1TJMA

Crystallographic identification of sr2+ coordination site in synaptotagmin i c2b domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
156
structure length
156
Chain Sequence
SGGGGGILEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Synaptotagmin I
publication title Crystallographic identification of Ca2+ and Sr2+ coordination sites in synaptotagmin I C2B domain
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
total genus 29
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2004-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1tjmA00
4EZKA 1E8WA 3N5AA 3W57A 1GMIA 4ANWA 4KZ0A 1DJYA 2KI6A 5KJ7E 3QR1A 3DBSA 1RH8A 3QK0A 3L17A 4L2YA 5JHAA 1UGKA 3OHMB 3PRZA 3PFQA 4IQHA 3QARA 4XX5A 2B3RA 5G2NA 5H4ZA 2X38A 4EZJA 3ZIMA 4LT7A 4XZ4A 2ENJA 3NZUA 2ISDA 4L1BA 1QASA 1E8XA 2ENQA 3F00A 1WFMA 2YOAA 3L16A 4TV3A 5T8IA 3FBKA 4WWNA 5CCJA 2Y3AA 3LJ3A 4Y1TA 4FHKA 2WXRA 3F05A 4FULA 2ZKMX 3FDWA 1CJYA 3RPBA 2Q3XA 3DPDA 2RD0A 3QR0A 4QJ3B 2K3HA 2WXPA 2CJSA 2WXNA 1DJGA 3TWYA 2FJUB 2WXIA 3R7QA 4EZLA 3ML8A 3B7YA 2DMHA 3W56A 4J6IA 3CSFA 2BWQA 2LHAA 3MJWA 4NPJA 4NS0A 2Q0ZX 4OVUA 4GB9A 2CM6A 2CHXA 3P2BA 5EDSA 1BCIA 4GNKB 5H4YA 2WXGA 3QJZA 4F92B 1W15A 2CHZA 3L9BA 1TJMA 4OVVA 4F93B 4V11A 3L4CA 1QATA 2CM5A 1E7UA 3IM1A 4ICXA 3T8MA 4TS6A 2WXMA 1W16A 3F04A 4PS3A 2K45A 4FLHA 1BYNA 4DK5A 2V4LA 1DQVA 2FK9A 1DJIA 3OAWA 2NCEA 4FA6A 4WEEA 1DJHA 3NZSA 1DJZA 4JPSA 1DJWA 3L13A 5G55A 3APCA 3APFA 4LDCA 2YRBA 4QJ5B 4HLEA 4KZCA 3NSJA 4TUUA 1V27A 4XE0A 3KWUA 4ANXA 2CHDA 4URKA 3KWTA 4ANVA 1DJXA 4A55A 4DNLA 3M7FB 4NP9A 4NPKA 3ZVVA 4BGDA 4ICWA 3TJPA 4QJ4B 2ENPA 3GPEA 4MJJA 1UOVA 1K5WA 4FJYA 2A5UA 3ENEA 1HE8A 3ZW3A 3CSTA 4ANUA 2R83A 3HN8A 4FHJA 1UOWA 3S2AA 3ML9A 3PYCA 4F91B 1YRKA 1BDYA 2NQ3A 3APDA 4BFRA 5JHBA 2N1TE 3R7RA 3RDJA 3L54A 1DSYA 1TJXA 2A4ZA 4FADA 4QAMB 1E8ZA 1RLWA 3F01A 4AOFA 4F1SA 4HVBA 2JQZA 3TL5A 2UZPA 4L23A 1RSYA 4FJZA 2NSQA 4WWPA 2K4AA 2WXQA 4L1LA 2CHWA 2WXLA 1E7VA 2WXHA 2WXOA 2Z0UA 1E90A 3L08A 3QAQA 3HHMA 1A25A 3SD5A 4AJWA 2DMGA 4KITB 1WFJA 4LCVA 4WWOA 2CJTA 2WXKA 3PREA 3IBEA 2WXJA 4WAFA 2EP6A 2WXFA 4IHBA 5CCGE 2QZ5A 3JZYA 1E8YA 4PS7A 2QZQA 4Y1SA 4G11A 3HIZA 4PS8A 2K8MA 5CCHE 3PS6A 2D8KA
chains in the Genus database with same CATH superfamily
2DMCA 4XP9L 2ICWA 1JGVH 3MCKB 3T0EB 2AP2A 3TA3C 5HVHB 2D0HA 5DK0A 3W0WE 3ARBC 3PP4L 1KV3A 3EDFA 3VXUA 4QRFA 3CMOL 2B8OT 1TPXB 1BW8A 1HEZA 5GS1A 3P11L 1HILA 3DX7A 1MDTA 1NA8A 2JIXA 1WFMA 4FLSA 5L4FA 4UT6H 1UXWB 2YXMA 5FO7B 1K4DA 4X8JB 5J06A 3HC0A 1OALA 4XBMA 4OBSA 5KWYC 2AEIT 5JXEA 3S6CA 1MY5A 2R2BA 4HK3N 3ZO9A 4L3EA 4IBLT 3PHQA 3TCTA 2YGVA 3QXAA 4O02H 3VD7A 4NN7B 1RK7A 2IGFL 3L1GA 3SY6A 3WKNA 4XXWC 3ZKND 4KY1L 4Q9CA 4JM4L 1CK0L 3D25A 3GFUA 3EUDA 2F53E 4IU2A 2F54D 1WZKA 1XIWB 2AXGA 4KHXH 5DGQA 2VDNH 1YYCA 1GYAA 4QHKJ 4HK0A 1WBZA 1A4CA 4D7PA 5F7NC 5F7EH 3CJJA 4F57L 3T6QC 3NH7H 1Z1WA 4POUB 2K1MA 3ULVL 4F2EA 1CR9H 3EJZC 2K45A 2L04A 5EU6B 4M5YH 1NCDL 2BP8A 4DGVL 5HDQL 3IS0X 3Q2LA 1S9XB 4RRPM 3B2MA 4XN5A 5E6IC 4GY4A 3QUZA 3B6SA 3ESMA 4XPHH 2GTQA 1KCVL 4TVPD 4XOAA 2DZEA 5LGHH 3WS3A 4XVUD 4PRDB 1MCPL 3C75A 4LCCB 2H9GA 4LRNL 1WC7A 1I1FB 2F8VA 1TNMA 2WKOA 3S5LB 2BS9A 3MRHA 1SVZA 1ES0A 3FUFA 1TTBA 3FHEA 4NX0A 2CGYA 3C09C 3X1NA 5JMOC 4NQCB 4P9ML 2ORBH 3HKFA 3ZRCC 4OZHF 4O58L 1UJ3B 5B1KA 2CIKA 3LKOA 4BH7B 1TDQA 2CKBB 3MXVH 4FI7A 1RERA 4MXVE 1GZHC 1ZLUK 2F19L 3UZVB 1H15A 3SODB 3X3FH 3UTTB 4QPEA 3FU7A 5DEGA 3IN0A 2CCVA 3RE0A 1UD8A 1E40A 2WXOA 4B97A 4AYID 4Z76A 3N85L 4ZMPA 5D4JA 2VW6A 5C09E 4BK8A 3AWFA 4KKBC 4UM9B 5GS1C 2LU5A 1GW0A 4GKOA 4NZRH 5F2FA 2DI9A 3OHXB 1AJ7H 2ZCHL 1F3DH 1JNNL 1UYWH 3BP5A 3A22A 5C09B 3WIIH 1CMOA 2JCCA 4FQCL 3T08A 3HMWH 4RLDA 2TSBA 4I48A 5IMMB 5I0DA 2EXYD 1T1XA 1HEJC 1ND0A 1NLDH 5FYJE 4Y5XA 4ZMTA 3KLQA 5IQMA 4PJGE 3NFSH 2ZXEB 4ZMZA 4HZLA 2PWDA 3TZVB 3J07A 2ENJA 4OGQC 2BM3A 3VXSB 2VISB 1BXXA 1J0HA 3GJFB 3VI3E 4FCHA 1QNIA 3OQ3B 4U1IA 1RZJL 1B6UA 1K9TA 2IG2H 3F05A 3D50A 4LF3B 5D9SA 3E6HA 2X3CA 1BPLB 3BVXA 1ORQA 3Q8EA 3V6OE 3WKML 1WRFA 5IV2A 1RJYB 4M7ZC 3UGXA 5DWPA 4MZ3A 2I24N 1F5WA 5D7JD 4Z7AA 3NJJA 3QUZC 1MVYA 5FO9A 2VUYA 3ARPA 1D9KB 3HI5H 4Q58C 1L6XA 4OGYL 3RJQB 5I1HH 1RHHB 1NEUA 2PW1B 2HZHA 1CO1A 1IC4L 1T04B 2GJ6B 1BFVL 1WHPA 5IMLA 5D2NE 1YLBB 1UXLA 2DAVA 2WD0A 1T3FA 3RGBA 1IQDB 1CGTA 4BKLB 3JVFC 1SF3A 4I3RL 1W16A 2BW5A 4DCQA 3MA7A 4O9HH 4PCKA 8CGTA 1RK1A 4M61B 2WJ7A 4ISVB 5D1QA 3L7EB 2NDGA 4HQQH 2Z91A 4POYA 1HCYA 2DLGA 4AMWA 2H3NA 3DTDA 5D1QE 1UH2A 5E2UL 4CN6A 1NGYB 2FWUA 3TH3T 2V2XB 4FQHA 5M95B 2VZTA 3H9SA 2NRDA 1CFVH 3S88H 1J5HA 2NXYC 4GRWF 1NDGA 5KSBA 4MTMA 3O2DH 3FN0H 3TJEH 3KM1A 1LP9A 3F84A 3IJHA 1W8EA 1FNHA 2ZOOA 1THAA 3Q3GB 4FHJA 5I75C 5KTEH 1A6UH 1X5AA 4PV8A 3CZUB 1JWUA 1QSFE 4ORZC 2BERA 3RDJA 4U1GC 3CIAA 3L54A 1Q9OA 3MUUA 4WU7B 1B0RB 2WOYA 4MZ2A 4KRMB 4QAMB 3EJSA 3V55A 1P1ZA 2J8UA 4TSAH 3QIWC 4FFVD 3MV7B 3KYKH 5AAWC 4AIXA 1X5LA 5CN3A 4KVNL 1XIWD 4XXCA 4MDRA 4PGDB 1PEZA 4ZMXA 5DEZA 2RFXB 4EVNA 4NP4L 5HYSB 1UXMA 2VXSL 4E5XB 5MEOB 3BGMB 4HIXH 3TF4A 1C9SA 4HIEB 7PAZA 1A4JA 5JIDA 2H2PD 1DCEA 1IFHH 3B2XA 1K85A 5BOZG 3M7OA 5E95B 5EU6D 1OGAA 3JWDH 5HDRA 4LHUG 4PJ9C 1RAMA 4HG4J 4S1RH 2R4RH 3O6ML 1WHOA 4KH9A 4GKNA 2R23A 5AW0B 4RDQF 3U0PB 2OM5A 4FLQA 4LCWA 4WY7H 3V7MA 5IVXA 1WS7A 3L4UA 1UTDA 1DBKL 3VD0A 4MHHI 5IW6A 1HXMA 2FJFA 4WJ5B 3WN6A 4PQXA 2WYIA 4XZ4A 5C6TH 4M5ZL 5D6CA 2J1ZA 3CX5K 4PB9L 4PRPD 5HGHB 2D3NA 4DUXA 1NPUA 1WO2A 1N0LA 3T3PF 4Z7VE 5DQDL 3PGCB 1E5AA 3L4WA 3ECBB 1LO2H 1FCGA 3PP3H 1PFCA 5EG6C 5ISZD 2OPCA 3ULUL 3GJEB 2W8CA 2XWTA 5T5FH 5CCKH 1T7XA 3UTTD 2HKFL 4FXGA 3LH8A 5D1QC 4EZLA 2NY2C 3BRDA 1VKXB 3LS5H 4HIJB 2GSIA 5SWZD 3VFNA 1RUMH 4ZX6A 3SQBA 5C0BA 3SYQA 3AC0A 3OLEA 4DGIL 4UM9D 3UTSB 2CO6A 2BC4A 4C56A 4MMXB 5K59E 2PW2B 4J3WA 5KW9H 4HWZB 4F93B 1JNJA 1KN4H 2J8HA 1GAFL 4MVBC 1OARH 3FZUC 2MWCA 4AEIH 2GT9B 2QHRH 4XX1G 4GP8B 1MCIA 2E86A 5AVUB 4PLNC 2H8PA 4WNQB 4LCYA 1DFBL 1R34A 3TYFA 2NUTB 5J9PB 2P7TA 5CSZB 1ZLVH 3TZVD 5J1AB 4I5BA 1A4AA 2NNAB 1DQML 4JR9L 3QHZL 1JPFA 3V0EA 5IF0A 2A4EA 3IGAA 4XXCC 3HC4H 1JERA 4IDJL 1HXYB 4O02A 35C8H 4PM1A 5DZAA 5JQ6H 4UM8B 1WGOA 2CNYA 4NZDA 3WXVL 4A39A 5F9AC 1AG6A 5MEPA 1HZHH 5F9JA 1CD1A 3X13B 1ZHKA 3IYLW 1JGUL 3SGJC 4LP4A 2EO1A 2Q8AH 1OTTD 5IQNA 4HW6A 1FGNL 3EO0B 5C0EB 1OAQH 1D9KD 3GS0A 1H9DA 1H8LA 4IOSA 5IUCA 2GJ6D 3ARFC 1QA9B 3U7WL 4GW5A 1Q1PA 2J20A 4LPYA 2AC0A 4DKEL 1BPVA 4HJJL 4P2OA 5ABAA 3FSWA 1CFNB 3FCTA 3IXTB 4F15C 5EC2B 2J56A 3S5ZA 3OF6A 3SEPA 5I1JL 4ZW6A 2D8KA 3C12A 4XCEB 3WLWC 4KROC 2QVIA 2NR6C 5ESQB 1EEQA 3L17A 2VDOB 4WHTA 3OKKA 4WF7A 3FO1B 4BDVA 4HU8A 2C9XA 1KB9K 3P9LB 5AVVB 1RV6X 1NPJA 4JJ5A 5HYFA 1XGQB 4ODVH 1RZ8B 1R47A 1SFDA 2Y1VA 4K71B 4OLWL 1R5WB 4X5XB 3FC8A 3WE1A 2FQEA 2AK1L 4DP7X 3NTCL 4XNBA 2D2OA 4A2FA 3P4MB 1EMTL 2PTTA 3RWCB 2EE6A 4YO0B 4Z8FH 4MZRA 5I1KH 4CILA 5BZDB 4RFEB 2PPAA 3LMJH 4HLJA 5A16B 3CFKA 1JGLH 1T5XA 4XP5L 1MHCB 2WQSA 2Z65C 2EABA 1QR4A 3RVVC 4F7CA 4W6XB 3JT2A 3MJ9H 3MV7D 2WV3A 4JFPB 3RDTD 2UUDK 4JMXA 1HKFA 5A2KH 2FWLB 2ZT9C 1S7QB 1A4KA 1I31A 3E6FA 4HXAH 4CNIA 1N4XL 4FNSA 1M57B 5IOKA 5KBLA 5IFJB 1KIQB 1KBBA 5FAAA 1IQWH 5INCA 1VFBB 2P5WA 4LSSH 5LBSL 4XP1H 4YBQC 4Q97A 1IE4A 1JHKL 2A6JB 2YUWA 3BIKB 3GMPB 2QMJA 1SF5A 3O2WH 4M5TA 5KSUA 4RBPH 1M53A 3IFPB 2FSEA 2K9FB 4LDLB 5EC1A 3T6VA 3IDMA 2GABA 1RL1A 1ZLDA 4YEEA 4PGBA 4F37F 2IV9A 4LVHC 1IFGA 4FKKA 3I6GB 3GS7A 3I9IA 4WWKB 2ZPKL 2VZUA 1CVSC 4S1DD 1BBJA 1CDJA 3BUBA 4L5FH 3PIQB 4WI5A 4ZO6A 4BGDA 5JA8B 1ZA3B 3SDDA 4MD5A 5E5MB 1NOLA 1S8DA 1WCBA 1GSMA 4FL4B 1SEBA 2KZBA 3ARGD 4W9DC 3A67H 4WW2B 3QDME 2Q3ZA 5IVOA 3P0YL 1FZJA 1E4JA 3HUJF 1CS6A 1BDYA 2EE2A 2C1OB 4XOBA 1KBVA 1HYSC 1U0QA 4HHAA 1FNSL 2IFGA 1XSOA 3HFMH 4KNQA 2OL3L 1JFQL 5FA3B 4QRSA 1AZZC 1YECL 1VERA 2GBUA 5JQIB 4QI3A 3FT3B 2XRAL 4WK2B 4HS6A 1YNTF 4LRIA 2DEWX 3UTSD 2VAJA 1QBML 3RTQD 1NGZA 4J4PD 3V52H 4AX3A 1P6FA 1A1OB 3RI5K 4L9LB 1HHGA 4GQZA 3NQIA 2PR4L 4OF5A 4H8PA 3D85B 4HKXA 1YQ2A 1MVUA 2QZ5A 3ZIYA 3FPXA 3GBNH 4KUZH 4BKSC 3FQTB 1UC6A 2ZP0T 4JQIH 2GQHA 5JHDA 1C08B 4FNPA 3LH2H 1GGCL 1BECA 1MW3A 4GO9A 4KUCD 4CUCA 5SV4A 4AT6A 4XMLH 4GEJA 1OAKH 2Z92A 2YOCA 4M8RA 3O2DA 3BIAX 3FUMA 3VD5A 4QOKB 1I7TA 2AJSH 4OTXH 1ZHBA 5B7EA 5C0AB 4I3SL 5GZOD 4Z7WA 1X5JA 2BNRA 5CZVL 1QUNB 5JW5A 3IJYB 3KG5A 2YKKA 5L88L 3RWIB 4JKWA 3ZZSA 4OFIA 1YPZB 3G04A 4XCYA 1FZKB 2EUZA 4XVOA 2FLBT 3ARDB 1U8JB 1B4RA 5E8PB 3VFSB 1NWOA 1FL5B 1PZ3A 1TU2B 2UZXA 3AT9A 4G8EA 3ZHNA 3I50H 4NSKA 3ZDXB 1G7HB 5EORH 2FECL 1EQWA 4PJHF 5FO8B 4X6CF 1F4WH 2WAQA 3HE6B 4UBDD 4HYTB 4NRXA 2QELA 4PWGA 3IJ7A 4ZFZA 1OSPH 3LKPB 5D7HA 2FE0A 1KB5L 4PREB 4O5LL 5E00A 1KNOA 4F3FA 3SB3A 3AXIA 5B39A 1G5AA 3NJMA 3HG4A 5E4OA 1NBYB 3CUPB 3SJVE 2AI0H 4EO5A 2AGJH 4MB5A 4FC3E 1ZIAA 3B2DC 4PJ7B 1AZUA 4UUJB 2W0FB 4IOFC 3CGTA 3U6XA 2RCSL 2NOYA 2ZXDA 3EHBB 4N6RA 1EO8H 4UOW0 3D8MA 5D5ME 4GG8B 1W8OA 3BMWA 4X4ZA 1FUNA 1IGCH 1S7UA 5EEWA 1I1CA 3LXBA 2B7DT 1FFPA 4YXKH 1JYNA 5H35A 3KYOA 3TBSB 4JY5L 5DJ0A 6PAZA 4PTUB 4DHLA 5HYJA 2HLFD 3PPSA 2BIQA 4HBCL 4PJDB 3CFJA 4QXUH 1W6WA 3P3RA 3QXVA 5F9WB 3BAJA 1PSKH 4WVRA 4P2QE 3V0GA 1WUZA 1P7QA 2C9UA 4BFRA 4F9LC 2DRUA 3L3KB 2GTZA 5FUOH 4MJIA 5EO9A 4AKQA 2OMWA 1VZIA 3FO0L 5FWQA 1WFOA 2GUYA 1T1YA 2I60H 1OP3K 3V9CA 1HOCB 2V33A 1XH1A 1G7QB 2AJXL 3FQ1A 3LRSA 4K23H 3WKPA 4D9LL 1HC1A 3V0DA 3ZHFA 1U58A 1KCRL 5D7SL 3SD5A 3H85A 5HJ3B 1TZIA 4JCWA 3BQUA 4JHVA 3DVNA 5J1TC 2NW3A 3MNWB 5DD0H 3FO9B 4LLYA 4LARL 5A2IH 5D70H 4K8RD 4JG9A 3E0GA 4FS0A 4JJOA 3C08L 4G71B 4TUJA 3U1QA 3S3CB 1M7UA 3EFOB 5C0ND 2X28A 4M62H 1N64H 3I6LE 1TCRA 4WWKD 2JXMA 5JMRA 2FBRA 2GHWB 3QEUB 4MCYA 2OSWA 5J13B 1F4XL 2VMFA 3JV4B 3O4LE 2EVFA 4Z7NF 5CS7A 4KO7A 4PN6A 5DVLA 1WWCA 2Q7YB 1A7NL 2Y5QA 4MKTA 1IBHA 3RRQA 3GWJA 5BS0A 3JWDC 1QTYT 1EDHA 5ANHA 4HOWA 2CDGB 4OLZH 3SYCA 4NPYA 4U7SA 3K6SB 4M29A 2JJSA 2WTRB 4MKMA 5EOTB 1T1WB 3LZFH 1LK2A 4MRBA 3MHZA 1KJ2B 3GMNA 2BY3A 4UQ3A 3UZQB 3MN8A 1NC4B 4BEIA 3AXHA 3BW9A 4TVUA 3FBQA 3S37L 4JGNA 1ZGLB 4L4TA 4BV1A 4YHZL 2BCKA 3ZQXA 3QYMA 3VNYA 1QZNA 2FTAA 4PHZA 4J3OF 5LDSA 3IJ8A 3WNOA 1BBDL 2VSMB 4L4TE 5MI0B 3D85D 2X70A 1IEBB 3CDCA 43CAA 1SRDA 2ZX6A 5AVQB 3VSUA 5IESL 4NFCA 4XNDA 5JNYB 5EV7A 1KT2A 5DFAA 1TJIH 5CWSA 3F04A 4FQLH 2VB5A 3NBNA 3ZO0A 1JXKA 5AQ0A 5DXWA 4AE1A 2VMCA 3OMZA 1D5BA 2ZCLH 3FQNA 2Y6SD 4I89A 3EFDL 4OCYL 3D0VB 4RMSA 1H3WM 4NQQA 4MA3B 5AUMA 4QOKD 3IFOA 5C0AD 2A6DA 5L8LB 1YEFL 1K5NB 4YH6A 1I8MA 3FN3A 5A6MA 2HX8A 3CDYA 5CP7B 2PXYA 3GPEA 2XWEA 2C3VA 2W95A 2EJ1A 2VXTH 4P5KB 4E41A 3BQUC 2VLKA 4GSRA 4IIQA 1JZ6A 2C4XA 5AOKA 1KXHA 3MJ9A 4WV1B 5BOPA 1I8UA 2YMTA 5GSRB 1FSKC 5CZXD 4HAGA 5GRUL 3ILPA 2VLKE 2VDQL 4MCNA 3F01A 1N12A 3I2CL 5IB1B 5I1EL 5H2BA 1P7KA 4NC0B 3D51A 5ERWB 3N0PB 5IQ9A 1MFDL 4M1CD 1KEGH 4OZHE 3Q2WA 5GQBA 3ZTEA 1IAII 1KPVB 4R8WL 4LL1A 1VPOH 1I7RB 5KUMA 2VLLB 4WWOA 3HJ0A 1PJWA 4AVKA 1D5ZB 4JO1L 2Z1KA 1XSJA 1QRNB 1IO4C 3ESVF 4A7UA 4XO9A 3VFPB 1XEDA 1OTUC 3C5JB 5CUSL 8PAZA 3NA4A 3PGDB 3GBML 1HN1A 3MJ8B 3PAUA 4TRPL 1YEKL 2NLJA 3ETSA 4NT6A 4X99B 4ABVA 4TQPA 3ZDWA 3EHBD 3DBSA 2F61A 4ZO8A 1QSEE 4PJBB 3TBVB 1JUFA 2K70A 3TBYA 4CBPA 1CLOL 3C60C 4R4FL 3SE9L 5LCVA 4JFYB 4JG1H 4L5FE 3MV8B 3MBEC 1V7ML 5FDYA 3OKEA 5KSAB 3MV11 4OJEH 2YLHA 4GO8A 5CP3H 3TEXA 4KKAC 2LLLA 4OGAD 4JM2D 1XSKA 1P0SE 3SKJL 4M1DH 4RFNB 1FFRA 2VGLM 3F8UB 4W93A 4UNIA 3SDXA 2ICEB 3ULVF 1AE6H 4BZ1A 5L7XL 3NK3A 4X6DF 4LSPH 4W68A 2CZNA 3R7QA 1QR1A 1YJDH 1MH5A 2VT0A 3NPSB 1NCWH 1M1XB 2Z31A 5T5NG 1KDIA 3X1EA 1NH6A 3ME0A 5K39A 3SOTA 1YEIL 5J5EA 2YD8A 1DZBA 3KPNA 2F9BT 4JQIA 1JYWA 32C2B 5ID1A 3P9MB 2PXYC 4XNQB 1A9EB 1GJWA 3E2HB 1AIFB 2YARA 4DW2H 3IAGC 2QDWA 3SBQA 3BUYB 4IIQC 4JX0A 3QJVB 4F33A 4RISL 5TGBB 4G1EA 5EIQA 2D3VA 4XNXL 1NDTA 2FO4B 5DRZA 2JVUA 3BPCB 2FEDC 3DURA 3GIVB 1FNAA 3QQDB 4KH2A 3VE0A 5ADPL 3AB0C 3B43A 3VFGL 3F62A 3OKMB 4JZNB 4Z0BH 5FCSH 1I8IA 1XV8A 3KDMA 1HE7A 2X6AA 3DXAB 2X4OA 2Y3NA 4KJQD 1FYTA 3PU7A 3LIZH 4G2AA 1WJ3A 4XC1H 1TQTA 4XMUA 4AZUA 1FFQA 4Y9CA 4OV5A 3A4EA 5AZEH 2X1XR 4PR5A 3RWDB 4KAQH 1KV7A 1RZIA 3T4YA 3ZUCA 3NCJH 4UOJA 4DPBX 4ZFGL 2BFGA 2XKNB 3QCUH 4GRWE 1N10A 3FB8A 3O4OC 3BD4A 2ITCB 4R7NB 4Z7UB 1IAIH 2ZJSL 3G6AB 1F4HA 4OCNC 3ROLB 4L37B 5C08D 4ONFL 4ATWA 4NAMA 3UMNA 1A25A 2YN3A 2DLHA 2WWMC 4P59L 4P4RB 3ZQWA 5E4AA 4M7LT 4AL8C 3UJJH 1TQBC 3HA0A 3MJ6A 1C8PA 4U1KB 4YHOH 3IDGA 3WG7B 4UCFA 3HZ3A 1HSBB 4HSQA 3SSGA 2WLIB 1DANT 2L7EA 2BP0A 4KV5F 4CMMA 3GSWB 3V5KB 3LV3A 3AAZA 2APVA 3M17B 2AV1A 5B3JF 3ZL4L 2G3MA 4N5ED 4MQ7B 1CDUA 1MFCH 3DETC 4XNUH 3D4GA 2C1PA 1WWAX 2NTSP 1FI8C 3KJ4C 1A7RH 4CDGC 3HBPA 3VXTA 2G30A 3KWXA 1WS8A 1A8JH 1BLNA 5EN2A 3MODH 1ONQA 2AEWA 3OLDA 1FVCB 4BH8B 2PCYA 4PHXA 1KG0B 1NJ9A 2QDVA 1MFAL 1JHLH 1G6RH 2UWEF 3QFGA 2VW7A 2CDFB 2E46A 3QI9A 4ODSL 5IBLC 1Y0LA 3U6RB 3RNQA 2PWFA 1EO5A 3VGAB 1G9NH 4F1ZA 1FZMA 3OGCB 3T3PE 4LLUA 2ZAHA 3VYPA 3EOTL 4Z3EA 4U6HA 3NJKA 3Q44A 5AD0B 4NQTA 4NWTH 5HHQB 1XR9B 1FE8H 1KZQA 1QRND 2DQFA 1KXQA 1AR1B 5B21A 2APTA 1F3RB 1KIPB 3DK0A 2OCJA 3QG7H 2PYEA 3PWLA 4A67A 1I9IL 3U4EB 3CSBA 3OAWA 3IFNL 3CDGA 5EBMA 3QQ3B 1X5GA 1EZLA 2RHEA 2EEFA 3I9GL 2CAKA 4X6FB 1YDPB 1IEAB 2HVJA 1JTTA 2PYEE 4M7JH 5G4MA 3TWCH 4W9FC 4DESA 3RU8H 2E6PA 4XR8C 1YQVL 3LDBB 1FNEA 5EWIH 5DLLA 4LOUD 4Y4KB 3ZTJG 3X2QB 2EDDA 5F1OB 4PRHA 3T9WA 5KSAD 4XC3L 1O6SA 5CJQH 3RIFF 3TNMA 2BX5A 4HJIA 1L5GA 5F6IB 4D9RD 12E8H 1B88A 3AT0A 4JDEB 4NKMA 4YLBA 4ZS6D 1ZE3H 2YGQA 1GA2A 3T04D 3GM0A 4M02A 5A2JH 3BN3B 2DQDL 1BQLL 4AIOA 4F7TB 4IRZA 2Z93A 1YN7A 4W9GC 4AENB 4KMLB 3MRKA 3OB8A 1JTOA 3WDIA 3QEHB 1CGVA 4QTHA 1MFEH 2VABB 5AW5B 3GLDA 5JPNB 1CGXA 1HKLH 2KL6A 2P24A 2YPKB 2CLVB 4U1SB 4V33A 4A6YL 1UA3A 4XCCH 3BFWA 3VWKB 2YPVL 4ZNEA 3QYNA 2J1WA 4FNRA 4RGOH 3STLB 2H3KA 4X7EC 1J86A 4HKJA 4OZFH 2XKSA 3ISWA 3NQKA 3ABLB 2BPBA 1UM6H 4NN5C 3NSYA 3WO4B 1QWUA 3MMEA 4QD2E 4TUKL 3KH4A 3MLRL 4IYKA 3TVMC 2WLMA 4XCFL 3ULUF 1M05B 4D0BB 1WZAA 2G5BA 2P45B 4HJEA 2RMNA 1E3ZA 3KPQB 3DXAD 2FT7A 3BGFC 3FB5A 1PLBA 3IXAB 1I1YA 3CDFA 1QUPA 3TT1L 3AWGA 3PGFL 5CSBA 5T1KA 2AXWA 1F58H 4IGBA 4PS4L 1KGIA 3QISA 4N87A 2RD0A 5ILTL 1KGJA 5FB8B 3DX2A 3WSQH 1IAKA 3FF8A 2CIIB 3H8NA 1MY7A 3VFWB 1D7BA 2K4WA 4AG4L 4HEPA 4FXTA 3ZT7A 3WFBL 1XCTA 4I0PB 5KVEL 1Q38A 2UYLB 4MX7B 5A7BA 1X4YA 2CM6A 4NJ9L 1VZHA 2I85A 2JTDA 4I9WE 4M00A 4PV1C 3NIGF 5DHVH 3GKWL 3D34A 3QNFA 4FFYH 5DWUL 1MWAL 3U36A 4Z1PA 3KYNB 1TVHB 4YZWA 1Z2KA 4YSEA 2EE0A 1PJ9A 1TVDA 3EGDA 4U1MB 3ZRFC 3VRIB 4P99A 5HYIA 1CGSL 3P4NB 2J43A 4HJ0D 2BRQA 2EKSA 5E7FA 3L3DB 1KLGA 2FR4A 2W0KA 3NSJA 5CP3A 4P9HL 5MENE 4X7FC 4DKDC 1VEMA 3A0OA 2G2RB 3MI6A 1QEXA 4ICWA 3TCXA 2R1YB 5HDBB 4QRAA 5B38A 3ARYA 2GK0B 2GBAA 4N9GB 1TT6A 5DD3L 2KZ1B 9CGTA 4RWYL 3RKDD 4DP9X 3CSTA 4OQTH 3FRUB 4XVSL 3TNNB 3AY4C 5KVFH 1NMCB 2YD9A 3C5SB 4FFWD 3SKMB 3SGKC 2W80C 3CVHB 2GC7C 4O51B 3WCYA 3NFNA 4UQDA 4Y19D 2OMUA 2G3ZA 4IOIA 4JFOA 2BINA 4M43L 4CMHB 2OTUB 1YAIA 5I8EA 3U7AA 3ZU8A 4FJZA 1OK8A 5DJYB 1DBAH 2VZ3A 3EDEA 5MP6H 1IC5L 4HUUA 1EXGA 2HTLD 3CIQA 4JO4L 1GZQB 1ML0A 5EZLA 4OIIL 5JDSA 1WTLA 5KSVB 3HUJE 4AV4A 3VG9B 1AR1D 1FO0A 4EN2A 2E27H 1KXTA 4NJAL 1E8YA 2XV2A 1NEPA 1XT5A 2WHVA 5DVMA 3NUKA 4IGBC 4QRBA 1KCVH 4E9WA 2RQEA 1CT8B 2R4SL 4LRNH 4WFGE 3MRDA 1UACL 1RVFH 5G5DB 1KIRA 3DPBA 1DBJL 4Y4KD 3CSPA 1JV5B 1D6VL 3L5WB 1DDHA 3QT2A 4FQ2H 4KX8A 5DEFA 4DP6X 4JL2A 1U8HB 1RIVL 2I5YH 1JVLA 1PTZA 3OGOE 4ZMNA 3NRFA 3HTLX 4GG6A 4DQOH 3CVCA 4OLEA 1W6LA 4ETQA 5IJDC 1EAQA 1C16A 4XTRD 1WAAF 1XGPB 4YDIL 4YDNA 4D0DB 1AQ8A 1KCSL 3H9YA 3MACH 2DDQL 1GOFA 2JJUA 5FOBA 2F54A 2RALA 2G5UA 1YEEH 5F7HA 4AEHH 1B4JH 2VMDA 4NO5B 9PCYA 5BPPA 1GGBL 1TIUA 1I8KB 3ORJA 3UGEA 2XPGA 3N85H 5CEXA 3RP1A 1R46A 1ZEAL 2Y07L 4LCUA 4AKPA 4GNKB 1MJJB 3I3DA 4JGUA 5D7KE 2ZCHH 4ORGB 3GSXA 5E9DB 3HBQA 4P05A 3EIFA 4PJHE 5I9QC 2RQ8A 2VXUH 2KLRA 4X6CE 1WIOA 2VC2B 1T4WA 3AZUA 1N18A 4QYAA 4S1QH 4AUJA 4JO5A 3A3YB 1MG2C 2JF1A 1ZTXH 4OR1A 1YJDC 4ALAL 2EC8A 4NKDB 1WAEA 2KZWA 3OKYA 4OI8A 4OLYH 3APFA 2GTWA 2NW2A 1JZDC 4QJ5B 1B90A 5AYTA 3L1OL 1CVRA 2YLKA 1R5VA 1EDQA 3H42H 4GIPD 3UTQB 3UOAB 4ANXA 1E9OB 1WZLA 2PO6C 2WLLA 5SWSB 4X5QA 5D96C 3LQAH 1G6RA 3FTZA 3MTRA 4Y2NA 5GRVK 3QDHA 2J88L 4C58B 4CC0A 2MCPL 1ZS8A 1NIAA 3FYIB 3K5SA 1E0OB 1HZKA 2O30A 4LU5L 4GLRI 3ARXA 1MQ8A 5E23A 3P3YA 5AVSB 4MAUH 4N2IA 1WBYB 1UWEH 4HS3A 4OGYH 4KTDH 5LNGA 5JA9A 2EUXA 4WHYH 1MKFA 5IM7A 3DWTA 2F58L 3CN3A 1KC5H 2X9ZA 2YD5A 4PP2B 3VJ6B 2OMZA 4WO0A 3ZE0F 1WYJA 3RAJH 3QBTB 1F1GA 5C07B 4ONOA 5DHDA 4V2CB 2J57A 3TEYA 2P8MB 4R7DB 4GINA 2O6CA 5HHPB 2X2YA 5TDPB 3IE9A 1QFWI 3ZKNC 4IRJC 2JB5L 4ZFOL 2X6VA 2YKLL 3KL0A 1OCCB 4WK0B 2FVNA 4ZPVA 4LASL 4AZ8B 2BIIA 3AREB 5TDOB 1URLA 2FJGB 1P9MA 3HMXA 4JVWA 3TEUA 3FQRA 2ZWYA 1MELA 1SM3L 4DKAA 3UIZA 1DHKA 1MRDL 1GYUA 3AADB 5LBVA 5LG6A 1A2YB 1E8XA 3KD4A 4Y2OA 1UD5A 2DKUA 1DYZA 3O3UN 5TPWL 5ES4B 2M1KA 2I07B 1EO7A 2VUOA 2CLZB 2JB6A 5D7JA 5HHMB 3CBRA 1DP0A 2BOBA 1R3IL 1ADQL 4LPXA 3B9KC 4DEPB 2F8XC 4RMVA 3ZK0A 1EXUB 2G9HB 4Z7NE 1Q9LA 3VTTA 3CSFA 4LLAA 2OJZL 4NUJB 4ZS7L 3K8KA 3GSNH 4HCRL 3LD8B 5AW2B 1BCIA 2ENYA 4PIRF 4JANB 4TNFA 4BFJA 3HHSB 3MCKA 4UTBA 5A6LA 3BD5A 2Z6FA 3L9BA 4OZFA 3H3PL 3UTPD 5GISH 4ZUTB 1N6QL 2YHGA 4WDIA 3FU6A 3QEGL 1I82A 4LLMB 5DQJB 5DLML 2V7HB 1G9NC 1WCQA 4RIRB 5A3IC 2D2CC 1UXWA 5FYKL 5FO7A 1L3NA 4HISA 2BRRL 4M1GL 4TXVB 4XPFH 4PB9H 1OSZB 3HAEB 2EC9U 3LQZB 4AEFA 3GSOB 3NRPA 5DQDH 4X7CC 1MCHA 3EF7A 1IM9B 2EXYC 4LVOC 4X9IA 3ULUH 1NUDA 4U0QB 1NFDB 3Q13A 1XIWA 2C9SA 2MH4A 3MA9L 1JV2A 4PVBA 4ZD3H 3RY6A 3QPQC 2Z7YA 1S3KL 1Z5LA 2OMVB 3GLAA 3T4AC 3QYCA 4MHHG 1QX1A 3QWQB 4AH2A 4AOFA 4LVNB 1MAML 2WXQA 5I8OL 4ES8A 5EU6A 1FBIL 2CBPA 5AW7B 4NRYB 2IVFC 4FXKC 5C71A 2A73B 3COOA 1P7HL 2WWKT 3BN9D 1TZGH 4MNGB 5E9DD 2CUHA 2CWRA 1ZE3C 2H0EA 5EBLB 4PRDA 2F7PA 4LCCA 1QFWH 3SO3C 1QI5A 1I1FA 1L0XA 3B56A 4G11A 3S5LA 4IEFB 1P7BA 3MLVL 1MFBH 2EACA 3QEQB 5D7JC 3GRWH 2VDOH 1FDLH 5EHFA 3RYMA 2V5SA 5A2LH 3BKML 1WAPA 3GUTB 2WINB 2CO2A 2VMEA 4NQVB 3QARA 1UJ3A 2B3RA 1XR8B 2OR7A 2DQUH 3DO3A 4NGHH 3ZHKA 4BH7A 2CKBA 4PRPE 5SWSD 4UAOB 4MXWL 1E6OL 3BZDA 2A9AA 2CO4A 3UZVA 2DQCL 2OP4L 5FA4B 4XWGL 4F80A 3TIEB 2SEBA 3UTTA 4X4XA 3W5MA 2XQBH 5HVHC 3JTBA 1WBXB 2GBTA 2VL5B 3CVIH 5ISZE 5KVFE 1PX3A 2N59A 2AJZB 2VLJB 3ALWA 4FQXD 2K3HA 5KOMC 5JIIA 2J72A 2WXNA 1RUKL 4UM9A 3LZOA 4HCFA 2ODIA 5SWZE 4GXVL 5F93C 3EFFB 5HSFA 3EH2A 3T2PA 1LDPH 1SUJA 5E4IA 4OIAA 2E6JA 2XY2A 4U4BA 3KPMA 1NMAH 3KCWA 7FABH 1HQRB 3HHRB 4UQAA 3DLQR 3F7VB 5IMMA 3QJZA 2WBJB 3ULVE 5C07D 3C6LB 3DX9B 4K8RH 1MCOH 4X6DE 1CL7I 4XODA 5D1ZB 4Y16B 4POZC 1XQ4A 2IWEA 1HHHB 4MSWB 4BINA 3TZVA 1QFPA 1I9RL 25C8H 4FFVC 3VA2C 5D4QA 2VL4A 3H6JA 3AXLA 1KBWA 3VXSA 4DTGL 2D7TH 5CFHA 2X1OA 3GJFA 2PTUA 4YGVA 3US9A 1OGTB 4GAGL 1MIEL 5CBAB 5T33L 1HL4A 3NZHH 3FULA 1NGXB 4OLWH 1RULH 4KJYB 3D05A 4LF3A 5C6PB 1OVZA 2H2PC 3GIZL 1UM4L 3B5TA 1RJYA 2BSTA 4KXBA 1FH5L 1X5XA 4MJ6B 5HHMD 3DSFL 3O6KL 5IW1B 4NENB 1D9KA 4E68A 4Q9RH 2IOMA 2XICA 1MI5E 2X6CA 1GOGA 1KCKA 1RHHA 2J5LC 2PW1A 2FQFA 1ZJAA 3TS8A 1E50A 1T04A 2GJ6A 4LCCC 4GIAA 4LEBA 3HFFA 4N8CL 5FFOA 1BAFH 3LHPH 1IQDA 4BKLA 3SY0B 4DP8X 1AANA 3FQ4A 1X7TA 4M61A 3NA9L 5GRJH 4PJIB 1UJ3C 1ZPUA 3L7EA 1INDH 2H1XA 4F58H 3CHSA 1R9FA 2KS0A 1RY7B 4RZCB 5EUOB 3FFOA 4PS7A 3QHTC 3OC8A 2R69L 1NGYA 4WI2A 1CDIA 1CICB 1PD6A 3KEHA 4U0RC 5DMIL 5F9OH 2H0FA 3NK4A 4DSYA 4E2OA 3MDJA 1KB9J 3HRZA 3UERA 3INUL 2PPDA 1UWGL 5I1GL 1FLTX 1EXHA 3K2UL 1GOHA 2AXFA 1JDCA 2DQGL 4IS6A 1NCHA 3OZ9L 5DC9B 3WUZA 5ITBL 3GF8A 3HR5A 4QHNA 3DVIA 2TRYA 5ALBH 4WU7A 1B0RA 3PWVB 4FTVD 2C3XA 1EEYB 2IWFA 3FBKA 3MV7A 1PAMA 4G5ZL 4ZUUB 3RDTA 3VVVA 5B3JE 5EEUA 1CQKA 3BFOA 1U3ZA 3UDWC 2CLRB 3L4XA 3VB9A 4PGDA 3K74B 3VM5A 2RFXA 3NCWA 1YECH 2IFFL 1J0IA 4OM0H 3TZVC 4E5XA 3FO2B 5MEOA 3BGMA 2BXYA 5EF3A 2IO5A 4WLCA 5E8NA 3BYTA 2YN5A 3QJFB 4NPJA 1HTYA 2ZUWA 2FX7L 1CD0A 3H1ZA 1ZOXA 3EAKA 1TTCA 2QVMA 4NO3B 4NM4H 4QKXB 3QNYB 3VXOB 2OV0A 4Q6IC 1QVOB 4LLVB 3W39B 1CL7H 3GSQA 3L3HA 4FXLA 4GYBA 3WL9B 3U0PA 1QLEB 2BSED 3G6DH 4QXTB 4RDQG 4LESA 5PAZA 5IWLC 1ACXA 3MGAA 1OTTC 3QEQD 2UWEB 4WJ5A 2VQ4A 3EJJX 4C4BA 5BCAA 1FRGL 5L0QB 1GGCH 1JZJA 2YZ8A 4YSSA 3QRGH 1JWSB 1JI1A 1OT1A 2J4WH 1AZBA 4X50A 5KANG 4TL4A 2V17H 1G43A 2OR8A 5GS3A 1AHWC 4F2MA 1ZV2A 2M8XA 3ARGA 4I3SH 3PGCA 4LKXB 2AEQH 1L9SA 4WZ9A 4FQJL 2FBOJ 1ZLUH 2AJVL 1MUJB 3LZPA 4F2ME 3GI9L 2DM3A 3HS0B 3D4ZA 1VKXA 4N2KA 4HIJA 2B59B 6TAAA 4GQ9L 1WWWX 3CBKB 2HN7B 3BO8B 3GSUB 1Y6KR 4HIQA 1SOXA 2H6UA 5LWYH 4K0OA 3T0WA 3Q06A 1FAIH 3FFCE 3V0JA 1CN4A 3UTSA 1WT5A 3GSNA 4B9YA 3D6GA 4J4PA 3RTQA 5HI5D 4RGMB 1L6ZA 4XN1A 3MOBH 4HWZA 2VDKB 3B7RL 4JFED 3HRZC 3MRJA 4JFQB 5BV7B 2F1EA 1LXMA 1NMBH 2GT9A 1QPXA 2EXWC 3F5WB 2OCCB 3U7YH 3J8F7 4WNQA 4DO4A 4JQVC 4JFDB 1N0XL 4WAFA 2NUTA 1DQDL 4Y16D 4DP0X 1FC1A 1JGIA 1XTMA 1K4CB 2EIDA 3K6IA 4JCMA 5J1AA 2WNXA 2IXQB 2NNAA 4K94L 3RDTC 4AYDC 5GZOA 2QGEA 3PQYE 3RY5A 3W57A 3OSKA 4P46D 5FYKU 3D18B 2DLFH 4N24A 4M6OL 1HXYA 4LOVA 4XOCA 4FMVA 5GGTH 3RI5F 3BQVA 4UM8A 1MOEA 1BQ5A 2QFRA 3NSFA 2UXTA 2XIIA 3H4FA 3WBDA 1JD9A 3X13A 2G4GA 4UDTB 3ZLQC 2LU7A 4HBCH 1JZ4A 1CGWA 1CU4L 4P3CH 2E9BA 4FMFA 3QHFL 5AOJA 3EO0A 1RK0B 5C0EA 4B9PA 5F88B 5KAQF 4C57C 3MOAH 3ULUE 1FFOB 1QA9A 3N43F 5EU7E 4WO4C 2FLMA 5IFAL 1DJGA 1T21B 3FU8A 1U8QB 2AJXH 1A6ZB 1UVQB 4K3DL 1IGIH 5LNDA 1UT2A 3IXTA 4PP1D 4KPHH 1IIIA 2H1PL 4URTB 4PRIB 3ARGC 4XNZC 3T2LA 4QRQB 2EDLA 3QZWB 5FDWB 5AB0A 4XCEA 2Y5EA 2CPCA 4AW4A 3ATEA 1A7OL 5ESQA 3GRWA 1OLZA 4M6NL 3BVWA 3FO1A 1TNNA 3C08H 3OL2A 3ZR5A 2ZP9A 2B5IB 1CICD 3P9LA 5CLZA 4L4VB 2ZD0A 1PNCA 1XGQA 3AWEA 2DQ6A 2XG4B 4X5XA 1GPOL 5E1AB 3BAKA 5GGRB 3CZFB 5IJKA 3NIGE 4DH2A 3P4MA 3RTQC 4IW4C 4J4PC 4MMZB 3RWCA 4IBZA 3UPAA 4YO0A 4FFTA 3KPSB 3QULB 5K9JL 2E9IA 2FH8A 2X4NB 3R0MA 1GL4B 1LO0L 4RFEA 5BZDA 4G7YL 4Y7OC 2ZUSA 3RWJB 5A16A 5KVDH 2VITB 1A7NH 1MHCA 1I7ZB 4JDTL 4JFPA 2L7UA 4JFVA 2MIZA 2JJVA 3ZZ1A 3PWUB 3EO1B 2CDEB 1S7QA 4IM8A 4OCWH 3RPKA 3KR3L 1ERNA 2P47B 3S37H 2XXGA 4G6FB 4D9QD 1AQDB 2ZOUA 5GZOC 1FVEA 1OPOA 3ZL2A 4OW6A 2G4EA 4G6MH 1AI1H 1VFBA 4YL4A 4A2MA 4NQSB 2X9XA 5I1DB 3GXIA 2WSPA 3BIKA 3GMPA 1MF2L 5FHBH 1JTPA 2CU9A 4RX4D 5AG9A 3IFPA 4MRCA 5DJ8B 2N1KA 3ULUC 3FQUB 4P2YA 5EU7C 3TX4A 1QTSA 1P6AB 3I6GA 3K81A 1LD9B 4Y1SA 5B38G 4WWKA 2OBGA 2R8SL 4P2RB 4UBDC 4OCYH 3PIQA 4HWBH 1GMIA 3UIYA 3QSKB 2YC1B 1HHKB 1IT9H 4J8RB 2YPLB 5KVGL 2FGWH 5ADOH 2CK2A 2QKSA 3T1FA 2F15A 5AYUL 2C1OA 4M48L 2WNWA 1N70A 3EYOA 4W9EC 4LAJH 4NI3A 5I0YA 1HDMA 5FA3A 1FYHB 2A9MH 4H0HB 2DQTH 3FT3A 3LJ3A 4HD5A 3T6WA 1ED3B 2EDHA 2A77H 4WU5B 1HXKA 5GRUH 4MNQB 3AG2B 1TETH 4A66A 3K1KC 5J1SC 4EIBA 1A1OA 4H8WL 4L9LA 2E7MA 1MCNA 2AITA 4QF1A 1YMMB 2APXA 2PWHA 3D85A 4K71C 3WLBA 3V9EA 4RGNB 2Q0ZX 3BHBB 3FQTA 3UAEA 2MPAL 2HLFC 1KYAA 4DPAX 2EUWA 1C08A 3KGRA 3VU1A 5T3XD 4JFDD 4H2AA 3NG5A 5AW1B 4WSKA 2XJLA 2VDMH 2QADB 3RLSA 4NQEE 1KZYA 1IBGL 3EJQA 1CDCA 2XI9A 2BH0A 6FABL 4BE5A 3WTUA 1PLAA 4QOKA 3QCTH 4YUEL 1DEDA 1U93B 5CGYD 4ACTA 2XETA 5C0AA 4HC1L 4I1PA 2ZYRA 1DVUA 2MQGA 5EU5B 3IJYA 2YGPA 3AMKA 3RWIA 1KGUA 5GHWH 1YPZA 4ELMF 4LDCA 3WEAA 4HS8L 2Z8WC 1FZKA 4UDUB 1Q0XH 1E4HA 4EN3D 3VI4A 4HULB 4GRLB 3ARDA 1U8JA 4G42B 3VFSA 1FL5A 3K8LA 3EYUH 1FPTL 1UWXK 2V3EA 3GXTA 4JFZL 4KK8C 4K8RC 4KNSA 4LLWB 2ENPA 3EKCA 3WEXB 1G7HA 3VI4E 4NDMB 3EJPA 3GO1H 3HE6A 3BDXA 1L9RA 3MFGB 4WFFD 4Z7QF 4RMUA 1XH2A 5MEQB 2CPUA 1MAKA 2W9EL 3LKPA 4B0MB 1P4IH 2VDPL 4JO2H 4WWKC 2CK0L 5DJAB 2OMYB 2JH2A 1E8ZA 4N2DA 3UAJC 1Z3GL 3PXLA 3NJLA 4J12A 1OAXH 1TEFA 5DFTA 2OL3B 3CUPA 2C7UA 4L1LA 2GI0A 2W60B 1YEIH 2B77A 2YWYA 2FUTA 3BP7B 5FPIA 3DOSB 1I3GH 2N4IA 4PJ7A 4UUJA 2W0FA 5FGCE 3TASA 2ARWA 1I8AA 3CPLA 4D8OA 3GTVA 2XTJD 3Q6GL 2X0WA 1AHKA 2WQ8A 3FUEA 4L4VD 5FGCB 5HJDA 4GG8A 1KCUH 4FNLH 3PAZA 3N41F 1VFAB 4RISH 4CC4C 4AY0A 2YXWA 2VSDA 3DRQB 1ICTA 1Q72L 1H8OA 5F9DC 4PVNA 2B0SL 4PU2A 4PJDA 5CD3B 2DM2A 3ZE0E 3KPSD 4LKCB 2HT4C 3CHQA 4OCXH 4ZW5A 4UV7L 4LAQL 4HOZA 4ZBJA 5CN1A 4JM2A 3MBWB 1QFUH 3X11B 4PJFF 1R24B 1PZ5B 3SPCA 3KH3A 3L3KA 1LK3L 2UUDH 5C0CB 4F8LA 1RIHH 2CBOA 1ZSDB 3IMWA 3ASWA 4TKWA 1HOCA 1G7QA 4R4NC 2WXRA 2Y6SC 5C0IB 1QSZA 3OZLA 4LBAA 5HJ3A 2BSDA 2WXPA 5C0GB 1SJHB 2DY2A 4G6FD 1TVBB 1JXFA 3LKSA 3DYMA 3CXFA 5CBEB 3KBEA 4YZFF 5F7UA 4L8CB 4FZ8L 2ZJSH 3FO9A 1M7XA 2A3TA 1KFAL 3WFDL 4JPVH 3MLTB 1FFNB 3IT8D 4HEME 4OF7A 1YEHL 3LRGA 2EECA 1I1RA 3F7YB 3P2BA 1JK9B 4TUOB 4KJWC 2ROXA 3EFOA 1DZ0A 3MV9B 1KJVB 1NC2B 3CU7A 3RG1C 4MB3A 3K2KA 4R96A 5CZXC 3VQLA 3UBXB 1KB5B 1LVEA 1MCFA 1A7PL 1Z32X 3SE8H 5E08H 2NY7H 2BS8A 2EYTB 1JVOA 2C9PA 3ILQD 3QEUA 4AQZA 1TUPA 5GGTA 4QXVA 3NZSA 5EF2A 5EBGA 4M1CC 5DUBB 2Q7YA 1BQHB 2YPLD 2X4TB 2F7IA 4YHYB 2DLIA 2CDGA 5D2LF 2XWRA 3QUXB 4QRPE 2WTRA 5EOTA 1T1WA 2Y7SA 2O5ZH 4TLTA 1KJ2A 5HI3D 3HS8A 3UZQA 5JXAL 1DBML 1OE3A 1R6VA 3FRPB 4JRYD 2B08A 1MG3C 3ZE1F 3D06A 3EHBC 4MNQD 5K9OB 4C4UA 4OZFG 5C08A 3RGVB 3QXWA 1J5IA 4J3OG 4LSQH 2EDYA 4Z18A 5I0XA 5LXGL 2NQDA 3NJGA 3PABB 1IEBA 2WC7A 2IANE 4M7LH 3MSPA 4RGND 5BVPH 5JNYA 1A14L 1WISA 2R59A 2ZXQA 3UJIH 2E47A 4N8VG 3VFTB 4OGAC 4JM2C 2QADD 2WNKA 2EP6A 4MA3A 2EVHA 3GGWA 3ZDYF 1JMZA 4R26H 3VXPB 5TDNB 2LABA 5TE6L 3IDXH 1NAKL 2BNUA 1KYUA 3EGXB 3HNSH 4K7PX 5CP7A 4P5KA 2A74C 4TN9A 4X6BB 1RH8A 3INOA 3HI6H 4GRLD 2XN9B 1KTLA 4WV1A 3D30A 1ZXQA 2AEPH 1IC0A 4Z9KB 5ACZB 4IK6A 4M6ML 5GSRA 5DTFB 1WLHA 1UHVA 3DUUB 3MCLL 3HG1E 4PW9A 1JSYA 1CE1H 2OJ1A 2R27A 4YSRA 1UOLA 2HRLA 5IB1A 2MMXA 2W92A 5JPMA 1X5YA 1NIFA 1JNLL 5ERWA 1L9TA 2AEOA 1Z3RA 3KPPA 1I7RA 2VLLA 3WGUB 3OJ2C 1D5ZA 2BVYA 3KL5A 1QRNA 1LO3L 1OT4A 1EBPA 5B1BB 3L3IB 4MA8L 2J2ZB 4R5VA 1BF2A 3VFPA 3C5JA 5DVOA 3PGDA 4AM0B 4P06A 3MJ8A 2BMKB 4X99A 2EDBA 4A6YH 1RUAL 4Z7OE 3MLPA 4X0NA 3ZMRA 1A0QH 1EEZA 1CLCA 3DVGB 2LOEA 4BFIB 4PJBA 1OCOB 3BZEB 3TBVA 1MNNA 1BEYL 4YHMH 1DJIA 3HPLA 3MXWL 2X42A 4KO5A 3NN8A 5KSAA 5KYXA 4XHJD 1EJOL 1M2VB 3OVUB 4OAWB 2D3JA 2OSLB 2PCPA 5C0FB 4O4YL 4NN6B 3BYYA 5DT1H 4KQ3L 4ANVA 3OQRA 1ZLSH 3M7FB 2APFA 5GJTL 4DO5A 1EJ6A 2ICEA 4I18B 3RWHB 1IARB 5C0CD 4D9RE 3AM8A 2HLAB 3PGFH 1OP3H 3S8FB 1ET5A 4PS4H 2ZYHA 2DLEA 4P4KB 1C5CL 1DSWA 2V5MA 4Y2DD 2OYLA 4Y9GA 4N0UE 4AV5A 5L2KB 3R7RA 3NCCB 3S3DB 3MX0A 5CMAB 1F4AA 2OR9H 1E65A 3LNFA 4CSPA 5D71L 3P9MA 1T2XA 4XNQA 1A9EA 2NDFA 2DBJA 2R7EB 2VDQB 1NBZA 4HDIB 5FYJL 4HPOL 3TM6A 3RVXC 4ZYKB 1CD9B 3BUYA 2DKSA 4J1UB 5AYQA 1S78D 3DOHA 4KITB 5AW3B 4WGWB 1TQCB 4G59C 1NC2D 5DUPH 1MWAH 4IKNA 2ZQKA 3CK0H 4PJXF 1USZA 5TGBA 4ATTA 2EVIA 5I26A 2FO4A 2ZONA 1IKFH 2EXTA 1FH2A 2Y69B 3BKJH 2JMRA 3BPCA 3GIVA 3QQDA 1R0AL 3GB7A 4K2UL 3OKMA 5JPMC 2N01B 1AACA 1CPUA 4XMKH 1ZDQA 2BVTA 2EYSB 3DXAA 5E2TL 4JDZB 4PUBH 2E4TA 1IILE 1JPGB 3D69B 4L18A 1G9ML 1IBBA 3G5VB 2O1AA 1VCBC 4G6JL 5DD3H 3KMDA 2EH8L 4JHBA 4S11A 2XWXA 3WXWH 4N2CA 5FUZL 3P73B 5CCJA 4XH2B 2ITCA 4R7NA 4Z7UA 4EUPB 1H3GA 3QZBA 5D1XB 4L37A 2CG9X 1ZCRA 3IU4H 3WS6A 4XN8A 5EO0B 2WUCH 3BRGC 2AZUA 4I9XA 4P4RA 3VGHA 1EVTC 2IQ9L 1T7WA 3ML8A 1UH4A 3ZKMD 3D2UD 4U1KA 1HSBA 1U8PB 1IGMH 3BEWA 2WLIA 5CEYB 3V4LA 4ZMLA 3FTYA 1ZS2A 3UYOD 3ECVA 4CSZA 4ZS6C 3I9PA 3V5KA 4YK4C 1I9EA 2FO8A 2XZAL 2I25N 2WOBA 4LCIL 1J8HB 4GW4A 3NPSC 1SLVA 4B96A 1J1PH 1JYVA 5DS2A 4DETA 5SX4I 4KI5D 3VD2A 4YBLC 1DJWA 3CVBA 1IM3B 4XO5A 4BQ6A 4DPCX 2NY6C 2XN9D 4N26A 4E42B 1CE6A 3QGVA 2WCPA 4K7FB 4WQOA 3E2HC 4ZX3A 1FVCA 2QPUA 2I26N 2Z64C 3S97C 1KG0A 5F1IA 3H55A 5ID0B 5CR1A 1CLYH 3U6RA 4ZW3A 1UATA 1P4BL 3HBZA 3VXRE 4ZQTA 5I76B 1U8LB 3CMGA 3BJ91 1G7IB 1DQLH 5AD0A 1ETZA 4Y19E 1XR9A 1QEWB 4JVUA 4J23A 4HXBH 1NDMB 4NIKB 3BDYL 2QQKH 1NEZB 1KXVA 2W81C 5AVXB 3RTLA 4JO3L 2Y07H 3LEXA 1E4XL 1E7VA 2IADB 2WXLA 3PL6C 5I6KA 2X6MA 5E99H 3CCHA 1KELL 4NFDA 2FH6A 4Z78B 4U31A 3KZ8A 3DROB 1N6VA 1IEAA 2IBZY 4QYOB 2VO5A 1MIML 5D7LE 4H26B 4F27A 2ZXWB 4BQBA 3ULSB 4Y4KA 2IBGA 2Y23A 3WJMB 2VLRE 5KBDA 3FYEB 1KEMH 4QRTA 3SPVA 3O9WB 3KS0H 5KUKA 4G9FB 3WS6C 1A3RL 2FX9H 1JF5A 3QIBB 5DJXA 5AW8B 1PD1A 5CD5D 5I19H 2YXVA 2QL1A 2WP3O 5C0DB 4JDEA 4Z77A 2Y06H 1U95B 4L3ED 3SDAD 1UJTA 1QLRB 1EDYA 1F90H 1C5DB 5DA4A 4W4NA 4F7TA 4TQHA 4ZAKB 4P4KD 4AENA 3FTXA 3VSQA 1A5FL 3GRGA 3C6EA 2AERT 2D4FA 3UAFA 2QKIB 5L2KD 1MRCL 43C9B 5I15L 1TJGL 1XL4A 2H41A 1MCRA 3W5NA 1RZGB 4PMFA 5JPNA 4ODBD 2YPKA 1JGVL 4AEEA 2LAGB 5EPMB 2H1LM 3TYGH 3G9AB 1JFHA 1WPCA 2ZYIA 3ILEA 3VWKA 2PF6A 2XYCA 3PWPB 4NS0A 1OP5K 3BISA 1FIGH 4M6AA 1HH9B 1FVDB 4I0CC 3IB4A 5HGDB 4N2NA 5GZND 3EDDA 2H2SD 2BNQE 1X5ZA 2FIKB 3C2AH 4U3HA 2FJHB 4FFWC 4GSXA 4ZTPH 4UT6L 5IK3B 1M05A 1JZ8A 5SX4H 1QACA 2BNQB 2YKLH 3K6FA 2HG5B 2HUHA 3KPQA 3QRLA 4L8DA 4N1HB 1L7TH 1T6BX 4UB0H 2HTLC 5E24E 4O02L 3DX1A 4TNGA 1NIBA 4G1MB 4ZJ9A 1AR1C 1MN4A 3HAEH 4FG4A 1KXVC 3ZDZB 1OEZW 2E7HA 3QDGB 3WGVB 5F7MC 3HPJB 1QP1A 5FB8A 5TPWH 1UEMA 4KHXL 4OFYD 1JE6A 3DGDA 1Y1DA 3GLEA 1S3RA 3BI9X 2IOOA 5F7EL 3VFWA 3NH7L 4E9YA 2XZQH 3U6XS 5D1XD 4P5TC 4I0PA 5K9KB 1CR9L 2R0KL 2UYLA 4MX7A 3O41B 5LUMA 1XB8A 3LDBC 1T80A 3AROA 4M5YL 2QLYA 3S3JA 3QS3A 5D4HA 4I85A 1DUZB 4XPHL 4ZS7H 2H4EA 3KYNA 1TVHA 5B8CB 5JR1H 5LGHL 2OW6A 1OAZH 3ECWA 4XTRC 3CHRA 3VRIA 2HKHL 1NUNB 1RUQH 1KDJA 3P4NA 3PREA 2HLEB 1T5WB 5EEXA 5HVFB 3L3DA 4ZQKA 1N6QH 4JPKH 3V5HB 2DQEH 4P48A 1J8HD 5FM4A 2ORBL 4LPWA 4CVUA 3BUTA 4JY4B 3WKQA 4DEWA 5IBUB 5HJBA 2G2RA 4Q89A 4G9DA 4YIQB 3MXVL 5F1KC 2R1YA 3F58H 3BRFA 2NY5H 2GK0A 4N9GA 4ZOAA 4M1GH 4WI8A 3X3FL 3VFMB 5JLZB 2DYPD 3FRUA 3CNKA 2AHIA 3TNNA 3VNZA 5CN2A 2J6EA 4BFKA 4X8CA 1QI3A 1PKQB 3C5SA 1BD2E 3SKMA 5B1AB 5HTSA 3NZUA 3MLUH 1H3PH 3QJHB 1U2YA 4YXHH 4LVEA 3POCA 4IDLA 2ZE0A 1BD2B 3ISYA 3PDOB 4FG2A 3QUYC 1N3NB 4NZRL 1FNLA 4G8GB 5DJYA 1AJ7L 4WUUB 3OKOB 5DUMH 1UYWL 3I6KB 3WIIL 4BCYA 5KSVA 1SGKA 1AO7D 3HMWL 3FOLB 4Y88A 2I9TA 1E4WL 4NUGH 2IMMA 3DIFB 1DQKA 5FYJU 4CGUB 5KVEE 1OHQA 3O45A 4N2OA 3X14B 2EZ0D 1NLDL 2L7JA 3LEYH 4K9JA 3NFSL 5EDSA 1PFOA 4KKLD 1FA4A 1GC1H 3IE4A 3P77B 2P9RA 1CYGA 4BRVA 1QKZH 2NXZB 2XV3A 1CT8A 1OZTG 3DTXB 3IMUA 5JOPD 2HFGH 4ICXA 3V4UH 3NIDF 2M83A 5G5DA 4A68A 2JKNA 3H9SD 2MKWA 2IAMB 1IBFA 3KPTA 1G7MA 3F65A 3O9WD 4WKXA 4G9FD 3UTZB 5DI8B 3W9EB 3VGEA 1F8TH 1Y6NR 5I8KH 5LDUA 5GGVY 1XGPA 4JRXB 4ANKA 3RB5A 4IK7A 3L2LA 2A4CA 3HI5L 4FMKA 4MXWH 1BHGA 2W59A 5I1HL 1ZV9A 2GEEA 2I7SA 1T6WA 2BSRB 3HBGA 4ZAKD 3IKCB 3U2IA 3ATBA 2GY5A 3S96B 1G4RA 2NY4B 4W9HC 4DWHA 2XKUA 4HK3J 4ADIA 4ELME 4L29B 4APXB 4XB8A 5I5JA 4M3HA 1RUKH 4O9HL 3LZQA 2J21A 3IGFA 4ZUSB 4CJ1A 5KYYB 1MJJA 2X2UA 1AVAA 2Z7ZA 4PJEF 4E0RB 4ORGA 1TMCB 1W0VA 2C9RA 2ZWZA 4HGWB 4HQQL 4Q2ZB 4XBGA 4NAQA 3PWPD 3QW9A 1IB5A 1OGAD 4LQ1A 3IFLL 3A6CH 1OM3H 4QRRB 4X9HA 5J12C 3EF4A 4C55A 2LW3A 5B7MA 3FTSA 2WXKA 3JYBA 2R9HD 3O2DL 3FN0L 4Z7QB 4G7VH 2VZVA 3TJEL 3QNZB 3F12B 4OIFA 1I7UA 3UTQA 5KTEL 1SDDB 1A6UL 3NACH 5TFSH 1E9OA 3K4AA 3SYAA 1AXIB 1MFMA 3N5AA 1FN4B 4RAUA 5SWSA 1BZ9B 4KXZI 1CZ8H 3D39B 4P0DA 3B2VH 4TSAL 3VG9C 4AQ8A 3F7QA 4OLUL 4KVPA 1NCGA 3KYKL 4FGMA 3VRLF 1XB6A 4S0SD 3NABH 3FQXB 3CAFA 1FH5H 5H94B 3SYOA 3JUYA 2ZX8A 3RWEA 4NOBA 5FFGA 5I73B 3FTUA 1TCMA 1WBYA 2Z7UA 2F2HA 4KRPD 4Y1TA 3ZMNA 1BP3B 1IFHL 4KZEH 1QWNA 4WTWA 3JWDL 4N2HA 1TJHH 1GJUA 4RRPG 4PJFE 1GSKA 2BIOA 4PP2A 3LS4H 2YQ3A 4S1RL 3VJ6A 2R4RL 2XN1A 2XV6B 1E4KA 1J8KA 2OJEB 5C07A 4WY7L 4DP2X 4TVSa 2P8MA 2XHNA 3SBRA 3QXDB 5HHPA 4LHQB 4EJ1C 1W0WB 1QLEH 4U3XA 3MZTA 5C6TL 4YFLI 1RUPH 2G75A 2XN0A 4AQ1B 1KULA 2BS71 4YZFE 2Y7OA 2R69H 2DTSA 4MQSB 3QAZC 2FJGA 5TDOA 1HNFA 3UZEC 1KENL 1E5UI 4N1EA 2IH9A 1LO2L 2VDRB 4BUQA 4OZIF 4DF9A 5I1GH 1PLCA 2OW7A 2DH2A 1GIGH 1VLXA 4S10A 4ENED 2DYSB 3PUCA 4F9PC 2I07A 3DJTA 3IPEA 5CCKL 3E38A 2CLZA 3BN9C 4X9YA 2EO9A 3LS5L 2EE3A 3Q1SL 5B3SB 1RUML 3T2OA 4A04A 4DNLA 2OMXB 3TJHD 2WKLA 5DDHB 2P8PA 2G9HA 3E8UL 2HSIA 4HZAA 1EZVY 1KN4L 3Q7JA 1OARL 1DFXA 4NLAA 3PAYA 1OKEA 3QPKA 4AEIL 2VDKH 4JANA 2QHRL 2XACC 3HHSA 4NQDE 2FEEI 4DK6A 5BV7H 1ZHNB 1A6VH 3WEMA 5D2LB 3BZ5A 4ZUTA 1G1YA 1WFNA 3ZE1E 1RIUH 3BH8B 3O6FC 1S4IA 4OCRL 2O6EA 4LLMA 5DQJA 5T3XH 2HRPH 4GP4B 4PRNB 4BUGA 1SBSH 2V7HA 4RIRA 3HC4L 2EIZB 4FQXC 1AHMA 2JQMA 4W9CC 2IAMD 35C8L 3DC0A 1YZZA 4MQTB 5DRNA 5CEZL 2L4OA 5JQ6L 3O2VL 3HAEA 4KXZH 3M8OH 4X4MA 4JFXB 4KO6A 3LQZA 3GSOA 4J27A 4U1LB 2KZKA 2Q8AL 2X4PB 4FTVA 5LVEA 4UF7C 3SCMC 1KMGA 2XXMB 1KIUB 1U21A 1RJZB 1NFDA 2Y0SA 3ZDYE 3SGEH 3MPCA 1FZOB 4FTVE 4HAFA 4CW1A 1G9EA 1TSHA 2DV6A 2OMVA 2NY4D 4U1JB 5EOQH 4BYHA 1GS8A 3MYJB 5TD4A 5I0VA 1FL6B 5HY9B 4BWTA 3AG4B 4HPHA 3JZ7A 3MJ7B 3FDWA 4Q9QH 5ICZB 4HUXB 4HFUH 4NRYA 1MEXH 2A73A 1IX2A 4UTCA 2HFTA 2NZ9C 4GPVA 4UT9H 1DSFH 5B1JA 3I02B 1OXYA 4CU8A 3FKUS 5ESVB 2BSEA 5EBLA 5MHSE 3MRIB 4QRRD 4YOKA 4IEFA 3QEQA 3MRLB 2VZSA 3AQDA 1BXVA 1HSAB 2Q20A 2E59A 4ODVL 3B3IB 1CCZA 2ICWJ 4M93B 4I4WB 3GUTA 4RNRA 4TM9A 3BE1H 2DI7A 5IB5B 4X80L 4QHLB 4NQVA 3TV3H 2QQNH 1LWJA 3TEWA 1XR8A 3QFDB 1GY2A 1ITCA 2HX9A 4Z8FL 4KQ4L 3SDDD 3WUWA 3SQOH 2FZ3A 2H26B 2WTPA 1JGLL 3EBGA 3E80A 2NSXA 1X3DA 5FA4A 2MNWA 3TIEA 4BFBD 2J44A 3MJ9L 4UV4H 1E2ZA 2VL5A 2E7LA 3PNRB 2O6FA 2AJZA 2OX5B 1N8ZA 2QT6A 3OXSB 4HXAL 4G83A 4NNXA 5HPOA 3EFFA 2R2EB 3ARWA 3ZTNH 5AB2A 2WCGA 3CQFA 3B2PA 3VH8G 3CXHK 1IQWL 2YAOA 3CV5A 4LSSL 4XP1L 3F7VA 4N3TA 2IDTA 3PXHA 2GPZA 3LNIA 3POHA 4P3DB 4B95C 4H40A 3O2WL 1RLWA 4JFEE 1WTGT 1U8IA 4GEIA 4JEGB 1X9UA 3RX5A 5E8EB 4YSOA 4Y16A 1ZT7B 4D8PB 2X0UA 2DYRB 3PAVA 4ELDA 5TK2A 3SKNB 3L08A 2AQNA 2F74B 1EJFA 1C7TA 4L5FL 4M6NH 4P46A 3B1TA 1OGTA 4HWEH 4S2SB 4JHWL 1ACYH 1GYVA 3A67L 1NGXA 3WN5A 4NUPA 4KJYA 2BNRD 4LVNC 4PY8J 3B37A 5EULV 1K2DA 3HVDA 1T1ZB 4ZI8A 2ESVB 3KLHD 3UCRA 4F8TA 3GNMH 1Z7JA 2VWEE 4PJXE 4JAMB 4MJ6A 2MCG1 2YAQA 5IW1A 4NENA 5B1JC 5EO1B 2IQAB 5DZNA 1FG2B 3F6JA 1XGYH 5CLYA 3T2NH 3TEZA 1F2XK 5AALA 4U2ZA 5DHYB 2OSYA 2VSCA 1SJEB 1EV2E 3P3UA 4F5CE 3I85A 1UGNA 4CDHA 5F7DB 4OCMC 4RDBA 3V52L 1HS6A 3II3A 1P69B 1ZIBA 3B9EA 2YEVB 4Z0XB 4JKMA 2X7LB 1EAOA 2Z35B 4EXKA 4HIIB 2QMKA 1AKJB 3GBNL 4KUZL 4FF9A 2NY5C 1J05B 4PJIA 3RIAK 4HT1H 2ITEA 3EDJA 4JQIL 4QHUB 2P5EB 2FIRT 2WKOF 4LPCA 2FJUB 3LH2L 3SDCD 4XVTL 3NCMA 2HAZA 5EUOA 4RZCA 2X1PA 4XMLL 1JYXA 1OAKL 1AD9B 1NBVH 3T71A 3RUGA 1CICA 2AJSL 2R1WB 4OTXL 5C2BH 4YX2H 3MCG1 3OJVC 4FQQB 5GGQL 5KVMC 1UA7A 2ALWA 2R0WH 1VENA 5A1AA 5JIKA 5IW3A 5E9AA 3BLBA 2ZOLB 3ARTA 5IJVB 3CFCH 3IJSB 1R3HB 2PP7A 2ZZUT 3I50L 5KVGH 2C4FU 1EEYA 4YDJB 3RWGB 4L3AA 1F4WL 1GC1C 2CRMA 5AB1A 1VSCA 3OXRA 4XE0A 3MGTB 5DD1H 4MJID 4OIBA 2CRIA 3EW3B 3KPOB 2QBWA 3UL4A 2JCCF 5IIEB 1IC7H 3MLSH 1OSPL 2Q3AA 3FO2A 4QEGA 4MJ5B 4KNUA 3FUKA 1MLCA 3QJFA 4P46C 3ECQA 2ADJB 2J1KA 5AWNH 2VN3A 4NO3A 2XPZA 1QRKA 1LTXA 3QNYA 2VYRE 2W9DH 3N91A 2VWEC 2AI0L 1UM5H 3VXOA 3WN5C 4D9QE 2AGJL 2QEJA 1QVOA 3L6FB 4LLVA 3W39A 3VD1A 4RX4A 1SHXA 3WL9A 2X6BA 4QXTA 4N90E 1HT6A 2P26A 2MPAH 4K3GA 4A7QA 1EO8L 1BFOB 5LGYA 4RMWA 3FTGB 4GP5B 5EIIG 1IJ9A 2OA9A 4Y5VB 1L9OA 5IBTH 1JWSA 4YXKL 1KGXA 4FI8A 4MCZB 4QXUL 5FXCH 1RP8A 4LKXA 4YHPB 5AOMA 4A1RA 1IGFH 4B6ZA 2WQRA 1PSKL 5E6ZA 3IVKB 1H5BB 1MUJA 3A21A 3D2TA 4PP1C 5BS0D 2RTTA 1F6LL 1WQVT 3IDNB 4DN4L 5FUOL 4OF3A 3A47A 3S8GB 1J9RA 2B59A 1JS4A 2HN7A 2KPNA 2I60L 3GSUA 3HJEA 1D5XB 2BSSB 1CUOA 4K23L 5E03A 4JK0D 3BAYA 4QY8B 1OB0A 1ZVYA 5FK9B 3OAYK 3TOPA 1H0DA 5DD0L 3BPNB 3GMLB 1BWWA 4JFQA 5D70L 3RWFB 1INEL 1AZCA 1HVXA 1PX4A 3BSZH 3F5WA 1SXNA 2CK0H 1W80A 4L4JA 3EYQD 5J4MA 1XEUA 3BIBX 1B2WH 4JFDA 3EO9L 1ZTMA 5CJ8A 2HH0H 5ECJE 1YSOA 4M62L 5ANMA 5KSBF 4WENB 2HRHA 1EH9A 1K4CA 4WSJA 3WNMA 3KPRB 1LP9F 1MHPH 2DLTA 3HZKA 1EHLL 2OMNA 4B5ZA 1KY6A 1TQWA 2OK0H 1U4EA 3D18A 5ANME 4NRZB 3LKQB 5ESAA 2MHAB 5LO7A 6PCYA 4MD0B 1ID2A 1F97A 4QXGH 3T8MA 3QO0B 2CGZA 5GGVH 2J8UF 4XPBH 4LBEB 2Q2LA 1U33A 3CG8A 4OLZL 1DJHA 2OKMA 4V1DE 2A83A 2EDNA 2V5RA 3BAXA 4OUUB 4UDTA 3LZFL 4E41D 3T77B 3ESPA 4PJ6A 1PY9A 4UQIM 4LHUB 5F0PB 2OQJB 2AXHA 4JDVA 5F88A 5BOJA 4V1DB 5KAQG 3IMBA 2CUAA 4TUUA 1AY1H 3UTOA 4AJVA 1AH1A 1LK3H 4M9OA 3UFIA 1S5IH 1Q90A 1K8IB 1T21A 1U8QA 1A6ZA 1UVQA 1A6TB 1P84K 1CFQB 4XAKE 4UT9A 1SXCA 4MA1C 1IRAY 1TJIL 2ERJB 4Y1AB 5IVXF 3CZLA 4PRIA 1IVLA 4FQLL 5KBPA 1SOSA 2P5ED 1PZBA 3HLKA 1QYGH 5FDWA 3QZWA 4XMTA 1UADC 3WFDH 2ZCLL 2R2HB 4U4IA 1SDYA 1SPDA 5BRZE 5ABDE 2CE6A 4JFFD 3EH4B 5M7QA 4L4VA 2IALA 2HWZL 4MBRA 3N3EA 2EEAA 3HR6A 2XG4A 3MNMA 5E1AA 3G6JB 5GGRA 3CZFA 3QH3B 5IP4A 2XTJE 3SKOB 1I1AB 2WXJA 1M9SA 2VXTL 2YGOA 1WUNT 3TBCA 4FNQA 3BSGA 2B9AA 3KPSA 1CLZH 3QULA 1MXDA 2X4NA 1SYVB 4BZ2H 5K59F 3GJFK 5F7LB 3RWJA 4O2CA 4WI0A 1DLFH 2WWOA 2VXQA 2VW4A 3DIDA 4L2YA 3SO5A 4BSVB 5E2WH 1JOIA 4QTFA 4FEIA 5HD8D 3PWUA 1GH7A 2CDEA 4ZFFB 3WE6B 1G1OA 2B1AH 5HGAA 1KEGL 4JKKA 3QORC 2RGSA 1VPOL 1AQDA 3DBXB 1PKOA 3P3SA 4ZXBB 3LKNB 4JY6B 1JDDA 3B1UA 4I8DA 2G60H 4OBRA 5BVJB 4EN3C 4XWOC 4HCGA 4IJ3B 1S7WB 2AK4E 5DJ8A 3CFBA 4Z95H 3NCYS 2JELH 4NCC2 3FQUA 3DMMB 4EDWH 4LMQE 1AQHA 4O2FB 1LD9A 1E9QB 1MRFH 1E28B 3GKZA 1NCUA 5KS9B 4P2RA 4JG5A 3U9PL 1DTUA 4JG1L 1F6AB 4H8QA 5IHHA 2YC1A 3OR6B 1OZUA 2CBQA 3IM1A 3N9GH 3QWRD 4Y4HC 1JRHI 4J8RA 2YPLA 3C6SB 4NBXB 3RNKB 2A6IB 5AKVA 5I74C 4M1DL 3RHWF 2OFQA 1OQOA 2XDHA 2LU3A 1AE6L 4ZDHB 1Z9SA 2WVSA 3DVFA 4LSPL 4JRYA 2ZXAA 2HMID 1YJDL 3H54A 1HNYA 3NIDE 2Q8BH 3O8XB 4WU5A 3SBWA 1NCWL 2XTJC 2Y6TE 4MNQA 3VXMB 1AMYA 4PG9B 4QGTA 3BPOB 2B5IC 4F7MB 2FATH 4KXAA 4JRYE 4NNPH 4PGCB 2X89D 1LLAA 2NUPA 2OTWB 2IPTH 2AJUH 4DW2L 3OAUH 1YRKA 3BUDA 4HJGA 4L0PB 1F3DJ 2HFEB 4AMXA 4TL5A 5JTWA 1BYOA 1X5KA 4FE9A 4PLJC 2J1YA 1FJ1B 1UURA 1KFGA 1OP4A 1UEYA 3NEXA 1J10A 4GXFA 1U93A 4NBYB 1GKEA 1G1KA 1KJMB 3MYZA 4H20H 5FW6A 4TULH 3FU3A 1QW9A 3H6AA 3EJUA 4WGVB 3WDJA 1WA2X 3LIZL 4XC1L 1BGXH 4N2GA 4GRLA 3AU0A 5HDWA 4WNJA 4HUWA 4PJEB 5DJ6B 4KAQL 2ZICA 4LLWA 5CIPB 3WEXA 1BM3H 3NCJL 4LHUD 3C9NB 4LNRB 4L8SC 1IAMA 3KXFD 3KWVA 3QCUL 3QE5A 3DDGA 4NDMA 5KVGE 3SPHA 5IQ7H 5C9KA 4YHKL 3II2A 1WP6A 4JHUA 1N59A 5H4ZA 3O0RL 4P07A 1CURA 1IAIL 5MEQA 1A47A 3UPRB 2V9RA 4G7RB 4Z5RB 3QI9D 2XWDA 5DO2D 5CJXC 5DJAA 2OMYA 3FSOA 5DQ9B 2X12A 1XCQB 4R5XA 3EBHA 3UJJL 2OL3A 3BPLC 2W60A 3S36H 4YHOL 3VRLE 4YDVB 5GGSB 3HCVB 4D0CA 3BP7A 2CJSA 4ZT1A 3DOSA 4TVPL 3ZE2B 2HTKC 3T8XB 2D7QA 1JZEA 2JLLA 4UIKH 1SHMA 5DJDB 4DKTA 5HI3C 3W37A 3QFJE 1WZMA 1VFAA 1MCJA 1VEOA 3GUFA 4HUVB 4XNUL 3DRQA 1ZMYA 4KBPA 3TO4B 1I1AD 1JRHH 1PGRB 4CVZB 1A7RL 2F8IA 1RZFH 1QATA 5CD3A 3E8VA 1A65A 1FFTB 1P5UB 2GJPA 3F7KA 3MBWA 3DI2B 1GGUA 2UZYB 3MODL 3OG6B 1RCYA 4RGNC 1R24A 1PZ5A 1G6RL 1NGWB 1TO5A 5C0CA 1O5PA 1ZSDA 1GTNA 3IRCA 4EE2A 1G9MH 1IV8A 1OTSD 2QADC 5IOPB 3CD4A 1G9NL 1NCAL 2ZOKB 3HB3B 2Y5TB 5C0IA 1ASOA 1R3KB 4HUCA 1HINH 3K4ZA 1TVBA 4NWTL 4OZIE 1H9VA 1PU0A 3BSZA 1FE8L 2DEXX 5CBEA 4U1NB 2Q10A 4ZXBD 2WCSA 1QFWM 3LZRA 3UCQA 4XI5D 4DGYL 3C5ZC 2GSMB 2FLRT 2TAAA 4F8NA 3RVUD 4YPJA 2O6DA 5I6LA 1AGDB 3QG7L 1SLUA 3F7YA 5HHOB 1JK9A 1RZ7H 1NOAA 4GRLC 3L5XH 1F00I 1ZWIB 3VGDA 2VUKA 3ZSTA 4GUOA 1KJVA 1NC2A 3V95A 4Z7WF 2XQYG 4UNVA 1U8OB 3DMMD 2VDPB 4H1LH 1KB5A 3TWCL 4M7JL 1LM8V 1G7JB 4NO0D 4UMSA 3RU8L 4H0GA 5EZJB 5EWIL 4A38A 5D7IB 4ZOBA 5KBKA 3QQXA 4DP4X 5DUBA 3GQFA 4PJCB 2XWCA 5CJQL 3LB6D 1I75A 4H8WC 2X4TA 3NAAH 2O5YH 12E8L 4EBQH 1U36A 3ROOB 2VSKB 2O26U 4HUNB 5T3ZD 1NBQA 3CPUA 5HBBA 2JFCA 4NAJA 3QRBA 3FRPA 2FX8L 3LRMA 2XTLA 2V8LA 4N0FB 4PJ5E 3H7BB 3VXMD 3AS2A 1H6UA 5K9OA 2FD6L 4ZMWA 3TA3B 4Y4FC 4H8UA 1QASA 3ARBB 1P4BH 3PABA 1MFEL 3GHPA 4ZUWB 1O7DC 1HKLL 2GFBA 5C1MB 2MQCA 1AOZA 4FHKA 2LQRA 4NO2B 4XCCL 5DZ9A 3D2UA 3U1SL 2AQQA 3VQ1C 3ZZLA 2VLMD 3TFBA 3BP4A 4RGOL 4UTBL 3CC1A 3VFTA 4G3YH 2WY3B 3QUKB 4RQQA 2YD0A 5BNXD 3OWEA 1UM6L 4B9KC 2V2TB 5FM8A 3NMEA 4E9VA 5A43C 1R19A 3ASNB 3VXPA 1KELH 2P8LB 4PGZA 4AGQA 1H3VA 2WO4A 4OJDH 4X7DC 3D3VB 2PCXA 3EGXA 2HB0A 4Y2DC 3RPIB 1F41A 1VACB 4BZ2A 2WM0A 3QDJB 3DV6B 4X6BA 4YHNA 1FAKT 5E56A 5FM5O 5BUAA 1BIIB 2XN9A 2ZSWB 5C70A 2M2DA 1MCBA 2VE6A 1F58L 1UENA 1UWXH 2YRPA 2Z9TA 2FK9A 1YC8A 5FGSA 3JBG7 5DTFA 2LU4A 2ED9A 4PLKD 2NX5B 3WSQL 1D6EB 5DEJA 2OMTA 4ZOEA 1WA1X 4JG0H 3IDJB 5E6IB 1AD0B 5CKGA 1H6TA 1F4YH 1T89C 2YGNA 1J7VR 1M7IB 1ZHLB 3N06B 1DVXA 5DZOA 2QVTA 5JIMA 1E27B 4FFYL 1MRCH 2J2ZA 4XOEA 4X5LA 5FUCC 4A37A 1TJGH 2EDEA 4TNVK 4LHJB 1OM9A 1SXAA 2BMKA 3P30H 4YSCA 3C09B 3N04A 3FH7A 1HI6B 2A4ZA 3MUZ1 2IDCA 3OB0K 3DVGA 4JPWH 1TENA 1QSVA 4BFIA 3BZEA 3WUWG 2AVGA 3FUJA 4M56A 5DA0B 3W0WB 5AG8A 4RMTA 2C3GA 3VXUE 3SE6A 1AGFA 1KGYE 1PZSA 2OYKA 3MUGB 5HVGB 3IBEA 2VAAB 1TTAA 1M2VA 2YO3A 4OAWA 4BELD 2OSLA 3B5GA 5C0FA 4OQTL 3DGCR 4YDMA 3SDAA 1HEZB 5KVFL 1UB5B 2QR0B 1HILB 3IK2A 2F0CA 2HLAA 4FABL 2VJ0A 3VGFA 4P4KA 2LFEA 4L3EE 3QIUD 1UWYA 3HC0B 5G2NA 2HJKB 1DBAL 3T8VA 3OLGA 1A66A 2GJJA 4RVBA 1XF1A 2ZX9A 3JTTA 4YN3A 5L2KA 5MP6L 3M6DA 5I24A 4G5AA 5CMAA 1CFMA 2DMKA 3JV6B 2F53B 3M1BA 4PGEA 5GS0D 1PBYA 2R0KH 4KI5C 2R7EA 4HDIA 2E27L 3KYMB 2XBZA 5LB1A 1CGYA 2AVFA 4ZYKA 4FULA 4CADB 4J1UA 3BDBA 3ZYJA 3KGSA 1BZQK 5AAMC 3AACA 4R2GC 3L48A 4TSBL 3H9HB 3HRPA 5GZNA 3BWSA 4P23B 3MRBA 2K7PA 5D72H 3FQ2A 1RVFL 2HKHH 5E1QA 4FQ2L 3ZN6A 2CD0A 4M7ZB 1K6QH 3STZB 2I5YL 2WXGA 2YQBA 3HG2A 1TXKA 4DQOL 4DIXA 4DJMA 1MZZA 3Q01A 3SBPA 1JPGA 3D69A 4IRSB 2ZAIA 1WC7B 1HHJB 3CLFH 3G5VA 4ZOCA 3MACL 2AKRB 2P28B 4FI6A 4RCAA 4JFSA 4X98B 1YEEL 4OFYA 4L8BA 4AEHL 1B4JL 2DQIL 3MU3A 4XH2A 4LIQL 5D1XA 3GZOA 3LCYA 5K9QI 3TA3D 4JZJA 2CIKB 3SPJA 3LKOB 3ARBD 5EO0A 1RP9A 5IVZA 2GI7A 4PWHA 2APSA 1KPUB 5PCYA 3I3EA 4A2LA 4YWGH 1XCWA 1NAMB 4PCSA 5J6SA 5GXBB 1S5HB 4YDLC 3FU7B 5DEGB 5CD5C 1U8PA 2VXUL 1UKQA 4G80B 5ICUA