1TJMA

Crystallographic identification of sr2+ coordination site in synaptotagmin i c2b domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
156
structure length
156
Chain Sequence
SGGGGGILEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Endocytosis/exocytosis
molecule keywords Synaptotagmin I
publication title Crystallographic identification of Ca2+ and Sr2+ coordination sites in synaptotagmin I C2B domain
pubmed doi rcsb
source organism Rattus norvegicus
total genus 29
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2004-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1tjmA00
3ZVVA 2Y3AA 1BYNA 3SD5A 2ENJA 2WXJA 3L17A 3M7FB 2CM6A 3LJ3A 2V4LA 4Y1TA 4WWNA 3APFA 4DNLA 4DK5A 2YOAA 1BDYA 2WXOA 4ICXA 2WXFA 5CCGE 1E8ZA 4XZ4A 3TJPA 4LDCA 5G55A 3MJWA 5JHBA 4TUUA 2D8KA 3ZIMA 4LT7A 1V27A 3PFQA 3S2AA 2NCEA 4AJWA 4ANVA 4LCVA 2WXKA 1DJIA 3L54A 4FJYA 3KWUA 1DSYA 4GB9A 3QR0A 2DMGA 4BGDA 2BWQA 3PRZA 1W16A 1RLWA 2NSQA 3W57A 4PS3A 3L4CA 3B7YA 4KZ0A 2NQ3A 1K5WA 2CJSA 1W15A 4KZCA 4NPJA 4QJ5B 3HN8A 4GNKB 3HIZA 4L2YA 3NZUA 2Q0ZX 4MJJA 5H4ZA 5CCHE 2FK9A 4TV3A 3F01A 1UOVA 4FHKA 3R7RA 2DMHA 1YRKA 1E90A 1E7VA 2CHWA 3F04A 3F00A 2ENQA 4PS7A 2CJTA 1WFMA 4G11A 3R7QA 3GPEA 5EDSA 2ZKMX 1CJYA 1HE8A 3N5AA 3APDA 4FADA 3CSTA 1DJWA 1A25A 2CM5A 4L1LA 4WWOA 4Y1SA 1BCIA 3OHMB 1DJGA 2K3HA 2WXMA 4JPSA 5JHAA 1DJXA 3PYCA 1DQVA 5G2NA 1E7UA 2FJUB 3FBKA 3PREA 3F05A 4WEEA 3L9BA 3RDJA 2K45A 3CSFA 3QR1A 4ICWA 4L1BA 3T8MA 1E8XA 3ML9A 2A5UA 4NS0A 1GMIA 4NPKA 4BFRA 4EZLA 2RD0A 2K8MA 4ANXA 4WWPA 3L13A 2WXQA 4QJ3B 3IBEA 5KJ7E 2EP6A 3L08A 2WXLA 4KITB 4WAFA 3QAQA 1TJMA 3ENEA 3KWTA 4AOFA 4FHJA 4HVBA 2WXHA 3W56A 3NZSA 1DJHA 4F93B 1RSYA 2WXIA 1DJYA 3IM1A 4ANUA 2YRBA 3ML8A 2WXRA 1DJZA 2JQZA 4FJZA 4L23A 3DBSA 3ZW3A 2LHAA 4OVUA 2QZQA 3JZYA 1QATA 3HHMA 1E8WA 4URKA 2K4AA 2N1TE 4OVVA 4XE0A 1E8YA 4HLEA 4F92B 4PS8A 1TJXA 3RPBA 4TS6A 3QJZA 4NP9A 5H4YA 2A4ZA 3TWYA 3L16A 4IHBA 1UGKA 4F91B 2WXPA 4FULA 4QJ4B 3P2BA 2ISDA 2ENPA 2R83A 3FDWA 3OAWA 1UOWA 2UZPA 4EZKA 4V11A 2X38A 3DPDA 4XX5A 3QARA 1RH8A 1WFJA 2KI6A 2QZ5A 3NSJA 4IQHA 5T8IA 1QASA 3APCA 3PS6A 4FLHA 2B3RA 4QAMB 3TL5A 4ANWA 4FA6A 5CCJA 2CHXA 3QK0A 2CHDA 2CHZA 4A55A 2Q3XA 2Z0UA 2WXGA 4J6IA 2WXNA 4EZJA 4F1SA
chains in the Genus database with same CATH superfamily
3ZGHA 3MFGB 3SGDI 2XY1A 2VWEC 2AQQA 4NZ8A 2VIRA 3ES6B 2EH7L 5LXGL 1NLDL 3S36L 1KCSH 4X7TB 2NXYD 3QIUD 3UP1A 3H54A 1KT2A 1KACB 2X4OA 4V2BA 3RGVA 3RILA 4BFIA 4WU5A 2P45B 3L9RB 4CKQA 4P2RD 4LT7A 5FA4B 3MRMA 3VXRB 4K94H 1MELA 4Y19B 3VB8A 4BKLB 2CIKA 1KN4H 5DTFA 1G1CA 5C0CB 5EULV 4ZUVB 3VO0A 2VM9A 4NHUB 4HS6B 4XNZB 3Q8AA 4F9PA 3QR2A 3TBTB 3F6JA 4KHTL 4X9GA 4B96A 2VSCA 3ZLQC 5C86A 1KTLB 3HE7D 1EERB 3SQOL 1EQWA 2ARWA 4FZ8H 2NY6C 1UXWB 5E9DB 4NCC1 2ED6A 1YRKA 2BC4A 5D1ZB 1KNOA 1PIFA 3DOSB 4O51B 1G7MA 3VGAB 5E2JA 4HFUL 4XR8C 5EU6B 2JB6A 4K55A 1H15A 1ZHKA 2O5NA 5E5LA 1URIA 1NBVH 1UASA 2YSSB 3GHPA 2BNUB 1JF1B 3QEGL 4HCRL 1H6UA 4AYBA 4P59L 3ZL4L 3K74B 2I5YH 4UOZA 1VAHA 1NGYA 5LDSA 4EVNB 1P4UA 3B2XA 5I0XA 1OAZL 4NQEA 3CFCH 5F9WB 5KJ7E 3MV8A 4ZRGA 2NY5H 4QMEA 4BQBA 1U0QA 4N4YB 4GBXC 1NTDA 4YHIA 2CDGB 2YC1A 3WKPA 4BH7B 3QCTH 4DEPC 1KJ2B 1PSKL 3DVNA 2P8MB 2J4WL 2X6CA 4KK9C 4ZTOH 4OUUB 1OY3B 2D7TH 3QUZC 4K5NA 1YEEH 2K8QA 4XN2A 4WKZA 3ZDYB 2HSIA 1KGYE 3NFNA 1YNTA 4WUUD 4AQOA 4UAOB 1N67A 5MENE 3FJTA 2D0HA 4UF7C 4ODVL 4YVUA 1T3FB 3OG6B 2CRYA 1GGCL 3TPUB 3UZVA 2V3DA 2ICWJ 3DX8B 5E4EC 5HGDA 2ZP8A 3SKMA 2BOBB 1IGFL 3BIKB 3FT4B 2E3VA 4RA0C 3SE3A 3D2UD 4B9CA 4AQ8C 5HPOA 4UDUA 2XLLA 3BKJL 3H55A 5AB2A 1RUML 4HWEL 3FBQA 1UFGA 4P99A 2XG4A 1P2CA 3ARFA 4Y16A 4DPAX 4JQIH 4AVKA 4YDNA 5E03A 3WKML 5LCVH 2DQHH 5EIIB 1JWMB 3MAWA 4H0LC 1G7JB 1B2YA 4GSDH 3GLZA 4UT6A 5GZND 5TFSL 1ID5I 3UL4A 1I1FB 4PGBB 4PUBH 4LLQA 4G6AD 2G0KA 4N0CD 4ZFOA 2GJ6A 4NQCB 4GH7B 3U9WA 4LDCA 5DO2C 1KFGA 4FLQA 1XR8A 2XWJA 3QI9C 3QS2A 4BFOA 4QUOA 4NSKB 4M1CD 1RUQH 2GITB 4M48L 3O3AB 2VDQB 1UVQA 4GKLA 4MNGB 3MZGB 1WZMA 2VDRL 3Q7JA 1XBRA 4LCIL 2WSPA 3ZTJG 3M8OH 4KOBA 5CEYB 5TPWH 2BK8A 2GI0A 3N1GC 4NKIL 4NPJA 3SOBH 3DBXA 1OTSC 2YJLA 1MWAL 3EGSA 1DZ0A 2GK0B 4MVBD 1P7QD 4DKEH 3B2PA 2WWMC 1A3LL 4LOUC 5FGBA 3BPNB 1L9MA 2Y7NA 3DX4A 1MJUL 2DLEA 4MS8C 1TZGH 2K6WA 4P3DA 3GK8L 3OPZL 4HKZA 4MSWB 2KDGA 1N8OE 3H85A 1YQ2A 4H44C 4PTTB 1A64A 1OT2A 2Y5TB 1FO0L 4GAYA 4ZFFB 1FNLA 2Z35A 5EBWB 4QYAA 4NUGH 2HFTA 3MLUL 1T7XA 5BZWB 2F19L 2WAHA 4ERSL 2JJUA 4OZ4A 2WYIA 4CC1A 4YQXH 5T33H 2J5WA 4WDIB 4Z7WA 4HK3N 5CCKL 2NT1A 2OSLA 2VDML 3NH7H 2WYZA 4KOCA 2I60H 5JPNC 3IVKA 1HI6A 3NACL 2A77H 4HUXB 5KJRL 3GO1L 4WAFA 4YLBA 4UQDA 5IVZB 1UM6H 2A6DA 3A21A 2JXMA 2OMTB 1XTLA 4D3CH 2MPAL 4TNVF 3MV7B 4FRWA 3IF1B 5AVZB 1SYSB 3A6BL 3NK4A 1F11A 1DL7L 5I0DA 5HD8C 1UH3A 2AZAA 1ZY9A 2KZ1B 1DQTA 3H3PL 2JIXB 4PHXA 4HMCA 1FDLH 3AT0A 3T3MB 3TBSB 5CEZL 3STZB 2AK4A 3ASOB 5I19L 2FWSA 4PJGF 3L5WA 5F0PB 3T4YB 1DYZA 3EH1A 4HWBL 4MZIA 4LGRB 4MJID 1RZ8A 4PI0A 4URTB 2GAZA 3VRLF 2D7PA 4AQ1C 1JYWA 3T1WA 1MIEL 3B1UA 1WZ1H 4M7LH 5FF6B 4MDJB 4S1SH 3ORJA 4U6YB 2R51A 4JZJB 3SBQA 3MV8E 3RI5F 2DQEL 1U4EA 5KYUA 3NPZB 1A7RL 5CINL 2PLTA 1IC4L 1TIUA 4TN9A 1K85A 4WK2B 2PWGA 1FFOB 4GBXA 4WWKC 1RURH 5F88A 4JFHD 5KWYC 1YSOA 1DE4A 4CMMA 4XBGB 2LGNA 3D85A 4L1DA 3MUHL 4RMUA 4NO0A 4J1UB 2CRZA 3BP7B 1YMMD 3I50H 4P2CG 3WFEH 4EXPX 4Q9RH 3FC8A 2R2BA 4N0UB 4KHXL 3QUZA 3FN3A 1ORQA 2FQGA 2ZF8A 4QHUA 4WTXA 1DP0A 4N8VB 1C8QA 2OL3H 1F3DJ 3H9SA 4ODXA 1K8IB 3FO0L 5FLUA 3AUVA 4K5LA 3VE0A 35C8H 1ZLDA 4KTEH 4HAKA 4J8RB 2O6CA 3NJMA 2EE2A 4Q6IB 1MRFL 4AQ8A 4DZBA 3PWPD 5IHBA 1AHWC 4HHWA 2YD0A 4L4TA 4JHWL 2BOCA 5AW3B 1CWVA 3FQWA 2XG5B 5FV2A 1KYOK 3ZYZA 2VN5A 5HTSA 3WY2A 2DQTH 2DQFA 1K4DB 2VJ0A 3BUDA 1BD2A 5IMLA 5L8KB 2FX7L 3LKSA 5LUMA 2GJ6E 2ZXAA 5AVQB 1DN2A 4XNMB 1K6QL 3RDTC 5KYWB 5C0FA 1TYRA 4AQAA 3QI9A 2QGBA 3GRWH 4IIZA 4OT1H 1JGLH 2UXFA 3FKUS 4YC2B 4FNRA 4FXKC 1ANUA 5IJKC 1IE5A 2QVTA 3PFUA 3LVTA 1QUNA 4U0QB 1L7IL 5LBSL 3FN0L 2Y1AA 3CFDA 4OZFG 4OFYA 3LQZA 4YHLL 1HEJC 4MJ2A 3NOIA 1WF5A 1OW0C 1U95A 4FNTA 2YRZA 5D72H 1JPFB 4Z0XB 3DX1A 3QUKB 1NCOA 3IDGA 5GIRB 1OARH 1HJCA 4HGWB 5GGRY 5CM1A 2DIBA 4QAWA 3PJSA 5C0NC 4AYID 3VFUA 1SOKA 1OVZA 3KZ8A 2PPFA 1EBAA 3L5HA 3ILDA 1ZANL 4PGCA 4ONHB 1MCSA 3RIKA 5DHVH 5KVGE 1PEWA 4KPHL 4PAZA 1RUPL 1T66C 3BRFA 4Z7WE 3FTXA 2XSKA 1A9BA 4H8WL 5KBNC 2QDVA 3NCFB 4ANWA 3CPUA 2Q76A 3JT2A 5D2LA 1R24B 4PVBA 4EUPA 1VEMA 1HK6A 4XPHL 3ARBB 2Y5QA 5JPNA 4KGLA 1KLGA 2P24B 4FQJH 5HYJA 4M56A 4DVBB 4NN5C 1PLAA 4QKTA 4YDIL 4MXQD 1OGTA 5JXAH 1UM4L 2GJJA 4H2AA 4JBSA 4B0MM 4LAQL 2CHNA 2IH9A 4JO3L 4OKDA 1EX0A 1ROCA 2X42A 2G0LA 1VFBB 4UTBL 3VGEA 2AK4E 1TJGL 1C1EL 3AITA 1T5WB 3HRPA 2E6PA 2WK2A 1EJFA 1EFXA 1W72A 2YBRB 4AG4L 3KPQA 2DMCA 2G3XA 3FB8A 3ZUNC 3PAUA 4AQ1A 4F1ZA 1ZV9A 3IRCA 3FRPB 3K6SA 1IRAY 2A9NH 5FYJD 3WNLA 1LEGA 1SOXA 5F7FA 5JW4M 5AQ0A 1XB6A 4X6BA 1H8NA 3RURA 2V8LA 4G9FD 2ID5A 3SYQA 1Q9LB 3CXDL 2HRHA 5GGUB 4QIRA 5GGRB 1EJ8A 2J73A 3JV4B 4LLUB 4GO9A 4PRNB 3MOQA 4LEBA 5EWIH 2OYKA 4WFFD 2YEVB 1CU4L 4BINA 4MBOA 4PW4A 2QQQA 2CUHA 1U8HA 4MASA 1XGUB 2EVHA 1GPOL 1XEUA 4XHJC 3WUWB 4Y9BA 3JV6A 1S7SB 4N24A 3NCWA 4WTZA 4JKPL 1LK2B 2OBGA 1X5HA 4YDJA 1CFTB 3ZQWA 3O11B 2AJ3A 2O26U 5DJXB 3H9SE 3BO8A 1U92A 1WDAA 1KBWA 1P1ZB 3B83A 4EIBA 4M5YH 4ODWA 3OMAB 1J5DA 3FT3B 3M1CA 1CBJA 1NC2A 1IVLA 3SE9H 4L4TE 4XP4L 1N0LA 3MLSL 1LO2L 1AHWA 4YHMH 5LHDA 2VLKB 2CJ3A 4XX1G 1BX2B 1UWGH 2P8PA 1A22B 4WEUD 1OAYL 4QRSA 1M7XA 1JWUB 3HKFA 2OL3B 4ZNCD 1IL1A 2D0GA 2BP3A 4PG9A 1DBAH 4XMTA 5IBTH 3RDTA 1G87A 4HIXL 3RTQB 5B1BB 2HT2D 2ZF9A 5B22A 1RH8A 4I13B 4X0KB 1JRHL 1EO5A 4N86A 2KZKA 4Z7AA 2LAGB 4KVNH 2MFNA 4FXKA 3BZ5A 5IJKA 3DETD 2P5ED 4RFNC 2Z3FA 4ZXBC 1C9SA 1H8OA 1DQML 32C2A 3DX3A 3NA4A 5TE4L 1NEZB 4UM9B 5FUOH 5EEYA 4M1DH 3RVVC 1T21A 4KXCA 1HHKA 1OW0A 4MDRA 3V6OC 4P5KA 4Q0XH 3LXUX 1A1OB 3ZE2B 5JQ6L 5HI5C 1TCRA 3U1SL 2E47A 3NSFA 4LHUA 3UBXB 2JKSA 5FCUH 1SRDA 4NLAA 2OYPA 3H2WA 4R7NA 4X5PA 1QI3A 4FFWD 5DVMA 4RSVA 4YFLF 5HDBE 4NT6A 2ZOKA 5GZOC 2AHIA 3MBEC 3GDBA 1AS6A 5I16A 3G04A 1JGVH 1AIZA 3MKKA 4X4YB 4GSQA 2G9KA 4R7DB 3PP4H 5C0AD 1RLWA 4X7SH 2EDNA 4OQ1A 3VA6A 4Y5VC 1FIGL 1M4KA 3T5WA 4JG0L 2PPEA 2UV3A 3C5SB 4W9EC 5EO0B 5KEZA 4AGPA 1QWHA 1RZGB 4N2MA 3RWEB 4XCFH 2XIDA 1AQHA 4AVIA 4MTMA 3EJCA 4ACTA 3N1QC 3VH8G 5JZ7C 3OX8A 4N2BA 2VR8A 3DRTA 2NZ1A 1C5DA 5DHVB 2DLFL 1JXJA 1L7TL 2BP5M 4NNXB 3TN0C 4A66A 3EFFB 3LAFA 1KCWA 2AJVH 5BVPH 1NJ9B 4GUCA 1ZVNA 1ONQA 1CDJA 3O8XB 3GT6A 5GGTL 3FNKA 1R3IH 5ITFB 4MMXC 2DKUA 2H3XC 2KS0A 4L9DA 1CDIA 2W94A 2XJKA 2WBXA 2QSTA 5FO8A 1R0AL 3MNWB 2FZ3B 2RD0A 2XKUA 3O6KL 4K2UL 1INEL 3UBFA 3VGGA 3VXTB 2YXMA 3RNQB 3T1FA 1Q9KB 4DERA 2O61B 1BYOA 5D7KD 2EIMB 1RMFH 3KE0A 3RWJB 4PJAA 2WPGA 4CW1A 4KC3B 4ZO8A 1T5KA 3QNYA 4MB1A 2WBJC 2APTA 2PTTB 4ES8A 5TDPB 3SGEH 3Q06A 5E6YA 4MYPA 3TV3L 5I75C 1FZKB 1VADA 4M7JH 3FO1B 2FJGB 4K3DH 3NG5A 4J4PD 4Z7UB 5LGHH 4F37K 3SEPA 4QF1B 1M53A 3Q01A 2IAMD 2MQCA 4OD2B 4J28A 4HWZA 5FUZL 4Z76B 4JKWA 3P02A 5EDXA 5DFWH 4WI4A 4XX5A 3MUZ1 1WAEA 3DWTA 4PEEA 5DK2B 2WKGA 3LIZH 4TNWK 3LN4A 1Y6KR 2DIEA 4Q2ZA 5D7SH 2XN9D 1NMAL 3D0VA 3KGUA 5DFAA 3B7TA 4JFZL 5DEZA 4P4KB 2NW2A 4JAMA 1HX0A 3L9EA 3U6XS 2EILB 3D3VA 4ENEC 5GJSH 2OMWB 3M7FB 4YDKH 5ANHA 4LF3A 2BNRB 3BT0A 3TT3H 4E0RB 9PCYA 2VM3A 2WVVB 4L4VD 1BBJB 2FDBP 3DYPA 2WZPA 3S7GA 3UGEA 5IQ9B 2BZDA 5ESQB 4JY6A 3CDGB 1GC1L 2E8YA 4DO5A 1N59B 1IB5A 3D4CA 1D5MA 2IGLA 3LSOB 2AXGA 4ZTPH 1KZQA 3BISA 5DT1H 3C5ZD 1QG3A 2AEPL 2X1QA 5DD6B 3RPIA 3ZTJH 4MJ4A 5HP5A 3ESOA 1FLRL 4I85A 4IOIA 1W16A 5HJ3A 5F3HB 4YK4B 4E5XA 1BWMA 4PS3A 4FXTA 3VQMA 3SKOA 1JFQL 1FL5B 3SYAA 5CD5C 2CGRH 2BIOA 2X70A 3QS3A 3KPOB 4ZXBA 4G6FB 3JV5A 1RZKC 4Q89A 1HHGB 4NQSB 3BDYL 1K72A 1SXNA 3JWOH 4PYHA 5CZRA 4JG9A 3TH2T 4A2LA 4OZGB 4RCAA 3BUBA 4GAFB 1E28A 5AOMA 2DN7A 3ZE0E 1FYTA 3W9EA 3BXNA 3LEVH 3V6OA 5JMOC 5IWLC 1PL3A 3BZ4B 1D9KD 1S7VA 1H3WM 3EH2A 3KPLB 3QW9A 5ICUA 2E56A 4FNLL 4CILA 1NCBH 3MV9D 4IJ3B 2C34A 3AWEA 3V6FB 1HQ4B 5GZOA 2ZG1A 3MBEA 3B9KC 1KJ3H 2D2OA 4HF5H 3L13A 1INQB 2XPGB 4QJ3B 4BSWB 1I1AB 3L7EB 3NSDA 2UVEA 4PJCA 5D71H 1DBBH 2BSED 4PJDF 4UT6L 1K8DB 5J6GB 2XTJD 4QOKB 4Y5VA 4D0CB 4ZFOL 5E6ZA 2WXIA 1RIUL 4NRZB 1NCWH 2AJYL 4FDWA 3VFRB 3N41F 1LM8V 2ZKYA 3BQVA 3BHBB 3SDDC 4UT9L 4HLEA 4RAHA 5C3TA 4XB7A 1FGVL 4ONOA 4U3SA 1GYAA 2NR6D 4XMXA 4PJ8B 4MJ5B 1GZHC 2OW7A 4LPYA 1U2HA 3TN0A 1U33A 1Y0LA 2YA2A 3KJ4B 3WMSA 1H5BB 4QJ4B 2C4FU 1S9XB 2AQ1A 3S3JA 3N44B 4DETA 3DVGB 3I9IA 5SWZE 1GZQB 1U8CB 4MMXA 3FQXB 3S9DB 4GRLB 4YDLB 3WUZA 2R69A 4GMSL 3QORB 1BMGA 3IN2A 4Z78B 1GTNA 5EZIH 3N55A 2ZKWA 2ZG2A 1EHLH 2CHDA 3MRPB 2FVNA 3V5DB 43C9B 4NQDB 3P0YL 4AK2A 1MUJA 2ZE0A 4I77L 3B56A 4PJAE 5D1QC 1TVDA 2PXYB 1ODUA 1PG7W 2VXUH 1U8PB 3NCBB 3V0IA 1T4WA 2IGFL 4L4JA 5F9AC 2WBJA 1XL6A 2W91A 5FDWB 3U2IA 3U83A 1HDMB 1TVHA 4LPXA 3WXVL 5KVGL 4X5WA 1BG9A 1VSCA 1N3NA 2PCPA 5ID1B 4PBXA 4NYLA 4XBPB 3VCLB 3LZFL 5J56B 3KEDA 5L2KA 1HWGB 4OUOA 1DO5A 4F8LA 4Z7OB 3DECA 2C9PA 5F2FA 1EHXA 4N85A 4BBWA 3SE4C 4XAWL 5CZVL 1FI8C 3ALWA 3Q48A 4YHPA 2EUWA 4YXKH 1YUHA 5HJGA 3SCMC 2B16A 4UUJB 4YWGL 1W15A 2AEOA 2OFQA 5EUKB 3EJYC 5J12C 5JW5A 1ZT7B 2GK2A 2KPWA 3D3VE 2F74B 3DYOA 4M9PA 1QKZH 2R56L 1JDAA 5SWQB 4AZUA 1DDTA 3UTTB 4WWOA 2YD1A 3K2KA 4AYDC 2VOTA 4AUYA 1I7TB 3ESUF 2X0VA 1QFHA 4ZOBA 4F8QA 1E3XA 5BS0B 2G3ZA 1I31A 2A9DA 2Y06L 3F85A 4G5ZL 3KPRE 2K45A 5AWNL 2PTUA 1BGXL 4TQPA 2YWYA 3FB5B 2LU5A 3ZDXE 1SJEB 1CLOL 3F2LA 2A99A 2K8MA 1C7SA 4NZTL 1FBIL 4OZFH 2WVTA 4DKFL 3QEQB 5DEGA 3MLRH 3G5ZB 4F20A 3D18A 4F7PA 5I82A 1DJHA 3MLXH 4AJVA 1MHCA 1EJ6A 2UVFA 1QEWA 1IKFL 1HHHA 4ZZFA 1S9YA 5C09D 3Q8EA 2X4SA 3AM8C 4P2OB 4PLKD 4U0RC 1ZDSA 2R9HC 1RZ7H 2VW6A 1FYTE 3V6OE 3B2MA 3TH3T 3B3BA 1JCVA 4DZ8B 3S8GB 1IO4C 1UGNA 5BZDB 1S3RA 2F53B 4RRPG 3TVMD 3ARXA 1KBGH 5IWLA 4ZPVB 4PREA 3GMMA 1W91A 3QIWB 4BYHA 5ERWB 3IXAA 3EO9L 3TH4T 1E9OA 1GYWA 2X44D 4R83A 1FVEB 1NDMB 4LEOA 1CQYA 4P23D 3MUGB 2O93L 1VPOL 4MDIA 4M03A 4K7FB 5DWUH 4PJCE 3B9KA 4GLRI 5DUMH 4KVCL 1TMCB 1KPVB 4FG6D 5F9OH 4ZUTA 5C9KA 4DGWC 3BZFB 4J3OF 5DUBA 4MX7A 4YXHH 1OOAA 3MJGX 1VKXB 3THMH 5K9OB 1KIUA 3KVQA 3SDDA 2HLFC 2F54D 2ZZUT 3D39B 3P2TA 3POHA 1AYRA 1P69B 3LZQA 1FUNA 4PV9A 1FFQA 2NY0C 5FA3A 1NZRA 3UTZA 4H4NA 1GZHA 2XPYA 4P2YA 1J1OH 2DS4A 4W81A 1ZEAL 4FI6A 2AFNA 2ZOUA 3R4RA 2I07B 4FTVA 4M93C 4DP0X 4IIQB 4HS8L 2F7OA 4OGYL 3VFPA 5C71A 1SHWA 5F3FA 4KZ0A 3TWCH 1WJ3A 3D05A 1W80A 4QJ5B 3QQDA 4S2SB 1UWEL 1E4XH 2J71A 3QXWA 2P5WA 3R1GL 3EYUL 3NN8B 4AE0A 3G6JA 7PCYA 3EUDA 4XXWC 4GXVH 4LOFA 3WJJC 2ZUWA 5D1QA 1DSFL 3LRSA 4JCLA 3EOAB 1M2VB 1A6VH 2VO5A 4Y1AB 4YMPA 3P4OA 4L1LA 1ZGLB 4N8CL 1T6VN 4N2LA 4DN4L 1JBJA 1XH0A 1WBYB 3DGCR 4R0LA 1MHPH 3RDJA 2VXTL 3CSFA 1Z3GH 2WQRA 4UBDC 3SY0A 1J9QA 3EG9B 4FNQA 4PJXB 3ML9A 4HLZG 5F71A 3T8MA 4M6OH 4FC3E 3BWAA 2P26A 3GJEA 4TLTA 2LE9A 3SE4A 5HHXH 3V0WL 1UKSA 4ES9A 1JXDA 3CZLA 1MNNA 5I74C 1X9QA 3SCMA 4MA7H 5L0QB 4HIJB 1V7NH 4K71C 3ARYA 2ZOOA 4P3CL 5HDQH 4YEFA 3OXRB 2LR4A 3T8VA 2V8MA 1Q0XH 1HNFA 3BAYA 2FO4B 1C5BH 1W72L 2R23B 5BV7L 2A0LC 4U1IA 2H1LM 4RQQA 3O2WH 2E8ZA 1TZHA 4DEUA 5DURD 4LDEB 1ND0B 1A7NH 5DK3A 2VCOA 2PR4H 1JRHI 2NQDA 2ORBH 3NSCA 4JVUA 3WIIH 5EOQH 2WJ5A 4ZODA 3SOTA 3UX9B 3HZVA 4IRSB 1YNTF 3V4UL 1LK3H 2X40A 1FG2B 3NEEA 4JFQB 3HA0A 5DVPA 4GRWB 2BVPA 2DJMA 2JNZA 5KUKA 3ATDA 2HT4C 3S34L 1D5BA 2QR0A 4LKCB 1N18A 4HUVB 5M7QA 1ETZA 2EYRB 3MCG1 3WNIA 5DUPH 2SEBB 5JPMB 4PJBB 2H2PD 3CFTA 3QQ4A 3MJ6A 4TVPD 3CFBA 4P4RA 3PAVA 3TV8A 5CP3H 3WKYA 3AM8A 2Y5EA 1SY6A 3S96A 4QHMA 1YQVL 4OZFB 1TKWB 3E2HC 3OAZK 1NC4A 5AOJA 1D2OA 4FGMA 4FXGC 5FM8A 2WLLA 1NFDB 3QJXA 3BKCL 1AIFB 1OO2A 4KMTL 2ZUSA 4QPEA 4UIKH 3U0PB 5B7EA 3E0GA 3MACL 4H20L 1G4RA 1E3ZA 5D1XE 1WK0A 2NSQA 3ZR5A 4JFEA 4NZRL 5E2UH 1D7DA 1JXFA 3H6AA 1A6AA 1HH6B 2CKNA 3MLWH 3IFPA 3OQRA 4FG0A 4H7VA 4B9IA 3HZKA 3MRFB 1RK0A 2BH0A 4C47A 1P6WA 3NABH 4XP9L 3S5ZA 3BPOB 2EVJA 3GPEA 3ZZSA 3C5JA 3NJJA 2L7JA 4NZDA 1EAQA 1VB9A 4OV5B 2JELH 3KLLA 3EXLA 3QEHA 4JPSA 2G60H 4YHOH 4DN3H 4DP9X 3FAXA 2M26A 1DQLL 3OTTA 1KIRA 4ZUUA 3S97C 4XN4A 4ELMB 1NGPL 3PV6B 3OC8A 1T0MB 4GS7B 4HT1L 4QRRD 3VQLA 3KGRA 4KV5E 2V9TA 4FTVE 4WHTA 3V5HB 4WSKA 5I1AB 1I3RA 4P5TB 2OA9A 4Z7WF 4DK3A 4UM8A 4C56A 1KIQA 2R2CA 2UZYA 1L9RA 4MAYB 1OWRM 2P5WE 2MSPA 4N8UA 2PCXA 2CIIA 2GHZA 3HCVB 3LNGA 1PNDA 1PKOA 3G6JE 5FKAA 1A4KB 3NRFA 1XXFC 1BSIA 5AUMA 3BP6B 4XXWA 1QBAA 1NSNH 3IJ8A 2I32A 1I8MA 3RVTD 1GAFH 1XD0A 2OYMA 1NL0H 1ZHNA 4MNQA 3T6WA 1DFXA 3FT9A 5I1DB 1IBHA 2H0JA 3WTTA 4G9DB 1HZKA 1HYSD 1XR9B 2YD6A 3DSFH 3ISRA 3GSXA 2FX8L 4Z7QB 1NPUA 5ILTH 3RVXC 2AK1L 3ABMB 5HHNB 5EO1B 2BFVL 5DZAA 4BZYA 3ABLB 3UIZA 4IBSA 2MEJB 2QGEA 4WI3A 1NMCB 1S5IH 2H6UA 4XNQB 5FO9B 4HIQA 4RFEB 1NCAH 5TGBA 4HZLA 4MQSB 3BUYA 2IALA 3TNNA 4MA8L 3B2UD 4Y0GA 4Y4FD 3EJPA 3K4DA 1R9FA 3CHSA 3WS3B 2AJZA 3V0VA 1UQSB 3OL2A 4PJ6A 2XRAH 4NZUL 3F7YA 5GSVB 5I8EA 2FX9H 1KY7A 1NDTA 3EYVA 3U30C 1Z6JT 2CLZB 2Z64C 2YGOA 15C8L 1VZGA 4FQQA 2HH0H 4QR7A 3L54A 5KG9B 1OCZB 4GB9A 5FB8A 1L4IA 3WV0A 4R26L 3FMGH 3IJHA 1J86A 4WW2C 1MCJA 3KGTA 1TEFA 3R4DA 5DK0A 3SN6N 2YGQA 2JH2A 3X1NA 3UYRL 4PV8A 4APQB 1AAJA 1AGBB 2AITA 3K8KA 1ADQH 1EXGA 3DVIA 3RVWD 2ZXQA 1WHOA 4WO4B 5I5RA 2KQMA 3MCLH 2AEQL 2FYYA 3P9MA 5C0RL 5K9JL 1HXMA 1D5XA 2HG5B 2WANA 4HMDA 1P5UB 4UQ2A 5IB1A 3HPLA 3T77A 2J43A 1BAFL 3FS9A 1S7WB 4Y9CA 5C07A 3CXHJ 1AR1D 2EADA 4GAGL 4GW1B 4PLKC 2P52A 2KLRA 1SVBA 4OCWH 3S5YA 3K6IA 3VXMA 4HSAC 3BGFC 1YUKB 3QHZL 1IM3B 1YJDC 3ARTA 4HSQA 1OD7A 3KCWA 1QR1A 2YD8A 4HJSA 4UCFA 4I9WE 3C5XA 4JFEE 4HSCX 2VW7A 4WWPA 3BH4A 4BUQA 2GY7B 3VG0H 2FIKA 3T0BA 4Z0BL 4H8QA 1E5BA 1F6LL 1ZXQA 4OFVA 3U2SA 1IBFA 1N10A 4ALAC 5C1MB 3L3GB 2DH2A 2N4IA 3FB7B 5C0IA 5GRUL 1N4XL 1SJXA 4H26A 3BUIA 3RNKB 3CVIH 4G2AA 1TETL 1U6AL 4F24A 4N9GB 2YQGA 4BQCA 1JZGA 4E9VA 1JIBA 3HAEH 5I1HH 4JM4H 4BA8A 4YSDA 3L8QA 3ZHLA 1WEJH 3UAJC 4HHAB 4HPOL 3REVA 5CEXA 3SDCC 5CLXA 2VO8A 3TCLB 4QRQB 1ZDQA 1Z2KA 2XWBA 3IMVA 3DHMA 3FOLA 3PWJA 1T03H 2X2JA 2C8NA 2FEEL 3UC0L 1BQRA 3STLA 5HDBF 3HE6B 3W82A 1NUDA 1PIGA 1SOQA 2NY3D 3PG2A 4N1HB 2YD4A 4JO2L 4C56E 4HEMA 3N91A 5FC9A 3QDJA 1F1DA 3AACA 4I0PC 4JPVH 2PPCA 2ZWKA 4UT7H 5DI8B 1BXUA 3CZUB 4EZJA 4JPIA 3MODL 5INDA 3VI4B 2H32A 3WLBB 5H2BB 5F96H 2XYCA 4ETQA 2E6JA 5CGYC 4M4PA 5IFHH 1SYVA 3RHWK 1LNUA 4ZMLA 3DI3B 2EECA 3OMZA 1T6WA 5L6YH 4J27A 1A7PH 2DYPA 4QYOB 2X89D 3DX9B 5EBLA 1PQZB 2D2CC 3K81A 4LKXA 4E9TA 2ZJSL 2TAAA 5KYXA 1HZHH 2MNUA 1HQRB 3RKPA 3H9HB 1MI5A 3OKNA 2DMGA 2VAJA 4YSRA 2IGTA 3POCA 4QXUH 5DMGD 3E6FA 2CUIA 3FU7B 3S35H 4DP5X 1F02I 5FOJA 1NGQL 3DV4B 2CLVA 4YUEL 2JI2A 2XWDA 4OY9A 1FNEA 5LGJB 4XGZB 5GHWL 3DTDA 4F7EB 3BE1H 4UV4H 2DRUA 1S7UA 3BVTA 1MH5A 2A6IB 3CSTA 2AJUH 5IHHA 1ORSB 1TENA 2FQEA 2VC2L 3F6IA 3LX9A 3VDAA 2KZBA 4NAQA 2R69L 4AV0A 4HJGB 2BXYA 4NI6A 3QZPA 5BQ7A 4NJ9L 3HG1D 4QRFA 3MGAA 2WTOA 4CN1A 5A6IA 4UTAL 2CALA 2XN0A 1ZV2A 2L8AA 4NNYA 3SO3C 3IPFA 2AQRA 3WG7B 1CD0A 3P0VH 1UB6B 2OYLA 3TO4D 1RVFL 2C9XA 2J20A 1KBVA 1ZCRA 3K2UH 3X1BA 4FCHA 5CKGA 4U1SA 1Z1WA 2VLJA 3L08A 4WW2A 3TJEL 2EIZA 1XF1A 4ZX4A 4KNTA 2EEDA 3IDXH 1G7QA 3IU4H 5JXED 3JYCA 4QEGA 2C4FT 4OLUH 2OZ4H 5IEKA 1WFIA 2PCFB 2L7UA 4MZ2A 4JMNA 4OKVA 2DWTA 3BPCA 1MHEA 1P7KA 1HJBC 2NY1D 4KUZL 3GSRA 2C1OB 12E8L 4G8FB 1HOCA 1WCQA 2BJMH 5DC9B 5C07E 4E9XA 2PP8A 5CJBA 4HALA 1B4LA 3KHQA 2TRYA 4L37B 3X14A 4HG4J 5AL0A 1U8NA 4TUJB 3P9LA 5TQ0L 3VXME 3RQ3A 2GTZA 4XMKL 1I53A 4KWUA 3VFNB 3L48A 2FECL 5SWZD 2RCSH 5I8KH 2FCBA 3PS6A 1CXLA 4IU3B 2VB5A 4FKKA 3IDIA 3W9DA 1F90L 5B7MA 4IBTA 1LL1A 2HFEA 3WJLC 5I1KL 3SDYL 4F7TA 5E8OA 4KK8C 3ARVA 3MRQA 3WDJA 3MCKB 4GW4A 4L29A 3I84A 2V3EA 4X6FB 4QGYA 5IFJA 4OLZH 4BZ2H 3HTLX 1EEYA 4G80A 4XMPL 1A66A 1CG9B 2WY3B 1RJYA 2W38A 3M46A 4HOMA 2A4EA 3H7BB 4AZ8B 3PGCA 4R4FL 4JFDE 4HKBA 3ZE0F 3B9AA 5D7LB 2HLAB 2ZUTA 3RY4A 4MJ6A 1XO8A 2YWZA 2F7QA 4G8GB 5KTEH 1ZLEA 4JPWL 3UAJA 4ZDHB 1QFUL 1H9DA 3SDCA 4Q56A 3V10A 3UMNA 1AI1L 5I18L 5C0DA 4IKKA 3QZWA 3LOWA 1I8IA 4P5MB 3W57A 3CUPB 1BPVA 1NH6A 4PJ9C 4M62H 4UB0L 3L3HB 1RZKL 4HEME 3HN8A 3QDJE 1HHJB 1HAUA 3HAEB 1EUTA 1Z5LA 1O7DC 5KW9L 3ZHDA 3PGDA 4I0PA 2ZCHL 4OSUL 2YLHA 2B0SL 3HC3L 3HZ3A 1M3JA 3TS8A 2N0KA 1RIHL 2ZXDA 5MEOB 2OTPA 1LVEA 1NAMH 4DFIA 5F7BA 1G9NC 1TJHL 2A74B 3QVAA 5CGBA 4HA1A 1B3IA 3JVFC 1KYAA 1KJVA 1W0YT 5F7MC 1OM3H 4YX2H 5JHDB 1KOAA 3LZOA 4WU7B 3IGAA 5G2NA 5HXMA 1EXHA 1JWSB 4HLZH 4B9PA 4ZFGL 1QQDB 3RUGE 1MI5E 3KPRD 1OCOB 2YN5A 4Z1PA 2W60B 2BCKB 2YA1A 4RISL 2IH3B 3MNVB 1DCEA 2PPAA 4AH2B 4TNWF 3X12A 1WS8A 3OKDA 4K9JA 3QXDA 5DYOB 4OJEH 1O6SB 1T1WA 3CZNA 5DC2A 1RCYA 1JYVA 1UEMA 4WTQA 3OJ2C 2IANB 4PJAF 2BWDA 3KPPB 2LQRA 4PFEA 1X7QA 3VXUA 2PETA 4JQVC 1ZKAA 4RBPK 4WFHE 4OQTH 4MCYA 3NBNA 1I7RA 1R3JB 3RPBA 2R0WH 4K8RD 1QPPA 5IOKA 1C5CH 2OR8A 2DQUL 3W0WB 5GRVK 5KSBB 4FTDA 3I6KB 3P77A 2RGSA 4LU5H 2V0AA 5HHPA 3BVNB 2XWTA 4ZMNA 1MPAH 2NLJA 4X4XA 5DD3L 3VQ1C 2DQJH 2F18A 2NY4C 2VLJE 1OP5H 2YZ8A 4E9QA 3L3OB 4YN3A 5C0GB 1GW0A 2Z92A 2P1YA 3MOBH 1V3LA 5JDJA 1N8ZB 1MQKL 3ZT6A 3GKWH 5FGSA 2WCGA 4JN1H 2EH8L 4OCMC 2APSA 3FTGB 1DBKL 3LKOB 3S37X 2CO6B 2DQMA 1AXTH 3P4MA 5FYKH 5GRJH 3TA3B 4R90H 4LQFH 2FBJL 3IRZA 1DVFB 4LLYB 1BJ1H 4GMTH 4ECNA 2HG0A 4DT2A 4MQXC 4Y2DD 3IFOA 3UTQB 1LEKB 4K9EC 3D25A 5KSUA 3HZMB 5ADPL 1JNNL 3K72B 3ZDXF 1WCBA 4MNHA 5EZLA 3VXNA 1BBDL 1HCZA 2IEPA 5TDOB 4LLMA 4WHYH 5H94A 3VRIB 5KSAB 2F7IA 2VR5A 4HD9A 4EN2A 5B8CC 3N2JA 4N6QA 3KYKH 3NGBB 1TTFA 25C8H 1SDDA 3HMWL 3O9WC 1U3NA 4IHOA 4F15C 2ICEA 4DH2A 2BIHA 3O6ML 2XZQH 5B1CA 2XT1B 1F5WA 2I69A 2W9EH 2UY7B 4PP1D 5E6IB 5IVXA 2DM7A 5GJTL 1J18A 5C2BL 1GIGH 4TOYH 5KVDE 4R96A 4XCNB 3CZFA 2IPUG 1K5NA 5BW7C 4PLOB 1NBZA 2J1WA 1KTKE 2NZ9C 3LD8C 1HSBA 4AEEA 1TO5A 3UO1L 5DS2A 5IJCC 5H37A 4WWID 4ZO9A 4ORZC 3KWTA 4PJ9A 4PJCF 1SY6L 3H0TA 3BLPX 3C8HA 1OHZA 2JK5A 2HJKB 3C6SB 2E6QA 3RA7L 2JF1A 1TLMA 1UB5B 4JFXB 1CVSC 3BWSA 4XWOD 4KX8A 2XQYG 5KSVB 1UXSA 1D5ZB 3I9PA 5T5NF 3QFJB 4N2EA 3FT2B 2O5ZH 1MF2H 1Q72L 2R4SL 4PBWD 3MO1A 4FN0A 1PDKA 1DVZA 1REIA 4ISVB 1MRDL 4P46B 1NAMB 2WVSA 1LWHA 3ZL1A 5BJTB 2C4XA 2AV7B 2X6BA 3RWIA 4RDQG 1KWGA 4FQ2H 4NAMA 3WEAA 4NKMB 1T04A 2GSGA 1M2OA 1SJHB 3NVQA 3LH2H 4TPRL 3VXUE 4KI5D 4DNLA 3VVVA 2BSRB 1QFOA 1UT9A 2YOAA 1N5YH 1F4WH 1P4IH 5JNYA 3MRNA 4JQVA 3OMIB 1CE1H 3HG2A 2HTLD 2BVEA 3BPLC 4M6MH 1IE4A 2ATKA 4N2CA 1BAGA 1CGTA 2CSPA 2OP4L 4E41A 3DUUB 4G42B 2DEYX 3MMEB 1O5DT 2ED7A 4LLWB 3X11A 2ZYRA 2YKLL 3CQQA 2W0KA 1D5IH 1NLBH 5F89B 5EUOA 1YEHH 2Y36L 2ATAA 4B5EA 2XZZA 3CHPA 3ECQA 4PN6A 1F8TL 5CSZA 4JPKH 4O2EB 1J0IA 5D1XD 4Z95H 4QI3A 2HT3C 3O2DA 4KQ0A 4RGNB 5HDWA 1OD9A 3AQXA 4ODTL 4OD3L 5DC0A 3MUJA 4K3JH 1KTDA 1OP9A 5CBEA 3F04A 1BLNB 3GLAA 5KOMC 1CIUA 2VUYA 3R8QA 5BQDA 1M9SA 2CM5A 1RZIB 2ZPKH 4TSBH 4F58H 1XGZA 3LNEA 4JM0A 5IGXH 3MOAH 4HK3J 3EBGA 4MCNA 2Z91B 1FCCA 1WICA 3RX5A 4TUKH 2ERJB 3MV7D 2EDFA 2NY1C 1YY8A 1SFDA 3LEYH 4NXKA 4OF8A 2A5UA 3EJJX 1OANA 4BEIA 4G1MA 1BQHA 4QTHB 3PIQB 3PWLA 4PP2B 1BIIB 4U6VH 5JUEH 2BNQD 5D7IB 4XC1H 2QHRH 3TO2A 1YEKH 3X13A 3RX9A 3LS4L 2WMPA 2OMYA 2G2RB 3PJLA 1JZDC 4YE4L 5CIPH 1ACYH 3PL6B 3QUGA 1KFAH 1A7OH 4N2IA 2Q20A 3Q0HA 3HR5B 5B8CA 4G6JL 4A7QA 5JIIA 4I4WB 4A7GA 1R5IA 2ITEA 3EFOB 1JZ2A 2XX0A 4PRDA 2EDDA 4D9LH 4AYFB 4OFPA 5JIDA 1L9QA 3O9WA 4NP9A 3A4FA 2HYMA 3T0WA 5ECGA 4PCTA 2PWEA 3IDYB 4LCWD 2CH8A 4TXVB 3VI3B 4KKLD 3L4WA 1CFSB 2VDLL 4U3HA 1OSPH 5D7JD 5E8NB 3QDGB 3ULAB 4D9RE 5BW7A 4DKAA 3B7RL 3VU2A 1FH2A 2EO1A 3FULA 1CL7L 2RQ8A 2FWOB 2IWKA 4MGXA 4N2GA 1LD9B 2J56A 3ULUD 1I8KB 1QLEH 1CPUA 3FU5A 1DQKA 3DK2A 2ZXCA 2H7WA 4WUKH 1LO0L 4KJWD 1FE8H 3Q9QA 5A6MA 4QO1A 5IKCA 1X7TA 1JNLH 3VJ6A 2RAMA 3EHBC 1E4JA 4M6NL 3UGXA 4YSPA 2BZ7A 4KXDA 3NJKA 3QWRD 3MA9H 3TLRA 3UZQB 4L5FE 5HVGB 3TCXA 3D87B 4X6DB 5IW1A 2A6KB 4X98B 3NRPA 3PDGA 1FRGL 1XDTT 3IDNA 4CJ1A 3T6QC 1ZJBA 2QQKH 4NGHL 5AOZA 4PRIB 3P3TA 5KANG 3VSTA 2EDYA 2IAAC 4M7KH 1U3HC 1IC5H 3RVUD 5DRZA 2VGLM 3F3HA 4R2GC 4XNXL 1AMXA 3K6OA 2H5UA 4KNSA 1U2CA 4KV5F 1HKLH 2CR3A 2HFGH 2WP3T 3I02B 5T1KA 3COOA 3Q2CA 4OB5L 3BH9A 3PUUA 2IV8A 2VXVL 5IT2H 1CD8A 4RX4D 1HXYA 3BGMB 3GXDA 4FFYA 3FQRA 4F7CB 4JO4H 4KFMA 3G9AB 3N04A 1HILA 1DN0A 3U46A 3G6JF 1IZKA 1MJ7H 3MLZL 3EZ8A 3O4LB 4X42A 2VH5L 4XZUB 3OKOA 4EI0A 1I9EA 3U7AA 1Z9LA 4HUMB 2VZVA 2FNBA 4XI5D 3FXIC 1U93B 3QRFM 1JJUA 3SDAB 1PD0A 3RG1C 3I6GB 2W07A 2AKRA 3OLDA 4E41E 1E5UI 4EEEA 5JOFB 4GUOA 2JB5L 1YEFL 2W81C 4LVOB 3I2CH 1T20B 4M3KB 4Z7VE 2WAQA 5EUOE 2OAAA 2X4QB 4LL4A 1I3VA 1UUSA 1WVZA 1GKOA 1UACL 4I9WD 2QT6A 1U91A 3ZHNA 2W0LA 3KYNA 1NCUA 5F3BB 3MRLB 5IR1B 4YEEA 3WN5B 3MNZB 1BECA 5IROC 4PRPE 2YEQA 5E8EB 2MHAA 5TH2B 1A8ZA 4JJ5B 4L1HA 3VXOA 3RZCC 4E42A 1TJXA 5MP6L 1PX8A 2P80D 2DPKA 4B50A 4CADB 1FVDA 4JO1H 1Q4NX 4U7KA 1M1XB 1YEJL 3MGTA 2R1YB 3SHSA 3KCPB 3GB7B 2FECI 1CGYA 4XNZC 2E74C 4W9JC 1KCUH 3GXNA 1KTJA 2HFFB 2QVFB 4PLJD 1G7IA 1WFJA 2W0FB 3IMWA 4KH9A 3SDXA 1AKJA 4H88L 2GT9A 2W80C 4JRYB 3VWKD 2AJXH 4I9XA 1EHNA 4RWHA 5D1ZC 1DVQA 1J5OH 1JN6A 3VTAA 1K2DA 3VGAC 1IEAB 4JFTA 1BYNA 2FD6L 4P2AA 2L3BA 1NANI 3QIUB 2IPKB 4PJ5E 3ATAA 2ARJB 3FU6A 3AB0B 4L8CB 1FZMA 4P2RB 5T1LD 4Y4KD 4I2XA 5E2TH 2H9GB 1BZQK 1SHSA 1S9WA 2UZIH 1A21A 1A0QL 3UJJL 1AZBA 3T3PE 3OZ9H 3NFPB 4H13C 3VFGL 4XE5B 1OE3A 1M7IB 4JJOA 5F9WC 3E1ZA 5K1JA 3GSOB 5F1NA 5DS8A 2G3MA 4HPYL 4Z3IA 3QCUH 5CIPB 1MAML 1LP9B 5EORL 3RJQB 4AGNA 3HE7B 2EH7H 1ROWA 2PP7A 3OB0H 4IBWA 1WISA 4EQ3A 3MXWL 2V17L 3ZYOA 4Y2OA 3TZVD 2EIJB 3I6LD 1H8SA 4A68A 4HH9A 5T3XE 4WHCA 3L1OL 3OKMB 4XVOA 2ZQKA 4L0YA 1VCBC 2ZUXA 2GJZB 1WZKA 5DHXB 2FLBT 2CHWA 2XBZA 1J7VR 3VB9A 4V1DA 4UAOC 1HTYA 4QHNB 3W5NA 4ZQTA 3H42L 5E4AA 5ESAB 1RZJH 2CO4A 5I23A 1XF2A 4Z7NB 1L5GA 4FQ1L 1YJDL 1FFRA 3IWUA 2VKXA 4KHTH 3K6NA 1A8JH 5H35A 1ZSDB 4TTDD 2NT0A 4B9JA 3FTWA 2VLKD 3G6AA 1KGXA 1QLEB 3QUXD 1BP3B 2DI8A 1OXYA 4PMEA 2EE0A 3WMQA 1IARB 4ALAL 3QG6A 1U3HA 1PAMA 2B7DT 2Q7YB 1OCRB 2GSIB 2CBPA 5BO1H 1AKPA 3ZHKA 3REWB 3HS0B 2HZHA 2OPCA 1JNHB 4OJFL 3ATFA 3SE8H 4GW5B 1QZNA 5ETUB 1OEZW 4JCWA 4YXLH 3WD5L 3LV3B 3OHXB 5CBAB 1JPTL 2EKSA 4HCRH 3MCYA 2D7OA 3HMXA 2W9LA 3PABA 5KVDL 3UTSA 5HYSG 1CS6A 3HHSA 3WSQL 4JDZB 1WHPA 4WUUB 5I2IA 1NANH 2Q2EB 5EBGA 4PJEE 3QJFA 4F33A 1OAZH 5I5MA 1LO4L 3MBXH 1PFOA 1A14L 1U8IB 5DZVA 1B9ZA 5EOCH 5CFHA 2UZXA 3D2UB 2B14A 2BVOA 4DP2X 2X4RA 1UA6L 5KS9B 1PSKH 5E1GA 5A2CA 2X1WL 3WEOA 2XV0A 3BPNC 4QRTA 2EYSB 2APFA 1L0XA 3G5XB 1ZS8B 1KENH 1XD1A 3N40P 2C5DC 2DJSA 3BFWA 1PY4A 3E7JA 1DCLA 5IBLC 4J6RH 4X7TA 2Q86B 4KO9A 3IJYA 5A16B 4RZCB 5IROA 1GGCH 3FK3A 3L9RA 1OT4A 2FWUA 5FA4A 1AGCB 3VXRA 3RZCA 5ACMA 5FO7B 5TDNB 3BKJH 3HC2A 3MTXA 5C7ZA 4EIZC 4Y19A 1SBSH 4BKLA 1J1XL 3MNMA 4JFDD 5C0CA 1HHIB 1QRND 4NHUA 4HS6A 3WKMH 4I1PA 3SDXE 3RWDB 3TBTA 1P7QB 4R97B 2VJ8A 4A39A 1A6ZB 4NQQA 1BVNT 1KTLA 4N5UA 1J8HB 2HX9A 3O8XD 4NO3B 5L2JB 4GNKB 1UXWA 5E9DA 2OJZH 2P44B 3PHOB 4BWWA 1L9OA 5D1ZA 3FSAA 5GGQL 3B4NA 2NMSA 3DOSA 4G7SB 2ZAIA 3BKMH 4O51A 3FUFA 3LIUA 4KRMB 1UOLA 5EU6A 3SYCA 4P5SA 4JZNB 4YLCA 2VDRH 3LPPA 2GUOB 4I2XE 4KO7A 2YSSA 1XMWA 4LCIH 2Y2WA 2BNUA 4TLSA 3SJVD 5DRXB 4BFEA 4G6ML 1AY1L 4HJJH 1XH1A 3PYCA 4PJFE 1MWAH 2WKOA 4JZJC 3L9BA 4YJZL 2VRKA 5EHFA 4EVNA 3QZMA 3KL3A 4I0KA 4O58L 3CC5B 3QA3B 4ODSL 2WN2A 4QRAA 3EBIA 1N2RA 1X5YA 2XN2A 1Y07A 3GK8H 3IJ9A 3OPZH 4A2HA 1T0OA 5FO2A 1YEGH 3EYFB 1X4YA 2A2QT 1TJMA 5DQDH 1FO0H 2B2XL 5FYJH 4YO0B 4BH7A 3ESMA 2EDTA 4K73A 4DF9A 4AW7A 5JYMA 4AIXA 4OUUA 5IQNA 4GUPA 3MLUH 1T83C 3C6LD 1H0DB 5IESL 4URKA 3RIFK 2WWKT 1V7ML 3T0DA 5CCKH 4MJIB 4TS6A 4X8CA 1IKNC 5I1LB 3BAEH 4FF9A 1WPCA 3VRJA 4O5LL 1T3FA 3RIAF 3CNKA 3GO1H 3TPUA 1UCBL 2XFXB 5E1AB 3OB8A 3DX8A 3GBDA 1N6QL 2BOBA 3BIKA 3FT4A 1R3KB 3O3DB 4NIKB 1NGXB 4Q6IC 3RLSA 5KAQF 4NBZB 5JQIB 1OAJA 3QFDB 1X6NA 3GKZA 1CLYL 1DL7H 4FI8A 5KVFE 3KXFD 4YBQC 1E4HA 4ORGB 4FCAA 3UABA 5I5JA 5EIIA 4PRHA 2DTSA 1B88A 1AXSB 1JWMA 4DWHA 2ENJA 1G7JA 2BW5A 5I19H 3ZK0A 4LCCB 3WL9B 3LS5L 4JANB 1Z9NA 1I1FA 4PGBA 1EO8H 4FEMA 4WI9A 5HJDA 1MIEH 5CJQH 5FGCE 4NQCA 3UTSE 5B38B 4XVSL 3GBLA 4EI5D 3MRGB 2RR3A 4NSKA 2AEWA 4POUB 4XZ4A 3EJZD 4ATTA 1OL0A 3AWFA 4YC2C 1AQDB 3O3AA 2DQEH 4G6FD 5GRZA 2EACA 1ACZA 5CINH 4Z8FH 2VDPL 4PWHA 1IC4H 1UWXH 4FZEL 1ZHLB 1B0RB 3IDMA 4KY1H 1TF4A 3O4OB 4LVHB 2VLRE 3BX7C 2OM5A 3PNWB 3PWPB 4ONFL 3RUGF 2GK0A 5I1GH 4HU2A 2YQ2A 4FFTA 4TM9A 4KKAD 4HC1A 1PF3A 4FQLL 1AD0B 1M1SA 1YA5A 3BC9A 1LO3H 5C9JB 3MRDB 4L5FL 1G9NL 4V33A 1OSYA 3GRBA 4YZFE 1B3JA 2WUBL 3QB7C 4MSWA 1Y1UA 2VABB 4ZO6A 4LEEA 4PTTA 2Y5TA 1NUFA 3SQBB 1I1AD 1MCPH 4ZFFA 3JBG7 5EBWA 3TFBA 2JLLA 4KXZI 3NCJH 1JVLA 1BCIA 1P84J 2BVTA 3NDZE 3G08B 1FNSH 4M43H 1KV7A 4OM1L 3VD2A 5BZWA 3OM3B 1H3PH 1EJOH 3CX5J 4Y19E 1PZ5B 2AMGA 4I3RL 5I15H 2VERN 3DKHA 2FB4H 4WDIA 2KLTA 5IHZB 3TC9A 1SXCA 2W65B 4GEJA 1LDPL 3ARBC 4JHWH 3RY6C 3MZTA 2VMFA 2HA1A 2ATPB 3SYPA 1YMHB 1W8OA 3FONB 1IX2A 5IVZA 1TTRA 2CR0A 3QXUA 5E9DE 1HIMH 4A2FA 5J6HB 1LJMA 1OIOA 1K6QH 3KLAA 3MRBB 1V5JA 3QDAA 4WW2F 1SYSA 5IF0B 2E4TA 1WUNT 5EU6E 5K39B 2JIXA 2GTWB 3TBSA 5HGHA 1PZ3A 3ISWA 2OMUB 3STZA 4DEWA 4XWGH 4L8SB 3T4YA 4FNSA 4Q97A 4IRJC 4I1NB 3QQ9D 1RKRA 2VZOA 2XFGB 3FN0H 4DJMA 2E4FA 4N8PA 4YHLH 5E8DL 2WYHA 4RGMB 3WLWD 2CJUL 3O2DL 3U6RB 2A9BA 4U6YA 3FTYA 2KLSA 4JZJA 4D0BB 3N9GL 3DX0A 1AZCA 1JV2B 3CXFA 5BUPA 2CHXA 4YOKA 3EDKA 2LU3A 3EYQD 1FFOA 1JMZA 3ZDWA 4GAAA 5LB1A 2XTSA 1WAPA 5E99H 4BE5A 2C7UB 4NWUL 2EDMA 1X5GA 3PHQB 3BP7A 5KZCD 4KPHH 4U6HB 4N0UA 5FXCH 3RGHA 2BS9A 4ODHL 1T83A 4XRCB 1G5GA 4HUWB 2EKJA 2QPSA 4NPYB 4UU9B 4BKTC 2VE6A 1P6FA 4K9EL 1IKNA 3A6CL 4XPHH 1E5ZA 3HZYB 4N8VA 2OMVA 1EDQA 4ZS7L 5A2LH 5AD0B 1FO0B 4FQHB 2QPEB 1K8IA 1IM9A 5F0MB 2O5XL 5A1AA 4J8RA 4G9FB 2AS5M 4Q6IA 5DLLA 3B7YA 1X4ZA 3V4VL 2DYSB 3NZUA 4Y89A 5CD3B 4PRHE 2XG5A 4IOSD 3U6XA 3IXTB 1TJGH 3W5MA 3JTBA 1MCDA 3OV6A 4NOFA 4WFEE 2IDUA 5KVMC 2FRGP 4AG4H 2Q8AL 1G84A 1JPEA 3K0YA 4XNMA 5KYWA 4BV1A 2X2HA 3RTQC 4GG6B 3CQFA 5DJDA 3VW3L 1KYUA 1P5VA 3DC0A 1BQ5A 3LCYA 5DSCB 3KYOB 1F58L 4JQIA 1AO7B 5E2WL 2Y7QA 1ULVA 4D9QE 4GYBA 2XJLA 4KKCC 5LCVA 2V7NA 3CXDH 2K3TA 2F7RA 3BUPA 2X12A 2QGDA 4KVPA 5HI4D 1CR9L 1NGWA 3EUUA 4XO5A 4UOQA 2F53D 1CU4H 3S88L 4DKTA 4W6WB 3RWFA 4B9ZA 3WDIA 2H3NA 1JPFA 1UKTA 4Z0XA 3S3BB 1EZVY 3QUKA 5DFTA 5GIRA 5CAYB 3CVCA 2F8XC 2B15A 4HGWA 1SMOA 4QXGL 2LV4A 1I85C 4AEHH 5EZJB 3IE4A 2V2TB 4APXB 3CMGA 2Q87A 5L9DH 4RMWA 4NP4L 4CC4C 4OLWH 1RJZB 1UOWA 3MKGA 5DRWB 1F3DH 2P5EB 4LVNC 5BRZD 4XP4H 5GS1B 2RIKA 3MLSH 1JGIA 2WCSA 4FFYL 1R24A 4DP4X 5GS0D 3NZHL 1E6JH 2B3RA 3ARBA 1WT5C 3D39D 1YECH 2V5TA 3RY6A 2AXJA 2P24A 3U0WL 4D9RD 2B1AL 2BRQA 5JO5B 4DVBA 2R1WA 1QLFB 3T8XB 2WXGA 2R59A 3QDMB 5FFLA 1XF4B 4L9LB 1INDH 2XC8A 1F6AB 4LK4A 2ZNWA 4HIXH 1BZ9B 3KHOA 4R8WL 1J5HA 1VFBA 3MLPA 1GSMA 4MBRA 3X3GL 1QYGL 1T5WA 3CMOH 2RHEA 1ERNA 2HXAA 4QWWD 1DANU 4Y9FA 4KRPD 2C9UA 5C0AB 4IRJA 3V52H 3QJRB 3WTSA 1GJUA 1A7BA 3IEAA 2C9RA 3FRPA 1A4JB 5TE4H 1BQSA 1OCWL 4TQEL 1IEBB 4F57L 1QR4A 5ES4B 5DWPA 1PBYA 1E65A 3VFOA 4K7PL 2IDCA 3WEMA 1Q9LA 3U1SH 3P3YA 4DUVA 1IGCH 2AP2A 5GGUA 2GJPA 4WTZG 5GGRA 5JW3H 4LLUA 4PRNA 1K9TA 4G70B 3T04D 3DJRA 1J87A 4NQVB 4HEPA 3IU3B 3MREB 1C12B 1OE2A 4PJ7B 3X17A 4JPQA 2XCMC 3HBZA 4OGXL 5IQ7L 4N0UE 4XTRC 3ZTCC 3FQNA 3DROA 3K4ZA 4M5ZH 4PSPA 5HHMB 1S7SA 5TK2A 3ILPB 1N5AA 3NT0A 4KZEL 1LK2A 3QNXA 2I9LB 3ZZLA 1CFTA 5HDOA 4FG4A 3KR3L 3TJHD 3ZKND 5DJXA 4CVXB 5DJYA 2YAQA 3NP3A 2ESVB 4BM7A 1PLCA 1EGJH 3C2AH 1P1ZA 4P4KC 3D09A 1AS8A 1SVCP 3VWJB 5TE7L 3P3UA 1HH9B 3FT3A 1JF5A 2RFXB 5TQ2L 1FHGA 1NIFA 3RTLA 1VEOA 4ZMYA 4GKZB 2OSXA 3B8YA 1FZOB 4W1TA 3WIAA 1L7TH 2BHFA 3B1TA 1YYLL 3ZKQD 1SDAB 2OXGA 4PS4L 1W0VA 2DF3A 5LQBL 1R33A 4FNUA 4BFKA 5GGTH 5ACZB 3GBNH 1MJ8H 2Y7MA 4JHAH 1N7ML 4LMQI 2IVFC 1UKQA 2Y24A 2IAMB 2NNAB 1R0AH 4PRPD 1SZNA 4N2HA 4DPCX 3MYZA 1SFHA 2B1HL 3O6KH 1INEH 1JFHA 4M4RB 2MTPA 1QFWI 1O9VA 3DUHA 3RTQA 1R1CA 3S36X 5A3ID 4WLCA 4X0KA 2Z6FA 3HC4H 4V11A 2QPDB 4NC1E 5EG6C 5K9QI 4G8IB 5DJAB 1J8KA 1SEQH 1QSFB 2FLRT 4LHUG 5E0QA 1XSIA 4TULL 4NCC2 1OSEA 3DV6B 1AG6A 1NEZA 4UM9A 3OWRA 5DJCB 4L4VB 3FUNA 3ZO9A 1SLWA 4D0DB 1GY2A 1O9ZA 4QY8B 3DJSA 5BXFB 1F42A 5B39G 5IHWA 1A1OA 3GRWA 3SBPA 3MJ8B 3UBXA 4FEIA 4JGJA 5EZOL 4XNDA 5IK3B 1T7WA 5LWYL 4PJ5D 3MX0B 5MEPB 3C5ZB 2YXFA 5HVWA 4HKJB 3VD7A 1I85A 4XMLH 4IJ3C 3ZJAA 3BLBA 4DKDC 3JV0A 3MLVH 3ZIMA 4JFZH 2X6MA 1AXIB 3PF2A 4YH6A 1I1AC 4X4YA 5KVFL 5I0WA 2DTMH 2JWYA 3BEVB 4LCVA 4KKPA 5ALCL 5KVEH 2EAEA 1ZTXH 2X53A 5EEWA 3R18A 4IDLA 2CBMA 5TF1H 5ADOL 1IAIM 1ZRUA 5LJYH 3HI6H 2QADC 1FHNA 3FZUC 3HMXL 3VNZA 4Z7VF 2TRHA 5DR5L 5EO0A 5EUOF 1RZGA 1GC1H 3QRGH 4FJ6A 3RWEA 3EOTH 1WT5A 2X6VA 3GSVB 3J8F7 3CG8A 2ZSWB 3BWUC 2DMHA 4U4BA 4WZ9A 5DFVC 4PJ8C 3PAYA 4M1GL 2ENQA 5DHVA 1X5LA 4NNXA 2LLNA 3EFFA 3KJ4C 1ZVSA 1OAUL 1LXMA 2XQBH 3N5AA 5AVXB 1D9KB 3RAJL 1NJ9A 2VJXA 4XPTH 4OF7A 2F1EA 4FYQA 2OSWA 1S9VA 3ALPA 4XODA 5ITFA 4JB9H 4GRLC 4YDLC 5AB0A 3QIBD 1KLFB 3QORC 1A47A 4AYMC 2Q10A 2ZSVB 1TEYA 3K6DA 4H1LG 3VYOA 5IQLA 3MNWA 2FZ3A 1W2KT 1ADWA 3VXTA 1PFCA 1FH5L 1QFWH 4Y5YB 1CXEA 3RNQA 3L6FB 2Z0BA 3BSGA 3T6XA 1Q9KA 2BP8B 3AVEA 2O61A 2PXYC 2XTJB 4IBZA 3EDFA 3RWJA 3RPKA 2EP6A 1JGEA 2OLDA 1JZ4A 2HUHA 3WELA 2OK0L 3FCUB 3LNHA 4HIEB 2AGJH 2ZCKL 5TDPA 3V0GA 1F1GA 2YUVA 4IGBD 3A4DA 1RZFL 4HH8A 1FZKA 3LZNA 5EA0L 4KNUA 1GGTA 1SOSA 3FO1A 2FJGA 4B0MB 5A2IH 1HZLA 2B9AA 4Z7UA 5ICXB 2OI9B 3CN1A 4QF1A 3DX7A 4UIMA 3BQUA 1PJWA 4OJAA 1E2WA 1CD1B 1MFEL 3IKCB 4Z76A 3BCDA 3C8DA 3QO1B 3CAFA 1CQKA 3UJTH 3GMQA 5DK2A 4EAEA 1RUKL 2YJQA 3WFDH 3G5YB 2X38A 3T3PF 1CO1A 4LSSL 2YAHA 1KCRL 4XVTH 3N43F 3FO2A 1LHZA 4JFVA 4Y7OC 2BHZA 4P4KA 2FR4B 5AVUB 4KQ3L 4AQEB 2P48B 5I1EL 1AZUA 4F2MA 1XGQA 5DEJA 3A67L 4PMFA 3K1KC 4F1SA 2BNRA 8PAZA 2WVVA 1NBCA 1BBJA 2Z31D 5IQ9A 4OCYH 4ABWA 3CDGA 5T5FA 1KTRL 3V8OA 3FCTB 4I5BB 4J39A 3L5IA 1CVRA 1AD9B 1MJJB 4YR6B 4QTIL 2EIBA 5CZXC 5DD6A 3C9NB 5HY9B 1EMTH 3P0YH 3O3EB 5B4MD 1DHKA 4I77H 5CMAB 5F3HA 1YN6B 4LFHD 2KYIA 5HYSB 2KL6A 4EDWH 2IGFH 3BD5A 2XYBA 3AQZA 3LZPA 3U9UB 2VRQA 1OP3K 3K71B 1IGYB 1AKJD 2PO6B 2WLYA 2EC9U 3WXVH 4P2OC 5KVGH 3BIAX 4PTUB 3KPOA 3U25A 1HHGA 3L95B 4NQSA 1O7VA 2R0KL 3WMPA 1MCLA 1XGPB 4S10A 3Q6GH 4PS7A 3WEXB 3ZE2E 2EDRA 2F58H 3IJSB 1F4YL 4C58B 4J3XA 3BFQG 5T1DL 1I9RH 2FSDA 3BUQA 3NA9H 1S3KL 5CZVH 3QIWC 3RGVB 1OAXL 2D4DA 2RALA 3BZ4A 1OHQA 4TVPH 5F7HA 3KPLA 2K4WA 4X8JA 2R2EB 4Z9KB 4LSRH 2WNGA 2XTLA 3NSXA 1KXVC 1HQ4A 3V6FA 5DDHB 2FTAA 4FERA 3QR1A 4UOW1 1S7TA 1UJ3B 1INQA 2XPGA 1E5YA 2MNWA 4XVUD 5I66B 4PI2A 5T5NG 3O6LL 2QLVB 5IM7B 5J6GA 4QOKA 2CD0A 4D0CA 5C09B 3ESPA 3ZXAC 3IJEB 4NRZA 5SWSD 4KBPA 2F8VA 2PPDA 3MA7B 4N22A 2BC4B 3VFRA 4F5CA 4Z23A 3BHBA 2VDQL 4TNVK 5AVWB 2YN3A 4JK0D 3TVMB 3GJFK 4FS0A 4PJ8A 4MJ5A 4ZQKB 1II4E 2W95A 5J3HD 5A2FA 3B5TA 4QT5B 1G6RH 5IG7B 4RAUB 5ELIA 2D4FA 1P9MA 4XOBA 3DVGA 4OV6F 1BG1A 4IIQC 4KGJA 3O6FD 1GZQA 1U8CA 1YYML 3FQTB 3FQXA 3GMOA 3P2BA 4W6XB 4GRLA 3V8CA 4HC1L 1UEYA 3F5WB 3QORA 4Z78A 1MSPA 2ZX8A 4P5RA 1IKFH 3QJQB 1QWUA 2B59B 4GFTB 3NCMA 3MRPA 4ZFZA 43C9A 4NQDA 1FG9C 2E46A 2QQNH 3I75A 4OI7A 4FA6A 4PW9A 2NUPA 3SDXF 3RI5K 2PXYA 3BSZH 4F9LC 1QSED 3LY6A 1PZBA 3UYPB 1U8PA 1EPFA 4BFGA 4EZMA 1A7QL 5FDWA 5DA0B 2DMBA 1IFRA 3TURA 4N25A 3QUYD 2F54B 4I0CC 2AJSL 4ZW5A 5ID1A 5FYLD 4XBPA 5CHNB 3TT1L 2R27A 2OQJB 5HYQB 5AAMA 3BOVA 3LKPB 4WKZB 4X7FC 3F58H 1EANA 5B3SB 1DEDA 4I89A 3VFSA 2EZ0D 2VZSA 3ARWA 1OPGH 2G9HA 3N3EA 1KB5B 2EDJA 4UOW0 5F8RC 4UMSA 2AQNA 1VGKB 3KW7A 3Q3GA 5HGDB 2VAAB 4N1EA 2J8UB 3SKJH 3UIYA 1TZAA 1RXLA 2X6UA 4MZRA 1EZVX 1ZT7A 1KN4L 2VLRD 2XG4B 4BK5C 2F74A 2VXQH 3ZKNC 2YOCA 4F2ME 3L3IB 4JM2D 5JIPA 2E0PA 5SWQA 1NCDH 2BNRE 1KGCD 2A4CA 1KV3A 2FE0A 4FHKA 4LEXH 2YGVA 4B53A 3UTTA 2Z9TA 2AABL 3D52A 3V4LA 3VXSD 1CJYA 4FZ8L 1ZEAH 3ETTA 1I7TA 2WWNA 2AXWA 1M7DB 2NY2D 3SPGA 4HS8H 5BS0A 1CN4A 4IRSC 4OGYH 3ARUA 1TYJA 3JUYA 4WY7L 3HFMH 3FB5A 1SJEA 1U2YA 2PW2B 5HHVH 1DVXA 4QXTB 1YHPA 3EYUH 6FABL 1NBVL 1RUAL 4EZLA 1X4XA 3OB0K 4LCUB 2KMWA 5BMFH 1KEMH 3QEQA 5LNGA 3G5ZA 3IBEA 2I5YL 5C70A 3EGSB 3INUH 3FRUB 3ZKXB 1UFUA 2CDFB 3CFCL 1RK1A 3ECBB 3VM5A 4P2OA 3EJSA 4DN4H 1M71B 3A0OA 1H3VA 3QZOA 5AKSA 2A9CA 1KC5H 5IV2B 5DURB 3DSNB 4DZ8A 3DLQR 5BZDA 1J0JA 4WIQA 4GAYB 3QCTL 4FYTA 3ZKMC 5G5DA 3A4AA 1K4CA 2F8IA 4ZPVA 2QFRA 3QIWA 2WOBA 4ZTOL 2FEJA 2WXPA 2AQ2A 3K80A 2D7TL 3T0ED 3TYGH 5T1MA 3ULSA 1NDMA 4MXVE 1GR7A 3MUGA 4LSUH 5I6KA 1KXVA 1QD0A 5JDSB 4ZS6C 2J55A 2QTVA 3Q2WA 3IVKB 3E9TA 3I9GL 1F18A 1W72H 1KPVA 4QOKE 5D7LD 5EC2A 3BPOC 4PWKA 3BZFA 3OXSB 3L4UA 3HI1A 4FQXC 5DZNA 4F5CE 2BERA 5BUGA 4ZX5A 2NY6B 1I8LC 2AXHA 1VKXA 5K9OA 1M56B 1X6LA 1UM5H 3O0LA 1OOWA 2CBQA 4JQIL 1XEDA 4XCCH 4W70A 4YZFF 4GS7C 4ONGH 5LCVL 2DQHL 1HC1A 1UYWH 5JHBA 3WGUB 1JGUH 1F4HA 3L5WB 4GSDL 3S6CA 3X1FA 1A3ZA 3S34H 2GAZB 3OC5A 4PUBL 3OJDB 4P5TC 3BRGC 2I07A 3ULVC 3T2QA 4IIQA 4XPGL 2P8LB 2JKIS 2BHUA 3EYOB 3JTTB 1MAKA 3PXHA 2D3NA 3BDBA 4MAYC 1Q0EA 2PP9A 2K6ZA 1X9UA 4E9SA 4S2SA 3V0EA 4U1LA 3VD9A 4UV7L 1CGSH 5CN1A 2R0ZL 4KZCA 5DJ8B 3NN8A 1F2QA 3UTPD 1OB1A 1UURA 4A04A 1YNLH 3G5VB 1G6RB 5ALBH 3M8OL 1YEDB 1YQVH 5TPWL 2V2WB 2CR6A 4F9LA 5EF1A 3SOBL 1M2VA 4Y1AA 1IJ9A 3GTTA 1ZGLA 4KMTH 3D85B 4DKEL 5I28A 3LYRA 5CO1A 4RMVA 5KN5B 1WBYA 2FEDD 1TZGL 4QRRB 3OHMB 4Z7OE 4NZRH 4K3HA 2UXTA 2CK0L 3NUKA 3EG9A 4PJXA 4HCFA 4DPBX 1CDUA 2QGCA 5DU7A 4G1EB 1DVUA 4NUGL 5F8QC 3H9SB 2WKOF 4ODXB 3QEUB 3U4BH 2XBTA 4D9QD 3VE0B 2X9XA 4XP9H 1TUPA 4HD5A 1GSKA 2ZUQB 4HIJA 5T33L 1NIBA 4AMXA 2LLGA 4KJYB 3NH7L 4BA0A 3W0WD 3OXRA 1E40A 4OH2A 4BK5A 4U31A 2X4TA 4WRLA 4MB4A 2WNWA 4MWFB 3P54A 1DQLH 2FO4A 3UTTE 2DIJA 3FPYA 4YSEA 2R23A 4HT1H 1MLCB 3ARGD 3NAAH 1EAPB 2EXWC 1UM6L 5GS3A 3LKSB 1IBBA 1ML0A 2ZNXA 3WNNA 4D3CL 4BH8B 1ND0A 3EYSH 3OBAA 3WXWH 2HCZX 2GC7C 4J5VA 4GJTB 3EFDH 2CA3A 1Q8MA 5HI3C 4AQAB 2FJHB 5KYYB 1GJWA 4IRSA 3ZYJA 1KGWA 1FDLL 2K70A 4YDVB 4JFQA 2CRMA 1XF3B 3KM2A 1CLCA 4Q9CA 4MMZB 4U1MA 2XVLA 3UG4A 4APQC 4LKCA 1IU1A 5T8IA 4ZW7A 1QASA 1ED3B 2WVUA 3CPLB 4HUVA 1WZ1L 2EYRA 3NIGB 4Y4FB 3RL2B 4M7LL 1ZA6B 1U8LB 4WO4C 5LDUA 2SEBA 4KJQC 1BA9A 2BWIA 4PJBA 5FWQA 4LP8A 1DANT 2FYVA 1P5UC 3UCRA 2V4LA 4Y1TA 1FCGA 2AK1H 2ILLA 4PW3A 4OZIB 4OZFA 1TKWA 1RURL 2VN3A 3CSYB 3OR6B 3MV01 5IJDC 2WQUA 1NFDA 3WJMA 3Q8FA 1SQ2N 1TFPA 4JNXA 3U0PA 4PGCB 3H2QA 4A37A 1JNJA 2DW5A 3WFEL 3HN3A 3TTSA 4Q9RL 1ZK9A 1BEYL 5I0YA 5IUSA 3C60D 1A9BB 1R4XA 2HAZA 3CGTA 4MA8H 2BWQA 2Q76B 1I9JH 1HH6A 3L4CA 1J10A 2CJSA 4DVRL 2YGNA 2F0CA 3MRFA 3NESA 4EN3D 1JZJA 2NW3B 4NO2B 4NO5B 35C8L 3DGGA 4KTEL 3UPRB 4POYA 3P69A 2JTDA 2KT6A 3FFDB 4FQXA 4YDMA 3H53A 3EGDB 4OV5A 4OGAC 1I8LA 3ZT7A 2EUXA 2AXFB 1AR1B 2Y23A 3UEZA 2CGYA 4R26H 4CSZA 3P3SA 5HHOA 5J6SA 2JI1A 3OKKB 4ELMA 4H1LH 3PV6A 2DQTL 3DPBB 2QTEA 3E9UA 3HE6C 4FQIH 2BDNH 4JEGB 3FBKA 5K59E 1W72B 1EFXB 1CYWA 3F05A 1BEXA 3KPQB 5D93B 3KPSD 2GKIA 3BW9B 4AQ1B 3HVNA 5I1AA 1E8XA 4P5TA 2VSKB 3Q1EA 2DQDH 3ZRCC 2H6PB 1MCOL 3L2MA 3GRWL 2XWEA 4OT1L 1JGLL 1LEGB 4MAYA 4DP6X 1JK8B 4KROD 5C0RH 3OKLA 4CGTA 3QFJD 5EU5B 4UMGA 1R5VB 3DGDA 3O3UN 4HGKC 3BP6A 3MRHB 1M9WA 4XVJH 3US0A 1ZTMA 2BMKB 4Y1AE 5AVTB 1NICA 2IFFL 1IGIL 1WTLA 5JYLA 1KYFA 5I1CH 5I1DA 5D72L 1IGMH 4G9DA 4WJG3 1U21A 1XR9A 4KTYA 4AV4A 3ZTDC 5D1ZI 3W3BA 5HHNA 5EO1A 4PJXE 4TF4A 4EZKA 3P40A 3A23A 4RA3A 5K93A 2NY3B 4XNQA 5K33A 5FO9A 2WYTA 3QARA 4LARH 4ZBJA 1CFVL 4RFEA 5DD1H 8FABB 4LPVA 4JDTH 2QSQA 3F7VB 1ZJAA 3NJIA 4DUWA 1N64H 1CI3M 4PJIA 3NDYE 1A6UL 1FL6B 1KTCA 3B5HA 1MRCL 1N0LB 1BZOA 4JX0A 3WS3A 3FU8A 4AEFA 4HPOH 3BT2H 3B34A 4NHCH 4U6XA 3BRDA 4IMKA 1N70A 3T2PA 4FQJL 1XMEB 3EXJA 3KJ6L 5GSVA 3WAKA 1ZLUH 3Q8BA 3GS0A 2WQWA 1EO7A 3TJPA 1I7ZB 1IL1B 5GXBB 2CLZA 1JPSH 1BMZA 5E94B 1UD8A 1N68A 4JO2H 5KG9A 4K8RH 4XP6H 5JW4Q 5E9NA 5IW6B 4GRWE 4FA7B 2DQIH 1USQA 4HWUA 4N87A 4MFHA 4BSVB 3RRQA 4U7MA 1ZSHA 1JCKA 4XN8A 4APQA 1DBMH 2ZOLA 1AGBA 3HB3D 3T08A 3VYNA 3QJHB 4FMVA 1HEHC 2KERA 3IDJB 1WV7T 2KC0A 3MC0A 4P9MH 4PJBE 1HN1A 1HHKB 4WO4A 5CZKA 4NEHB 1J48A 3UEQA 6PAZA 5M95B 3ZE0B 2BFGA 2HG5A 1TCRB 3AG2B 1P5UA 4UQEA 1HE8A 5JIKA 3RJOA 5LNDA 4LHUB 1S7WA 4BFJA 3HG1B 3KVDD 1KCKA 2GFBB 2NX5E 4MCZB 3OVUB 4GW1A 1DJGA 2RTTA 1NFDE 5E8PB 1IM3A 2ADFH 3P73A 2OJ1A 1OGAA 4G72B 3TO4B 1FSKB 1NGQH 3S8FB 3MLYH 2FJFA 2NZIA 4YSAA 5B39B 1UD3A 1FPTH 1GA2A 5CP3A 2HWZL 5T5FL 3L3GA 1JVOA 2ZXBA 1MW0A 1GXEA 3CFNA 3RNKA 5KAQG 2R69H 4YPJA 2X3BA 4N9GA 3V0DA 1JI1A 4POZD 3IM1A 5DZLA 3H3KA 2DIAA 3OX8B 4NN5B 4UOJA 3DRTB 2WBKA 2QZQA 5IFAH 4FMKA 3LRHA 2J72A 2XZCH 3LNDA 3M6DA 3SE9L 2GPZA 4HOWA 4WEBH 3O3BA 4F2FA 4YHML 1ZOXA 2Y1ZA 5DYFA 5HHOE 4ELME 3UDWC 43CAB 3II1A 4V2CB 4UTCA 1OTUC 4PB0L 3P30L 2IDFA 2BINA 5SWZB 2PW1B 5FO8B 3FQUA 2XXGA 3HE6A 3KBFA 5ICYA 4FE9A 1JTTA 5E56A 1Q1JH 2ZG3A 2QVKA 2YD3A 4LSQL 5AL8A 3ULVE 5IBTL 2FNWA 3RWGB 5FEBA 3BUTA 5DI8A 2IXQA 5B1AB 4G59C 2EXSA 3AJ7A 4HKXA 4PJAB 5CP7B 2EINB 2A74C 5TD4A 2NQCA 4KVNL 1OK0A 1UWFA 5IMOB 1QHPA 2A7BA 4H1LB 4OJYA 1VADB 2HKHL 2ITDB 5EPMB 2EUVA 1W8EA 4Y7MA 4AE1A 4S1RH 5FUOL 4M1DL 2YD5A 4QYOA 2XWCA 4X5QA 4L3ED 1PQZA 3LDBB 2FAUA 4ZX3A 3C75A 3B2VH 4TUUA 2EC9T 1HQRA 3JWNE 3S2AA 3H9HA 5FCUL 3TA4D 3VSVA 4G7QB 1X5MA 2X9WA 4XAKD 3SDYH 3QQXA 3WU1A 1FGNH 1NIEA 3F7QA 3PCYA 2W9DL 3WFCL 3S5LA 1QX1A 5D6CB 3GTVA 1ZLWK 2B4CC 3DV4A 4XMPH 1JGVL 5TK4A 3PP4L 3D3VB 5LGJA 4PJIE 4XGZA 4R4FH 1NA8A 5DMKB 3R7RA 4AM0Q 4LF3B 4XN7A 2A6IA 1BM3L 4JY4B 4JVPA 2MCAA 2HVJB 2PCYA 1ORSA 4JY6B 5FIEA 4XCFL 2EXYC 3FUDA 3IRPX 1AI1H 3QRLA 2G2PA 4HJGA 3PWNB 4IBYA 5I18H 2ADJB 2EEFA 4RETB 1SQMA 3ARDD 2H0PA 4UB0H 4L8BB 1IFHL 5L4IA 3KPRB 1RZKH 1ZT4B 1A4CA 1TFHA 5GRXG 1GJIA 1FL3B 1G1YA 2LAAA 3AABA 4AGLA 3FTSA 5BVPL 2ZCHH 4IYKA 5HJ3B 1R3IL 5J1SC 3QWOB 4KFZC 3QJUB 3MRRA 4D94A 3GI9H 1KJMA 2PCFA 3IWVA 2YR3A 2WN3A 5CLZA 5JLZB 3BEWB 1RMFL 3TA3C 1T7VA 1U8KB 2WNKA 1SVZA 2EE3A 1AYOA 3W9EB 4FLOA 1DVFC 4G8FA 3GXFA 4KX9A 4OCXL 4CN6A 1CF8L 4L37A 3B37A 1T0PB 3L16A 4M7JL 4HWNA 1AQMA 3BD3A 5LGHL 4BCZA 4C59B 1OGAE 1WZAA 2CA4A 1QEXA 5AVVB 2VN4A 4G8AC 4LPWA 4L0ZA 1VACA 1ADQA 1MFDH 4IU3A 2KI6A 5KSAC 4GQRA 4OJCA 4HIHA 3MBWB 3D07A 3NGBC 3DVFA 3LIZL 2XIBA 3F12B 3MCKA 1UUNA 3KDMB 4X6FA 4N5ED 1Z32X 3DURB 3VU1A 1CG9A 3QZWG 3WFBH 3MRKB 1S7XB 4P3WA 4EOWH 1ZGLM 5AZUA 5E6IC 4AZ8A 4U3SB 5GJSL 3ZE2F 5DHYB 5CU9A 3TT3L 4G8GA 4Y2DB 1LILA 4ZDHA 3UDWA 5T3ZD 5J9PA 2BO0A 3AT9A 4PRAB 3UYOD 3IFNL 4P5MA 3CUPA 3VMOA 3D4ZA 1MZYA 5JIHA 4CGUB 1WE5A 3L3HA 4GQZA 1MQKH 4WV1B 4Y4HD 4BZ1A 4ZYKA 2V37A 3HAEA 1X3DA 2O5YH 4UQIM 2ZYSA 4L2YA 1KEGH 3TFKD 5MEOA 1JYXA 4K0OA 5ANMB 4JFFD 5AW4B 3ULUH 2A74A 3DX6B 4FG2A 1B0GB 3E6HB 1TVHB 4G11A 1ET8A 2CGRL 5JHDA 3L3DB 4WI2A 4WU7A 5ADPH 4ZUSB 3OZLA 1MNUH 3LPOA 4XPAH 1JWSA 3LMJH 4U1JA 4Z5RA 3V4PH 3KBHE 2DLTA 1QQDA 3LEVL 4UI2A 4P2QD 4AM0A 4KKBD 4P46C 4X8XA 4YHPB 4ZK8A 2W60A 2BCKA 2E75C 3KW8A 2IH3A 3FUHA 3MNVA 3GNMH 3OAZH 4YSCA 1MLBB 2B5IB 2V9UA 3S4SB 4IEFA 5ACLA 1NCBL 5FCSH 5JOPD 5ISZE 1Q94B 1VCAA 3BD4A 4FI7A 1O6SA 4JKMA 2P43B 4Q52A 5DYOA 1KJ3L 4FAAB 5ICZB 4ZOAA 3MXVL 1DDHA 4JFOB 2IANA 4X6EB 3KPPA 5D71L 1DBBL 5DVNA 2YFOA 5GJTH 3LEXB 1R3JA 3ESVF 4MZ3A 4C4KO 3JXAA 3NCEB 4OD1H 3II3A 1KB3A 4Z7UF 4X8GA 3HNTH 1NCWL 2QLYA 3F64A 3QJZA 4A7UA 2BSDA 2APXA 5KSBA 2PKDA 1D7FA 5FK9B 1ZPUA 3VTTA 3VD1A 4DGVL 5MERA 2P5PA 3E8UH 3WN6A 3BVNA 3PY9A 2NXZD 5L7XL 4RGNC 2KHAA 4OFKA 2PR9A 4UT9A 3L4TA 3RA7H 4BXVA 1H3UA 3P9WB 5CCJA 5DEGB 4FABH 4R4NC 4NBYB 5LAPA 4CA4A 1N8ZA 4JZOB 1XL4A 5EZIL