1LE9B

Crystal structure of a nf-kb heterodimer bound to the ig/hiv-kb siti
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
312
structure length
312
Chain Sequence
GPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 5'-D(*TP*GP*GP*GP*AP*CP*TP*TP*TP*CP*CP*T)-3'
publication title The x-ray crystal structure of the NF-kappa B p50.p65 heterodimer bound to the interferon beta -kappa B site.
pubmed doi rcsb
source organism Mus musculus
total genus 45
structure length 312
sequence length 312
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00554 RHD_DNA_bind Rel homology DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1le9B02
2.60.40.340 Mainly Beta Sandwich Immunoglobulin-like Rel homology domain (RHD), DNA-binding domain 1le9B01
4JY6A 4OZFA 3PXJA 1T3FB 4QCIB 5TFSL 2OJZL 5DA4A 3MV7D 1T0NB 4Y88A 3T0ED 1RZGB 2RCSL 3NCYP 4FQJL 1N59B 1HHJA 4DN4H 2BXYA 1R3IL 2FL5B 4IOIA 4UQ3A 2DKSA 1KEMH 4LLYA 3K2UL 2HH0L 3KLSA 5HHOE 3EDFA 3MRMA 1ROWA 3MA7A 5D2NE 5GRUH 4KJQC 5TE6L 1AGEA 4MJ4A 2VDNH 4B41A 4OF0A 1KLGB 5DJ8B 4U1LB 1K8IA 3QQ3A 3GMPA 1A6ZA 3MRFB 2B1HH 2OK0L 4TVSa 2OL3A 2VDLL 1A0QL 3QUMH 5C0GA 3QEHB 3SE3A 4LCYB 5DRWA 1CD1A 1I3GH 3JWOH 2R4RH 3B9KC 4GXUM 3MJ7B 4NRYA 5E5MA 4MD0A 2LFGA 5I71C 3PP3H 1S9XA 1RHHB 3HE6D 3KJ4B 3MLRH 4H1LA 3FO0L 1F90L 3FAXA 4WI8A 3ZT7A 5JDSB 5F7LB 4G8FB 4ODVL 4P57A 1XGTB 2MQ0A 3BSZL 3RKPA 5C08B 1IFHL 1JIBA 3WO4B 1NANH 3SGDH 5CAYB 1RURH 5EH1A 1GC1H 2AJSL 5HDQH 2C4FU 3CXHK 3PQYB 3BT2H 3REWB 1UA6L 4YHOH 4XWOD 4FXLA 2HKHH 3P73A 2BNUB 4G9FB 2VLKA 1FLTX 3MRCA 2Q87A 2HMIC 2UWEF 2F5BL 4NQDB 1NC4B 3HC4H 3VRJA 4UT7L 4P5MA 3OXSA 2E8YA 2AGJH 3SKMB 3U4BH 1XGQB 4J4PC 3VFRA 4F2MA 1JZ4A 1W0WB 2NXZC 3FB8A 3MUZ1 2R0LH 1Z9SA 3M17A 4RMVA 2AJXL 2VLKD 4QY8A 5CSGA 4KK8D 2J6EH 4R4ND 1A5FH 3QNXB 5T33H 1BMGA 4DVRL 4JANB 2UZYB 1OL0A 4ZQKA 3MXWH 1QO3A 5FECB 2Z8VC 4C4KT 5IQ9B 4HAGA 2RGSA 1H3TA 1TTUA 1ZS8A 5E7FA 1NMAL 3WFCH 1QFWH 1XGYL 5D7LA 4XPBH 1HSAA 4HIHA 1G7QA 3OZ9L 5CWSB 3D25B 1IEHA 5BQ7A 1I8IA 4QYOA 3NTCH 4JDTL 1WFNA 4UDUA 5IMMB 3FQXA 1U3HB 3DX8B 3QNYA 1A9EA 4FP8H 4O4YL 3MLPA 3JBG7 3HC3L 1KIRB 3DX9A 3QCVL 5CILH 3PP4L 3A6BL 1CGWA 2I60L 3WHE0 1DEDA 3ARBB 5IKCB 1RIVL 1FNEB 5DD0H 3IF1A 5D7LD 1DBAH 1ETZA 3KYOA 3PUCA 4QRPA 1U8OB 1IGCH 3V4PL 3CK0L 5JORA 5J89A 3RDTA 1JFQL 2JB6A 4AQ1B 4PJ8B 4U6HB 4NT6A 4QT5A 1FYTE 2DQGH 1Q1JH 3RJQB 1RIHL 5C0BA 2IH3A 1ZT4A 5DJ0B 4OD1L 5H35A 3WYRA 5F1IB 4FFWC 2R4SL 3MODL 4QRPD 1XGRB 4Q7DA 3IETA 4NKDB 2R29L 3RDTD 2JJSA 1QSEB 4M7JL 4U0QB 1P7KA 2A6KB 3A0OA 4JZOB 4K3HA 3TBWB 3HI6L 3BD5A 2R0WL 3IGAB 4F9LA 1H3XA 1RSFA 3PGFH 4XBPA 5H8DA 4HT1L 1ZHBA 3KYAA 5EC1B 1B0WA 4PTTB 3RBSA 1T7VA 3NIFE 4OKVA 3TJHD 3WNKA 1OSZA 1TNMA 2FHBA 3DGGB 5IFHH 2NYYD 1YECL 5DJAB 4TSBH 5FF6A 1YZZA 2VR9A 2XWJA 1OP3K 4N9GB 4XPGH 5HSFA 3HE7D 3EO1B 5B38B 4GG8A 4XCFH 3W0WA 5IFAL 3GGWA 3L9RA 1I3RA 2Z8WC 4XPHH 4TVPL 1IAIH 1KUMA 2UVFA 3B5GA 1QLRA 1YEKH 1EO5A 1WEJH 1FVEA 4RNRA 4WGVB 4F7PB 4PB0H 4PR5A 1LMKA 2FBOJ 5A2KH 1X4XA 4M62H 4TQEH 3W0WD 1CU4L 4PGCA 5EC2A 4JFXB 4HUXA 4TVPD 5D1ZA 1BVZA 4D9QD 3STLB 3LEYL 1LDPH 3Q3GB 2IPUG 2Z9TA 2EE2A 2X9YA 2XZQH 3CFKB 4XCCH 1QYGH 5T1LB 1SJXA 3PE9A 3C6LC 1U8MB 3GB7B 1IVLA 4NSKA 2FGZA 1VSCA 5MEOB 1L6ZA 1NAKH 3B43A 1FVDA 3VGFA 4BELD 3OKKA 3P4OA 3EJYD 3JUZA 3EYQD 4N0UB 5D1ZD 3V6OE 3VXMB 2BHZA 4MD5B 4J3XA 4NQED 3KLAB 3A6OA 5TE7L 4X80H 3S35L 4CGTA 1ZA6A 5DJ2B 2DQFA 1EEZA 4YHKL 3GSNB 1V3MA 4Y0GA 1JZ8A 1UM4L 3QO1B 4PLKC 3I02A 5AWNH 2HLFC 2FNBA 3FL7A 1SJHA 1VADA 3DYMA 3U36B 4P2RB 3TBVA 4OIAA 4OLZL 4LCUA 2VH5H 5K9JL 4LSQL 3WV0A 2GUOB 2EEDA 1Z0NA 2APFA 3IJHB 4OZFH 5EBWB 5TFSH 2OJZH 2E7CA 2MCPL 2RCSH 4FQJH 4K71C 3RGVA 4J7RA 5FDWB 3T4YA 2ITDA 4N90D 2B7DT 2HH0H 3UTOA 1RZIB 4MA1C 3RFZC 5BMFH 5HHMD 2X1QA 4PBWD 5TE6H 5EULV 1HDMB 4ODBD 1D5ZB 1NGWB 3HCVB 3CC5B 5HVHC 5J56B 3GMNB 3HRZA 3PF2A 4OLUL 1U8PA 4DUVA 2OK0H 3RGVD 2VDLH 3GJEB 1A0QH 2Y72A 1TETL 4NFCA 4RFEB 4HBCH 1G7MB 3KNBB 3PDGA 2MHAB 4LRIC 4YO0B 4F15B 4P4RA 12E8L 2OM5A 2DQTL 3L5WB 3FO0H 1F90H 4H1LH 1XIWA 5JHDB 1Y18B 4ODVH 4JFZL 3BSZH 4O2CB 1TQCC 3TN0C 3QDJD 1IFHH 2IF7A 4NWUL 5MHSE 1XF3A 3OAZK 3VXPA 4MX7A 3PIQB 15C8L 1JZ5A 4PJ9A 3MZGB 5CZXD 3O9WC 4X0KA 4ISVB 3M07A 4OQTA 2AJSH 4OQTL 2P4AB 3UJJL 4WTZG 5JMRA 5CGMA 4LGSB 1KTLB 4HS6A 5I1AB 3OKOB 4M1DH 5BVJA 5GS1C 2F5BH 2VLLA 5IB5B 5L2KB 4UT7H 1ES0A 1QP1A 3WD5L 5HHQB 3P4NA 5HYJA 2FJGB 2X4SA 5SWQA 3WIHA 3MGTB 3WIHL 5C0DB 4PJ9D 3IU3A 4FQIL 2APWA 3V52H 3PNWA 2WSKA 1FORL 3QG7L 4LVNC 1AD9B 3ECBB 2AJXH 3ULVL 4B50A 2I5YL 2R23A 1SHMA 1T1ZA 3KHQA 4QLRA 4DVRH 3WNOA 1G7IA 3UTTA 3NAAL 3LEXA 2Q8AL 1MELA 5D5MA 3K4ZA 3V7AG 3MOAL 5HYJD 2YEZB 2VWEC 3SDDA 5I1CL 2LU3A 3ARFC 1FFOB 2EC8A 3CX2A 3ULUE 1NMAH 3IFPA 5DURD 5EOTB 4HW6A 4XP9L 3WIFB 2YR3A 4HMCA 4AT6A 1XGYH 2ESVE 2W92A 2AK4B 2CKNA 5HGGS 1WBYA 3ULVD 1AP2A 3OZ9H 4YDVB 5JMOC 3QEQD 4LOUD 4BZ1L 4PV8B 3REVA 2NNAA 1MCPL 3UTTD 3K3QA 2GQHA 5EO9A 3SDDD 1FL3A 1JK8A 3E6FA 1NGZA 3D0VB 3HC3H 3QCVH 3PP4H 3A6BH 3T0EB 2I60H 2NCMA 2GCYA 4LP4A 1RIVH 4PLNC 2F19L 1NGXB 4X83A 1CDHA 3CFDB 3V4PH 3CK0H 3NFNB 3HI1A 1JFQH 3WNPA 4PJDB 3QRFM 3SDCA 1WIOA 1WT5A 5D72L 5DJCA 3B3IA 1RIHH 1KPUB 4PJBF 4P59L 1KN2H 2CXGA 4OD1H 3RIFF 4X9HA 2W9DL 2NY6C 3CZFA 1HHJB 1FRGH 4W81A 1D9KC 4W4OC 2R4SH 3U7YL 2ZKHH 1QPXA 4IOIB 4NN5B 3LKSA 3MODH 4NNYA 4UQ3B 4ZNEA 5I6XC 3MRMB 2V9RA 2R29H 4WV1C 1OP5K 4RA3A 1T83C 4OBSA 4M7JH 3MA7B 3RI5F 3SDCD 4S2SA 2PXYC 3SPVA 3HI6H 2R0WH 5CBAB 5GPRA 1K8IB 3QQ3B 2JIXA 3GMPB 1A6ZB 4QHNB 3KPLB 5IJKA 5BS0A 1ZLWK 5A16A 4HT1H 2OL3B 5C0GB 5DRWB 1AR2A 1CD1B 4POYA 1NEZB 3UDWC 1YECH 1IRAY 1XR9A 5E5MB 4D94A 4MD0B 3QI9A 5C71A 5C0AE 1S9XB 1C7TA 2CDEA 3ZE1E 5HVWA 5IFAH 3T4AA 4I18C 4TVPH 1CICC 4O9HL 5B4MD 3B9AA 2JIXD 3G5ZA 5IW6B 5BS0D 3GI9L 4V1DA 3MRIA 3ULVF 5I1LA 1CXKA 1UXSA 1UB5A 1C5DA 1QBAA 4DFIA 2EDDA 3C87A 1FNGA 2D0GA 3WLBA 3QI9D 2XKSA 4IRZL 1PEWA 2IEPA 4XVSL 5EIIA 1CU4H 5JW3L 4TRPL 3SKJL 2VLKB 5C7XL 1HKFA 3LEYH 3UTSD 1QSFA 3MRCB 1WZKA 3CLEL 4LSTL 4IMLB 4Z95H 1M7XA 4LSRL 4KY1L 4V1DD 3VRJB 2N7AA 2OTUA 4P9HC 4P5MB 3AS2A 3OXSB 3D48R 3V6FA 4ZS6D 1IGJB 1BFTA 1A3LL 2Q3AA 4HBQA 1CQKA 3NPZB 4ZS7L 5D1XA 3VFRB 1QQDB 3O6FC 4F2MB 1IBGL 4S0SD 2FRGP 1Z5LA 2ZUQB 3FB8B 3MRBA 1K8DA 1I85A 1GGTA 1QSFD 2Q76B 1DZBA 1KCVL 4EDWL 4YHKH 4X6EA 3RVWD 4PJGE 2GJJA 1UM4H 4ZQKB 2O5ZL 1QO3B 2J7LA 2OS7A 4CJ1A 1KYOJ 5CSZB 4M3KB 5D1XD 5DQDL 1G9MC 4OLZH 3MV9A 2P5WD 5C9KA 1T04A 5E6YA 3GDBA 4LSQH 5K93A 3DHJA 5KOVC 3T2OA 1HSAB 4HIHB 2PW1A 1G7QB 1P84J 3CXDL 4JHBA 3O2VL 4QYOB 2EDRA 4L29A 4UDUB 3FQXB 3F12B 2B4CL 1ZV5A 2YWZA 1A9EB 4MJ5A 3VA6A 4Q2ZA 2OTPA 3MV9D 2MSPA 2EDLA 1AD0B 4EOWH 1T03L 1L9MA 1YY9C 3FQUA 1ETZB 3KYOB 3ULUF 2QV2A 5TGBA 3ROOA 1VEOA 3G04B 1HHHA 4OLUH 1HWGB 1YEDB 5JORB 3VGAC 3RDTB 3JVGA 2JB6B 4PJFF 1TETH 2EXYC 3VXRE 4NT6B 4QT5B 3NFPA 5JIHA 3U4EA 1NLBL 4LLAA 2FJHA 5C0BB 1OARL 4F9PA 2IH3B 1ZT4B 2OQJA 3MRJA 2WUCL 2AEIT 4P23A 4GW4A 3ZKNC 12E8H 2QQNL 2DQTH 1MJ7L 4ELKA 5LVEA 4JREC 3I2CL 3JTSB 4XNQB 1GZPA 4JFZH 1P7KB 4PGEB 1RD6A 1AO7E 2P46B 3CFBA 4JQVC 1EX0A 4WHDA 1SM3L 15C8H 3RWEB 3T8XA 3ILQC 4P23D 2CUMA 2XWBB 1ZHBB 2X09A 3B9EA 4OQTH 3UJJH 4Y8AA 4OKVB 5E4EC 5FA4A 5ILTL 5FF6B 5KAQF 4Y4FA 4EXPX 1HOCA 2XWJB 4MD4B 4U6TA 2Y6SC 4MAYA 3H9SE 1EAJA 2XN9E 4G7VL 5F44A 3WD5H 3GGWB 2FYYA 3L9RB 4DKEL 1I3RB 2GYSA 4X4XA 1CDJA 1FVCA 2Q6WA 5DD6A 4FXGB 3QUKA 4MHHG 2P49B 4YHZH 3MR9A 3FO2A 4FQIH 1QLRB 4NQTA 1FVEB 1UB6B 5L0QC 1T0MA 4LDEB 1FORH 3QG7H 4Q9RL 4QOKE 4PR5B 4E0RA 3ULVH 3FHAA 2I5YH 4P4KA 2DYPA 4Y4FD 5M95B 3V95A 5DRNA 2EDKA 4MAYD 2OMBA 3QSKB 4WO4C 3NAAH 4PGCB 2Q8AH 4HUXB 3O4LE 3O6KL 5D1ZB 2EXWC 5I1CH 3KLDA 3DO7A 5BW7A 4RMRA 1N5AA 4QHKJ 5A40E 4XCEA 4QTIL 3B2UD 4LCWA 4HUUB 4NSKB 2BSTA 4GRWE 4K9EL 1ONQB 4P4KD 1HQ4A 4BZ1H 2R2HA 2DYPD 2DB8A 2NY2C 4XB7A 1FVDB 1HINL 2GTZB 2NY5L 2YBRA 3RZCC 1MCPH 4CBPA 1AGDB 1IC4L 4LFHD 4JO1L 3FB5A 3HG1A 4PIRF 2V2TA 1MRCL 1ZA6B 4WW2C 3QUXA 5TQ2L 2F19H 3I02B 2H3NA 4XI5C 1EXUA 5A3ID 1VADB 5KTEL 3TBVB 2A77L 4LCUB 5HHMB 5I8KL 1J10A 4DVBA 4QXTB 2A6DB 4JPIB 5E0QA 1UJTA 2PN5A 5D72H 4LMQE 1YJDC 3HG1D 1GL4B 4TPRL 4P48A 3AREA 4P59H 3QUXD 4JFED 2JELL 3V79C 2W9DH 1OOAA 1A3RL 3AY4A 3L3KA 2YWYA 4PY8I 4L9LC 3U7YH 3FB7A 3T4YB 4BQ9A 2ITDB 3ZHLA 2DIAA 4PJGF 3P0VL 1DBJL 2CO6B 1KELL 4RISL 3O0RH 3SN6N 2B2XL 1QHPA 3MV01 3CLFH 3KLHD 1YEIH 3I6KA 4PJEE 4TYUA 3HRZB 5BV7L 1YPZF 1DCLA 4LRNL 4XNMA 3RNKA 1U8PB 2YA2A 5CMAA 4XGZA 5BOZG 3PJSB 1GGIL 2W60A 5JLZA 1BVKB 3LQZA 3ZDZF 5ESVB 3QH3A 4NCC1 4P4RB 3VI4E 2Z8SA 2LVCA 32C2A 5T5NF 3CPLA 3KGRA 3UTQA 1T4KB 1XIWB 4RCAA 4O9HH 3HC0A 4LF3B 4RGNC 1RI8A 5ICXB 4MQXD 1FH5L 1XGPB 2HFTA 1X5FA 3GI9H 1AKJB 1KBGL 3QHZL 3RVUD 1BGXL 1BD2E 1OTTC 5BZWB 3VXPB 4MX7B 4PJ7A 4FFVC 1CN4A 4X0KB 1M6OA 4IRZH 1LE9A 4XVSH 5JW3H 2YD9A 3T77A 1JNJA 5ECJE 3QT2A 4TRPH 3K0WA 3M45A 4O00A 2MCG1 3SKJH 4KI5D 1MY5A 4LU5L 5C7XH 1CDBA 2BZDA 5K9QG 4LSTH 1RZ7L 2VLLB 4LSRH 4KY1H 5CEZL 2VQUA 1U8LA 2GJ6E 5HYJB 1A3LH 4NQSB 4HH9A 3MTRA 1VACB 2X4SB 3MNZA 4ZS7H 1UT9A 4GAYA 3PNWB 5TH2B 4XNZC 5DURB 4U7MA 1IBGH 2ZUXA 5DFVC 5DJZB 4UTAL 1D5IL 1T1ZB 4BM7A 1KCVH 4EDWH 5BJTA 2R15A 2GTWA 1PFCA 1DBBL 1G7IB 2IANA 5CEZD 3UTTB 1CCZA 2O5ZH 5MENA 3LEXB 5D5MB 1LK2A 3N06B 3P4MA 3SDDB 1I8KA 4ZOCA 2O93L 3MOBL 5DQDH 5IBLC 1GOGA 3EZJB 3IFPB 1JCKA 3QJHB 4Q9CA 3QUZC 3KJ6L 1AP2B 1I8MB 3NA4A 3CXDH 1ORSB 1KG0A 1PW3A 2VC2L 1CLCA 1RJCA 5IBUG 2ENSA 3VWKB 3REVB 5MEND 2B4CH 4FQCL 4N8CL 1IAMA 2HVJA 5EO9B 5E70A 1FL3B 1JK8B 4MSWA 1NGZB 1MCJA 2CK0L 2GCYB 1IKNA 5J12C 4ZSOB 1U42A 5FGCE 2XWTA 2EDEA 1SYSB 3VCLA 3HI1B 3HE6C 1TDQA 3TPUA 2ZCHL 4QRQA 3SDCB 5FO8A 2A38A 3EOAA 1NLBH 4MQ7B 2D7OA 3B3IB 5KSBB 3OPZL 5GRXG 1OARH 5IVXE 2WUCH 3SGEI 2UY6A 4D8PA 3CZFB 2QQNH 1MJ7H 3RVTC 4CNIA 5C0CE 4KI5F 4KKCD 3LV3A 3LKSB 4MXVE 3I2CH 4OKDA 1CDUA 1VENA 4V2CB 4XCNA 5I1IL 3RL2B 5IESL 2FJFA 3BP4A 3SPVB 4G80A 1SM3H 3HAEH 2LABA 4G9DA 2VDRL 3DOSA 3MQIA 1DQQA 1Y6NR 1PKQA 2ARWA 5BS0B 1JGEB 3MNVA 1B4JL 5ILTH 5DZLA 4YK4C 1P6AB 1XR9B 1QLFA 4MA1B 1T5XA 5CZVL 5EU4A 4XX1E 1MIML 3U7WL 5D7IA 4DKEH 1RK0B 1EERB 1GGBL 4I2XB 2V2XA 1I9RL 4R4NC 4PJEF 2EKSB 3MXVH 1CTOA 3EGSA 4XZUA 4F7MB 4M9OA 4GFTB 3MRIB 5I1LB 4Q9RH 5F9WB 1DEEA 1UB5B 4FOMA 2XV6B 4LEOB 5D2NC 4K7PY 1FNGB 3VMNA 4XB8A 3WLBB 2XG5A 1CFSA 5D7JC 3KPTA 2G2RA 4Y16C 4WFGE 5EIIB 2R2EB 1XAUA 2NY3C 5IB3A 3C60A 3O6KH 1AE6L 3G5YA 1MHPH 1MNUL 4WDIA 5I9QC 5J6HA 2MQ3A 5FB8B 4QTIH 2P43B 1F3DJ 2CQVA 3O11A 2OTUB 2IQ9L 5SWSA 3V6FB 2E7HA 2VABB 4K9EH 4U1JA 4PJHE 3RIAK 4XXDB 2EH7L 4BFBD 3TIEB 5I1EL 4YX2L 2NY5H 1ZWIB 5K9QI 1CDIA 1MI5E 3MRBB 1IC4H 3C60D 1K8DB 4FQPA 4M7LL 4NZUL 3IS1X 3X13A 1MRCH 1WCBA 5GS1B 3C5ZD 5DJYA 2X4TA 1OAXL 1YEGL 3QG6B 4BFIA 3VH8G 3BH9B 5HXMA 5L88L 4U6XA 5F70A 1B0GB 5KTEH 1XEDA 4DOHB 2A77H 4R8WH 5I8KH 4C56A 1T04B 5EZLA 1YQ2A 1OP3H 5LGJA 4TPRH 4X4YA 1XF2B 3PWVA 1T5WA 4LGRB 1TPXC 2JELH 3GUTA 2X42A 1A3RH 2CDGB 3PWJA 5K9KA 3P0VH 3ARFB 3LAFA 1CDYA 1DBJH 4P46A 1KELH 4Q2ZB 4RISH 4YXKL 1YA5A 5B39A 2B2XH 4CMMA 43C9A 2NYYC 4YBQD 1EDQA 5TGBB 4YHYC 3EJJX 5BV7H 1H5BA 1HHHB 2Y5EA 5A2JH 1UXWA 3HE7C 4KKBC 4KC3B 3ZDXE 3NFPB 2VIRA 3U4EB 3BUTA 2DMCA 2DBLL 3BAEL 3S5LA 2FJHB 4P46D 4WWID 3MRJB 4P23B 1JWUB 3FT4A 5DJXA 5MEPA 2VLRB 1CD9B 4ELKB 4RA0C 2CGRL 1R3LA 4XAKD 2ZOKB 5I1GL 4G8GA 1FH5H 1GZPB 5HGHA 4ZNCD 1LGVA 3D9AL 4NKMB 1KBGH 1P84K 3CFBB 5DRZA 1LD9B 4WI7A 1BGXH 3VFUB 1LO2L 1U93A 1Z9MA 4TN9A 3T8XB 1F13A 5C8JA 2NY6B 1ZOXA 2CRZA 1BIHA 4OM0L 1P7QD 1J1PL 4M1CD 1UWXK 2H8PA 2H6PB 3H7BA 4XP1L 5EPMA 5FA4B 5T3XE 5I6XB 4LU5H 4U1GB 1HKLL 2NTSP 4WV1B 4Y4FB 1HOCB 4G8GD 1RZ7H 5EUOA 3EJYC 3SKUD 1YUHA 4MAYB 4PB9L 5CEZH 2FYYB 4U6YB 1QA9B 5B38G 4X4XB 2H1PL 2Q6WB 1TZHA 3SJVE 5DD6B 1DR9A 3QUKB 4M6OL 3MR9B 4TUOA 2A9NL 1WQVT 3WNLA 3OX8A 4UTAH 4YAQA 6FABL 4P4KB 5I8OL 1D5IH 8FABA 3S37X 1J86A 1VGEL 2ILLA 2PYEA 1DBBH 4LPXA 3KPNA 1YC8A 4OZHA 1INDL 3DV4B 3DO7B 1NGQL 1N5AB 5C92A 3MOBH 1S7VA 3PGCB 4XCEB 3OJDA 2KH2B 5A2LH 4LCWB 4KTDL 2BFVL 3KJ6H 3R1GL 1YC7A 3WFHB 1HQ4B 2R2HB 2VC2H 3QO0A 1EVUA 2EEAA 3ZE2E 5F88A 4LHUB 2PYED 3RUGF 2YBRB 3MJ6A 1TVHA 1CGUA 1N64L 3FRUA 4N8CH 4Y1AA 2ATPA 1EBAA 4EN3D 3FB5B 1VPOL 4PUBH 5MI0B 2C1PA 3RGVC 4WUUE 5F1NA 3QUXB 4LPYA 3OAZH 2CK0H 3ARDC 1EA9C 5F1KC 3CDFA 3CZJA 1F8TL 4ZO8A 3W9EB 2DQJL 2VAAA 1EXUB 4HKXA 3FONB 4DVBB 2ZCHH 3EJZD 4Y1AD 3SGKA 3LS5L 3LOWA 4D9RE 4B7LA 3OPZH 3AREB 4PYHA 2L7JA 1T1XB 3L3KB 3MRGB 3ZO0A 4FQXA 2Y5TB 5IB2B 4H26B 1G6RL 2DL9A 5B8CA 3V6OC 1H3WM 1T66D 2YXFA 4IOSD 3IFLL 4OF7A 2BRRL 3FT3B 3PWPB 2WINB 5I1IH 3LKPA 3I6KB 5IESH 4OGZA 2R2CA 4WFEE 1MPAL 1Z9OA 2VDRH 1JNLL 1R6VA 5FHAL 3RNKB 5JIIA 5CMAB 1B4JH 5HBBA 4NDMA 3LY6A 3L5XL 1JP5A 4FQXD 2D9CA 4PJXF 2W60B 4BUGA 3OKEA 1MHCB 3OTTA 2AERT 5CZVH 3UBXG 2HKFL 1QFUL 2V2WB 1IGFL 3MBEC 4MXWL 3CVHH 1MIMH 3U7WH 32C2B 1M1SA 3CPLB 1GGBH 3BP6A 4PRBB 5I8CA 3UTQB 1I9RH 3HC0B 1I1AC 4YC2C 4KJYA 2NY4D 3O6ML 4LLDA 3EO0B 5HHPA 5CD3A 3BJ91 3MC0A 1QBLL 1Q0XL 3EOTL 5GGSA 4JPKL 1HE7A 1ED3A 1QACA 1TJHL 3QXVA 2ZG2A 1JPFA 4PJ7B 1EFQA 4CADA 4QF1A 1HEZB 2GJZB 1UEMA 1LE9B 2R1XB 2QADD 4OZHF 3T08A 3ULVC 4LOUC 4X6DA 3TFKC 1KJ2B 3QZWA 1MNUH 4F37K 1MCSA 3PWLA 4EI6A 2IG2L 2VL4A 1P5UA 2CO7B 3P9LA 3ZYZA 1TTFA 1BIIA 2IQ9H 3U2SB 2BOCA 5EBLA 1EMTL 4HH9B 2EH7H 2FWOA 3MNZB 2ENYA 5I1EH 3OV6A 4YX2H 5IMOB 3EDEA 4GAYB 4ZYKB 3L3GA 1KPRA 5C70A 3SHSA 1RZKL 1OP5H 4G8IA 3QIWC 3TO2A 4M7LH 4NZUH 5BJTB 3IRZA 2IANB 1OAXH 1YEGH 3DV6A 3RL1A 1R3KB 1ZLWH 3O3DA 3Q6GL 4BSWA 3P4MB 3TYGL 4FABL 5L88H 2IQAA 3OSKA 1NANI 3SGDI 3CFJA 3HHRB 1G7PA 2RFXA 3DROA 4PRNA 3MZTA 4PRDB 4M61A 2WQ8A 1KG0B 2DQIH 4NOFA 1PEZA 1S9VA 2A74A 2PTVA 1B0RB 1CFQA 3DX6B 5ACZA 4NGHL 2EIBA 1P5VA 4MSWB 1I7TA 3PG2A 5E5RB 2BNRE 5IHUL 4W70A 3QWOA 4KKLC 1JGUL 1ZAGA 2G75A 1NEUA 2XWTB 5I75C 1EGJA 4MNQB 1EGJL 3MCKB 2WNGA 5J6GB 3B6SA 1D5MA 3TPUB 3DSNA 3RZCB 4JFFB 5ALCL 5FO8B 1JUFA 3ULUC 3THML 2J8UB 4EEEA 2DBLH 4OZIA 3BAEH 4OZFG 3EYSL 2DKMA 4D8PB 1E4KA 4IRJC 4CNIB 1KC5L 4JO4H 3LV3B 1EJ6A 4JRYE 1JHTB 2CGRH 1QFWI 3QI9C 3WIIL 3MLTB 5I1GH 2C4XA 4XCNB 2C3HA 3H3KA 3D9AH 3IKCB 3PWUA 3VXNB 3WJJC 3BP4B 4G80B 5EORH 3BISA 1U8QB 4LSPL 4X9FA 3TLRA 4G9DB 1LO2H 4LSUL 3X3GL 1QKZL 4L4VE 1PKQB 4GBXC 4R2GC 4UDTA 5GGVL 1JNHA 4X6DF 1RZJL 4ZS6C 3MNVB 2PCPA 4OM0H 2YOCA 1J1PH 3TZVD 4ODUA 2A0LD 4MA7L 4R97B 1HKLH 1QLFB 1T5XB 3BJLA 3ESUF 4P2QE 1Z3GH 4GS7B 3KXFA 4PB9H 2O26U 3Q0HA 5D7IB 5HDLA 2V2XB 1J05A 2H1PH 4H1LG 4M6OH 2GAZA 3EGSB 4XZUB 4U0RB 4NQVB 5EDXA 3UBXI 2A9NH 4MQSB 5E99L 2X4QA 5HYFA 1YY8A 1NCAH 5DDHB 6FABH 1OLLA 3DIFA 1L0QA 5I8OH 5K33A 4GMSL 4OV6F 2R39A 1QEWA 4DGYH 1VGEH 1CFSB 2AEQL 3KXFD 5CJ5A 2G2RB 4IMKA 5IB3B 4GRMA 1KJ3L 4KI1A 3C60B 4ZAKC 3G5YB 4J3OC 3K81A 1NGQH 3RWCB 1MWAA 3BGFB 3MBXL 3O11B 2YZ8A 4C57C 5SWSB 3KPMB 1FSKC 4KTDH 5DEFA 4M6AA 2B5IB 1MQ8A 4M6ML 2BFVH 4U1JB 3R1GH 2VXTL 1NFAA 4PRIE 5KVEL 2C9AA 3VXUE 1ZHNA 2BXZA 3IDJA 4UNTA 2APXA 1OM3L 1N64H 1L0XA 1AFVH 2OYPA 2IGFL 4OGXL 1VPOH 2DRUA 5IK3A 3RY6A 3WKNA 1N4XL 3ZT5A 3KS0H 1IAII 1SMOA 2W0KA 3S34L 3D85A 1HHKA 2DQJH 1WBXA 4U6XB 2D7NA 3I6GA 1JPGA 3KPQA 4HWEL 4PRPA 5HHVL 4NJAL 5EO0A 4C56B 4XTRD 5E4IA 1D5BA 3V6ZA 4O2FB 4OZIF 5EZLB 3VFWB 3D39E 3LS5H 4OB5L 4PGBA 4Q6IC 2FHFA 3H42L 2YPLB 4U7SA 3PWVB 4X4YB 1K4DA 1T5WB 2ID5A 1M4KA 1KOAA 5D7KD 3GUTB 2XTJE 3D85D 2AABL 2VISA 4LCCA 5I73B 5K9KB 1G6RH 4PRPD 4MNGA 3TBTA 5B39B 2BRRH 1T2JA 1PY4A 5AYQA 1RUPL 1GGUA 4N8VA 3NCBB 4I0KA 1I9JL 2OMNA 3HUJE 3VMPA 4NNPL 1IM9A 4ELME 1MPAH 5F7EL 3GMLB 1JNLH 1W2KT 2H9GA 5FHAH 1RZ8A 2K7QA 3L5XH 5JIPA 2NY7L 5AD0B 2X1PA 2X4UA 4OFYA 3BKML 3IDNA 1A64A 4PJAA 3S5LB 2Q20A 4Z76B 4G6AD 1MCQA 2HKFH 4UBDC 1QFUH 1IGFH 3FT4B 5DJXB 5DUBA 1IM9D 3AXLA 5F7YC 5TDPB 3SE8L 4L3EA 5DHYA 1ZLSL 3D3VB 1N3NA 2QR0A 5HGHB 1QBLH 1Q0XH 3EOTH 5E9DE 5CIPA 4N5EC 4OFYD 5DRZB 4JPKH 4OIIL 1TJHH 4R96B 5GGTA 5CCKH 5GGTL 1U93B 1SJEA 4QNPE 5C8JB 4JRXA 3VRLE 4K23L 1HK6A 2H8PB 3H7BB 3H0TA 3FMGL 2NMSA 4L3ED 3SDAA 5EUOB 2IG2H 4R7DA 1JNNL 2F54A 1YUHB 3C6SA 3VFTA 5CJOL 2X4OA 3TNMA 1WTLA 5DR5H 1O5DT 3MJ8A 4HGKC 1EMTH 5HTSA 1OGAA 3OAUL 1LNUA 4JRXD 4K9EC 4P2OA 3OX8B 5SWZA 5IP4A 2ICWI 5A3IC 5DK3A 4YAQB 4GSDL 4CW1A 1BQSA 5L8JB 3CSYA 3SDAD 4NP4L 1F3RB 2DTSA 2F54D 2CMRL 4KRPB 3DGCR 1NUNB 4IS6A 5SV3A 1PQZA 3KPNB 3M8OH 5EZJB 1HI6B 2WWMC 3Q6GH 4O51A 4OZHB 3TYGH 4FABH 1NAMA 1OGAD 1NAML 1I7ZA 1S7VB 4LKXB 3AMKA 3ARTA 2EDNA 5SWZD 1SJVA 4N68A 3BP5B 3TO4A 4UIKL 2EDOA 3QO0B 1G9EA 3NVQA 4I0PC 4U1KA 1TVHB 3FRUB 4Y1AB 3LMJL 2ATPB 3Q1SL 4NGHH 1NCBL 3QXAA 5HI3D 1W0YT 1KB9J 1A6WH 3CH8A 2C1PB 5F1NB 4HEPG 5IHUH 2P44B 5IOPA 2VUOA 3F7PC 2OI9C 1JGUH 3V4VL 1PD6A 4U4BA 3TCXA 3CAFA 3TO4D 3DVGA 3ZYJA 3EYFA 1EGJH 1PX4A 4HKXB 3QHFL 5CS7A 1AQDA 4L8BA 5D8JL 1WIUA 5BV7C 5ALCH 4JM2A 2DWEA 3THMH 3G6JE 4H5SB 1U95B 4MQXC 3D2UA 1PDKA 3DECA 3EYSH 3RVUC 4XPAL 5E1AB 2BVOB 5IHZA 1KC5H 1I1YA 5B22A 1H9VA 2BVQB 3QDGA 2V17L 3K8KA 4JHAL 3WIIH 3GM0A 3V7AE 3LKPB 4JM2D 4KI5C 2P5EA 3MV8E 3BW9B 3K8LA 4PY7A 4HHAA 4LSPH 3D2UD 1ZK9A 4X6FA 1YN7A 1KENL 4LSUH 3X3GH 1QKZH 5ENWA 4LVOB 5C09E 3VD5A 1MUJB 5GGVH 2IADB 2Q7NA 1RZJH 2VQ1B 3LRGA 1MCEA 3JWNC 4CN6A 2BSRA 5CP7A 1ZE3C 3OKEB 1H3UA 3LQAL 3QDGD 3WS6C 3WL9A 3KVQA 4NRXA 1MREL 2XRAL 5C3TA 5KSVA 2QADB 4NCC2 2P5ED 3BP6B 5I8CB 2E5EA 4YHYB 2DLTA 1ZLUK 3X11A 3HKFA 5EU6E 5IF0A 1EIBA 3EYOA 3FO1B 4KJYB 6CGTA 3S8WA 3N9GL 4LLDB 3RPKA 4WTZA 3AVEA 4C58B 1HZHL 4MB5A 5E99H 5CD3B 1CFNA 4IRSC 5GGSB 3QIUB 1FIEA 1Q94A 4AJ0A 1ED3B 1UJ3A 1FG9C 5FM5M 2B39A 5HYEA 4GMSH 1JPFB 5GRZA 5AYUL 4QF1B 2AEQH 2F53E 3B83A 4Q0XL 2XQYK 4NYLB 4GRLA 1KJ3H 1RUQL 3PWLB 3GEWB 3ZYIA 2VMFA 2XKUA 4M4RA 4EI6B 3MBXH 5J1TC 4PRHA 1BIIB 4FG6C 3QXTA 4M6MH 1MH5A 2VXTH 2XT1B 5KVEH 3AS0A 3L3GB 5DC9B 3BD4A 3TJEL 1I7UA 2Z4QB 4QNPF 4GRLD 4G8IB 1MJJB 2NTFB 3H3PL 2IGFH 3LKQA 1QRND 3TO2B 3K2MC 4OGXH 4JG0L 2F8XC 1XZ0A 2VLMD 1N4XH 1UC6A 3QWQB 3P9WB 4PRHD 4XMPL 1M05A 3S34H 1N6QL 4F7TA 5GGSY 3O3DB 4BSWB 4FXKB 1H8OA 5HHVH 3V4UL 1IKNC 2JLLA 4G43A 4NJAH 1S78D 4JM2F 2EE9A 3CFJB 3P40A 4UTBL 5FYJE 4FFZL 5D6DA 2HG5A 3HB3C 1G7PB 2RFXB 3DROB 4OB5H 5I74C 4PRNB 2FB4L 3DWTA 3FCTB 3H42H 4N0CD 1S9VB 2EDQA 4F7CA 2A74B 1CFQB 5K9OA 3INUL 2AABH 4ZXBA 3GJFK 5ACZB 4XH2A 5E2JA 1I7TB 4AYFA 2HWZL 1JPTL 5IMKB 1NL0H 3KPSE 1RUPH 4U1SA 1VEPA 2QEJA 3BQUA 3QWOB 5DWUL 3C9NA 1I9JH 4JQIL 4KQ4L 4NNPH 4M93B 3QQ4A 4ODTL 3NBNA 5F7EH 2APTA 1P4BL 3PHQB 2B0SL 1D5MB 1HCFX 4Y5XC 2NY7H 4C83A 3MSPA 2YK1H 4ZXBD 1I8LA 3BKMH 4OZIB 4PJCE 1KCKA 4RMSA 4HXBL 4QOKA 2JCCE 3JWDC 4HZLA 4ODWA 4UAOB 2V7NA 3BQUD 4HJJL 3RPIA 1EVTC 4WWKA 3SE8H 3DRQA 3T3PF 4ZDHA 1ZLSH 3VD3A 3IS0X 5FUZL 3D69B 1UYWL 2AJYL 1MHEA 3PWUB 5EFIB 4DZBA 5CIPH 3O45A 3MLVL 4RAUB 2DS4A 5GGTH 4Y4KC 5KS9A 3OJ2C 4MA3A 4P9ML 4AG4L 3QFDB 1UH3A 2PCPB 4K23H 5C0RH 5GIRA 3VGBA 5DEZA 3FMGH 4ODUB 5FUCE 4WWKD 3WFEH 3C5JA 3KXFB 3VI3E 2V9QA 5CJOH 3BYTA 1J05B 4KJWC 3SE9L 2DMKA 4D3CL 1CGYA 3C5ZC 3PXHA 2GAZB 3L7FB 3V6BR 3GZKA 2PYFA 3G08A 4YPJA 2X4QB 4YDJB 2YKLL 2ZUUA 5D2LA 1YY8B 3CFEB 2HLAB 4GSDH 2L4OA 1AIFA 2UYLA 2KL6A 1PG7X 3SCMC 4AK1A 4NP4H 1NC2D 2CMRH 2ERJB 3SO3C 5EOQL 1IKFL 3S4SA 1A66A 4YC2B 1BOGA 1CFVL 2KQMA 4GO6B 2LU4A 1NAMH 4E41A 4WJ5A 3OF6A 5JW4R 1MWAB 1MHHB 5FXCH 5GGVY 3RHWK 3MLSL 5DEFB 5ADPL 5KAQG 4UIKH 5DSCA 1RAMA 1ZHNB 3IDJB 1UEYA 1TZIA 3OHXB 1EFXA 5L2JA 3Q1SH 1NCBH 1KTRL 2YRZA 3FRPA 1JF6A 4E41D 5IK3B 4HS3A 2DQEH 4LVHC 1QLEL 5CJXA 4X9GA 2PO6A 3BDYL 3HMWL 1W0VA 1C08A 3D85B 1HHKB 4P46C 1S8DB 1Q9OA 1WBXB 1UM5L 1JPGB 3I6GB 1C16A 3KPQB 1UWXH 3QHFH 4PRPB 3ZE0F 2Q7YA 4NM4L 5D8JH 1GZQA 5EO0B 1JV5B 1D5BB 3KPRA 1PZUB 1EFXD 2W91A 2F8VA 3C8HA 4PGBB 4JQXA 2FIKA 2OXGA 4DEPB 2BJML 5BZDA 2PO6D 4XPAH 4HLJA 1Q0YL 4LCCB 5JQ6L 3ALXA 4NRZA 4WFFE 4JHAH 2V17H 1GAFL 4MNGB 2H2PD 1QBBA 3Q5OA 4QRRE 3QRGH 3KPRD 3VG9B 4ZG1A 2NY0B 1IM9B 4KKAD 3WNNA 1KENH 4LQ1A 2H9GB 1CLOL 5I76A 3GRWA 1U6AL 2NX5E 3GRWL 1RZ8B 1F4XL 2F74A 1A6PA 4S1SL 2IPTL 3HZYB 4EVNA 2X4UB 3IDNB 4PJAB 3MLWL 3STZA 3LQAH 3VFVA 1MREH 5B3JF 4HUVB 2XRAH 2GSGB 5ITFA 5IHBA 1KCSL 1MCNA 5KJRL 2XKNA 2EEBA 4L3EB 3N9GH 5DHYB 2X6MA 4O02L 1N3NB 4MCYA 2QR0B 3W11D 4DN3L 5C3LD 1HZHH 2V5YA 3W5MA 5AG9A 2EZ0D 1WV7T 4XCYB 1NFDE 4R3SB 5C07A 3T1FB 1ND0A 2ESVB 4IHOA 3T0WA 3ARXA 2VTFA 5AYUH 2ZCLH 4JRXB 4Q0XH 5GGUB 4EUPA 3K4AA 3O6LL 3H0TB 1RUQH 2KQNA 4NOBA 1CT8A 4KRNA 3SDAB 1A47A 3FFCA 3H2WA 3CX5J 2HJFB 2F54B 3VFTB 4HUWA 3RWGB 2DN7A 3TNMB 4EN3C 1BVLB 5J11B 4S1QL 1J7VR 5C07D 4OUUB 1KJMA 1BQHA 1OGAB 3TWCL 2D4DA 3TJEH 2HJKA 4P2OB 5GZND 3IFNH 3MA9L 3H3PH 1PLGL 5SWZB 3U9PL 4KH2A 4CW1B 1JZ7A 3ABZA 4JDVB 4JG0H 3FFCD 5T5FH 5INCA 1FO0A 1FO0L 4XMPH 5E2WL 1PQZB 2DI9A 1N6QH 3UC0L 3VI3F 1TQBC 2VDQL 5KW9L 2VLJE 3ARGC 3O4OB 5C0CA 1NAMB 4LFHG 1I7ZB 2D31B 3V4UH 1OVZA 2E7MA 1EO8L 4UTBH 3SKNA 4FFZH 1T66C 2FB4H 1BVOA 4WI3A 2D7PA 2AVGA 1SBSL 5KANG 2BVEA 4HJ0D 4PJ5A 3EYVA 4PV9A 4U1KB 1LHZA 1RK1A 3INUH 4HZAA 1WZMA 1L7TL 3STBA 3QXAB 1GPOL 4DGIL 4Z0BL 4QHLB 3BVNA 2HWZH 1JPTH 3DXAD 5IOPB 2Z31C 3WJLA 5DWUH 3V5KA 1FSKB 1EHLL 2XY2A 4NHUA 4JQIH 4KQ4H 4FTVE 4ODTH 3EYFB 4XVJL 1LO0L 1P4BH 5FGBA 1LP9F 1AQDB 2B0SH 4CVZA 4CU8A 2NLJA 2YPVL 4HMDA 4PJ5D 4XP6L 2K9UA 4LBEA 1MOEA 4CMHB 3PV7A 3WDJA 4JM2B 2DWEB 1UWEH 2NY4C 5GJTL 3D2UB 1KPVA 4HXBH 5C2BL 1GHFL 1LWRA 4L5FL 3WCYA 1Q9WB 3W9DA 4HJJH 3VFMA 2AQ2A 1I1YB 5DO2C 2IFGA 1QUNA 2YRLA 5FUZH 4QHUA 1UYWH 1NBVH 4QXWA 2A6JA 4PY7B 4Q6IB 1HXYA 1YN7B 4YXHL 5JW4Q 5ENWB 1M7DA 4BUHA 2QQLL 4P9MH 5FYKE 4AG4H 2XXCB 4OAWA 1KB9K 4TTDC 1MI5A 5ID0A 5CP7B 1KGCD 3WL9B 4NRXB 3P4LA 5GS0L 1V05A 3VXSE 1NUFA 3SE9H 5FYJU 5C6PB 4UT9L 3Q5YA 3ZYOA 3X11B 2AJVL 2VWEE 2P47B 3O3BA 2CJUL 5HYQA 2YKLH 4HF5L 1UJ3B 3G6AA 1NMCB 1BQLL 2UZIL 1A7PL 1Z6JT 5GS0D 5JOEA 4QKXB 1YEJL 1MCHA 1JHLL 4GRLB 3MJ9A 5EOQH 1IT9L 5IVNA 1KV3A 1NMBL 4HKBA 1CFVH 4BH7A 5J3HD 4XVUD 4OD2A 4PRHB 3MLSH 4FMKA 1J9CT 5ADPH 5IBTL 3IDIA 3H9HB 3AU1A 4HIIA 3L6FA 3F6IA 1MH5B 5D4QA 1A7QL 1ZT1A 3WN5A 5ISZE 1XF4A 2FD6L 1I7UB 2ZUTA 2BNQE 1PYWA 1NGYA 2J5LB 3K8MA 3VXRB 1ORQA 1NDGA 1QLEH 1CYGA 2G5BA 3BDYH 1M05B 5EO1A 3GSUA 3HMWH 3J7HA 4APQD 1A1NA 2NW3A 4F7TB 4ORZC 4BZ2L 4PLJD 1UM5H 2BHUA 7CGTA 4MXQC 2FCBA 4WY7H 1BEYL 1DDHA 4BSJA 2EYSA 2X4NA 2Y1VA 3SBWA 5J8OA 4Z7QF 2ZUWA 1JTTA 2H2SD 2BJMH 3OKNB 4F7CB 4EDXB 1TVDA 2VL5A 4OLVL 3TIDB 4L8DA 2KKQA 2E7LA 2YPKA 2EECA 4ZXBB 5JQ6H 3RWHB 1IZKA 3L3IA 3LKNA 3BDXA 4XH2B 5IEKA 2E7BA 4HULB 3DRTA 4U2YA 3E6HA 3TZVC 3BQUB 4H8WC 1L0YA 2A0LC 5KVMC 2HTKC 3H9SB 1T3FA 2XN9B 3QXDB 3B5HA 3PQYE 5FKAA 1CLOH 4G9FE 3V2AR 3SJVA 3SQOL 3GRWH 2NY1D 1F4XH 4G6JL 1D6VH 2FL5A 4NQDE 4S1SH 2IPTH 3V5HA 1IJ9A 3MFFB 4QXUL 2EE6A 5DC0A 4WHYH 4QOKB 1OAYL 1MFNA 2R8SL 5IMLA 4M5ZH 4HZLB 3QISA 2OR8A 1KCSH 5GGQL 4JKKA 5KJRH 1KXQE 4WWKB 4ZTPL 3DRQB 2EDHA 3MRFA 5T3ZE 1T89A 4O02H 1R3HB 5I2IA 4DN3H 1OHQA 3QEHA 1MHEB 4DZBB 3O45B 1N7ML 1F97A 3FZUC 2F5AL 1U92A 3MJ7A 4GRWB 3V5DA 3U30B 5KS9B 4MA3B 2JKXA 1K6QL 3UTZA 4N9OB 4ZO6A 4EUPH 3IDYC 5A2IH 3O6LH 1FJ1A 3ES6A 5SV4A 3MCG1 1A02N 5JDSA 4HXAL 3LVEA 3C5JB 1XGTA 1P69B 3AM8C 4KMQA 35C8H 3FJTA 4IBLT 5C08A 4S1QH 2D7TL 2ZP0T 4JFPA 1GOFA 1JN6B 3TWCH 3GJFA 4YDLC 1J8HA 4GAJL 3JXAA 1F3DH 3G08B 5C2UB 5D2LB 4K94L 3MA9H 1PLGH 3U9PH 4J6RL 2UYLB 1FO0H 2Z91A 1NC4A 5E2WH 5C08D 3U46A 5J1SC 3UC0H 2JF1A 4X5XB 2VDQH 1D6EA 3RY6C 3SKMA 5KW9H 1A3QA 1BOGB 3BPCB 4G6KL 3CSGA 4WJ5B 4KK9C 2G9HA 1J8HD 1EO8H 3VRIA 4KTYA 1W0WA 2NPLX 4MS8D 4DK6A 4JO3L 1U3JA 4X8XA 3WKML 5HD8D 3JV4A 4NQXB 3QNXA 2JJVA 2AJZB 3UJIL 1NC4D 5DSCB 4N1EA 2R1YA 1TZIB 5ANMA 1QSEE 1EFXB 4YGAB 5IQ9A 1GPOH 2X44D 4DGIH 4X8JA 4Z0BH 4Z7NE 4HS3B 1JBJA 1PSKL 1EHLH 1W0VB 3GHEL 4Y5YA 1N5YH 5CWSA 4M03A 4OZGA 1Q9OB 4XVJH 3RBGA 5J13B 1LO0H 4ESKA 1C16B 1VFBA 2Q7YB 4J3WA 3T0XA 5DT1L 2YPVH 1GZQB 4XP6H 1T22A 5C9JB 2FEEL 4MJIA 3LN4B 3X3FL 3VDCA 2FIKB 5C2BH 1S7UA 4Z7OE 2YS4A 1GHFH 1MAKA 1BD2B 2P48B 3ARBA 5IKCA 2Z35A 4IM8A 3OGCB 4L5FH 5K59E 4G6FB 3CH1A 1U8OA 4DKFL 4NRZB 4XVTL 3BPOC 2YD8A 4Y5VC 2G5RA 3KPPB 1ZVSB 4Z7UE 1CGTA 5E2UL 5F8RC 1T6VN 1RU9L 1YMME 2AXGB 2VN4A 4MJID 5B39G 3GBML 4ODHL 2YUZA 4ENED 1B4RA 4NHCL 4NO2A 3ZMRA 2GJ6B 4YXHH 2QQLH 4PJIA 3ARBD 5F1IA 4ORGB 2F74B 4EVNB 1FZJA 5DJDA 3STZB 3PDOB 4HWBA 3AROA 3C5SA 4HWBL 3VFVB 1PZ5A 3S5LG 4Z18A 5GS0H 2A6KA 3I50L 4KXZH 4QWWD 4UT9H 1BLNA 3P0GB 2XKNB 1CLYL 1QZ1A 4L8SC 1Q72H 2NW2A 1UZ6E 1FNSL 3QIBC 4TUJA 4J3SA 3VFSA 4MCYB 2AJVH 2IPKB 2IBZX 5JOPE 2CJUH 2R0ZL 4S11A 4HF5H 4Y89A 3DGGA 5C07B 1ND0B 5DJAA 5GJSL 3U0WL 4IHOB 3EIFA 4H0HB 3NCMA 3K46A 1BQLH 2UZIH 1A7PH 4X99A 3G5VB 1YEJH 4EUPB 1JHLH 1IT9H 1BZ9A 1BPVA 4KMTL 4OFVA 2NZ9D 4HUWB 5C1MB 1MCBA 3MRKA 5IBTH 4WI4A 4Z7WE 1SEQL 4GMTL 1KJMB 3S35X 1U2HA 4M6NL 4Y4KB 3RTQC 1F4WL 1FHGA 3LB6C 1A7QH 5JR1L 4LL9A 2FD6H 3SDXA 3WFZA 2WMPA 2WUBL 4JFXA 2OCFD 4AH2A 3DO3A 3D18A 3TIDA 3CFKA 3UJTL 1X7QA 3DSFL 1FO0B 4ZFZB 3TM6A 5I1HL 1DE4A 3GIZL 1IGTA 3SE4C 5IVXB 5I19L 2A6IA 4BZ2H 3F58L 4HCRA 4HCRL 5C0CB 5MEOA 3EW3B 1C1EL 4NQUA 4ONOA 4RWYL 2ED8A 3UXFA 2IFFL 4WW1A 3RAJL 3P3YA 5FYKU 3SKNB 3BN9C 1C5CL 1JWSA 3ARZA 4RMTA 3FO9B 3SCMB 1WFUA 5DJ2A 3GSNA 1ZLUH 3GSNL 3CSPA 3EYVB 4PV9B 1RQ5A 1RK1B 3D1MC 3MUGA 5I1KL 3CX5K 2EDYA 4YE4L 3HN3A 1ZHKB 1HH9B 2GUOA 5C0IA 3V5KB 3IJHA 3T65A 3PDDA 3VXMD 3BZDA 5DRXA 4X7EC 2YA0A 5EBWA 3JV5A 4AMKL 4JJ5B 3AAZA 1REIA 4NQCA 1I1FA 3SQOH 2NLJB 3SGJA 3RHWF 4LBEB 4G6JH 4R0LC 5DVOA 2YC1B 3I84A 1VESA 1OW0C 3MRPB 4QXUH 4BQ8A 1RZIA 3P0YL 1OAYH 1NBQA 1S5HA 4P2RD 4JPWH 2R8SH 4PG2A 4Z7NF 3HCVA 3W9DB 3VDAA 1MFBL 3VFMB 1JWMB 3GMNA 3DLQR 4ZTPH 4KROB 4NQCD 5IV2A 2E27L 4Z7VA 4QHUB 1INQA 1MVFA 2A9ML 1YEHL 3BD3A 3U9UA 1G7MA 1N7MH 2A6JB 2F5AH 3OL2A 4F8QA 1HXYB 1GIGL 1WITA 4JZJB 3NACL 3SQBA 4PJHB 1M7DB 1K6QH 3IFOA 4XRCB 5ERWA 1Y6KR 1DUYA 4OAWB 3V0AC 2W38A 1MI5B 5ID0B 2UWEE 5JHDA 2AK4E 4HXAH 4ZPVB 3BMWA 4O2CA 5JW4N 5ICYA 2D7TH 3T3MF 3SDXF 2EH8L 4MB3A 3GJFH 3NIDE 1CS6A 4EI5B 1A9BA 2LU7A 4GAJH 3UP1A 3MV7E 4AENA 3T0EE 3FN0L 3O3BB 4LIQL 4P5TA 3RVVD 5HYQB 4K94H 3MREA 5JHDD 4J6RH 1B3JA 1KTLA 1S78C 3G6AB 5I1AA 2QLVB 3IJSB 5I0DA 5IB5A 4QO1A 3VWJA 5L2KA 1IMHC 5JA8B 1J8KA 5DHXB 2IAMA 4HKBB 4G6KH 5C0DA 4BH7B 5KBNC 2VZTA 1KSRA 2M1KA 5GSVA 4OD2B 1VFAA 4P5TD 4JO3H 4S10A 3IDIB 1HN1A 4OLXL 3AU1B 3OGOE 3B9DA 3T04D 3WKMH 4D0BA 3HUJA 2BVPB 1ZT1B 2BC4A 3UJIH 2GEEA 1DVFA 5DQJA 4NBZB 3GSOB 5D6DC 5DTFA 3VWJD 2QSTA 1XF4B 5L2KD 2DI8A 1J0KA 2X1WL 1PYWB 2YEZA 2IAMD 4O2EB 3TNNA 1FFOA 5D96C 3O8XC 1NDGB 1G0YR 5EOTA 1PSKH 1LDSA 4FZ8L 4U7KA 4EXKA 2G5BB 2LV4A 3GSUB 5EO1B 3GHEH 1GH7A 4IIQA 2DQHL 1E4JA 4S1DC 3ILPA 4PV8A 2APVA 4ZUUB 5JZ7D 1DDHB 1DVFD 4XPTL 3PV6B 4JVUA 4YGVA 4I77L 1NSNH 5E08L 2Y7QA 2DICA 2X4NB 1MCRA 3QQ9D 2XICA 1PKOA 2NY1B 1XGUB 2VL5B 3U0TB 4L8DB 3IT8D 5E8EB 1RULL 2YPKB 4DKFH 4Z7VF 1U3YA 3L3IB 1K9TA 4XVTH 3BE1L 1NFIA 5IEKB 5E2UH 3DRTB 4IJ3B 4JLRA 4PJDA 1RU9H 3E6HB 3GBMH 3QNZB 4PP1D 4NHCH 4RBPK 4WIQA 2WWKO 1KPUA 4X6CA 4P3CL 5FKAB 1RIUL 2VLKE 3SJVB 2NXYC 4H88H 4WU7B 2I26N 1JZ3A 2RHEA 3V5HB 4ZD3L 4TSAH 3PL6A 4HWBH 3BRGC 4L3CB 3DMMA 4KQ3H 4Z78A 5IMLB 3I50H 3WLWD 4POUB 4WFHD 5CBAA 2WZPD 1F11A 1YN6A 4KK6C 3TH3T 1CLYH 4QHNA 3KPLA 1BBJA 1FNSH 2AS5M 4LPWA 5I2IB 2OL3L 1VFMA 3WE6A 5FKPA 5EBGA 1NEZA 1OAUH 1MLBB 1U92B 5GJSH 3PL6D 3V5DB 1D5XA 3U0WH 2AV7B 1KNOA 2WBJC 3DMMD 3UTZB 1L6XA 1BOYA 4YPGB 3MUJA 1FJ1B 3ES6B 3WHXB 4WGWB 5D7LE 4KMTH 1FFRA 5IW6A 5CHNA 5KN5A 3QPQD 3IAGC 4OCYH 1SEQH 4GMTH 5FIEA 2ICWJ 5GZOC 3DETC 4JFPB 1F02I 4M6NH 1F4WH 3GJFB 5F96L 2D3VA 5JR1H 1J8HB 3WEXA 2WUBH 5DD3L 3X14A 1SYVA 3GSWA 3LDBB 1T7WA 4W68A 3UJTH 4R26L 4QRPE 3DSFH 3G6JA 3GKWL 5I1HH 4RAHA 4IMLA 2Z91B 4JFDA 3UTPD 3HLAB 5I19H 3U46B 1IGJA 1D6EB 3F58H 4HCRH 4J3VA 3K1KC 1C1EH 3QUYC 4RWYH 4WVRA 3RX7A 5BO1H 3ZKQD 5FV1L 2G9HB 5F89B 5FUCC 1QQDA 3UZQA 1ZGLM 4H20L 2BOBA 3L3DA 1QPPA 3VRIB 3NIDF 3BN3B 5GISH 4OI7A 3A67H 1JPSL 3MYJA 2Q76A 3JV4B 4JFDD 3GSNH 1VHPA 5KSAA 4RGMC 2R1YB 4KKAC 5ANMB 5CEYB 3TA3C 1UG9A 2W9LA 1SMAA 3OAYK 3KDMA 4HIJA 5I1KH 3LEVL 4X8JB 4PJDF 1CDGA 5CSZA 4KZDH 4X7FC 4KUZL 4Y2DB 2YD7A 4P5KA 5ICZB 4X6CF 3B2VL 4M7KH 4Y5YB 3QXWA 1CD0A 4OZGB 4AMKH 3FT2B 1VFBB 5JOFB 1FIGL 5EU6A 3NGBB 1T22B 3F12A 4MJIB 1S7XB 5TE4L 3W0WE 3N85H 1YYML 4J12A 4TVPE 1NJ9B 1S7UB 3P0YH 3QULA 4D9QE 2IH1A 3W39B 1AD0A 2C26A 2Z35B 4ACPA 1MFBH 3DYPA 4MAUL 5JQHC 3KYKL 1I3VA 3CH1B 1VGKA 3G04A 2XNAB 1J1XL 1YEDA 2E27H 4HH8A 1ODAA 1PJ9A 3TVMC 2A9MH 1YEHH 4LARL 4N8VG 1GIGH 4NO2B 3D0LB 3NACH 1WAAA 4NQEE 1MJUL 2Q8BL 4PJIB 3QP3A 1K5NA 1FN4B 3MRDB 1FZJB 4NC1E 5DJDB 3JTSA 3C5SB 1BBDH 1PZ5B 1MFEL 5C6TL 4XNQA 4EJ1C 3E2HB 5GZNC 4YZFE 4PGEA 4GQ9L 4UOJA 1F4YL 2L7UA 3D5OF 3BP7A 1BLNB 5C0BD 1ULVA 3RWEA 4DQOH 2NW2B 2VAJA 4TUJB 3VFSB 2XWBA 2PNDA 3FN0H 1DN0B 5FCSH 3WDHA 4POZD 3B8SA 1I4FB 1U8NA 5I17B 4CKVX 4LNVA 5HGDA 2V9TA 1G9NC 2W9EL 4MD4A 2WIIA 4N90E 4OD3L 5HDBF 4X99B 5BCAA 1KN4H 3E0GA 1X5LA 1S9YA 5HHME 1EJOL 1WVZA 1BZ9B 1RFDL 1F4HA 3L5JA 5I30L 4FXGA 4LLQA 2AK1L 1UB6A 1EAPA 1N0XL 1MCDA 3MRKB 2BNRB 4Y4HB 4OLXH 3KPSA 3B9KA 3ET9F 2J8OA 5D93B 5HPOA 1CXLA 3TF7C 4LPVA 4KJQD 3SDXB 1S9KC 2E9WA 4AH2B 3KG5A 2Y07L 3D18B 1BZQK 1X7QB 1DE4B 1IGTB 4FZ8H 3HTLX 1R3JA 1WFTA 4HUUA 4NN6B 3U82B 2A6IB 3B9KD 1T7ZA 3O3AB 2X40A 2DQHH 1ONQA 1QRKA 4KKNA 1E6JL 1EHNA 3QDJE 5CD5D 1E0OB 4U33A 3F6LA 4UB0L 2GTZA 3GSXB 1AHWB 4IDLA 4XMKL 4XPTH 4WW1B 1P53A 2LQRA 1AGDA 4I77H 4YH6A 2Y06L 4PJBE 1JYVA 5E08H 1UACL 3BFOA 1JWSB 3IRPX 5JNYA 5ITBL 1JZ2A 1FCGA 3LD8B 5D1QC 3MUGB 4ONGL 1RULH 4ZFOA 3QCTL 4ZFOL 1AI1L 3BE1H 5F6IC 4BSVB 3ORJA 2WQRA 4N1CA 3T0DA 1T2XA 2ZOLB 2FECL 2JE8A 4NCDA 3ISWA 4QXTA 5C0IB 4F3FB 2A6DA 4JPIA 3T65B 4P2QB 1WAAF 5DRXB 2PW2A 2OX5A 5IROA 4P3CH 4LQFL 3AAZB 4NQCB 2HMID 2WBKA 1I1FB 1RIUH 4UMGA 4J1UA 3G9AB 1R3IH 4CDHA 4YUEL 2UZXB 3UPRA 1TJIL 2RQ8A 3K2UH 4ZD3H 3ZKXB 1NDMA 5HYJE 1S5HB 4TUKL 3FTGA 1F42A 1UKSA 1DL7L 2E6QA 4AEIL 2XACC 2E6PA 4TNVK 2C1OB 4X9BA 2WAHA 4AIXA 5GS0C 4CN4A 5DMGC 3ULVE 5IV2B 4Y19A 5HJ3A 4Z7VB 5I1JL 3QEQE 1INQB 2DTML 2OL3H 4YFEA 2ZG1A 1JRHL 3U9UB 3PJSA 3UTTE 5J3HC 1BVKA 4LSSL 2DDQL 3AUVA 5ESVA 3BO8B 3O2DA 3JSSA 3IFOB 3O2DL 5ERWB 4PRIB 1WWAX 1DUYB 2A73A 3LN5A 1T4KA 4RMQA 3X12A 4LF3A 4M00A 4LPCA 3ZHKA 3EO9L 5ICXA 4Y19D 4FQLL 1R5VA 3OKLB 1XGPA 3QB7C 2XZZA 4TSCL 2JJUA 1E6OL 1AKJA 2DIBA 5ICYB 3RX8A 3J8F7 5BZWA 1DUZB 2AQ1A 5F96H 1BJ1H 1A9BB 4APQC 3V9FA 4AENB 4DTGL 5DD3H 7FABL 4P5TB 1UA6H 1XIWD 4CDGC 4F7EA 3MREB 2JTDA 3D39B 1D3CA 4R26H 3GKWH 1ERNA 3VWJB 1J11A 1AKJD 1F4AA 2W1NA 4YZFF 4NQSA 2IAMB 1VACA 2H2SC 2XTJB 2VSCA 2CRMA 4LNRA 5TH2A 4H20H 2CR3A 1H8SA 4Z5RA 5GSVB 2FZ3B 1VFAB 5DJZA 2DQCL 3VJ6B 1JPSH 4D0BB 2DKUA 2DLIA 3HUJB 3ALPA 4ZNEE 2LTQC 2BC4B 1DVFB 5DQJB 5DTFB 1VDGA 4GKNB 5EZOL 3ZKMD 3TNNB 3LEVH 1FC2D 1VB9A 3OKDA 1I3UA 3QJHA 3GSRA 3NPSC 5BS0E 4IDJL 2ARJQ 3S9DB 4IIQB 3RWIA 1I8MA 3DVNA 5F6HJ 1ORSA 3ILPB 4KJPC 4PJFE 3UEZA 4KK5D 3TCLB 3BPLB 5ADOL 4CVUA 1FIGH 4JEGB 3VWKA 2YSSA 2PF6A 3VFOA 4JDTH 4YGVB 1KIPA 5DMJB 4E42A 4X7SL 2QL1A 2Y7QB 4O4YH 2XIDA 5F21B 5TE4H 1YYMH 3LKRA 1X9QA 3C8KB 3UTSE 4ZSOA 4L4TA 4MAUH 3ETBF 3KYKH 4V1DE 3MACL 1QG3A 1SYSA 1J1XH 3BPNB 1NFIB 3HMXA 4BK4A 3HMXL 2MQCA 3VWKD 4JLRB 3IXAA 4LARH 1Y0LB 4MQ7A 3H3BC 1JMXA 1U36A 5KSBA 4X6CB 4MGXA 1MJUH 1FFNB 1PVHA 3GHBL 2Q8BH 1QSFE 2YD6A 3ZT6A 4L4TD 3TV3L 1DBKL 2C4FT 3HPLA 2ZG3A 3KPOA 3PL6B 1MFEH 5C6TH 1VFOA 3DMMB 4Z78B 4GQ9H 3RL2A 1F4YH 1DJSA 2P5WE 4M8VA 4U6VL 3QAZB 1MCFA 1F11B 2V7HB 5AAWA 1QR1A 1YN6B 2J4WL 1QD0A 1A6TA 1BBJB 2R2BB 5GSRA 3ZDYE 1JGEA 1EZVX 3WO4C 4NZRL 4JFYA 1J87A 4PLKD 3WE6B 2HLFD 4OCSL 5FKPB 1LEGA 2YRPA 3ZL4L 1D5XB 2W9EH 1KNOB 3EUUA 1OSPL 3AB0B 1GJIA 5DVLA 1RK0A 3MV9E 4IOFD 4I2XA 4LCIL 3QPXL 1JYXA 1EJOH 1RFDH 5I30H 1QVOB 2EKSA 1I75A 2N7BA 5CHNB 2AK1H 5IW1B 3FOLA 5KN5B 3BYYA 4F7MA 2VERN 1JMZA 1N0XH 5E6IB 1YQVL 3DI2B 5CLTA 4LEOA 4I5BA 1S7RA 3FB6B 2XYCA 4LRIA 3CDCA 2CH8A 1I9IL 1BFOA 5D5MF 1LO4L 3WEXB 2R2EA 4AM0A 2EDWA 3X14B 1SYVB 3H7LA 5DGRA 2Y07H 3GSWB 1XF5B 2V5SA 4RMUA 3DUUA 3TEUA 5FB8A 3G6JB 5DVMA 2E9BA 3RA7L 4JFDB 1J0JA 5FHBL 5F7KC 4XMLL 3TN0A 2VABA 3S3JA 4XXDA 1E6JH 3S4SG 5GGRA 3TIEA 4YHLL 4UB0H 1ZWIA 4XMKH 2Q1EA 2BOBB 3L3DB 4NN7B 4OLYL 5AUMA 3WNMA 3UO1L 2Y06H 3A6CL 2I27N 1UACH 4PFEA 4U2ZA 5TE7H 1CGVA 3MYJB 3S35H 2J88L 4UV7L 5GS1A 5ITBH 2WP3O 4NO5B 2MOVA 1I1CA 1U3HC 5KSAB 3QG6A 4ENEC 5C09B 3BH9A 4ONGH 2P8LA 2HRLA 3QCTH 3KDMB 4HIJB 1AI1H 1B0GA 1KIQB 3ME0A 1G7JB 4WU5B 3FRPG 5K9JH 1YNLL 3QFJA 4P5KB 1YPZE 5KSBF 1JJUA 5C0JB 4AEEA 5FGSA 1XF2A 3I3DA 4LQFH 1K3IA 1IQWL 2MCPH 2I9LA 4PJ8C 5H94B 1CFTB 5EU6B 3O41B 2CDGA 5L8KB 3ZDZE 4YUEH 4UILL 1TJIH 5E1HB 2X4RA 4HC1A 3ARFA 4HC1L 2O5YL 2VE6A 3QULB 4TUKH 2IH1B 1DL7H 5FAAA 5BXFA 4KV5F 3QFJD 4AEIH 4U1IB 2CKBA 2ADGA 1VGKB 3E1F1 3MRRA 4NUJA 4OF8A 5DEGA 5I1JH 2DTMH 1A1OA 5BRZA 1JRHH 4NZDA 3NIGF 3ARFD 4LSSH 2DDQH 2HTLC 1JWUA 3JWOC 3O2DH 3OG6B 1K5NB 1KFAL 2RAMA 2VLRA 5ISZA 3WFBL 1S7SA 1IE5A 3BX7C 3EO9H 2DQUL 4FQLH 1ITCA 4XWGL 2ZOKA 3DTXA 3CD4A 5D7SL 4OCXL 4WHYG 5BRZD 3KAAA 1F58L 4NKMA 1E6OH 2FEDD 4TSCH 1Z9LA 3MJGX 3CMGA 1LD9A 5FYLL 2Y4SA 4NWUH 2FX7L 2ADIA 2IMNA 3VFUA 3BP7B 5CGYC 3GM8A 3HG1E 2NXYB 1I1RA 1D9KA 4DTGH 2DQDL 5SX4H 4JFEE 4W4OA 3DVIA 4W6XB 2VLRD 3HR6A 7FABH 43CAB 2H6PA 3UPCA 1U8NB 2Y9RT 2IC2A 1GC1C 4WV1A 5HGDB 2IALA 1P9MA 2WIIB 2GT9A 1T83A 3LH2L 2HFGL 3IXTA 5ETUB 2CLVA 4XHJC 2PXYA 4U6YA 1QA9A 1S9YB 5FYLD 5JXAL 4OGAC 3DX7A 4EUPG 5CJBA 1XT5A 2H32B 1EO7A 2DM4A 1S9WA 4LLQB 3WIHH 4I1NB 2NY6D 1EAPB 1D9KD 3VD7A 5I66A 3ZDYF 2DQCH 3KPSB 3UDWA 3B9KB 3CU7A 2ICEA 5I71B 4MDIA 5EUKA 1BQHG 2JB5L 2WIMA 3RKDC 4I18A 2PXYD 3MOAH 2MKWA 5FEBA 1CICA 5EZOH 1FZOB 3DV4A 1XR8B 1MCIA 5DXWA 5CEXA 3OJMB 5IG7B 3PGCA 4PJCB 4JN1L 3OWEA 3V0WL 1R3JB 4XP9H 5HPMA 2ZNWA 4IDJH 3WXWL 1MCLA 3WFHA 5IQ7L 5ADOH 4LHUA 4JRWA 2BX5A 1ZANL 4D0CA 4X7SH 1JTPA 4M4PA 3CU1A 2J1KA 5CJ8A 5JNYB 2AJ3B 1OPGL 1A4JB 2DL2A 3O3UN 4KI5E 4LCWD 3G9VA 4P9HL 1N8ZA 4HIEB 1MCWW 3MACH 4ZFOB 3W9EA 4CVWA 2CLRB 2BY1A 4LHUD 3O6FA 3FONA 4PJ7E 2J12B 5HHXL 3QDMA 2NXZB 3MMEB 2IBZY 2PW2B 2QKIB 4TNWK 4PG9A 3MLXL 2YD1A 4XX1G 1ZT7A 3RX5A 1RMFL 2NR6C 3GHBH 3HZVA 1T1XA 3MRGA 4J3TA 4J1UB 3MCLL 3GI8L 3W82A 1OWWA 2Y5TA 1DBKH 3TA3B 3TV3H 5IB2A 4LHQB 4XNXL 5CEZE 4H26A 3UPRB 5F9DC 1W72A 3BIBX 1NDMB 1W72L 3FTGB 3FT3A 3PWPA 2WINA 3QDMD 3CFCL 5EN2A 3MRHB 4Z0XA 1T80A 1NGPL 2CIIB 2HT2C 4U6VH 4R4BA 4I8DA 4K2UL 1HCVA 3ARED 5F7WC 4YNYA 2J4WH 3P2TA 4Y19B 5HJ3B 5DS8B 3NCEB 4HWUA 4NZRH 1SEBA 2GY7B 1CR9L 1TCRA 4OCSH 4MLSA 4JFHD 5MENE 3ZL4H 1PG7W 1A14L 1MHCA 1HHIA 2V2WA 3PWPD 1OSPH 2A73B 2DOCA 1J88A 3C8DA 4NO0A 3LN5B 3BGAA 4LCIH 4PRBA 3QPXH 2H41A 5JXEA 3BZFA 3X12B 2P8PB 4GG6A 1FZMA 4X5LA 1VEMA 5GRUL 3I6LD 1R5VB 4OGYL 3EO0A 2FHCA 2VXUL 4L1DA 1YQVH 2LVEA 1FAKT 2H26A 4UNUA 1CWVA 5HI4C 3QUMA 3QUML 1I9IH 1HEZA 2GJZA 4DUXA 2R4RL 2R1XA 1YY9D 4NO0D 5JXED 1KJ2A 4F7EB 1KJ2L 1CE6B 2VZUA 1K2DB 5J7CC 2HT4D 4WEMB 5IWLC 4NJ9L 2RIKA 3MLUL 3SKOA 3CLEH 3MLRL 3RA7H 5FHBH 2EXYD 1HWHB 2JJTC 4XMLH 1LE5A 4JQVA 3U2SA 1U8HA 4GT7A 4PGJA 1CG9B 1F6AA 5AZ2L 5JO5A 4YHLH 5IMOA 2PKDA 2ADJA 3NN8A 4LNRB 2UUDK 4ZYKA 3ZKND 1OY3B 2E9JA 1ZEAL 4OLYH 4AQOA 4Z5RB 2HN7A 4JG1L 1BFVL 3UO1H 3GMRA 3A6CH 5IGXL 1WIPA 1IEAB 1P1ZB 2J88H 4X4ZA 4MHHI 4I3RL 3BT2L 3VG0L 4H0GA 5T1MB 3MGAA 1R3KA 5DQ9A 2FLBT 5EWIL 3ARSA 1EHXA 4P0DA 3T0EC 1N2RB 1NKOA 2W0PA 3ILQD 3MLYL 1RPQA 5IVZB 4JHZA 3OKDB 2IMMA 1YNLH 3GSRB 4M48L 4MMXC 4PRDA 3RIFK 3RWIB 2YUWA 2VJXA 3DVNB 3WO3B 2Y6SD 1IQWH 1BWWA 1YEEL 3AMLA 3DARA 1B0RA 2K1MA 3O2VH 2YSSB 4WO4A 4RFOL 2IAND 4FN0A 3VFOB 2FATL 3UYOD 3DX6A 1KIPB 4E42B 3TGXA 2D4FA 4UILH 4OF6A 3MRQB 4GXVL 4HC1H 5CINL 3LKRB 2O5YH 3L5HA 1NFDB 3MXWL 3C6LB 1T03H 4NN5C 2HFEA 4ZPTA 4L4TB 3S96B 3I3EA 1AGCA 4AEHL 4MNQA 3MCKA 3VXQA 1MFCL 5J6GA 2VR5A 3RZCA 4JFFA 3IXAB 5LXGL 5CGTA 1A21A 2J8UA 3L7EA 4JZNA 1G7LB 1OCWL 3IKKA 4WW2A 2VO5A 2XQYG 1BX2A 3SE3C 1NCUA 4I9WD 1OAQL 3BGMA 1HYSD 1KFAH 2QQKL 1B2WL 3WFBH 5CILL 1JHTA 4MNQD 4U1MA 3HPLB 2DQUH 3KPOB 1CQYA 1GXEA 3MLTA 4XWGH 5DK0A 3KHOA 3RZCD 4OCXH 4JFFD 4OFKA 3B9VA 3IKCA 1F58H 4XWOC 5TPWL 3VXNA 3T2NL 3TT3L 2BHYA 5FYLH 1X5HA 4PJ7F 2FX7H 5ABDE 1U8QA 1YJDL 4K3DL 3BH8B 4LK4A 1QR1B 3DI3B 3CSBA 1A6TB 3OAYH 2VLJB 5GSRB 4K71B 2X10A 2P24B 2DQGL 1Q1JL 4JFYB 2DQDH 4L9LA 5D6CA 1P4LA 4XI5D 1HXMA 1LEGB 2OR7A 5DVNA 4ZUSA 4YBHA 3VFGL 1PX3A 4W4NA 4OFIA 3LH2H 5TDOA 2HFGH 4HX1A 3R8QA 4G3YL 2MWCA 5E24E 1X5JA 4G7VH 3MROB 5HVHB 5JXAH 2DM3A 4KK8C 4K3JL 1A4KA 1NCCL 1PBYA 3FOLB 4NQVA 1KTDA 4TNVF 1P2CA 4DGVL 1MCWM 4I5BB 5H37H 1BFSA 1IILE 1S7RB 4UI2A 5DDHA 3RUGE 4NKOA 5ACMA 5ELIA 4FTVB 3BEWA 4N5UA 2JB5H 1BFOB 2ZUQC 1OP9A 4AM0B 4G6ML 1TITA 3BXNB 3RWCA 5ESAA 1EPFA 3DUUB 4KXZI 3MFGB 3K74B 4ODXB 3KPMA 1TQCB 4R9HA 4XAKE 3TN0B 3KYMA 1MRDL 3QBTB 5GGRB 2BVYA 3OR6A 1HINH 3O9WB 5AUMB 3N0PB 4PGDA 3MUHL 1ZANH 1P7HL 2RBLA 4M62L 4OCNC 4JO1H 1OQXA 4RGND 3N1QC 5TQ2H 4CAGA 5SWSD 4P9HH 4G8GE 1LDPL 4UQ2B 3MYZA 1OTTD 2P8LB 3ALWA 3LIZL 4RAVB 5DZOA 1NUDA 4ZO9A 2MPAL 2J8UF 4O2FA 5IBUB 3VFWA 3QFJB 4LVNB 4JO2L 2R9HD 4WW2F 4ALAL 2CPCA 4WTXA 1TZGL 3RDTC 2YPLA 3MLXH 3GFUA 4LSVL 2I9LB 1RMFH 3KYNA 2GY5A 4PJXE 1KB5A 2EKJA 1KB5L 1T20B 4U1NA 1H3GA 4XNXH 5EOCJ 2B20A 2ZPKL 4B7IA 2X4RB 2HA1A 3QEGL 2XZCL 1CGSL 4QXGL 2P7TB 1NCWL 2VE6B 4NM8L 5GGRY 4C56D 4D0DA 3TJHC 5DFVD 5BXFB 3I75B 3CFCH 1NGPH 2HP4A 2CKBB 2HVKB 3QUZA 2ADGB 2JJSC 2YPLD 4K2UH 3MRRB 3GMLA 4LRNH 2XA3A 4NUJB 5E2TL 5T1DL 1JE6A 2VDML 5DEGB 1A1OB 5BRZB 1M7IA 5AD0A 1CR9H 2JK5A 4F9LC 2PYEE 1GGIH 3VFPA 5I15L 4HK0A 2KUTA 1A14H 1A7RL 5IBLD 1WSST 4LKCB 4OZHE 4Z76A 5D7IF 3RWFA 9CGTA 5GRYA 1S7QB 5F7NC 1KYOK 3QUZD 5ISZB 4YDKL 1B90A 1S7SB 5BMFL 5AEAA 1F3JB 5TDPA 2BNQB 3HE6A 3D3VA 3DTXB 4L8CA 4OGYH 1HNFA 2VXUH 3T0BA 3QHZH 4JHWL 1E28B 2FDBP 2ADIB 4R96A 4Y1AE 3EAKA 2X4PB 4HG4J 2VXQL 4HBCL 3GMOA 1DN2A 1D9KB 1R24B 2ICWA 5CD5C 1KJ2H 3OXRB 2B1AL 3UROR 3SDYL 4NJ9H 2IALB 3D3VD 3MLUH 2GT9B 3EYQC 2R69L 3IXTB 5D1ZC 3ARPA 2CLVB 4KDTA 2PXYB 5DK2A 2EDFA 1X5AA 3DX7B 4HIXL 1S9WB 4QRTA 5AZ2H 1X5KA 4NC1C 1ZEAH 3RVTD 5DFWH 5I66B 4JG1H 1BFVH 2ED9A 2VNCA 4LLUA 5IGXH 4U31A 2ICEB 2ICES 4GQPH 3B4NA 4MDIB 5EUKB 4I3RH 4JGUA 3VG0H 4HS8L 1KCRL 1NBYA 4RDQF 4I18B 4HLZH 5EZJA 1HI6A 1FAIL 5EWIH 4LASL 1CICB 2OP4L 4M1DL 5HGAA 5CEXB 3MLYH 4LKXA 5HHOA 1JF1B 4RIRB 5HDOA 5HPMB 4LDLB 4M48H 3BP5A 5D2NA 3V52L 1LK3L 5MP6L 2CDFB 1I9EA 1UCTA 5D7JA 1YEEH 4KRPD 4RFOH 4Y16A 1A1MA 3MO1A 2FATH 5HVGB 4FQCH 3HPJA 5IROC 4D0CB 3VH8B 4GXVH 3S36L 5CINH 5HGBB 5HHOD 1H3PL 3ARWA 4LEXL 1U8KB 1N8ZB 5A1AA 2VKXA 3PWNA 4AEHH 1LO3L 2I24N 1H15A 1PY9A 1MFCH 1QFWM 2ZSWA 3G5XB 5D7JD 1QR4A 3O6FB 4Y16D 2NY3D 3QDMB 5LXGH 5I0ZA 5DMIL 1DBML 1WICA 3KS0J 1RJLA 2F8OA 4H5SA 1U95A 4PG9B 4X6DE 5E8PB 1OCWH 1BQUA 4M8QA 1ZT7B 3RWDA 1G7HA 1F6FB 1OAQH 3HZVB 2QQKH 5E1AA 1B2WH 2BVOA 5IB4B 4GW1B 2BVQA 5CZXC 5E8DL 2OLDA 4ODSL 1W72B 4NZTL 1XIWC 3LSOA 5TPWH 5EN2B 4Z0XB 3T2NH 3TT3H 3BW9A 4R4BB 1YJDH 4K3DH 1RVFL 4HUNB 4YNYB 2FEEI 3PHOB 5LKNA 1MUJA 2IADA 1U8IB 1EHAA 3CVIL 2VQ1A 3FQNA 1SEBB 4Z9KB 1TCRB 4R7NA 1KN2L 4PJ9C 5EUOF 3VFGH 1HHIB 1FRGL 5IR1A 5DJ6A 2ZKHL 4G3YH 2RR3A 4NO0B 2VKWA 4K3JH 3BZFB 4GG6B 1FZMB 1NCCH 4F33A 3FO1A 3HE7A 3FN3A 3VGAB 2DIJA 3B5TA 3HZKA 4NPYB 2H26B 3ZKMC 3QIUA 3VXTA 2BSSA 4DGVH 2X05A 2GK2A 3QUMB 1J0HA 4X7DC 4YHPA 4L4JA 2XI9A 4NYLA 1F2XK 1AE6H 2K7PA 3GBNL 4KK5C 4G6MH 4JREB 5HI5D 2FR4A 1FNLA 4HKJB 4HGMA 3TT1L 3SKOB 4KKBD 2C5DC 1LE5B 1OB1B 2BERA 1IAIM 1JGDB 3SDDC 3QIUD 1MRDH 4MJ2A 1U8HB 2XTLA 1YMHA 5JW4M 1BECA 3ESVF 1F6AB 1WZLA 1VCAA 5JO5B 4OZIE 5KVFL 4CN1A 2X7LA 2ADJB 3NN8B 3GIVA 2AXJA 4LLVA 1R5IA 2Z4QA 2HN7B 4Z7UB 3ULSA 3IDGB 3GMRB 1UH2A 4YFDB 2XXMB 1MJJA 2NTFA 1YMMB 5E4EB 4UV4L 2VQTA 4YR6B 4Z77A 3VWKC 1FYTA 5BVPL 2ITCB 2F15A 2VITB 5DYOB 3CMOL 4NQEA 5DQ9B 4K3EL 1FFPB 4FXKA 4Z95L 3LIZH 4JPVL 5J06A 5L0QB 2MPAH 5DF0A 1IGIL 4JO2H 4QGTA 4ALAH 2F9BT 4GAFB 5ID1A 1TZGH 5FK9A 3FCTA 1FYTD 4LSVH 4WO4B 3SDCC 1WT5C 1A7NL 1NFKA 4KUCD 2O5XL 1KB5H 3KXFE 1T1YA 4U3CA 2ZPKH 2I07A 3QEGH 2XZCH 1CGSH 4QXGH 1NCWH 3DJ9A 4NM8H 5IMKA 4YXKH 3N50A 4LLMB 2HFEB 4ZPTB 4ETQA 4UU9B 1AGCB 3IJYB 3SY0B 2BY3A 1A2YA 4HFUL 3WS3B 3T2PA 2NY2B 4YHNA 5A43C 3VXQB 5E2TH 1II4E 5T1DH 3PHQA 2VDMH 2PTTA 4DCQA 4OV5B 4IOFC 1BWMA 4FQQA 4N8PA 5B4MC 1C5BL 3IB4A 3L7EB 5I15H 5IJKC 4JZNB 3H9YA 4KAQL 4Z7WB 1A7RH 4WW2B 3U4AA 1UWGL 1NUGA 1BX2B 3EBAA 3BGMB 2G60L 3ARDA 3EKCA 2OSLB 2Z93A 4YDKH 4U1MB 3TYFA 4CUCA 4EOWL 5DK0B 3V8OA 3D69A 1JTOA 1UENA 5EFIA 4R90L 4JHWH 4RAUA 2B8OT 4ZMAT 2VXQH 3HI5L 3QDJA 4X7TB 3AFLA 1MFDL 3ARDD 3QFDA 1CGXA 4LLWA 5F9WC 3UBXB 4L9LB 3Q6FA 5D6CB 4PS4L 1P4LB 5D7KE 4XP1H 1HXMB 4XBEL 1U0QA 4ZUSB 4TNWF 2KZWA 2B1AH 4PJBA 3V6OA 3SDYH 1NEZG 5TDOB 4HX1B 4UZGA 2R69H 4PRPE 4YWGL 2ZSVA 2O61B 1A4KB 5DC4B 4HIXH 1IAKB 3L7FA 3RVWC 1IEBB 3MRLA 3F65A 1KTDB 1VFUA 4YDJA 1P2CB 3CFEA 2HLAA 5D1XC 4NKOB 5IT2L 4KUCF 3BEWB 3MBEA 4U1HA 4UNVA 4HS8H 1KCRH 3MOQA 5FA3A 4MNGE 1I85C 3F7QA 1FAIH 3LQMA 4LASH 2OP4H 1I1AA 1INDH 4XC1L 3VE0A 4GOSA 1MJ8L 3NOIA 4RGNB 5ESAB 1MHHA 1MWAL 3CGTA 1S7WA 1JYWA 3KYMB 1WJ3A 4YHZL 1OF2A 4JR9L 5INDB 1LK3H 3MLZL 4BH8B 5MP6H 1GGYA 3OR6B 4PJAE 3MBED 3U83A 5T1KA 3EFFA 4PGDB 3QEQA 3NIFF 3OHXA 4JAMA 1ZVYA 1JL8A 1I1AD 3S36H 5F97E 1K4CB 2B4CC 1H3PH 4LEXH 4L3EE 1BJMA 2AQ3A 1LO3H 1F8TH 1S8DA 3NZHL 2FX8L 5EU5B 1NCDL 2UWEB 5FOBA 4XNZB 5T1KD 1JV5A 1KCLA 3KWWB 3R8BB 4JRXE 3TFKD 1EZVY 3QIWA 3P11L 5DMIH 1DBMH 3S3PA 1L4IA 1JI1A 3VGGA 3JVGC 3S6CA 1OAKL