1LE9B

Crystal structure of a nf-kb heterodimer bound to the ig/hiv-kb siti
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
312
structure length
312
Chain Sequence
GPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*GP*GP*GP*AP*CP*TP*TP*TP*CP*CP*T)-3'
publication title The x-ray crystal structure of the NF-kappa B p50.p65 heterodimer bound to the interferon beta -kappa B site.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 45
structure length 312
sequence length 312
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00554 RHD_DNA_bind Rel homology DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1le9B02
2.60.40.340 Mainly Beta Sandwich Immunoglobulin-like Rel homology domain (RHD), DNA-binding domain 1le9B01
1QEWB 1UJ3A 2X4TB 3Q3GB 4PV8A 5T3ZL 3VFOA 4MXVE 5EG6C 1HH9A 3U7AA 1JNNL 2WSKA 1TZIA 3SKMB 3OJMB 1W72L 2XI9A 1UYWL 3P9MA 3KPOA 3TT3L 4YDLB 3K2UL 3MRFA 1KPRA 2ED7A 2Z4QB 4XTRD 5DYOB 4V1DA 1BJ1H 3I6KA 5IBTL 1UXWA 3SOBH 1ZHBA 1U3ZA 4OZFB 3FRPA 3SDAB 3VG0L 3MXWL 3P4OA 4R3SA 2NY3D 2Z31C 1CD8A 4DGYL 5MEPA 2EDTA 4HBCL 1CFTA 1YYMH 5SWZD 4RBPH 4PJAF 1D6VH 4G8FA 5DRXB 1CG9A 5F8RC 2YN3A 3TH2T 4OKVA 5LAXA 5E94B 4WFEE 1Q0YL 3OKMB 4GO6B 1LE9B 2F8OA 3IDJB 4N68A 1WBYB 5ALBL 5IV2B 2E7HA 4NO0A 5DUPL 3DIFA 3TYGL 1HXYA 1YQVL 3KS0H 4HKJA 4MWFA 5GS0D 4F9PC 3N9GL 1JIBA 4MB4A 1LD9B 4QT5B 1E0OB 4TSAH 4LLWB 1VFBA 1YC7A 5DTFA 3QNXB 5HYSA 3WN5C 4HWEH 1IRAY 4Z7NE 3DRQA 3B9AA 3O9WC 4U1NA 4F8QA 3G6JA 5IFAH 3GNML 4LLUB 3V0VA 4N0RA 3CZJA 4OIIH 5EOCH 1X4XA 5BS0A 3CUPB 1VGKA 2VQUA 4GW1B 5IFJB 3U4AA 4V1DD 2G60H 2HVJB 4ZFOA 2ESVA 4UV7L 4GLRI 4N0UA 5L2KB 1G9NH 2DLTA 4IRJC 1HNFA 3DX8A 4P5MA 5GSRB 5DMKB 2YD5A 3SY0A 5GRVL 1X5LA 3V4VH 2AAVA 4I1NB 4LQFL 5KAQG 1FLRL 3WS6A 3K8LA 3VW3H 3M45A 1F8TL 1MFNA 4LHQB 4X7TA 2R0ZH 2XPGB 3D39B 2ICCA 2V2XA 5FM5O 3S3JA 3BT2L 4NO0D 5FHBL 1QKZL 3C9NA 1I3RB 3IFOA 1YYLH 2GYSA 4LBEB 2JJUA 2NX5E 1KTDA 3OKNA 3MBXL 3T4AA 1VCAA 3VDCA 1H3PL 3QUZA 5D7JA 3VFWB 5I8OH 5IFHH 1J1OH 5DVOA 2Q87A 3W82A 1N59A 4MAYB 5DD0H 3DX9A 5E56A 3X11A 1LO5B 4PJBF 4D3CH 3UJIL 1UJ3C 3U4BH 3PQYB 2VNCA 3K3QA 1U92B 2ZUVA 3MBEA 5SV3A 3EDDA 2KUTA 5H35A 4I13B 1H0DB 3MV8E 4AG4H 3GI8H 2IG2L 4HK0B 4NOBA 2J3SA 1BAFH 3R06A 3HC0A 4FA8A 1E6OH 3QUKB 2WK2A 2A9NL 1A9BA 1A47A 1NL0L 1L0QA 2ERJC 1FFNA 5HHMD 2NYYC 5J3HC 2I9LA 3ZKSD 1W72A 2I60L 4WFFE 3AGVA 3EOTL 3SO3B 1KIQA 4NN5B 2NY4B 1N64L 4LSDA 1FRGH 2IH3B 5D7LE 3MYJA 3QUZD 1IARB 5IB1B 3U4EA 1MPAH 1ZHKB 3UROR 2MKWA 1EEYB 1IAIM 2FD6H 1K6QH 2AGJL 2X70A 2R8SL 2CGRL 3C8DA 4HKBA 5TE7L 5JIPA 2PR4H 4YHPB 4Z76B 3C5SB 4PG9B 2IBBA 3D3VB 3RKPA 4A6YL 3IETB 2M26A 3QCVL 3PGFL 3P0YH 1XGPB 3T2NL 1WK0A 3QUXC 4HUVA 5HD8D 2X89D 1IQWH 1ZA6B 1EERB 2ADFH 4M7JH 5FK9A 5ANMA 1RIVH 2FL5B 5IB2B 4RFEB 5T3ZD 4CMHB 4KZDH 3BEWA 4L4TB 1TJHH 4WI8A 5C0ND 5ESAB 4Y2DA 1MJUL 4HJGA 3P4NB 3QPQD 4Z77A 4KTDH 4PJGB 5ID0A 2XT1B 5EBMB 2JF1A 1MLCB 4X6FB 4LCYB 1NMCB 4MQ7A 3GMOA 3E2HC 3DXAA 2MHAA 1S7UA 1IT9L 2PYEE 4YO0B 4ELMB 2XFXB 2YZ1A 1JWMB 2Q7NA 3NFSH 4KMLB 5DJ0A 3LH2L 3RL2A 2VDOL 2UWEB 5DURD 5C7XH 3V6OE 5D7JC 3HG1D 1DR9A 4M48H 4X6EB 4B7LA 4NWUL 1EUUA 3WUWA 1IC7H 4UDUA 2ZCHL 1TVDA 4JO2L 4RDQF 3S88L 2CDGB 4X7SH 2F54E 4PJFE 4S1DD 4CW1B 4I4WA 4QXUH 1NCTA 5DJYA 4Y1AE 3BPCB 3M07A 1UVQA 2QSCL 3UTQB 2VR5A 4JO1H 3EYVB 4LDEB 4OI8A 3I02B 1Y0LB 3QYCA 5D7KD 3VWKA 4H0GA 3CH1A 4XGZA 4Y2DD 4NQSB 4KXZI 1JWSA 3BUYA 3F58L 4ZFFA 4OUUA 2V2TA 3VXMD 3CX5J 3KYKL 3TCLA 2OMNA 3STZB 4O2CA 1FGNH 2BMKA 1R24A 4U1MA 3ZTNL 2O5XH 4HWZB 3J8F7 4HH9B 4Y19E 2A77L 1ZSDB 2OM5A 3BIAX 2NMSA 1KC5H 4KAQH 2VL5B 3QUYC 1N7ML 1ZHLA 3T0EC 4C58B 1DEDA 1MH5B 2WM0A 1F4YL 4DUVA 4DVBA 5T1MA 5JW4R 3S35L 1KB5H 1TZHA 1YN6A 2NLJB 2VE6A 4R8WL 3BGMB 1AGDA 1S3KH 3U0PA 1FL3A 1ONQA 1O0VA 3RUGF 4NCDA 2FIKA 1JRHL 1KIUA 2P8LB 4WU7B 1PDKA 3MRMA 4Y0GA 2FEDC 5KW9L 2FZ3A 1ZANH 1OP3K 4AH2A 2APWA 5FDWA 2YOCA 5CINH 3OR7B 1BQLH 4X4MA 3C2SA 3CXHJ 3LDBB 4A6YA 3RWDB 3HFMH 3RJDA 3VFMA 1F4WH 2JLLA 1S7VA 5DJDA 4BSJA 5GGRY 1TJGH 4O2FB 4JCLA 5F1SA 2V7HA 1I7RA 4NO3A 2R4SL 1P6FA 4MDIA 3KJ6H 4D0DA 3BHBB 4MSWB 2BJMH 1C12B 2WLZA 1XR9B 3WHE1 2DD8H 1FAIH 3T09A 3D69A 4OF0A 3JUYA 1PZUB 4OCRH 4KMTH 3S96B 1BVKB 2YPLE 1J5OL 4YHOL 1DCLA 2W92A 4L9LB 5JR1L 1WFTA 3BP7A 4KVNL 4RGOL 4YEFA 5T3XE 3LEYL 4ZUWA 2OTUA 4MNGA 5FB8B 5HYIA 5SWQA 4XBPA 3I9GL 4FZ8L 5KVEL 3SEPA 3MUGA 4Q9RH 2OBGA 2VERN 1MLBB 5D1XA 3X3GH 1SEQH 2HKHH 5ID1B 2RR3A 1NSNH 2VDQH 3TH3T 3TN0B 3U7WL 3ECBB 2VDMH 2ORBL 4I0CC 5DSCA 3HRZB 1RZJL 3QDMA 4UT7L 1GGYA 4IHOA 4WWID 5ISZA 5EOTA 3VDAA 3T1WA 5GIRB 4G43A 1VFOA 1D9KB 2EH8H 1UZ8B 5DUBA 5DR5H 5C86A 2W07A 5E99H 3LKOB 3PP4H 1J8HA 5CEZH 1UZ6E 1QPXA 3AS1A 3CFCL 2IBZX 1LWRA 2Y7QA 5ENWA 4KRPC 4LSRH 4ONGH 4G8GB 4DZBA 4HGKC 3UTTB 1S78D 3RBGA 3H3PL 2EDDA 4NNXB 3W0WA 2X4QB 3BZFA 4H1LH 4MZ2A 3Q0HA 1MJ8H 4X9IA 1WWBX 3QEHB 1XT5A 5GGSY 1MFDL 3MA7B 1OLZA 4OD2B 2KDGA 3HZMA 1ZA3B 1E4KA 2H45A 2Q86A 1G9NC 3I50H 5ESVB 3BGFB 2QJDA 5IGXH 4P5TC 1I8KB 2DRUA 1GCFA 4OFPA 5KS9A 5DHVB 2XKSA 4PGCB 3PHQB 1T3FA 2I5YL 3D85D 1YPZA 3UBXB 5ISZD 4TSCL 1DTUA 1AKJB 1A6UL 2AEQH 1SYSB 4HS6A 3IJYA 4JO3L 3FN3A 1E4WH 1U91B 1C1EH 4XPFH 3WLWD 1ZVSB 1CE6B 5IESH 5D7SL 1ACYL 5D7IE 3LAFA 1A1MA 1NCDL 1G9ML 4LFHD 2A6DB 3QWRD 2HJKB 1R3IL 1SHMA 3LN5B 4PGEB 3VFPA 2XYCA 5FKPB 2RHEA 3S37X 4PRHB 2AK1H 3ABZA 5F6IC 5C09B 3U9UB 2SEBA 1IGJB 4YHZL 1R3JA 4Q9QH 4MNQA 4BZ1L 2C26A 5HDQL 1L6ZA 1NCAL 3SHSA 5KTEL 3EZJB 1XH3A 1DE4B 5FYJH 2EE9A 3MUHL 4O5LH 5FGBA 4RRPG 1UB6B 3ILQD 1A6TB 5FO7A 2VXTL 3ARGA 5A2KH 1P84K 5GS1B 3FQNA 3REWB 3WFHA 5C0RH 4PJEB 3T4YB 3VRLE 3CC5A 2Z8SA 5IROA 5D1XC 2J88L 3K2MC 1AQDB 2WBJC 3TZVC 3I6GA 3MRHA 1I3GH 4ZPTA 4IEFB 2JCCE 1OAQL 2DWEA 5H2BB 3ROOB 2F74A 3OHXB 1ZKAA 5C2UB 3QPXL 1CFVH 1AGEB 5IWLC 4FQIL 3WNLA 2DJUA 3OB0H 4YX2L 2IFFH 4NNPL 1BOYA 2OSLA 5HPMB 4LIQH 2YSSA 2OL3B 4NRZA 4F33A 3FN0H 1XMWA 4BQBA 3ZL4H 2DQDH 3B9VA 4TVPL 5I9QC 1SEBA 4QRUB 4MNQD 5IB3B 3AAZB 3MLVH 2GW5A 2R2HA 3HZYB 1KELH 2O61A 1ORQB 2CLVB 3NIFE 5JOPE 3BI9X 5CJXA 4AENB 4IS6B 3BW9A 1CDYA 1FFPA 5EO9B 1LK2B 4ZS7H 4MVBD 2V6HA 1HWHB 2VQ1A 5E1AA 4XVJH 2BSSB 3CSPA 4HIEA 4UDTB 4LHUD 1FC2D 4P2QB 4K3HA 2D9QB 3SDDC 5FECA 4WEMB 2AJVL 3D48R 5TDNB 1A66A 2A83A 1MCNA 3K1DA 4FQXC 5I15L 3TBVA 1YMMA 1FNLA 1LE5B 4FTVA 1KIPA 4NO2B 1A0QH 4L4VB 2EDRA 3TNNB 3VD4A 3QI9A 4CVZB 3FQUA 4X5WB 1OQOA 2HA1A 3I2CL 1RQ5A 3QZWA 2EEBA 3FO1B 3DYPA 5AWNL 1T1WB 2HT3D 3F12A 4E41E 3TIEA 2GTWA 3BSZH 1OTTD 3WIFA 4XX1E 4NQVA 4ZDHB 4R26L 3LCYA 5FCUH 3HE6C 2P47B 4F7CB 5A40E 1FVDA 4UT6L 1JJUA 2F8XC 4UTAL 3MOAL 4PR5A 3SGKC 3DURA 3IFPA 5F7KC 4YC2C 2GSIB 2HVKB 4NHCL 1TJIL 3WDHA 4JN2B 3QA3A 4OZFH 4U0QB 4G42B 5GSVB 2D03L 1BBJA 4HUXA 4OSUL 1MJJB 4D2NA 5DQJB 5EDXA 3C5ZC 3SGDH 1HYSC 1GOFA 3HI5H 4NKMA 3IDGA 4PRAA 1GGCL 4TNWF 1D5BB 4TUKL 5HHVH 3MNZA 2F53A 3RIFK 3AB0C 2WWMD 1YMMD 5TDPB 5F72S 3ARGC 4FTVD 4YAQA 1L0XA 1N6VA 1PFCA 3LKSA 1HHJB 4M7LL 5EZIH 3VFTA 3QI9D 5IROC 3RHWF 2HWZL 2VSCA 4NQCA 1UWEL 5LGJB 2W9DL 1PLGL 2DLFH 4XWOC 2DQFB 3VMOA 5C0EB 5FYLH 3TBSB 4ZNEA 4HXAL 4PRPA 4MAUH 1CGTA 1ACZA 4LK4A 2XWTB 4H88L 3VXUA 2GUOB 2G5BB 1QG3A 5DGQA 4YEEA 4FNLH 4KK6C 3ARED 2J8UE 3S37L 1WSST 3DVGA 4MJ5B 1CBVH 4LPCA 5D2NA 3BE1L 3MROB 2EYSB 5DRZB 2FH8A 3N1PC 4AIOA 3FOMB 3QDAA 4XZUA 3PDDA 3AY4C 1CDJA 4RGND 3UX9B 3PNWB 4R4NC 5J13C 3BRDA 1HI6B 2BY2A 5E1HB 5E6YA 3GSQA 5I1GH 5SWZE 3PWPB 1S7SA 3NCYP 4UUJB 1ITCA 2F53D 4DJMA 3HNSH 5F71A 3LV3B 3STLB 2DQTH 5KSBE 3TNMB 5ERWA 3PGCB 4GRWB 4FFYL 3SPVB 2CUHA 3WYRA 4QO1A 2F19L 3EAKA 3MV9A 2YD9A 5FYKD 2D7NA 5DZOA 3W39B 4PJ7B 4MA8H 2FHCA 3ARFD 1AO7B 3OX8B 3S4SB 2AEWA 3HRPA 5FO8A 1DUYA 1CE1H 4WUUA 3VXUD 2EC9T 2AI0L 4Z0XB 2MNUA 4RX4D 1EGJH 4IRSC 4TTDD 1NAKH 4J3UA 1NFIB 1TVBA 1FSKC 3OZ9L 4V1DE 1FNEB 2ITCA 1MAML 2BRQA 2FYYA 2AV7A 4R7DB 4ZTPH 5CD5C 3GSWB 3TBWA 1A7RH 4GRLB 1MRDH 3FRUB 5CJOL 4P4RA 4HJ0D 1HHKA 3Q6FB 4WDIA 3KPLB 4L8SB 1OD7A 4G8EA 1KNOA 1JF6A 1CXLA 4S11A 3Q6GH 4HPOH 2Z93B 4BZYA 5EUOB 8FABA 3SGEI 4FXGB 1ZWIB 3NZHH 3QDGA 1M7DB 4O02L 3MGOA 5EH1A 4LPTA 1WZ1L 4ZTOL 5MENA 2HRLA 2IFGA 2C3VA 3ILPA 4JFEA 4RFNB 2R1WB 2FNBA 4CVXA 1CGUA 1IZKA 4HKZA 4WUUD 3G6JE 5C08B 2I27N 4BQCA 2MMXA 2NW3A 4JKLA 3FB8A 1TMCB 4ZPVB 1AIFB 5BV7B 2EICA 1F3JA 3EGSA 4V2CB 4WTZG 4XNQA 2ESVE 1OGAA 4N0UE 1LO4H 1M71A 1LVEA 3OGCB 4XX1G 5L7XL 2YUWA 3N0PB 2VWEE 5INCA 1DQML 4YHNB 4F2MB 5ACZB 1CXIA 3QHZL 5K93A 3FQXA 5MERB 4GAGH 5B8CB 1SBBA 5E6ID 2VXUH 5MEQA 1FORL 1T80A 5HHME 3OKKB 2H32A 3QDGD 4RNRB 3ULVE 1EHAA 4EVNB 5E2UH 4XMKH 1I8MB 4PTTB 3GK8H 4CU8A 5DJ2B 1FNGB 1Z3GH 4K23H 5FO9A 2V17H 4BUGA 3ZDXE 4X4YA 4F9LA 1EAPB 5IW1B 4L8DA 5F44A 3QISA 4I2XB 1DQJB 3OAYH 1FGVL 2XTJD 2Y36H 3RY5A 2L0DA 5HTSA 2VYRE 1TZGH 4XNUL 4Z7VE 1BZ7B 1PKQA 1B0WA 4PGBB 4MXQD 1KCUL 2AK4A 4PY8I 5GJTH 3EBAA 2Z8WC 1OGAD 2IALA 4KUCF 1FHGA 1KJVB 1OW0A 3MMEA 4OI7A 1LK3L 3MREA 4UNVA 1Q9LA 3PABA 2NY0B 3O3BA 1HK6A 4KJQD 2LAAA 1LNUB 4NP4L 2IANA 1NFDE 5EC2B 1TQBC 1QFWH 1F00I 2E8YA 4NFBA 5T3ZE 1SMOA 2MPAL 1IKNA 2IGFH 4X6DA 1A4JA 5GGUB 5CKGA 1WQVT 4UTBH 5CBEB 3NCJL 3RZCC 4O00A 4Q2ZA 2XQBL 2DL9A 2VLKA 1JF5A 3F7YA 4HIXL 5EIVA 2ZNXA 5TQ2L 4GAJH 5DMIH 4W68A 3RVUD 3ETBF 4J4PC 4U2ZA 3VFGH 2NZ9D 5TE4L 5I73B 3HNTH 2FJGA 4E9LA 1C7SA 2IBGA 2Y6SD 3EDJA 2QQNL 1ND0A 3RP1A 3RWEB 1YMHB 1KJ2B 1OD9A 5IR1A 1R3LB 2AK4D 4Z9KB 3HG1E 1AE6H 3AXLA 4JDTH 4MHHG 5HHOA 1MFAL 3GSVB 4WI6A 3ZDZF 5CEXB 5HHQB 1CICA 3L5WB 3V4PH 2PXYC 3E6FB 4K3JH 4R4FH 4OZIA 5ANME 3FQTA 3O4LA 4P57A 5J06A 1OT2A 3G5XB 5J4MA 1S7TA 3NIGF 4LEXL 4QYOB 4NYLA 1U8NB 5D7KE 4BKLB 1FNSH 4M1CD 1CDHA 2VLKD 3VXME 5HDBE 2EE6A 3BMWA 4WCYH 2XWJB 1EO8H 5DK2B 4WO4A 1T7VA 4I0KA 4Q6IB 3OB8A 1YNTB 4XC1H 5KSAA 4TULL 1W0WA 4RWHA 1NAML 5GZNC 3IJSB 4DQOL 1YEEL 2APVA 1CQYA 2AKRA 3L3JB 4HS8L 4B7IA 2YRLA 1XGYL 1B4JL 4Y5XA 3CU1A 1NGYB 4G5ZL 5I17A 1QQDA 1AGBB 3REVB 5HYSG 3RWJB 1KCVL 4D0CA 5HHOD 2BVPA 4M5YH 5F9OL 5HHNA 3UJJL 1Q1JH 1CICD 1YEJH 3H3KA 5C07B 1XF5A 1LQSR 5AD0A 1NGPH 5JW3H 4GKZA 5IMOA 3MLTA 2CIKA 3DMMD 3RX8A 1EO5A 2RFXA 5TFSL 4Z7QF 1FDLH 1SBSL 5IMLB 3IAQA 3L5HA 4PG2C 4DN3H 3Q2CA 5E6ZA 4W70A 3KPRB 3PGDB 1N5YL 3BH8B 4XP5L 4YDLC 4OJFL 1VKXB 1K5NA 1F3DH 3KJ4C 4CMMB 3FONA 4HFUL 1YNKH 1QR4A 4LVOB 3FMGH 3HE7B 5L8KB 5KSAD 5EO1A 4N0YL 3SDAC 1E6JL 2CDEB 4JFDA 3O11B 5BMFL 4RAVB 1GC1H 5EU3A 3P0VL 3RDTA 4O2EA 3C09B 1T21B 3VRIB 5ICYA 2FH6A 4ZG1A 5KG9B 1CGVA 4Z7UA 3IVKA 2LU7A 2P48B 4EXKA 1DFBL 4RQQB 4FXKA 4JN1L 5EORH 4IRZH 5BO1H 3QDJA 1DBAL 3LRSB 2QR0A 4Z7WA 4JCMA 4WW1A 1GPOH 4POZC 5EU6D 4G6MH 2CO6B 4XXCA 1H3UA 2R4RL 4GKNB 1A6ZB 2Y1VA 1T7WA 5E5MB 1IQDB 1AD0B 3B5TA 5C0CD 3U6RB 2C1OA 1F90L 1UM5L 1EXUB 4QXTA 1AHWA 3KXFA 3MCLH 3V6FA 1E4JA 1VDGA 1X3DA 1DVFA 3MLZH 1WBZA 1ZS8A 2DQJL 2J1KA 5BZDB 3ARSA 5CZVH 5DHVH 5CJBA 2ZNWA 1A3LH 2PCPA 5FM4A 4NUGL 3RDTD 5K9OB 4KKBC 1ORSB 1MEXH 1G7JA 1N2RB 3AS0A 4GSDH 2DAVA 2GJ6B 1OAKH 4M6NH 5JPNB 1FLTX 3WD5L 4PD4J 1WLHA 3ZE2E 1JYVA 2Z0BA 4NZDA 3QDJD 3D18A 3ISWA 4YHIA 4OCYH 3PWNA 5L2JB 4E42B 3HAEB 2EXWC 4HX1A 2P8PB 1KTLB 3JZ7A 3NN8B 3TVMB 1NAMA 4GAYA 3CFKA 3ZHKA 1FZJB 4MA3B 4OQ1A 2BC4B 1JF1B 25C8L 4P9HC 4JPIA 4MNGE 1LO3H 5CHNB 4OV6F 4PJDA 3RIAF 1P1ZA 4DCQB 3SQOH 3BQUA 1VFUA 3KXFD 1RMFH 4BYHA 3IKKA 5BOPA 1OP9A 3WL9B 5C8JA 2D31B 1DVFD 4U1HB 1S8DA 3PV7A 2H3NA 4F58H 1UC6A 4NO5A 2N7AA 3L3DA 2JJTC 3LHPL 1FFRA 4PY8J 4DZ8A 3UYOD 5E9DB 1GZPA 2P24A 5ISZE 4FQ1H 4PIRF 3FB7A 3H9SB 5IJVB 2CO7B 4AQOA 4ZFZA 3VI4F 4OZHA 3P40A 1J8HE 2ZG3A 2NPLX 1A9EA 2PW2A 4XXDB 3UYRL 4ZQKA 4LVHB 2HP4A 5GRVK 3WUWG 1O7SA 4CU7A 4J3VA 2V7NA 4WI7A 4U1LA 4XP6L 1OY3B 4OLZL 4EI5B 4KK9D 2A73A 3U7YH 4P59L 2VISA 4LCWA 2W0PA 1E4XL 2R0LL 2A0LC 2OL3H 4KPHL 2Y06H 2UYLB 3MRIB 3GSXA 2XA8H 2NYYD 3O2VH 5JLZA 3QB7C 3BQUD 3CX5K 4F7PA 1EPFA 5B21A 3GSOB 1MCOH 1TTFA 4JJ5B 5BRZA 4APQA 1CL7H 4XXCC 3TFKC 3B2UC 3TC9A 1E28A 4UV4L 5D5MA 1SM3L 4YFEA 1A2YB 4IOSD 1YPZE 4NDMB 1SJHA 1OP5H 1XGTA 2YD6A 5I0ZA 3UZVB 5SWSD 3KPSD 3LKNA 1LEIA 4JZJB 4JM4H 1KGCD 4LF3A 5BVPH 4PP2A 2MWCA 2HLAB 5J9PA 1ZLSL 5I1LB 2V2WA 4XI5D 1U8JB 3NCCB 1RZKL 1NMCC 5JHLH 1RUKL 4YFLF 1JUFA 4U6YA 1FYTA 4HGWA 1ZE3C 2YD4A 3BAEH 4NKOB 2XICA 3L5XH 4DFIA 1EBAA 1WWAX 3UZQA 7FABH 4FHBD 1FVCB 3O45B 4MNQE 4WNQB 4HG4J 1LO2L 1ZTXH 2NY1B 2R1XB 3N85H 1WAAA 4HWUA 1KBGH 3CXHK 1G7MA 3NZ8A 1CGSH 2NXZB 2DQUL 5EU5B 4KZEH 5B38A 4OLUH 2L4OA 4HAGA 5EIIB 4G7YL 1NBVH 2WLYA 4ODUA 1LDSA 2NZIA 2LFGA 4HLJA 4ZAKD 5JMRA 4Y5VB 2FHFA 3LQZB 3X3FH 5LQBH 4YBQC 4DN4L 1PJ9A 4N0FB 3A6OA 1JGEA 3V0WL 4EXPX 4NNYB 3SE9L 4LLYB 3CDGB 1KIRB 3IXAA 3RVTC 3G5ZA 5FF6A 5K9JL 4YBHA 3R1GL 5FEBA 2AV1A 1FYTD 1S9XB 2BNRA 3QEQA 3FTGB 4P2OA 3ARBB 4K94H 4XRCA 2R9HC 1WBXA 1JNLH 2GAZB 1ZLVK 2CLRB 3EHBD 4YGVA 5C0IA 2R2EA 3VW3L 4XWGH 4YDKL 3KPQB 4BSWB 1TNNA 4LSSL 2OJZH 4G3YL 1RZGA 2KKQA 5J6GB 1YY9C 1AH1A 4YXKH 3KWWB 2YRZA 1BLNB 43CAB 3GSRB 5DQ9A 2N4IA 4L3AA 1OQXA 3NGBB 1HILB 1I3VA 3ROLB 4OM0H 5IFHL 1HSBA 1I7ZA 4HF5H 3G6AA 3TBTA 1I7TA 1NUNB 4NGHH 3QIWB 3CLFH 2ZOKB 5CJQL 1RJYA 5DD0L 5JIHA 4PGDA 3WIIH 4APQC 3QXUA 3SE4A 4HD9A 4K8RH 1YMME 4QGTA 1CYGA 4FTVE 2JIXD 1UWXK 2E27L 2HTLD 1T20B 1IGTA 4GRWH 3WXVL 3LDBC 3X13A 4AG4L 3K74B 4UQ3B 3SDYH 1A7PL 3Q5YA 2BY3A 4AEIL 3QEQD 4P2OD 4OUOA 3NAAL 1HHHA 5IHBA 3MV8B 4PJ5D 3AVEA 4UBDC 3L3GA 1I9EA 1IFHL 3RWHA 1JPSH 4P23B 2BCKB 1XIWB 2FEDD 4LFHG 4PUBL 2X41A 4JAMA 1DQQA 4QRRD 4DFHA 4J1UB 1B9ZA 1FRGL 4M61B 3E8UH 1JV5B 4KQ3H 1P5UA 1MFEH 4RGNE 2CUMA 1F6AA 1OSZB 1BVLB 3BZ4A 4HBQA 2B8OT 3OGOE 1K6QL 4L9LC 5F9AC 1OPGL 4LNRB 2CKBB 1DDHB 3DUUA 3FOLA 4PJEF 3W9EA 3DX7A 4Y4FA 2F53E 4G7VL 1CLOL 1BQSA 5D7LB 5FFLA 2PR4L 2EXYC 1JGUL 3D9AH 4MD0A 3T77B 2DM4A 3QG6A 3DV6A 5ECJE 4AZ8A 5CJ8A 3MV7B 1T1XB 2PO6A 1CLYH 4PTUA 3MRNB 4AMKH 2CMRL 1IQWL 4M7JL 1V3JA 4I9WD 4PLNC 5LGHH 1DUZA 3T0XA 1L6XA 3MRBA 3OJDA 1DBJH 2X4RB 3GUTB 4PRPE 4D9LL 1N5AA 1Z5LB 1J1PH 2AW2A 2D7MA 4P3DB 4MZ3A 4M3KB 4XCNB 4FQLH 5IK3B 4JR9H 3VXUE 2YC1B 4U6XB 1J1XL 4KUZH 3W5MA 4GKSA 5A3IC 1WZLA 3CFJB 5C9KA 4HIJB 5C3LD 5JOEA 1RHFA 1CCZA 2R0WH 3T3PE 3C8HA 4KKAD 3SKOB 1K2DB 4Y7MA 3VXOB 3NCBB 1FZOA 2H9GB 2IPUK 1PD6A 5DC0A 5GRYA 1IKFH 5CZXD 5IIEB 1N26A 4JPKH 3U0WL 4PJHE 1BECA 5EBWB 3MLSH 4IIQB 3RUGA 2W1NA 3NFSL 3ULSA 2CKNA 5CS7A 4Y4FD 2HG5B 4MS8C 4P5KB 4YXLL 2QQLH 3HS0B 3VG9B 5TF1L 4ZUVA 2MQ0A 4TVPE 3DROA 2WANA 1G6RL 5ICZB 1IC7L 4QWWC 3L1OL 4LHUG 4WUKL 3BGFC 3MV9E 2PO6D 3IFLL 3OAZH 1S7WA 5HGHA 1U95A 5HI5D 3OXRB 4YH6A 3SE4C 1GZQA 5I66B 3LMJH 3WJLC 3W11C 2VAAA 2AQ3A 3CZFA 4WUUE 5K9QI 3DSFL 2EE3A 2GTZA 1SVZA 4JRYD 4XP4H 3SDCA 3C6LB 3O41B 3CVHL 4HK3N 2F54B 4PJFB 4H0IA 2VDNL 4GW5A 1KLFA 1U93A 2CRIA 3V5HB 1TVHA 2ICWA 1NBYA 4OD1H 3VGAB 1YDPB 4CJ0A 3OKEB 5GHWH 3MA9H 2FATL 4K7FB 3ZHDA 4POYA 2Y5TA 2VXQH 1EHNA 4X98B 3QEGH 1F02I 1CFNA 4UAOB 5T1DL 3CDFA 2JB5H 4YBLC 4OF6A 3RL1A 1K8IA 1MCRA 1A7OH 4OCXH 3QDGE 1R5IA 1V5JA 4K3DH 2ICWJ 3UJTL 4NFDA 1A21A 4TNVF 1VACA 2C7UA 3CDCA 1JYWA 4F57L 4Y19B 1N6UA 1LP9E 3MLWL 3GBMH 1BOGA 5I19H 1PYWA 2VDPH 3FCTB 3CMOL 4PREB 4UQ2A 5GS1C 2XTJE 3V79C 1NCBH 3HTLX 3QCUH 1MVUA 4XBEL 1ETZB 3HC3L 3GMRB 3P11H 4BQ6A 4EN3B 3QQ3B 3JWDH 4YPGA 4DKEH 5ADOH 3DVNB 5C0BD 3BMVA 4OCLC 5F7NC 5T5FH 4EBQH 4GQPH 1KYOJ 5CINL 3SJVB 1OGAE 3TPUA 4J6RH 1TCRA 3OAUL 4R4BB 2XXCB 3MRPA 5EU7C 2DS4A 5LVEA 4TUJA 2VXSL 3QUMA 2GITB 1KUMA 1A4KB 4F3FB 4JREC 1D3CA 2Q7YB 1KPUA 1IEBA 4OCWH 1UUSA 4WIQA 4R0LA 4F7TB 4KHXH 5FA4B 3D0LB 3ZT6A 4ZOAA 4WI3A 3F7VA 3LY6A 1WC7A 2ZP0T 2WBJD 2AEPL 3EJZD 3PWJA 4XNXL 1BBDH 2R0KL 3TJEH 2Q3AA 1N6QH 4PJXE 1R5VB 5I18L 2Y9RT 3EYQD 3A6BL 1VA9A 1BD2B 3L3HB 2CDFB 4GRMA 4GUPA 3WNMA 3SKJL 4GW4B 3WHXB 5IEKB 43C9A 3DO7B 1AD9B 3O6LH 5CZKA 1PKQE 1MOEA 1CR9L 2AJSH 2AK4E 3CVIL 5DJXA 3HLAA 5J6HB 2YPLB 2ICES 3T1FA 4Y5YA 1RHHB 3AM8A 1G6RA 5KN5A 5F3HA 1JTOA 3S34H 5T1KB 2ZSWB 1L4IA 4OZ4B 3B9KB 1NFAA 2A74B 3NCFB 3GMNB 5JO5A 1UH2A 4W4NA 3S8WA 1INQA 1NUDA 4TVSa 3N1MC 1YEIH 5F9JB 1CS6A 1H5BA 3GDBA 4MJ6B 4JM2B 1PEZA 2G2RA 2VLKE 4EOWH 5EUOF 4F80A 4DW2L 2Z92A 4LLMA 3CVHA 3AU1B 3LKPA 2WWKO 3OJ2C 4JY6A 1J18A 4M62L 2X9XA 4QRSA 1MAJA 4ALAL 4J2XA 5T1LB 4U6HB 1U3HA 3GRWL 3V2AR 1CF8L 2BSTA 2NXYD 3WO4C 4PJ8B 4MCYB 1GOHA 3HE6D 4X83A 5HHOE 3E3QE 1KENH 1Q9KB 1T6WA 4N9GA 2HTKD 2YUXA 2F5AL 4X9HA 4OZIE 3E6HA 4WI2A 4RWYL 4UB0H 3O4LE 3O3DA 3B2VH 2VB5A 1A5FL 5DD1L 1I1AA 4PJIF 3SGJA 2XACC 3UO1L 3QEUB 4BUHA 5E7BA 1ZHNB 5MEOA 3LIZL 1OTSC 3R8BB 3C5ZD 4HS3B 2GJZA 3EOBA 1AC0A 3UP1A 1C1EL 1AI1H 3BYTA 2FR4B 2N56A 4WFGD 4NN6C 2FO4B 4C4KO 5I1EH 3LEXA 4IM8A 1E27B 1TNMA 5ESQA 5GGRA 1U3HD 4XWOD 3VJ6B 1S7QB 5CUSH 5DS8A 4ZS6C 5I1CH 4TQEL 3L95A 4K8RC 3BDYL 4CN6A 2IJ0C 1CXHA 1WCBA 1YJDC 2WUBH 4WU5A 3H3BC 4Q9QL 3P77A 3KYNB 2VZ1A 4JPWH 3V95A 3U36A 3V5DB 1XF4A 2B0SH 4O5LL 3OR6A 5D96B 2Y5EA 2NTFB 5ILTL 1CFQB 2Q76A 3GIVA 5C0RL 3HAEH 4ODHH 1I1AD 3ARRA 5EU6E 1RUQL 3H0TA 3ES6B 4R4ND 2FX9H 1F11B 3KYMB 4KI5F 5DFVD 1GHFH 5TGBB 3KYAA 1I3GL 5DD6B 2BVQA 5C0CE 1BVOA 4CKVX 1QACA 1RJLA 4WEBH 5CD3A 4OGAC 2QADD 4HLZG 2I9TA 4G80B 1M1SA 1SY6A 1H5BC 5GGTH 4RZCA 3BJLA 1CFVL 3F65A 5E8PA 4L8SC 4HQQL 1V8HA 4ODXB 4MJIB 5DEGA 5D8JL 3T3MF 5C2BH 4ONFL 4JDVB 1ZLUK 3FN0L 3K81A 2DQDL 2A6KA 2BOCA 2Q6WA 3NOIA 4Z7UE 2CJUH 5D72H 1DBKL 4P0DA 2FCBA 2WMPA 3ARXA 5DJAB 4KJYB 3EYFA 4YHML 3MC0A 4G6AD 5DHYA 3QDJE 4ELKB 4RCAA 1VHPA 1LDPH 1EFXB 5DEFA 4Z7WE 4OAWA 4RFNC 2FO1A 2J4WH 2OJEB 5BVJA 5C9JA 4JFXB 4JKMA 1ZMYA 2IQAA 3MLYL 5ETUA 3H42L 2DI8A 4PBWD 1FNAA 1PY4A 3GRWA 5FAAA 5BV7C 4IOIB 3PL6A 3T65A 3MRJB 4QTIH 5HYJD 3C8KB 3KXFE 3BKJH 3F5WA 3IF1A 5FDYA 4X99B 1Z9OA 3NACL 4C56B 1NCWH 4ENED 4XPAL 5FA3A 1JGDA 2P4AB 1J87A 5B8CC 1YEKH 3O6MH 5EPMB 2X4NA 3MRQA 2FBJL 2UZYB 3GHEH 4GBXA 4LARL 5F7DB 3RKDC 2PYFB 5BCAA 2V5TA 1DN0B 2NQCA 2VZSA 4QTHA 1IAIL 4E41B 4F8TA 4G9DA 4Y16B 3HZVA 4YFDB 3UMTA 5CEZD 1L7IH 2EYTA 5DUML 3WDJA 2IADB 4HV8B 3D25A 5C0GB 3GBNL 4HT1H 5F9WB 3VFUA 3PHOB 4BA8A 1AFVL 3QJHB 3B3IB 1IL1B 3PL6D 3PWLA 3BRGC 1T89A 1NC4A 4PJDE 2W65B 5IT2H 1U8HB 1P4IL 3S98A 3AMLA 4FRWA 2B1AL 3BP4B 3EDKA 2NY0C 5GZOC 2DM2A 1MRCH 5HVHB 2BNUB 2G9HB 3EYSH 5F1IB 1FG9C 3FZUC 4X8XA 3WN5B 5GISH 3RY4A 5L9DH 2GK0B 1B3JA 3VXTA 3L3KB 3O9WB 1AXSB 5SWSE 4GBXD 1K4DB 4L3EA 4ORGB 5DRWB 1KEML 3GM8A 3DRTA 3CAFA 1KN2H 4OZHE 4S1QL 1KGCE 2IH1A 1J05A 4BH8A 4ZSOB 2PTUA 2YBRB 3VRJB 1RZIA 4RAHA 5IJKC 1R3HA 3VFVA 1MCLA 5E24E 4IRJB 5FHAL 2DQHH 4P99A 5I73C 2DBLH 1RU9L 1FZKB 4F37K 2VLRB 1N0XH 4LP4A 1VSCA 5I1GL 4LCWE 3JWDC 5H8DA 3RI5K 5KJRL 5J11B 2DQTL 1KLUB 3U2SA 4HXBL 3RZCD 32C2B 1HINH 3D2UA 1RULL 2NY3B 4H0HB 5AZ2L 1KFAH 3IU3A 4YHKH 5AYUL 3BWAA 5SWZB 3RWGB 2O5YH 3DGGB 1O7VA 5D5ME 1S7XB 4LLVA 5FYJD 3RWFB 4NCC2 4MA8L 4J23A 1BF2A 2ADJB 2C5DC 5I2IB 3S5LA 1Z0MA 2H8PA 4YUEH 3FFCA 1P4LB 3WFEH 3LKRA 3LN9A 1UJ3B 3V6BR 4PV8B 3JTSA 2R1YA 4Z95H 5EWIH 2EDHA 3VFOB 2NW2B 1BX2A 1HH9B 1UB5A 4M1GH 1TZIB 4JQXA 2Q8BH 4NJ9L 1A7RL 1CK0L 4Q6IC 4XNMA 5CP3A 3ZKMD 3P9MB 3KPOB 3MRFB 1MVFA 1FYTE 1KPRB 1P9MC 5J0BA 4NZTH 4V1DB 3I6KB 3GHBH 4HPOL 1LO0L 1UXWB 4PJBE 4H8WL 1ZHBB 2EDOA 1OP3H 1C16A 3NZHL 5DD5H 3EFDH 4QRPA 4PJ9A 3P4OB 1WAAE 4QNPF 3ARDA 1LMKA 1ZV5A 3QFJA 5MEPB 1CFTB 3T8XA 1T83C 3UC0H 4CUCA 4G8FB 8CGTA 1CG9B 2X4PA 4OKVB 5LAXB 1T89C 2DTML 1Y18A 4K7PX 4XP9L 1AY1H 4PRDA 4OLVH 5GZND 3ULUH 3FFCD 4NO0B 3DIFB 4YWGH 1HXYB 4IDJH 1WITA 2CKBH 4HKJB 4MWFB 3O2WH 3TJHC 2NNAA 1BM3H 2H26A 1VFBB 2N1KA 4FQCL 5DTFB 2ZUSA 3KPTA 5HYSB 3DUHA 5FYKU 3DRQB 4U1NB 1MNUH 5K59F 3QR2A 3G6JB 1WEJL 3HE7C 5HSFA 3QUXB 3G6DL 1KB9J 2DL2A 2LVCA 1KCRL 3V0VB 4TTGA 4KHTH 1FIEA 1QO3A 5BS0B 1VGKB 2R29L 3QEQE 5H94A 2RB8A 1QPPA 4U1SA 4KTEH 4ZFOB 2C4XA 2ESVB 1CZ8L 1ADQL 4N0UB 2DI9A 1ZK9A 1IAOA 3S6CA 4PJ5E 2PETA 3C09C 4QRPD 3PIQA 4PJ9D 3DX8B 3KLHD 1A7NL 4AEHL 5E2UL 1YQ2A 4XMKL 5JIKA 4P5MB 3ARDD 3QFJD 2CK0H 4KUCD 4K23L 3SY0B 4D9RD 1B0RA 4OB5H 5K9KA 2W9EH 1EK3A 4LOUC 5HHMB 3M8OH 4CADA 2HVJA 3BPLC 5F7UA 1G7LA 2M1KA 3RVXD 4X7TB 1AJ7H 1D6EA 2V2XB 3SDAD 2UUDK 3C9NB 3IFOB 3TT1L 4LRIC 1KTDB 3OKNB 4ZODA 3BD3A 3T4AB 4B5EA 5CGYC 3QUZB 5D7JB 5DDHA 3CPLA 5F89A 4EQ3A 1FIGH 1N59B 3HB3C 4OQTL 5F1OB 5GRXG 4L8CA 3DX9B 4N1EA 3K4DA 3X11B 2NCMA 4MXVF 1Z0NA 1H9VA 4C83A 4I9WE 1HH6A 1OWWA 2XZAH 3MBEB 4O4YL 2IGFL 2ATPA 3B43A 5H35B 3IU4H 2E8ZA 4UTBL 3BDXA 1HQRA 4MAYA 1NDMA 3R06B 3HC0B 1ZEAH 4QXGH 2D7TH 2XRAL 1ODAA 1A9BB 1S7RA 1EVUA 1FFNB 2I9LB 1HIML 5L2KD 1W72B 1F45A 3ZKXB 4PP1C 5DRNA 1KIQB 5BQ7A 5HY9A 1CFSA 3MYJB 4ERSH 3CU7A 1NCCH 4HKXA 4KKBD 3U4EB 3FT2B 1AE6L 4F7EA 3TGXA 4HJJH 5EA0L 2E6JA 3D39D 1P7QA 3BN3B 1MCPH 1HXMA 2F58H 4H25A 5FM8A 4K9EL 5EBLA 4LSTL 1PG7L 4HKBB 3JWOL 1EJOL 3ARPA 3I3BA 4Z7NF 4JPVH 1UH4A 5B39A 4B53A 1OSPL 2AABH 2EXWD 1HYRC 4HZLA 1PSKL 5F7LB 5ABDE 1RZFH 4JRYE 4HUVB 3QWOA 3L7FA 4MAYD 1FNSL 5T5NG 4KKCC 5FK9B 4X7CC 3B9DA 1MF2H 3SDXA 3HMWH 5IQ9A 4ZFGH 2P5EA 3BEWB 1OAYL 4TN9A 5LJYH 4XC1L 3WLBA 4D0BA 4Y2DB 4HJGB 3NABH 4U6TA 4Z77B 1UQSB 3B5GA 3RUGE 4NKQB 4ISVA 3IB4A 4N9OB 4AIXA 2F5BL 4UINH 4EI5C 3L3IA 5ID0B 3X17A 1OAXL 1RUPH 3RA7H 4X8JA 5B38G 1NEUA 4MQ7B 1ADQA 2EKSA 3GMOB 2MTPA 1UM6L 1CDGA 2IAMC 3EO9H 3C6SA 2UY7A 4KK8D 3DXAB 2MHAB 1S7UB 4XCCH 1EFQA 2CH8A 3DHMA 3LZFL 4DGIH 4POUB 3IXTB 5DJ0B 4FFVD 4P46A 3RL2B 2NX5A 2P8MA 1QBML 4BSVB 1C5BH 2NY4D 3IKCA 4AIZA 1C5CL 1FE8H 3MOBL 2CR6A 4FQHA 1NGQH 3WUWB 1MCCA 4UDUB 2A1WL 1JZ4A 4OLXL 5I1JH 2WAHA 4UIKL 2YPVL 3ALWA 1LGVA 2ZUXA 3VFSA 4I4WB 4JZJC 1IGCL 4WI5A 5DJYB 5JNYA 3BJ91 5E95B 1UVQB 3QRGL 2P5ED 2MCPH 3BKCL 3D3VD 4XNZB 4OQTA 2YPKA 3VWKB 3CH1B 3DLQR 5JHDA 1JWSB 3BUYB 5EUKA 4ZFFB 3TBYA 3TFKD 3GMPA 4OUUB 3B2UD 2V2TB 3VXNB 3F6IA 5T3XH 3TCLB 2GQHA 3S3PA 3JV5A 4O2CB 1WICA 2GT9A 2C3GA 3PHSA 3ULUF 4JY4A 2BMKB 1R24B 1RZ7H 3C08H 2BHYA 4NBXB 4L4TD 5TE6L 2NY1C 4JQIL 1NMAH 4GJTB 3KPNA 3I6LD 1JCKA 4KRPB 5IG7A 2NXZC 5BO1L 5KSUA 3R0NA 4ZXBA 5FUZH 5DVLA 1ZHLB 1FFOA 1VGEH 4KV5F 1VPOH 4MA7L 1ZGLA 2OCFD 1Q0XL 4OZGA 5T1MB 1GGBL 1TZHB 4LU5H 1YN6B 2VE6B 3Q1SH 1U8KB 4Y5VC 4K2UH 1AGDB 3U0PB 1FL3B 1ONQB 3UEZA 5I1HL 5C0DA 3UDWC 1EMTL 2NY7L 2FSEA 3CLEL 2FIKB 3ZT7A 3QQNA 1WCQA 3HMXH 3MRMB 1JGLH 1MH5A 1FL5A 2CUIA 3QHTC 3K0WA 1MCWW 2FZ3B 4JZNA 4AH2B 3MLZL 5FDWB 3C60A 5M7QA 5A2FA 5HI4C 3VXPA 4W6YB 4P3CL 3WFDH 3LRHA 4G6JH 3QXTA 4A6YB 4ONHA 2HT2C 3VFMB 3L3OA 1S7VB 5DJDB 3W9DA 5JXAL 2X09A 1I7RB 1EDQA 4NO3B 1EHXA 2OR8A 5AZEL 4X6CF 3V52L 4D0DB 4MDIB 4NQTA 4KRMB 2RCSH 4MQXC 3FN9A 3NGBC 4L8BA 1SVCP 5F3BA 4DGVH 1CDIA 1JI2A 1L9MA 4IJ3B 2PYEA 3QIWC 4M5ZH 1W8NA 5A16A 3X12A 3D69B 3BO8A 12E8L 2ZG1A 2R9HD 4P46C 5F6IB 4FZEH 2QHRH 1IC5H 5A43C 2B1HL 5DT1L 3BP7B 2YD8A 4Q97A 1MCDA 3GMMB 1EO7A 3RGHA 1FH5H 3RTQA 4MMZC 3FFDA 2HFGH 1T2QL 1YY9D 2P42B 4M7KL 2OTUB 4ZUWB 4MNGB 5SWQB 4XBPB 5LCVH 4Y1AA 4M6ML 1NANI 2HJLA 6FABL 2AP2A 1X5YA 3MUGB 1MFCL 2VLMD 5D1XB 3A67H 4TPRH 2OQJA 5I8KL 3M17A 1VFAA 1V7MH 4Y4HA 5FM5M 4P23C 2IF7A 5DSCB 3ZE0F 2PNDA 3QDMB 4DUXA 4IHOB 5EOTB 2FX8L 2WIMA 1UKTA 2O26U 4G43B 5DUBB 4DTGH 4HPYL 2EH7L 1NGWA 3TYFA 1J8HB 3TN0A 5FGRA 1U9KA 1BGXL 3ECBA 1NLDH 2Y7QB 5ENWB 5F7EL 4JFFA 4BZ2H 4ZXBC 4DZBB 4UBDD 5KVGH 3W0WB 3BZFB 3R4DA 1I9RL 3GZKA 5E8OA 4XVSH 3MJ9H 2G75B 2J6EH 2MJWA 3D0VA 4NZRL 3GGWA 2EDFA 1J0KA 1CD0A 2BX5A 3L7EA 1KN4L 3HZMB 2DLGA 4ZOCA 2Q86B 1ZT4A 1JP5A 1NKOA 3WFBH 1G0XA 5AUMA 2VR4A 5LXGL 4RRPA 5IHZA 5KS9B 5JQ6L 3C60C 5B3NA 5IB4A 3WKML 2XN9A 1T3FB 3GMQA 3ESUF 1YPZB 1ZLWK 2BOBA 4PV9A 1X7QA 3VD5A 2HT4C 1VESA 1KV3A 5I30L 1U8QA 4HS6B 3IJYB 1HWGB 5C0AA 3GIZH 3TN0D 3H9HA 4IIQC 1FAKT 5GRJH 5E08H 4JFFD 3VG9C 1A1MB 4NPYA 1G0YR 1IGML 3N85L 3TH4T 3BKYL 4IDLA 3VFPB 1D9KD 4Z8FH 4HW6A 1ES0A 2HKFL 4IMKC 5JORA 4OT1H 4KZEL 3SKNA 1HKLL 2SEBB 2J8OA 1R3JB 3V6OC 1QFUH 4G8GD 1FG2A 3OBAA 1HZHH 1TCMA 1F58H 5GS2D 5D1QA 2ZJSL 4JRXA 4ODVL 5TPWL 3P30L 3C6LC 4HUKB 5FKPA 5ALCH 5FO7B 5LQBL 3ARGB 4MS8D 3WIHH 1JYXA 3OPZL 3FQNB 4LASH 3WFHB 2Y07L 2OZ4L 3PF2A 4PRHA 4R7NA 3CC5B 4LSVH 3RAJL 4QWWD 3VGAC 1QP1A 5KANI 4KVCL 1JHLH 3I6GB 1EBPA 3GO1H 4ZPTB 5C0AD 5CKAA 1RAMA 4OGYH 4K94L 4XB8A 4G8IA 4UAOC 3HR6A 2DWEB 3V7AE 3W11D 1CGWA 4WJ5A 2F74B 4NC1E 4NJAL 4DUWA 2HH0L 1AKJD 1WUNT 4M4RA 5JW5A 1MY7A 1I1FA 2IQ9L 2Z35A 2OSLB 4RMWA 5KOMC 2YSSB 3MGTB 3UYPA 4NRZB 4F33B 3TA3A 3EIFA 2QKIA 1SEBB 1FL6A 1SJEA 1NBZA 5I16A 2R2HB 5J13B 2O61B 4BFIA 3QXVA 5D1QD 3WIIL 1YA5A 4JRXD 3BW9B 5TH2A 4EN3C 1FFPB 3IS1X 2YUZA 2ATKA 2BHUA 4N5UA 2UY6A 1JPST 5C6TH 5ICXA 4BFGA 2VQ1B 5E1AB 4PRHD 1MI5B 5C09D 4HIEB 3QO1A 5D70L 4JQVA 2X10A 3OMZA 4XC3H 3WFCH 1QLFA 3MLRL 4LSPH 5E4EB 1V7NL 5FECB 1NEZA 5BXFA 1T0PB 2A83B 3DOSA 3FJTA 4YHYB 3AS3A 4AENA 3TBVB 1YMMB 2AJYH 4FTVB 3PWUA 1KIPB 1LK2A 3ZKND 4MHHI 4OF5A 2VH5L 1U6AH 1X4YA 4R96A 3QI9B 4EDXA 2YR3A 3FQUB 1T0NA 3X14A 1MHPL 4IRSB 3QZWB 4H20H 4OTXL 4P2QA 2ID5A 2JELL 1IC4H 2WINA 4HC1H 3F12B 3MJ7A 3TIEB 1CU4L 4YDIH 2GTWB 3GB7A 1T1ZA 3WIFB 4NQVB 4O58L 3VE0A 4LSUL 1QA9A 1FVDB 5D7IA 4TRPL 1MIML 5D93B 1QRNA 5JOFA 5MP6H 4NWTH 4PR5B 3V0AC 3DURB 3IFPB 5I1KH 5BOZG 5HDOA 4LRNH 4Y4KA 3WXWH 1V05A 2ADIA 5HHXL 3QA3B 3GSNL 3KPPA 1AGFA 4RGNB 4Z78A 1BBJB 4HUXB 4X5XA 3IYLW 4NKMB 2BDNL 4LEOA 3IDGB 4PRAB 1PKOA 2CIIA 4XPBL 5FYJE 1I8LC 3MNZB 2F53B 3B9KC 4QY8A 2VQTA 3BXNA 1QSVA 2DYPA 3LKSB 3IDXH 1UCBH 4MX7B 4JR9L 4L3EE 3VFTB 4EUPA 5ADPH 2O5ZH 1IEHA 4NQCB 1YZZA 1OAUH 4JM2C 5CEYA 4P2QD 4GG8A 4U0RB 5F7FA 5CLWA 1BFOA 4PRPB 4WW2F 5EULV 2JCCA 1RIUH 5HBBA 2OZ4A 1RURL 4XBGA 3VXUB 5DWUH 1NMBL 4NZJA 3S7GA 1XEDA 3DVGB 4Y4KD 5DQDH 1F4XL 5D2NB 2P49B 3QH3A 3U83A 5J8OA 3FB6A 3TA3C 2YD1A 4XZUB 2YHGA 4PJ8C 1DL7H 1PX4A 3NIFF 3QQ9C 5K9QG 2GIYA 1UM4H 1AXTH 3K8MA 5GS0L 5I76A 3GSQB 1S7SB 4OLWL 3ALXA 4UILL 3P4MA 3LS5L 1R6VA 4W6WB 4YJZL 3JXAA 5DJ8A 5ERWB 3ULVH 1UJTA 5KVFH 2C1PA 3FFCE 4D9QD 3NCYS 3MV9B 5HXMA 1A14L 1NUFA 3P9WB 1GXEA 4HWBL 5IQ7H 1MFBL 5KVDH 1DQDH 1YN7A 4KFZC 1WJ3A 3PWPA 3GI9H 2VZ3A 4LAQH 4PRIA 5E5UB 2XWBA 2FWOA 3LV3A 3V7AG 3WCYA 5FO8B 1HE7A 4OCMC 4WUUB 3PXJA 3DV4A 4LCUA 1DLFL 1WTLA 2OP4L 5IBUG 1TVBB 5E2WH 1XF3A 2ITCB 2FYYB 3N06B 4JGUA 2AV7B 1FQ9C 5HYQA 1P69B 3TBWB 1MUJA 2XZQH 1A7OL 4I48A 4P4RB 4QRPE 1HHKB 1X5HA 3TV3H 3K80A 4WDIB 4N1HB 4WGVB 3RHWK 4G8EB 1KNOB 4C59B 3QFJE 4I18A 3UPRA 3NTCL 3RGVA 3TM6A 2I25N 1GVIA 4H1LG 3ZKQD 8FABB 1QTYT 2VDPL 4FFZL 5D96C 1UADC 1N0LA 1JNNH 3HI1A 4PGJA 4GRLA 1W72H 3MGOB 1G7QA 4JO4H 3IGAA 1UYWH 4WHYH 1T03L 1JZ6A 4ODWA 5MENB 1H15A 2C3VB 5L0QB 4JFEB 3PWPD 4PRID 5IBTH 1UG9A 4K8RD 2ZKHH 3LB6C 4CVXB 2XTJB 3GSNA 4HKZB 4NM4L 2GY7B 1UXSA 3LSOA 3VG0H 3MXWH 2NW3B 1I85A 3FB8B 4GG6A 1BQHA 2PXYB 1F3JB 2DKSA 2DMCA 1MREL 5L8LB 4HBCH 3EGSB 4L29A 1NLBL 4XNQB 5D6CA 3DGCR 1OVZA 2YS4A 1OGAB 3NA4A 1M71B 5C71A 1AO7D 1Q0YH 5JXEC 5INCB 3ARQA 4AY0A 1RK0A 1U58A 5ALBH 4YXHL 4PY7A 1J88A 3PWVA 5DUPH 3TYGH 2X6MA 3FQXB 1YQVH 2J8UA 1CDUA 3WBDA 3N9GH 1NBQA 3MO1A 1NDGA 5D71L 5MEQB 3SE8L 3PV6A 3ZDZE 4P4KA 1A6VL 1T5XA 1Q9WA 5EZLA 4OLYL 3BP6A 1QR1A 4HMEA 5L2KE 3ZTJH 4GRLD 4JY5L 2UVFA 3GNMH 4GMTL 1OTUD 5ITBL 2VDLL 2YD2A 2IWGA 2WBWB 5FGCB 3O6LL 4PJIA 5FO9B 3KPMA 5C3TA 4X4YB 2X1WL 4L8DB 3LS4L 4UV7H 3ZYIA 2R69L 4DVRL 5KSBA 4U4BA 4BM7A 4KI1A 4XAWL 4HEPG 2FJFA 3QIBA 3S34L 3QXAA 1PKQB 4KROD 2AK4B 2B4CL 1T5WA 1WT5C 2IALB 1A1NA 1FLRH 2GHWB 1F8TH 3MMEB 1YEIL 2WUCH 3MREB 3VGDA 1Q9LB 3PABB 3O3BB 3JVGC 5C08D 5LG1A 2EDXA 5LKNA 3BT2H 5FHBH 3V9FA 4EOWL 1OAZL 2IANB 3RZWA 3KJ4B 4P3WA 4HWBA 1EEUA 2FGZA 3MBXH 3VMPA 4YQXH 4XCEB 1T66C 1XR8A 2AJ3A 1B2WL 4X6DB 4Y16C 4P4KD 1A4JB 2DLHA 3UAJD 4I0PA 4FG6C 2AXHA 4Q2ZB 2JJSA 2F15A 2VLKB 4KJPC 1CN4A 3F7YB 3UJIH 5D6DC 5F9WC 4C54A 2KL6A 4L5FL 4P9ML 4AL8L 3S5LG 1T04A 3INUL 4HCRL 2LABA 4NT6A 1PGRB 4R2GC 1ND0B 3QIBD 3LQAL 4X4XA 1HEZB 4MLSA 5HVHC 2A9NH 5IR1B 5JDSA 4CRPA 1NL0H 5E2VH 3U9PL 3MYZA 3R8QA 3AXLB 5SX5K 3PDGA 5HHOB 5CWSA 4M8QA 4U1IA 4RIRA 1CICB 2UZIL 3EOTH 1I85C 1ZVYA 4XPGL 1JNHA 1AR1D 3CFBA 4DAGL 4OZIB 1N64H 3FQTB 3O4LB 4P57B 3RFZC 3SDXE 5KSVA 1EZVX 2BNQB 2P5EE 1U0QA 1S7TB 3D3VE 3EFFA 4I0PD 4NYLB 1EHLL 5I1EL 2AGJH 2BRRL 2NY0D 2R8SH 4GH7B 4E0RA 5TE7H 3FZUD 4XTRC 3ULVF 1WGOA 4WHDA 4WO4B 4KI5D 4GLRH 5C0JA 4A6YH 5KSAB 1VERA 2QTEA 1W0WB 3QCVH 5GS3A 3PGFH 5J11C 1T6VN 1YECL 1QNZL 1IGIL 3T2NH 4M93B 2AKRB 1F4HA 4JHAL 5CILL 2NY3C 1T1YA 3O0RL 3I6LE 1CD1A 1J10A 1INDL 4Y5XB 5FCSH 1KB9K 3LKQA 1CWVA 1GH7A 5HVWA 5I17B 1QQDB 4PRBA 5E70A 2H2SD 3WJJC 4D0CB 2BVPB 4RA3A 5HHNB 3MR9A 2DQGL 4Z7VA 1MJUH 1NGZA 4TYUA 2AJZA 1XF5B 4WV1A 5AD0B 1BMGA 5GS0C 4NHUA 4GKZB 5IMOB 3MLTB 2CIKB 5IVZA 3A0OA 3S35X 1T2JA 4AEFA 1MCJA 3BD4A 2RFXB 5KVMC 5GQBA 2DOCA 4ESKA 2BSRA 1JK8A 5JHDE 3CMGA 4UNTA 1IT9H 1IM3A 2X89A 4MJ2A 2NY5L 1NFDA 1K5NB 3LH2H 2VDOH 1OT1A 3BIKA 3FONB 2ZOLA 1DBBL 5F1NA 3V4UL 5EO1B 5IVOA 4OCSH 4NWUH 1JHTA 3UZEA 2ZCHH 4HIIA 4JFDB 4JO2H 1UWXH 5D72L 4QHLA 3S88H 2WP3O 1FYHB 1TDQA 3SO5A 1OGTA 5EU3B 3RDTB 4O2EB 1JVKA 3IDNA 1LILA 1Q94A 4NUJA 1P53A 2E9JA 2QSCH 1OM3L 5ICYB 2D7PA 4Z7UB 3IVKB 4OZGE 4JKWA 4JHZA 3F58H 4FXKB 1I9IL 1I4FA 3PDOA 3KYKH 1RPQA 3QDJB 3CSGA 3VI4E 5DLML 2QR0B 3SQBA 4Z7WB 4U1KA 3HG1A 4WW1B 4YK4C 1B0GA 3WNOA 1QVOA 4HCRA 1TTUA 1JYNA 3DX6A 2H6PA 1TETL 3FQRB 1M7XA 3O8XA 5C07D 2A77H 4B50A 4JLRA 3FQWA 2H1PL 2VDRL 1A6AA 3DARA 2OXHA 4RAUA 1NKRA 1AHWB 4QXTB 3KXFB 2VLME 1N7MH 1WTGT 1Q38A 4JVUA 3V6FB 3GHEL 1JRHI 3OKDA 5HGAA 2VWEC 1DVFB 3KPRD 3S35H 1WBZB 1ZS8B 3TJHD 3VXMA 5J56B 4R8WH 1UACH 2PCPB 3ZO0A 3QULA 1ULVA 3WS6C 5IHLB 3ULVC 3BWUC 4OGZA 4AT6A 5KW9H 3VXSA 2X9WA 3W81A 5DVNA 2VUOA 3H9ZA 1EH9A 1I1YA 3D18B 5DD3L 4YHIB 3PWNB 3QUZC 5B39G 2DDQL 3G5VA 2MQ3A 4HX1B 4DWHA 4NM8L 3HUJA 1NAMB 4GAYB 3CFKB 2FLRT 2Y25A 1RSFA 2ZWLT 2R4SH 1MQ8A 3O8XD 3T04D 1IVLA 4WV1C 3RVWC 4JKKA 1K4CA 4PJDB 1P1ZB 3RWCA 3BQUB 4UIMA 1UCTA 2XG5A 3MBEC 2HMID 3HAEA 2D7OA 5INDA 5C8JB 5M95B 4O51A 5HD8C 2H3NB 4ETQA 3G9VA 4TOYL 4NO5B 3L3DB 4DZ8B 2CD0A 1GZPB 2P24B 2VLLA 1J5OH 4YHOH 1TPXB 5I1DA 5CIPA 2DQHL 5ACLA 3FB7B 2IPKA 2DBLL 5JR1H 1KTKE 2YN5A 4ZFZB 1N0XL 4OZHB 1RIHL 4KXZH 3ZKXC 1U41A 4M03A 3VXSD 1GIGH 3QPQC 4RGOH 3LEYH 1A9EB 2H2PC 2PW2B 3I9GH 4FZ8H 4JFFE 4ZQKB 5KVEH 3VXQA 5IVXB 5C1MB 5IMKA 3JV6A 4PRNA 2V7NB 2QV2A 4U1LB 3KNBA 3BFOA 1ZT1A 2A73B 3U7WH 2VISB 4LCWB 3S36X 1GAFL 2O5YL 1JPFA 1BFVL 2ORBH 4HDIA 4PLOB 2EIZA 1AQKL 4UT7H 3GSXB 4DKFL 5JLZB 5FKAA 3ARWA 4F7PB 4G8GE 2R2CA 1FO0L 4Z7OF 4PP1D 4APQB 3TVMD 5BRZB 2DMBA 3QBTB 3DECA 4YE4L 1E28B 5D5MB 1X5KA 3CFCH 2DQIH 2XN9E 4X6BA 2C9AA 1SJHB 3D5OF 1XGTB 3H3PH 2B2XL 5D1ZA 3LKNB 1N4XL 4Y2DC 5C0AE 4BJLA 2MKLC 4LF3B 3EO0A 4PP2B 1W2KT 1MFDH 5J9PB 1X4ZA 2V2WB 4U1GB 5E9DD 3ZT5A 5DD5L 4ZUSA 5C70A 1JUFB 3H9SD 4U6YB 1FYTB 4HGWB 4C55A 4KKCD 2YD3A 3QXDA 3UC0L 2BFVL 5HGDA 2Y72A 1CT8A 5EOQL 5TDOA 2I5YH 1U8JA 3MFFA 4BH7A 4H26A 3GKWH 1AY1L 1A6UH 4JANA 4QOKA 5DK3A 4JZOA 4IDJL 3QQ4A 4JRXE 4JO3H 1G7MB 1KT2A 3CNKA 4TSBL 3NZ8B 5GGVL 4X4ZA 3MRLA 4FQJL 4NKOA 4EI5D 5B38B 2YMXL 4QRQA 4PRHE 5D7SH 5IMMA 4Y8DC 1MNUL 1NCDH 1G9MH 5D1ZD 4XNZC 5FYJU 3VWKC 1R3IH 4NOFA 5DMGD 1Q72H 1PY9A 1JGEB 3D85A 1U8LA 3SCMA 4PJEE 3G5ZB 4YHZH 4TUOA 4BZ1H 2HFEA 5HDQH 3TO4A 2AV1B 1QFWM 2BERA 4XMPL 1NCAH 1H3TA 4CL7A 5KTEH 2BNRB 3QEQB 4P2OB 2K9UA 4XRCB 3BYYA 1MY5A 1WBXB 2VXTH 4YGVB 5C0IB 5GRUL 2E9BA 2R2EB 4S0SD 4JG1L 5CAYB 2DLEA 5EU7E 1UEYA 4XMLL 4NC0B 3KYOA 1AJ7L 4YZFF 3HC4L 1RZGB 2J88H 4QOKD 3QWRA 1HDMA 3VWJA 5BW7A 1D5XA 5DQ9B 1HSBB 1OAQH 1I7ZB 2EC8A 35C8L 3G6AB 3TBTB 1I7TB 1FIGL 5KS9F 1RJYB 4U1JA 4PGDB 5J12C 4FQIH 3TF7C 4YX2H 1YPZF 2JB6A 4NNPH 5EC1A 5DJZA 3LVEA 3DJ9A 5J7CC 4TVPH 3SCMD 1IGTB 1IBGL 5F1KC 1MCQA 3X13B 3TO4D 1FO0A 5DXWA 4KKNA 4K3EL 4KY1L 1OF2A 4P2QE 1G1YA 1QLEL 4FP8L 4P2RA 1ZEAL 3PJSA 2ZUYA 4LCCA 3IT8D 1P4BL 4JHWL 1YUHB 3JTTA 1HHHB 2EZ0D 3C87A 3L3GB 1GRWA 2E7CA 3RWHB 1G9EA 1QRNE 4XCFH 3S36L 2R2BB 2E7MA 4IJ3C 4JAMB 1DQQB 2XNAB 3VWJD 1T7YA 1QYGL 4YBLB 3U1SL 5I15H 4X0KA 3ARBD 3CFEA 4QGYA 1NCCL 1QZ1A 1J12A 3L9RA 1F6AB 3WFZA 1KACB 1RVFL 3BZ4B 1JGVL 4AYFA 3MSPA 3FAXA 4GAFB 5FYKL 3I2CH 1MCPL 4X80L 1XIWA 2IBZY 2F58L 3DUUB 5AWNH 3DX7B 3W9EB 4Y4FB 1IAKA 4X9GA 5J1AA 4MQXD 4XCYA 4JPVL 1Z9LA 1I3UA 4FFWD 2D2OA 4MD0B 4R26H 3QG6B 3DV6B 2AABL 4U7KA 4R6UA 3RY6A 1M4KA 2OK0L 4LHUA 4PLJC 4D9QE 4UTAH 3MOAH 2PO6B 3QIWD 4PTUB 4P2RD 5B3JE 4LCIH 1DUZB 4NHCH 1TJIH 3MRBB 3OJDB 4DOHB 5L6YL 1FNFA 2FECI 1N5AB 5AYQA 4J3SA 3L5JA 4CBPA 1UGNA 3HMWL 4XVTL 2D03H 1B6DA 5D2LA 4NRYA 2EDYA 3UBXG 3S3SA 2J2ZA 4GKSB 4JREB 4KJWD 1GGCH 4WY7L 5DFTA 4AK1A 2HLFC 5DK0A 1A6WL 3BN9C 3WLWC 3UTPD 1R3KA 3RA7L 1FZOB 4M7LH 1A02N 1ZOXA 2HWZH 5A2IH 3B83A 3GSUA 4UU9A 2DM7A 1XIWD 3RUGB 2J12B 3ULSB 2W9DH 1MIEL 1PLGH 1P7KA 4CAGA 4HXAH 4ZUVB 3DROB 4H88H 2P45B 4L1DA 3ZMRA 1E4KC 4JFPA 1ZLUH 2E9WA 5HJ3A 5HGHB 1S7WB 4RGMB 3ULUD 1U95B 2CLZA 4WFFD 1RK1A 3S37H 4NSKA 2APTA 4P49A 1GZQB 3KR3L 3PWPE 4PRIE 3BE1H 3ILQC 1JZ2A 3EYUL 5D7LD 5JUEL 2VAAB 3CZFB 4YR6A 4XB7A 3V8OA 4X6CA 2GTZB 3MACL 1HCFX 3QSKB 4M6OL 3EJYD 3MV7D 2R56L 1U8IA 4NKDA 3SDCB 1P6AB 3BZEA 2VUYA 4GW5B 4LCCC 2DIJA 1U93B 1KG0A 1KOAA 2DLIA 3TIDA 5IEHA 3RRQA 1AO7E 1TVHB 2ICWB 1NBYB 2YZ8A 4FFYH 1BZ9A 2Y5TB 3F62A 2F19H 3AREA 3STBA 1CFNB 1L7TL 2AERT 3MNVA 3RL1B 3HCVA 1K8IB 5HPOA 1R5IB 2HT4D 2QQQA 5JPMA 2AI0H 4I5BA 1VACB 2C7UB 4KWUA 3VCLA 2XTLA 1NEZG 5B22A 1BOGB 3OZ9H 1F5WA 1PYWB 1YEHH 4ODSL 4K2UL 5FGBC 1X5IA 3WO4B 1MAMH 2FECL 4UQ2B 5EUOE 5I1AA 1RFDL 4Z5RA 4MVBC 2JK5A 3P9LA 3HR5A 5CJOH 2CQVA 1TQCC 1MVUB 2AQ1A 1UA6L 4GG6E 3GJFA 2VTFA 4YPGB 1IM9B 3VXRA 3ZE1E 2D0FA 2X05A 1YNLL 2C3HA 3ARFA 1TCRB 1T4KA 4G6JL 1REIA 1OARL 4FN0A 3MRPB 5E4IA 5TQ0L 4AEEA 1DEEA 4O02H 4TUJB 5C08E 3MNWA 2DM3A 1SQ2N 4OM1L 5EU4A 2Q8AH 3QUMB 4B0MM 1WZ1H 4RX4A 1GGIL 4ZTOH 3TCXA 4MMXC 3C6LD 1KPUB 1DQTA 1IEBB 3OXSA 3PG2A 4EI6A 1WZMA 4NKIL 3O3EA 3JUZA 1JE6A 1MHHA 4U2YA 4NN6B 1RZJC 1DBML 1GOGA 2FGWL 3F7VB 1WC7B 4N8VA 4PJHA 4PJIE 1M7IA 3PWJB 1MJ7L 2HFFA 1I8IA 2JE8A 5CJXC 1J0IA 2Q7YA 1FJ1A 4QHMA 2YK1L 3QIUA 4YHLL 2VC2L 5L7XH 3K46A 4R90L 4GRMB 4GUPB 4PB9L 2N7BA 4ODTL 1DQMH 5FOBA 3WNKA 4EUPG 43C9B 1FH5L 3QHZH 4XPTL 2HFGL 2OTWA 1S5HA 3VXRD 5E4EC 3KAAA 2NXYB 1FORH 5DJXB 3HLAB 4YHYC 5GJSL 3MX0A 4LVNB 4Y5YB 2ZCLL 1G6RB 3QI9C 4TNVK 5F3HB 5KN5B 3A67L 3IDMA 2ENSA 1FC1A 4P9HH 2FB4L 3GMLA 4QXWA 4EN3D 5F96H 2X44D 3BISA 5E00A 5JO5B 1YEFL 2HAZA 2R15A 4ZOEA 1INQB 1RUAL 3SJVD 1FGVH 1H5BB 4NQXA 4UT9L 2G2RB 3V6ZA 3OF6D 4PJCA 2XZCL 3FO2A 5D93C 1WF5A 4LLMB 3RBSA 3CVHB 3LKPB 4OFDA 5E6IA 1KCKA 3OWEA 1KCUH 1SJVA 4JY6B 5FUOL 1CI5A 1JPTL 1NLDL 3DUSA 4KI5E 4QRSB 3QIUD 1A7QL 3VH8A 3EUUA 1LK3H 4YIQA 5BZWA 4RGNC 2YXFA 4WWKA 4ZD3L 2GJJA 1G9MC 1U3HB 1LP9A 4NP4H 2BSTB 4ONOA 3O2DL 1FVEA 1JTTA 5T33L 4I3RL 1QSEA 3NPSB 2LV4A 4FQ2H 2MPAH 4QCIA 3SGEH 4LLDA 1QLRA 1XGQB 3NCJH 1BD2D 4N9GB 2XQBH 3T3ME 1UWGL 2LQRA 2B39A 3AS2A 4Q74A 3EJJX 3I3EA 4XHJC 3VGFA 4N8CL 5TQ2H 4CNIA 2X4OA 4U0RC 3O3DB 3BX7C 1I1AB 1LEKA 2YPLD 3TWCL 1FCCA 1PEWA 5MEOB 3S4SG 1U8OA 1KJ3L 1Q8MA 5A1AA 4HFWA 5EO0A 2GJZB 2QQNH 3LD8B 3EOBB 3VI3F 5T1KD 3O6KH 2ZCKL 1JMZA 4TTDC 1W0VA 2CRMA 5T3XD 5D2NC 2X4SA 1DLHB 2QADB 1RV6X 3QWQB 1MFAH 3LEXB 4XPHL 2WIIA 4WWKD 5ESQB 5GGRB 1XCQA 1KCSH 1FV1A 1MRFL 3GJEA 1QSED 4RISL 5DS8B 3L95B 4PJXA 3ESVF 4WU5B 1WCBB 3T0AA 3P77B 1PZ5A 2A9ML 2NY6B 4LSQL 1D5IL 1PQZA 1HZHL 1BQHG 3U36B 5KANG 3WE6A 1XF4B 3P73A 3OR6B 4RFOL 3VJ6A 3MLUL 3GIVB 2W38A 4PJ8D 3A6CL 3O6FA 4EDWL 4Q0XL 1NAMH 5F70A 3H0TB 4WHCA 1YEEH 4HS8H 4I77L 4X6DF 5C07E 1KJMA 3BKML 2BVQB 2VJXA 2UUDH 1B4JH 1BQUA 1RJLB 5CD3B 1EA9C 2I9TB 4G5ZH 3V8CA 1S9YA 3H2WA 2BK8A 1KCVH 5ITFA 5HI3D 3JV4A 5F9OH 1QSZA 4RZCB 3UJJH 3KPRE 3ALPA 5E8PB 2HN7A 3THMH 1A3RL 2VO5A 5DEGB 2J5LB 5TFSH 4N0CD 1PG7W 1SBSH 4PGZA 5DA0B 2A6KB 2BOCB 2Q6WB 2D9CA 2VITA 1XGUA 1XCTA 1N5YH 4XP5H 4IBLT 4OJFH 3EYFB 3O3AB 3T2OA 3FHAA 1CLCA 5L0QC 4DKAA 4HFUH 5DEFB 4OAWB 1G7PA 4OGXL 5BVJB 2W0FA 3O6FD 2XTJC 3TO2A 2IQAB 4N0YH 4WW2A 4XC3L 3WFCL 5LWYL 3RNKA 1M05A 4ORZC 5BMFH 3O2DA 1MQKL 3PL6B 3DMMA 3T65B 4MXQC 1B4RA 3P0VH 5DC4B 4HUUA 3RVVD 1R5WA 4ZOBA 4NQEA 5E8DL 3F5WB 2BXYA 3IF1B 4URTB 5LBSL 4IMLA 1DSFH 5DEZA 1VADA 4S1RL 4YDJB 4Z0BL 1DFBH 4GXUM 4JN1H 1JGDB 4KJQC 5FA3B 5F88A 3V5KA 3IS0X 4HC1L 1KXVC 4U7SA 2W91A 2DJSA 4YDIL 4W4OA 2DIAA 2X4NB 3MRQB 3LB6D 1MELA 3U46A 4M43L 3T0WA 3MLXL 4PB0L 4GBXB 4ZYKA 4F37F 2R4RH 3VXSE 4JFZL 4MXWL 3FAWA 2PUQT 1NPUA 4U05A 4G9DB 3HZVB 3L6FA 4MJID 1F90H 4F9LC 2EYTB 3RVUC 4JG0H 3RI5F 2NZ9C 3HUJE 5JXED 3D25B 2Y6SC 4KTYA 3QFDA 1JZ8A 3VFUB 5IM7A 2DQJH 4OIBA 1BF8A 4XP1L 3PWLB 1RUML 4XH2A 1NC4B 1ERNA 4NQED 1EFXD 1UCBL 3G08A 1OW0C 5EU6A 2EKJA 3GM0A 3WD5H 2O5ZL 2Z31A 5C0CA 4QNPE 2AJXH 1VB9A 3VXTB 3QCTL 1U8MA 1MHCA 1IKNC 3NH7L 2HFTA 2RJMA 5I71B 4L3EB 3DRTB 3ORJA 5MI0C 4C56D 2IH1B 1J05B 1FZMA 4UOW0 4BH8B 4F9PA 3QG7H 25C8H 1RZIB 1R3HB 5C0FA 3VFVB 4Z7UF 1H3XA 4M1DL 5E9DE 3DETC 2VKXA 5C6WH 2GSGA 1IILE 5K59E 2YBRA 4N5EC 5EFIA 3BPLB 1T66D 3LHPH 1XFPA 4Y16D 3AUVA 1OHQA 1WVZA 3WV0A 3U2SB 4IRJA 4GXVL 1DZBA 3SKUD 1FPTH 5KVFL 3D2UB 3E3QC 1OCWL 3IU3B 2Z31D 2WBKA 3BWAB 1CICC 1E4XI 4F7MA 4U6VL 1BP3B 4KDVA 3UYRH 2OR9H 3S5LB 2H8PB 1NGXA 3QHFL 1GYAA 3FFCB 32C2A 2CSPA 4I3SL 4PJGF 4EKXA 1IGFL 4XP6H 4OLZH 3OKOA 3JTSB 2R1YB 4P59H 2FHBA 2R0LH 1BX2B 1YC8A 3BPNB 1UB5B 1XGRA 3T08A 3W2DL 5E0QA 4ELMF 2XZQL 3IAGC 5CJ5A 4WO4C 1RI8A 1ED3A 3O9WD 4XNMB 5KSAC 1DQLH 1OB1A 2UWEF 3WUZA 2VDKH 4M93C 2ZUWA 4UV4H 1D5MA 1SM3H 2OX5A 3PXHA 4HC1A 4HUWA 2APXA 2NW2A 4Y5XC 1C16B 5KZCD 4G9FA 4IRJD 4QRPB 1QUNA 4WENB 4M7ZB 4PJ9B 4JO4L 3ARDB 4QOKE 3NFPA 1ZGLP 4Z6AT 3QFJB 2VLRD 3HI6H 4PJDF 3RQ3A 3T8XB 2YEZA 1ZLSH 1W0YT 2X4PB 2ZKHL 1Y18B 3RPIA 1RZKH 2A2QT 4PRDB 4PLKC 1IEAA 2VZUA 1RUKH 1T22A 2QQKL 2W9LA 3MCKA 4IOFC 4WTWA 2NNAB 3D1MC 5B4MC 2H26B 3UTSA 4OZHF 4JB9L 4PPTA 4L3CA 1VEOA 1LO2H 4PJAA 5SWSA 3KPSA 4NCC1 1QO3B 2YKLL 3BIBX 5H94B 3MXVL 4QHNA 2AJUL 3NFNA 2DQUH 3MRRA 4U1SB 2P1YA 5IVXF 4WHTA 3U0TA 3RDTC 1IAOB 4G7YH 4G9FD 3EO1A 1MWAL 3PIQB 2FDBP 4OD3L 1QBLL 1K8DA 3QUXA 4MD5A 2HRPL 3EOAA 1IGYA 1B0RB 3CXDL 3T0DA 1L9NA 1N8ZA 3VFRA 5K9KB 3CCHA 4DN4H 3MODL 2EDEA 2HJFA 4CADB 3V0WH 1S9VA 1G7LB 1S5IL 2IAMB 3SE9H 5J3HD 5K9JH 1RJCA 1D6EB 3HAEG 3R1GH 4U3CA 5D5MF 3WSQH 4OKDA 5E8NA 1MCIA 4OFVA 3Q5TA 2ARJA 5DDHB 3UTSD 4OIAA 3CPLB 5F89B 3VA2C 4GS7C 3ZDYF 1AHWC 4YDKH 2WUCL 4LSSH 4L8CB 2E5EA 4H5SA 4G3YH 4ZAKA 4P2RE 3KGRA 4C83B 1DVFC 2VIRA 2VZTA 3HZKA 3HPLA 1HH6B 2BVTA 4YQXL 5IW6A 4OI9A 1CD9B 5TJWK 4DEPB 2ATPB 4XNYH 5T5NF 3GFUA 3SOBL 2ICWI 1MCFA 1JPGA 1HQRB 5CJQH 3QUXD 1NDMB 4N1CA 2W60A 2WP3T 1YYML 1G0DA 1S7RB 5BS0D 5TF0A 1D6VL 3UTPE 1WAAF 4PJBA 2E27H 2ESVD 2RAMA 3WXVH 1M6OA 2GKIA 3H8NA 5DRNB 1ZLWH 1A7PH 5BQ7B 4AEIH 5HY9B 4KK9C 4E5XA 1CFSB 3CJJA 5GPRA 4HKXB 4TSAL 5E2VL 3NAAH 3G04A 3ZYJA 4CGTA 4HWEL 3NMEA 4F7EB 3BQUC 1BIIA 5IFAL 3ULVD 3MV11 1IFHH 1P7QB 3ULUE 1HXMB 4H25B 4PUBH 5EBLB 3QJFA 4OIIL 5EOCL 5D4QA 1DANT 2G60L 5B39B 3R0MA 2JIXA 1LEGA 4MQTB 5D7JD 3QUYA 1NCUA 4HZLB 3T0EA 1G9NL 5D2LE 1TPXC 3FT2A 3DBXA 3QWOB 3L7FB 3MV7E 3MRGA 1OPGH 4F15C 5JW4M 2B7DT 4W81A 4AJ0A 4KV5E 3AMKA 3V4VL 5EZJA 4G7VH 3RVWD 3SDXB 1CLOH 1XF2A 1G1CA 5IQ9B 1JGUH 2P5EB 4XI5C 3MBED 1XAUA 4FQQA 4PJ5A 3WLBB 4D0BB 1AC6A 1BPVA 4D8PA 3QUMH 2R0ZL 4WGWB 1C08A 2P46B 4ISVB 1YYLL 4X5LA 2EYRA 2CMRH 2NY2B 1EJ6A 4QRRA 3L3IB 2XZZA 1AP2A 3VFNA 4QF1A 4X8JB 4D9LH 5I8OL 1BFTA 2EKSB 1J1OL 5HDLA 5DMJB 3C6SB 5I74B 4MNHA 4MCZA 1MWAA 1J1XH 3BD5A 4Y2OA 2AS5M 1NC2A 4D3CL 4JEGB 1UQSA 4P46B 2NX5B 4AM0A 2P8MB 4FABH 3HKFA 2H2PD 3IKCB 3U4BL 4AIZB 1Y6NR 4LPYA 1HOCA 4LGPB 1YJDH 4FQHB 3QUYD 4QRTA 3T0ED 4X6CE 2B20A 3U0WH 3GI8L 3N1GC 2KPNA 1BAFL 4ZAKC 3VFSB 3SN6N 1PAMA 3IXTA 1E6OL 1OL0A 2XKNA 1HQ4A 3NA9H 4YXLH 5JNYB 4LP5A 4BSVA 5TF1H 3DTXA 5EN2A 3KLAA 1X5AA 2L7UA 3UTOA 4OCSL 1G6RH 2YPKB 4U1GC 5JHDB 5EUKB 3L1OH 4WUKH 3TBYB 3IFLH 3GMPB 4XAKD 2GT9B 3OKLA 4DKDC 4JY4B 3I84A 3EHBC 1MPAL 3IFNH 4HH8A 3DSFH 2FD6L 1CGYA 1HN1A 2F8VA 2PF6A 1NC2D 3CVHH 1HNGA 3KPNB 3VXNA 2NR6C 2VDNH 5IG7B 5A2JH 5KSUB 4ZXBB 1BJ1J 4NQDA 2PW1A 1FFOB 4LKXA 3FB5A 3P0YL 3ZE0E 1ZGLB 4OZGB 2FATH 3C5JA 3DXAD 5IOPA 4P2YA 3KHOA 2VR9A 5FYKE 3KHQA 3VXRE 5JW4Q 2GK2A 1H8NA 1KPVA 2ADFL 5T1DH 1RIVL 5C0DB 3EKCA 1ZT7A 2FSEB 2VL4A 4KZDL 2HTLC 3UJTH 1YEDA 1TJHL 2GFBA 1EX0A 1FL5B 5JZ7C 4JRYA 4F57H 4JZNB 5BV7H 3MLWH 3C60B 1G7HA 3NIDF 3KS0J 3T2QA 4KTDL 1UACL 1U8KA 4P2OC 1A1OA 3VXPB 3CMOH 1JFQH 4CN1A 3HPJA 3SJVE 4X7EC 4ONHB 2C4FT 3L3OB 2APFA 3W9DB 4MDJA 4NRXA 4HZAA 4LGSB 4XBEH 5DA4A 5IW3A 4P5TA 3S97C 3HC3H 3VWKD 4J12A 4Y89A 4LLQA 3RX7A 2YA0A 5EOCJ 2BHZA 3VA6A 2IPTH 2L7JA 5C7XL 4NQDD 2EDJA 4L8BB 5F3BB 2EECA 3OAUH 4M48L 4QHUB 4JFOA 2VXSH 2PYEB 5DJ6A 5A16B 3X12B 1QBBA 1WV7T 3BO8B 4X7SL 3H7BA 4QXUL 1MHEA 4KRPD 1Q9OA 1T7XA 1BD2E 1H8OA 3NCEB 4JO1L 4CU6A 3RTQB 3FFDB 1CVSC 2AEPH 1VENA 3HA0A 5H37G 5C0BA 4XNXH 1JWUA 2WQ8A 2R0KH 4Y1AB 2I07A 1MCSA 2HJLB 2VLJA 3ZSTA 4R97B 1FGNL 5I18H 3A6BH 3I75A 2X1XR 2O5XL 4PJCE 2OQJB 3SKJH 3M17B 4P5TD 3GMMA 1VFAB 4LMQE 4Y4HB 4I3GA 2E6PA 2X4UA 1GIGL 2A6JA 3NVQA 1NJ9A 1CR9H 3CVIH 3WEXA 5DI8A 2YWYA 5F8QC 1KC5L 2BVOA 4KAQL 4KKAC 1N3NA 1SY6H 1RZKC 5CZXC 1VFMA 4KKLC 2DWDA 3TYFB 1NGWB 2WBJA 1RJZA 1INEH 3TZVA 1KB5L 1QSEE 4Y4FC 4U31A 2OR7A 1S3KL 4JFFB 1WISA 2YWZA 3MJ8A 5E8OB 5IWLA 4DW2H 2PO6C 3LPFA 1ZANL 3D0VB 1KJ2H 5CBAA 5HI5C 5I8CA 3GGWB 2DQIL 3L7EB 4M62H 5F7YC 2VLJD 1BQLL 1EIBA 3CSYA 4ALAH 1ZT4B 4GQ9H 3VD3A 3HFML 1F4WL 5AUMB 1TJGL 1XZ0A 3GRWH 5IHZB 1CF8H 5BJTA 2G75A 4JDZA 5IB4B 2XN9B 1ZGLM 3KJ6L 3GMQB 1UEMA 4MD4A 2BOBB 2V5YA 1X7QB 4PV9B 1QSFA 2BJML 3BOVA 5D1XD 4PLJD 1U8QB 3WS3A