFH 3MA7A 4TQEH 1BVLA 3MYJB 3MRHB 1WBXA 1RIHH 3EDDA 5KOMC 1S7TB 3IT8D 2J88H 3O8XD 2FWOB 4P5MB 2ICWA 4GQPH 1MHEB 3AMKA 4S11A 4XNQB 4CN1A 4G6ML 5J9PB 5I8KL 3L7EA 3L3IB 3DXAB 3BEWA 4U1GC 3QFJE 3CAFA 5IT2L 4KDWA 4QRRB 3FQRB 1JL8A 3TEUA 2ARJB 4Z7QF 2FX7H 4PRHE 1FE8L 5F96H 2EDHA 2VRAA 4XX1G 5AZEH 4EN3B 3JV4B 3BISA 4ACPA 2YUVA 2Z35A 4L9LA 2YSSB 4JN1L 3HMWH 3V95A 1X5ZA 1NFKA 2VMFA 2YR3A 1LMKA 3CVHB 2HFEB 5J6HA 1CD8A 4J8RB 3QSKB 4KV5E 1NH6A 3KYMB 4RMQA 2QQKL 3VXMB 1TFHA 5T1MB 4CVXA 1U2HA 4ZOEA 5FYJU 2Z92B 3VMPA 1D5IH 4KUCF 4V2BA 3K8MA 5KSUB 4LCIL 3V6BR 2NY0D 5JUEH 1QFPA 4MAYC 4TSBH 4ZFFB 1YEJH 2UUDH 1DLHA 3MLTB 2BRQA 2NY1B 2UVEA 1SVCP 4Y1AB 4FXGB 2V7NB 1CD9B 2FSEB 5FYKH 1UJTA 1S5IH 4DEPB 3VWJD 1OQOA 5JNYB 1HCVA 2EIEA 1J18A 4FZEH 3H7BB 4X7FC 1A6UH 4HIIB 4KUCD 4MS8D 4IMLA 3LQMA 4S1SH 5IVXB 3MLVL 2ADIA 1INDH 1IFHL 4F15C 2FYYB 5F3HA 4NKMB 2FEDC 3HI1B 3GMMB 1A6VL 4JHBA 3BN9C 2MKLC 5ID0A 2PUQT 1PW3A 3BW9B 3T2NH 4PUBH 1K4DB 5E56A 2EDJA 1DANT 1I75A 2EYTB 1GXEA 1UT9A 2X7LA 4BZ1L 4NQEB 3KXFB 2AJZB 3HPLB 3MOBL 3HR5B 4JDVA 3G08A 1KEML 4PJEB 2VZ1A 3P0VH 3RL2B 1V3KA 1W0VB 4Q6IB 4N90D 3RPKA 2NCMA 3MLYL 5EZJB 1YEEH 1I85A 1UH3A 2DQUH 4HAGA 2JK5A 5C7XH 3IDJA 3WL9B 1S7QA 4ZUTB 1LK3H 3RBGA 3ZYZA 3BD5A 4P0DA 1PEWA 3NAAL 1N5AB 2VN7A 1HQ4B 1L7IH 1GHFH 4ZO6A 1RZJH 3D85B 2K7QA 5DO2C 3O6LL 5EO1A 3SJVD 2FEEI 3UTSA 3UAJD 2ZCHH 3U9UA 4M1CC 1YC8A 3U6RB 4JFEE 1BGXH 1A5FL 3U9PL 1CE6B 4MAYA 3L3DB 2XQYG 5T1KA 3E6HA 4PJ8D 2Z31B 1MVUB 2RGSA 2BNRB 2WUCL 3L5JA 1S7UB 5DUBA 4AMKH 1JWSB 2ILLA 2P5EB 4PP2A 1UH2A 3BH9B 4H0HB 1SBSH 5D2NE 1HHHA 2XZAL 2VIRB 3QISA 4J6RL 3RTQA 3TF7C 3LIZH 3ECBB 3PG2A 4X8JA 4M93C 2FO4B 3BQUD 5FCUL 4ETQB 3MLWH 1AP2B 2VXUH 2EZ0C 3U30B 4OFYD 4U1JA 1S9WA 2XA8L 5HHMB 2OR9H 4OTXL 5D1ZB 4PJ5D 3G5VA 5CP3A 1ZHNB 1QSED 1F58L 4KK6D 3BAEL 5CJ8A 1PQZB 3BP7B 4FTVA 3KPPA 4NQSB 3U83A 3KLHC 3MV9E 1ETZB 5CEYA 5IMOA 2IG2L 1NKOA 5E8EA 4LRIC 1ZS8A 2AJUH 2HKHL 1U8NB 5MI0B 1LQSR 4TOYL 2BNUA 4UT9L 4MXWH 4PJ7A 3WS3A 3OGCB 4HMEA 4DGIH 2W0PA 4J12A 1RVFH 4JFDA 4G9FD 3KAAA 3J7HA 4UDUA 5FYJD 1HH6B 1MRFL 3D69A 3N9GL 1CFQB 4JFHD 2ZSVB 1OVZA 1J0ZA 1ZEAH 4MNHA 3IDXL 5FM5O 2NPLX 1W72H 2AV1A 5M94B 4I0PC 4KK5D 1FBIL 4LP4A 5EU4B 1QLEL 5C0GA 1CXEA 1DTUA 3O11A 3V7AG 4ZMAT 2R9HD 4WHCA 3T4AA 3TNMA 2YUXA 3B2VL 4I0KA 3JWNC 1CFBA 2YA0A 4HGWB 1EBPA 1X5XA 1OTSD 5D6CA 3KLDA 4CVZB 5AD0B 3H0TB 1NUNB 3B2UD 4OCXH 1P53A 5E2JA 4KTEH 4HT1H 4LCYA 3TBWB 3H9SA 3L5HA 4PRHD 5HDBE 2DQCL 1MCHA 4LPTA 3QUMH 5GS1B 2XG5A 5L88H 2VXQH 2XZQH 4UNUA 1BLNB 1MHHB 3ZDXF 5A40E 4CGTA 3KS0H 2A6JA 2G5RA 1ROWA 4P46D 1J05A 4LPUA 3S3JA 2GITB 2VISB 3SKUD 1IL1B 5GRZA 1TVHA 4H1LB 1C5CL 1FGNH 3DRTA 4RISH 3VFUA 3HLAA 1UWGL 3NFPB 1XF1A 4PJXE 2AEPH 2VXSH 1BZ9A 1FZJB 4GRMA 5T5NF 5DZOA 1I9RL 4LRIA 5I15L 3V79C 4QEGA 3WFBL 1QSFB 2M26A 1H15B 3STBA 5HGDA 2OTWB 5DQDL 1NL0H 3FKUS 3SPVB 3MCLH 2Q7YA 4AH2B 4WU5A 3MV8B 3OKDA 4UUJB 2HA1A 1JE6A 1D3CA 5DD0L 1EH9A 4U6VL 4XPTL 3RIAK 5ACZA 5AZ2H 5EN2B 1K8IB 1LP9B 1MCIA 3CFJA 4KKBC 4RSVA 3VFTB 2VXVL 1IEBB 4I0PA 4WEBH 1BBDH 3U0TA 4IHOA 4NO5A 1MJJB 4FTVE 1FNHA 3WXWH 4YZFE 3E6FA 1JYVA 1KG0B 3MC0A 4JHZA 4LCUB 2H8PB 3BZ4B 3KNBA 1UXSB 1FGVH 3QA3B 4LAQH 1Q38A 3SDYL 3QP3A 3DMMA 2HRLA 1LE5B 4PJ7E 5HVHB 4JFDE 4PREA 2HT2D 1MCRA 4W4OC 1UVQB 3U4AA 1AD0A 3LN4B 1U3HB 4ZG1A 4OF6A 1A3LL 2E7BA 2FR4A 3A6OA 1CI5A 3R8QA 3C09B 3TVMB 3RZCA 2UZIL 5KAQF 3DVNB 4NUGH 1K6QL 2CK2A 4K07A 4EI5B 1NLBL 3I6GA 5CJQH 3T3ME 3L1OH 1U0QA 4LPYA 2QQLL 4QRPB 4DKFL 3ROLA 5DJDA 3LPWA 4XH2B 4DKEH 3LRHA 5C0DA 3QUKA 4ZPTA 3MJ9H 3MRDB 5FA3A 1KPRA 2V9RA 3CXDH 1H8NA 3Q6FB 5I1DB 4GG6B 4NP4L 1KYOK 5FOBA 4Y2OA 4JFPA 3UDWC 3QUZB 1NCBL 2UWEA 2X4NB 1B4JH 4HC1H 3LS5L 3PV6A 1IEAB 3EJYC 2XIDA 4JZOB 4P48A 4HKZA 2AV7A 3LEVL 3LKNA 4OCWL 1KELH 5F1OB 3IDGA 1HINL 2LAAA 1ZWIB 3CH1B 1GCFA 4PRPA 4MCZB 4LLWA 5JLZA 3VXRA 1WFTA 2DS4A 3UZQA 3WLWC 5FO9A 4YPGA 2XQBH 5DA4A 3WHE0 1WFOA 3VXSD 1IGYA 3WLBA 5T3ZD 4OCYL 2IPKB 5I1KH 4NZRH 2BHYA 1XIWC 3W2DH 3S5LB 3C60C 4NC1C 4HDIA 3QCUL 3P9WB 1OY3B 4UBDC 5I30H 4S1DC 4MCYB 4Y4KB 2VDNH 3N85H 1I1FB 1S8DA 1C7SA 3KHOA 1FG2A 2HVJB 1SYVB 2F15A 2AK1L 2F54A 5IB1B 2ERJB 1V05A 1BP3B 4XNUL 4GBXC 1SBBA 5E99H 5GGUA 5CINL 4LLYA 1T6VN 2Y4SA 2QL1A 4M5ZL 1N4XH 4H88H 2NY2B 3H3PH 2P24A 5IB3A 1RULH 1N7ML 1I7ZB 1BJ8A 4B7LA 4HXBH 3S35L 2L7JA 1CXFA 4JFOB 3PXHA 4M43L 2FL5A 1KB5B 5B21A 4NWUL 2GUOA 4KTDH 4P3WA 3UPAA 3BEVA 5BOPA 3AAZB 4X0KA 3WFHB 4NZJA 4MD4A 3L95A 4DVRL 3UDWA 4XGZA 5CBEB 3T3PE 1Z6JT 3RWFB 5BCAA 3JVGC 1FNGB 5BXFB 3IFLL 5I18L 4ZUWB 3VFOB 2WBJC 1IAIH 4HG4K 4P9HH 3KPQB 4NRXA 5JQ6L 4NM8L 1NMCB 4CKVX 1MCWM 4PGBB 3NZHH 1LD9A 2QEJA 3UTSD 2ZUWA 1F45A 2OCFD 4QRTB 1CFVH 5E2TH 2VH5L 4WJ5B 4HKXA 5BVJA 4A2MA 1P4LA 3IDIB 1A1MA 4PGZA 4E41B 4JN2B 1M6OA 2X4UA 5DURD 1OT2A 1XIWA 4GH7B 5EOQH 5HYSA 2DQDH 4KZDL 3BXNB 4TSAH 1ES0A 2VDPH 4NO3A 3PDOA 1Y6NR 5DJAB 4Z7VA 3VFGH 2UWEE 5CFHA 4Z7UE 3VW3L 2C1PB 2BSED 3RTQD 3TH3T 1N0LA 4JO2L 3D0VA 3MNVB 2ZUQB 5F9OH 1EJOH 4K3EH 1HK6A 1HN1A 1YPZA 3I50H 4ZUSA 4FOMA 1OLLA 1IAOA 1WJ3A 1YNTB 4YO0A 5INCA 3OJ2C 4RZCA 1KPUB 3BN9D 1XCQB 4OLVH 2ED9A 4X6FB 4PTUA 1YA5A 2B20A 5DVMA 2V2TA 3C8DA 1CFTB 2VAAB 5FHAL 3JWDH 3RI5F 5HI4C 2Z91B 1AGCB 5KSBB 1FC2D 4GKNA 1Z0MA 4Q9CA 6FABH 1EZVY 1TJHH 4QCIA 1JHLH 2DQEH 4OJFL 2F54E 5T5FH 4JFDD 3T08A 4MSWA 2WBJA 1QRKA 1C5BL 4ONFH 5D7SL 2DQTL 3L3OA 4XNMA 5F89A 1TCMA 5MEPB 5ISZA 2M8XA 1EAJA 4PJCF 4XCNB 1CQKA 3MRGB 3PGFH 4MWFB 1LO2H 2CKNA 2FJHB 4HKJB 3S37L 4OZFG 1VPOH 3PWJA 4J1UB 5IHZA 4N9GB 5HPOA 3EJZC 1CFSB 1RJCA 2GK0A 4HCRA 4XP4L 2GJZB 3W81A 2NY4D 4DZBB 3H9SD 1B0RB 1OD7A 3OAYK 4JM4L 3WUWB 5DJZA 5HYEA 5FB8B 3ZKQD 5A2JH 1WC7A 4OZHA 2VLJB 5ANME 1P2CB 3QXDA 3PQYB 5I2IB 3QDGB 4G6MH 3U0PA 4HCRL 4PJGF 5E6ID 3PWUA 5I8KH 1IGJA 4NZUL 1X4YA 1SEBA 3TZVD 3CPLB 5IT2H 4HS3B 2AEQL 3HAEA 5DRZB 3V6ZB 2R2EB 4M3KB 4P2CG 2R1WB 1OAYL 1FE8H 4NC1E 1G1YA 3SDCB 2N1KA 2ITDA 3OR7A 2F5AH 2AI0L 5J13B 3CFEA 4Z7VE 3VFRB 4JN1H 2GAZB 4Y4HC 5DJXA 1XGTA 4LLMA 4GOSA 4M48L 1LE9B 4LLUB 5FM4A 2GK2A 4UOW0 1XF5A 1XF3B 3IU3B 5CWSB 3DTXA 1YPZE 1FVCB 4Y19B 5EFIB 5C0IA 4WI7A 2QQKH 4QYOB 5JOFB 2JE8A 4KKAC 1I8IA 1QBML 2BSRA 1MREL 1QD0A 4LCIH 3D9AL 1KULA 2BHZA 1OGAD 1Z5LB 4YNYA 5L8LB 2R8SL 1A2YB 5ESAB 1UB6A 1RD6A 4J3VA 2YEZB 3FO2A 2MKWA 1H8OA 1KTRL 3GMLB 1QP1A 3T0VA 4G8GA 3PWNA 4UINL 1JGUL 4UOJA 5IV2A 4GRLA 4LVNB 1VENA 2H32A 4U2YA 3QEQE 3DMMD 1B88A 2FZ3A 5M7QA 1NFIA 1UKQA 1MJUL 2R0LL 5DEGB 3MLVH 2KZWA 4WFEE 3C8KB 1IFHH 4F8TA 3IS1X 5DRNA 3SY0A 5DI8A 4XB8A 1QKZL 3WO4C 1QA9A 1A6VH 2W0FA 1CDCA 1KUMA 1NDMA 3VFVB 1KN4L 2X40A 5D2LB 4M7JL 3ARWA 4PRNA 3RZCD 4BZ1H 5ISZE 1KEGL 2BY1A 3ILPB 3MOBH 4FQQA 3PHQB 2APFA 3CCHA 1KEMH 1FDLL 3KPRB 1KLUA 1BHGA 4MQXD 3RX8A 4BUGA 3MXWL 3N50A 5SV3A 2V7HB 2ZSWB 3MLYH 1ZHBA 5C0AB 1KIRA 3SGJC 4G8IB 5JA8B 2BNQB 2CO7B 4OZGB 5CKAA 2X4QB 4Y4HA 4HPOL 1F5WA 1AGBA 3CX5J 1FFRA 4BQ9A 3NAAH 3KYOA 4YBHA 4APQB 1Y6MR 1MRDL 1B3JA 5DMKA 1N3NB 2J5LC 3O6LH 3P4MB 4Y4FC 2DIJA 4KGJA 3MUY1 1LVEA 3IJYA 3DRQB 3AY4C 3S3SA 1A5FH 4PRPD 3U9PH 4X6DF 4KK9D 1S5HA 1AR2A 5JHDE 4CW1A 3VXRD 3CMOL 1DANU 2GTWB 3ARQA 4WWKA 2WUCH 1NBZA 1XZ0A 2BOBA 4RGND 4WW1A 5J11B 3V6FA 2NX5E 5I66A 2VLKE 1S9YA 1UJ3B 2NR6D 3BHBA 2XZAH 5GHWL 4J6RH 4JY6B 4P57B 3BO8B 3IFPA 3S3PA 4XWOD 4Z7NE 5B38G 2HFTA 2CLVA 2X4OA 5FCUH 2H6PB 1LNUB 3BN3B 1P5VA 2XA8H 1EEZA 1P1ZB 2BVQB 4NQXB 4OTXH 2ADJA 3IFOA 4LSRL 1HQRB 5EIIA 4I3SL 5GS0D 2F54D 5TF1H 4X5WA 2CO6B 3FTGA 4P4KC 1F58H 5F7HA 3BAEH 1QRNE 1T2XA 2W0LA 5H2BB 2KPNA 4OAWB 4F33A 2ICEB 3MLUL 4DN4L 4ZXBA 1X5IA 4KJYB 4PD4J 3VWKC 5ADPL 1GGBL 2DI8A 3P9LB 2Y07L 2E9IA 2IG2H 4HIEB 3ULSB 5CP3H 2HKHH 1MUJB 1KXVC 4Y16C 4TOYH 4UT9H 5SWQB 4G8GE 5K9JL 3IF1A 5C09D 1U92B 1MCJA 4X6BB 8FABB 3O81A 43C9B 2JJWA 2X9WA 3Q3GA 3SGJA 5AG8A 1CFNA 1T1YA 2QBWA 2X09A 1EMTL 2EYSB 5IP4A 1FNEA 1MRFH 5IW3A 1BQLL 1FNSL 2I25N 3KYAA 3N9GH 1NEUA 2GFBA 4N0UE 5EO0B 5HYJA 5SX4I 2XYCA 4ODUA 3IDXH 1RZFL 1DBJL 4Q0XL 1FZKB 4WFFE 1KTKE 5D8JL 1AIFB 3EJYD 4XP5L 4ZPVB 5F7YC 4Y4FA 4YIQB 3FONA 1FBIH 3OXSA 4D0CA 4D9RE 1QLEH 3QQNA 1QYGL 3T04D 1H0DB 3PE9A 2X9XA 2YRPA 4MDIA 1VA9A 3T0EB 4PPTA 3B2VH 4ZQKB 1NBYA 3WLWD 1MY5A 4JKMA 5HTSA 4KH2A 4P5KB 1TNNA 2YN3A 5I71B 3WFZA 4JANB 3MRRA 2EDFA 2H2PC 2BP3A 3OAYH 2DQCH 3TO4C 3E8UL 1GOHA 4MA3A 3VD3A 3OPZL 4QHNB 2A73B 4AIZA 3FO1B 2BVOB 2VZTA 5EOCJ 5C0BB 5TDNB 4JDZA 4FQXC 5D7JB 4QOKE 1BBJA 4E9LA 4XVUC 2F8OA 1EFQA 1C5CH 1SEQL 5ECJE 1AKJB 1PKOA 2O5XL 1EVTC 1UWGH 2OTUB 3ARRA 3VWKA 5HYIA 1I7UA 3LQZB 4Q7DA 5IJVA 1I9RH 5I15H 5IBUG 3CSYA 3WFBH 2WINA 2AK4D 3QI9A 4NJAL 3GFUA 4QO1A 1HCFX 1NUGA 2V5TA 4Y16A 5C0FB 5FEBA 5A3IC 5F7WC 4HLJA 4XAKE 4X83A 4LKCB 5DQDH 3Q48A 4XHJC 2W07A 4GUPB 1HKFA 1GZPA 4F2MB 3ZMRA 4LGPB 3MRMA 5IUSA 5E9DE 3HE7C 5DD0H 4Z5RA 5DMGD 3O4LA 4X6CB 3DUUA 4U6VH 4XPTH 2FX8L 1P4IL 2F53B 3W5MA 3TBTB 1PG7W 1J1XL 2VXVH 3QQ4A 2VXTL 2OMNA 3ZHLA 5IESL 4AQ1B 5EB9A 1OGTB 2Y06H 3ELAT 4J4PC 4ODXA 3QIBC 4I5BB 2MHAB 5GRXG 3QEUA 4JRYD 4XPHL 3S35X 3SDYH 3L3GB 3QULA 5JORB 1Y18A 3TT3L 1BMGA 4PIRF 4NKDA 4OZHF 4JQIL 4R6UA 5IMMB 1FNAA 3LRSB 4PGEA 2RQ8A 1NFDB 2HTKC 3JTTA 3MBEB 1J12A 1MCOL 1A3LH 2JB6B 2E27L 3NA9L 1BVZA 4QNPE 4FQXA 4Y88A 1KXTB 3VFNA 2UZIH 3UTPE 1K6QH 4LNRB 5HD8D 1NLBH 4LVEA 5H37H 4NRYB 2F58L 2D0HA 3D18B 2QQLH 1RHHB 4DKFH 1U3YA 4MNQA 5JXAL 2IBZY 4JFXA 1S3KL 3ALXA 4XP9L 4JQXA 3V5HB 2M1KA 3D39B 2OTPA 2FLRT 2AXGA 2PO6C 1HI6A 3CXHJ 4NP4H 4ZDHA 2PW1A 2ZOLA 4JRXB 3P30L 1NCBH 4HEME 2Q8AH 4L3EB 3DO7B 3HE7A 3LS5H 1GGCL 2JJTC 1W0WA 3LEVH 4OCWH 4YR6A 1HINH 3BMVA 4W6XB 3BVNA 3OKMB 3HUJA 3GHBL 1MSPA 4HQQL 5T5NG 4WW2F 4J4PA 3UJTL 3OGOE 3QIBA 4OCYH 4LCWD 4XBEL 2A9ML 5I1AA 2J7LA 3CGTA 3P4OB 2X2YA 3JWOC 4RGMB 1ND0A 4X5LA 3QCUH 3SKMB 4AENA 1U2CA 4X5XB 4H25A 5DJ2A 1WIUA 5DHYA 1Q9WB 4O2EA 4GRLD 2AK1H 3O4LE 3D2UB 5IFHL 1M71A 3B9DA 3VGFA 4PV9B 5DUPL 5CINH 2W60B 43CAB 3QDMB 1WAAF 5IFJA 5LAXB 1O5DT 3MRQA 4M5ZH 5C0EA 4X99B 4R0LC 3MSPA 3FB5B 4Y2DB 1N7MH 3EBAA 1P84K 3S35H 2IJ0C 4WI6A 3OMZA 3E3QC 3N1GC 3GJEB 2P46B 4M43H 4DOHE 4FFVD 1QSZA 4NWUH 5ILTL 1J9CT 4PRAA 3IXAB 4QXUL 1WBYB 5SX4H 4U6HA 4FQ2L 4DVRH 3BKCL 3KPOA 4R9HA 3V4UL 2BC4A 1EK3A 2NY7H 4BZ2L 3S37X 3ZLQC 1WCBB 3T65B 4C56B 2JJTA 3VFPA 2Z4QB 3MRKA 3EYUL 4U3HA 5KAQG 4P4RB 1L6ZA 1JNNL 4NRZA 5A2KH 2G9HB 3IFLH 5I18H 1MLCA 4ODVL 2DLFL 3ZE1F 3MV7D 3UCRA 5JQ6H 2R4RL 4NM8H 3AMLA 5ITFB 1NGWA 2WQ8A 3G6JE 4PJDB 3BH8B 4P2OB 2X1XR 2L4OA 3JBG7 1J8KA 4MNQE 4KKAD 3IETA 4IOFD 2YA1A 3DURB 4EN3C 4NSKB 4JFFA 2IQAB 3FT2A 5J1AA 4KZDH 1I7TB 4WWKD 2GJ6A 5E5MA 2OYPA 1GL4B 4CL7A 5K59E 4H26A 5BV7B 4NYLA 4XAKD 3VXTA 3VW3H 3PUCA 4L4TB 1PBYA 4JO2H 4WI5A 4X98A 2PN5A 1J10A 4MJIA 2VDML 4PJHE 5HVWA 4OZFB 2FIRT 4HFWA 2HLAB 3HUJE 1F4WL 2BVPB 3A0OA 2HVKB 2NY1C 4R0LA 3BDYL 5MENB 2IPUG 1OTTC 4DEPC 1YDPB 1OB1B 2XFXB 2XN9B 1RJZA 1HHGA 4GMTL 2EXWD 2AKRA 3PP3K 4ZXBD 1IMHC 2D31A 5FHAH 3HN3A 1CG9A 1IAKB 3GBML 4XVSH 2XT1B 1B6DA 4BH7A 5ELIA 3T2QA 3ZT5A 4OJFH 1CXLA 12E8L 1L9NA 1T0NB 3VMOA 2FDBP 3DXAA 1C5BH 5HYJD 3WNLA 1I1CA 2A83A 5D7SH 5D71L 2DQTH 4HUWB 3FRUA 4P2QB 3FT4B 2QSQA 4KHXL 3T4YA 3KJ4B 2H45A 4R3SB 5I19L 3W5NA 4Q6IC 2BMKA 2WIIB 3UTPD 4FFZL 4NQDB 3RWHB 4U1IB 3BGMB 3HCVA 3GSRA 4MJ2A 1G7HA 1W72B 4ZO7A 5DJYA 3MREA 2IALB 2D7QA 1YQ2A 1CLYL 3C5ZC 4NN6B 1FV1A 3S37H 3WEXB 3PWPB 3OJVC 1MRCL 4LSQL 1MNUL 1R3IL 4YUEL 5IQ9B 5JPMA 4XP4H 1N6QL 3O3BA 4MB3A 2Z92A 4PRIB 5KSUA 4RAUA 2QQNL 4ZFFA 2PXYA 2Z31C 4OGYL 1GOGA 1I1RA 1UA6L 3O6ML 1HSAB 4POYA 1M7XA 3NACL 4Y1AA 4FXGA 2V7NA 2FSEA 3DYOA 4UNTA 4HCRH 2FLBT 4IOIB 2ESVB 4NZUH 1A1OB 3CFDA 1U8QB 1DBBL 3OKEA 5LXGL 4XXCA 3H7BA 2ENSA 5JW3L 4HIIA 2AEQH 1B2WL 1OAYH 2X4SA 3V4PL 2GJ6E 3U30C 3CFBB 2AI0H 1F3JB 4JCMA 1U93A 4PRDA 5D1ZC 3QI9D 5EOTB 5HHQA 3MJ7B 2IC2A 2MCPL 4U3CA 3O8XB 4M48H 2NXZB 5GRYA 3DYPA 1G7QB 1QPXA 3HAEH 3OR6B 4FQLL 1K4DA 3EOAB 4OFPA 1L9MA 3QQ3B 4MJIE 3ETBF 1CTNA 4MLIA 2D0FA 4XP1L 4MJ5B 3TA3D 4BH8A 5GGRB 2AJZA 3HPLA 4OB5L 3HR5A 1QBMH 3MUZ1 4YGAB 1IILE 1MREH 4PJEA 3RL2A 3H9YA 2CRYA 4N0CD 3BP4B 1GGYA 2R8SH 4OD3L 2EDYA 4O00A 3E3QE 4L4VA 5GIRA 3AS0A 4TNVF 1CDIA 4FQJL 3WIFB 4ZUTA 5KW9L 1QNZL 1EEQA 2GIYA 5E8DL 3MCG1 3C5ZA 1JGUH 4UINH 5I8EB 1KN2L 2I9LA 4QXGL 4YHPB 5SWSA 1U6AL 2IH1A 4GKZA 3DIFB 4L8CB 5D5MA 3EOYG 5ACLA 4MB5A 1MJUH 2R0LH 3FCTA 3FN3A 3QDAA 4JG1L 1R3LA 5KSAA 2NY0B 4RMWA 3STLB 3U6RA 1E6JL 4MDJB 1SJXA 3QNXB 2FECL 3RVVC 4FG6C 1QKZH 3DXAE 4X4YB 2Z31A 1X4XA 1ZLVK 2BNRA 4QRRE 1KN4H 2HTLD 5CGYD 3BGFB 5B38B 1BFSA 4M7JH 1MPAL 2ZG1A 2P5EA 1X5AA 2BXYA 3VWJB 3BH9A 5FGBC 1KEGH 4NN5B 5JZ7D 3O4OB 4Z77B 5KS9F 5C08D 1IT9L 1FDLH 1ZT4B 4PJIA 3MXWH 3REWB 5E1AB 5GS1C 4WHYG 5D1ZA 9CGTA 3M45A 4HPOH 4JZJC 1DBKL 3VXME 1T0MB 2YPLD 3EHBD 3RL1B 1E4WL 1MRDH 2C1OA 5LGKA 2FJFA 4NQSA 1RIVL 3D3VA 4HIJB 4ODHL 5BZDB 1ETZA 5JW4M 3FO0L 1I3VA 1FG9C 1T3FB 4G9DA 1MH5B 4L4JA 4Y1AE 4G6AD 5BMFL 2V9QA 4G43B 4NC0B 2D9QB 3OGCA 1PKQA 3CMOH 5DJ6B 2ATPB 3THML 5JXED 1JI1A 2KH2B 1WZ1L 2WWKT 1AQDB 5DDHB 5DFVD 4JGJA 5IVXE 4CADA 4R90L 3IKCB 3DX9A 4M6OL 3OTTA 3BT2L 3KWWB 4GQ9H 3SJVB 2VYRE 4A6YA 3O3AB 1DQJB 1K3ZA 3MTRA 4R4FL 2JCCF 5DXWA 1CBVL 3GSVB 1MHCA 1ZA3B 1HWHB 4LSRH 2C4FT 2KL6A 4I3SH 4LOUC 4NQEE 4PJ8B 3KXFE 1NBVL 4N8CL 4UQ2A 4BFIB 1PYWA 4JB9L 1U95B 5E1HB 4A6YL 4PJEE 5CD5C 2IAMD 3PP3H 4CVZA 4MAUL 3MLUH 4DN4H 5FGBA 2DQGL 3ZYJA 5ABDE 2Y07H 5E2WL 4L4VE 3TBWA 5IOPA 5HVHC 5E03A 3QXWA 1A7BA 5TQ2L 3CD4A 1FYHB 4HS8L 1S7VA 3BQUB 5GS1A 3AFLA 5K9JH 4X4XB 4HKBA 1U3HC 3HPJB 4PJ5B 3MLPA 5SWSE 1I7RB 2YOCA 1N2RA 1DN2A 3C09C 1BQLH 1FNSH 2FX9L 4I9WD 1QSEB 4JZJA 3TVMC 4YK4B 1XH3B 1FH5L 2VISA 3C87A 5IBUB 1IL1A 3D6GA 4L9DA 5I1CL 1RZFH 2Y9RT 4P23A 1AXTL 1DBJH 4Q0XH 5D8JH 1X6NA 4XP5H 3M07A 2BNRE 4QRUA 1FAIL 1QSFA 4OQTA 1QYGH 2BCKA 1NC4A 2P5EE 3QG7H 1H15A 4IJ3B 4IDJL 1G7JB 4PB9L 4QRSB 3DSFL 3TM6A 4D8PA 4N68A 4G9FB 3IVKA 3QUZC 2DICA 5HI5C 3MMEB 1QFWM 3MV8A 4UUJA 2VDRL 2XTJD 1WWAX 1MI5D 4JFFD 5DK0A 1CWVA 4KJPC 4GJTB 3VI3E 4OQTL 1K8IA 4OLYL 5HHME 1F3DH 5DEFB 2XZCL 3VFTA 4NHUB 3CDGB 3E8UH 1K2DA 4I4WB 4EDWL 3OPZH 4K7PL 2DLHA 3ULVC 5IK3A 3MZGB 3EFDL 1B0GB 4G6KL 1KG0A 4LCUA 1TTUA 4DCQB 1J1PL 4MJID 5TH2B 1Z2KA 1GIGL 1SEQH 1Q9KB 1OP3H 2O5XH 5CP7A 1PKQE 3VFMA 4AG4L 1VGKB 4PRHB 2CQVA 4Y4KC 4HZLB 4GT7A 4NJAH 1Z9SA 1D5ZB 1TQBB 3AB0B 3F7YB 2ERJC 4S0TD 3NA4A 4P46B 5AAMA 2L0DA 3LMJL 5JR1H 5IB5A 3UTTD 2IEPA 2NY2C 2FX8H 32C2A 3BPCB 1J1XH 3K2UL 2IH3B 1JYXA 5IESH 1GVIA 5GGVL 2J8UF 5KBNC 4UB0L 4KWUA 3SGEH 1A7RL 4PJAF 2BSTB 1CLZL 1I3RB 1NUFA 3GSXB 1UWXH 4XPHH 1QFWL 1UXWA 2JKXA 1IEAA 2XPGB 4OT1L 3BJ91 1HHJA 1OLZA 3TT3H 3OKOB 2YXFA 1GC1C 2VDLL 4P59L 3FN9A 1N8ZB 1Q72L 4JQIH 4PJBA 4LLVB 1Q9OB 1NMCC 3U1SL 4WTXA 3PL6A 4I2XB 2E27H 3NA9H 5HYSG 2NZ9D 3RNKA 1SJVA 4ALAL 4FABL 3O2DL 3NIDF 2IFGA 1QSFE 5D93C 1NMBL 2F58H 3DX6B 2PXYD 3ULVL 5JXAH 3FMGL 3DX7B 3QIWB 2VKWA 1QHPA 1I1FA 4R26L 1S3KH 2YWZA 5KZCD 3MLRL 3MV8E 5CLWA 4XP9H 1U8JB 3RHWK 1TTFA 1ZK9A 2PTTB 2ZUQC 3LEXA 3QPQD 4XBGA 3MA7B 1BVLB 3HI5L 5IBLD 3FOMB 5IFAL 3TJHC 3CU1A 5TGBB 4RA0C 4NWTL 4U6YA 1GGCH 4U31A 4X7SL 1WBXB 4ZSOA 1JZ4A 1N0XL 1HEZB 4ZAKA 2FCBA 1I7ZA 4JVWA 1MQ8A 1EDQA 5CS7A 5I75B 4JFOA 4J3UA 3GHBH 4HQQH 3VDBA 5MHSE 1JNHA 3L7EB 3UJTH 3BEWB 3T1FB 5BVPL 5E24E 1EJ6A 3AAZA 4KHTL 2A9MH 3ZDYF 1T5XA 5D5MF 3LN9A 2VDOL 1GGIL 2JTDA 3F65A 3VGAB 4LKXB 4S1RL 1TQCC 5BS0A 1F97A 2EDOA 1KB5L 1RUAL 3QQ9D 1FNGA 1JN6B 2YD4A 5GS2D 4M6AA 3WDIA 3C5ZD 3KPQA 5J6HB 5SWSD 2RJMA 3MRPA 1UZ8A 5IFHH 2WSKA 5DS8B 4XXDA 1VB9A 3VXSB 4QRTA 1KGCD 4QRPE 3HTLX 4KRLB 5DUPH 2N7AA 4WJ5A 5KSAD 3IDIA 4FQ1L 4PJIF 1GC1L 3BIKA 4E41A 1HWGB 4Y89A 2GJJA 4MMZC 1MY7A 1DLHB 3RY6C 4RRPA 4GG6E 1W2KT 1RZGA 4JLRA 3PHOB 5IGXL 5ILTH 1X5JA 2C1PA 4QXUH 2D9CA 4EI6A 4FQ2H 4IMLB 3BKCH 3V4UH 3AREA 4M7LL 5FKAA 2ADIB 4BZ2H 3EYUH 1JNNH 5F3HB 3ULVE 3HAEG 4POZC 2X1PA 1FO0A 2AJXL 1GYAA 2DLFH 2DTSA 4KJQC 4BZYA 4HIXL 2R4RH 2VSDA 3NCFB 3LS4L 2X7LB 1C12B 3DPBA 3D3VD 3W82A 4B7IA 1CFTA 2VAAA 2YD8A 4UU9B 4L29B 2UVFA 5DYOB 4JDVB 3G08B 3SDCC 4KAQL 2Z91A 1AHWC 1KPVB 1D5BA 1T22A 4LEOB 4KMTL 1FO0L 2EDWA 1MOEA 3TIEA 1VFBA 2I26N 5DD5L 4AYFA 2JK5B 3IDJB 5EUOA 1S7QB 5D72L 3CZFA 5HGHA 3B3IB 3UP1A 4QLRA 1J86A 15C8L 3EYOB 3QNYB 1IC7L 4XVTH 5EO1B 4OFIA 3UTSB 1EFXA 5FUZL 2VDMH 2GHWB 2Y6SC 3U9UB 1VERA 2BVUA 1N59B 2R15A 1F4WH 4MWFA 1GJIA 4F37F 3JTSB 4MAYB 3K0WA 5DURB 3E6HB 3BDYH 1MFDL 4HKJA 3RY6A 4UIMA 3MPCA 4N9GA 2X4PA 4GMTH 3UROR 3U36A 1HHHB 1CFSA 4S1QL 3RTQB 4IRSA 5BS0E 1KSRA 1U58B 5FCSH 4MXVE 4AEEA 4X8XA 4X8JB 5ICZB 3GBMH 1D5MA 1T1XA 2Q8BL 2UYLA 5C9JA 3EDKA 5ETUA 5FB8A 1S9WB 2VLJA 1P2CA 3G5VB 4UILL 3M1BA 1FPTL 1MAML 5I2IA 4NOBA 1EGJA 12E8H 1AR1C 2OMBA 1S9XB 1CICD 4FTVB 1N64L 3KPPB 3TWCL 2YPKA 1CIUA 1AY1H 2ICES 2PETA 5D71H 3V6OC 4P23D 1P7QA 4E41E 2BK8A 1CXIA 3P0GB 4KHXH 5CEYB 5I19H 3BSZL 5IMOB 4OV6F 4FFZH 3SDCA 5E8EB 4G7YL 1AHWA 3QEGL 2GCYB 2YBRA 1NC4D 2GAZA 3LCYA 3WS3B 4F7CA 5KVEL 5DVNA 1YEHL 3V4VL 4XHQA 5FYLD 4WGVB 3GZKA 4XPGL 1CLYH 4JFDB 4MD0A 4UDUB 4APQC 2WLZA 4EBQL 4K55A 5CWSA 5ESQA 4OF3A 1MRCH 3IRPX 1TPXB 4LSQH 5I1JL 1MNUH 1R3IH 4YUEH 4Y19A 5EFIA 5TE4L 2BOCA 4LLDB 4QYOA 1FLTX 5JOFA 1N6QH 3SCMA 5KOVC 4P2RA 4XWGL 3QWOB 2QQNH 3CFCL 1ZTXL 1CTOA 5ESAA 1LK2B 4OGYH 4Y8AA 4GAYA 5C0GB 2YEZA 2LFGA 3SE3A 1UA6H 3O6MH 1FLRH 3O11B 1QFOA 3NACH 3TNMB 4WUUA 3OKKA 1DE4A 1UJ3C 2X6MA 5KSBE 1DBBH 5LXGH 3VA6A 5CD5D 4N5UA 5JW3H 3MQIA 5HGBA 1B2WH 4LCYB 5B3JF 2NY4B 3V4PH 2NY3C 3H9SB 3FQNA 4PJCB 2YD5A 5EUOE 5C6PB 3QPXL 2ZPKL 4M93B 5E5RB 2MCPH 4AM0A 4XX1E 1EHLL 3C6SA 4TUJA 2EDDA 4FQLH 5CGTA 5E6IB 2A6JB 1EIBA 4CJ1A 1J05B 3RGVA 4XP1H 3MV11 3MRLA 4OB5H 3TZVB 1TVHB 3DRTB 5FHBH 3HLAB 4N1CA 1PEZA 5HGGS 2VTFA 3OHXB 2QJDA 3QFDA 4OD3H 5C0AA 4UT6L 2I9TA 4M1GL 3WD5H 4FQJH 4Y5VC 5HGDB 4EQ2A 5C3TA 1JTPA 4PJBF 4PJGB 5KW9H 1QNZH 1EA9C 1T03L 1NCAL 5E8DH 2Q7YB 4DGYL 1KN2H 3ESUF 1F6AA 4QXGH 4WU5B 4BSJA 1U6AH 3QUXA 3P4MA 2HT4C 2UY6A 2VITA 5ACZB 5B4MD 2VLJE 3CFJB 4JG1H 4HH9A 3DRQA 1IVLA 1E6JH 1OGAB 4I0PB 4JR9L 5D7KD 1K9TA 4IHOB 1JV5A 4NO5B 4U1LA 3T0EC 2AGJL 4WNQB 3PL6D 2VZVA 2PYED 5DD1L 3E6FB 1MPAH 4BQCA 3KNBB 2W1NA 5I71C 2HJLA 1IT9H 3DMMB 3FQXB 4P57A 3F7VA 3DI2B 5C6TL 3G5XB 5GISL 5KVDL 5C0ND 2D7MA 3RPIB 5F93C 3RWEA 1T83C 4PREB 4NDMA 4RAVB 4OGAC 2BVQA 4XNZB 2NYYC 1HQRA 2QQQA 4Y19E 2VQ1B 5D7JC 2FR4B 3AROA 1DBKH 2ZNXA 1ACYL 4GXUN 2XI9A 2Z9TA 4NO0A 1E4WH 4MA8L 3RZCB 1RIVH 4TN9A 5CCKL 4LSDA 1ZT1B 4ODHH 4KJYA 4K7PX 4RA3A 3FO0H 4R2GD 3I6GB 5GGQL 5I9QB 5H35A 4ZAKD 1BJ1H 5DUML 3ROLB 4J3XA 4U3XA 4KUZL 4MA7L 3ZE0E 4O2FB 5BMFH 4ISVB 5SWQA 2VL4A 2AW2A 3QUKB 4ZPTB 4LVOB 4UTAH 3AC0A 1U92A 2JF1A 3B5TA 4X9BA 4HUUB 3GSWA 2D7TL 1KPRB 2EICA 4Y5VA 3THMH 4QTHA 1DQLL 3EYFA 4Q2ZA 3QIUD 3PHSA 5FOBB 1RUML 4R90H 1V3LA 4M6OH 3BT2H 4KROD 3P4NB 2XA3A 3PV6B 1JI2A 5DJCB 4L5FL 1QLRA 4HKZB 4ZPVA 3LKNB 3IDGB 4R4FH 1CBVH 5D2LE 3B83A 4PRPB 4H8WL 5IROA 3EZJB 2AXHA 4Y5XB 3VXRB 4NKIL 1HOCA 1NBVH 1IGCL 1QBBA 4QKXB 4N8CH 5F1IA 3AS1A 1CYGA 4YPGB 2AJVL 4KRPD 4RGNB 4JB9H 3V6OE 3WLBB 1IGYB 4A6YH 4UZGA 4P5KA 4MAUH 5ICYA 4FNLL 3K1KC 3LH2L 2DQGH 1M7DA 5C0AE 3TYFB 3UTOA 1JZ3A 3WV0A 2BNQE 5B22A 5EDXA 3TC9A 5TQ2H 3PGCB 4X6DB 4HS8H 2EIZB 4DGVL 1KCSL 1WWCA 4ONHA 1ZV5A 3MBEC 1S8DB 2UY7A 1FG2B 5TDNA 2F54B 5D7JA 2FX9H 4UNVA 4NBZB 5KSVA 4DZ8A 5GGUB 5LKNA 1FH5H 4FQHA 1NJ9A 3NMEA 2ZUSA 4P3DB 1ZA6A 3ARED 5I1CH 1AXTH 5C8JB 4XPBL 3VXPA 4XI5D 5F44A 5AG9A 1UYWL 2C4FU 4OF5A 1J0IA 5EU6A 1FAIH 3SEPA 4QHMB 5FECB 5C09B 1NMAL 1JNJA 4IDJH 2JB5L 4GRWF 4M8VA 4PB9H 2FL5B 3DSFH 4LKCA 2GUOB 3WJJC 2B8OT 4WFHE 4HJ0D 4PG9A 4G3YL 3V7AE 2VDRH 1RV6X 1EHNA 1ZVSA 3UBXI 3QRFM 3I6LE 4LHQB 4OLYH 4OQTH 2XZCH 3FQUA 5FM5M 5KJRL 4KMLB 4EDWH 4K7PH 4KJWC 4NRXB 3EFDH 4TUKL 4G6KH 3STZB 4C4KO 3V7MA 1J1PH 1EFXD 1DBML 3ABZA 3LQAL 4RGMC 1GIGH 1SVZA 4HKXB 1G9NC 1JJUA 1UQSB 2QKIA 3L3GA 2D7PA 4LP5A 5CIPA 1M6OB 2X4UB 3OB0K 4AG4H 2OBGA 4QGTA 1XIWB 5HYSB 2LQRA 5CJOH 1ES0B 2KKQA 4NO3B 3UXFA 3PDOB 5IMMA 5FGCE 2E3VA 4Z7VB 1NFDA 5DVKA 1MIEL 2R2BB 4D9QE 1I8KA 2ORBL 4NKOA 4IRSD 3WKML 5DC0A 3D0VB 4LNRA 3FL7A 3LMJH 4X6EA 1X44A 4Q74A 3D18A 4ZUSB 4Y2DC 1UZ6E 2CDGB 3MUGA 1AFVL 1RHHA 2C7UA 3K2UH 3VDAA 3HFML 3T0EE 3WNMA 5INCB 5GGVH 4RZCB 3RVUC 1DR9A 4UB0H 3ZE2F 2AK4B 4PJFF 1A7RH 5FFLA 3B43A 4PTUB 1KLGA 1CLZH 2V2TB 3F7QA 1A9BA 1P7QD 3WJJA 3RWCA 4ZUVB 4JRXA 1QFWH 4GKNB 1XGRA 3OX8A 4YDIL 4LLQB 2RB8A 4IRJA 4CBPA 1FNLA 4QCIB 1A64A 2PTUA 5DFTA 5C0BE 3OKMA 1HZHL 2VDLH 4P59H 2JJSC 1Q72H 4XT1C 5BRZA 1NCDL 1CDHA 3U1SH 4B0MM 3GI8H 2NZIA 4P2OC 2WUBL 5I1IL 4YDLB 3D48R 1J0HA 3L3OB 3Q5YA 4ALAH 3SCMD 4G42A 5F89B 4P2RD 2GI7A 4FABH 1PGRB 4JRYB 1RZJC 3O2DH 3ZDZE 5EU6E 3TPUA 3DHJA 5I8CA 1DQQB 1RZ7L 3PABB 1NMBH 3RWDA 4GO6B 1JMXA 2P8MA 2X1QA 3ULVH 3ARBA 2OL3B 2I24N 5D7LA 2PW2B 2YUZA 4JKLA 4R26H 5BV7C 2H2SC 4G8EA 3MLRH 4N5ED 4WUUD 3VGDA 3PWJB 1C08B 5IHZB 4PYHA 4X6CE 3D2UA 1G0DA 2HYMA 1G9NL 1MFNA 3H2WA 5CUSL 1ZVYA 1DUZA 2F53E 1FZMA 4KI5F 4PV9A 3HI5H 2XY2A 3GSQA 1D5IL 5IFAH 43CAA 3WUZA 3QDMA 4NWTH 4X7SH 4IIQC 3KS0J 1ZLWH 4TSBL 1LWRA 1N0XH 3NPZB 2P42B 3FB5A 4Y2DA 1WC7B 4OZHB 1G7IA 5CSZA 5FOJA 3BUTA 3QXDB 2XQYK 3U0PB 1F13A 3GJEA 3PWUB 5GGSY 3F7PC 3C5SB 1IGJB 3ARDA 3RGVD 4OCMC 4ODWA 4FZEL 4KI5D 5BVPH 4KVCL 5HBBA 3HAEB 4WDIA 4KHTH 3HE6C 3BX7C 2VDOH 2V17L 1GGIH 2Z0BA 2ITDB 3GSOA 4S1RH 4WCYL 1WCBA 2Z4QA 1NFDE 5CZXD 5DJXB 1XGTB 4LLMB 1RUAH 4R4NC 4JHWL 4OCSL 3VXNB 2CGRL 4LU5L 1XF5B 1DSFL 3W9DB 3QUXD 4BSWA 3KJ4C 4XBPB 1UM5L 1I8IB 4LCWB 3MUHL 4Z7OF 1MCNA 4FQ1H 2IQAA 1GC1H 1MWAA 5TJWK 3TIDA 1CGTA 3GBNL 2Q86A 3D39E 1I7TA 4NN6C 1MF2L 3G9AB 2HLFC 3ULUF 4JRXE 5IGXH 4GRLB 4L3EE 1WCQA 1DFBL 2H32B 4L4TA 1MWAL 1JHTA 2EH8L 4U1HA 4WFHD 4D0DA 4XNYL 4M7LH 4OZFA 4XRCB 5L2JB 5BRZE 5DRNB 3SY0B 2WNGA 4IIQA 1CLOL 5D1QA 5DI8B 2HVKA 1M4KA 5BV7L 4B53A 4TVSa 1QA9B 1ZHLB 3ULUD 5MENA 2AJXH 4RNRA 4J3SA 1OB1A 2P43B 3D1MC 4HIXH 1HXYA 4I3RL 3WMSA 4AMKL 4NO0D 3LS4H 4EIZC 4FQQB 4OLWL 3LKRB 5D96B 4I48B 1T5WA 1KLUB 4QWWC 1RK1A 4KMTH 3HE6A 1FO0H 3EO0A 5ICXB 2R69L 4LSSL 1ZHBB 5DD5H 1VEPA 3O8XC 1KIRB 1H3VA 4LASL 3WN5C 3KGRA 5TDOB 5D72H 3DETD 3DHMA 1IARB 1AGBB 4J2XA 3MV7B 5CJBA 1T0NA 3KYOB 3OL2A 3LSOA 3QDME 2OX5A 15C8H 5TDPB 1WIPA 4YDJA 4HUWA 1IC7H 1P4BL 3IJSA 4M7ZB 2DBLL 4KZEL 4NHCL 4FHBD 1AGDB 5FUZH 4NQVA 2AJUL 1S7XA 4GRWH 4PBVC 4RCAA 5DK2A 5GRWA 1S5HB 5F88A 5J1SC 3MCKA 1MFDH 4WWKB 2QR0A 1XZ0B 2YZ8A 3PWLA 3L3KA 4K8RD 5DGQA 1S7SA 3SDXF 3PDDA 3PWPA 4XB7A 5ITBL 4HHAA 5C0JB 4GG8A 1OCWL 5I66B 4S1QH 1JTOA 3BHBB 5IQ9A 3F6LA 4C56E 3IFPB 2NY0C 2CLVB 3V0AC 2ADGB 2X4OB 2Q8BH 5IIEB 4HBQA 3ARPA 3CSGA 4OGAD 4UILH 3IFOB 4PJDE 1FPTH 1MAMH 3VRJA 5AYUL 4IOIA 2ESVA 3VWJC 4NN5C 3O4OC 4GLRH 1GGTA 5KVFL 1N64H 3TWCH 1U8QA 4MS8C 2R2HA 4ZXBB 3BSZH 2IFFL 4PY7A 1LEIA 5GGSA 3MLXL 4G7YH 4ZNEE 1UM4L 3QEGH 2XWTA 3MFGB 5EOTA 5L2KA 5KVEH 3IF1B 1YEHH 3B6SA 3V4VH 2VXQL 5F1NA 4XPGH 2XZQL 1CFNB 1G7QA 3WN5A 1FC1A 4L4TE 3OR6A 1FNEB 4EBQH 5FK9A 2GFBB 5E2VL 3ET9F 5I1JH 4MJ5A 5TE4H 5HYJB 5GGRA 3AU1A 4ODUB 5E8NA 4DN3L 1CU4L 4X4MA 1QO3A 2QSCL 4QHLA 4XCYA 4XWGH 3CFCH 1IRAY 1ZTXH 5MENE 1MLBB 3FONB 1HHKA 4UV7L 3K81A 3OXSB 4D0CB 3GMPA 1OQXA 1WFNA 3UZEA 4MDIB 4MHHI 3VXUA 4HGMA 4DAGL 3EOTL 5C6WH 1KJMA 3HNVL 5I8EA 2RCSL 4YHPA 1KJ3L 2DYPA 4PBXA 3F7RA 5FF6A 5KTEL 3VH8A 4L8CA 1NGYB 3MRRB 3UAJC 2GEEA 3STLA 1X5FA 3QPXH 1U8OB 4KDTC 2ZPKH 4MA3B 4ODTL 2H1PL 1QQDA 3O3EA 4M1DL 1EHLH 1WIOA 3OV6A 4JDZB 4OM1H 4P2QE 3GMRA 4LHUD 1BBJB 4TNWF 3C8HA 3VD5A 4XZUA 4NQDE 3U48A 4LMQE 3VD9A 1JMZA 3IDUA 3VU2A 3BQUC 2W0KA 1NGPL 2KQNA 5E1AA 4IBLT 5IJVB 2DM3A 4UT6H 3QI9B 3QCTL 3PWPE 4M1GH 3TBVA 4QT5A 1T03H 3P0YL 4DTGL 1NCAH 1M7IA 4KK6C 1T0MA 4YK4C 3T09A 4DGYH 4E42B 4PRIE 3MRMB 4GMSL 5FXCH 5HXMA 3TA3B 4E0RA 3O4LB 3DUUB 5BZDA 1NQBA 4IRJD 2D3VA 2EC9T 1MCWW 3QQ4B 1M1SA 3NIFF 3A67H 4TNWK 2ESVE 4G43A 4IJ3C 5BRZD 1NCWL 1FZOA 3Q5TA 1RU9L 1NDGB 1G7LA 2EDRA 3RU8L 3R1GL 5D7IF 2C9AA 5DD1H 3GGWA 4P9HC 1LO4L 1U3JA 5DDHA 2WQRA 3QEUB 4AIXA 4JRWA 2HFFB 4DW2L 2YRLA 2FEEL 3EYQD 3IXTA 2O93L 1KLFA 2AVGA 2C26A 3QULB 4KK5C 5C6TH 1J0YA 5GISH 5KVDH 4OBSA 3ARBD 5ENWA 1DQJA 1Y18B 1CT8A 1AO7A 2IGFL 5D7LD 4YJZL 3GSVA 1ZA3A 1CS6A 1KTDB 3W39A 1ACYH 1OTSC 4GAGL 4MA8H 4I3GA 2FHBA 3B2UC 5CCKH 5DLML 3WIHA 2BVYA 1KF9B 2DBJA 3WCYA 5F9JB 1E27A 5C08B 3PGDA 5EIVA 2V6HA 3KYNB 3GIZL 2UUDK 1Z9MA 5TPWL 1F4AA 3ES6A 4KUZH 4MA7H 4XAWL 3AB0C 1KYOJ 3IYLW 4JFXB 1WICA 3QHFL 3HPJA 3ARDD 2D7TH 2ICWJ 3WIHL 4Z7QE 3S88L 2JIXA 1DQLH 2AXGB 1HI6B 4P46C 3GK8L 2YPLB 4ZDHB 2PW1B 5KS9B 1RUMH 3MRNB 5EBGA 1EERB 3TLRA 2CK0L 1BVKA 4Q9RL 4L5FH 3MJ8A 3RIFF 1QTYT 1TETL 4YR6B 1NC2A 3P2TA 3BVNB 2G2RA 5I6XB 2YN5A 4H8WH 3MOAH 1BFOA 2CUHA 1G7JA 4NKIH 1IGCH 4K3DL 1BZQK 1YY8A 4KTDL 2Q87A 2AJVH 1A6PA 3I3BA 1EHXA 4ZUUA 2OI9B 3SOBH 2CIKA 4FNLH 3LH2H 2O26U 4RGOL 5DRWA 5LJYH 5DEFA 1ND0B 2QHRL 4NHUA 2DQJL 4PLJD 3VDCA 4AENB 5HI3D 4DGVH 4H25B 3RA7L 1KCSH 2H9GB 3HMXL 5FYJL 5DHYB 4R96A 4JJ5B 3FQWA 2MFNA 4O2EB 5IW1A 3FZUD 4Z7WA 5DD6A 2A1WL 1M71B 2AJ3B 5JTWA 2W9DL 3QXUA 2P7TB 3EOBB 4Q58C 4DCQA 3MFFA 5TH2A 1CFVL 1OT1A 2IAMB 4N90E 5IFJB 4XPBH 2CSPA 5TFSL 5C0EB 5D1QD 2QTEA 1AJ7L 2E6QA 2CDEB 1UYWH 1X5LA 3P11L 2AXFB 2HT2C 3Q0HA 5F7LB 5GZND 5BJTA 2CXGA 3N1PC 1NMAH 2JB5H 2W38A 4HWNA 5JIHA 2WWKO 5F3BA 3RUGA 4PRAB 1SJEA 4G3YH 2AJSL 3SQOL 4KDVA 5L7XL 3HE6D 3KPOB 2DKMA 4U7SA 1LEGB 4XPFL 3MRKB 4YHOL 4NRZB 5KJRH 1MLCB 2I60L 1HSBB 2J4WL 4JY5L 2E8YA 1OARH 1NGWB 4EJ1C 2BSTA 4TUKH 4MQTB 4PLNC 3RDTA 3LQAH 4BQBA 2EKJA 2XTJB 3VGAC 4MXQD 3HS0B 2RHEA 4M03A 1MI5B 4JFFB 2XPGA 3ZL4L 2X5PA 5KVMC 1MCBA 5J1AB 3W11D 3OKOA 3K8KA 4HV8A 5IW6A 1C7TA 3SO3B 1MIEH 4HX1A 1INEL 4UMGA 1JFQL 5JMRA 3RZWA 3VXTB 5E6YA 4I2XA 2IPTL 2Y36L 5K9QI 4X98B 3N0PB 4MJIB 3FAWA 1CDJA 3DX6A 3UTZB 4HFWB 1AFVH 4NZTL 4KQ4L 1LO2L 1GRWA 3G5ZB 1MFCL 3R8BB 4G9FE 2NW2A 5FYJE 1BF8A 1CLCA 3O45A 4LFHD 4R97C 4JFHE 5EC2B 1DZBA 1RJZB 1HHGB 3BPNB 1JGDB 4PRBB 3UBXG 2R1YA 2PTTA 1A02N 3IAGC 2D31B 1CG9B 1F3RB 3QCVH 3FOMA 4LDEB 4HXAH 1F11A 5TGBA 1U8PA 2VLLB 4QWWD 1YYLL 4YDIH 3UTTB 1HDMB 5L2KD 1FVEA 4BH7B 3SBWA 4F9PA 1HEZA 4M4RA 1HZHH 4HWZB 4AL8L 5IM7A 2PR4L 4YXLH 3I3DA 5EOCH 3B5GA 3L5XL 1NCDH 4R8WL 5IKCA 2WUBH 3JXAA 4POUB 5I1IH 2A83B 3T1FA 3JUYA 5B8CC 3FRUB 3T4YB 2BMKB 1I85C 1RZ7H 2F5AL 3OQ3B 4LKXA 4LPXA 4MD5A 3HCVB 3GSRB 1G7HB 3WNOA 5DJYB 1XR8A 3MREB 4RMUA 3VXUD 3ZKXB 1JN6A 1EAPB 3D87B 4PJAB 5FDYA 5LGJA 1FV1B 3ZTNL 3I85A 2ARJQ 3ALWA 1ACZA 3LAFA 2CLZA 2DYPD 4HIHA 5DS8A 1G9NH 3VI4F 5JPMB 1ADQA 3HG1D 5CUSH 3VXSA 4JM2A 4MLSA 5HDQL 3O3BB 4RAUB 2D7NA 4RFOL 5FM8A 2PXYB 3ZDXE 1U91A 2KQMA 2ID5A 2YD9A 3D0LA 5TF0A 3NCEB 5DQ9B 2CDFA 4H0IA 2DLGA 3KR3L 3BPLB 1ADQL 4PJ9C 3ZHKA 5T3ZL 5KZCB 3PHOA 1ERNA 3CFDB 4M6ML 3RTQC 3OKEB 3HRZA 4KVCH 2X4SB 5IB2B 2V17H 5C07D 3SE9L 4WCYH 1YY9D 1U93B 4PRDB 3NCJH 5HHQB 1G9MC 3VJ6A 3CNKA 3WE6B 3KHQA 4I2XE 4JHWH 3SDDA 4OCSH 2CGRH 4LU5H 2E7LC 3S4SA 1DDHB 3HZVA 1DSFH 1C12A 3FFCA 4BH8B 3RKDD 4L8BB 5DYOA 4UU9A 4L29A 4XMPL 3VRIB 1UM5H 3ARUA 4JFQA 4MB4A 5B8CA 1FFPB 1ED3B 1KPVA 4WO4D 2ZUUA 4LEOA 1AD9B 1BX2A 1FYTD 4G5ZL 5GZOC 3T77A 5FUOH 1CGVA 4L4VB 1NSNL 3GBNH 3MROB 5GIRB 4GKOA 3ZT7A 1MF2H 5EUKB 3SDAD 2HMID 1LP9F 3C5ZB 3B3IA 1TPXC 2I9LB 4GW5A 1DFBH 5SWSB 2IH1B 4LNVA 3EYOA 3QNYA 4GKZB 4OD1L 1MWAH 3U2SA 2EH8H 1JRHI 3MRJA 1YEIL 4LSUL 5D5MB 4WI3A 1SYSA 2NY5C 4XNYH 3ARFA 4I8DA 3MLZL 3B9AA 3FCTB 1AO7D 1R3LB 5KSAB 1FIEA 3NPSB 2P5WA 4PLKD 4F7PA 4LPWA 1N59A 5SWZA 1CLOH 3CH8A 5BV7H 3JTSA 4PY8J 4U1MB 3MLSL 5B3NA 4I3RH 4WIQA 4PJ9A 2ATKA 3WJLA 5FO7A 4OZFH 2NY4C 4OLWH 2EDKA 1U58A 1EHAA 5BO1L 1E4JA 4PJIB 3KLAA 5ICZA 2R69H 4LSSH 4NQCD 1XFPA 4LASH 1XMWA 4NGHH 4WFGD 5E6IC 2JIXD 5TF1L 4XNXH 4UAOB 4UIKL 3KVQA 3VXSE 3VGBA 5T3ZE 1PJ9A 1P7KB 1S9XA 3QEHB 3TZVC 2E7LA 3W0WA 2C1OB 3L5IA 4H0GA 2FJFB 3D3VB 4G8FA 3MNZB 1P4BH 2DBLH 4KZEH 1WUNT 1F2XK 4NHCH 3QZWA 4G9DB 4RX4D 2OJZL 1NC2D 1G9ML 1Q0YL 1LHZA 2GCYA 3FO9A 1C1EL 1W0YT 3KYKL 5E94A 1PKQB 1CN4A 4EIGB 2BHUA 4NUJB 4Z7WF 2HT3C 5LBSL 4YAQA 5ITBH 3MZTA 1OCWH 4CADB 4L1DA 3DX9B 4LLDA 4ZYKA 3OJMB 1TVDA 1U41A 5T33L 4A6YB 3QWOA 1SQ2N 4YHIB 5E2UL 3B8YA 4NKQB 1LK2A 3U4EA 1MHCB 5FGSA 2IBBA 1BREA 4MJ4A 4LSTH 3K4DA 4UQ2B 5EBLB 3X3FL 5AYUH 1PYWB 1EEYB 2VOTA 3RUGF 5KVFH 2NY5L 3HZKB 4BELD 3DMMC 1CVRA 1MELA 4XCFL 5EWIL 4BM7A 5IOPB 4QHKJ 2IFFH 5F7EH 4DUXA 2HN7B 2ZCKL 3MLXH 4PJCA 3F12A 4XMLL 1UM4H 1S7VB 4XNZC 3QXTA 3KPLB 3OG4B 4HKBB 3U0WL 1RURL 1N2RB 4MZ2A 3DARA 1P69B 4JZJB 5E6IA 3RZCC 4KKLD 3UTSE 1PLGL 5E2VH 1CICB 4NM4L 3CX2A 4BFGA 5GQBA 5JW4R 3TZVA 1UB5A 2P5WE 4P23B 5SWZE 5I9QC 4DN3H 1CU4H 1GOFA 2FJGA 2YPVL 4MQXC 4WI8A 2QSCH 2WP3T 2BSSA 4U6XA 4N1HB 3OHXA 4UV7H 4LVOC 3H7LA 4QRUB 2BCKB 1NC4B 4NPYA 3JV6A 2VLRD 4PJGA 1B0WA 3VFWA 3RDTD 4DAGH 4D8PB 2XWBA 3EOTH 3IVKB 1D5XA 3HNVH 2IF7A 2RCSH 1KJ3H 1GAFL 1X9QA 2XY1A 5KTEH 1FL6A 5DK0B 1UENA 2VUOA 5ADOL 3GKZA 4Z9KB 2VQTA 3NN8A 5DFWH 2DM2A 4FQCL 3WS6A 5L6YL 5BW7A 1RI8A 5J0BA 2HP4A 3BJLA 2J3SA 4MNGA 1K2DB 1OGAA 4KK9C 4ODTH 2H1PH 4HWBA 4Y5XC 4ELKB 4M1DH 3OKYA 2NQCA 5IK3B 4K3JL 2Y06L 4WNQA 1UACL 3GI9L 3V0WL 3VCLB 1JF6A 1BD2A 4RGNC 4PFEA 2B0SL 3EFFB 1H3PL 2DQIH 2P44B 3QNZA 2X10A 2NR6C 2F8XC 3NGBC 4MVBC 4XWOC 3FQXA 4HWBL 5CP7B 3G5XA 3VFMB 2FIKA 2X70A 3G04A 1NGPH 2IAND 3RPIA 1NGZA 4RAVA 3QCTH 5A43C 3UYOD 5IVOA 5GS0C 4ZFOA 1V7NL 2VQ1A 3P0YH 3TCLA 4DTGH 4OLUL 1CXKA 5IJKA 1VFUA 4GMSH 2MSPA 1ZGLB 1CL7I 4OZIF 1JF1A 1ZT1A 5IB5B 32C2B 4B41A 2C3VB 4ZFOL 4MHHG 4OI9A 4JO3L 1JPGA 3VE0A 4O2FA 1ZKAA 4ISVA 3DBXA 1OHQA 3TN0A 2AXJA 1NCWH 4HUUA 1RU9H 3HB3C 3RU8H 3U79A 3R1GH 4P5TD 5A2LH 1LO4H 3HNTL 4OLXL 1INQA 3D5OF 3H9SE 4MYWB 4PJCE 2E9WA 2EDQA 4F7MA 1UXWB 4DW2H 2Q8AL 1MCSA 4JM2F 3P4NA 1JWUA 3WFDL 2W65A 5DJCA 1T89C 3TT1L 1HHJB 2WW8A 4RAHA 1PZUB 5DRXA 2IGFH 3DROB 4LGRB 3R06A 3SN6N 5DHVB 4PJBB 4YXHL 2R29L 2ARWA 4Y5XA 4H5SA 5HY9B 1IM3A 3PL6B 3CFIC 3QB7C 1BFVL 2HWZL 2PYEB 3LB6C 4WI2A 3RNKB 2PF6A 4GAGH 4JM2D 1A7NL 1VFAA 4OGXL 4FMFA 3SE8L 5DLMH 2EC9U 3TYFA 1ZSDA 2CPCA 1JGLL 1K3IA 1WT5A 4FP8L 4L3CB 3GIZH 4PJGE 4QGYA 3PGCA 4LHUG 5F7DA 4X6DA 5TPWH 1JZ6A 4XAWH 2EIZA 4YWGL 3QHFH 3U82B 5JPNA 2J8OA 3WIHH 2DI9A 3S88H 3LEXB 5D1XA 3GK8H 3O6FA 1JGEB 5F70A 4XBGB 1EBAA 4P3DA 3CK0H 5I0DA 1WEJL 1OGAE 2CK0H 4U6YB 5C8JA 4Q9RH 1ONQA 3PWVA 4ZSOB 2Y7QA 1TETH 4QRQA 4ZAKB 4L8SA 5GS0L 1BD2E 4JREB 3SDDD 3H3KA 1U36A 4QHMA 2BVEA 2ZOKB 3OAZK 5FECA 5C09A 1R3KA 2IPUK 3O2VL 1JNHB 4AEIL 3FFCD 4K3DH 4JPWL 2N4IA 3ZKMD 3QIUB 2APXA 4ODSL 5DMGC 4ONGL 3K74B 1T5XB 4RGOH 5FDWA 4KROB 1C5DA 2C5DC 2NY7L 5BS0B 4DVBA 2QHRH 5DHXB 1T89A 2DQJH 3UX9B 2A0LD 4CNIA 3RA7H 1BF2A 3HMXH 3BGAA 5FYJH 4JQVC 3TPKA 1FRGL 3IB4A 3LKOA 3L5WA 2WM0A 4YDLC 2E7MA 3MRPB 1UZ8B 2A1WH 2DM7A 3STZA 2W9DH 4XXDB 4KRPB <