1GGCH

Major antigen-induced domain rearrangements in an antibody
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
215
structure length
215
Chain Sequence
QVQLQESGPGILQPSQTLSLTCSFSGFSLSTYGMGVSWIRQPSGKGLEWLAHIFWDGDKRYNPSLKSRLKISKDTSNNQVFLKITSVDTADTATYYCVQEGYIYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG2A-KAPPA 50.1 FAB (LIGHT CHAIN)
publication title Major antigen-induced domain rearrangements in an antibody.
pubmed doi rcsb
source organism Mus musculus
total genus 35
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1993-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ggcH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ggcH01
3JXAA 2CLVA 3NCYS 4ZPTB 4HJ0D 4OCRH 2A6KA 4JFOB 3TESA 3LKNB 4AEIH 2Z93A 4ZNCD 4JFFA 3VCLB 4Z5RB 3UAJC 4NQXA 3S36H 1UKQA 4HBCH 4Z0XA 3B9KD 2QLVB 1Q72H 1BIIA 3BPCB 3MV8A 4M93B 5I73C 5LWYL 3G6AB 1F6LL 3MRLB 3I9GL 3TBSA 4YDLB 4YE4L 5ACZB 4MJIB 5C3TA 2VUOA 4DAGH 1HSAA 3QCTH 1QYGH 1ZMYA 2R2BA 1OCWH 1ES0B 4X0KB 5EUOB 2VKXA 4KHXH 1DLFH 3ZHKA 4JFDD 1EEYB 5HHVL 4QCIA 1QFWH 5CP7B 4FQQA 5GSRA 3LIZL 1ADQH 1ZOXA 5F21B 2FH8A 4BZ1L 3RL1A 3K8KA 2VQTA 4AZ8A 4RMVA 3QUMB 3Q6FB 4MQ7A 4UILL 1N2RB 1QNZH 1P7KA 1QLEL 2HYMA 1HNGA 2WIIB 1BOYA 5H94B 2E6QA 4XCFH 4PV8B 3S7GA 3MRMB 3MNVA 1E4WL 1F00I 2DQUH 3BT2H 2PYEA 3NN8B 4X6CB 3VFNB 3UJTL 5CCKL 3PL6B 1MSPA 5DZOA 3RVVC 1OAZH 4NQVB 5BRZB 4KJWD 4F37F 3F7VB 4ZTOH 3PV6A 5MENE 4M7LT 3K81A 1AXSB 3S3SA 3MXWL 1TZHB 2DWDA 3U30C 5J13C 1DVFC 3VA2C 5DD1H 3BW9B 3QQ4A 4XXCA 1A9EB 2Q8BH 1B6DA 4HC1H 4HJJH 5HJ3A 5EFIB 2VAAB 4PRAA 1ETZB 3LS5L 3MLYH 2QQKL 2F54D 2EE9A 4N0UB 1SYVB 4JHWL 3BDBA 2ZSWA 4PJ5B 2DMCA 4NQEB 4KROD 4NM4H 5I1KL 3VD9A 3RAJH 3CSGA 4JG0L 1KCVL 2EXWD 4AM0A 4QHUA 2FJHA 3O41B 5CUSH 4OCXL 1K4DA 1AO7A 4QRRE 4GJTB 1OGAB 3V6ZA 3T65B 2ESVD 4KRNA 1VA9A 3RVXC 3FB5B 1BBJB 3H3KA 5AG9A 1P1ZA 3EO0B 3GSRA 1OQXA 1YJDH 1XIWB 5SWZA 4P9HH 3D85A 2G9HB 4NNXB 2ZKHH 3C5ZB 5DS8B 4ZD3H 3PIQB 3KJ6L 4YAQB 4KQ4H 5D7JB 3A67L 5DJXB 4Q6IB 1DSFH 4KKLC 1H3XA 5I1AB 1AR2A 1JGUH 1R3JA 1RUPL 1CD1A 4BQ9A 3STZB 2I27N 2XA8H 5HVHB 1NGPL 2UZIH 4MAUH 3S37X 4MDIB 2MFNA 5L0QC 3JWDC 4QHLB 3BP7A 4ZODA 4YK4C 2CKBB 3DUUA 2GFBA 5FAAA 3V0WL 1R3KA 1UC6A 1OT1A 2CUMA 2J88H 4JRXE 4PJCA 3BESR 2ERJB 4TQEH 5I76B 4LCWD 2NX5E 4Y4HC 1GJIA 3MGTB 1H3TA 4LP5A 1JI2A 1LNUA 3DSFL 5AG8A 4OGXH 3L3DA 4MHHI 1OSZA 3TZVC 4FFYL 4FTVE 5IT2H 4YHIB 1NUNB 1T5WB 1ZVYA 12E8L 1HXMB 3TPUB 1AIFA 2AJVL 4GMSL 4PP2B 2NZ9D 1Z3GL 1WJ3A 3GHBL 5HYEA 1I1CA 1FNSL 5C6PB 4I3SH 1EERB 1UKTA 2W38A 5JLZA 3TYGH 4F2MA 1TENA 1JZ6A 2ZCHL 5GISH 5E8OB 4UT6H 3RVTD 1YEHL 3L1OL 2ICWJ 4Q0XL 4UBDD 4KVCH 1CFVL 4G6MH 5I8KL 5FYKU 3R0NA 3TIDA 3QO1B 1SJHA 1HH9A 4JY5H 2P8LA 4C58B 3RPIA 3GSQB 1YY9C 4LEXL 2BVYA 3FQXB 3H7LA 3EZ8A 1Y6KR 5D7LB 43CAA 4ZQKA 2VIRB 3MJ7B 3NFSH 4ONFL 5HHNB 3L3IA 5IMOA 4WW2F 3T77B 1RD6A 4OGZA 2F74A 4QF1A 1Z9LA 1RK1A 3GSNA 4NQSB 3LKRA 4HFUH 4CJ1A 2CLRA 4JHAH 5BXFA 4EDWL 5E7BA 4MGXA 2IH3A 1X9QA 2BNRB 4ZS6C 4Z7OF 3VI4E 5ICXB 3MV7E 5HGHA 3U0TB 3L95A 2E8ZA 4MNQA 1I1RA 1L0XA 3CFKB 1JN6B 4HIIB 2Z91B 2VZUA 2WAHA 5EU6A 3QUML 2CPCA 3SKOA 1WBYB 1WF5A 1OHQA 1NBYA 2BSTA 1ZT1A 2FB4H 4K8RD 4ODBD 5DSCB 5IESH 5GRUH 3U7WL 1WFOA 2XI9A 3CC5A 3T3PF 5F88A 1Z5LA 3TV3H 4PJFA 3QG7H 3C5JB 3VRIB 3ARDC 3PGFL 2EYSB 3RNQB 1D6VL 1BOGB 4CDGC 2CJUL 4C4KT 4NO5A 4NZTH 3KPPA 3H9SD 2NLJA 5CP3H 4Z7UE 3JWNC 1IAOA 3MLRH 4J1UB 4NKIL 4JN2B 3DXAE 5DGRA 3KPMA 1A6AB 1F4XH 3VWKD 3F8UB 3PQYE 5DD5H 4PJ8D 5DD0L 3ECBB 3R8BB 3V79C 4XPAH 2C3GA 4B7IA 3SCMA 5EUKB 3MREB 5FYKH 5CGMA 3GIZL 1QBLL 4EOWL 4JQIH 3KLHC 4KTDL 1I7UB 4XWOC 3FQRB 1REIA 2LU3A 4PJIE 3DV4A 3SPVA 3G5ZB 5GRVK 1E4XH 5C71A 2AV1A 1I7ZA 2WMPA 1OAKH 3SGKA 3EYUH 3JBG7 1R0AL 1MWAB 3G6DL 1K5NB 1NGQH 1OGAD 1J0HA 1P4LA 2A73B 4P23B 5HGAB 1BF8A 2GQHA 1FN4B 4O4YH 4R4FH 2YK1H 4GW5B 3Q6GH 5GJSL 3I3BA 3OQ3B 2YC1B 3FQTB 4I48A 1U91B 4ZUUA 4P2QD 4OGAD 3T09A 5EU5B 2Y36L 2Q86A 4PJ9A 4LRNL 1IL1A 1IFHL 2A9NH 4YHOH 2YPKB 3HNSL 2XYCA 3RY6A 5TDOB 4ZPTA 4JFOA 3LKNA 1K9TA 1XAUA 3CFEB 4Z5RA 3A6BH 3VCLA 1CK0H 4FXLA 3B2VL 3G04A 3N9GL 2EDHA 4QWWC 4KZDL 2CMRH 2IPTH 4C83B 3BPCA 1NFDB 1XF4B 4QLRA 4IOSD 3G6AA 4X6DF 3MRLA 1OTSC 3QP3A 5FM8A 4V1DB 1CWVA 2X70B 5JORB 2E3VA 2FGWH 5ACZA 4DOHB 4MJIA 1BQLL 4WO4B 3O8XB 4EVNB 1AY1H 1ES0A 4IMKC 4X0KA 5EUOA 2P42B 4ELMB 2ZUTA 4UINH 5FKAB 5CD3B 1H3PL 5CZKA 4KK8C 1EEYA 1JF6A 5B22A 5CP7A 1KCUL 5DC9B 4BYHA 5I8OH 1LP9F 4TUOB 5DLMH 5HI3D 3M07A 1CU4L 3QUMA 3Q6FA 1T0NA 2R29H 5D7KE 2E6PA 4FXKB 5JMRA 5TDNB 1OTUC 1N2RA 3U6RB 3DIFB 2YWZA 2WIIA 3BXNB 5H94A 4PV8A 5IGXH 3MODL 2X4UB 1BM3H 4YX2L 3RZCB 3NN8A 4X6CA 3VFNA 1BECA 1NCUA 3QIWD 3PL6A 5BRZA 4NQVA 2QQQA 3BHBB 3O11B 2P47B 3QEUB 3BYTA 5FHBL 3F7VA 4F7CB 4H8WH 2V5RA 3X3FH 3FKUS 1N5YL 3S37H 1AXSA 5DMIH 1A7NL 4ODWB 1S7XB 5JDJA 1FIGL 3BD5A 4L8DB 1TZHA 3EJZC 5GRXG 1KEGL 3O4LB 5D96C 5DMKB 3OXRB 5A2FA 3KXFB 2F15A 3BW9A 1EHLH 1A9EA 5DUPH 3VRLF 3RTQA 3EW3B 3O2WH 5I6XC 5EFIA 4DJMA 1ETZA 3VXMD 5GGRB 3V6OA 3TBTB 1VPOL 4N0UA 1MVUB 4NJAH 3MR9A 4ZSOB 4TUKH 4PJ5A 4NQEA 5C9JB 3K2MC 4NQDB 4NO0B 3DYMA 5F7UA 4MD0B 1LO2H 1U0QA 1S3KL 4QRPD 4RMSA 1U8KB 3D3VD 4P46B 3O41A 1A0QH 4LCCB 1ZA6B 5ITBH 1IJ9A 3BO8B 3P9MB 2B1HL 1G9MC 3T65A 1PYWB 5IIEB 4Z7QE 4I0PC 3V95A 1RVFH 2JCCB 3FB5A 5D7IB 5CJXC 1XCTB 2FL5B 2NY6C 3AY4A 1MCPL 1QQDB 3AREB 5GJTH 3BRGC 1XIWA 3BFOA 3MFFB 3NPSC 4FG6C 4IMLB 5F3HB 3QUYB 2XWBB 2R2EB 3BP4B 1KPVA 3ARGB 4NZUH 4QHNB 2FEDD 3HE7A 1ZLVH 3C5ZA 3GSVA 4X6FA 2C1OB 3QR2A 3PIQA 3U4AA 5IM7B 4YAQA 3WLBB 5D7JA 1ZHNB 5DJXA 3SKMB 3TPKA 1JL8A 4Q6IA 5I1AA 5HHQB 1K6QL 3NIGF 3STZA 4JO1L 3WNPA 5F9OH 1T2JA 5F72S 1ZKAA 5E9DB 4QHLA 1ODAA 4IOFC 2V6HA 4QY8B 2EZ0C 1UZ6E 4AG4H 1YC7A 1CFTB 4P23D 3MNZB 4U1NB 1ZT4B 1FZKB 2EC8A 2AK1H 5I76A 4XCNB 4M43L 1UGNA 1WIOA 1FFQA 5HPOA 3C09C 5J57B 5T3ZL 4GBXD 1BEYH 1OLZA 3HCVB 4YXHL 4YHIA 1T5WA 2NY3C 2WUBL 4QXGL 1HXMA 5MERA 3TPUA 5K9QG 1AXTH 1J10A 4PP2A 5GGQH 5LKNA 4OFYA 3AVEA 1FZMB 4PJEB 2UWEB 2ARJQ 3QEGH 5FYLE 4BZ2H 1AGCB 2I9TB 1CCZA 3O3EB 3MJ9H 1Q8MA 2H32H 1H5BC 4BK4A 5E8OA 4FQCL 1CI5A 4BZYA 2B4CL 4K7PL 1XGTA 4EZMA 3CVIL 1CDYA 2CIKB 3G5VA 3UTTB 3QO1A 2AJXH 1I1AD 2PYFB 5IG7B 4JO2L 2VLME 2ZZUT 5JXEC 1JYVA 4XAWL 3L9RB 3O45B 1BZQK 2YA0A 3FQXA 5D7LA 3T8XB 2W9LA 3HPJB 2VIRA 3MJ7A 5HHNA 1YQVL 3DRTB 3QHZH 3NVQA 4KV5F 1A7BA 3AS1A 3T77A 3M1BB 2OZ4L 4YFEA 3T4YB 1WCBB 1CD9B 2NY4C 1KCSL 3WXWL 1D9KC 4NQSA 4JVWA 5IQ7H 4NNPL 3RZWA 3ZKSD 2ICWB 2UY6A 4UU9B 5BS0D 2BNRA 5ICXA 1YPZB 3U0TA 4YEEA 3NFNA 3ZTNH 4A6YB 1TQBC 4HQQL 4KI5F 3BZDA 3CFKA 1JN6A 4HIIA 2Z91A 1H9VA 5K93A 2QHRH 3CCHB 2EO9A 3MUZ1 4XP9H 1IC1A 1CLYL 2XT1B 1PJ9A 2O93L 3HAEB 4S1RH 1BX2A 2XWTB 5DSCA 3VFOB 3ULUL 5IW3A 2JIXB 1FYTE 5MI0C 4F80A 1UADC 1U36A 3X17A 4X6BB 4M1DH 4M5YL 2AXFB 5DZLA 3C5JA 3VRIA 2IAMA 5DHYB 1ZS8B 2EYSA 3RNQA 4I3RL 1BOGA 1C1EH 3KYAA 4P9HC 4GKSB 4PG9B 3MZTA 4PJXE 2HT4C 4J1UA 1FE8H 3S97C 3OWEA 4OF5A 4JN2A 1A1NB 1N3NB 1Y0LB 1A6AA 2EC9T 3SQOH 4WWKB 3PDGA 5D8JH 3ECBA 5EUKA 4Y2OA 3MREA 1FNHA 2H9GB 4DEPC 1RZ7L 5IHZB 5IUSA 5DJ6B 5HYQA 1I7UA 4XPFL 3FQRA 3RBSA 2WUCH 3MV9B 4XNXL 2AV7B 4M5ZH 3Q2CA 4F33B 4R4ND 4U31A 1DBKH 1K5NA 2FIRT 2A73A 4NN6B 3W5MA 1A8JH 1MF2H 4GQ9L 4KXZI 1F42A 3PWJB 3GDBA 3T04D 4GW5A 5J3HC 1RU9H 2QR0B 4RFOH 5DJYA 3F7PC 1MHCB 4R7NB 3C6LA 1U91A 3KLAB 2E9BA 5EU5A 4Y89A 2BHYA 3ME0A 2DQEH 2YPKA 4O2FA 4FQ2L 4HUMB 4GXVL 1CE6B 3VI3E 3BP5B 1TVBB 4O51B 4DZ8A 4PGBB 3RGVD 2SEBB 1I1FA 5I74B 3CFEA 5JOPD 1OARH 2F19L 1KLFA 3QEQD 3I3DA 4NUGL 4BFBD 1F4WH 3OPZL 4C83A 3X12A 1NFDA 5GS0L 3IF1B 1XF4A 1OW0A 3BPOC 4OLYL 1OP5H 3S6CA 5CIPB 4TOYL 2D7QA 4MHHG 4WCYL 5J6GB 3GJFK 1MY7A 4V1DA 2X70A 5JORA 4QT5B 2XZCH 5EWIL 4WO4A 3O8XA 2ZSVB 4EVNA 5IFJB 4FFZH 4ELMA 3QH3A 3OKEA 5FKAA 5CD3A 5JW4R 5M94B 4ZXBC 2Y4SA 4Y2DD 4DKFL 4XP5L 1Q9KB 2AGJH 5B3NA 5I9QB 5JOFB 4TUOA 2VUYA 5KSBF 5EC2B 4JN1L 5TDNA 4UTAH 5KSAB 1RIUH 4RX4A 1Q0XH 1ZHKB 3DIFA 3O6FD 4ODTL 3BXNA 4P3CH 5T3XE 4XP1L 4K94L 1F2XK 2OTWB 4POUB 2X4UA 2PO6C 4NN5B 3ZKNC 1S7UB 1TNNA 3L5HA 2XZQL 4RGNC 3O11A 1RUAL 5FB8B 3QEUA 1J0IA 4F7CA 2BFVH 2NYYC 5B39G 2NY0C 2Y07H 4X4YB 4FP8H 4YZFE 1G6RH 2MTPA 1S7XA 1E4KA 4L8DA 4LASL 1WZKA 1VFAB 5EOQL 3O4LA 5DMKA 3CSBA 3MLXH 3MRRA 3OXRA 5I8CB 4CJ0A 4WU5B 4WFGD 3V4PL 4MB5A 2V2WA 5T1KB 1NPUA 1L7IL 4JFEE 3BKYH 3BVNB 1PD6A 5MENB 3KPRE 5GGRA 2W92A 4OLWL 3TBTA 1MVUA 4ZSOA 2RHEA 1HIML 4F9LC 1XF2B 1IC7H 3LB6C 3QRGL 5C9JA 4NQDA 4NO0A 4MD0A 1SEBB 4IRJC 4DVBB 3NAAL 3VXNB 1U8KA 2X1PA 1SM3H 4P46A 4F57H 3P30L 3FCTB 4LCCA 5F1IB 5BW7A 3TVMC 1ZA6A 1EMTH 1RIHL 2CR3A 2ZUXA 3P9MA 3ZSSA 2PW2B 5IIEA 2YPLE 2JCCA 2CDFB 1U2CA 1EO7A 2C9AA 4KY1L 5D7IA 1N59B 1XCTA 4MSWA 3STLB 2Q20A 1QQDA 3AREA 4MQXD 3MFFA 1AQKL 4S1QH 5F3HA 3HZMB 3QUYA 4GRWE 5JPNB 2OR7A 2R2EA 2XWBA 3BP4A 5CINL 5BO1L 4JAMB 1MFBH 4QHNA 3S4SB 5GS1A 5EU3B 3ULVD 1A4KB 1HN1A 1L0YA 2C1OA 4MXWL 5IM7A 3WLBA 4JHZA 4QRRB 3KYKL 1ZHNA 3QDMD 5EZLB 1I3VA 5L2KD 1I7TA 1OQOA 3SKMA 2ENSA 3GSWB 4PJGE 1B4JH 1BJMA 5HHQA 4O9HH 1P4IL 3WN5B 1PVHA 5DMGC 5ADOL 4XP6H 5D9SB 4MXVF 4Y4FC 4Q9QL 2NY7H 1Q38A 2EH8L 3ULUF 4JO3H 3VD3A 2OX5A 3V5DB 4QY8A 3S3JA 5IQ9A 5AAWA 5FYJE 1KJMB 1CFTA 2F8OA 3AAZB 2R1YB 3MNZA 1ZT4A 1FZKA 4XCNA 1T04B 3UTSE 4BQ6A 5DHVH 1IEAB 2HFGH 4AJ0A 4PRDB 2ZCLH 4MDJA 1GGUA 5LVEA 1T66C 4TVPL 3H2WA 3GMMB 4HMDA 1KELL 4LSTL 4NGHL 3DX6B 5JDSB 4W68A 1NANI 1J0ZA 2BVOB 2X9XA 1FZMA 2C4FT 2UWEA 4JRXB 4OZFG 2CH8A 2NX5B 1AGCA 4RAUB 5DHXB 2I9TA 3O3EA 1X4XA 4HJGB 2F53D 3QXDB 4FTVB 4S1SL 4I0CC 1HZHL 3D6GA 4TNVK 3WDJA 3RHWK 4YPJA 3QUKB 5KS9F 1CXEA 3UTTA 3GKWH 1NEZG 5IG7A 2W65B 1KIRB 3NCJH 5GZOD 3L9RA 5ID1B 4GSDH 3O45A 3NACH 3QI9C 3T0EA 3HC4H 3T8XA 3HPJA 4LPXA 4YHYC 3DRTA 1TMCB 4NC0B 3S34L 4YXKH 2DMKA 3M1BA 3FZUD 1P4BL 2JCCF 2YD3A 3T4YA 1PFCA 5D71H 1WCBA 3P0YH 1IQWH 4WUKH 4XAKE 4HS8L 2J4WH 5F89B 3E1F1 2OMNA 5E5UB 2ICWA 3P4NB 4UU9A 1FORL 1YPZA 4A6YA 4XH2B 4QXUL 1DDHB 2YZ8A 1IGTB 4XC1H 2P7TB 2A6DA 4L4VE 3CCHA 2FX7H 3MV8D 3HAEA 3VFOA 2A9MH 1X5YA 3HNVL 2JIXA 1NCCL 1KIPB 4X6BA 3P73A 2R0LH 2A0LD 4JM2D 2AXFA 3LHPH 2CO6B 5DHYA 1ZS8A 3MV7B 4IRSC 5T1DH 2BSRB 3GBLA 3ZYOA 4GKSA 4PG9A 5E99H 4PG2A 4ERSH 3L3HB 3LKQB 2R4SL 3N1PC 2DQGL 1JRHI 1A1NA 1Y0LA 1JMZA 2AW2A 2FLBT 3X11B 4WWKA 3U1SH 5T1KD 2JB5L 1MJ7H 1JJUA 4UNUA 4Z0BL 5L8KB 1P9MC 4RRPG 5MEND 5CSZB 4IJ3B 1ZVHA 1JF5A 2GEEA 2H9GA 2DS4A 5IHZA 4N0CC 1LDSA 1UB6B 4GXUM 5DJ6A 5EZIL 2AJSH 1AJ7H 3MV9A 2AV7A 1IKNC 1MAJA 5I73B 3PQYB 2AEQL 4J7RA 5BMFH 1F4YH 2YZ1A 1J0JA 2ZOLB 4HHAB 2P24B 3IDNA 2IQ9L 3EFDL 2QR0A 3N1QC 1MHCA 1MNUH 4M7LH 1EVUA 3JTTB 4P99A 5J7CC 3KLAA 3ARBC 4PJIB 2FGZA 1FGNL 3MLSL 4XNUH 4IBLT 5KOMC 2HWZL 3SE4C 2HG5B 1CE6A 3BP5A 1CFNB 1TVBA 15C8L 4PGBA 5CD5D 2CO7B 4GO6B 1VADA 2SEBA 4UTBL 3V6BR 3AXLB 3QNXB 4NUJB 3GHEH 4RMTA 1WQVT 5IEHB 3HUJE 4OF8A 3S88L 2LAAA 5EOCH 2DICA 3IF1A 4Y4KC 3SDXB 1NCBH 4NBYB 4R4BB 2R1XB 4FFVC 2J1KA 5J6GA 1YQ2A 3F6IA 1MAMH 1T21B 3FO1B 4QT5A 4UDUB 1OPGH 4OAWA 1J1PL 4LGRB 2YXMA 1NCAH 3CSYB 3K0WA 5IFJA 5D1QB 4H0GA 1GHFL 3EYVB 5ECJE 2BVPB 2Z31D 3M8OL 1PG7L 3DVFA 3LEXB 5BVJB 3U30B 1C5BL 1Q9KA 1DVFB 4JRXD 5JOFA 3OXSB 4PJDB 1CGTA 5LWYH 2NX5D 5EC2A 3S35L 4MA7H 4PB0H 5KSAA 1ZHKA 5K33A 4YE4H 4HXAL 3VXRE 3UX9B 2VQ1B 3ESVF 3SY0B 2E9IA 1RPQA 5I1CH 2FNBA 4H0IA 4PJHF 3MRKA 1PX3A 2OTWA 4WI3A 1H3GA 5IROC 2D7TL 1S7UA 1KENH 1A6WH 1YDPB 3V52L 5EOTB 5FB8A 4ZUVB 1X5FA 4UQ3B 4PP1D 5I15L 1FC1A 1FL3B 2UY7A 1EDQA 2HP4A 4X4YA 1J9CT 2R69L 1SYSB 2PN5A 5GRVL 3ETBF 5DA4A 3LIZH 4L3AA 2EEBA 2X1WL 4BZ1H 2YUXA 1VFAA 4R96B 5D2LF 3LQAH 4DTGL 3SKJL 3K4AA 1YEIL 4MCZB 1QLEH 3BJ91 1LO3L 5I8CA 1MFAH 1AD0B 2KL6A 4WU5A 1TXKA 4QXTB 3FFCE 1NC2B 3Q0HA 1I4FB 3QPXH 2BNUB 1E4WH 2DI9A 3BVNA 2VXVH 4R6UA 3DBXB 2ZUQC 3BGMB 4GRLD 5E70A 1XF2A 1JGLL 4PUBH 1VERA 5JW3H 1GZQB 3E8UH 1DLHB 1WAAA 1SEBA 3INUL 3UXFA 4DVBA 1FFPB 3VXNA 5L0QB 1DEDA 2Z4QB 4Y5VA 5F1IA 3ALXA 4W6YB 5T5NF 3BAEL 4D3CH 4KKCC 2IMMA 2PW2A 2E7LC 3RIAF 2OS7A 3T0DA 3N06B 3MV7D 1A7RL 2CDFA 5FF6B 5D2NC 3STLA 1N59A 3R4DA 4NOFA 1MCIA 3SGEI 4WI2A 3H42H 4OGYH 1X5LA 4B50A 4Y19D 2ARJB 3SJVD 35C8L 5TE7H 1K3IA 5D1ZD 3TZVB 1T20A 4JHWH 4JAMA 3S4SA 4FQIH 1A4KA 3UDWC 1PSKL 3GSNH 3BE1H 2X4RB 4ZMAT 5I1KH 2R9HC 5JHDE 4QRRA 2X7LB 5H35B 1EFXB 1KCVH 3ELAT 3GSWA 4LLMB 4NP4L 5FO7B 3WN5A 3ZT7A 2BCKB 3QUZC 3OGCB 4WWID 1NC4B 1A2YA 1QSEB 4KK9C 3DXAD 3LN4B 5D9SA 3DVNB 3B2UC 2NXZD 1KJ2B 3V5DA 3C60C 2MKWA 1L7TH 1KJMA 3KDMB 3AAZA 2R1YA 4G9FE 4MJ6B 1I9RH 2YR3A 1OL0A 1T04A 3PWUA 1GGCL 1IEAA 1I8KA 3ARFB 4N90E 5EULV 4PRDA 1G1CA 3GSOB 3A67H 2QQNH 3O2VL 3RP1A 3SOBL 5FO9B 3GMMA 4KDTA 3T2OA 3SGJA 3DX6A 1BD2E 4LAQL 3BISA 1MCEA 1KEML 3RU8H 1RHFA 2FD6L 1X4ZA 4LHUD 3REVB 4RAUA 3UTOA 4HJGA 3V0WH 3MJGX 3DO7A 3EYQC 4YLQT 1WEJL 3QXDA 4JG1L 4FTVA 1IAIL 4LNRB 1OVZA 4XPTL 2CGRL 3OF6A 5C70A 1I9EA 3R1GL 1X5IA 4J4PA 3MOAH 2W65A 4MJ4A 1KIRA 3VXUE 2RCSH 2QJDA 3DMMB 4LK4A 5ID1A 1MIEL 1Z9SA 1WAAF 4MWFB 2Y9RT 3W5NA 1Z3GH 5D1QD 5CZXD 5EBGA 3WYRA 3ARDB 1LILA 3QQ3B 5E5MB 1GOGA 1UM4L 2ZCHH 1SQ2N 5HGDB 3EOYG 1MUJB 3JUYA 2GJ6A 4PIRF 1CFVH 5F89A 4JRYE 3FB8B 2GW5A 5ALBL 3P4NA 3D18B 3MACH 5D1XD 2M1KA 2H6PB 5HY9B 4XH2A 1DDHA 1RZ8B 1QG3A 1IGTA 4LEXH 2P7TA 4YHMH 3HKFA 4PJ7B 5C0FB 1T22B 4NHUB 3DO3A 4IS6B 4X5LA 3MGOB 1KIPA 4NQCD 4XVSL 3IVKB 2LV4A 4P5TD 3HG1D 1PKQE 1EUTA 4FZ8L 5CZVL 2BSRA 4PGZA 4XTRD 3DETC 4EDWH 5I1GL 2DQCL 3L3HA 3TT1L 3LKQA 3BDXA 3X11A 2EECA 1FLRL 2VXSL 3LKPB 1FYTB 3K2UH 1JHKL 4LMQE 3MLWL 4TPRH 3QUMH 4QYOA 4UV7H 3D48R 2QSVA 3GI9L 5K59E 3RY5A 4BSVB 1UB6A 2DQIH 1P53A 1D5ZB 2WBKA 4PJXB 1J7VR 3OZ9L 1KLUB 2E7CA 1EAPA 1S7WB 4P59L 1FFRA 1D6VH 3P11H 2CJUH 3VWJC 1P69B 4FABL 3JV0A 5C3LD 3PQYA 4O5LL 4G8IA 3U9PH 1YECL 1NAKH 1WTGT 3LEYL 1IZJA 1O0VA 1XGUB 2ZOLA 4HHAA 2P24A 3ZDXE 3CK0H 4OLUL 1TJGH 3L5XL 5DD0H 3JWDL 4PRHD 2H2PD 3JTTA 1EO8H 4NZRL 3F7RA 3VXSB 2E5EA 4EOWH 2CDGB 3MLVH 4KTDH 3BGAA 1DQML 1I1YA 1MJUH 2HG5A 3QO0B 1ZLVK 3U4EB 4ZG1A 5GGRY 1A3LH 4KTEH 4UUJB 2J8HA 4P2YA 4U6YB 3SDCD 3BJLA 2D0FA 4XVTL 1MCRA 1R0AH 3AXLA 3QIBD 3QNXA 4NUJA 3QXAB 4MAYD 1TETH 2C7UB 2HJLB 1PDKA 4NC1C 5IEHA 2OK0H 5TGBB 1FG9C 4X83A 3SDXA 2D31B 1LK3L 3VFWB 4R4BA 2MOVA 1JRHL 2R1XA 5DJ0A 5D5MA 2K3TA 5HHOA 2B5IC 1U8LB 2NY2C 2BNQD 2YUVA 1T3FB 1QSZA 3H3PH 3FO1A 1EFQA 4LLVB 3V8CA 1RZGB 2Y36H 2NTSP 5DO2D 3SE9H 4OLVL 1WZMA 3CSYA 2IPUK 2HFFB 3EYVA 5DD6A 4L29B 3PP4L 1JWMB 1GPOL 4AMKH 3LEXA 4WHYH 4HEPG 4ZS7L 3ZLQC 3B2VH 3HE7D 1DVFA 3MXVL 3NABH 1JF1B 1E27B 3OXSA 4PJDA 2XTJC 3TA3C 5LGKA 4GAFB 5I6XB 3O4OC 3BH8B 4I77H 3K7UA 1C12B 3MNWB 2VQ1A 3SY0A 2R4RL 1BMGA 4LSSL 3WNLA 2CKBH 3GI8L 5LCVL 2YD4A 3JV4B 5EOTA 1TLKA 2ITCB 5F71A 4ZUVA 4UQ3A 1FL3A 2WP3O 4OCSH 5TH2B 4HIXH 1SYSA 4OF0A 4X4ME 5FA4B 5HXMA 4O00A 2VYRE 4UV4H 5KVGL 1FIEA 4R26H 2MJWA 2HT3D 4CRPA 1G7IB 3KVQA 4R96A 3MCG1 3DVGA 2FHFA 3W2DH 5ELIA 4MCZA 5I2IB 1FNLA 4JDTL 4LSQH 3NPSB 4PLNC 1AD0A 4QXTA 4XGZB 1NC2A 2Y6SD 4UIKL 5E0QA 1I4FA 3MODH 5CLWA 1GGTA 2BNUA 3AUVA 1ZLUH 3DBXA 3EYSL 1U8OB 5D7SH 3BGMA 5IVXE 3UPAA 1BREA 1BWWA 1UM5H 2AP2A 2IPKA 1N6VA 1GZQA 2HH0L 1DLHA 1N5YH 1HOCB 4ZUWB 4JR9L 4NN7B 4XPHL 1OP3H 2Z4QA 5DWUH 4WDIB 5ADPH 1J5OL 1AGEA 4JFEB 3QDGE 3TBWA 3C8DA 5C6WH 1YEKL 3SDXF 3KPRB 3N50A 3RWHB 5D5MF 5FF6A 1RAMA 4J3XA 5EIVA 3WHXA 3W82A 4ZO9A 2ARJA 4YHKL 4LLAA 1NQBA 3TZVA 3C9NB 3IB4A 4AEEA 2EDDA 4GRMB 4LSDA 5LGJB 2X4RA 5AAMA 2D3VA 3L6FB 4I2XA 3S96B 1S3KH 2X7LA 1IEHA 5H35A 4RGOL 3VJ6B 4JKPH 1EFXA 4OBRA 5SWSD 4X7FC 2YPLB 3MTRA 4P2RD 3UJJL 4LLMA 4RA0C 5E6IC 5B39B 5FO7A 5IHLB 2VB5A 1WV7T 2BCKA 4HCRH 4G8FB 1J11A 3OGCA 1U6AL 2B1HH 4PJDF 3W0WE 1NC4A 1QSEA 4X5XA 3LN4A 4GRWB 5HDBE 1LO0H 2A77H 1KJ2A 4IM8A 3KDMA 2EICA 2VAJA 5HYJD 4HEME 3QDJD 3ARFA 5SV3A 4PJGB 1DBAL 3VXOB 2PF6A 5GS2D 3EO9L 4NFDA 1UYWH 3BUTA 1S7QB 1NMCC 2LQRA 3F5WB 5FO9A 4K9EC 2WWKO 1V7ML 4GG6F 2B8OT 3ZYZA 1K6QH 2LE9A 2DLGA 4HJ0C 5TPWH 5CBAB 4JO1H 3PP3H 3L3GB 2X4OB 3AS2A 5EG6C 2FJFB 3MPCA 3REVA 3B9KC 3VMNA 2VDMH 4OIIL 4LNRA 2HMID 2BX5A 3A6CL 1MFDH 4OZIB 1TQBB 1FYHB 2NW3B 1S9WB 4O2CB 2FX8L 5JUEL 5INCB 4LSPL 5T3ZH 5EZJB 4U3HA 4YXHH 1OP5K 2D4DA 4Y8DC 1MWAH 2QADB 3DMMA 5MI0B 3PNWB 2WV3A 5F8RC 4QGYA 3SKUD 4MWFA 5F7FA 5C2UB 5C09E 5IB4B 2X89D 3LZFH 3HE6D 3LQAC 2OR9L 2OBGA 4KDVA 1QZ1A 3ARDA 4P4KC 3K80A 1JNNL 3HZVB 4FQCH 5HGDA 1MUJA 4TRPL 1DP0A 3VGBA 3S98A 5DEGB 1U8QB 5B3JE 5EN2A 2DIBA 3D18A 4DGVH 2H6PA 1KXQE 1OSPH 4D9LH 5HY9A 3FRPG 4U33A 4JO2H 4P9MH 3HLAB 4D94A 1O7SA 2BK8A 1RZ8A 4XAWH 5CMAB 2ZUYA 1F8TL 1D7FA 4LSRL 2UUDK 4DEPB 1KJ3L 2C4XA 4PJ7A 3KYOB 1T22A 4G3YH 4NHUA 2IBGA 4G80B 4IS6A 4KJWC 2PNDA 3MGOA 5JQHC 3VD4A 5C0RL 2A38A 4E9LA 3IVKA 5CEZH 3PWPD 1OAXL 3FHAA 4OZFB 1KCSH 4BFIB 4BQCA 2YXFA 1Q1JL 5T3XD 3RX5A 4NNPH 5I19L 4LLYB 4X9HA 1LEKA 3QIUB 4KJQD 3HRPA 4NC1E 5EB9A 3LKPA 1FYTA 4FNLL 4ZFFB 1G9ML 5AYQA 1EUUA 1BJ1H 1CLYH 1NEZB 5AYUH 4J2XA 4KROC 1SY6L 1GRWA 3SDDC 4BSVA 3ARQA 3ZL4H 3MBED 4X9FA 1D5ZA 5FXCH 4M5YH 2WBWB 4PJXA 1KLUA 1R5VB 1T0PB 2EXWC 2FO4A 1S7WA 5CS7A 4OCRL 1MFNA 4AEIL 4S1DD 1UG9A 4KTYA 1EJOL 4OF7A 3S36L 2MQ0A 4HBCL 4EN3D 1Q72L 1H3UA 4XXDA 3RX7A 4P3WA 5J4MA 1DCLA 5F44A 4ETQB 3RKPA 4IMKA 1ZVSB 4KUCF 5L6YH 3VGHA 3VXSA 2CDGA 1INQB 1QYGL 1OCWL 3NA9H 4XPFH 3QO0A 3WV0A 5L7XH 2VDLH 4ZXBB 3U4EA 5C8JB 2JTDA 4KHXL 1TNMA 1QRNE 4UUJA 1J8KA 4U6YA 4OD1H 3P3YA 4D9RD 2NXYC 2ZOKB 5GGSB 1QFWL 3QXAA 1ADQL 4CVWA 1A4JB 2C7UA 2HJLA 3GSUB 4GQ9H 2D31A 3VFWA 3SGKC 2PTTB 4WU7B 2C4FU 4NO2B 1QNZL 1U8LA 5ACMA 3ZYJA 2PO6B 1NJ9B 1T3FA 2VXUH 4LLVA 3LKSA 1RZGA 4XCFL 3RVUC 3BGFC 4PJ7F 2EDWA 3WEXB 1N6QH 4LVNC 1F3DH 5M95B 3BT2L 4FQ2H 4C55A 1HNFA 1ERNA 2HFFA 2NY0B 4JGUA 1OAZL 3TFKD 2ED9A 4L29A 3GMNB 1FVCA 1JWMA 4ZTOL 2NZ9C 5HYSG 2J8UE 2LAGB 4APQB 3SBWC 3OPZH 1JF1A 1E27A 3DRQB 4NNYB 4OLYH 3UTSD 1FCGA 5GS0D 3RVTC 4UBDC 3BH8A 5DD1L 1LE9B 3MNWA 4KRPD 1B9ZA 5E95B 7FABH 2Q8BL 2QEJA 3QZWG 1XT5A 3MLYL 1JWUB 3JV4A 2VDRH 4LCYB 1IARB 4PRPE 4KKBD 4NM4L 5TH2A 3LDBB 5FA4A 2BXZA 4XP5H 3RAJL 3TVMB 3VFVB 5KBNC 1JFQH 1G7QB 3C87A 3VXRB 1DQLH 2J6EL 1G7IA 2BMKB 4I0PA 1FPTH 4Z76B 2F5AL 5CUSL 5CJXA 4JN1H 3PXHA 5I2IA 1OTTD 4XHQA 1SY6A 3ARZA 1OD9A 1JPSL 4XGZA 2P1YA 1FO0B 4K94H 3L3OB 3RIFK 3NZ8B 1KGCD 1N8ZA 4P9HL 5BVPH 3LS4L 1EO5A 1U8OA 2J7LA 4DZBB 5BZWB 4AIXA 2ZKHL 4ZD3L 5IHUH 3MRNB 4KQ4L 5EIQA 3PL6C 5DJZB 1ONQB 3BIKB 1HOCA 4ZUWA 5GPRA 4U7MA 4XAKD 3U9UB 2X1XR 4B53A 5C07E 5EOQH 1JGUL 3FFCB 4LDLB 2O5YL 1RK0B 1CDJA 1N7MH 2XA8L 2UZIL 4MAUL 3KPRA 3RWHA 5L9DH 3QYCA 3V4PH 3LVEA 1IGCH 1YNTB 4Y5XC 3L5WB 4L4VD 2J88L 4OLWH 3VWKC 4RFEB 1C08B 3C9NA 2W91A 1X7QB 4PJ8C 4GRMA 1HIMH 6CGTA 1ZGLP 2Z8RA 3F6LA 3QRGH 4OFDA 5LGJA 1HHHA 5E7FA 1J0KA 4LRIA 1MFEH 4OGXL 4HUXB 3S96A 4Y16D 1BFSA 3VJ6A 2MMXA 2YPLA 3NAAH 2B20A 5C0ND 4A6YH 5B39A 2VERN 1NGZB 4BJLA 2AQ3A 4G8FA 3OB0H 1H5BA 4N5UA 1ITCA 3P0VH 3HAEH 4KY1H 2G2RB 3D2UD 2X1QA 3DWTA 3S35X 3JV6B 4UT6L 5JHDB 3TT3L 5CINH 1F2QA 4CVXB 1E4JA 1T2XA 4G6ML 4KI1A 5E94B 5JXEA 1I3RB 2OL3B 1XGQB 4PJGA 3VXOA 4P2OD 4JY5L 3WO4C 2BVTA 3F5WA 5CJQH 3WKNA 4LOUD 1S9VB 5HHMD 3GSXB 3MLZL 3PHOB 5CBAA 3NBNA 1IC5L 4Q6IC 5C0BA 4G9FB 3L3GA 2X4OA 4JY4B 4Q9QH 2FJFA 5K9OB 1D9KA 1VSCA 4Z7WE 4JFHD 1EZVY 4OZIA 4JHAL 2NW3A 1S9WA 4O2CA 1QPPA 1JHTA 5INCA 5EZJA 2ERJC 5ALCH 3PF2A 2J6EA 1JPST 1KELH 4NGHH 3IGAB 4TVPD 3PNWA 4TNVF 2V9TA 3RHWF 1RURH 5IB4A 2IGFL 2DTSA 2FB4L 4KFZC 2CDEB 5IESL 5EC1A 5T33H 4R90H 1NCNA 3EKCA 4LHQB 4P57A 3HZVA 3TV3L 1NSNH 4WNQB 5E8PB 2X10A 3QG7L 5HI3C 4G7YH 5DEGA 4PGCB 3VXUB 2QTEA 4U6VH 3U79A 1UZ8B 3VDAA 3MLRL 2ESVE 3BZEB 3BEWB 1HQ4B 1KACB 4MA8L 3EOBB 3HZKB 3HLAA 2VITB 5TQ2L 5CMAA 3WE6B 5DD5L 3QIWC 2AKRB 4XI5D 4ODVH 4WHCA 4XPAL 5CIPH 5L2JB 3HMWH 1KSRA 4G80A 5FYKL 1QA9A 1DQQB 4JPKH 4U3XA 1OAYH 1S5HB 4I1NB 3S34H 4JQIL 5J12C 1EAJA 2QSTA 4YEFA 4BQ8A 4JRYB 5F6HI 1RQ5A 2CSPA 1RZJC 1K4CB 4PPTA 3MYJB 3OJVC 5C0AD 4DN3H 4OZFA 1E4XL 4GXUN 2QKIA 4KMQA 5F9DC 3GGWB 1OAKL 3PJSB 3EYUL 1FSKB 4LLYA 2YKLH 3QIUA 4N9OB 1PEWA 4O4YL 4O2EB 4PD4K 1U8HB 3ARBB 4R4FL 2YK1L 4EUPG 4ZFFA 1EZVX 5E8NB 3CD4A 4ZO6A 3Q6GL 3MRDB 1JPGA 1UH4A 3CX5K 1LE5B 1NEZA 4WJ5B 3VFPA 3HNVH 1NCCH 1PKQB 3Q5TA 1MHPH 1QLFB 3RDTB 1FO0L 4YHOL 1YMHB 2RJMA 1R5VA 4LIQE 3MQIA 4HH8A 5F9AC 1DBJL 5SX4H 1CXIA 1XGPB 2PR4H 4K7FB 3LAFA 3NIDE 5JOEA 4OLEA 3A6BL 4Y4KB 4MMZC 5JO5B 4PGEA 2DKUA 4OZIF 2XKSA 2GITB 1U8MB 4L4TD 3FOMA 1IQDB 2JK5B 4EIGB 1CD8A 1YNKH 1SVZA 1MIML 2JB5H 3VMPA 4ETQA 3BDYL 4JRWA 3SO3B 5IMMB 5IFHH 2BOBB 2FEDC 4M3JA 1ZVSA 2WBJD 2FGWL 1MI5D 1F6FB 4N8PA 1LEGA 1K8IB 2BP3A 2L4OA 4ZXBA 5C8JA 1BZ7B 4ZAKD 1AH1A 4UINL 3SGDH 3O3AB 2DQFA 4OKVB 2K7PA 2WWMC 2ZOKA 5GGSA 3MRJB 1IM9D 3ORJA 5DLML 3GSUA 3DV6B 2JJVA 2PTTA 2R29L 3EFDH 1IAMA 4WU7A 4NO2A 3ZDYF 2EIDA 4P23C 4BK5A 2PO6A 1NJ9A 5ESVB 3P4OB 5E08L 5IGXL 2E7BA 3A0OA 2BVQB 3WEXA 4RRPA 3VH8G 1CLZH 15C8H 1J1OH 1IAIM 3CFIC 3EJJX 3GMNA 4Y0GA 2W60B 2DQHH 1EBPA 4H8WL 4L5FL 1B6UA 2OL3L 3S37L 5DMIL 4APQA 2LABA 3DRQA 3S88H 4NNYA 3VXQB 2WIMA 2VLJD 1LE9A 3RRQA 4U1HB 3IDXL 1CLOH 1EHLL 5DUPL 3H9SE 2ZUQB 3R06B 2C3VB 5IVNA 3O2WL 1BD2D 1AKJB 4NKDB 2HAZA 4FMKA 1JWUA 2X6MA 1QBML 4WGVB 4NJAL 4GMTH 4JREC 2OYPA 4WO4C 4LCYA 4TUKL 3M8OH 3O8XC 4WI8A 5EOCJ 5H37G 4XCEB 4UOJA 4I4WB 3TVMA 1C5BH 2HRPH 1G7QA 3VXRA 2BMKA 4Z76A 4F9PC 1NFKA 3L5IA 5D2NB 2OMBA 5ITBL 2HN7B 3BPNC 2X40A 4HXAH 1RVFL 2GKIA 5HI5D 4BSWB 1FO0A 1XCQB 3L3OA 4H26B 5FIEA 4BFEA 3NZ8A 2D7TH 2Z8WC 4KK5C 4DZBA 4NZUL 1M7DB 2Q1EA 5BZWA 3MLTB 5DUBB 4HWUA 1JHLH 4U1JA 3VGEA 3OJDB 3RZCC 3TO4D 3MYZA 3MRNA 1A9BB 5DJZA 1ONQA 3BIKA 4P2QE 1A7OH 4C54A 1XZ0B 3QUZB 4HAFA 1DQJA 4D0BB 4HWBH 4HIEB 3EIFA 2W0PA 3FFCA 2R39A 3DSNA 1DTUA 1VGKB 1RK0A 1YEIH 5EU4B 5DMJB 1RSFA 3C60B 1IAKB 1E4KC 3P4MA 3ZKXB 2YN3A 5HYIA 3BEVB 4XNZC 5IVXB 3OMZA 5SWQB 3L5WA 3DHMA 2IH1B 3BX7C 4RFEA 1Y6NR 1U8JB 2X4SB 5E00A 1JGLH 5JPMA 2WP3T 3JUZA 4JGMA 4HUXA 3QDGB 4PD4J 3CXDL 3INUH 3RUGE 2DQDH 2V5MA 4HS6B 1I3GH 4LU5H 3CFDB 3CX5J 5KZCB 1ZANL 2EKSB 3V5KB 3RDTD 1DL7L 1NGZA 1O5DT 3ZDZE 3BAEH 1DEEB 3SE8H 4P46C 4W4OA 4BZ2L 2G2RA 5BW7C 2GYSA 3E3QC 3MJ9L 3JV6A 3PE9A 4DFIA 1UJTA 3QBTB 1KIUA 5JHDA 5L88H 4CVXA 3B43A 5BV7C 5C2BH 5E94A 1KULA 1I3RA 5HHPB 2OL3A 1XGQA 2A1WL 5FGBC 4J12A 4FQ1H 2AJXL 3ARGC 4Z8FL 2MCPL 3W0WB 2P46B 1S9VA 4JCMA 1EIBA 4NP4H 4FN0A 2G60L 3GSXA 3PHOA 1MCJA 3RGVC 4LVOB 3AB0C 3QPQC 3EDKA 4JY4A 4QOKE 3EHBD 5K9OA 3IDJB 4JFZH 3ESUF 5FGCE 4QEGA 1QFHA 5HDQH 2VC2H 4URTB 1EJ6A 1WBZA 3MRIB 5HPMB 5GRJL 3HFML 2XWJB 1OGTB 1L9MA 4ORZC 3IDUA 2PTUA 4AL8H 1NGXB 3UAJD 1GGCH 5IQ7L 2EDTA 2EEDA 4B41A 5DD3H 1A02N 4HUWA 2HTLC 5DXWA 3SOBH 3RWIB 3IGAA 2VLLB 2QHRL 4XP9L 1VGEH 1RZKH 1CICB 4S1RL 1KEMH 5GIRB 1BPVA 2CDEA 5DK2B 2GCYB 4C56E 1I9JH 3H7BB 4Y2DC 2YD2A 1G7HB 4F7MA 4M1DL 1EA9C 2AK4D 2AXHA 4Q9RL 4QRPE 4WNQA 5E8PA 4JG1H 1A7PH 3RFZC 1IAIH 3D3VE 3MOQA 4PGCA 3VXUA 3IXTB 3X3GL 2BOCB 2HKHH 4XWGL 1BFOB 3NMEA 2RBLA 1UZ8A 1FE8L 3BZEA 5BJTB 3BEWA 4LSUH 1HQ4A 5FECB 5C09B 3EOBA 3HZKA 2NQCA 1PLGL 2VITA 2QV2A 1A1OB 5D8JL 2XN9D 2AKRA 1A5FL 3T2NH 3HNTL 5L2JA 3WFHB 4GS7C 1DQQA 1WT5C 4X9BA 4FXGA 3CZFB 5JIPA 4J3WA 1IKNA 1UM4H 1ZSDB 5DJAB 3RVVD 1A21A 3TBYB 2EXYC 1K4CA 1OB1B 3MYJA 3V6FB 4M5ZL 4OZ4B 2C3XA 3PJSA 2XFXB 4RWYL 1Q0YH 3BOVA 3WO3B 4O2EA 1MF2L 1U8HA 3ARBA 2IFGA 3OHXA 4K07A 5F7KC 4U7KA 5E8NA 4G8GB 4PRNB 1BBDH 3MRDA 2EH7L 4PLKD 5F9JB 4XMPL 2VDOH 3SE4A 1HCVA 4UB0L 4WJ5A 1NLBH 4FHBD 1PKQA 4KU1A 4KVNH 3OR6B 1ZLUK 3MBXH 2WW8A 3L5JA 5F1OB 1QLFA 4XVSH 3UPCA 1YMHA 2H26B 4HGWA 1YEGL 1T1ZB 3UROR 3V7AG 3RI5F 3UTZB 4K7FA 1XGPA 4O02H 4NQTA 1OARL 3MJ8B 4Y4KA 1OP3K 5IBLD 2F9BT 4NWTL 4XHJD 5JO5A 1FFOB 1T1WB 4YGVB 2NY2B 2GITA 1U8MA 1CGWA 2PXYB 2ZCKH 1FLRH 2JK5A 2VXSH 3TBVB 4P0DA 1IVLA 4MQXC 4M7ZB 4P5KB 1IKFH 4TSBH 5IMMA 3MUY1 2BOBA 3KHOA 3RVXD 4WWKC 3PHQB 3ULVC 4NRZB 4ODXB 4QNPE 1K8IA 5EO1B 2GK2A 5ID0B 5E2VH 4R2GD 3OZ9H 4FFZL 1BZ7A 5INDB 2FBJL 4X98B 3IFNL 5KZCD 3O3AA 1LO4L 2XRAL 1A14H 3MRJA 4M6AA 3TA3B 4O5LH 5IB2B 1YECH 5FFLA 3O4OB 3E6HB 3L3KB 4KKLD 4JHBA 3IAQA 4IDJH 3DV6A 1YMME 3ZE1E 5DR5H 3L5XH 4UTAL 1RIUL 5IROA 4NN6C 1Q0XL 2RQ8A 3V7AE 5ESVA 3P4OA 2MSPA 2ZUUA 2IQAB 1IGJB 1HQRB 3ET9F 4NZRH 4P3CL 2EKJA 2CXKA 2BVQA 3WKMH 3VGFA 1UCBL 4OTXL 4M8QB 4Y4HD 5MEPB 3UC0L 3TIEA 2WQ8A 2BFVL 1HYSD 4FP8L 5DURD 5L8LB 1JP5A 1G6RL 2APVA 3DROB 2IC2A 3QXTA 2VLRE 3PP3K 1W8NA 1LK3H 1P7QD 5CWSB 3VXQA 2G75B 4HZAA 1XEDA 5FUCC 5C0CD 4U1HA 1UCTA 5ICZB 1G84A 2F8XC 1KN4L 2IADA 3R06A 2C3VA 3BKYL 1YNLL 4OLVH 1GOHA 2R2HB 1AKJA 2J8UB 4NKDA 1KNOB 1KJ2H 4DUWA 5GZOC 2BVEA 3PP4H 1IC7L 5E03A 4OUUA 1QR4A 4XCEA 5IB5A 3W11D 3RBGA 4RFNC 3D39E 3FJTA 3QHFH 4I4WA 3H3BC 3MXVH 1IT9H 2E7LA 1PY9A 2NY1D 1XGYH 4LCUA 1UXSB 2FSEB 3TNMB 4F57L 1MQ8A 5D2NA 1WIPA 4KJPD 1DE4B 4RDQG 5BZDA 4ONOA 4BSWA 5JMOC 1JNLH 4DUVA 4OKDA 1XCQA 1BGXL 5KSAC 1F45A 4H26A 3UDWA 4JKLA 4S1QL 4AIZB 3GI8H 5LCVH 3GM8A 1MFBL 1HI6B 4GQPH 4KC3B 2J8OA 3MLTA 5DUBA 3WSQL 4NN5C 3OJDA 2G5RA 1U2HA 4ZS6D 4XPGH 1HEZB 1A9BA 3B5TA 1JPFB 4ODHH 1UXWB 4G5ZH 5KVGH 3GBML 1XZ0A 3QUZA 4WHTB 4JDVB 4D0BA 2A0LC 4JM2C 5IOPB 1B4JL 5HYSB 4HIEA 2DIJA 5FYLH 5AZEH 3G6JE 1VGKA 5EU4A 3ROOA 4HWEH 4BA8A 3C60A 4OF6A 1IAKA 2ADGB 3NIFF 3BEVA 5JOPE 5IVXA 2NY7L 5SWQA 1BIHA 3K3QA 3CLEL 4LGSB 1ZEAH 2IG2H 2IH1A 1KTLA 2MHAB 2DBLH 5AZ2H 1U8JA 2X4SA 1F90L 1FNEB 5DDHB 5DZNA 3QZWB 5C07B 2HH0H 3EYFB 3QDGA 5KOVC 4ONGH 3IJYB 4GW1A 2BHUA 4JR9H 4HS6A 4LARL 4XPHH 1G7JB 3CFDA 3UTQB 3CVHB 2EKSA 3V5KA 2FEEL 2D0GA 3GK8L 1J5OH 2BJMH 4WTZG 3LH2H 3B9KB 1DEEA 3JWOC 3KLHD 3QDAA 3QUXD 4XWOD 1KB9J 4G42B 4LLUB 5A3IC 1F02I 3N1MC 5I17B 2H45A 3DX9A 2Y72A 1TTUA 2P5WD 3H9ZA 2O26U 4NCC2 3K8LA 1YN7B 4LKCB 1KJVB 1NH6A 3B9EA 4OI7A 1NMAL 3M17B 4H0HB 4OLXH 3BMWA 3JTSB 1QFWM 2Y25A 3MRHB 3W0WA 1ZXQA 4JFDB 5IKCB 3FQNB 3UJJH 4FFWC 3NACL 5DMYA 4N8CH 5KN5A 5CD5C 4WEUD 3W81A 4YXKL 1S9YB 4HPOH 1FV1B 3RWEB 5C6TH 5D71L 3MRIA 4WUKL 5HPMA 2XWJA 1QR1B 1MLCB 1U3HD 4Z7NE 2MKLC 4RNRB 4LVHC 1OWWA 1DBAH 1GAFH 4Z7VB 3WFEL 4JLRB 4WFGE 2E6JA 4WW2C 4HS3B 4X4ZA 1RJZB 1X5JA 3RWIA 1QRND 3KPSD 2VLLA 4XC1L 3AC0A 2FX7L 4Z7WB 1CICA 2Z31C 5GIRA 3HB3D 5DK2A 2GCYA 1BAFL 3H7BA 4DGYH 1G7HA 2YD8A 5D93B 4Z18A 2V9RA 1CBVH 3LHPL 3ZHLA 2A74B 2OJEB 5DA0B 1N0XH 1HDMA 2C3HA 3IXTA 1GGBH 4JM4L 5E99L 1BFOA 1BP3B 4YBQD 3T1FB 5BJTA 2EO1A 2F54B 5FECA 5C09A 1ZGLB 5HGBB 1A1OA 3U1SL 4KROB 4YR6B 1MJ7L 4YXLL 3TNNB 1K85A 2UV3A 3VD5A 3ULSA 3WFHA 5IB1B 3CIQA 5FGSA 4PP1C 2GK0B 3UBXG 4HZLB 3U82B 3CZFA 4JEGB 4FQXD 3LPWA 3DVIA 3VWJA 4PYGA 1ZSDA 5DJAA 2W9DL 2AJSL 1AI1L 3QDME 4U0RB 3TBYA 1F13A 1NGWB 2ESVB 1OB1A 3V6FA 2G5BB 4OZ4A 1FAKT 2XFXA 3K8MA 2COQA 3U7YH 4P48A 3UO1H 1TPXC 4OM0H 5CHNB 4PLOB 2V2TA 4G8GA 4PRPD 4PRNA 4LSRH 5F9JA 3MROB 4U1LB 3CJJA 1FBIH 2VLKD 1I3UA 3IDIB 1JBJA 3OR6A 4N0YH 4HKZA 3RVWC 1UM6L 2AVGA 4RCAA 2DYPD 2DAVA 2H26A 2R0WH 1T1ZA 4XBEL 3I2CH 2FATH 3UTZA 1T89C 3MJ8A 3SHSA 4OQTH 3RJQB 1FFOA 3GHEL 1T1WA 1FQ9C 4YGVA 1WUNT 1PEZA 3OAZH 2PXYA 4LCWB 5EOCL 3TBVA 1J1XL 1C5CH 1NCBL 1VEPA 2F53E 3UP1A 2EIZB 3BGFB 3D69B 5T3XH 4OF3A 4P5KA 5D1ZC 3UMTA 4LVNB 2I24N 1AGFB 3FRPA 5FUCE 3WNNA 3CH1B 3V0AC 1CGYA 1SY6H 2NY6D 4NRZA 3OBAA 4ODXA 5EO1A 4ZFOB 5ID0A 4X99A 5MHSD 2X4NB 5INDA 1YEJH 5HSFA 1EJOH 4HWZB 4K9EL 4XZUB 5FYJU 3TA3A 1BJ1J 5IB2A 1KG0B 1VB9A 3O3DB 3E6HA 3L3KA 3FHQA 4QO1A 3OB0K 5C0IA 4HV8B 3RWJB 1MREH 4MA7L 4PB0L 3CMOH 1XGRB 4M1CD 4TNWK 3WLWD 2IQAA 3KJ4C 1IGJA 3QEHB 3UJIH 1V3JA 1RZKC 3OKLB 4EUPB 5I1CL 4JO4L 5A2KH 4WIQA 4Q97A 5B21A 1FZJA 4JFFE 1KENL 1A6WL 5E8EB 1PBYA 4M8QA 5MEPA 5B3JF 3MV8E 4KUZH 5HTSA 1N6UA 1RZFL 2NY3D 4KGLA 4U2ZA 1BVKA 3MZGB 2C3WA 2GTWB 4JGJA 2VTFA 1S5IL 5CWSA 3LQAL 1I85A 3EO1B 3OKNB 3OKKA 4M6NL 1LGVA 4GAJH 2P5ED 1MFAL 3MRBB 2FO1A 5ICZA 3P9WB 3QPXL 4GRWH 1G7PB 2C26A 4LDEB 2R2HA 2OJZH 2J8UA 2VXVL 4KGJA 4XX1G 4YUEH 5H2BB 1KNOA 3O81A 1N0LA 1MCWW 1KLGB 5ANMB 5KJRL 4PUBL 3WNKA 5JW3L 3E8UL 4ZUTB 5D1QC 1F5WA 3VW3H 3GNMH 2FIKB 3MGAA 4Q2ZB 1UXSA 2FDBP 2FSEA 3TNMA 3H9SB 1NBVL 1F3DJ 1DE4A 2ZUWA 4X80L 4PS4H 4Y5XB 4D3CL 4PJAB 2Y5EA 3CSPA 3UTPD 3UEZA 3VWKB 5FYJH 4PJ8B 3H42L 4OGYL 3KWWA 5JW5B 4OCLC 4IOIB 5TE7L 1D9KD 5I16B 2CXGA 2DTML 2E27H 1AHWB 1HI6A 4FQIL 4RGMC 5E2UH 1M7IB 4ZYKB 1VDGA 5FGRA 1BQSA 3GSNL 3BE1L 3RIFF 5C08D 4HF5H 3VH8B 1JPFA 2XXCB 5E6IA 1UXWA 4WUUA 5SX5H 1K2DA 3RIAK 4WHTA 4JDVA 2J6EH 5IOPA 3VFRA 5HYSA 4XX1E 2F5AH 4N9GB 4KZEH 2ADGA 2NMSA 1CGVA 3C6SA 1JPSH 5GXBB 1MJJB 1KC5H 4P49A 5E8DH 1SBBA 5F3BB 2GT9B 1L7TL 2XXMB 4HK0B 1FRGH 4QHKJ 1EEZB 3LS4H 4P2QB 4J3SA 2MHAA 4LKXB 1I9RL 1X5GA 4Y1AA 3WO4B 5I75C 1FNEA 5DDHA 2BC4B 1PY4A 3LEVH 4HUUB 3QZWA 5C07A 5A40E 3WFCH 3EYFA 1CGUA 2QQNL 3MCLH 3B8SA 3O3BB 5ACLA 3IJYA 2GAZB 1G7JA 4MS8C 2J2ZA 5DC0A 3CVHA 3UTQA 4HAGA 1D5XA 2O5YH 3B9KA 4F58H 5CILH 1W72B 3HS0B 3RU8L 3WHE1 2DM7A 2DI8A 1M1SA 4G42A 4Z7OE 1A22B 3G08A 4X5WB 3I6KB 5I17A 1ZTXH 1MOEA 4W4NA 1MCWM 4I8DA 4K3HA 1YN7A 4LKCA 1KJVA 3RUGB 1X4YA 4TSAH 4OZFH 3M17A 1AQDA 4DK3A 4G6FD 2Z8SA 3VDCA 2H41A 5JNYA 1LWRA 1SEQH 3MOAL 4M1GH 4JFXB 3HZYB 2AJZB 5F7EL 2RCSL 3UZQA 5F7YC 5J3HD 4JFDA 1JVKA 5IKCA 3T3PE 1CF8H 4P4KA 1FZOB 3MCKB 4ZOAA 2AXGB 4QKXB 3BQUD 3SDCC 1S9YA 2Q8AH 3NPZB 3RL2B 3QIBC 2XKNB 4MAYC 3SQBA 3RWEA 1CDIA 5CJBA 3GFUA 4ZFOL 3IXAB 4GLRH 3S5LG 1JNHB 3TT3H 1YZZA 4AIOA 5TDPB 1QR1A 1MLCA 2DJUA 3MACL 4Z7VA 3QIWB 2UZYB 5E4EC 1JZ4A 4JLRA 5FCUH 3ARFC 4HS3A 4YBLC 1RJZA 1W0WA 2Z35B 4E5XA 4QOKB 3ZT5A 5J12B 4YHML 4HBQA 2MNUA 4E41D 2QSQA 3FT2B 3MLZH 4PRIA 3ARVA 2JELH 1IC5H 3SE3C 5FHAH 2IAND 5HVGB 3PWLB 1IM3B 2YPVH 3C8KB 1YYMH 5KVFH 3UYRL 2F58H 2A74A 2OJEA 2GSGB 2RGSA 3P2TA 5DQDH 5GGTH 4GAGL 3VXMB 3QWQB 2W0FB 5KW9L 2F54A 1AR1D 3D0LB 1ZGLA 5HGBA 2YA1A 3K2UL 1FAIL 4YR6A 4C56B 3TNNA 1NAMB 4Y19E 3SJVE 4TPRL 4ORGB 1MLBB 1ORSB 4UV7L 3SDDA 5GRYA 2IGFH 5IB1A 4QRPB 3DMMC 2GK0A 3P4LA 4JPIB 3D3VB 4HZLA 4LHUG 2VZOA 4OT1H 3ZKND 1W2KT 2DQIL 5K9KA 3H6JA 1U9KA 1IBGH 1MRDH 4RGND 1NGWA 2ESVA 2G5BA 1CN4A 4PGDB 4XP4L 3P11L 4X6DE 3KLDA 4PJCF 5A43C 4NWUL 3U9PL 4QRTB 1NAKL 2R2CA 4MA8H 3MRCB 2Y6SC 5J56B 5ESQB 3CK0L 5TQ2H 3O9WD 5CHNA 5EORH 1JK8A 1TJGL 1SMAA 3MROA 3A6OA 5T1LA 3U0WH 3IDIA 1EO8L 3LRGA 3D25B 1GVIA 4TULL 4YDIL 5AUMB 2AEPL 1OLLA 3IU3B 3MLVL 3VGAC 1F6AB 2X09A 3JVGA 5ICYA 5IMKB 1MJUL 1LP9E 1K3ZA 5DQ9B 1A3LL 4KTEL 3WS6C 1WTLA 4OZHA 1H8OA 3TP4A 3V7MA 1EXUB 4IRJD 1TETL 2YUWA 3G5YB 4X8JB 4XBPB 2OK0L 4LCWA 3JSSA 2VKWA 1F11A 4Z7VF 3K4DA 2EIZA 3D69A 4GBXB 4WFFD 5HBBA 4Z78B 4M9PA 1AGFA 3H3PL 1LK2B 3CH1A 3ZO0A 2YD6A 3SE9L 4ZFOA 4UDTB 1FO0H 1NKOA 2A6JB 1CQYA 2X4NA 1YEFH 1J8HD 1DBJH 3SBWA 4AMKL 3GMQB 3OTTA 3I6GB 3MC0A 4HWZA 4XZUA 4ZFZB 1H8SA 5GQBA 1KG0A 2X42A 1D5MB 3NABL 3VRLE 3ES6B 3O3DA 2IBZY 3B3IB 1W0YT 4HV8A 1MIMH 2CUIA 3RWJA 5DMGD 3BDYH 5C7XH 1Z0MA 3DOSA 1I1AB 4I77L 2Z92B 1XGRA 4UAOB 5GHWH 4M02A 4Y4FD 3NCBB 5I30H 4I18C 1W72L 4RAHA 4G6KH 3OKLA 4JREB 5IWLC 5DQJB 4HH9B 5EO9B 4PV9B 2CKBL 3AMLA 4RMUA 4AENB 5E8EA 2EDLA 4TSCL 2XQBL 2ICWI 1EHAA 3RWCB 2Q87A 4OCSL 3IYLW 1CR9H 2XY1A 4PJFF 1F4AA 4HIXL 4UV4L 2ITDB 4R26L 4K55A 2DLFH 4NQCE 1R5IB 3BPNB 1XF5B 3C08H 2VN4A 2DDQH 2AI0H 3OKNA 3W2DL 4MJIE 5BS0B 3HG1E 5C9KA 2ZG3A 5E08H 4LSQL 3ZKMC 3MRBA 4NHCH 4YFLI 3MRMA 1G7PA 5C0DB 5H2BA 5FK9B 3KPQB 1ZA3B 2ILLA 5D7SL 5TF0A 1KLGA 3OG4B 4XNQB 5ANMA 1UM5L 2WLZA 2VLRB 1U8IB 3NIGE 3FMGL 3AMKA 4QOKD 5LGHL 4ZUTA 3QWRD 3HE6C 2LTQC 4L5FH 1XR8B 2OL3H 4WY7L 4OZHF 4LHJB 5B4MD 1CL7L 2FIKA 3TN0D 4Q2ZA 5DWUL 3QI9D 4XNZB 5ADPL 3H9SA 4J3UA 1JGVH 4Y5XA 2XZZA 2DN7A 4K3DH 4PJAA 3IDXH 3VWKA 2NNAB 4PY7B 2IBZX 1RZJL 25C8H 4PJ8A 1KBGH 2VAAA 2ZNWA 4AT6B 1FLTX 5JW5A 1I7RB 4DW2H 1SYVA 1QBMH 1AHWA 4OFVA 4GUPB 4C56D 4ZYKA 4PRHE 4EQ2A 1HKFA 1CXHA 1VFBB 2IEPA 3HC3H 5F1SA 4C57C 3V4VH 4JKPL 1JGEB 2DLIA 4N9GA 5KAQF 1NAML 4HCRL 3WHE0 3WFZA 1OGAA 1KPUB 3U0PB 4HW6A 3V6OE 1BBJA 1LO0L 1MJJA 2A77L 3EO0A 5BV7B 2VXQL 5F3BA 4MXQC 2GT9A 2GHWB 4HK0A 3Q1SL 1E28B 1EEZA 4IRSD 4P2QA 2G9HA 4NNXA 1N64H 4LKXA 4M8VA 1NL0L 4KXZH 2MCG1 5DS8A 2BC4A 5FUOL 4HUUA 2BNQE 5EUOF 1GL4B 1UYWL 3G6JB 3D9AL 4KV5E 1S7VB 3MOBL 3O3BA 1QFUH 2GAZA 3RGVB 5J8OA 3AB0B 5KVDL 5J1AB 1KTKE 3QEQB 3U46B 5TPWL 1W72A 2DD8L 4NN7C 4MDIA 3T0AA 3EOTH 1X5AA 3WUWG 2CKBA 1CXFA 2ZPKH 4HLZG 4EN3C 5F7DB 3I6KA 5T5FH 4KI5E 3NA4A 2VDML 5DT1H 3CXHK 1MFDL 2BRRH 2W9EL 4X6CF 3MGTA 1IGYB 4PJBB 4YPGB 5BQ7B 2R8SH 2H8PB 3CXDH 1YEEH 4JFXA 3HZYA 1MWAL 4K3JH 4GFTB 1ZANH 4LRIC 3KPOB 5J11B 1FZOA 1DL7H 1A7QH 4Y2DB 2AXGA 5IP4A 3LZFL 4WVRA 3QFJD 2YEZB 3VD7A 1EPFA 2VH5L 3RL2A 3OR7B 2XKNA 5SX4I 4PJAF 3IXAA 3BZFB 1JNHA 3O6FB 3LV3B 5TDPA 2F8VA 3G5XB 3SO5A 3HRZB 1CQKA 2A1WH 4DGVL 2CR6A 1T6WA 3QIWA 4WI5A 1DUYB 1OSPL 4D9LL 4Z8FH 2MCPH 3GSQA 2NR6C 4P9ML 4GS7B 5DJ8B 2Z35A 4FFVD 4QRQB 2G60H 3FT2A 4G3YL 3MRGB 5D70H 1C7TA 4RISL 2OXGA 3PWLA 4AEHH 1IM3A 1YMMD 5CEZL 3SGDI 3L7FB 1T0MB 1B4RA 5GRJH 2GSGA 3HFMH 1CFBA 1QSFD 1RUQH 2Q76B 4NRXB 2RFXB 1DN0B 4AQ1B 1WZ1L 4UT7H 5IR1B 4X9GA 3VXMA 4KRPC 2W0FA 4ODUB 1P2CB 5D7LE 4HIJB 1KTRL 4L3ED 4KQ3H 1NAMA 4HCRA 4ORGA 1MLBA 4C4KO 1QP1A 1WBYA 4OBSA 4J23A 5AYUL 1L6XA 2DQTH 2QADC 4QRPA 6FABH 3D3VA 3VE0B 2FRGP 3OKOB 2VLRD 3ZL4L 1K8DB 3FB6B 5B38G 3VFGH 4NPYB 4WI6A 4Q9RH 5SWSE 4LQ1A 3AGVA 4P2RE 4PGDA 5DK3A 3X3GH 4XWGH 3WJLC 4L3CB 3EJYC 1OTTC 4QRSB 3ZHDA 4EJ1C 2NY5H 1YN6B 4QRTA 3MRCA 1PLGH 5ESQA 4KAQH 4ZOBA 3P40A 3G9AB 1A5FH 3HNTH 5HYJE 3D39D 3QDJE 3QDMB 5L2KB 5L6YL 3D25A 5AUMA 2DM3A 3TJEL 4EI5D 1F6AA 3NA9L 5IMKA 5L7XL 2VDLL 4OFIA 4RQQB 2DMBA 5DQ9A 5KSBE 3G5ZA 4OD1L 2IMNA 2HJKB 4M61B 4RWYH 3VXTB 1EXUA 5JZ7D 1MWAA 5HGAA 4P23A 1HWHB 4X8JA 3G5YA 4XBPA 1Z9OA 1FN4A 2VNCA 1P7HL 3MV01 2I60H 3UZEA 4OV5B 2BXYA 1MCKA 2ADJB 2EH7H 3QIUC 2YC1A 3FQTA 3GRWA 4KKCD 4XMPH 1HHIB 2VXUL 4UB0H 3BIAX 4MJ5B 1LK2A 4U4BA 4QTHB 1T7ZA 5JA9A 1N6QL 4UDTA 5DJDB 4Y16C 2A6JA 5BV7L 2HTKC 1YEGH 4JZJC 1A1MB 5TDOA 5C0NC 2DWEB 4DVRH 3GUTB 3SKNB 1NGYB 3UBXB 3T0VA 3GMQA 4IRZL 3I6GA 4ZFZA 1NANH 2F53B 3AS0A 4NWTH 1D5MA 5T1MB 4S2SB 3ES6A 3B3IA 3VG0H 1DQDH 4TTGA 5FOBB 3C5SB 1FNAA 3CH8A 7FABL 2RAMA 3I84A 1KOAA 5DQJA 4HH9A 5EO9A 1UJ3B 4P2OC 3WNOA 4ZOEA 2Y06L 1NLDH 2D7OA 3CXHJ 4PV9A 4AENA 4RFNB 1EGJH 2IALB 2UVEA 2VDRL 2FBJH 3I6LD 3IFNH 3RWCA 1LO4H 3QAZC 4DCQB 1MJ8H 2XRAH 4F9PA 1A6TB 5E1HB 1S7TB 2ITDA 1J87A 1JFQL 3PDOB 3RWGB 1DQLL 1XF5A 1FPTL 2F5BH 2NCMA 4FXKA 5BS0A 2EDEA 3PWPE 3U6RA 2UUDH 4UT9L 5C0DA 3W39B 1UCBH 5FK9A 3RZCA 3MV8B 3OAYK 5BVPL 3KPQA 1ZA3A 3HI1B 4OTXH 2HVKB 1XFPA 3BHBA 1NDMB 4XNQA 1OM3L 5ISZD 1CXLA 4XMKL 3UC0H 1U8IA 5IHUL 4JM2B 3CPLB 4HT1H 1XR8A 1Q94B 3PUCA 5I71C 1DBBH 3U4BH 4ODWA 3ULUE 2P4AB 5ENWB 4HLJA 3SDAD 4APQC 4R97C 1N7ML 3KXFA 5GZND 2P49B 3NTCH 2CQVA 5DTFB 4EXKA 4V2BA 5L9DL 2NNAA 4PY7A 1KN4H 1IGCL 1YNLH 3GMOB 4AT6A 1I7RA 1BFVH 4MQ7B 1JE6A 4XI5C 1MFEL 1VFBA 5DI8B 3I50L 4M3KB 3JV5A 1JGEA 5EA0H 4A6YL 4LCIH 4KKAD 3LDBC 4MA3B 3BO8A 3VFTB 1NFDF 1Z6JT 1KPUA 2B39A 1PYWA 1ZHLB 3P0VL 3U0PA 2KKQA 4D9RE 3IDYB 4R9HA 5KS9E 3GBNH 1BGXH 2FL5A 2J5LC 1IAII 4CVZB 4IMLA 5FGBA 4NQDE 2OSLB 1E28A 3QQ9D 2DBJA 2VXTH 2WZPD 4GT7A 3ARGA 2HKFH 3WSQH 2XQYG 4ELMF 1JYXA 3G6JA 1S7VA 2QSCH 5CJQL 3GBMH 1BZ9B 1IGMH 3MRFB 3N85H 5GGVY 3RGVA 5J1AA 2JCCE 3ULVL 1A3RH 3QEQA 5JIKA 4H88H 4OLZH 2DB8A 2YUZA 5E9DA 3ZE2F 4U7SA 1LO5B 3CLEH 4LVHB 4TYUA 5F7DA 3WFBH 4AM0B 4U1KB 1QACA 4U1NA 5EBLB 4OI8A 4ZTPH 4WW2B 3HA0A 1F90H 4N5ED 2HT2C 3OAZK 4PJBA 2WBJC 4YPGA 3HCVA 5ALCL 5BQ7A 2XV6B 2H8PA 1P1ZB 4DUXA 1M71B 5IFAH 2JLLA 2Z31B 5LQBL 4LARH 5C92A 5I18H 3KPOA 1B2WH 1RUKL 3QDHA 4WFED 2ED7A 3GK8H 4Y2DA 4ZAKC 1RURL 1JZ7A 3CNKA 4PJEA 3TWCH 1SJXA 2P45B 2YEZA 3PDDA 5T33L 4R90L 5TF1H 2CIIB 1NSNL 3BZFA 3BKML 1FFNB 4W4OC 4G7YL 3ARSA 4I5BB 3G5XA 4U6VL 1NMAH 5EU7E 3HRZA 2B0SH 3L7EB 2CIKA 2PYFA 1A3QA 3BP7B 2GJZB 1DUYA 1UACL 4N8VG 4XC3H 2CRYA 2A6IB 4U1GC 5DJ8A 3KAAA 2OTUB 1WT5A 4N0FB 1KGCE 4QRQA 4D2NA 4ODVL 3HMWL 1BLNB 3MRGA 4JPKL 5FM5M 1OAYL 1J12A 1LHZA 4PGJA 2P43B 1MEXH 4WTZA 4NC2B 2JJTA 2JB6B 3L7FA 5D7IF 1BF2A 1T0MA 4OD3H 3TLRA 4DN3L 2MQCA 1TPXB 2Q76A 5KSVB 4NRXA 2RFXA 1DN0A 3KYNB 4NJ9L 2GY5A 5IR1A 3WFEH 3ZZ1A 2YKLL 4ODUA 1UH3A 4JFFD 3T0EE 1P2CA 4HIJA 3ARUA 4GRLB 2XTJD 3PABB 3TJHD 2OP4L 2OR8A 5EZOL 5FA3B 3G6JF 2HLFC 1MCSA 4C59B 1V8HA 1QD0A 4YNYB 2XWTA 2WINB 2DKSA 3VE0A 3B9VA 1MHPL 1BAFH 1K8DA 3FB6A 4LGPB 4NPYA 4U49A 5LAXB 4ZPVB 1JTOA 2WM0A 2CK0H 2PR4L 3NCYP 4ZQKB 4JM4H 4L3CA 3K74B 3GO1L 4QRSA 4Y19B 3L3IB 3SJVB 2VN7A 1XF1A 5HI5C 3UZVB 3S5LB 5IMOB 1HWGB 5D1ZB 1N3NA 2GI7A 2XKUA 3KPNB 3KS0J 4NYLB 1YNKL 4PJBF 4YXLH 1ZGLM 1ZWIB 4HUKB 4QF1B 2VWEC 2X05A 5IFHL 1CFQB 3QDMA 3V0VB 5L2KA 1RY7B 2XG4A 1W0VB 1DBML 3DI2B 1CZ8H 4X6DB 1SJVA 2HVJB 5EBMB 4PJEF 2UWEF 1QFPA 4J6RH 2W9DH 4Z7UB 1AI1H 1A47A 4RQQA 4WV1C 3DXAB 3QSKB 1JUFB 5HHME 2VRAA 2PYED 4F33A 2BSTB 3BIBX 5SX5K 1E6OL 3MLPA 2NXZB 1HXYB 2B2XL 2YBRB 2HJKA 4M61A 1UVQB 4UOW0 3TO2B 3VXTA 4J8RB 4GW4B 4PJHE 3KJ4B 3PWJA 3JWOL 1FSKC 4OV5A 3SEPA 4JFHE 1TTFA 1NFIB 1JI1A 2ADJA 2FECL 3OV6A 5T5NG 1HHIA 3EAKA 4R7NA 1LP9B 1ZLWH 1PZ5B 4UNTA 5I0DA 3MV9E 2ATPB 1UM6H 5DJDA 3EDFA 3KPMB 5CGYD 4MVBD 4XBEH 1A1MA 1CLZL 1CS6A 3DGCR 4O51A 2DWEA 1J1OL 2JJSA 3IRZA 4TVPE 1CVRA 5D2LE 1NGYA 3SKNA 3GUTA 3UBXA 1MCFA 3RDTC 4LHUB 3HMXL 3KNBB 3SCMB 2DQHL 2VR9A 2F53A 5T1MA 4S2SA 1J1XH 4WUUD 3QHTC 5CIPA 1YPZF 1OAQH 4JANB 4A2LA 3GIVB 1PX4A 5CBEB 1WVZA 5FOBA 1A64A 1CLOL 2AQ1A 4HWNA 1AO7D 5H8DA 3SO3C 2I07B 4DWHA 4XVJL 1UJ3A 2XIDA 2ZSVA 4KK6D 3B83A 1JYNA 4TNWF 3IKCB 4GMTL 2IALA 4Y8AA 2VL4A 5SWZD 4YFLF 4ZDHB 1ED3B 3D85D 2BSSB 4K9EH 4N1EA 4Y1AD 1A6TA 2Q86B 5J9PB 4PJ9B 4F7TB 2HRPL 1IL1B 4R8WH 4POZD 3RWGA 2AJ3B 1MCBA 4Y5YC 3ZE0F 3CVHH 5D1XB 1A6VL 5C0AE 1S9XB 4G43B 4HMCA 3ULVF 4BUHA 1FVEB 4W70A 5K9QI 3ARTA 5C0GB 2P48B 3G04B 1CDBA 4JO4H 4RGMB 4N1HB 2FYYB 3W39A 3OJMB 3HI1A 2HVKA 1NBZB 1KXVC 1NDMA 1AD9B 4MNGE 1JIBA 4NQCB 1JHLL 3IFPB 4G7VL 4JM2A 3CPLA 1RZFH 4P5TB 1Q94A 2XTLA 3HG1B 1A7OL 3O2DA 1MPAH 1NUFA 2NY5C 4HWBL 1S5IH 1D6EB 5ENWA 3IJSB 1MCCA 1JTPA 4M6NH 4GKZB 2AERT 5DTFA 4P4KD 1JV5B 5T1KA 5I75B 3GMOA 2L7UA 5MENA 2YWYA 2VDQH 4L4TE 2XA3A 4WFHD 1T0NB 3GZKA 2H1PH 1B0GB 3GEWB 4CAGA 5KJRH 3T0BA 3IRPX 5FKPB 3S4SG 4CU8A 4TTDD 5DI8A 1WWBX 1TIUA 1MI5E 2DQDL 2M2DA 2R23B 2ZP0T 5I1JL 1SJEB 1I3GL 4LU5L 5E2JA 3MO1B 4MA3A 3FCTA 2MPAH 1T03H 1NBVH 5JXAH 5DVOA 4CMHC 2C5DC 3VFTA 4X80H 2CRIA 3D0VB 1ZHLA 3QNZB 3SE8L 4Z6AT 3ZSTA 4FA8A 4PRID 4PRHB 4HFWB 4L8SC 4CVZA 2OSLA 1JWSB 3HZMA 4M48H 5JPNA 3PXJA 5L88L 2DTMH 3HMXA 1WAAE 1M4KA 5C2BL 4P4RB 5EU3A 4PLKC 4QRUB 1JPTH 4FQ1L 3Q5YA 3SN6N 3RTQB 5EZLA 1BZ9A 3MRFA 3SDCB 4XCCH 5GGVH 1N26A 4OCNC 4BELD 1HINL 3CFCH 3MR9B 2APWA 3QIBB 4MNQD 4MAYB 2EDRA 5FDYA 5EU6D 3SDDD 4MA1B 5IBLC 1LO5A 4JFZL 4XHJC 43C9B 5HDQL 2VC2L 4U1KA 2BNQB 3ZKXC 1ZLSH 3QISA 5E4EB 2ZNXA 4YHZH 5EBLA 1FVDB 4CNIB 4WW2A 4AL8L 1RUML 4YBLB 2VLJE 1W8OA 5F7WC 5A1AA 3T08A 2PW1B 4TUJB 5DD3L 1M71A 1G6VK 2Z31A 4JM2F 4BFGA 5A2IH 1U3ZA 2OTPA 2BDNH 1Q9LB 4K23H 4R2GC 5F1NB 5JDSA 1KPVB 1VGEL 1WCQA 1XR9B 2APTA 5TQ0H 2IWGA 2BVOA 1RZKL 3HE7B 3GSVB 4X6FB 4JRXA 4PYHA 5T1LD 1I9JL 3WNMA 2NX5A 3SCMD 5JR1H 3CDGB 2CIIA 5F7LB 1A7PL 1FFNA 4M7KH 1UB5B 4I5BA 2NXYD 4JPWH 2HKHL 2NTFB 4K2UH 3QUKA 3L7EA 2VR4A 4LSUL 2GJZA 4IIQC 4HWBA 2A6IA 5F7EH 2ORBL 4KMLB 2OTUA 1URLA 1QPXA 4N0FA 1NUDA 2WSKA 3T2NL 2VWEE 4UIMB 1BLNA 3RVUD 3T0WA 3BPLB 4LIQH 1HYSC 5TE6H 3TCXA 1MRCL 1FH5L 5MERB 2JB6A 4FQJL 4LVOC 2V2XB 4PJ9D 5E6YA 3WUWB 5KSVA 3CAFA 3KYNA 1Q0YL 2CRZA 4HUVB 4MNHB 5IMLB 1RHHB 32C2B 4N0RA 4S0TD 5KTEH 1TJIH 4GRLA 3PABA 5IK3B 5E4IA 5FA3A 1BBDL 1KIQB 1HHJB 3VGAB 4YQXH 2VDOL 3S9DB 4YNYA 1NLBL 1XGTB 3IS0X 2WINA 4KVNL 3FFDB 3G5VB 3W11C 3MBXL 2E9WA 3F7YB 2R1WB 4PB9L 1LDPL 1T89A 2GJ6E 3H0TB 1CICC 4EUPH 5LAXA 3FAWA 4LBEB 1Y18B 2D9QB 4MJID 5J1SC 4ZPVA 2NY1C 2VDPH 3UYRH 3N1FC 3EDEA 1QFWI 3MV7A 4YC2B 5HDOA 4X7SH 4O02L 4KJPC 3MA7B 5JHLH 2KQNA 4Y19A 3SJVA 4KPHL 4GAGH 4OI9A 3NZHL 1IGFL 3S5LA 5KW9H 2EDYA 5D1ZA 4Y7MA 5TFSL 3ZTJG 3KPNA 2ZCKL 4NYLA 1FAIH 3DJ9A 1ZWIA 5DJCB 3IFOB 1IKFL 4TSBL 5CSZA 1CFQA 3V0VA 1FNGB 1INEH 1TJHH 3GMRB 5SWSB 3RI5K 1W0VA 4P2RB 4X6DA 2KUTA 2HVJA 5EBMA 3NFNB 3DI3B 5E2VL 3CU1A 1F3RB 4Z7UA 5ABDE 4OSUH 3DXAA 1JUFA 4K8RH 4XP4H 1BX2B 1MFCL 3PL6D 1HXYA 2YBRA 5BRZD 4CKVX 1UVQA 1A14L 4NWUH 3TO2A 4J8RA 3V4UH 3KPLB 3UYPA 5DVNA 4GW4A 1T5XB 3WDIA 5HYJB 3QDJB 4IDJL 4S11A 3MA9H 4I18B 4Z95L 4PTUB 2IAMB 1NFIA 5DR5L 4G6JH 2EYTB 3FN0H 1LP9A 4PJIA 2DOCA 4YDIH 4TULH 5KSBB 1PZ5A 1KUMA 2AEPH 3EZJB 2ATPA 3WKML 4D9QD 2O5ZL 3VU2A 3RTQD 1CFNA 1EHXA 4LAJH 2FJGB 4LHUA 3KNBA 5B38B 2X41A 2VMFA 4PJ5D 4NQED 2VSDA 3QUXC 5HYQB 5K9JL 4JJ5B 1JTTA 3BRFA 2AK4E 3EOAB 4JANA 5CBEA 3GIVA 3MX0A 1T21A 2PXYC 4M6MH 1X6NA 5DJ2B 1QBAA 1OP9A 4UDUA 4M7ZC 2I07A 2DLTA 1EEUA 1KJ2L 5D1QA 3HE6B 2LTQB 4UZGA 1EX0A 3IKCA 5DJYB 2BVPA 1CDGA 1RIVH 3ILQD 1XIWD 2XN9E 3C6LB 4ZDHA 5BVJA 1ED3A 1MH5B 2BSSA 4EKXA 3SDXE 3VI4F 2O61B 3QHFL 4YDKH 5J9PA 5D5ME 5HHOE 4F7TA 3C5ZD 4KI5D 2JJWA 4O2FB 1IT9L 2AJ3A 2CKNA 2GUOB 1XGYL 1FG2B 4HKBB 5D7JD 1ZV5A 5H37H 4DZ8B 5D1XA 3KR3H 3OJ2C 4HGKC 4DQOL 1S9XA 1I1FB 4G43A 4U0QB 1FVEA 1U3HC 2ZJSH 1JNLL 5C0GA 1W72H 5IBTL 2FYYA 3X12B 1G7LB 1YDPA 5HDLA 2DQJH 1NBZA 4TSCH 1AD9A 2XQBH 4NQCA 2YMXH 5B8CC 3IFPA 1VKXB 3U7AA 1UKSA 3CU7A 4Z7UF 4X4XB 3KG5A 4PJDE 4XPGL 3N1GC 2OM5A 4ODHL 4P5TA 3HB3C 4G5ZL 3HG1A 3PWPB 5AEAA 1IMHC 3B5GA 3WIFB 1D6EA 2R56L 3IJSA 5FYLL 5AZEL 3QH3B 3OKEB 4HWEL 4GKZA 3PG2A 4Q58C 4H5SB 4XPBL 4DKDC 1KYOK 2V7NB