1TJMA

Crystallographic identification of sr2+ coordination site in synaptotagmin i c2b domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
156
structure length
156
Chain Sequence
SGGGGGILEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic identification of Ca2+ and Sr2+ coordination sites in synaptotagmin I C2B domain
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
molecule keywords Synaptotagmin I
total genus 29
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2004-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1tjmA00
3QARA 4L1BA 2YRBA 3QJZA 4FJYA 2WXNA 4FA6A 4AOFA 4IHBA 3SD5A 1E90A 2FJUB 2A4ZA 3PS6A 1CJYA 1UOVA 2CHWA 3APDA 1WFMA 3ENEA 4TS6A 4KZCA 4EZLA 4FHJA 1BYNA 1DJGA 2WXHA 3CSTA 3PREA 1RLWA 2QZ5A 4TV3A 2N1TE 2WXQA 2WXLA 4Y1SA 2YOAA 3DBSA 1DJHA 2CHXA 2WXFA 1DQVA 4LCVA 2NQ3A 3HHMA 3QR1A 4NS0A 2ENQA 5JHAA 4J6IA 4OVUA 4G11A 3ZVVA 4XE0A 4GNKB 2CHZA 2UZPA 1QATA 2WXOA 2ENJA 3W57A 4ANWA 4DK5A 3HIZA 4IQHA 4GB9A 2CJSA 1V27A 2K4AA 3ZIMA 2Q0ZX 3FBKA 2EP6A 3QK0A 1HE8A 3LJ3A 2D8KA 4WWOA 2X38A 4LT7A 3N5AA 3PFQA 4QJ5B 4F92B 1DJIA 4KZ0A 2NSQA 4QJ3B 1BCIA 3PRZA 1UGKA 2DMGA 2KI6A 4L2YA 4PS8A 3ZW3A 5H4YA 3KWUA 1TJMA 3NZUA 4QJ4B 2NCEA 3R7QA 3F01A 3OHMB 3L08A 5G2NA 4V11A 1DJYA 4BFRA 4EZKA 1YRKA 4TUUA 2Q3XA 2WXPA 3B7YA 5CCGE 1E8XA 2LHAA 1RSYA 1A25A 2Y3AA 3GPEA 3HN8A 2V4LA 4L23A 2WXGA 1DJXA 1W15A 2RD0A 3IM1A 5G55A 5H4ZA 1E8ZA 3NSJA 3ML9A 1E8YA 4WWNA 5KJ7E 3TJPA 3IBEA 3JZYA 4AJWA 1DJZA 4EZJA 3PYCA 2WXIA 1E8WA 3RPBA 4HVBA 4L1LA 2ENPA 1GMIA 5T8IA 3W56A 3P2BA 4KITB 3ML8A 4FHKA 4LDCA 3F05A 2FK9A 3MJWA 5JHBA 3F04A 4PS7A 3QAQA 3RDJA 1E7UA 4PS3A 2K8MA 3TWYA 1UOWA 2CM6A 4WAFA 4WWPA 3S2AA 1DJWA 1DSYA 1W16A 3L4CA 3QR0A 4HLEA 4FADA 4MJJA 4A55A 4ICWA 3L17A 2JQZA 2WXMA 4F91B 1WFJA 1TJXA 1BDYA 3APCA 3FDWA 5CCHE 1E7VA 2B3RA 4WEEA 4ANVA 3M7FB 2CHDA 1K5WA 4QAMB 4ANXA 4F1SA 2BWQA 3OAWA 2K3HA 4NPKA 2ZKMX 4XX5A 4DNLA 4OVVA 3R7RA 3KWTA 3T8MA 2DMHA 4F93B 2A5UA 3APFA 2R83A 5CCJA 2ISDA 2Z0UA 3L16A 3F00A 4ICXA 1QASA 3TL5A 4FJZA 2WXJA 3L13A 5EDSA 2QZQA 4ANUA 4FLHA 3DPDA 4XZ4A 4NP9A 2WXRA 3L9BA 3L54A 3NZSA 4URKA 2WXKA 1RH8A 4JPSA 4FULA 4NPJA 4Y1TA 4BGDA 2K45A 2CM5A 2CJTA 3CSFA
chains in the Genus database with same CATH superfamily
2XQYK 4CU6A 1WA1X 4KOBA 1R17A 1IAIM 3RWCB 4OZ4B 1EXUB 3MZTA 3LY6A 2F19H 4O58H 3E8VA 1CJYA 1XMWA 5F93C 3UTOA 2A73B 1WFMA 3GRWA 3RWCA 3W2DH 1A6VL 1JGIA 4JFFA 2HG0A 2R2BB 5D1ZB 4GRWE 4YH6A 1XR8A 5ILTL 1OSPL 4MA3B 3FFDB 5JORB 1X5IA 2R2BA 5D2NC 2DL2A 2GJ6A 2VITA 1N0XL 4OLUL 2FGWL 4RBPH 3RI5F 2LW3A 4I3RL 1IJNA 3HHMA 3WFZA 4MCYA 4JO2L 2ZSWA 3MLRH 4QCIB 1RUAL 1LNUB 4OZGE 1M4KA 4XP1L 4JPQA 4LU5H 4OD3L 1A6UH 4XHJC 5J6SA 1NUDA 5DJXA 4CMMA 3V10A 1ZV9A 1CC3A 2NDGA 2YRZA 2R7EB 1JGLL 4UYPA 1E4KC 1W72A 4JFDD 5FGCB 2HN7B 2R0ZL 2J44A 2ADFL 1HWHB 2CIKA 2X70A 2BSTA 5F7AA 4J8QA 3D33A 3ME0B 1IAOB 1RIVL 1T5XB 2Z3FA 5JO5B 5HYQB 1IGIL 1TTFA 3MNVA 3X3FL 1IBFA 1TR7A 4KI5E 1IAOA 3LN4B 4OGQC 1JS4A 3MNVB 3DDGA 1EMTL 1MREL 2VXQL 3GXTA 3PWLB 3BPNB 5F1IA 2I26N 1KGUA 4LKXA 2CE6A 4TOYL 3OM3B 3DUSB 4PGCA 3MNWA 4MZIA 1QSFE 2WC7A 1YMMA 2XSKA 3O6MH 3AM8C 5I76A 3V0GA 3MNWB 5F7WC 1JXJA 5IMOB 2B0SH 4BZ1A 5ENWA 1JK9A 1KLFA 1T1XB 3D39B 4OW6A 1RK0A 1JPFB 3IYLW 1GJWA 5GS1A 3HMWL 4Q6IB 5I5JA 2IGFH 3JWNG 4JQIA 1N26A 5C0NC 2EDDA 3ARQA 3QJFA 3CSGA 3FH8A 4WDIA 2Z35A 3BGFB 4R0LB 2B3IA 1CDIA 5IV2B 3RZCA 4O02B 3QRGH 3PGFL 1JZ5A 2YBRB 1KJ2A 1B2YA 5I17A 3MRQA 4IDJL 5F8RC 4G8GB 4A68A 2HP4A 2XOTA 4BCZA 3QJQB 3R4RA 4FFWC 2VLKA 3FQTB 4F7MA 4TQHA 5ACZB 3WKPA 3D18A 3QFJD 2E3VA 2RIKA 4NDMB 3GUTA 2NW2A 4JS7A 1IC5H 4XPFL 1JHTA 5DRNA 1X5ZA 5DMKA 12E8L 5L2JA 1S9YB 3HZMA 4XO8A 2BIPA 4I3GA 4JDVB 1R3KB 3WLWC 2ZUVA 3HG1A 1UXSB 4X4XA 4JO3H 4QNPE 1UWXH 2Z8VC 3B1UA 5F9WB 2FL5B 4M02A 3HG1B 2WK2A 4ZUVA 3UCQA 5K1JA 3BEWA 5E9NA 3TZVD 3NSFA 1OZTG 3W37A 4XB8A 1EO8H 2C7UB 2AQSA 5CZKA 2OQJA 2AQNA 4QY8A 2UWEF 1AP2A 2Y7LA 4B7IA 4CDHA 2CQVA 2EH7H 5JW4M 4U0QB 5KSUB 1FH2A 1FVCA 2MOQA 4R4BA 1GA2A 1D5IH 3IJEA 4PFEA 5LNEA 3CH1A 2VDMB 4Z1PA 2MCPH 1L9NA 2PN5A 3TCTA 1PZAA 3FB7B 1J0JA 4DEPC 2Q3ZA 4JHAL 3D51A 4QRTA 2C4FU 2CO7B 2HA1A 1RIHH 2IDSA 3TVMC 4PP2A 4LDOB 3WEXA 2I07B 5ICYB 2B0SL 3QEGH 2NDFA 3ARUA 4H2CA 3RZCC 4KZ0A 2VSKB 1GMEA 4B60A 3M7OA 1BMWA 1Q9KA 1II4E 3QULA 3JWNC 3L08A 4AXWB 1Z9LA 4RMBA 1SJHB 4KJWC 4E36A 4O02H 4WUUE 3GHEL 5F7DB 4MD0B 3WNIA 4J3TA 1CGUA 4PW4A 1W15A 3L3IA 5E6YA 2W92A 4X6DA 4Z77A 1DCLA 2EXYC 4BCYA 2XA8L 5AD0B 1E8YA 2RGSA 4Z0XA 4ZW5A 3UTQB 1XGTB 4QXGL 5TQ0H 3JZYA 5DUMH 1VFMA 4X0KA 3TM6A 2V5SA 2ENPA 5TDNA 1QBLH 2XVGA 3GMRB 4PCSA 1KXVC 3SO5A 1IBZA 4NNXB 5JHDE 2CBQA 1OP4A 2IWKA 3FRUA 5E2UL 4G9FE 5CBEA 3UTPE 3EBHA 1VJSA 3WTSA 1VRSA 3CIAA 3BW9A 1JD9A 3FB5B 1QSFB 4PGEA 5I1GL 5KBNC 5ICUA 3N1PC 3QFJA 5FYLL 3T6XA 3MAWA 3MLVL 3VA6A 3HPLA 2B39A 4PV8A 4BFBD 5J11B 5DJZB 5F7FA 4Z7UB 3IS0X 1L5GB 5FFOA 4XVSL 3QFDA 2MPAH 3VFWB 3OLDA 3C09B 3GSQA 3QR2A 3V0WH 4HOZA 3HG1D 4HQQL 4C59B 3MHZA 5TE6H 3ULVF 5GRUL 3UTTE 2X3CA 3GHPA 3NCYS 4YZWA 1RU9L 3UAJC 5EDSA 1JXKA 3AZUA 1BXVA 2ZTBA 3U1QA 3TOPA 3DK0A 2EDJA 2YMOA 1TEYA 3VGEA 1K3IA 4XXWA 4Z6AT 1HH9A 2PTTA 2VIRA 3JZ7A 3T65A 2NY0B 4CVZA 4Y5XA 2X6UA 3U0WH 2FX8H 3HS8A 1CT8B 4APQC 3X1EA 2YA0A 4PW3A 4XMZA 2AMGA 5IMMB 3KZ8A 3GB7B 3W9EA 1YUHA 1U3HD 4X6DF 1XF2B 1CO1A 4ZW3A 3MRKB 4QXUL 3V4VB 1ZK5A 3GSNB 3NIGE 5DJ2B 1BEXA 2QSCH 1HHGA 1IT9L 3MBWA 1HZKA 3ZVVA 1ZT4A 3GI9L 1E4XI 3H3BC 5D7KD 5DMIL 3LRMA 4NM4L 3TA4D 4GMTL 3QPKA 4HSAC 2A6DA 3DROA 1BXUA 3BIKA 5CFHA 4MLIA 1FIGH 2PWEA 1ZXKA 1FZKB 2XYBA 4I1PA 2DWDB 4LLMB 1TQSA 1SN5A 5HD8D 1KPUB 5F1NB 3WJLC 3U9WA 1YMME 2NY1D 4BFNA 3KH4A 2FR4B 2H2PD 1A3RH 4D9QE 1HNGA 1V3JA 4J3XA 4GPVA 1IGTB 4PJ5E 5DLLA 3O3AB 2J2ZB 2ZZUT 2PYEA 5FW7A 5C0CD 1QNZL 1UZ6E 1FFNB 2WLHA 4IBWA 1E8ZA 1MJUH 3P02A 1EHKB 4I18C 3LNGA 1ETZB 4FXKA 5D1ZD 3RI5K 4BHUI 2DJUA 3RPKA 2VRAA 3CZEA 5F6IC 4XVUD 1HCYA 1E8WA 5A3IC 2RBLA 1PFCA 3GK8H 5BO0D 3DGCR 2W60B 3U0TB 2F5AL 3BGAA 3X12A 2Y5EA 3UBGA 1TNMA 1BVLB 4PJGE 5DD3H 2BIHA 4KZDL 1UJ3A 1L9SA 5F96L 3HS0A 2A74C 3QPQC 5T5FA 2PF6A 2GABA 2DQHH 1AZNA 3NCXA 3L3OA 5FKPB 1CICC 5E2VL 4LQFH 4ZFGL 2C1OB 1AO7A 1JWSB 2B3RA 2HWZH 4LVHB 3M7FB 2XLLA 4H88H 5D72H 1F8TH 4XRCB 4P3DA 5DHDA 4MMXC 3VDAA 2OW7A 4TNEA 2BFGA 1E9PA 3AFLA 4BZYA 1ZHBB 2OMBA 3PIQB 4MBOA 1RHHA 3DDFA 4O4YH 4KH2A 2JB6B 1UD5A 2WXJA 1LL1A 2VB5A 2NT1A 2OP4H 1GYCA 3V0VB 2VLRE 1KDJA 4ATWA 5AAPA 1ZJAA 1D9KA 4Y1TA 3T2PA 3ZY7A 2NNXA 5EIIB 4CBPA 1EUUA 3C6EA 5DJCB 2FUQA 3NZ8A 4OCYH 3RHWK 4JG9A 4OZFA 4DPRA 3O6FC 1WIUA 1URLA 2P8MB 4PCKA 2Z7YA 5IBTL 1ZLUH 3FO0H 3T6WA 4A6YH 4LCYA 4U6XB 5B1KA 2WBXA 1IC4L 2OSWA 5JNYA 4HEMA 3OSVA 1B9KA 5IHHA 5HHOB 4BSVB 4JFFB 1F3DH 1HSBB 4YBQC 2KZBA 5JHLH 4KK9C 5IB1B 1LEKA 3VE0B 3BN9C 2GJ6B 4DOHB 1UH3A 4OVUA 4I48A 3GSOA 3W5NA 4ODVH 1YPZB 3T8XB 4TLSA 4I48B 4HUUB 2XN1A 3QEQD 1PPIA 3FBKA 2DWSA 4N2IA 3ARDC 3HPJB 4W9EC 1GGCL 3GLDA 2EADA 4BXSV 2YK1H 2M8XA 3L3OC 1PY4A 3OR6A 1PZ5A 4OLYL 3PABA 5FX3A 4X4YA 1SXAA 1NSNL 2EXYD 3LNDA 5I8CA 3SDDC 3S5LA 3DYOA 4OGXL 2D7OA 4RBPK 2X4QB 3FL7A 4OCYL 4V1DB 4WFGE 4YE4H 4YQXH 1L9MA 5JO5A 2VXUL 4BJLA 4FQXC 5MHSD 1UWFA 3OMAB 5T1DH 5IJVA 3NCJL 3THML 2HJLA 2OR9L 4DZ8B 4HKXB 1QWHA 5I19H 5JHDA 3N0AA 1BOGA 1IARB 5GRJH 5CJQL 2J5LC 3NACL 3N42F 4YFLI 2D73A 4OM1L 2VXUH 4N2DA 5I82A 2N56A 2H2SC 3O6FA 1FWXA 5IM7B 5B1JC 1BZ9B 3CWGA 3QJVB 4UUJB 5DUPL 3AVEA 2GTWA 1MLCA 2GG1A 2XPGB 3SCMB 1INQA 5H35A 1FLRH 2QDVA 4OZIE 4POZD 3IE9A 3D0AA 4AV4A 5CCHE 4PU2A 2EECA 2WQUA 5AQ0A 4R0LA 1I1RA 4FCHA 1ZHKA 3E1ZA 1TMQA 2YGPA 2IWEA 3BRDA 2G3NA 4FQHA 4HCRA 3LH2H 5K9OB 1FRGL 2P49B 4PRDA 4FQPA 2QHRH 1CIDA 5I1LA 3IDNB 3T3MB 3PL6C 4LPVA 1EXHA 3C8HA 2EE0A 3CC1A 3FCGA 1K8IB 2XXFA 5IWLC 3E80A 4NDMA 3GUTB 4GXFA 4J4PC 4XZ4A 2VDOH 2YUZA 4YPGB 4APQA 3SHSA 3QHZH 4KTEL 3QS3A 1KCRH 3FQRB 1G9MH 1JK8A 1TEGA 3I9IA 3MLXH 1N5AB 4AVHA 5I71C 5F9JA 4FEIA 4FZ8H 3UO8B 3VXTA 1GS8A 1HILA 1R3KA 1RJZA 5CIPB 2ZYRA 4C8XA 1MEXH 4DP5X 1INDL 3CZUB 4G71B 5DVMA 4ZUVB 1X5LA 4DKTA 4PWFA 3VVWA 3PGCA 3ZDYF 2GBTA 4HALA 3B6SA 3H9SB 1MCCA 3EOYG 1MI5B 3V4VL 3OGCA 4GSDL 2BP5M 3MXVH 1KBBA 4LASL 5E2VH 5C0FA 3F8UB 3MRRA 1IILE 2OCCB 1QA9A 2WB1A 1D3CA 2DQCH 3I9AA 2VXSH 3RWGA 2W80C 2IH3A 3FB8A 4PHXA 4H1LG 1CXHA 1KTLA 4ORZC 3WN5A 3H55A 4E9SA 3HZKA 3ZDZB 5B39A 5LQBL 2R9HD 3GMQA 2CG9X 5BZDB 3SKNA 5JPNB 1GHFH 4HS6B 3LZRA 5JIDA 4IQHA 1ZSDA 1NH6A 4U6VL 5DUJA 3NFSL 1KMGA 4WUUD 1SY6L 5BVPH 1HQRB 3OKNA 4X7SH 1F3RB 2J1XA 1QUPA 4JO8A 3LH8A 3CZSA 4U33A 5AB0A 5FUZL 1IU1A 4OLZH 3BE1L 5FHAH 1AXSB 3SJVE 1YDPA 3EYSH 3OR7B 4EXKA 2CO6A 3TBTA 4NUMA 3EJYD 4LSTL 3DX9B 3OL2A 1L0QA 5MP6L 4WEBL 3FCSA 4ZTPL 4YHKH 3B9DA 2V2WA 1RZPA 3CFDB 5C71A 1AHMA 3WUWB 5DHVB 4GRLD 4RRPM 4ODUA 2FT7A 3L5WB 4XAWL 1ZPLA 3B2XA 5T1DL 1OY3B 3QRFM 3HI5L 3MRGA 1DUZB 2UWEB 1WD9A 4LESA 4QTIH 3MLWH 4DO4A 4I5BB 4MVBD 5EC2A 5F3BA 4WWPA 4GKZA 5EZJB 5CILH 4M5ZL 3BVTA 4EIBA 3IFOB 4M7JH 5EBLA 4JO1H 4Y9BA 3IXAB 1CDYA 4OTXH 4QXTA 1BM3H 1QSFA 4PGEB 4N2BA 2ZSWB 4QCIA 2ADYA 3WO3B 1OZUA 3OZKA 2IADA 1S7WA 3RGVB 3Q05A 4ONOA 1LDPL 4XCEB 5AVTB 1PKQB 3PWNB 2H6PA 3FYIB 3UBXI 3EUUA 1LHZA 3MOAH 2ZG2A 3C87A 3QG7H 5C0DB 3TFKD 2G5BA 3QUYA 5J12B 1SXCA 5I30H 3ALPA 1OTSD 4GQPH 4N2NA 1NCTA 5KZCD 4L3CA 2JH2A 4ODHH 4X99A 3E6HB 5GGSY 1QSEA 3EBAA 1KN4H 3FCTA 2Z92B 4LVEA 2Q5BA 1HH9B 2VIRB 3ARBC 2Q9OA 4UZGA 4ZMNA 5D2LA 2IEPA 2BZ7A 1J8KA 5LAPA 4HC1L 1KBGL 2X2UA 1V8HA 3HE6B 3FKUS 3M86A 4H8UA 5E1HB 5A16B 2CLVB 4P2OC 3TBYA 4MAYC 4RAVB 2AERT 1SN0A 3OXRA 4DFHA 4DEPB 1SUJA 5D5ME 3FUJA 4PMFA 3MODH 4RAVA 4XX1E 4Z7OF 2JELH 2VZVA 4OLEA 4LVHC 1NBZA 3QNXB 3UC2A 3QO0A 3Q06A 4HJTA 1UOKA 2OCJA 1SDDB 1ZCRA 3QNXA 3VXRD 5B4MC 3UROR 4CMHB 1QI4A 1S7RA 2FQDA 4OBSA 2G5RA 4K9EH 1JZ7A 3UZEC 4XWGL 2H4EA 3UZEA 1JV5A 4XB7A 1NGPL 2GITB 1KLGB 3S35L 3X1BA 1XV8A 1P7KA 3IU4L 3SKJL 2A9DA 3PPEA 1CD9B 5FGBC 5F88B 5FM5O 3PY9A 2GITA 3VRLF 1UZ6F 1OAQL 2BY1A 1JWUB 4JFDE 1PEWA 4F20A 3VB9A 5C0BB 3PJNA 3IB4A 3QCVH 1LD9B 3IJ7A 1D6VL 1DANU 3EO0B 1DQJB 4KRMB 4FZEL 1I1CA 1T7XA 3WXVL 2BSDA 1CDBA 5KBLA 1BFOA 4RFEB 2YZ8A 1XIWD 5IVOA 1Q94A 3AABA 4L8CA 1U8NA 5DZVA 3RWEB 2A7BA 4LP8A 1NCBL 3D9AL 2AVGA 3PWPD 5FA4A 1J86A 3ARBA 1W2KT 5DQJA 3TGXA 1BAWA 4PR5B 4FMKA 5B1CA 3WI9A 2AQTA 2J88H 4CVWA 1KY6A 1LO4L 4I77L 1GGYA 4X5WB 4HX1A 4AJYV 1K85A 4PVMA 1RZ8A 1T6VN 2ICEB 4AW4A 3L4TA 4YWGH 3TCLB 3DX6B 5DJYA 1L6PA 4AYGA 4LBEA 3L3OB 1GOGA 3LVEA 3OLGA 4PEEA 4PJXB 2YPLD 4OFKA 4TSCL 4YDJB 4OVVA 1J9SA 1A5FL 2DI7A 1R4XA 3SIKA 1UYWL 2FZ3B 5BZWB 3V9CA 3O4LE 5ICXB 4EBQH 3GXFA 1H3PH 1K6QH 1OQXA 4GKOA 1DQLH 3DUHA 3AG2B 1IQWH 1XF4A 2IQ9L 3SJVD 5A2CA 3K8MA 4GIPD 3ZXAC 2ICCA 3CFEA 4NRZA 5C1MB 12E8H 2P4AB 2XA3A 2WQWA 4GAAA 2HX8A 3QZNA 3HUJB 4QKTA 1MDTA 2WSPA 4PWEA 4H88L 4M4PA 4R5VA 1D9KB 2K8QA 3FO2B 32C2A 3HUJA 3MJ7B 1MW2A 5DJCA 3VMPA 3GO1L 1KN2H 4GW1A 2NZ9D 3VQMA 4AMKH 3I75B 4IDLA 4X6DB 4Z77B 5AD0A 1ZANH 2ENYA 3NFNA 1MOEA 4M7JL 2Y1ZA 4M1GH 2DLFH 5DFWH 5F3HB 3MTXA 1RD6A 5CGYD 5K39A 2QQNH 3H9HB 5I26A 2OL3A 3ARGC 5B22A 4YBLB 1CXEA 5AZUA 4QRPD 1S8DA 1IEBA 4XPAL 3ZE2F 4WO4B 4ES8A 4R8WL 5DK0A 1F5WA 5E8OA 4MRBA 2ZX5A 2NXYD 1MCPH 2CDEB 3BW9B 1D2PA 4G3YL 4UT7L 2Y69B 3QIBC 3L4WA 2CDEA 2Q7NA 3F7YA 5GIRA 1FL5A 3HPLB 3FFOA 3HB3B 2OULB 5SWQA 3S34H 4N3TA 4KOCA 4X6BB 1C7TA 1TJGL 1OTTD 3HBZA 1I7ZB 4H7VA 3A5VA 2O61A 1H5BC 1E9OB 3O81A 2QQLL 4LGRB 4Y1AB 4L8SC 5IB3A 4HDIB 4NO3A 1XGQB 1OAUH 4PJBF 4AQ1C 5HGBA 4PJ7F 1RURH 1BJ1J 1RMFL 1M6UA 5IIEA 1MN4A 3F7RA 5CGBA 4LSVL 4JPWL 4JCLA 4ABUA 3GI8L 4XNZC 2ORBL 1G94A 3RY6C 4JJ5B 1RK7A 3D87B 4YAQB 3K8LA 4IBQA 1IGFH 1E30A 3MVSA 3VQ2C 1A3LH 4UM8B 4F8PA 4ZUUA 5CJ5A 3RVUD 4JHWH 4RGNC 3WTVA 3G5VB 4MAUL 5IQ9A 4KQ4H 3AC0A 5JHBA 3UAAA 4HMEA 5D7SH 4Y4FD 4FQCL 2WN3A 3SDCD 4WFHE 4J39A 4A2GA 2O5ZL 3KPOB 5EO1B 5KSAC 2R69A 2J21A 4MJ5B 3KWXA 4MCZA 4HIPA 1OWWA 4B97A 3CDZB 4HHAB 2EZ0C 1XSIA 4U7KA 3UJTH 1HQ4A 3DXAA 3P54A 4OB5H 2P47B 3VJ6A 4M6NH 3Q2NA 5B21A 1Z66A 3JWNH 4G9FB 5JIQA 4EXPX 3SDAA 2FJHA 3BO8A 1XSKA 4GP5B 3KS0J 1SXZA 4R2GC 4HH8A 5FEBA 1O9VA 1YC8A 2QQNL 2IJ0C 2ZG1A 1PSKL 1GGTA 5IW1A 1QR1B 3JWNE 1M56B 5TDOA 4N4YB 4H4NA 4OIIL 1MHHB 4ZUSA 1VKXA 4NAJA 5E8PB 4ZOBA 2ORBH 4PJ7A 1WQVT 4ZPTA 5T33H 2ATPB 4MAYD 2XVKA 5C0RL 1XF3A 3BDYL 3DMMA 3T5WA 1MHEA 3ZTJH 1DVSA 5KUMA 2VABA 4LCWD 1FFNA 3CFCH 3FUHA 4PJIB 3T71A 1WVZA 4OZIA 3LEXB 4P46D 4PPTA 4IGBD 3KYNB 1V5JA 4XXCC 3PNWB 2NRDA 3MRHB 4OFYA 2YOAA 5I8EA 2Y5TB 1KB3A 5IOPA 3GSXB 4MMYB 4ONFH 5F71A 1FH5H 5KS9E 3L95B 1UJ3C 3DRTA 4JNXA 4DP9X 4ADIA 4EF3A 1X9UA 3QQDB 1NGYB 4IEFB 1V3KA 4Q9RH 3F84A 2MOVA 1CL7H 2X0VA 5TQ0L 3GSWB 5KSVA 3GXMA 3IDMA 4IBSA 1R46A 1Y6MR 2IH1A 5LGKA 4KMQA 3RFRA 4JG0L 5BZDA 5JPNA 2QQQA 3SPCA 1LWRA 5AKSA 1HFUA 1U8HA 2HPOA 1I8AA 2PXYD 5I0DA 2Y7OA 4IKKA 1O9ZA 4I0KA 4X6EB 5L2KD 3RNQA 3S3PA 3ULUF 4X6EA 3UBHA 4B9GA 5EOQL 3NT0A 4G6AC 4DGIL 1ZT7B 4KDWA 5D70H 1E4WL 4M7KH 1DBBL 5LQBH 4S1RH 4OZ4A 4B9ZA 3SBWA 5PCYA 2V2XB 2GJJA 3BZ5A 3BP7A 4U7SA 3WIIL 4Y4FB 1TVHB 4XPBH 2WP3T 4TVPD 3OR7A 1JD7A 2H0FA 2JKJA 3TBTB 5EU5A 4HF5H 1FFOA 3EH3B 3UAEA 3BN9D 1WBYB 5DMJB 4JANB 2WWMD 1ZHNB 4F9PA 3KPPB 4JFYA 2KLTA 2W0LA 4JVPA 4C47A 4X6CE 5HI5C 4JFYB 3BVNA 3OTTA 4PJ8D 4P2RE 3WJMB 1JN6B 3O4LD 3J07A 2AK1H 3SDAD 4CMHC 4BZ2A 4M6ML 5AYTA 3RKDC 4WEEA 3L7FA 2GW5A 3DA0A 2J8UE 2IFFH 2EDFA 4YSOA 1FNHA 4WI0A 4KK8D 3U7YL 5IW6B 1F18A 4KI5C 5FB8A 5EHFA 4AL8L 3V8CA 5T1LD 4FZ8L 4MD4A 2XQBH 2XG5B 1G7IB 2ZUWA 3L3GB 3TCXA 1QASA 4WHYH 2KZWA 2NZ1A 4M9OA 4MD4B 2CRIA 5E4EC 2X89A 5C0BD 4MB4A 1QO3A 4DKDC 4WJ5B 4MYWB 1EXGA 4TL5A 4BKLB 3AREC 1W72B 5JIPA 1NDMB 2E6QA 4GP8B 4K7PH 5HDLA 3CSPA 1CF8H 5IMOA 5LDUA 3CPUA 4PWGA 2EKSB 3QJZA 1X5HA 5TDPB 1ILSA 3VXMA 1J5HA 4CU8A 3TYGL 3QQXA 5F9WC 2VDNL 3ZE1E 3PJSA 2K7PA 4YGAB 4PRHD 3GBDA 3P2DA 3IDIB 3TASA 4UU9B 3QUZA 3P73A 3RBSA 1IBHA 1QG3A 4WDIB 5DFAA 5I30L 2G60H 2QVTA 1CBVL 1NOFA 1D5MA 1G1CA 2VLJB 1QNZH 3NEOA 2JLPA 4JQVC 4XMPL 5EUKA 6PCYA 2YOCA 3D2UA 4ANWA 2R23A 3HRZA 4K15A 4B5ZA 4LIQE 1NBZB 3PUCA 3D09A 3H9ZA 4I1RA 5EU6A 4AZ8A 3MRIA 1KIUB 1JG9A 3CZJA 3PRZA 3QJFB 1UGKA 3MRJA 3RIAF 4EAEA 1CDHA 4L0PB 5F1SA 4JDVA 3RZCB 4TNFA 2G3ZA 3FO0L 3WY1A 4D0CB 1TTCA 2NCMA 1TVDA 4WWKB 5ID1B 1GYVA 1MZYA 5E2JA 3UDWC 4XO3A 3NIDE 4EQ3A 5D2LE 1E8XA 4HH9A 2C7UA 3VU2A 1DJXA 3FQTA 4XMVA 2WD0A 2IAMB 4LEXH 4QYOB 4PN6A 4EN3A 5JHLL 2CJUH 5ICZB 2JKWA 4M1CD 1NFDF 2R1WB 2BSEA 1MFEL 3M45A 3VXTB 2Z9TA 3S8WA 1AXTL 1DFBL 2EO7A 3KYAA 2MRYA 1CI5A 2B1OA 4EI0A 5I2IB 3OGOE 4NZTL 5D55A 1U8NB 5DDHA 3T4YA 2EIEA 5I2IA 1LK2A 1I9EA 3MV9D 4AY0A 4LHUA 1OGTA 1JERA 4PP2B 4CSSA 3LD8B 4W4NA 2VDRB 2H9GB 3OKKB 2MJWA 3RGHA 3IGKA 3HC3H 5DZLA 2CBOA 3TYGH 1ZSHA 4KQ3L 2BP8A 3E1F1 3Q13A 3P1VA 1U4FA 4RNRA 4ZPVB 5CEXB 1QFWI 3MLSL 1WV7T 1FYHB 4OLVL 4KTYA 4KPHH 1Y07A 4OZHF 4YX2H 2YXFA 3GSNH 4M62L 4ZO8A 4S1SL 3C09C 2XIIA 5FYKL 4E5XG 1FYTB 4JGNA 4M7ZC 4XN4A 3V95A 1WP6A 2P5WD 1KACB 2CAKA 2YXWA 4OUUB 2YMXH 4Y4KC 3OKLB 3UTSB 2ZE0A 3WO4B 1BPVA 3VRIA 1U3YA 2WKOA 4HC1A 4KPHL 3C60B 1JGUL 2OCFD 1BVOA 2AXWA 5IREA 5AOIA 3X3GL 4E42A 5FYJL 4AXWA 2OW6A 5L88H 2VLLB 1OCWL 2MWCA 4X8JA 3RVWC 2AK4D 5KYWB 4K5NA 1MJJA 2NMSA 4RISH 4U7MA 1I1AB 4MDJB 1OK0A 2YN5A 2YPLE 1DJHA 2ZAIA 3NJNA 3BHBB 4UINH 1I31A 4GINA 5D71L 1DVQA 3TA3A 1MNUH 5EU6D 2EH8L 4D8PA 1CYGA 1AR1B 5DJ6B 2E4FA 2D3NA 3QFDB 1FFRA 1Q9WB 5I6LA 3HNTH 1IM3B 2RA1A 4XCCL 3MXWL 5GGRY 4MTMA 1QEXA 3TBWB 5BW7C 2R8SH 1J18A 3D3VD 4XBGB 1HKLL 2CDFB 5D7IA 1RUPL 2D7MA 3MCG1 1YYMH 3VTMA 1BIIB 1BVKA 4ECNA 5T3XE 1N5YL 2K7QA 4QMEA 3AS1A 1CL7I 3TX4A 1ZV5A 4HPYL 3A67L 4DZBB 5JXEC 3F2LA 3T1WA 1NCDL 1UKSA 4ABWA 3NQIA 4OI7A 3WY2A 4MGXA 4J3OC 5I16B 4QLWA 1IAKA 2JCWA 2VXTL 1TDQA 4L4TB 3SGDH 4IGBB 1I7TA 1CGXA 2XT1B 1HIML 4LHUD 1BF8A 4JUSA 3KPLB 3TEUA 3V4VA 2VN4A 4JFZL 4NZUL 4XC1H 4Y7OC 5HYJA 3ETTA 1IGML 2VWEC 3MUGA 5I1CL 2GUOB 4Q0XL 2HLFD 3GM0A 1MCRA 1CDCA 2JF1A 3RL1B 5HGDB 3UZVB 4B0MM 5D96B 2A6DB 4RGMC 1QFPA 1MFUA 5BV7C 2E47A 2ZJSH 4WTZA 4B6ZA 3QNYA 3SODB 1J8HE 5GGUA 1I3UA 3QNYB 4KHXL 3ARED 4XNMB 3OMNB 5HHMD 2LFGA 3U4EB 1M1XB 4QHUA 1OV8A 2DQJL 3BD5A 2Y2WA 4UYQA 1IC7L 2NY5H 3WFCH 4H25A 5SWSB 2YXVA 4PJCF 1VZIA 1KB9J 3CLFL 4GI9A 2H1PH 3BWSA 4OB5L 3NCYP 4U4IA 4DQOH 2OYLA 3MLYL 1OANA 2BNUA 3GWJA 4ZMXA 2UXGA 3EYUL 5EDXA 1EBPA 3NSXA 3VFMA 3Q2LA 3WKYA 4PJAF 2QLYA 1QBLL 3WHXA 4POYA 1KCVH 3PLYA 5CBAB 1QEWA 1JNLH 3WIHA 3HZYA 1IGTA 3CN3A 4J3UA 2E27H 4M3HA 1NGPH 2OMTA 4ZFZB 2NPLX 2CRZA 3KYNA 1XFPA 5EV7A 4Z3IA 4KXBA 1SY6A 2NQ3A 2R4RH 2CDGA 4Q9QH 1CD0A 1S7UB 4FXKB 3FONB 2DYRB 2MEJB 4ONGL 2BY3A 4XRCA 2R56H 2BSSA 2EINB 4FP8L 1FNLA 1SHWA 1AQMA 2Y25A 3BC9A 5LXVA 3VFOA 2QADB 2XQYG 2VDLH 3G9AB 1IGYB 2DLHA 4MSWA 4QJ5B 4QXGH 3ATAA 5GS0L 1YNLL 4FTVE 4J3OH 4NSKA 4F7TB 4OZFH 4DGYH 4NWTL 4JFDB 5IEKB 1A3ZA 4ONGH 4BELD 4AEIH 5E8EA 3R4DA 4JFDA 2W9DL 5FIEA 1ZGLM 4G2AA 2WVVB 1MCPL 3QUMA 3TNNA 3PP3H 4G6FD 3INUH 4LOVA 3NPSC 3MACL 4V2CB 4ZYKA 4DQOL 2RFXB 3WTWA 1W80A 3WAJA 4ZYKB 5HYJD 3BYTA 1VCBC 2B59B 4AYID 4APXB 1MPAL 3I3DA 4JZJA 3CVHA 4XPFH 2WINB 2D9QB 3P0YH 4HWBA 3DGDA 2YBGA 4HU8A 1PF3A 3CE1A 2X87A 1LEKB 2F0CA 1G0XA 3GMPB 3LMJH 1J5CA 1MVYA 4QUOA 2WBJB 2BHFA 1T1ZB 2N7SA 4A37A 3STLA 1G5AA 3QR0A 3O0LA 3ATFA 4A55A 5CJOH 3D05A 3GSUA 4KGLA 3E7JA 4OAWB 4RDBA 4K8RL 1WS7A 5SWZA 1YEKH 2MQGA 3WE6A 1CK0L 2LABA 2H6UA 5DZOA 2XKUA 3QI9A 3QYMA 2WM0A 4OI8A 2FSDA 2X4QA 1ZK9A 1G43A 5EN3A 3RY5A 3SE4A 1HCVA 4LLAA 2HTLD 5SWQB 5ABAA 4EBQL 1EVTC 2IPKB 1Y6NR 3Q5YA 1QLEL 4PBDA 4EOWH 2A6IB 3WHE0 4EIGB 4PJEF 4R5TA 2JSFA 2PO6D 3K46A 1PKQE 3MI6A 4NZUH 4XC1L 4NCC1 4AIEA 2QPUA 3LKOB 4JHVA 2B08A 2QFRA 3VXMB 2QFPA 5KSAD 4FXLA 1HTYA 3EGSB 3G6AA 4QHMB 3K6NA 3ZU8A 1OP9A 4YDNA 1LEGA 2C3VA 2OMVA 5ANMA 1INQB 1RZIA 5H35B 3SCMC 3QYNA 1T7WA 1LEGB 2C3VB 2OMVB 4YFDB 2EYRB 2H3NB 3JQOB 3N6YA 4HJGA 4OZIF 2WLYA 1SEBB 5F7MC 4X7TB 3RGBA 5JHAA 3ZLQC 4JY5L 4X4ME 1ORQB 3G6DL 1GW0A 3TWCL 4KO6A 4ZX6A 4G43B 4GSQA 2DQDH 3KPOA 3ZL2A 3KXFB 5EF1A 2VDPB 4WNSA 4PB0H 4Q6YA 1JPSH 5I15H 1SDAB 3CXHK 5F7EH 1R3JB 3UX9B 2CGRH 1R3HA 1HS6A 4NJAH 3GO1H 4URTB 4WJG3 4Q9RL 3U2SB 3WD5H 3KW8A 5K9JL 4L4TE 4YHIB 3LHAA 4PLJC 3DV6B 2XXCB 1ZDQA 3MJ8A 2Q3XA 2QQLH 1EIBA 3LIZL 1D5IL 4PJDF 2E59A 3H7BB 4K8RH 1NGQH 3MX0B 4DH2A 4RQQA 4J12A 5JOPE 1QWUA 1M7UA 1XTLA 2AITA 2TRYA 1A4KB 2AK4B 3RTQA 4MX7B 3EBGA 1RVFH 1F2XK 3V52H 3BUBA 4WENB 5J9PB 8CGTA 2X6MA 3CZNA 1MFCL 3ILDA 4ERSL 3WNJA 1QVOA 2BVOA 4XNYL 3U4BH 1TO4A 2FNBA 4KH9A 4JY5H 4M6OL 4NT6A 3DARA 4G80B 5IBUG 3K2UH 2X53A 2P43B 3CQFA 3KL3A 4PRAB 4U4BA 3QIUC 2AJUH 2I25N 3O3DA 3OWEA 4PB9H 1X5GA 4O9HH 2NY2B 4UT6L 2QT6A 2CBTA 2QVFB 3O3DB 4EIUA 3QXDA 4BYHA 3GSRB 5EBMB 4DN4H 2KQNA 5A40E 4HKZB 3K6SB 3JTTB 5EB9A 2XNAB 3GSRA 4GRMB 3TXAA 3M8OH 3KWTA 4JRYE 5K1VA 2VDMH 1QNIA 3SZ6A 3WN5B 2ZXDA 4PS4H 4X80L 2EYTA 2F54A 3ZT5A 5HSFA 1N4XH 4WK2B 5E99L 4CVXB 5J7CC 2DQFB 3HS9A 4QLRA 1XSJA 4H20H 2OZNA 5DRXB 1H6EA 5E8DH 4ZMZA 5C0GA 2MTPA 4OU3A 2YSSA 3VRLE 4LKCA 2VLMD 2ZICA 5CLYA 4IHBA 3VYNA 3IMRA 3N85H 4AYFA 2V2XA 3LQZA 2EDQA 2DMBA 2N59A 4NHCH 2R15A 1TZIA 2APSA 4JFQA 3RJQB 3S7GA 5EBWB 4YC2B 1A0QL 5E23A 2N7BA 2XBDA 3AXHA 4OLXL 4K7PY 3FCBA 2NTFB 3QDJB 4JLRA 3SBRA 5K33A 5T5FL 4ZOEA 1WBYA 4FEMA 4J3SA 1UEYA 3FT1A 1XR8B 3EJTA 1XGRA 4OGZA 3EGXB 3NPZB 1WC7B 1P1ZB 4CMMB 2IADB 1JHKL 2DQEL 2VJ0A 2LAAA 2CO4A 2DWEB 2GSIA 3L5WA 2X9WA 1LNUA 3HIZA 3MNMA 4FX5A 1BXXA 3EYOA 5C92A 3T6ZA 2OR9H 3BXNA 4UT9H 3H85A 4WEBH 1C5BH 1A1MB 1ZPUA 3ZW3A 4PUBL 2W65B 4EJ1C 1NCAH 4Y19E 3NRPA 2EVJA 3B56A 3VB8A 2AKRB 3KLDA 1B4RA 3AMLA 4TQIA 1M2OA 2UZYA 3PWNA 5D2NE 3TEXA 5B7MA 4M93B 3QW9A 4Q9CA 1RULH 3LKRA 4A7UA 1P69B 3HE6C 4OZGB 2Z8WC 5I28A 4MQTB 4LL1A 5LN4A 1SDYA 2V5RA 2J1WA 3I02A 3TJEH 2LR4A 1IAKB 4H8QA 1VGKB 5L88L 3FZUC 3V4UH 2QELA 4GAFB 1QFUL 3GXIA 3FT0A 4Z78A 1KYDA 5DRZA 1LDPH 1K4DB 1JI2A 5ALCL 3ZUNC 5AYQA 2V17H 2HLAB 3P9LA 1VACB 2CUAA 4JFFE 3ULSB 1LILA 1Q9LA 2F5BL 4I88A 2DMCA 2PCXA 4R4ND 5HI4D 5KUKA 2CPCA 4Y9EA 5E1AB 3A6CL 2BY0A 2R0ZH 1RL1A 1DR9A 2HX9A 1IBBA 5HD8C 5FYKH 1SBSL 5K59F 1DDTA 4N2EA 1P7KB 5IP4A 3O11A 4RAUB 4JB9L 4F9LC 3TNMA 1HL9A 1NFAA 1XH2A 1NFDE 1C1EL 4XP9L 4IYKA 2W88A 2ISDA 2YMTA 3RWDB 4WTZG 2OTUA 1C08A 4XI5D 2NW2B 2R4SL 4PJFE 1XWVA 1YYLH 2FEEI 1XAKA 4UTBH 1KELL 2W07B 2DQ6A 1IVLA 1P5UB 4JFOB 3WS6A 4GEIA 5E9AA 4YDMA 3ZYZA 1U8IA 1UA7A 3KPRA 2WHVA 3QDGB 5EU3A 4GH7B 4R26H 3MU3A 4L4VE 5A2JH 4MA8H 3KPRB 5DUPH 4XMKL 3INOA 3PS6A 3SQRA 4F7EA 5KVFH 1CYXA 3ZHLA 5D71H 2Z4QB 4ZO7A 2YD0A 1UD8A 3LDBC 1D9KD 1FHGA 1GVIA 3GTVA 4U1KA 4NZRL 1JWUA 1EFXD 1XL6A 3BIBX 3U82B 4LCIL 3V6ZB 5TK4A 4Z23A 5E08L 4AVJA 1XMEB 3H56A 4S1RL 5CILL 4FERA 1CD1B 1IFRA 4Y1AD 3E8UL 2EUWA 4WSJA 4LBEB 3IPBA 2CPUA 1BFOB 1OB0A 1E28B 4YBLC 2Y07H 4NQCD 1J10A 2VNCA 4OM1H 4U0RC 2VXQA 4JG1H 4MZ2A 3SZKC 1RPQA 2MQCA 4NQDE 1IAIH 2KMWA 3QUXC 4JGMA 4UIKL 3QULB 4RGOL 4XNDA 3KH3A 2YA1A 1Z9SB 3T3PF 4R7XA 3HB3D 1BD2E 8PAZA 3U36A 4KHTL 4ELMA 1MEXL 1QPXA 3OV6A 4P4KD 4PJ7E 1E5UI 4TNVF 3CVIL 4HHGA 4HV8B 4PJGB 2CK0L 2PKDA 5FAAA 2YAPA 4XTRD 3MRFA 4GQQA 3L48A 3NIFE 3OJDA 4JGJA 1DHKA 1MAMH 3ULUL 5FGSA 3IRZA 1BOYA 1NAKL 1OF2A 3GUFA 5F89A 4Q7DA 1E5ZA 3GHEH 5GQBA 4CW1B 4Y2DC 4AMXA 4G9FD 5CBEB 4XOCA 2WQ8A 1KFGA 3ARGB 4KO5A 2ZT9C 4HPOH 1DSFL 5JHDD 3ARGA 3DBXA 3NJFA 3OAZH 3AU1A 4N25A 5I18L 1OCRB 3PDOA 3TO4D 4AIXA 3GBML 1HSAB 1L9OA 5J11C 4PRPD 4OFDA 4M48L 2AQPA 4LDEB 3O6FD 4L29A 5LCVH 1ACYH 4V2BA 4JPIB 3BUDA 2PWGA 3HG5A 4XMKH 1G9EA 4KKCD 3W11C 4DT2A 5FDYA 2V7HA 2XWTB 5DJ0A 4PIBA 3KWWB 4PJAE 3C6LA 1NCCH 2VH5H 3EJPA 2XZAH 4LCWB 4J1UA 4LPUA 3WIHL 4HDIA 1BBJB 5E6SB 4NUQA 1SXSA 4Q74A 4PJCB 4KO9A 4NQEA 4JDEA 3NIDF 1MVUB 4UNTA 4YAQA 3SQOL 5GIRB 1PS3A 4HJIA 4DP7X 2IMMA 1PFOA 1QTYT 1T3FA 4YHZH 5BMFH 4I4WA 1N3NA 3ESNA 5FYJE 3E38A 3IKCA 3LZQA 4KRPD 2XRAL 2GIXA 4Y1AA 1NFDB 4JO3L 4DN3H 4EZLA 1KTRL 4Q56A 1LXMA 2CWRA 5HJDA 1EO7A 1GGUA 1RLWA 4NWUL 4JPKH 3RWFB 3SO3B 2HFTA 2C3XA 1NLDH 2Z64C 4NQCA 3RWFA 1QUNA 3N43F 3K1KC 1ZXQA 4DJMA 1XF5B 3HNVL 4S2SA 2FWLB 4H5SA 5KVEL 2ZNXA 2DEXX 3PF2A 4P5KA 4XH2A 4XP5H 5EC1A 2V5MA 4NQSB 3PAVA 2IF7A 1M57B 2C26A 2E74C 3BPLB 2ZYSA 1AZBA 3ISWA 4AW7A 1GRWA 4AQEA 5B38B 1WWCA 4WUUB 4KV5F 1XCWA 4L2YA 5EO1A 5JQ6L 3TEZA 3IETB 5TE4H 3RP1A 3NPSB 5B38A 1N64L 1EGJH 4LSUL 2PETA 4GS7B 3VAEA 1E27A 1U8KA 8FABA 3QORC 2Q76A 1NAMA 4PJ9C 3IGLA 4NPYB 3DGGA 2W59A 1P84K 1TFPA 3FUIA 4MCMA 2VSCA 1QFHA 1UATA 3LEYL 5GSRA 4YNYB 4LCIH 4ZFOA 1AQHA 3LRGA 3MX0A 1XAUA 4X8GA 2Y72A 4KI5D 1P4LA 5KAQF 3CVCA 2Y4SA 4PGBA 4IJ3C 4CC4C 3L95A 4X9GA 1VSCA 4MXWL 4P9ML 4WU5A 1JBJA 3IJHB 2W60A 3U0TA 5K5YA 2FYYA 2N1KA 3FTUA 3TBBA 1UH4A 1PU0A 1ZV2A 1JYVA 1BAFL 4LB8A 5C2BL 1CVSC 2JI1A 4RRPG 1GYAA 3ALWA 3N41F 3MGAA 3PGFH 4ZFFB 4XO5A 2XJKA 5FR3A 1AGCA 2PPDA 1WGVA 3UERA 3E2HB 2E5EA 1ET5A 4LFHG 3BKYH 4R5XA 4YK4B 1SMAA 5CINL 1AO7B 3MLYH 4NPKA 3QXDB 2ZX9A 1S7VB 4BQBA 5L7XL 3M6DA 4XNYH 2L7QA 4F8NA 4A1RA 1TJGH 1F6AB 2WYHA 1K72A 4NNPL 3REWA 2C1PB 5CJOL 4N28A 3UJTL 1RIUL 4RETB 1F6AA 1J11A 5E4IA 3V2AR 3VFNB 4KNUA 1J1XL 1WZ1L 2JB6A 2NY0D 4XBEL 1JNJA 2PWDA 3KVQA 3QIWB 4HQQH 3RTQC 3ZYIA 1SUHA 1CFSA 4MNGA 4LSVH 3T0EA 1NGQL 4N86A 4DN4L 3QUYD 4MS8C 4JR9L 3ZX1A 4OCSH 1EAJA 4K3DH 4LAQL 4OZFB 4I0PB 1TJIL 3RDTC 1JZIA 2ESVE 4LE8A 3WTTA 4JFPA 1XB6A 2I85A 3L2NA 4LNVA 3T2OA 1N6QL 4UZSA 2WLLA 3APNA 4NC2B 1U6AH 2YR3A 4LF3B 5CJXC 4FQCH 2E7LC 4J2XA 4I9XA 4X0NA 3FFDA 4P3WA 2WZPD 3Q6FA 1C5CH 4O2EB 4BQCA 4YDVA 1A5FH 1JGLH 4EDWL 3ZTNH 2CKNA 2Q7AA 4P59L 1AQDA 5AYUH 2PNDA 5HDOA 4D9LH 1OPGH 4RMRA 3LSOB 2AW2A 3WD5L 5K9JH 2AEPH 5FK9B 5EU4B 3FF7A 4HIIA 4LP5A 4OAWA 3QXWA 2O1AA 1F1GA 2JFCA 5L0QB 1PX3A 2VQTA 3O2DA 3VD0A 3MKKA 5JR1L 5I8CB 1U8QB 3H3KA 2VDML 2XI9A 4YSUA 2NZIA 1KEGH 3MCKB 3N50A 3E0GA 1RCYA 2DM3A 1FAKT 2GTZB 2Z31D 4ODTH 4UM9D 4AMKL 5DQDH 4IDJH 2XFGB 1I1FA 3D6GA 2DIEA 5I1EL 3BAIA 2HJLB 1HXYB 1E40A 4DZ8A 1NJ9B 1GC1H 4NKMB 3EG9A 1EA9C 3A22A 4BFOA 1NMAH 1WPCA 2B5IB 4W9CC 3EG9B 4DO5A 3D4ZA 4UQCA 5IFJA 3HI6L 3RLSA 1EQWA 2NX5A 1Z9OA 2BVQA 3DV4B 2IO5A 3PWVA 2J12B 5F7NC 4N2LA 4IHOA 4MDRA 4WTXA 5B1JA 3DV4A 2YD8A 4GMTH 3QG6A 3SCMA 1K5NB 3HAEA 4WKZB 4AYDC 3NCCB 2YD4A 5J13C 4TNWK 2P46B 1XIWA 2VGLM 3Q8BA 4GQRA 2YIHA 5D9SB 1TTAA 3U2IA 4F2ME 1INEL 2PCFB 5AZEH 3IDYC 3N1FC 4V1DE 3ARBD 1TZ8A 3VM5A 4X7TA 5IK3A 2O5YL 3FFCE 1QQDB 2B2XH 5ECJE 1AZUA 5A6IA 2VW6A 1JMXA 2ZAHA 1HNYA 1QFUH 4GG6A 4HT1H 4NKIL 2K9FB 1B88A 1D5MB 3FUFA 3L4ZA 4Q4IA 4ZX4A 1OAKH 1INEH 3AUWB 1WFOA 4MNHA 1BF5A 3QSKB 1L0PA 1G84A 4P5MB 1U2YA 5E1QA 4XPGH 4ODXA 4D9RD 3PU7A 3GPSA 4JL1A 2ITCB 3ZTJG 1KGCD 1OW0A 1A9BB 3Q01A 5AKRA 1KNOB 4D7PA 4WF7A 1BQHA 4WNQB 2QR0A 3CSFA 1BQLH 4G83A 5I0WA 1R0AH 3V0IA 2J88L 2F5AH 1JZ3A 2YGQA 5E5MB 1N5AA 3VWJB 4QRFA 1A6ZB 2WV3A 4L9LA 1TYRA 3HOGA 5DEZA 4PBWD 4LEEA 2ZUSA 4OBRA 3STZA 5DJDB 2BZCA 5ANHA 4AEIL 4DCQB 1Q9OB 3MV7A 4DFIA 1EJOH 2C34A 5JOFA 3HI1B 3STZB 4U1KB 1M2VB 1CGSL 2UVFA 4BH8B 3MV7B 1MW0A 3UYRH 1S3KH 2FX7L 4LEOB 1FVCB 2DRUA 4FLRA 5EUOE 3RAJL 4I8DA 3RQ3A 1A7NL 4BZ2L 4OCXL 4ADGA 3L9RA 3BGMB 3KMDA 1B2WH 5GISH 1QFWM 3EFDH 5TPWL 4OIBA 3FB7A 1G1KA 1AGBB 4MAUH 3MCYA 4LPTA 2BK8A 2XVBA 1QLEH 5DVLA 1FIGL 2UWEE 5I74C 1IMHC 3ARXA 3T4YB 4LLDA 1IM3D 2BW5A 2KYIA 3O2WL 3AXLA 1JHLH 4KAQH 1T7ZA 4D9LL 2GPZA 5C9KA 2P28B 1MCHA 3CDFA 3R7QA 1R5WB 4KRLB 4IKLA 3A6BH 2XWBA 1IM9A 1GGIL 2ZP9A 3PFUA 4PRHE 3C5SA 3N40P 4K3DL 4LAQH 2NX5D 2A0LC 3GPEA 1RSYA 4UIMA 3OF6A 2B16A 5F7DA 4Y88A 3WUWA 1ZVYA 3IJ9A 4N6QA 1JPEA 4P9HC 1EJOL 5I0XA 4LKCB 1CBJA 3B9KB 3JV6A 1K4CA 1DUZA 1IKFH 2UWEA 1E67A 2PW1A 2W8CA 2DJSA 2YKKA 2PO6C 4E9XA 4FNSA 2PP8A 1AI1L 4JDTL 2BNRE 1SM3H 2GQHA 3RIFK 3RAJH 2V3EA 2NR6A 3CZGA 3GC3A 1KPVA 4G6AD 4CW1A 2BP0A 3S2AA 4BD4A 2G2RA 4RA3A 4A66A 5ESVB 3ZSTA 4EUPG 1XF1A 2CDFA 3NIDB 1S7WB 3RGVA 1A6AA 3FDWA 2G2RB 5LBVA 4RGMB 2F8OA 3TO2A 3IGAA 3NVQA 4QXTB 4ZOAA 1P53A 4MHHG 2FUTA 3FRPB 5DWUH 3QXAA 3BHBA 3IMSA 1WAAE 1OW0C 4H1LH 3TA3B 3TEWA 1T04B 1MG2C 1U8PB 2TRHA 3DXAD 3L13A 1R33A 4WSKA 5D1QD 1IBGH 2FIKB 2VW4A 5FO2A 5F3FA 3ME0A 5ESQA 5KBDA 2P44B 1HOEA 2W65A 3P77A 1S9VB 2BP3A 4NJ9L 1FL6B 3K1DA 1GHFL 4MWFB 3P77B 5CS7A 1T66D 3E6HA 3Q1SH 4WI2A 2XN0A 1E90A 4JO4L 2YD3A 1WIPA 1XR9B 2TSBA 4B9IA 3MLXL 2X42A 4LARH 5DVOA 2B8OT 3UBXB 4XN9A 4MA7H 2NSXA 4B95C 3QT2A 1NFDA 4DKFH 3TYFA 1NGXB 1EZUA 1F0LA 1T1XA 3D39A 2CLVA 3TBYB 1YYML 4F57L 4N90D 3WS3B 1WFUA 3BWUF 3TYFB 2EDRA 2EXWD 4GW4B 2EYSB 1I3GH 3L4YA 1I7TB 1FRGH 1OGAB 3ZL4L 1FGNH 2ED8A 5FV2A 1V27A 4KQ3H 1JF1A 1XF5A 2EP6A 2JJTA 1DVFA 4WWOA 2GUOA 4JRXD 5D1XE 4UQ3B 4OCMC 3TBSA 1G7QB 2HTKC 4K2UH 1OCZB 1NLDL 1B4TA 4B50A 1MWAL 1NBQA 3TC9A 2J8UB 2NCEA 4DP0X 2R8SL 1OOWA 3IGFA 4K7PX 1TZOA 2VLRB 3ZSSA 1AYRA 4WU7B 1CDUA 1GJIA 2O5XH 2WXPA 3FOLA 5INCB 3EO0A 2BVYA 4KMTH 1BM3L 3G6JF 1NEPA 3FOLB 5F9DC 3NSJA 4WFHD 2DAVA 2AI0L 1I9RH 1UQSB 1FZMB 2FJSA 1A6PA 3VFTB 1H19A 4OJAA 5GJTL 5D1ZI 1PG7X 1DJZA 3F85A 3RA7L 4YR6B 3ZZLA 4ZD3H 5LNGA 3S98A 1YA5A 3ZT7A 3Q48A 4N0CC 1L7TH 1ZKAA 1S5HB 1CG9B 2LLLA 4UOQA 4PG2A 3KE0A 4PGBB 4D94A 4FXKC 4YHLH 4H0GA 4K94L 4TN9A 5EZLB 2Z0BA 4QHNA 1DYZA 4CSTA 1YPZE 1X5JA 1IGYA 4WSGA 3C9NA 2R9HC 3FT4A 3UPRB 5BVJB 4ZQKA 2AABL 4QDGA 2ICEC 1PCXA 4G82A 5KYUA 2FBJH 4D7BA 1PAMA 5BVJA 5B3JF 3W2DL 4Z7QE 5CIPH 4G6KH 5KVFL 2WLNA 4N20A 2DYSB 2QHRL 3DX3A 1A1NA 4XVJH 3GS4A 1WT5A 2JWYA 3SE4C 1ES0B 5E2TL 4IRSC 2MPVA 4IKJA 2EAEA 3P4MB 5HHQB 2B5IC 5LGYA 2XG4B 3M1BB 4XP4H 2ZKXA 3DX7A 1CE6B 1CGVA 4BFEA 1XTMA 5IQ7L 1MCSA 3MO1B 4W6XB 5E8EB 3G5ZB 1B4LA 3KLHD 3WEMA 4HW6A 3IDUA 2A74A 4CN1A 4BH7A 1PTZA 2ZXBA 3MXVL 4HOWA 2VO8A 2WXQA 1A6TA 2PTUA 4X0KB 4TUJA 2DOCA 3M46A 2WXFA 5BUPA 4ETYA 1CMOA 5CF3A 1E2ZA 3NIGB 3RFZB 1UWGL 5E6IA 2IG2L 5IB2B 3BAEH 2ZD0A 1O6SA 4OI9A 2X4NA 3HLAA 4YHMH 5J0BA 5F7YC 1MFEH 4PRNA 1QATA 4LSQH 2EDYA 1NEZG 5AUMB 4FHBD 4YDVB 5LXGH 5DK0B 1EDHA 4GBXC 4NLHA 1J9TA 5FLVA 3BUYB 4JG1L 1XBRA 1J12A 2X12A 4MDIA 5IUSA 3GJFA 4UAOC 4G8GE 4DGVH 3DKHA 4L8SA 4NO3B 4HUMB 3KPSA 4ODWA 1NIBA 4JFEA 3NBNA 5D5MA 4J1UB 5BNXD 3TN0C 5G5DB 4KRPC 1VGEH 1JSYA 4N0YH 2W0KA 3LHPH 1GGBL 1ILUA 2JKNA 2M1KA 2VLME 4R7DB 4L23A 5C0AD 1EEYA 3SQBA 1CFBA 2GK2A 3H42H 3VFVB 4BSWA 4EKXA 1F4YL 4NN5B 5D1ZC 5GHWH 1DL7H 3MRNB 5H37H 4HUWA 2IAMD 2I5YL 4AL8C 2JV6A 4FXGB 2OV0A 1U42A 1E7UA 1LO3L 2D7TH 4PS3A 3ZMRA 4KJPD 4OF6A 5A6LA 3Q6GL 5L9DH 2IDTA 1EZVY 5FUOH 4BQ6A 4L8BA 2X4SB 5EEWA 3CDZA 1KXQA 4HHAA 4Y0GA 3WU1A 4N2MA 2J6EA 3MGTB 4W9KC 3V6OE 1YEIL 1HQ4B 5FHBH 4ZUTB 2ALWA 4UTAH 4G1EB 5DD0H 2NNAB 3W5MA 3F58H 1KYOK 3MV9A 3ZKXC 2M2DA 4X98B 5TF1H 2NY3B 1ASPA 4UQ2A 1CE1H 1HHIB 5BO1L 1SJXA 4HLJA 5C0EB 5DD6B 4HAGA 2QL1A 2GJ6E 2JQAA 4AG4H 4DOHE 5DHYB 5AVSB 3MFFA 2A77H 1MCLA 4CN6A 3OKYA 3ZYOA 1K6QL 1ZWIA 1P6FA 2IBZX 1B90A 2VZ3A 1LK3H 3BKMH 6PAZA 3DSNB 4OV5A 4UQEA 1IO4C 3JWOL 4MJIB 4Z7WF 1FN4A 2Q76B 1MJ8H 4TULH 3SGEI 1S7TA 1DEDA 1FN4B 3FMGL 4LPYA 4K7FB 5E5MA 4JK0D 4XP4L 4Y4HD 2OXHB 1DDHA 4KJYA 1AD9B 2ADJB 4M3KB 4I2XB 3TPUB 1P9MA 2HT3C 2Y1VA 4BIKA 1SVCP 2DD8H 2GT9A 2NXYC 2QPFA 4DCQA 1F00I 5JOFB 1AGEA 2BW4A 2QSVA 3QUXD 4NEHB 3DSFL 1I1AD 5IBUB 4G8FB 1A4KA 2AK4A 5KAQG 1J5OH 1EZVX 3MBXL 3VG0H 1QLRB 3FSZA 1KTLB 5B39B 3GI9H 1TU2A 1QPPA 1W6LA 4NQXA 3KPSD 5IR1A 1UWGH 5A2AA 3TA3D 1LO2H 4JUTA 5T3ZL 1ZSDB 4ONFL 5D93B 3MRBB 2YC1A 2FEJA 4NZDA 4JZOB 1VCAA 4P48A 4XP6L 5EEZA 4IOFC 1YECH 4M3JA 4PJBA 3QJUB 1U8HB 3BJ91 4DP6X 2APBA 3Q3GB 4KHTH 2WZ6A 4X42A 3FYEB 1J0KA 1DZBA 1HXKA 2H32A 4P2AA 2HXAA 5SX5H 2ZPKH 3H6AA 1XCTA 4I18B 3K6SA 3ISYA 2ZF9A 2FJFB 4G1MB 2BNQD 5T5NF 3VGFA 4P3CH 4AM0B 3LZLA 5F6IB 3V0VA 4C55A 3R8BB 3D85D 1FDLL 4NAQA 5EIIA 1CFSB 3DX9A 4Y4FC 1X5AA 3KPNA 4JY4B 3TF4A 4A7SA 2E75C 2JKSA 4UQDA 2FT8A 3B8SA 3BAEL 3ML8A 1PIGA 4TTDC 5GRUH 4DTGH 1OM9A 4YHYB 3IJSB 3BVNB 1HOCA 1EAPA 4FLSA 5GS2H 3VW3L 2OK0H 2NZ9C 1FF5A 1YEEL 2O5YH 1G9NH 1GPOH 2DYPB 4U1NB 4HF5L 4HLEA 3K6OA 2RAMA 3MRMB 2BH0A 2WGNB 5F96H 1TUPA 3ZE1B 1DBJL 3U0WL 1WFTA 3BDYH 2OTWB 3LKNB 1UFUA 3K2IA 3TU6A 3F12B 3A0OA 1AI1H 4JDTH 3KL5A 4C57C 1UCBH 4U1HB 1IV8A 4HXBH 2ZYHA 1Z32X 1NMCB 3OZLA 2OMUB 1CQYA 1PL3A 4RMSA 3HG0A 5CINH 3NMEA 3GM8A 5AZ2L 1K9TA 1BFSA 3GF8A 3HEIB 1O5DT 1WIOA 3KBHE 4JFHD 2I60H 4JPVH 5DEFB 4RVBA 5DK2B 3NN8A 3AREA 3LOWA 2E0PA 1YEGL 1TVBB 2C8NA 4ATTA 2ZWSA 3AY4C 4FI7A 2B14A 3I6LD 5DUBA 1IKNC 1NDMA 1TSRA 3ECQA 1IKNA 1XEUA 2CGZA 1DBKL 1NJ9A 2ZIDA 5DVNA 4PV9B 1SRDA 2X2IA 2MNUA 2MCPL 4NZ8A 4FQ1L 5FCUL 3QDMA 5E8DL 2Q10A 4JAMB 3B43A 1V10A 3T0BA 5FC9A 1ZIAA 4UV4H 1CFNB 2B15A 2IDFA 4M6OH 3GMOB 2G9KA 5GRZA 4B53A 2IOMA 3QUZB 2QVIA 4UNIA 3CFCL 2OMZB 2WLMA 5GGTH 4JJOA 4P2OD 5DF0A 3VI4B 3LS4H 3ARDB 1JTTA 4F7MB 3Q2VA 5FW8A 1FDLH 3MMEB 4F33A 1X7SA 4X6DE 2OMXB 3IJ8A 2ADGB 3HI6H 3VSUA 5KW9L 5L8LB 3VACA 5DS8B 1PNCA 3H2WA 1D6EB 3SDDB 5C9JB 3CMOH 3N91A 4UOW1 5J3HD 4MLSA 5CGTA 3IMUA 3KLSA 5DS1A 3BP5B 5C0IA 2R1XA 4PRDB 4RRPA 3F64A 1RZKC 1KJ2B 2YN3A 2OX5A 2R27A 4LOUD 3DYPA 1YEJH 4MA3A 4OGAC 1DBJH 1S7QA 3CMOL 1RU9H 4CJ1A 3ILPA 5DTFB 2ITCA 5CP3A 4Y1AE 1RIHL 4AGOA 4ZJ9A 3ULUD 3CJJA 1X5XA 4HVBA 1ZOXA 4OLXH 1BZEA 1MQ8A 3DSFH 5FFLA 2OMNA 5DDHB 3H4HA 3L7EB 3DHPA 3ISRA 1QHPA 1DVUA 5C0AB 5HHPA 2YWZA 4X6FB 3WNPA 2DTSA 2F7RA 3C2SA 4K3JL 3AQZA 4Y4HC 2XTJB 4XPGL 4NWTH 1MHPL 5I15L 3VSQA 3QUKA 4EKJA 3WEXB 5I1JL 1X7QB 3FFCA 2BXYA 2E27L 3SJVB 4F91B 4HUXA 5IJDC 2XN9B 1RMFH 1L0YA 3UIYA 3BD3A 2XC8A 4LOEA 4HFUL 3CNKA 5C09E 1KTCA 5FO9A 5IHUL 3QWRD 2JKRM 5ADOH 5CJBA 3VGAB 4AH2A 3WKNA 3IDXL 5T1JA 1T22B 1URIA 3A4AA 3MDJA 3SYOA 4CAGA 3GSVA 5BZWA 1EDYA 3VXNA 5I1HH 3UAJA 4AKPA 1N0LA 3HC4L 4L3EE 5CZRA 3NA9L 3A4FA 3OAZK 1QYGH 4NPJA 2QKSA 4XNQB 1MFVA 3ROOA 1JPGA 1ZD6A 2DEYX 4NRZB 1J5IA 4U1JB 1AXSA 1FVEB 3GIZL 3L4VA 1SJMA 2A6JA 2XG4A 3M1BA 3QEUA 4FL4C 4PG2C 5F7KC 3IDGB 4UOJA 5LBSH 4Y2DB 4AGQA 1UOVA 4BKTC 2BVEA 4HYTB 1U91B 3LAFA 3KAAA 2WSKA 2E7BA 4UBDD 4AT6B 3ULVC 2D7QA 4P2OA 2PO6A 4ZDHB 2P5ED 1MWAB 4AT6A 2KPNA 1I9IL 3M1CA 1MHPH 2VLKB 5AB1A 1ML0A 5F6HJ 2YEQA 3JYCA 4FKEA 4C4KO 5BOZG 2WBWB 4MJID 5JPNC 5KSAA 5C7ZA 4HWEH 1VEOA 2EIDA 4QF1A 1T89C 3BQUC 3DOHA 4HFUH 3QUGA 4P46B 1O6SB 3O9WD 3PWJB 5FECA 5CN1A 2X4RA 4B9CA 5IHWA 1MSPA 1T0PB 3GS7A 3NFSH 5KN5A 3L1OL 2I9LA 4PG9B 3T1FA 3VFGH 3WFEH 1DQQB 1X44A 3MUHL 4RGND 2NXZD 1NKOA 3Q5OA 1G7HB 4LSSL 5EO9B 1BVKB 1DQQA 4GRWH 4X6BA 2C9SA 2ERJC 4BUHA 1CK0H 1FNEA 4YE4L 4YQXL 1OT1A 3IVKB 1E9OA 4I0CC 4H0HB 3U7WH 4OCNC 1CLZL 2QGEA 2Y2YA 3SOBH 5AW0B 4L4TA 2LTQC 2P24A 1NMAL 5KWYC 2WUCH 2MNWA 4TVUA 4L3CB 4Y9CA 4BSWB 1CU4L 3H53A 3TWCH 5BS0A 1FV1B 4L3EA 2YPVH 1QABA 2W38A 4XP1H 1VPOL 2X2JA 4IGBC 3GSNA 4FHKA 4MJ6B 4UDUB 1NZRA 2QSQA 4BA8A 3LS4L 5C0JA 5IHZB 2FX9H 1RUKH 1BQHG 1FZOB 3OAUL 5IQ9B 2CO3A 4NC1E 4X50A 1UXMA 2GY5A 3V0FA 2X6BA 1RPKA 1CT8A 3NIGF 2GKIA 4FTDA 1TJXA 5AZEL 5ISZA 4CU7A 4Z7NE 5LDSA 4K9EC 3MGTA 2VQ1B 3OPZH 4X7FC 4P4KC 5ISZB 4ZUTA 2HJKB 2OSLB 3FT2A 5DYOA 5JW4Q 2ZOTA 3MRKA 4DNLA 2P7TA 1G5GA 4LK4A 3CXDH 5IQOA 4E9LA 4KNSA 1L3WA 1T0NB 2HFFA 3MBWB 4QHKJ 3KPMB 1G6VK 2VAJA 3LKQB 3LKSB 5TJWK 3WGVB 3M88A 1NIAA 2XKNA 3QJHA 4RCAA 2DQIH 5C0CB 4XAWH 5ETUA 5JQHC 5TDNB 5BQ7A 4Z3TA 2XKNB 4BFFA 2NYYC 4R3SB 3OG4B 1UM4H 5DJ8A 1S9WB 2GJRA 3HHSB 1SPDA 3CDGA 3FUMA 3QARA 3VNYA 3X1FA 5DJ8B 1MCBA 1OE3A 1THAA 1KC5H 4ZPTB 3ARTA 4CGUB 3RZWA 1B6UA 4IOSA 4MJIA 1UZ8B 1CFQA 1BV8A 3IBOA 1X5YA 5FYLD 1QRNB 4F9PC 3ZHNA 1N5YH 1CFQB 4MA1B 3IDJB 4IBYA 3HZYB 2IGLA 1O5PA 2ADJA 3C5ZA 3IK2A 4AI7A 4O5LL 4NS0A 5I8EB 4KUZL 1JWSA 1Q1PA 4OJEH 5FA4B 1F90H 2K6YA 3UFIA 2F08A 3LXAA 1DE4B 2ICEA 3FT9A 3J2PA 4IRZA 4WZ9A 4B3VA 4GRWF 3C9NB 2B1AL 1DE4A 3FT4B 3IJHA 4ZQKB 4EUPH 3JT0A 2X4TA 2EICA 5LAXA 4XZUA 1WZMA 2DQTL 4KRPB 3KPQA 3QUMB 2BIIA 1I9JL 5IMMA 1HXMB 2FZ3A 1MWAH 1LDSA 3W9EB 3X3GH 1WBXA 5IVXA 2RQEA 4LL4A 5EBGA 1CUOA 4F15B 1OAXH 3QZPA 1IGJB 2YRPA 3CCHA 4LLVA 4P3DB 2RFXA 3WFBL 4AM0A 5JIHA 5A43C 2BIOA 4QTHA 2L0DA 1F4XH 1OSZA 5IBTH 2VUYA 3RVWD 1JMZA 1AH1A 4K71C 1KV3A 4BSJA 4P5TB 1A6WL 5TF0A 5CAYB 1QKZH 3F58L 5J1SC 1XXDC 2WBJA 1W16A 4G8EB 1UOLA 4UBDC 2YO3A 4QHKI 5DEGA 4AZUA 1J1OL 1KPUA 4HIIB 1PVHA 3WFDL 5CZXD 4D0BB 1LO4H 4I77H 1GCYA 5T1MA 3UJIH 4JO4H 1B0IA 2J8OA 4GFXA 2YGNA 4M7LH 5CGMA 2VN6A 1W0VA 4WI3A 2V0AA 2K3HA 3S88L 5C86A 4YXLH 3O8XD 4F93B 5D1XC 3SDAC 1CD8A 3QHZL 4KTEH 5HYEA 1SLXA 3EYVB 4G6KL 5LGJB 4GAGH 1HC1A 1UCTA 2ITFA 1I8MA 1AXTH 3UJJL 3EYVA 2X7LA 3U30C 1NWPA 2X0WA 3X12B 2O72A 4BGDA 3PWUB 5D8JH 3O45B 1HAUA 1HE7A 4JM2C 1QBAA 4KTDH 5BRZD 1ASQA 2BVPA 1J48A 4J3OD 2ZWLT 4B27A 2W0FB 4CADA 4YLBA 2J8HA 2HLEB 3DURB 1NCAL 5KVMC 3MBED 4BXVA 1RZGA 1WH0A 1ZY9A 5D6DC 5C3LD 5DUBB 2GJZB 1BZ9A 1EEYB 2PWFA 3EAKA 3S5LB 4OY9A 3SQBB 5I19L 2P5WE 3PREA 1OD7A 3MREA 2FTAA 4PWIA 3DOSA 2FSEB 2BNQE 4JAMA 1MFBH 1KGIA 2DM7A 2E4TA 3HBGA 4OCWH 3NK3A 5K9QG 1TJIH 5T3ZH 4HKXA 3LN5A 1QBMH 3AMKA 1ADQH 3OAYK 1T6WA 2XPYA 3IAGC 3G04B 1EFXA 4UT6A 1KCLA 2CJ3A 2VMDA 1J9CT 1NGWA 5IFAL 4HUVA 1JXGA 5C07E 5JZ7D 5C07B 4G43A 2NUTB 1D5ZA 1MIEL 1BPLB 3BSZH 4LPWA 4UUJA 2H1XA 4PY8I 5KBMA 4Z8FL 1PLGL 5HJ3B 4Z76A 1SOXA 2PPEA 3L3HA 1V54B 2Z6FA 2JNZA 3AG3B 1MG3C 3RUGA 2DQDL 3TBCA 1R3IH 5AAWC 2Q7YB 4GLRI 4PLOB 3RE0A 5E8NA 4D9QD 3F5WA 2JCCF 3EOBB 4IBLT 2NY4B 4ZNEA 1A7OL 1YJDL 4J3VA 2YA2A 4DVBA 4J4PA 4RGNB 1JOIA 3NJGA 4LGPB 4P5MA 4XVJL 3MRRB 1Q0XH 3D4YA 1EV2E 2DWTA 3D0VB 2ITDA 2YUXA 1A9BA 3F04A 4XI5C 2IH3B 1V05A 1BZ7A 4NFDA 4KK5D 2VZTA 5J4MA 4C56E 5JDJA 1UENA 2X4UB 3CVDA 1BZ7B 2H5UA 4AGNA 2IQAB 1GW6A 2WOYA 3X13A 5A7EA 5TGBB 2IANB 3HBPA 4HKZA 2WYIA 5TGBA 1A2YB 1RKRA 1U36A 1ZLDA 4DGWC 1KZYA 2H9GA 2NY2C 5CD3B 1M2VA 2A4CA 1BQLL 5L4IA 3WN5C 1RUML 2H3KA 2BZDA 2ERJB 4IRJB 3V4PA 1NIDA 4KQ0A 3MBEB 4M61A 5FKAA 2LLGA 4BUQA 4KX9A 3QCTL 2Q8BH 4I13B 3MBEA 3QUYC 3DRQA 1U3ZA 2LTQB 3AT9A 3RNQB 1AMXA 2XX1A 1PSKH 4XO4A 3OBAA 2FQEA 1HQRA 3OKNB 5E2UH 5CSBA 2B9BA 3QH3A 3U6RA 1SLVA 1MLBB 3K91A 3QZBA 4TNVK 1I7RB 3CLWA 5LCVL 4YSQA 3HCVA 2PABA 4Y2OB 3QUZC 4DGVL 1RUQH 3X2QB 3H3PL 4XBMA 2DQGH 4NGHH 3FSVA 4J6RH 3O0RL 3REVA 3V55A 1A14H 5K9OA 4IMKC 3REVB 5K1NA 1H3XA 2W91A 4ORGB 4N2OA 1FE8H 3TO2B 2X28A 3OWRA 4GNKB 1SHXA 1PKQA 3CZFB 1KCKA 2VR9A 1GGIH 3QXAB 5EMYA 3L5XL 3IRCA 4WW1A 1JZHA 2P48B 4ZSOE 3EYOB 4NBXB 2WLZA 3RURA 4WCYH 1VADB 1L7IH 4P2RD 5HHXH 3U9PL 4AUYA 4A7VA 3NEEA 4BFIB 4MQ7A 4TTGA 3S37H 3MYJA 1TJMA 1WF5A 2BSTB 5IROA 5IW6A 2N4IA 4C4BA 1IX2A 1G7IA 3EIFA 3I6GA 4R2GD 3AGVA 5D2LB 2VLRD 1EVUA 2A9CA 4LCCB 4NJAL 1FO0A 5DK3A 3JBG7 5EU7E 1OGSA 3AREB 1NMBL 1T20B 1XVSA 1YMMB 2F58L 3D0LA 2HRPH 1IEAA 1ZLWK 3WIIH 4K3JH 5FWQA 2JJVA 4I87A 5DXWA 1CS6A 2IDUA 5DRZB 2V8MA 4EDWH 2FK9A 2O6CA 2ZOKA 3RRQA 7PCYA 3MJ6A 3PJSB 2G75B 2BNRD 1H9VA 5IVXF 3T3PB 5GS0C 1WAPA 3L5HA 5GS1B 2ZOKB 3MV8E 4UDUA 3ZE2E 2ZX7A 2BO0A 3CN4A 2CCVA 2EEXA 3HLKA 2HG5B 4U1SB 2H0PA 3SDXA 4AQAA 4F24A 3RWHA 4NKDA 2R2EA 5D1XA 5FS5A 2Z35B 1BDYA 2I7SA 1TPXC 3U46A 2ARWA 5IFHH 1LQBC 2YQ2A 4HK3J 4O02A 4OJDH 4WK0B 1DBBH 1UT1A 5DLMH 1JZJA 3LB6C 1AKPA 4R90L 5HJGA 2QTEA 2VZSA 1DN2A 1UUSA 1OEZW 4NOBA 4Z7AA 4NKOB 3SE3A 1CICD 1XO8A 3OLEA 3L16A 5IGXL 1UM6L 2HAZA 4EO5A 4N2FA 4G7RB 1D6EA 5EZIL 3SDDA 1AE6L 5AVRB 1YVLA 3CFMA 4Y4KD 5FYLH 5MEOB 1UD6A 5ITBL 3ROLA 2PLTA 2YD1A 4XN8A 5JYMA 3DIVA 5C0RH 4FFYL 4WUKH 4MCNA 2FJUB 3HHSA 4KRNA 3CLEL 3ROLB 1NSNH 2GEEA 2QGDA 3SE8H 4D3CH 5IVXB 3BX7C 3QDJE 5DQJB 2VDKB 3OG6B 4WU7A 1OAYL 2GK0A 2F5BH 1UZ8A 4MCYB 4Q8BA 4MMZA 4BRJA 1QEWB 1UZGA 2E6JA 3MJ9L 4LSRH 1A7RL 3STBA 3QEGL 2FJGB 1FYTE 2OMTB 4ZFZA 3ZHKA 4RX4A 1LTXA 4X5XB 1TKWA 1YEJL 4PJXA 4E9YA 1NWOA 4YR6A 3UPAA 4N5EC 4YDLC 3W38A 1J5OL 3EADA 1IGCH 1E3FA 1I3RB 1E28A 1CGTA 2N0MA 3QPXL 4PB0L 3VX0A 1O7DC 3F83A 1A7RH 4ZXBB 3TH2T 3LNHA 3K71B 2BJML 5FUCC 1OAUL 3GZOA 5L6YH 1TCRA 2VR4A 5KW9H 5TE6L 3G5YB 5EORH 1N59A 4AM0Q 1CDGA 2X3BA 1Y0LB 5GRWA 2R0KH 3VGHA 1BJ1H 3PE9A 1XT5A 4GXVH 1VDGA 3NH7L 4HKBA 1H6UA 4JO5A 5T1KB 1KXTB 4M43H 3V5HB 1TCMA 2NQCA 3CQQA 3OKLA 2Z31A 3PAUA 4UM9A 1OAKL 2WNKA 5AWNL 3UTSA 5B7FA 1HYSD 3Q0HA 2EXWC 3NG5A 3WV0A 1UD3A 3OB0H 3QO0B 1AJ7H 5JPMA 5IHUH 3CX5K 2ESVD 2IALB 2OL3B 4ZAKC 5IGXH 5KVDL 1B2WL 4RESB 5GISL 1NPNA 4DTGL 5LJYH 4HD5A 5F7LB 2NY4D 3NCBB 4JN1L 4G6JH 2VLLA 4N2HA 3OJMB 4TSCH 2DLFL 3QQ9C 3MRDB 1UM5L 1IBGL 1MWAA 4DERA 4GW1B 3KLHC 2YBRA 4GAJH 2OSYA 1JFQH 2DM2A 5I17B 3BP4A 3QUHA 1CICA 2A74B 1V3LA 2NXZC 5ACZA 4FFYH 4WUKL 2G2NA 3HNSL 3OC8A 3BP4B 3BWUC 2ZKHH 4IKNA 5EOCL 5JMOC 3SDDD 4F2MA 5SWZB 1LD9A 2FH8A 4MB1A 1Q9WA 1UCBL 5EEXA 3LXBA 2AFNA 3B5TA 1RZKH 3NJHA 1S8DB 5JUEH 5HGBB 1O7VA 3S34L 4ZTPH 3KJ4C 3MRLB 4Y5YC 3IFNL 4Y5YA 1I8MB 2DY2A 1EX0A 1WTLA 2WXKA 3F6JA 3BEVB 3KBFA 5I1DB 1NCCL 2VH5L 2CJTA 3IFPB 3GZQA 2VC2L 2F54E 2DBLH 2A6IA 5C6TL 2DKMA 5I5IA 4HKJB 4UILL 3DWTA 4HIXH 1QFWH 3B2DC 2BJMH 3QZWB 5AW4B 5BOPA 4H2AA 5L6YL 1H0DB 3CH1B 4XN2A 4C58B 4GYBA 1G7LB 2AXGA 3A21A 3KXFD 4HGWB 1KFAH 1LJMA 4KK5C 2CA4A 3BFOA 1KXHA 3MLZH 3V9FA 4NO5B 2W5PA 2C9AA 1XEDA 3HN3A 4W9DC 1AAJA 1L9RA 3BZ4A 3UAFA 4N1HB 3DJZA 5EC1B 3V52L 1KG0B 1J05B 3I9GL 3WDHA 2I07A 2HH0L 2V7NB 3TT3H 4LPXA 4AX3A 1MI5D 4X7DC 3JV5A 1J05A 1H8OA 3ZR6A 4H5SB 3RU8L 4LHQB 4OF0A 4FTVD 5EZIH 3UDWA 3WNKA 3WOVA 1OP3K 1DBML 2ZOWA 1MHHA 4FYQA 3ILQC 1REIA 3CVHH 4HIQA 3QPXH 2IDCA 1E27B 1U8KB 8FABB 5G2NA 2H6OA 3DHUA 4ZTEA 4Y5VC 4Z76B 1Z0MA 3NCWA 3NFNB 3DTXA 4QHLB 4KDTC 4I3RH 1XF3B 3LKSA 1ZHLA 2DYPD 1R19A 1A25A 3ARYA 1JGDB 4NIKB 3GZPA 3O4LB 3TONA 1GOHA 1ZHLB 4U3HA 3DVNA 4NRXB 5IW3A 4F3FA 3H7BA 2UX7A 2XTSA 1S9WA 1IEBB 4K71B 1SHSA 4NWUH 3VGGA 4YNYA 3O2DH 1OT4A 5IW1B 2Y5TA 1EHLL 4WTWA 4KXAA 4G6ML 1RLBA 2GI7A 4HISA 5HBBA 1F13A 2D0GA 2HYMA 4Q4EA 4TLKA 4PVNA 3GSWA 2CU9A 3V5KB 4PV8B 1DQKA 2VQ4A 4HWUA 4L2LA 3B4NA 3TT1L 4ICWA 4ELKB 1A6VH 3K2KA 4LASH 2VM4A 3MPCA 1GYUA 4N87A 4QWWC 5IQNA 3UTSE 4RMUA 1XX9C 4S0TD 2AJYH 4C4UA 3B3IA 3E2HC 1MCJA 1IAII 1RERA 4KUCF 2EABA 4OQTH 2A5UA 2VWEE 2Z0UA 5D7KE 1U2CA 3S3JA 3WHE1 1ZHBA 3PIQA 5MENB 5IWLA 2PR4H 3UTTD 2OMYB 1QZNA 5GJTH 5KSVB 2IAMC 1JP5A 2H8PA 4KMLB 5IR1B 1CE1L 1MAJA 5L4MA 2XWJA 1PDKA 2EE2A 2FWOA 1QBBA 4JRYA 1Z5YD 1QWNA 3MOBH 2Q2EB 3AACA 3ULUE 3GIZH 1OCOB 1DSFH 1QRND 1V7MH 3CIQA 1DVTA 4WW2C 3F3HA 1NC2B 3QP3A 3NABL 1ADWA 4IJTA 3II1A 4BFKA 4CL7A 2OYPA 1N0XH 1Q0XL 3CUPA 4QRAA 3JVFC 2GBUA 4B5EA 4PRID 1JDDA 1T66C 1HHGB 2DLGA 5HVHB 2WBJC 3GMPA 2MCG1 4EMZA 2FJHB 3BO8B 3MV8D 2DW5A 3EJYC 2EH8H 2QGCA 4N0YL 1A47A 1KBPA 1UFGA 4R6UA 5C97A 4QEGA 3CZFA 3BPOB 3H42L 5DJXB 1L9PA 4XXDB 1HKLH 3UIZA 1RUQL 1BCIA 3MUJA 5E6ZA 1H8NA 3QJTB 2IH9A 2PYED 4HIJA 4TNWF 4XP5L 3BH4A 5EWIH 3HG4A 3OHXA 1T6BX 3BJLA 3OR6B 2GTZA 4P59H 5E9DE 3F01A 2X4PA 5IB4A 5DURD 3M1OA 1D7CA 3MCKA 3LS5L 5TDPA 5LGJA 3FU8A 4LU5L 4OKDA 1WGOA 2AJSH 4NM8H 5JPMC 1LWHA 2DWYA 1SZNA 1I1FB 1N7MH 3GXDA 1SY6H 5JDSB 3ML9A 4PRHB 1URZA 3ERXA 3D52A 3O45A 1FO0B 2RB8A 1QAWA 3B9AA 5GS3A 1I1AC 2XWEA 4YHML 2FGZA 3ZHFA 1J0ZA 1QO3B 5KYXB 4Z7QF 2OR7A 5TF1L 2VLJA 5J13B 3HAEB 4WKZA 1A22B 1KLFB 1YUKB 3HE7C 2Q3AA 3WFHA 3QDGD 4WAFA 3S5YA 1GZQB 1ND0B 1KBKA 4IMLA 1WZ1H 3AROA 2Q20A 1DN0A 1JDAA 2GVYA 3TBVA 3ABKB 2G60L 4NERA 2P5WB 3IFLH 4XAKE 5MP6H 2UYLB 1PEZA 5CLZA 1RULL 5LG6A 3IWUA 3T6VA 1LMKA 1J1PH 4ZXBD 5E1AA 2CH8A 4YMPA 4KKBD 2O5XL 1ORQA 4NKDB 3WKQA 1IQDB 5I6NA 4XP9H 2V2TB 4XMUA 2N0KA 4UANA 4OSUH 3BP5A 5C0IB 3VI3E 1TVHA 1UA3A 1KCRL 1W6WA 2Z65C 3LRLA 5BRPA 3VD9A 2P8PA 2R29A 1G7MB 3AT0A 5MEQA 2O93L 4ACPA 1C8QA 1F4YH 4A2HA 3BVDB 4NKOA 15C8L 4G7VL 3TN0D 4WQOA 5LLIC 2H7WA 1DEEA 4GAGL 5AAMC 3KPPA