4F1ZA

Crystal structures reveal the multi-ligand binding mechanism of the staphylococcus aureus clfb
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
322
structure length
322
Chain Sequence
AKGTNVNDKVTASDFKLEKTAFDPNQSGNTFMAANFKVTGQVKSGDYFTAKLPDSVTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDILTKTYTFVFTDYVNDKENINGQFSLPLFTDRAKAPKSGTYDANINIADEMFDNKITYNYSSPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEESSGKVSATDTKLRIFEVNDTSKLSDSYYADPNDSNLKEVTGEFKDKISYKYDNVASINFGDINKTYVVLVEGHYDNTGKNLKTQVIQENIDPATGKDYSIFGWNNENVVRYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Clumping factor B
publication title Crystal Structures Reveal the Multi-Ligand Binding Mechanism of Staphylococcus aureus ClfB
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion
total genus 74
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f1zA01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f1zA02
3IRZA 3V10A 1R19A 4F24A 2RALA 4JDZA 5CFAA 2Y7MA 4FJ6A 5CF3A 2F68X 4B60A 5IHWA 1R17A 4LEEA 4MBOA 4JDZB 4B5ZA 2Y7LA 4LE8A 2YLHA 4Q6KA 4RMBA 2Y7NA 4F1ZA 2Y7OA 4BBWA 1N67A 2VR3A 3IS1X 3AT0A 4LEBA 3IS0X 3AU0A 4MBRA 2Z1PA 3IRPX 2F6AA 4F20A 4JE0A 3ASWA 4F27A
chains in the Genus database with same CATH superfamily
3I9PA 3W39B 1UM4L 3P4LA 1ZE3H 2RA1A 2MNWA 2J73A 3VXUE 2DQJL 1Z2KA 5ENWA 2WLHA 4M5SA 4Y9CA 1IRAY 1H0DB 1HINL 2F58H 1OP5K 5C0EB 3GUTA 4E41E 4PV9A 2PXYA 4A7VA 4OGZA 4HULB 1KELH 2CIIA 1X4ZA 5HY9B 3MJ8B 4N5UA 1I8AA 4NT6B 2NSMA 4PP2A 3ZVVA 5HD8D 3MVSA 4UQ2B 4AL8C 2HWZL 4JG0H 5JXAH 1IL1B 2ROYA 2WVSA 4IIQC 3L1EA 3GC3A 3ZL1A 3IVKB 3LKNB 2DLGA 3IU3A 4MAZA 4OKVA 3TGXA 4X99B 2L04A 3NIFB 3TNMB 3ULVE 1DL7L 3US0A 2GJ6E 1UQSB 3CLWA 4GRWH 2CXKA 3FFDA 2ZOKA 4PI2A 2GVYA 1DLFH 1T7YA 2VGLM 4RGOH 4GNKB 4LEOB 4RFNB 1SYSB 4X6DB 1TETL 5CN2A 5J11B 2YQBA 1E5BA 5D7KD 1NFIA 4GW1B 4HF5L 3IE4A 3HE6D 3DX3A 4WHDA 4UQAA 3DO4A 4TNWF 2AABL 3L3OA 2BFGA 5KBMA 3QNYB 5J8OA 1YEJH 4RDBA 1CFSA 3W0WB 1J1XH 3T2OA 3I3EA 2R56L 1E9PB 4PJ9B 3SO3C 2P5WA 3SPJA 1XF5A 3HC4L 1H3UA 4IRJA 4KUCF 3CZNA 5F1OB 2F8VA 3EZJB 1A14H 3QUHA 4P2RB 3UTPD 4CA4A 4PJHA 1KGCE 2EICA 3CFDB 4HPOH 4XPTH 4WW2C 4MAYC 2EC8A 2Q8AH 5LNEA 2YPVA 5DVOA 4CN1A 4JG9A 1WH0A 4NKDB 3RKPA 4XB3A 2C3VB 3RPKA 3S5ZA 1N64L 2HRHA 1T20B 2FNBA 2ZOTA 3B2XA 3C2AH 5FK9A 3U30B 4Z3HA 3ZTNL 3DXAE 2GBVA 4BIKA 4RRPA 4DW2L 1PD1A 4XPHL 1YEKH 3FU6A 1J5HA 1LHZA 4PG2A 4XAKD 1V54B 4PB0L 4YHIA 3LKOB 2GPZA 3WY3A 2WKGA 2YD6A 2ZOLB 4HGWB 4TKWA 3TBBA 2YSTA 2BIPA 2OL3A 3CBKB 1S9WB 1ZHKB 4PJIB 3ZPDA 5C08E 4F7EB 1CLZH 2QADC 4XNXH 1BQRA 4Q6YA 2NY6D 3K72B 4QAMB 1NAMH 5CF3A 5DMGD 5DLMH 5KEZA 2V9TA 2YAPA 1SQ2N 3IBOA 3MLSH 3VTTA 2RJMA 4YX2H 1OCCB 2GFBA 1JF6A 4NKOA 3VGBA 3C08L 3ZKND 2X3BA 2Q7AA 3QQ4B 4I3GA 4LAQH 3WNNA 3HG3A 4OIBA 1A3LH 1PSKH 1BFOB 2VJ0A 2ZICA 4TNGA 5D1QA 5IMMB 2OZ4L 4LLMA 2DQDL 3JYCA 1HEZB 4QRQB 2C9VA 4YPGB 5BVJB 1QSEE 4Y4KA 4GMTH 1A6AA 3HAEH 3M1BA 5JIKA 2E8YA 1L0YA 4AJ0A 3PP4L 4HWNA 1ETA1 3CSGA 3MUUA 4I77L 4EOWH 2WANA 3ARDB 5C0NC 4L3EE 4NUMA 3HNSL 4MB1A 3WNKA 3ZU8A 1CDIA 1CFNA 2OZNA 3DVGB 4UQBA 3WNJA 3VSVA 3QPKA 1RIHH 5FC9A 2ZSWB 3VFRA 4GAJH 1UENA 2CCLA 4PR5B 2JLPA 4TL5A 5IQMA 2YGOA 3P9MA 3PAYA 3EYUL 4W4OC 3VRJA 4XCCL 1A7QH 2DD8L 1O6SA 2W94A 2V7NB 4LNVA 3W2DL 4IOSD 1CQKA 1JF1B 3PABB 4PRDA 3P9WB 2J1XA 3RUGA 2NY4D 5CCHE 3RNQB 3UBFA 4BZ1H 3GMNA 5IW1B 1IQDA 1NKRA 4OLXH 4WDIB 3SGJC 1DBKL 4YDJB 3ILDA 4JFUA 1NCNA 4NN6C 3O4OC 4OFQA 3SDXF 3UZEA 3IMBA 3K4ZA 4AENA 2YLHA 3B9VA 1IM9B 4Q9BA 4PJ5A 1OGAE 4NWUL 3SDAD 1LQBC 1WRFA 4NJAH 5K1VA 3TTYA 5K59E 4F7MB 2YA0A 3DHMA 2QKSA 5FUOL 4GW4A 1BXXA 4AQZA 4JRLA 5IHZA 2K70A 5D7KE 3BDYH 1PD0A 3G5VB 4UNUA 2VDNB 1DQKA 5HVFB 4KXAA 1JV2B 2QQKL 3GDCA 2DBLH 1D7FA 4TQEH 3BKMH 1DUYB 1MLCB 5MENA 4L5FH 2VLMD 3A4AA 1KSRA 3FO0H 4JRWA 4JZJC 7PCYA 4WHYH 2CM5A 4JFWA 4CILA 3DURB 3UTPE 3UO8B 1JGUH 2DQIL 3MRJA 1A1OA 3MUGA 1LMKA 4JRXD 3RVXC 1CXFA 1NDMB 4M1CC 3X3FH 2ED9A 3NA9L 4Q6IA 4FDWA 2EINB 5IK3A 1FNGA 2ZKYA 3NN8B 3WI9A 1FRGH 1FI8C 2ADFL 5D93B 1MUJA 2QTEA 4XAKE 1EEYB 3MMEA 3O0RH 4F5CA 4JHAL 5LAPA 5I8OH 2XYBA 2CK2A 4A6YL 3SE3A 3ZYIA 4G9DA 1IAMA 2TRHA 3EGSB 4D3CH 1X5ZA 4YC2C 3JV4B 3LSOA 2XJLA 3OJ2C 2ZUQB 3BFOA 1T6BX 3AU1B 3H6JA 3L5XL 3LN9A 4L9DA 4LP8A 4RISL 5DA0B 6TAAA 3S8FB 3F04A 2CE6A 4JRYB 5I8KL 4PJEE 2NT0A 1HIMH 4FEIA 5EZOH 4ZRGA 2NNRA 2MMXA 1HI6B 2J21A 5AW6B 2JWYA 4JY5L 3D5OF 4WIQA 3MRQA 4L4TA 4K07A 2PYFB 4WEUD 3EJZD 3C75A 4JFSA 5AVWB 3S2CA 3U36A 4GKNB 4JO8A 2ZXGA 1PU0A 2DJ4A 3D0LB 3ILQC 3HN3A 4HP5A 3UBXB 3WE1A 1NAKL 3FB6A 1NBQA 3P30L 3GS4A 4XH2A 2MOVA 1ZVSB 1XCXA 4G42B 2Z92A 4YDVB 5F0MB 2G0KA 4OQ1A 4TXVB 3RDTB 1G7PA 4YLCA 4HIHA 3EDJA 5FYKU 5L2JB 1HCYA 4LDCA 2VN6A 1HZKA 1UWEH 3OR7B 2XLLA 3CXHJ 1GVIA 5E2VH 2V2TB 1NKOA 3VXMD 4FQHA 4HWZB 3RTQA 5EUOB 3RDJA 3G6JF 4KK9C 4M6MH 4QWWC 1VFBA 1RURH 1HHJA 1RERA 4HJTA 2QPSA 5FYJL 2PYED 5HYQA 3OVUB 4R7XA 4PRAA 5B38G 1FGNL 4YNYB 2Y36H 1FL5A 4L1LA 2IC2A 4N6QA 4NN5B 3QRGL 4WSJA 1G6RA 4KJYB 3TA4D 5AG9A 3A23A 4AJWA 3FL7A 4NQDD 4ZX3A 2EH8H 5IQOA 4WRLA 1EXHA 1H3VA 3SCMC 3FQ4A 3SJVB 5JTWA 4UQ3B 2IBZY 1RPKA 1X5GA 1ADQH 4J6RL 4JO3L 1KGUA 1B88A 2DLEA 4ELME 2CIKA 3QEQA 3QFJE 2YQ2A 1NC2D 3T2LA 3WXVL 3BUYA 3HHSA 4UIKH 3ULUH 5SWZD 1GZHC 1OW0A 1TIUA 4N0YL 4P5KB 5C3LD 4Z1PA 5LUMA 3OZLA 2FD6L 4Q2ZA 3TEYA 4TOYL 4JHBA 1HK6A 1NDGB 4Z7NE 4RFEB 4P46B 2K6ZA 1G7JA 1WIOA 4A63A 1XGZA 4O58H 5I8CB 2I60L 3HE7B 1JWSA 5T3ZH 4JRXE 4NQUA 1ZY9A 5DD6B 3B3IB 1GGCL 1LO4L 5EOQL 1OTTC 1Z6JT 3CVDA 2FVNA 3DMMC 4RX4A 1BZ7B 1J1PL 2WY3B 4MB3A 2XWBB 2Z7YA 3GNML 4JFZH 1ID2A 4KRLB 1JJUA 1O6TA 1INEL 1KIRA 2H26B 5IESL 2KZWA 4HQQL 3ZSTA 4DKEL 4HS3A 4X9IA 1A3ZA 4PIRF 1FZMB 3PG2A 4MNQA 4FI7A 7FABH 1EEZB 1KNOB 4KKLC 3GMMA 1Z9PA 2I25N 4W9KC 2IDUA 3QUXC 4TUJA 3HC2A 3O6ML 4LSPL 2W9DH 5BRZD 4G6AD 4UT6A 1BAWA 5CLZA 2OW7A 3ETSA 4ODSL 2EDKA 4IEFB 1U0QA 4QRBA 3IFNL 1CDUA 3KPLB 4LEXL 4AMKL 4WK0B 5KSAC 1HXMA 5G4MA 4IK7A 1PY0A 4K8RL 4P5TC 1UUNA 3IPEA 1MOEA 3L5WB 4A2FA 1IVLA 3HZKA 3GIZH 1NCHA 2OMXA 4W9JC 1AC0A 1DVFA 2F19L 1R5WA 3QIUD 4I89A 3NIGE 3FCTB 4N0CD 2BSRA 2OTPA 4JY6B 3WN5A 5EF2A 1DDHB 1RJLB 3N85L 4IJTA 3N9GL 1OLZA 3WDHA 4GRWE 1N59B 4A39A 1MCPL 4OFPA 2HT4C 3EDDA 4MNGA 2YEQA 3GSWA 2FAUA 3E1F1 4LLWA 1D6VL 4QXWA 3KLHD 2GITA 1DVYA 2YD1A 5AYUL 5K39B 3BT2L 4JE0A 1DEDA 4YHOH 3BAYA 4GO9A 5C7XL 2Y25A 3ZZSA 2MCPL 4ODUA 3O3DB 3LIUA 3I84A 3PU7A 4OZHA 3N6YA 3TH3T 4XVUD 2FX8L 3ZE1B 1PZCA 9CGTA 1MCLA 3VXPB 1FBIH 4KQ3L 1FAKT 1HQRB 5GJTH 1DE4A 3VXME 2DRUA 4ZX6A 2P8PB 5F1NA 1KBBA 2YKKA 4F9LA 3CGTA 1Z9SB 2CMRL 3OMIB 4HLZG 5JUEL 1Q9WB 4HX1A 3UAJD 4Z3IA 5KJRH 2V9UA 3EUUA 3IK2A 3SQRA 2OMBA 2PYEE 3FT4A 1W91A 4G8GD 1C5CL 1YHPA 1H15A 3D39D 1IAII 4NQEB 5EO0A 5D7JB 1T5WB 2Y0SA 3RYMA 1A6ZA 3VXSD 1NGYA 4KI1A 3KYMB 3O8XD 3RBSA 3SDYL 5IJVB 2YBRA 4H1LH 3BMVA 5C9JB 4NQDE 5C0BA 1IZJA 5KUMA 1IX2A 1DLHA 1R24A 5K93A 1IGML 2NXYB 2CDFB 3REVB 1SXSA 5ETUA 3C8DA 3O9WD 2V2WA 3RL1B 1JRHL 1NFDF 3IDGB 1G9NH 2CKNA 2MQ3A 5CJOH 1X6LA 3UCRA 5DRZB 4LKCA 4Y5VC 3PJSB 4LCCA 3Q1SL 5SWZE 1U93B 3TESA 3OHXB 4NNXB 4JHWL 5E7FA 1WBYA 1I7TB 4ZMQA 3ZTDC 2K3TA 1AGEB 1UB5B 1PJWA 1D5XB 5C7ZA 3FT1A 4RGMB 2F7QA 3RG1C 3CUPA 2F61A 4WFHE 3LZQA 3V4UL 1G4MA 4JFTA 4Z7IA 1JOIA 4KHXH 4JL1A 4N24A 3HCVA 3TBVB 1I1YB 1U3HB 4LSRH 5D8JL 4PGJA 4FQQB 1OD7A 4QTIH 3ZQWA 1SXZA 3S4SA 2J8UF 5CEYA 4XWGL 2HVKB 4L4VE 1BMWA 4N25A 2Q2EB 5DD1H 5CEXA 5JO5B 1X3DA 1WWCA 1N3NA 3HB3D 5F7FA 1QFUH 1OAKH 1MF2H 2L0DA 3BWUC 3GSNH 4LLQA 3HA0A 4R8WL 1V3JA 1N18A 5IT2H 3LN5B 2A83B 2ZWZA 5KOMC 2VIRB 1A6PA 4Q4EA 1CC3A 2DI8A 3VXRA 5BRZE 5GGRA 2ALAA 2FATL 1M71B 1J05A 1R3HA 1HXYB 2X2UA 1DHKA 4XBGA 4Y19B 4IOFC 5HGHA 1TUPA 2EXWC 1EXGA 5D7IA 2FX9L 4P3WA 1YYLL 1AR1B 2YMOA 2CDGA 3UO1L 3KPNB 4MRCA 2BVUA 3LHPL 1P7QA 1XZ0A 3ZKMC 2C9SA 2RACA 3TPUB 1N8OE 4CVXB 4HIEB 2OSLB 4L4JA 1B0IA 3AXLB 4RFNC 4QCIA 2VZ3A 3F7RA 5J11C 1DSFL 5FCUL 2ENJA 2VXTL 3S98A 1SFHA 4XCYB 2V6HA 5F3BA 2X10A 4X4XA 4YSEA 3VQ1C 3GHPA 3GSUB 3R7QA 2WINB 1B2WH 3PXLA 3U7WL 4LVHC 1C08A 3RGHA 4PJ9C 4M1DL 3M45A 4YE0A 1SNRA 5FXCH 4OBSA 4LPWA 4ORZC 4KROD 4LEBA 5DYFA 3MBEA 1Q9KB 4B9FA 5KYWA 1JDDA 3V5HB 2EVJA 4P9HL 5HYEA 4J28A 1MKFA 3U46B 3VSTA 3VFTA 1URIA 1PCSA 4UWQB 1A7PH 3O6LH 4L5FE 3ULUD 5ITBH 1ET8A 1I9JL 3QQNA 4JPIA 3G9VA 3GXTA 3BRFA 2Y3NA 3SE9H 2QPUA 2YD2A 3UROR 5L0QB 2O5ZL 1FNSL 1L6ZA 5I1AA 2GIYA 2IOIA 3VXTA 3CZJA 2HJKA 3FUJA 4LT7A 5T3ZD 4G8GE 4XAWL 4E42B 1NINA 3D39E 5CGYD 4NO3B 2ZD0A 3F83A 1P6AB 2TSAA 5E8PB 5INCA 3VXSE 2R7EB 2Y07H 3FU9A 3O11A 4DN4L 1EZUA 3WKQA 1XIWB 3QIBB 5I9QC 2ZJSH 1VGKA 3MR9A 4MBRA 4X83A 5I76B 2VDPB 4K7PL 1BZOA 5BVPL 3IDMB 3NYKA 4Z7VF 2FJUB 5E4OA 3TT1L 1DJXA 4NSKB 5AKRA 5F7AA 2BOCA 4AEEA 3RY5A 1E4KA 3WNPA 4D8PA 4G8FB 1VGEH 4PGEA 4QRPE 4O02A 4QI3A 3ARYA 1MJUL 3NFNB 2ILLA 1I8LA 1P5VB 3QH3B 1QSFB 3GXMA 2H1XA 4KO7A 2C9PA 5B3NA 1TVHA 1JXJA 5B4MD 2X4QB 3IWVA 4DWHA 3IBEA 3A6BH 3NJVA 1ZSDB 3RWIA 3KJ4B 3ARDC 1JZFA 5E7BA 4AEIL 2OI9B 3QUZA 3TFKC 3VU1A 2GQHA 3DX7A 3SDDA 5H94A 1OXYA 3H9SB 5KYYB 3ZRSA 4LP4A 5EEYA 3RIAK 2C5DC 2GYSA 5E9DD 3VSUA 5GGTL 5B1CA 3MQIA 2XWTA 4Z3GA 3ARBA 3QO1B 4HH8A 4UT6H 2I27N 4WAFA 1CGUA 1TU2B 2FUTA 4WTZA 4L1HA 4JN2A 3P02A 1IBHA 1BAFH 2PO6B 3DX6A 4QOKB 1HSAA 5J5EA 4XPBH 1EHKB 3V5KB 3X1GA 4MA3B 5LXVA 5CKGA 2WCSA 2K78A 4KTGA 2IAMB 1T1YB 3QK0A 1IGYB 3VWJB 1TMQA 1F3JB 4EVNB 2WLZA 3K74B 1SN2A 1FYTD 3TCLA 1K5WA 1ETB1 5GISL 4EIUA 2DYRB 2BH0A 3A24A 1IGTB 1QQDA 3BD4A 3C09B 3IDXH 4Y2LA 1HQ4B 2FB4L 3AMKA 5HHMB 1DQQA 2A7BA 3IDNB 2B1HL 1NBZB 3CV5A 3V9CA 2AKRA 1NIBA 5LQBL 3AUWB 3GI9L 5DEGA 5BZWA 4NHCH 1MFCH 5BW7A 1IGCL 1MI5D 1QNIA 2NR6C 3BQUD 4ICXA 25C8L 4RZCB 3V7MA 3HG0A 4OSUL 3ZZLA 5F71A 5TDNA 2Q3ZA 5E6SB 2V17L 1TQCC 5E6IB 1R0AL 1QLEL 2FUQA 5IB5B 2VKXA 3LQAC 5F7MC 4Z23A 2P24A 3VFSB 1T7ZA 4Z78B 1OP3H 1VKXA 4R84A 4JZOA 4YHYB 4WNQB 4APQD 5KBPA 3LPWA 2PCYA 5HGAB 3Q6GH 2F68X 1M2OA 1RZPA 4QRSA 1XR9B 3LB6C 3VM5A 3BZDA 2N7AA 1P4IL 3ULUE 4BUHA 2FBJH 1BEYL 4F7CA 5C0GA 3O3AA 1HILB 4ODVL 5IFJA 2RD0A 2O6FA 1D7CA 3ZW3A 3UTZB 4PUBH 4UV7H 5JYLA 4FC3E 2Q3AA 3H3PH 1M9WA 4J8RA 2ZONA 2QFRA 4NRZB 4F7TB 4G6KL 1ZANH 2R0ZH 2UZIH 5T3ZE 1B4LA 4QHLA 1U8CB 5D93C 4YL4A 3LKQB 5TQ0L 1WAPA 1PX4A 2C3HA 2AXFB 4ISVA 1MEXL 5I16A 3HG2A 3SQOH 5DUPL 3ML9A 3O4LD 5J1TC 2YC1B 3G3LA 1BZDA 2AHIA 3FQNA 4A2HA 5E94B 5DSCA 4JEGB 2H3XC 4N6RA 1ZWIA 1K3ZA 2EYRB 4J2XA 2VR6A 2F7RA 2NZ9C 5AW3B 4QYOA 3WELA 4LARL 2IPUK 4QHNA 1FVEA 5IVNA 5L88L 1ETJA 2YPVL 3I9AA 5E2UH 1ZAGA 4DGWC 1QKZH 1XGYH 1WZKA 5KVGL 4KV5F 3LCYA 5D4QA 4W6WB 4B9ZA 2A6KB 5K9QG 4ZFFA 1PD6A 5CWSA 5LGYA 3GKZA 4FG6D 4RA0C 5E9DE 1AI1H 1M42A 3IETA 1WUZA 3KYOA 4XXCA 2W9EH 4ZFGL 5IHBA 5KTEL 1RUML 4PS4H 3SE6A 4JFYA 4L18A 5T1DL 2OL3L 1MREL 3DGGA 4TUUA 3RDTC 4Q89A 3V0JA 2JJTC 4N1HB 4PJBA 5DMYA 1A9BA 1JL8A 3LZFL 5FOBB 1OSPL 3WJMB 3N1MC 4K7FA 4WZ9A 1UG9A 4BWWA 5JQ6H 1UT1A 1F6AB 4JB9L 3WIIL 5A16A 1CMOA 1D5RA 3CFMA 1WT5A 2FWOA 4PJ5E 1MCNA 4OTXH 1ICTA 1JPFB 2DTML 4JANA 3FRPG 3GSVA 4LBEA 3KWWB 4BH7B 2A0LD 3S36X 4KHTH 3HE6A 2VO5A 2B0SH 3DPBB 3EJRA 1CDYA 3MGOB 3P73B 4NN5C 4XNQB 1BG9A 2Q9OA 3K2UH 4PLOB 3V0VA 4HJJL 3JVGC 4G7VL 3A0OA 4TQPA 2WXOA 3VTAA 1D2PA 4DP5X 5GZNC 3L1OH 5DJAB 1ZT7A 1KLUB 1MI5E 4GAGL 1U8LA 4BFNA 2N56A 4PJ7E 3WHXA 4DAGH 4N8CH 2GABA 1ZV5A 2VLJB 3MA7B 4MX7A 3EYQC 4K3EL 4ONHA 3RIAF 1H5BB 3ZKXB 5A2FA 5HBBA 3QQDB 5CD5D 4I4WB 4KDVA 3ECQA 2W0KA 3BEVB 5GS0L 4KKPA 3MRLB 5F1IB 4OM1L 5B1AB 4EI6B 2X4TA 1E6JH 4P2OD 4U0RC 2CDEA 1J0HA 1I1RA 3WJLC 5JLZB 4PREA 4ZFOB 3GBLA 4G6MH 2NY1D 4F2MB 1FG2A 3HE7C 3Q13A 1P1ZB 4G1EB 2B4CH 4MVBC 4EN3B 5AOMA 3DSFH 5I1LB 3RVUC 4TNEA 4BXVA 5A6LA 1CE6B 4PSPA 2HMIC 4XN8A 5SX4I 3MYJA 4F8TA 4UINL 3P4NA 1KN2H 1ZTXL 5F8QC 1WAAF 5FOJA 2B59B 5IQ9A 1BJ8A 4RCAA 5A1AA 4J23A 3CHXA 1PCXA 3REWA 3IJYB 5F44A 1E27A 1WQVT 2HLFD 3EJYD 4IHBA 1J8HB 4AH2A 1TCRB 1WHOA 4OF8A 4ZXBC 2D0HA 3QEGL 1OSEA 2RCSL 4TUOB 3O4LE 2NYYC 3NMEA 4K3GA 35C8H 1TTGA 3H42L 3HFMH 5GGSB 5CZVH 3MV7A 1Q0XL 2PPEA 3C6LB 1BVZA 2QADD 1I8KA 3WIHH 1L0XA 4IBWA 3BH9B 2EDQA 4W9GC 1H3WM 3WFBL 4GBXB 1N4XH 5JQHC 3N41F 3V79C 3HIZA 4R5XA 1F3DJ 1RMFH 1I9IH 2IOMA 3QGVA 1E4XH 2R4RL 1H3PL 3GZQA 2C3XA 3SZ6A 4DVRH 1BFTA 1R33A 2NTFB 1DBBL 3ULVF 5EOTA 1KJ2A 4LXFA 3BAEL 1QR1A 4EZMA 2LLNA 2UVFA 1ZT4B 1M1XB 3HRPA 4TSAH 1XEDA 4DP2X 1J86A 1XF2B 2LU3A 1E43A 1K85A 4P4KB 3DJ9A 5SWQA 2VKWA 5A2JH 1KYOJ 2WB7A 3BIBX 5HHPB 3LHAA 4UCFA 3BWZA 3ZJAA 1PEZA 2BIQA 1S7TA 4ZO6A 1DJHA 1PYWA 4HGKC 1MVUA 5DVMA 2N0KA 3NEEA 1MIML 2HFTA 2VWEE 2ZUUA 5T33H 1H9VA 2AJYH 1UM5H 2P7TA 4W6XB 5IHHA 2WO3B 3E38A 3MLTB 4ALAC 1ANUA 3DK2A 5JYMA 2XPGB 3FB5B 5DRXB 3V6BR 1ZJAA 1WA2X 2AJXH 1A4KB 3S3PA 3TBYA 5JXEA 5D7JC 2PTTB 3SBPA 2JKWA 2QELA 2EE2A 3R0NA 4ODHL 1O9ZA 5AVUB 1HHKB 2IADB 4MXWL 3TIEB 3BPNB 4J3OG 4BDVA 4E9YA 1HCZA 2H8PA 2NXYC 3QDHA 1ZXKA 1JHLH 5DUML 2H5UA 3OHMB 2ZX6A 4WWKA 5F7LB 2W80C 5D5ME 5F7YC 1RHHA 2IANB 4K2UH 1SEBA 4PGCB 1DUZA 1XTMA 3C5ZD 2WQUA 3TJPA 1QVOA 2P42B 3CVHA 5DMJB 1FLRH 1J87A 2KPWA 4UT9L 1KDIA 5SWSB 1B90A 1RULH 4NLAA 4R5TA 5FUCE 4MMZA 3SE4C 4IKKA 5JPMA 3OHXC 2QR0B 3KPPA 3PQYD 1ZA3A 4F33B 3CSYA 4Q9CA 4MCYA 2CU9A 2VE6B 1Z1WA 2VISA 1IARB 2ENQA 2QLYA 2JKXA 4PRIA 1ZCRA 2G0LA 3HHRB 4RGMC 3RI5K 1C8QA 1F90H 3MRPA 3JWNH 2E7LC 4ZPTA 1CF8L 4FADA 3JWOL 4KWUA 4NQCD 1U3HC 2LU7A 1AS8A 5G2NA 3G5XB 1R34A 3MV9B 5AZUA 1G6RL 2ICWJ 4LLAA 3TA3A 2XQYA 3RWFA 1A6TB 4X7SH 3J2PA 2VR7A 1NPNA 1QRNB 1NOAA 1E65A 3I75A 2UX6A 4OLWL 1JERA 2EUVA 1P4LA 1DFBL 3RZCA 2EACA 2WUCH 4H13C 2DIJA 3L3IA 4OD2B 2ADIA 1NLBH 4OJFL 1F2QA 2XWCA 4M7LL 3DRTB 4ZPVB 2E27L 3P0VH 3HTLX 4JAMB 5H2BA 4JM4H 2GUOA 4XC1H 5DQDL 5CJXA 3MRFB 4BYHA 4GRLD 4PJDA 1V3LA 5CCKH 2DWDA 3NJNA 1AR1C 4HEMA 1Q9LB 3IXTB 4X5XA 1KPRA 2G2NA 2EH7L 1FE8H 1UH3A 2CO2A 1EXUB 3IJEB 4QTFA 4K3DH 5C09B 1DBJH 2FTAA 4NS0A 4U1IB 2D73A 1BSIA 2GIXA 4QUOA 5I2IB 2Z31A 3MV8D 3KLKA 2H47C 1AANA 2BSBA 2VZVA 4HJGA 3ASWA 4LLVA 2X1PA 3MXWL 4OD1L 1XCTA 5GS1A 3H6AA 3LXUX 4O9HH 2VDLH 3RY4A 3OAUH 3QR1A 4I7ZC 1J0ZA 2HTLC 5K59F 4YBHA 4HHGA 3SDXB 5D1XB 2AVFA 4LKXB 4ZI8A 4EZJA 1CICD 1I82A 4ZW5A 5A2AA 4LLDB 2R23B 4P4RA 2Z9TA 3VFNA 5IG7B 3TBSB 4U1JB 4ZS6C 1RK1A 3F58H 5DUJA 5IOKA 3KH4A 2MHAA 3MJWA 4GH7B 1R5VA 1NBVL 2A73B 5FGSA 1JZ3A 5E9NA 5JHDE 5ID0B 1I7ZA 2FJGA 4IYKA 3IDJA 4J27A 4PVMA 5HI5D 4QRTA 1CL7H 5HYJD 5T1LD 1CXEA 5L0QC 4Z0BL 3H1ZA 1QHQA 4K9EH 5F0JB 3ATEA 4LVEA 4OD3L 1LWRA 2BSTA 1PAMA 4HGMA 1PZBA 2G75B 2VLRB 1F4WH 4PD4J 2IPTL 2NSQA 4KUZL 4D9LL 5CM1A 1XIWC 3QIBC 1E7UA 3SKOA 2Q8BH 1XCQB 5LXGH 3KJ6H 3KM2A 4WI3A 5L7XL 1JZ8A 4ZZFA 3HW7A 3PCYA 3HI5H 2FHCA 3C12A 5IWLC 5KVMC 2IALB 2VC2H 1A9VA 1OF0A 3ZT5A 3KVDD 4F93B 2B08A 4FQXC 3UGXA 3BZ4B 4K23H 2DB8A 2I26N 1Z9OA 2JE8A 4XZUA 4GSDL 3L3KB 4BXSV 1QSZA 3QO0B 1XSKA 2NQ3A 2GJRA 3QQ9C 1ZJBA 2N01B 5D2LE 2YAOA 4F9PA 1KCBA 3RA7H 3R06B 3D9AL 5TGBB 1UACL 4JO4H 2AJ3B 3GXIA 3ZZ1A 5FYKH 3EO1B 1CE1H 3FQUB 3H9HB 4BEIA 1YQVH 4PJEF 5A40E 3R19A 3KJ4C 2VSCA 3UIYA 2OI9C 4LCVA 3W11C 5CXPA 2O5YL 4ONGL 3S96B 3BH8B 1GAFH 2WIIB 1IGJB 3BLKA 3GPEA 3I3BA 3NA4A 3GSXA 1FZJA 3BAWA 4G6FD 4LPTA 2FSEA 4POUB 1JN6A 2NY3D 1G94A 2AXGB 3TH2T 4ZUSA 3ARGA 3DOHA 3LJ3A 3O0LA 1TNNA 4XO9A 4YXHL 2X4RB 5F7KC 2DWEB 4F91B 1QLEB 4NOBA 3KGRA 5ENWB 1BWMA 3LNFA 4KZDL 1R17A 1MH5B 1BQSA 1X5MA 1JHKL 4HBCL 1LTXA 4PV9B 3UAAA 1CN4A 3CFKB 4BWTA 4HZ1A 4FERA 4NIKB 3VH8B 2IAMC 1ILUA 4WHCA 2XZZA 3VWJC 4ORGB 5D7IE 3GO1L 3INOA 3QJTB 3D85B 2OCJA 4FXLA 3LS4L 3NRFA 1XFPA 1XF1A 3WDJA 3DTXB 1O6VA 4OKVB 4DKAA 3C09C 2HN7B 3BOVA 3IU3B 1GZPB 3A67L 2OAAA 2W38A 2E46A 4HG4K 3BPCA 1U8MB 2FGWH 5MERB 1YDPA 3QNXA 1SFDA 3FHQA 3R7RA 2ZOKB 4MBOA 5E5RB 3LH2L 3H4HA 1MFDL 4LBAA 2VDOH 3QPXL 2WZ5A 4RAUA 4MWFB 5EU6B 4J4PA 5L2KB 2ZXBA 2CWRA 3VH8G 4HMCA 2EVFA 3D4ZA 2ORBL 2FEJA 2J2ZB 2NY0B 3G6JB 3MLZH 1MFNA 3FB7A 4PRPA 5F0PB 4QLRA 1X5YA 4JDEA 2H1PL 2N0MA 2MCG1 4AIXA 5KZCB 4Y5YB 5I15H 2J4WL 3RWJB 2ARWA 3JWDH 3TBWB 4YHYC 2YAQA 3HG1A 3OB0H 1XF5B 4XNZB 5FUZH 3QG7L 3N1FC 2R8SL 3FZUC 3M7FB 4ELMF 2RIKA 1D2OA 4DP4X 4PJHB 4MZIA 2YPLA 2V7HA 2WSDA 4WSKA 3MC0A 1BQKA 3N40P 5B39A 3DIVA 5B8CB 1TJXA 1ZEAL 5HYJE 2HJFB 1F58H 4XNUL 3IFOA 4FLHA 5I1DB 2A74B 1CXHA 4M7ZB 2BSSB 5CAYB 4JPWL 4Z7NF 1VIWA 4KI5D 4QGYA 3NTCL 2N4IA 5EBLA 3CMOL 2X4OB 1WFNA 2Q6WA 4QLWA 3QXDA 4EBQH 4XXWC 3QEHA 4Y4FA 4NQVA 3K6IA 1ORQB 3OLIA 3VI3E 1MAJA 1RUKH 2EYTB 1E8WA 4G7SB 4OJCA 5DR5H 2Y7NA 3BN9C 2NRDA 3NSJA 4FQCL 4X7FC 3NOIA 4HAKA 2MFNA 3L4XA 4QGTA 4Z95L 4BFGA 1HOCA 2AJUH 2NXZB 4QRUA 3P54A 3MNZA 2GFBB 5A2CA 4H40A 3U4EB 4LU5H 3VMNA 1D6EA 1S9XB 2IH3B 2VW6A 3FF8A 3X11B 5I1CL 2VJXA 3NSFA 1B9ZA 3SDCB 1LK2B 3B6SB 3HZYB 2OK0L 4YHPA 1LE5B 4XGZB 4Y4KB 1PFOA 1QFWH 3QHFL 5T5FL 1MG3C 3RWCB 5K9OA 4KMQA 5C2BL 2AXWA 1R47A 3QUKB 3BW9B 5F96H 1S7SB 2ITEA 3O2DA 4KTDH 4OIIL 5JA9A 4XO8A 4OVUA 1CFNB 4PJFE 4X9YA 2ZE0A 2HVBA 3KLAA 1MQKH 3NIGF 1XSOA 4Y4HB 5AW1B 3RWDB 5ISZA 3FFCB 2LLLA 4GRWF 5CIPH 1O6SB 3ZQ9A 2AQNA 1RLBA 4OCXL 2YRPA 5LGKA 3SBWA 2WXHA 2Y06L 3IGFA 1FCCA 3MRHA 1OAJA 3OKNA 1FC1A 4O02L 2BS71 1M3IA 4PRDB 3BKCH 2VXUH 4AJVA 1A5FL 3NESA 1LO0L 3DROA 4HXAH 1A1NB 3GMNB 1DVTA 1IQDB 4F1ZA 4XP9H 4YO0B 3FUIA 3OPZL 2D7PA 1I8IB 5E5MB 2OJ1A 1JCVA 4IOFD 5D6DC 2J3SA 5FGCB 2H4EA 3GMQA 4FNRA 5DQ9A 1KCSL 1U41A 1WFUA 1URLA 2W91A 5BJTB 1KG0B 1KN4L 4JVPA 5D6CB 4DK3A 1W8OA 2GUYA 2WTPA 4YGVA 4V2BA 3HMWL 2MIZA 5FWQA 2FZ3A 4EIZC 4BQBA 1ACYL 1DQLH 1JHTA 3NH7H 4KKZA 5IHZB 3ZKXC 1H5BC 1KFGA 3QXAA 5FO9A 1IU1A 2UY7B 2NT1A 4YDLB 5TQ2H 4M29A 3PWPA 4X7TA 3RVWC 3STLA 4HIPA 1X7QA 2R1WB 3NK4A 4N9OB 5MENB 2ZOOA 5CBAB 3DIFB 1QI3A 4M5YL 4K0OA 2C9UA 2OJEB 3Q0HA 1WV7T 3GIVB 4RRPM 3U9PH 4ONFL 3TN0B 4MJID 4X9BA 5BUPA 1A3RH 4K8RC 3KCPB 1QA9A 3VW3H 2VLLA 4EN3C 1IILE 3CFEA 2BNQD 1NFDB 4C56A 2I5YH 1OTUC 3DSNB 4U31A 5INDA 1F2XK 4E9SA 4WI2A 4KI5E 5E2WL 1NBYB 2X6CA 4Q6IB 5FYKD 2UYLA 1VAHA 1WVZA 3FBQA 3JWNE 5ESQA 4Z5RB 5I1EL 3GGWA 4CVWA 2XFXA 4X80H 1FH5L 4XPFH 4YSTA 4WCYL 2KMWA 1PNDA 4JKMA 4U6YA 1AP2B 4JFDA 1YN7B 4PBWD 4E0RA 4MJ5A 1YEEL 3E3QC 4ZSOB 3AITA 4YHKH 5M7QA 3CN1A 3SPHA 4Z3FA 3QDMD 2CNZA 2NNCA 3CX5K 3C6LC 3MLUL 4TQ8A 4WV1B 4ZAKD 3D3VB 1LP9A 4JHZA 1MAML 2J8UB 2YK1L 4XPAH 1IV8A 4NZFA 1VACA 5DHVH 5D7LD 4N0UB 4GBXC 3TU6A 1ZLSH 1WIUA 5F6IB 4UAHA 1F97A 4JQVA 2CCWA 3DNKA 4CU8A 1MW0A 2OJZH 5FECA 3VI4F 4L4TB 1V55B 4GLRH 4GI9A 4NUQA 5FLUA 4GFXA 3AQZA 3U36B 2XBTA 1A7BA 2CJSA 3AY4C 3QIWC 3U7YH 3SKMA 5KANI 5GGUB 5MEQB 3FKUS 4FXGC 3B9AA 5FM8A 4U1LB 5FLVA 1S8DA 1U8NA 3MXVH 5GRJL 2ZPKL 1NGWB 4XH2B 1VRSA 1CXKA 1HWWA 5TF1H 3O3EA 3X14B 4P4KC 5D4IA 4N2LA 1UKTA 2F2HA 2KPNA 5F7DB 2VUYA 3FO2B 4HIHB 3NZ8A 1C1EH 2YUXA 4ODXB 2OTWA 4GUPB 4JKNA 5D1ZD 4YVUA 4Y2DD 3UYRH 1MCIA 3QAQA 3OR6B 4OJDH 4XOBA 4H2AA 4TRPH 1F13A 4N9GA 5EOCL 5IBTL 1T6WA 5FHBH 3SKJL 4C54A 4FQHB 3RTQB 2X87A 5D2NE 3NSDA 1HT6A 2Y24A 3QI9B 4U6TA 4UM8A 1IBGH 3IN0A 1AO7A 4RESB 5A2KH 2DYPA 4PLJC 1VB9A 4MA7L 4KVCH 3WL9B 4R96B 3ZUNC 4ES9A 4KO5A 4O2CB 3K6FA 1A4JB 2C34A 3V0WL 3KPRB 3B56A 3B9KA 3CNKA 3IS1X 3BPNC 5CMAB 4LQFH 4ABWA 1L6XA 4KOBA 3H2WA 5J6HA 3AG4B 2GSMB 3OQ3B 1KT2A 2BMKA 1EBPA 2B15A 1F0LA 3GSRA 3QJSB 3DKHA 2Z4TA 2GB2A 3QEQB 2YRBA 2JJSC 4H8HA 5FX3A 4X8JB 1T7WA 3BEWB 3BUYB 3EHBD 3HHSB 3M7OA 1PG7W 2ATPB 1U8KA 1TKWB 3VD0A 5KYUA 4MJIE 3NPZB 1GJIA 5BO0D 1CFTB 1UH4A 1JWSB 4JFFD 5EN3A 1E5ZA 3L4TA 2D9CA 4I13B 5AZEH 4Y9GA 1KCKA 3BAKA 5CZXC 2IH8A 2RHEA 5FYKE 2QTVA 3CFCH 4HOWA 4H8WL 3UTTD 2CJUL 3E6FA 1GZQA 3BJ91 4Z3JA 3QDGA 5E8EA 1LO2H 3ESOA 1HTYA 1RPQA 2DF3A 2XRAL 1CFVH 4HS3B 2DAVA 2CJ3A 1ES0A 4KBPA 1PL3A 3QDJA 4L1TA 5B21A 4F2FA 3ZRFC 3DO7B 1W72H 1AE6L 4JFED 3UZQB 4HKBB 1QRKA 3WKNA 3GMMB 3LKRA 4NRYA 1LEKB 2IWKA 1IEBB 1CZ8L 3QRFM 3WS3B 2QQNL 2I9LB 3KMDA 4D8OA 1CFQA 3C8KB 1TG8A 1OAYH 1TZOA 3SBRA 1IFHL 3K6DA 4N28A 2ZIDA 4P48A 4TQIA 4HOXA 3CBJB 3GTVA 4XB7A 5DMKA 1IAIL 4G3YH 4Q6KA 3UTQB 3WKYA 3BE1H 3IN2A 1R5WB 1ZSHA 4ZTOL 4FFVC 5CU9A 3UZVA 3SO5A 2QHRH 3WFDL 4YJZL 2HPOA 2F53B 4C47A 2CA4A 2WYHA 2EEBA 4MNGB 3SIKA 4M5ZH 3POCA 5D1XC 4OB5L 1XSJA 1JNNH 1IKNC 3I6KB 2EIKB 1QBLL 4QHKI 3DPDA 1QI5A 5HHOB 1ONQA 4JPKL 4PWJA 2X89A 3S0PA 4M7JL 4ODBD 4OZHB 3AVEA 1DTUA 2ZAGA 4IIQA 4FHJA 1ZPLA 2YKLH 1D3CA 4RAVA 4FQ2L 5F1NB 3S88H 1S5HA 3KPOA 3QPQC 4U33A 4ZDHB 3PNWB 4WO4B 1IAKA 2EDXA 3I9GL 2WQAA 4JLRB 1LK3L 1NCCH 1MWOA 2EIJB 2AK1H 3BUBA 4MGXA 5CGTA 3ULUF 3WTVA 1H15B 1BZQK 5J0BA 4H5SA 4S1RH 1U6AL 1GGYA 4JMXA 4OV5A 3L4WA 4NJ9L 1KJ2L 3HN8A 5F8RC 4JFXB 5H4ZA 4XTRD 3KHQA 1MJ8L 2KUTA 4ZMOA 2YZ8A 3MRDA 5D9SB 1NL0L 1SEQH 3NJHA 1DQTA 1Y1DA 3FH5A 1DSWA 1CB4A 5J7CC 2XDHA 1ROWA 5DHXB 1NCAL 3IDUA 4LCCB 4PRIE 4UM9D 1UA6H 1FNFA 3CH1A 4WEBH 4P07A 3VNZA 1GMIA 4KNSA 1C5DA 4MAYA 5GPRA 3ALWA 1CIDA 3TBTB 5C8JB 2BY1A 3FQ2A 3CVIL 5M95B 1M7DA 2BNUA 1Y1UA 4I1RA 4IIZA 2GK0A 4PJXA 3S97C 1G9EA 1Q94A 3ABGA 2BY3A 3ZZQA 3U0WH 4JFFE 1KBGH 5CU5A 2ZCLL 3EXJA 3MKGA 4NC1C 3OKOB 2JIXD 3Q01A 1OM3H 4Z76B 3F3HA 3UTTE 2BP8B 2R1XB 5C0CA 3QZWA 2K6WA 1DANU 1ZLWH 1U91B 5EZJB 4UYPA 2WJ7A 3O2WH 4ZYKA 5I19L 4MHHI 1IBZA 2DLFL 2O26U 5IVZA 2VDKB 3IMUA 1OT1A 4PRNB 4RWYL 2ODIA 1RK0A 2CGRH 4PJCE 2OBGA 1DQDL 3CVHL 1TVBB 4JFQA 4JFEE 4NNPL 2VZTA 2F1EA 4KZ0A 2ZP8A 1A1MA 3OKDA 5JOFA 1EMTH 3C60D 5L4MA 4HEME 3W37A 2F74B 1MRDH 5DS8A 3WKMH 5LGHH 1KGJA 4AV5A 3UADA 2JKRM 4XMLH 3FT3A 5ERWB 1JK8A 5CCJA 3ZHDA 2W0LA 1WD9A 3LXAA 4MLSA 1XZ0B 1KTRL 5AVSB 4UZUA 4A66A 2G2PA 2CK0L 4PI0A 4WUUD 3S36L 3B3BA 4MAUL 1JWMA 5DRNA 2CQVA 3AWGA 1L7TH 4XO5A 4L3AA 1U2HA 1FNHA 2VMCA 3TNNA 4CRPA 2OP4H 3ULSA 4ATTA 3FCUB 1YNTA 3RX8A 4M7KH 4EDXA 4HJEA 5GSRA 1XAUA 3V4PH 4ANKA 1GCFA 4JS7A 2DBJA 1V3MA 1QWHA 1YMMA 4W4OA 4Y5YC 1VFAB 4L3CB 5E4EC 4FQ1H 5AVYB 2ZUWA 4WWNA 2BK8A 2XZCH 1NSNH 3IKKA 4N8VA 1JZJA 4PJ8B 3MLRH 1A2YB 4PJ7F 4R4NC 2J8OA 4BZ2A 4EUPB 4G8EA 5KYWB 3CIAA 3GZKA 3QXVA 4NUJB 4Y9EA 3MJ9A 4ZD3L 4HKXA 1RZFL 3EFDL 1SXNA 3VFTB 3SGJA 1VJSA 2WPGA 5B8CC 2L7JA 5E95B 4CC4C 3KM1A 4JO2H 2F54A 3QISA 4JPIB 5DO2D 4A7GF 4GIPD 1MWAB 2A74C 4M62L 4M7ZC 4I1NB 1UWGL 2A9NH 3V4VB 4DESA 5KSBA 2XV0A 4ZG1A 1FZOA 5F7NC 4RGOL 5I1AB 3GK8L 2DWTA 1INQB 2D7QA 2ZXWB 3D09A 3ARED 4L29A 4U6XB 4QF1B 3D7PA 4PBXA 2CH8A 3PHQA 4NLHA 3MLYL 3P3TA 3S5LA 4MZ3A 1VPOL 5TE6L 1M6OB 1J18A 3LZLA 1Q8MA 1QEXA 3TV3L 3GLEA 1OAUL 3BVUA 2AFNA 3PQYA 3QA3B 4NN7B 1JSYA 5ES4B 2XG5B 5LJYH 2GHZA 2P80D 3OWRA 4H44C 4LL4A 1NGZA 3L3JB 3ZT7A 1DVSA 2HRLA 4JZJA 3V5DA 3RGVD 3QRBA 2Q7NA 2NXZC 1BPVA 4O02B 1L7IH 4JKLA 3MLVH 4LSTH 4NQCA 1OP3K 1VZGA 3COOA 5CS7A 3FH8A 4PGDB 1FFTB 2H32A 2JCCE 3OLGA 4DOHE 3SDCC 3UXFA 3ESUF 4MJ6B 1U8QA 2FX7L 3ES6B 2F8XC 4G11A 3A47A 5C0AD 1CR9H 4NHUA 4HJ0C 5IQLA 3MJ7A 3NZHL 5KVDL 2MTPA 4KVNH 5DJ6B 4XMWA 1FZKA 1CD1B 3HVDA 1FNEA 2V4LA 4DHLA 5MEPB 4N2NA 1I3GL 4E41B 3F62A 4KX7A 1GIGL 2MJWA 3ARBB 3OJVC 4XX1E 6FABH 3Q5TA 3N41B 3EOBA 1ZTMA 4Y4HC 1L4IA 2WBXA 1Q0EA 1LO5B 5H37A 5GS0C 2PABA 5GXBB 3NABH 4GRLA 1KMGA 1E5YA 1VFMA 1B9KA 1KJMA 3JTTA 3QWOB 1NCTA 3CC1A 3IGKA 1IC5L 3L45A 3MRBB 5E2TH 3T09A 3D06A 1I7UB 1KBKA 2WQVA 3AUVA 3DJSA 1QQDB 1AKJB 2X53A 4JDTH 3P40A 5EH1A 4DGUA 3ARFB 4WTZG 5IFAL 2A9MH 4I8DA 4ANUA 4FFTA 4PJAA 2LVEA 2BVYA 3FN9A 3K91A 4BM7A 1IC4L 2YPKA 4KPHL 2HFGH 4MJ2A 4PQXA 4OZ4A 5DEGB 2Z6FA 3K7UA 1PS3A 2XWJB 4FAAB 5IMKB 3BGFB 5AOIA 2LQRA 1ND0B 2AXHA 3EDFA 4R97B 4BUGA 1N0LB 4UTBA 4X4KA 4YDLC 1OO2A 1FORH 1OSZA 3WU1A 3H7BA 4YSCA 4KO6A 1OT2A 3BFQG 2APBA 4KRPD 1OOWA 1XTLA 3FOMB 1RZJL 5DJCB 1MHHB 3KXFD 2OYMA 2ZNWA 5D5MF 5T1MA 4MD0A 4CU6A 1E90A 2HG5A 3BESR 3NDYE 5JMOC 3TN0C 3V6ZA 1RZ7H 1A7RL 1D5BA 1GS8A 2W07A 3LRLA 1ZLVH 3CLEL 5LGJA 2BS8A 4MJJA 4BE6A 2ICES 1W15A 1NIAA 1B3IA 3N42F 2G5BA 1M56B 1PIFA 4IQHA 2ZKHL 4NCC2 2VQ1B 3F05A 1T0OA 1ZIAA 5C08B 4PG9A 4RMSA 1RIVL 3LRSB 5FV2A 2BRRH 2W81C 2P8MB 4F1SA 3CE1A 3FQTA 3SCMA 3O6KL 2WQ8A 5I16B 3EIFA 4R7VA 1XGQB 4UQDA 4TQEL 3CTTA 3CSTA 3FO1A 3VB9A 1OWRM 2FGZA 5FYLL 3MU3A 3CVBA 3F6JA 5ALBH 3QUML 4WV1C 3FQNB 3U9UB 1GZHA 4IRSC 5DSCB 1TENA 3FDWA 3QNZB 1ZWIB 1J1OH 4QHUA 1E3XA 4TLUA 4HPHA 3EJSA 2K6YA 3NUKA 3CMGA 4Z7OB 1OGTA 3VMPA 3IJHB 3ABLB 2Y4SA 3SQBA 4L3EB 3RPIA 3PAVA 1EAJA 5HJ3B 2XY1A 2CHZA 2K9UA 3KBPA 3M46A 5ADPH 2YD9A 1G7QB 5C0AE 5CLYA 3PE9A 2OSXA 4AKOA 2MQCA 1F02I 2AV1B 5JW4Q 1WZMA 3JBG7 4CMHB 2JH2A 3DMMA 4OM0H 3WXWL 4TNVK 3ME0A 1U8PA 2DWYA 5DFAA 1SJEA 3UX9B 3FN3A 1BOGB 4HUUA 4LDLB 3IETB 3UBXI 5I8OL 3JTBA 4I0PD 4PGBA 1IJNA 1O7DE 2F5BL 3IGUA 2Z4QA 4H20H 1NC4A 4JFYB 4NM8L 4WU7B 1FVDA 2CRMA 2JB5H 4JG1H 1GR7A 3NZUA 4PJBB 2X88A 3ZDWA 4OZFA 2HLAB 1BBDL 1GGIH 3QUXA 1T4KB 2B77A 5IM7A 1S9KC 4XP6L 4YBLC 1QOKA 1I1AD 1P4BH 1SHMA 4K7FB 3RQ3A 4FN0A 1ZD6A 1M3JA 2B1AL 4G5ZH 3QI9C 5KSAA 4XBMA 5FO8B 3MODH 4YWGL 1BXAA 4P5TA 3WIFA 3H0TB 4MDJA 3ETBJ 2WUBL 4MFHA 2OMZB 3JWOC 1JZ4A 1KFAH 3ALXA 3D0AA 5DCCA 3Q3GA 5DK0A 3OKEA 3MGTA 3H9ZA 3HE6B 5ILTH 1IAOA 3INUL 1W9XA 3EG9A 1TMCB 2O61A 3C6SA 4E5XB 3OV6A 1OP4A 3VD1A 5GHWL 3O2DL 1OAZL 5H35B 4BZ2H 3D1MC 1YNKH 4LOFA 1E30A 3UTOA 4XVJL 1U8LB 3T65A 3P0YH 3WHXB 2DDQL 4EJ1C 3FU7A 4N2CA 3A6CL 3BZEA 2APXA 5C71A 3P3UA 5EZPA 4ZUTB 5CEZH 3IYLW 1KDJA 1KUMA 4X5PA 4HD9A 2WBJC 2WB1A 5IVXE 3AQDA 4IU2A 3B2PA 4DP8X 3TT3H 1HYSC 2B1OA 5IW6B 3E0GA 1AH1A 2DQEH 4IM8A 1RJZA 5CGBA 3ZIMA 1J8SA 3D2UD 1IKFL 2HRPL 2XXGA 1JGDB 4X5WA 4M6ML 3VRIA 2R4SL 2OULB 5F6HI 4ENEC 3PRZA 1FG2B 1VEOA 2EDMA 3W38A 3BSGA 5D2LF 4GI6A 2YA1A 2VITB 2YGQA 3NRPA 4QHPA 4Z7WA 3FMGH 5AKVA 1ZS8A 1CVRA 3BQVA 2NY6B 4APXB 1KCVH 1FO0H 3MNDA 1OPGH 1Q1JL 2PP8A 4LHUD 4NGHL 4ZUUA 4BD4A 1F42A 4AH2B 1J0IA 2AEPL 4EE2A 2DM2A 4PJEB 4K9JA 3BIKB 3GEWB 4IOIA 2KZ1B 4TVUA 1TLMA 4UIKL 5MEOA 1G9ML 3MCG1 4WHTA 5T1KD 1CURA 3ELQA 4Y5VA 4X6CB 3B2UC 1J10A 3MV7B 3HG4A 1T1WA 3IKCA 5EU7C 4AQ1B 2ESVA 2QGCA 4HUKB 4AWJC 1LEGA 1MFAL 2CRIA 1M53A 3KWXA 4X5RA 1CTOA 4UB0H 3VACA 3F00A 4KX8A 5IOPA 3KYKH 5I66A 5IKCB 5J3HC 5C07D 3NFPB 3DI3B 1N12A 4LSVH 4U49A 4UQCA 1PX3A 2G3NA 3FQYA 3D50A 5H37H 3HZMB 3ARSA 4PTTA 4F57L 3TX4A 4HU2A 4DGIH 3MLWL 5EOTB 2ZWYA 3K6NA 3W39A 3T2NH 1I31A 3K81A 1A6UH 4AVKA 5C0EA 5HSFA 1YY9D 2NY4B 5DK2B 3T9WA 2FYYB 5SWQB 3L4YA 1UTDA 1BZEA 2GTZA 4YLBA 1I9RH 5E6YA 3MJ8A 4ONOA 3A21A 4JN1L 4OVVA 4NT6A 3CJJA 3F6LA 4FZEL 5I28A 3V6OC 5DD3L 4Z77B 1IL1A 1KB5H 1MVUB 1F86A 1YYML 3SZKC 3IVKA 1WA1X 3ZXAC 3DV6B 4X99A 2W65B 3TNMA 3Q2LA 5CUSL 3PUUA 3S35X 4WO4C 1UQSA 4B97A 3ZE2E 1P4UA 4RDQF 4R2GD 1MCEA 4X9FA 4UTBH 5AD0B 5DVKA 4LEOA 2WM0A 1SYSA 1XXFC 4X6DA 1KCLA 1OEZW 1LE9B 3P9LB 4ELMB 3BP7B 4GW1A 4K94C 2DI7A 1ODUA 2JQAA 5HHXL 3QNYA 4TNVF 4CVUA 2XN2A 3MHZA 3W0WA 1JD9A 1HZHL 1U4FA 1E9PA 4FTVD 4PJ9A 1T0PB 1HYRC 1J0YA 4Z7NB 3RL2B 4HFWB 3BT0A 3MN8A 1NCUA 4XC3L 4JRXB 4P2RA 2NY2D 4MMZB 1TQSA 2EO1A 3VI3F 5LDSA 4YHZH 1EBAA 3US9A 1L3NA 4GFTB 1P7KB 1CCZA 4NKDA 3RHWK 3WFCH 2Z91A 1DBAL 2C3VA 2OXHB 5E8OB 1Q72H 3K0YA 4FNLH 1T20A 3HNVH 4HG4J 3LEXB 3NEXA 1UWFA 4LLYB 1YO4A 4ERSL 1USQA 5FEBA 1MNUH 3QDGE 1CDGA 5LB1A 3LKOA 4RIRB 4L8CA 4FG2A 1UM6L 5C6PB 5E9AA 2ZOLA 3EBGA 4GJTB 4HGWA 4KMTH 3V0HA 4QAWA 4PJIA 1S9WA 1ZHKA 4FFZL 4UDTB 2ZQKA 3U1SL 3HLKA 1MW1A 5CZKA 1K72A 3K72A 2DH2A 4DUWA 1ET5A 1BREA 2R69H 3S8WA 3T0EE 1EO7A 3KPSD 4DN3H 3DI2B 3UJJH 5JW3H 4ZOCA 4PJFF 5C97A 3Q9QA 3JSSA 4ZS7L 1KYFA 3QQ4A 4CN6A 2E4TA 4GKOA 1TT6A 1BFOA 5IMMA 3VFWB 3P11H 1PEWA 1P7HL 1HEZA 3F7KA 4QRQA 4OFVA 1DQIA 5HJDA 4YPGA 2DWDB 5BVJA 3I2CH 1KC5L 2VL5B 3CQQA 4X5XB 4IGBD 1K9TA 1IB5A 2XQYG 4GRWB 3TLRA 3MRGB 3ARDA 5E8NB 3FT2A 2QVIA 4NAQA 4OZFH 5CP3H 1E4WH 5GZOD 2KQMA 3DVGA 1BM3H 3FSVA 4FJZA 5CBEB 4QD2E 4GUQA 2CHXA 2ZSWA 4PB9H 4CSSA 4ZNCD 4PR5A 4BFEA 3QIWD 1QFUL 4EDWL 5F89A 3NRQA 4LCIL 2CZNA 3GSNL 3L6FB 1KJ3L 3FN0H 1EZVY 5JW5A 4FABL 4G71B 4C83B 2XN9D 5TJWK 3VXMB 5IT2L 1OB0A 1UCBL 1JF1A 1QUNB 1XR8B 4GQRA 4P4RB 4PJ8C 5DZVA 3PABA 4N87A 1XF4B 3CDYA 4MJHA 3BP5B 4OQTL 3RNQA 5LG1A 2EDDA 2MHAB 4N5ED 3N0PB 2IV8A 5IW1A 2PYEB 1T22B 4WDIA 1K3IA 4NRXB 4YDJA 4CNIB 2WZPA 4DKDC 5DMIL 2X0UA 3IDJB 3M8OL 2VQ4A 1IBYA 4QRTB 1ID5I 1V7ML 4NQDB 2HT3D 4GT7A 4H88H 4F7MA 2MNUA 4NOFA 1X5JA 2J6EH 7CGTA 2BSTB 2K0RA 5FYJU 4AG4H 2AQ1A 2NR6A 3LEYH 5E99L 1IC7H 1NC2B 3QJFA 1NMAH 2V8MA 3CFQA 2E9GA 1OF2B 3SKOB 1BVNT 2DWSA 4KI5F 1JVLA 1JV2A 2WD0A 4NN7C 5DEFB 5EC2B 1AJ7L 5SWZB 4B95C 3GS7A 4FNSA 1SJHB 4XVTL 4XHQA 4FTVE 4TV3A 2P52A 2XZAH 4AQOA 1XB6A 1CK0H 3E2HB 3ZMRA 1YUKB 4S1DC 1E7VA 3T4YA 5GS2H 5GGQL 4AL8L 3DURA 4D2NA 5KUKA 1DO6A 1NUFA 4F3FB 4GG6E 5IROC 4MA1C 3KZ8A 4Y8DC 2XG4B 1AZNA 1I8LC 1RUPH 5JHLA 4AMXA 1NDMA 1YYCA 3QORD 1YNLL 5D7SL 3SE9L 2X9WA 3OB0K 2OXGB 3HAEB 3U0PA 5HHVL 3L5HA 4HHWA 1QFWM 5BV7H 2CAKA 3NN8A 5K9JH 3SHSA 1ACXA 4NO0D 5HDWA 2CO6B 2DMBA 1A0QH 3ARBC 3V7AE 4XO4A 3F2LA 2ZP0T 3CH8A 4GW5A 3VO0A 2AEQL 3VFGL 4ZBJA 1DZBA 1S78D 3DHPA 3RWEB 3KVPA 2EE6A 5BRZB 3VI4B 3EGSA 3GKWH 3F5WB 1KYUA 1EDQA 4LOUC 3KPSE 2YQGA 3CFJB 3JV4A 2BSED 1EJOH 4FYSA 4EXPX 3TZVC 1X7TA 2HKFL 4DP7X 3KL0A 1WFIA 2LGNA 2YD5A 3HAEG 4JRYA 4MS6A 3VD5A 3EYOB 4M43H 15C8L 4HS8L 1LNUA 1HI6A 2BFVL 2VB5A 5EWIL 3FCBA 2VZUA 5ECGA 5FGBC 1EV2E 4PY7B 3QZBA 2PCPB 3QIUB 3RVVD 1I7RB 4GXUM 2PYFA 4WI6A 3IB4A 4GXVH 4KRMB 3ARFC 4GKNA 2DIBA 4K71C 3RHWF 1JF5A 1WFJA 5A3ID 1ED3B 3D0LA 4JPVL 1A7OL 4L9LC 4S1SH 5FWRA 3UBXA 3S34L 2XQYK 2DQTH 2ZAHA 2ZXQA 3EFOB 3BGFC 1YMME 2XOTA 1UKSA 4G42A 3LIZA 3MCLH 4R97C 3FTWA 4YDVA 1BAFL 2JJTA 4FFVD 3QUYD 3CHOA 5L2JA 1ZA6B 3QCTL 4JDEB 4KKAC 5F7EH 2LV4A 4AVIA 1N5AA 2CPCA 1MCOL 4F92B 2K45A 2XN9E 3SY6A 3OR7A 1U42A 2FT7A 2OR8A 2Q3XA 3AGWA 3CX5J 3QUMB 4W68A 4ZFQA 3R8QA 2R0LL 5EEXA 5TPWL 5CEZE 4AVHA 2BJML 4YDKL 5KBDA 4EPSA 3HC3H 2YOCA 3DRQA 3MOAL 1F4YH 2OPCA 4KKBD 4G8GB 2YPLB 4RFOH 3D39B 4FLRA 5KSBE 4XMZA 5I6LA 1AAJA 5KS9E 3LD8B 1KGYE 3N1QC 3EBHA 4UOW0 1Y0LB 4YNYA 1PIGA 2DEYX 2WNKA 1M57B 2OM5A 3ARXA 5IP4A 4KJYA 1ZHNA 3WOVA 5BO1L 3B2VH 4IW4C 1GS7A 5GZNA 3O9WB 3N1PC 1HX0A 2GW5A 2YD0A 3ARVA 2J43A 5DYOB 1JPTL 1BVKB 4M3KB 1XAKA 3GMRA 5FO2A 3QXDB 4Z7UE 2EECA 1K8IB 3GMLB 2H2PC 3QEHB 1JZGA 1Y6MR 3ZE0E 3AU0A 4P5KA 1KGIA 4TVSa 2YJLA 1AY1H 3WJLA 3AWEA 3GF8A 3RX5A 3KR3H 1NDGA 2H2SC 3TIDB 4RFEA 1T6VN 4O4YH 2LR4A 2E56A 3ARRA 3MJ9L 5EORH 1URZA 3HC0B 3T0DA 3H8NA 5I8CA 3HE7A 4YQXL 1HDMB 1SM3H 5DD6A 2YFNA 3UGUA 3B3IA 5I26A 2X2JA 1ZANL 5I0ZA 5LBSH 5K9OB 1AFVL 5GSVB 1BZ7A 2AZUA 4CL7A 2NY5H 2XWBA 1MHPH 2EIBA 2LW3A 3AABA 4WY7L 3D25A 2H26A 4Y7MA 5FHAL 1KCUH 1HL5A 2GEQA 1FZMA 4ZXBA 4AK1A 4C59B 1YPZE 4ZMXA 1EEZA 1DANT 5HD8C 12E8L 1KNOA 3LRKA 3F7VB 4IEFA 1KTCA 5CNHA 4HUCA 2ZXEB 2X9XA 1F00I 1SY6A 3KPLA 2W92A 5HI4D 5JQIB 3LMJL 4WUUA 4D9LH 4NZUH 1U8HA 4HIJB 1FHGA 2BP5M 1XH1A 2APWA 3L5WA 4QXGH 4PJAE 4UV4H 4FFYA 1CYGA 2Y72A 2BIHA 3FC8A 5CJQH 2M26A 3X3GH 3BI9X 4JY6A 3GMQB 5DQ9B 1DDHA 1RJLA 2R0WH 4H8WC 1N59A 4GRMB 4X7CC 2VUKA 4FLQA 4YGVB 1JZ6A 4JO1H 4FQLH 1NCDH 1JHTB 5K39A 4PY8J 4KROB 5DC4B 5HI3D 3DVIA 2CLVB 4BBWA 4RETB 2V9QA 2EADA 3O3DA 5TK2A 1IMHC 1AGBB 2AC0A 1M1SA 5F9JA 3O45B 1X7QB 3HNTH 3SYOA 2QQLL 1KIPB 3VXPA 3B8SA 1HQRA 2F8IA 4HT1L 2M2DA 4DCQB 1FG9C 1Q0YL 2P8PA 2EE0A 2A77H 3BKYL 4JCWA 1Z9SA 1G1OA 4OJYA 1KLGB 1Q9WA 3SPGA 4OFIA 1MY7A 3UJTL 2VDNH 3CFEB 4JG5A 4KH2A 4ILDA 3TBCA 1J11A 2A6IB 2OCFD 3PJNA 5AW0B 1JUFB 1S7QB 3LQAH 4NQEA 5D7JA 1T5WA 3G6DL 3R18A 5EU3A 2E47A 3WY1A 1TSHA 3KYMA 3U4KA 4LASL 5IJVA 1N70A 4EMZA 3RURA 2NY6C 5C9JA 1RP8A 5DMGC 5EHFA 4E2OA 3CX2A 3QYMA 1N6QH 3REVA 4HCRA 4PS7A 4LPVA 1MIEL 4W93A 3ZBMA 2ERJB 3W81A 1U58B 2ZSVB 1A6WH 3B83A 3RL1A 3IDGA 5JHLH 1H6TA 3ZKNC 3QJZA 1TYEB 1E6JL 3TYFB 5IHWA 3PJSA 3CXHK 1WFOA 3I02A 4HC1A 3SE4A 3UC0H 1UOLA 2E59A 2IEPA 4LE8A 3OHXA 4AQ1C 1JAEA 4NNXA 1ADWA 3GWJA 5F1KC 3OTTA 1HNYA 1I7TA 1MPAL 1XGUA 4R7DB 1JPSH 2IG2H 1AGEA 1WK0A 3PL6D 1UB5A 4PJCF 1D5XA 3DVNB 4BE5A 3O3UN 4CMMB 2E7LA 1JZHA 5E9DB 3DJZA 1J8KA 4GUOA 4AUJA 5FECB 3FU8A 2ZCZA 3TBVA 5IJDC 1U3HA 4U6VL 2EZ0D 4FQQA 4XT1C 1JCKA 4N2OA 1ASQA 1ZDQA 3ZRCC 2HVKA 1KJVA 1DBMH 5F2FA 3OAZH 5AFAA 1Z5LB 1I1CA 4OCSH 4PCYA 2DM7A 2A38A 1UYWH 4OFYA 4UUJB 5JO5A 1GC1C 4YZWA 2WSPA 2JSFA 2FBRA 2D3VA 2LAGB 2NY4C 3W9EB 2WQWA 5LKNA 1FYTB 1RD6A 2A83A 3LN5A 3ABMB 4E9XA 3E6HB 2EVGA 4UT7L 1UURA 1YY8A 3S7GA 3ZDYB 3T6VA 1EDYA 2O5XL 5KVFL 1M71A 3TO4D 2EP6A 5EUKB 1HXYA 5DDHB 4GQ9L 2QFPA 2ZKMX 2B8OT 4Y19A 3OBAA 3SDAC 4C4KT 3UBGA 2A1WL 4E68A 2CD0A 5EDSA 2VLKA 1RMFL 5HVWA 3KPNA 3RILA 3IFLL 4FCHA 4RA3A 2BW4A 4YAQB 3TPUA 1AZUA 1EZVX 5KBNC 1MI5B 3BQUB 4CVXA 4HIEA 2OSLA 4KAQH 4PJ7B 2FWLB 3VD3A 3NCJH 1SUHA 4G6JH 3UMNA 2ZWKA 1BXUA 4H1LB 2JKLA 2NDFA 4KK5D 1KIQA 4JCLA 2YLKA 1R3IH 2WINA 5LO7A 4APQB 5J6HB 2DLTA 2KDYA 3DLQR 4IMKC 4WJKB 1KTJA 4QXUL 4FJ6A 1PLGH 3TF7C 1ZDSA 2Z1KA 1EO5A 2YMXH 2HA1A 5DZ9A 2YXWA 2AQ3A 3ISWA 1S2EA 3LS5L 3QT2A 1Q9KA 4R4FL 3BKJH 4J5VA 5D7EA 2WWKO 2Z35B 4WUKH 4XR8C 3AT8A 2FWUA 3U46A 4ZMNA 5T33L 1ZLDA 1AQKL 2VJ8A 1ZLUH 4FL4B 3GHEH 1IC0A 2VM9A 3NPSB 2ED7A 1YJDC 3HZVB 1K2DA 1QZ1A 2BZDA 4G7RB 4MQXC 5BUAA 4FE9A 3L2LA 1ZPUA 2X41A 1J9CT 1T03L 4Z7WE 4E42A 3ROLB 4NO3A 2JCCF 2YQ3A 2CBPA 2KYIA 1EIBA 5E8PA 2R7EA 3O4LB 5IMLB 3AROA 1XIWA 2FLBT 3QIBA 5ALCH 1ZE3C 1N7MH 5I76A 3Q5OA 3V2AR 3IDMA 2P5PA 3T3PE 3DK0A 4XPGH 1CDBA 3RU8H 1KF9B 3GBNL 5IWLA 1JNLH 3GSNB 2IPKB 4U1NB 3QFGA 1BBJA 1ACCA 1L9RA 2Y7QA 3AQYA 1UXMA 2BCMA 3QDAA 1FIEA 4G8FA 4FQXA 4OCYL 2PR4H 3LKSB 4TSCL 5HYSB 3NFNA 2QGEA 3RJQB 1NZRA 1KY6A 1LXMA 1P5VA 1EZSA 3EJZC 2UXTA 5CJXC 4AVJA 4FYRA 2EAEA 3MZTA 2F7OA 5TDOB 2NCEA 3S37H 1ZSDA 1WYJA 2N59A 3N2JA 4N90D 5B3JE 4XCEB 2ZX8A 3FTUA 3H9SA 5KYYA 4NFCA 2R2BA 3W57A 4J3WA 1FNAA 1UEYA 4RMRA 1G7HB 3QO1A 3THMH 3OLEA 5I1HH 1TU2A 5GJSL 2PCXA 4L1SA 3DX8B 4FS0A 5E8DH 5C0IB 4FEMA 3S6CA 2Y7MA 3LQMA 1WICA 1F4XL 5ESVB 5EA0H 3DX9A 4M8QA 5F0LB 3V5KA 3LPPA 4MA3A 3QG6B 5AENA 2IAMA 1T1YA 4WI9A 4YEFA 3NAAL 1ZLWK 1V27A 3VWJA 3GBDA 4EVNA 2A4ZA 3WNLA 1IJ9A 3D48R 5F7BA 1AGFB 4HLZH 5JDJA 1IGTA 4HUWB 1HQ4A 4OF5A 3GI8H 1EWHA 1AMYA 1S5HB 3AS1A 3IDNA 3KPOB 1DBJL 4TTDD 2VXSH 1UXLA 1NBZA 1IAKB 2WNWA 3LZNA 3D0VB 4FA6A 3GBMH 4ZMPA 3L4CA 1WUNT 4OZGE 5D5MB 4O51B 4O5LH 3JV5A 4H5SB 4RZCA 4G7QB 4YGAB 5IB4B 4CJ1A 5CO1A 5IBLD 3UDWC 4B7IA 4OV5B 5E6IA 4TUKL 1EX0A 2D4DA 5IB5A 2QGDA 2HH0L 4HWBL 5H4YA 1QI4A 3VFSA 4P2OB 4DKFH 4Z78A 3EBAA 4GMSL 2W0PA 3MRDB 4PW9A 2J5WA 1CWVA 4TPRH 2BP0B 2NY1B 3E2HC 3F58L 4AYFB 1KCWA 2VABA 4F58H 1XR9A 1QO3B 3ZHLA 4AYDC 5KAQG 1NLDL 2NUPB 3OGOE 1GKEA 2IAAC 4F9PC 2YJQA 3E1ZA 1U36A 3TTSA 4M4RB 5SV3A 3UTZA 1UM4H 2FJFB 4F7TA 4NRZA 5HJGA 3TP4A 5EEZA 3CSPA 1HINH 4ZMLA 2UXGA 1AYOA 2ZCKL 2WLLB 4KXCA 1U8CA 4PJIE 4IBSA 1V7NH 2AXFA 1CU4L 4NEHB 3NGBB 1JGIA 4N2BA 4Y5XB 4HAFA 1BAGA 1XBDA 2Y1AA 2HWZH 3D4YA 3E80A 3M86A 4R5VA 4XXWA 5EDXA 4G6AC 1DJGA 2DQUL 2QADB 1KXHA 1DL7H 2XIIA 1RZJC 3AB0B 2NZ1A 4PHZA 2EYRA 4N0FB 4MRBA 4PWFA 4PSRA 5IF0B 3N1GC 1QBML 2AMUA 2CBQA 1C16B 1TETH 3QIUC 4N0CC 5T5NF 4N85A 2QPFA 4POYA 2AABH 4N90E 3WD5L 2WAHA 3QZWG 5EN2A 1UWYA 2WNGA 2PPAA 5AAPA 2A6KA 2R56H 3KLHC 3WMSA 5GGVL 2AXJA 3HC4H 2HX7A 1GOGA 3TPKA 1C9SA 4IDLA 1YNTB 4DEUA 4ADIA 1ASOA 2V37A 4WFEE 4CC0A 2AK4D 4XVUC 5FS5A 2GTWB 5FOBA 5FR3A 3FNKA 4FULA 3ZMEA 1KPVB 3BRDA 1N64H 3GJFB 3BD3A 1VERA 3ZTNH 2WZ0A 3UAJC 4ABUA 1F6AA 1QYGL 3EYVB 4G8EB 4DW2H 2GBTA 1HS6A 1XT5A 3I6GB 4XPHH 2Z8WC 4OZIE 1X5HA 2ZG2A 4PB0H 5IVXF 4DPBX 1MCJA 4QT5B 1JPFA 3HBPA 3EJTA 1BGXL 1AGCB 1R4XA 2J6WA 2QLVB 4MKTA 3LD8C 3KWWA 3O8XC 1DSYA 1KZQA 2DIEA 1EHLL 3P3SA 3SOTA 4F8NA 3P73A 4XNQA 2Y5QA 1J9SA 3DPBA 2JELL 3FQRB 3MGOA 1BCIA 5D6DA 3RB5A 1AR2A 5EU5B 4ODTL 3SJVD 3UTSD 4AGNA 2M1KA 2YHGA 4R4BB 4XODA 4I0KA 4L29B 5EBMB 3NCMA 3FRUB 3O9WC 5DJAA 1KLUA 2BDNL 3C5ZB 4PIBA 2BVEA 3PHQB 3MA7A 2VLJA 1E0OB 2AJVL 4N8VG 2QDVA 3C08H 1H5BA 3S5LB 3QQDA 5I15L 2X42A 4PU2A 1X5KA 4HIQA 1MW3A 1MCCA 3DGCR 3PQYB 5D2LB 1XQ4A 2OZ4H 4HAGA 2DQDH 5F1IA 4EI6A 1NGZB 3K2IA 6PCYA 4B50A 3PP4H 5AKTA 1LYQA 1NDTA 4AGLA 4ZFOA 1YRKA 3STBA 2H0FA 3HNSH 4BSVB 4LSUL 4F2MA 3O6FD 4NQCB 2Y2WA 2RAMA 4B9CA 4G1EA 4KQ4L 3U1PA 4EN3A 2AAAA 1FSKB 2MPAL 2XPZA 1OAXL 2YSSB 1CE6A 3UJIL 7PAZA 4CDHA 2XA8L 3S5LG 1A65A 1OB1B 1N0XL 3EYUH 3MJ7B 4HPYL 2DD8H 1VDGA 4FMFA 3HB3C 5I0WA 1G7MB 1FZKB 1ZLVK 1GGBL 3IJYA 1UD2A 1PG7L 3QWRD 2LAAA 4PRHD 3W2DH 1MHCB 4AGPA 4MS8D 3F7QA 1J8HA 1WHPA 1TCRA 1SJVA 1R1CA 3Q9PA 4TUOA 4GOSA 3SOBL 5F70A 1DBKH 3C6LA 3DJTA 4GRLB 4NWUH 1GS6X 2VT0A 3HFFA 3QZMA 1KJMB 3BH9A 2Z8RA 3QCVL 3HMXA 4GBXA 3EW3B 3UG5A 2XZQL 2KLTA 2R0KL 5FUOH 3GXUB 2AI0L 3Q44A 3MV8B 5E4IA 2EE3A 3S35L 5BZDB 4YE4L 5I1JL 2QQKH 1YECL 2VMEA 5HJBA 3AY4A 3QIWA 2R29A 1KWKA 4X4MA 3S9DB 2ADJB 3L81A 2PWEA 4FXGA 2BY2A 3ZE2F 1CICB 2HYMA 1ZT4A 1M1XA 2JJWA 3LOWA 5IQ7L 1MQKL 1BD2D 4KROC 1XF2A 2DQIH 2GAZB 4P4KA 2WGNB 2AK4E 4H8PA 1PKQE 5ECJE 4Y88A 2P44B 5BXFB 3ULUC 3ZUCA 5EUOE 3RGBA 2I7SA 1FCGA 1N26A 3NA9H 4IS6B 5L6YL 5HYJB 1UVQB 5T1LB 1JNHA 1CGXA 1PZ5B 2C9XA 3V0GA 2P1YA 2HG5B 2DMGA 2YRLA 4JJ5A 4KK8D 4LQ1A 1FN4B 3H9YA 2ADFH 3MLTA 4L8DB 3EO9L 4JHAH 2XPGA 5DRXA 4LSDA 3SBQA 1RJYB 4D9RD 4A6YH 1ZVNA 1NGPL 2PTTA 5BRPA 4K3JL 3SYAA 3SJVE 1J5DA 4PG9B 2IADA 3PV6B 4WI4A 3TIEA 3L5XH 4RISH 1WZAA 1JGEB 4HBQA 1N68A 5I8KH 2ERJC 3LIZL 2IANA 2X6MA 3DBSA 3L3GB 3WHE1 2P5ED 1G0XA 1ODAA 2JJSA 4JY5H 5SWSA 4OCWL 2FJHB 4OV6F 2QR0A 5EOCJ 5I6PA 4F33A 4OGXH 5B4MC 4B3EA 2VE6A 3GMOB 5FFLA 2VUOA 2WCGA 5MHSE 2XC8A 5KW9L 2IFFH 1NAKH 4Y1AD 5EF1A 2CO7B 3P30H 5AB0A 1WGOA 3ORJA 1TSRA 4ZUVB 4OAWA 3GB7B 4AM0B 2NY3B 4PJFB 3MNWB 2QPEB 3IEAA 3QCUL 4ODWB 2H0EA 2H9GB 3Q8EA 4V1DD 3IU4L 5JW4N 4DZ8B 1A6TA 4X80L 4PRHE 1QRNA 1SJEB 3ZY7A 3AXHA 3VXUD 2WXRA 4H4NA 3GSOB 4YEEA 5AAWC 3WMQA 4NXKA 1W80A 1FVDB 4OFKA 3DHJA 3FUMA 1RLWA 4OD2A 5FFOA 4AZ8A 4GO8A 2YA2A 3NCBB 1T83C 2JK5B 3DRTA 5FYJH 4LCUB 4AT6A 3NIDE 4HUXB 4JAMA 1BVNP 2AGJL 5HYIA 1FGNH 1FGVL 3QAZB 4Y16D 3QRGH 3T1FB 3MRFA 3ZX1A 4AYBA 2WBWB 1Q9LA 3IXTA 3ULVD 4BH8A 2E9JA 2EIZA 4LCYB 3T77B 2FT8A 3BXNB 5B22A 1EXUA 4P5TB 4LDOB 5C09A 4JO3H 4U1IA 4J6RH 1TDQA 3BQUC 4ADGA 3U4BL 1B3JA 2IIJA 4P23D 3U7YL 5L9DL 5DK0B 3OKEB 3MGTB 1F8TL 1KTBA 3KDMB 1L5GB 1FFQA 3WXVH 3AS3A 3TF4A 1U33A 2MNJB 3C6SB 4I0CC 3V4LA 2BNRA 4LMQI 1GPOL 4N0YH 3LY6A 4F8PA 4APQC 2N1TE 1W0VA 4TOYH 4NXSA 3SDXA 5D1XA 1QNZL 3VWKD 1BD2E 4LKXA 3CN3A 1IKNA 1FL3B 1G9NC 4LLDA 3PHAA 2R23A 2I60H 5F9DC 4ACTA 3TBSA 5IG7A 4U1JA 4K15A 3SODB 4IU2B 2B9BA 2GEEA 2VM3A 3X1FA 3GHBL 4OGAC 1GGCH 1LO4H 3WY4A 2WN3A 2XWZA 2A73A 2Y22A 1KGCD 3GRGA 5EOQH 3PGFL 4Q97A 4MSWB 1YEDB 1SY6L 5ID0A 4X5QA 5JPNB 3NPSC 1J1PH 5C2UB 3GNMH 3O2VL 4NPKA 4WW2F 1INEH 1UZGA 4LFHD 4NQEE 3H3KA 4HQQH 5ID1B 5IESH 2BWDA 4DKEH 3GEFA 3DXAD 4CSTA 1HAUA 4LGSB 4RSYA 4FFYL 5E5UB 4GG6F 3IF1B 4D9RE 3N55A 4YHLL 2G75A 2VLRA 4CVZB 5E24E 3RY6C 5GGTA 3SB3A 3O6MH 4LSPH 4XHJD 1ZS8B 5D72L 2NYZA 4ODSH 2GKIA 5DZJA 1A8ZA 3IFNH 3ILEA 5E03A 4KXDA 3RB7A 4LEXH 5EMYA 4AMKH 2IALA 2NSXA 4P2QD 2V8LA 2EEXA 2VTFA 4K8RH 3G04B 1S7VA 4HKZB 3A4DA 5DUBB 3QNFA 3JWNG 3L3KA 1JPEA 1FFNB 1E8ZA 2F19H 3IKCB 4PJGE 2ESVB 1JV5B 3R06A 5TGBA 1LEGB 3LKPB 3N85H 4PWGA 3N9GH 1UD8A 2ED8A 4IKIA 2AJ3A 4WLCA 3WY2A 4IBVA 4ALAL 1MCPH 4Y1AE 3EO1A 1JDCA 3H9HA 4KDWA 5I66B 5DFWH 4N2DA 3UC2A 1D6VH 2FL5B 2Z34A 2AQRA 3L9EA 2A3TA 5AYUH 4MMXB 3GXNA 3BT2H 3BH8A 4Z0XA 5C7XH 2WIIA 2DMCA 2MCPH 4XMTA 3WLWD 4V1DE 3MRNB 2AXGA 1IM3D 1P84K 3VXNB 2VDLB 2PO6D 4QOKD 2FX8H 4JQIA 1FPTL 2ALWA 2X4RA 1YEIL 2DWEA 2OMYA 4HCRL 4KQ3H 2VWEC 1MH5A 4HK0B 4R9HA 2W0FB 1K4CB 3VD7A 2NLJB 5C92A 2CMRH 3CFKA 4BGDA 5JUEH 5D2NB 3KWVA 3VH8A 3V0EA 2GTZB 1C5BL 4HC1L 4ORGA 4NB7A 1C5CH 1UH2A 2VL4A 3D8MA 3D85A 5BS0A 4U7KA 5TE7L 2A0LC 1MELA 2Y7OA 3DTXA 4K5LA 2HN7A 3SDYH 1GZPA 1R3JB 4DFIA 5I1GH 4OR1A 1EFXD 3U0TB 5IHUL 3BAIA 1PGRB 1U8MA 1OGAD 1IGMH 2BXZA 3GSQB 4LCWD 4NX0A 5B7MA 5MERA 4MHHG 5BZZA 2ODHA 4XMPL 5CCGE 1JRHH 2Q2LA 4A7UA 3QJXA 5CD5C 5KSBF 4J3OH 5EU6A 4MWFA 1RPUA 3HKFA 4AEFA 5KS9F 3PWVA 5L2KA 4NDMB 1TQTA 4BSWB 3Q1SH 3G6JA 5KBLA 2J2ZA 3SSGA 5E70A 4JHWH 3Q5YA 1MCFA 4P2OC 2KERA 1OTSD 4Y5YA 1HL8A 3RWJA 1GHFL 1C7TA 4LVHB 1E2WA 1CTMA 2WO4A 3TBWA 4Q9RL 2NY1C 3MBWB 4ATWA 3ZT6A 2YUWA 4F20A 4MJIB 5EO1A 3V4UH 4Z7UF 1E42A 3T0VA 2Z0BA 4NO5B 5D8JH 2BNQB 3L4UA 3V8OA 3LPOA 4IBTA 2Q86B 3ZE0F 1VA9A 2R2CA 5B8CA 4XWGH 2BVQB 5G4OA 4CC4A 1NOLA 4NBZB 5JORB 3MA9L 5AWNL 2HJFA 2Z91B 3W3BA 5I1DA 2A74A 2N1KA 3H55A 2BSSA 4BHUI 1Z66A 1A4AA 2N7SA 2HLFC 3EJYC 1HCFX 4IKJA 5D4HA 4UOZA 4W70A 2VDQL 2FNWA 3QEUB 4R8WH 1J5OL 1AZBA 4GG8B 5CILL 2X4OA 4L8CB 2YWYA 3NGBC 3WEOA 4Y5XC 2J5LB 2FATH 2JMRA 2DW5A 5I9QB 1HSBB 3QDMB 5E6UB 5ACZA 3UBHA 1ORQA 1I9EA 3ESNA 4HDIB 2EYTA 2FX9H 3ARWA 4HXBL 4P2QE 1YYLH 4AJYV 3UO1H 5D7LB 4X6EB 3AB0C 2ATKB 3LHPH 2AITA 3GXDA 1QSFE 4AYGA 1YPZF 3BH4A 2RGSA 3M6DA 3CAFA 3U4EA 4HVBA 3IMVA 5FYJD 3JZYA 2IH3A 1S9XA 2APTA 1DSFH 5CSGA 5FCUH 3X11A 2VXTH 4QYAA 3SDCA 1LK2A 3B6SA 2A4EA 1N19A 2G2RA 3HZYA 3PXHA 4UTAL 1LE5A 4XGZA 4DO5A 3IAQA 3RWCA 3TEWA 4WFGE 2G5UA 3U7WH 4DK6A 2EDRA 3QUKA 1VEMA 1JWUA 3BW9A 3FT2B 5F3HB 1S7SA 2CCVA 1F56A 4PD4K 2VDOB 1IGFL 1MJ7L 4UNVA 1RZKL 3PIQB 1QTPA 4QOKE 4P9HH 4H0IA 2VDPL 4LIQL 3UERA 2BLFA 2VH5L 4Y4HA 5D1ZB 3RWDA 4AY0A 2ZYHA 3FFCA 4Y2DB 3RP1A 5F89B 1KTDB 3EGXB 3ZLQC 5E51A 1I9JH 2VXQA 4G9FA 3TVMD 2YIHA 5JW5B 4I1PA 2J56A 4OH2A 1FNSH 2J88L 4FXKB 1Z9NA 1D9KD 5BRQA 4XAWH 3GRBA 1DFXA 4LSQL 3MROB 1A1NA 5HHME 4I3SL 2VR9A 4YO0A 4DN4H 2TRYA 4H0HB 3EJUA 1I8IA 3LX9A 4HIXL 5E5MA 2AJSL 1EAPB 4K7PH 1WISA 3NACL 4LCWE 2BRQA 4UQIM 5E00B 3TT1H 5BJTA 1KG0A 5D6CA 2WCPA 3K1KC 3QE5A 3KE0A 1OE3A 3C5ZC 1U92B 3OZ9L 1GCYA 1TZIB 1MJUH 2P26A 3QJFB 2JXMB 3L4VA 2UY7A 5AOLA 2X2IA 1TQCB 2RALA 4FLSA 3EHBB 1KV7A 1YCSA 3VSQA 2D7NA 3QFJD 4HSAC 2ZUYA 2J55A 4PLKD 1INDL 2R1WA 1OSYA 3OLDA 1NSNL 4IRZA 5CBAA 1HZLA 1SYVB 3DIFA 2XU9A 1HE8A 2OJEA 4AEIH 5HHNB 3GIVA 2C8NA 5E4AA 1BLNB 2YBGA 1A7NL