1LE9B

Crystal structure of a nf-kb heterodimer bound to the ig/hiv-kb siti
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
312
structure length
312
Chain Sequence
GPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The x-ray crystal structure of the NF-kappa B p50.p65 heterodimer bound to the interferon beta -kappa B site.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords 5'-D(*TP*GP*GP*GP*AP*CP*TP*TP*TP*CP*CP*T)-3'
total genus 45
structure length 312
sequence length 312
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00554 RHD_DNA_bind Rel homology DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1le9B02
2.60.40.340 Mainly Beta Sandwich Immunoglobulin-like Rel homology domain (RHD), DNA-binding domain 1le9B01
1CGSH 1QOKA 3BEWB 3RDTD 4NO2A 5BO1H 4PJIA 5FECB 2F53A 5DQDL 5TDPA 2B4CL 2PTTA 1A14L 1B6DA 1OT2A 4F8QA 2FX9L 3NCYS 4WV1C 5F88B 4ZFOL 2OR9H 3LN9A 3PNWA 5CBAB 5FUOH 1NC2D 4UDTB 2YZ8A 3TWCH 5EN2A 3H9HA 1WWCA 3LVEA 5TFSH 1LO5A 4FQJL 4BM7A 4R7NA 4O2EA 3FT4A 4QXUL 1JNJA 1HHJA 3BUYB 1INDL 3U83A 4OZ4A 4MNHA 1MCHA 4ZUSA 2VE6A 3VFNA 4IEFB 4WWID 1Z5LB 3MPCA 5HVWA 1WBYA 1ZTXH 3KLHC 4P5MB 2GSIA 3HS0A 1X5LA 2R0LL 1FZJB 3IDIB 1KPVA 2C5DC 4EEEA 3DX9A 4UINL 4NQEB 4QHKI 4P46D 3P4OA 4LCYB 3LQAC 3QUKA 2AEWA 2VKXA 1B9ZA 1J8HA 2NMSA 3VG9C 1K6QH 1FDLL 4ORGB 3QXDA 1QQDB 4NQCA 3H7BB 5HSFA 2HT2D 3HE7D 4TUJB 2IAMD 3NTCH 1JMZA 1R3JB 4JFPB 2FH6A 5EZLA 1Z9SA 2JJUA 4TOYH 4NQSA 3P73A 3SQOH 5F1IB 3D85D 4C57C 4ENED 5IHZB 5DJ6A 3UDWC 3IS1X 3DO7A 5B3JE 5IFHL 1YMHB 4JHWL 1Q0YH 2KUTA 3NPZB 4U3HA 3UTQA 1FO0B 1JI1A 5GRYA 2JELL 1P6FA 4GAJH 5CJ5A 1P4IH 1SVCP 2J8OA 4LCCC 4OV6F 3TBVB 1NGQH 4CDHA 4H20H 2OTUA 5GZND 3JTTB 4JQXA 1P5VA 3QDMB 1G9MH 3B5HA 4XI5C 3VFWA 1R0AH 3GSQB 3WHXB 5D72L 4C4KO 3FB8A 1EPFA 1KJVA 1QSEA 2VDKL 1W8OA 2Y5TB 5FYJU 1YQVL 3V7MA 3MV7E 1N2RA 3HC3H 5F9JA 5KVDL 1NAKL 3WD5L 3T0EC 4X6FB 1HHJB 2VL4A 5D2NC 3I6LE 5MI0C 4OT1L 4UZGA 5DVLA 5DQ9B 4NIKB 4RWHA 4LSUH 3S8WA 1W2KT 3R1GH 2EZ0D 2NW3B 3HZMB 4BZ1H 3RWJA 5CSBA 4XPHL 3KLAA 5FA4B 5CMAA 1J05B 1UXWB 3H9SB 2MKWA 3RNKB 5B39B 3F6LA 1QP1A 1J11A 5CP3A 1EEYB 3IDMB 5DMYA 2OQJA 4N1CA 1PG7H 3T08A 3BP5B 2ID5A 3WFBL 4ONGH 3MZGB 1MLBB 3CX5K 4R3SB 3SKJH 4OF6A 3TJHD 4G7VL 4I18A 1Z3GH 1CDHA 3Q3GA 4QXGH 3OG6B 2ORBH 4N8CH 2DOCA 1H8OA 3MRIA 1M71B 2XG5A 3KPLB 3FRUA 4K7PH 2FL5A 1S7UB 2FBJL 1KG0A 2OK0L 1GXEA 1RURL 3KYKL 5IJVB 4XPGL 3UAJC 5D7KE 3MOAH 4GMSL 4J3SA 4FQQB 1B2WL 2GTWA 2F5AL 1KN2L 3AREB 4I0PA 5GS1A 3LN4A 3EOBB 2DQHH 3VXUD 2W9DH 4UV4L 5IW6A 1U8JB 4S11A 4S1RL 2IPTL 2EDEA 5E5MA 3K7UA 3BKJL 2VLKD 5KG9A 3FN9A 2YD9A 4J2XA 1O7VA 3CC5B 4YUEL 5EPMB 5GGVH 2FNBA 3LD8B 5T3ZL 5ITFB 1AD9B 3MRDB 4PRHE 4FXGB 3VD7A 3MRJB 3TO4B 2EDHA 4PP2B 2W59A 4XT1C 3IAQA 2DBLH 2GTWB 2E27H 3L3IA 5TE4H 1IL1B 3ARGA 4OCRL 5C0FA 3LH2L 4JN2B 4PJBA 3S6CA 2VWEC 2C4FT 1Q9KA 5D8JH 3VE0B 3REWB 1DEDA 3VRJA 1U8OA 3RL2B 1A5FH 1EFXA 3SDXF 3HRZB 4XVSL 1HK6A 1YEDB 2P7TB 5IFJA 1S9YB 4NKDA 4ZDHA 3DV4A 3VMPA 3GKZA 3PWLB 5DQJA 5HI4D 1LDPL 3QUYB 3DETD 5DEFA 1MIEH 1BVLA 5JHLL 2Z31A 4IBLT 3QQ3B 1B88A 5FYKE 1ETZB 3T77B 2X4NA 3LRGA 3HE6C 3L3OA 5T1DL 4GRWE 1RZ8A 1I8IB 5ERWA 3LPGA 3P9LA 3UZVB 1ZT4A 3GMPA 4F9PA 1RULH 4C56A 1CVSC 4M02A 3SKOA 4MJ6A 3INUL 2XTJB 4X4YB 3VGAB 4ORGA 2A0LD 2ESVB 5J13C 1MFNA 2Q3AA 5C0IB 3B9AA 4DK3A 2BSED 3LV3B 2ATKB 3M8OH 2GK2A 4PJ8C 4F58H 2JK5B 1CL7H 2VABB 3ARTA 3MFFA 4OIBA 3OKOA 3TVMA 2B5IB 3HFML 5IMKB 5KSAC 3HG1A 3IXAB 3F7YB 5FYLH 3X14A 3WE6A 1YC7A 3UTSA 1AI1H 4RA0C 5JA9A 2DJ4A 1PVHA 1ZMYA 1CGXA 2WBJB 5FM5O 1QFUH 3WLBA 4MA8H 4IOIB 4YXHH 4UQ2B 4UI2A 4IRJD 4HCRH 5H94B 4GXVH 5AG9A 2AXJA 1KTLB 1BJ1J 2BRQA 5JPNA 1HQRA 1C1EH 3PWUB 2GSGA 2M1KA 2DQCL 1I7UA 3S37L 3EFFB 5HHVL 4BSVA 3PE9A 1JPSL 5C0EB 1IRAY 5I71B 1NANI 3BD5A 4NO0D 3MLYH 4PJAF 4G80B 5LWYL 4ZFOA 4UOW1 4D9QD 2WK2A 3FOLB 4OZHF 3AS1A 3IJHA 3CMOH 4WFGE 2GUOA 3LOWA 3P9MB 4Y1AA 3X3GH 3NIDF 1NDGB 4ODHH 3D6GA 3HA0A 3DURB 1CF8H 3O45A 3VJ6A 1RJCA 1RZFL 4FTVE 3IF1A 5DQJB 4RWYL 2IPKB 4H5SA 1UM5H 1ZHLB 5GRJH 2JJSC 2H8PA 4MA7H 5I1LA 2DL2A 1P2CB 4UT6L 4RX4A 3VWKC 1Q94A 5GZOC 5TDOA 4EUPA 3ESUF 3KS0J 3UTTB 1SJVA 5GIRA 4P2CG 1QSFE 1D6EA 4HQQH 5EU6A 2E9BA 2MQ3A 4XRCB 4H25B 1FNGA 4PJ9D 3OKLA 4AMKL 1JF1B 3MREB 1BVKB 5BRZA 3RVTD 5L0QC 2Y6SD 4JZNA 2PXYD 4LAJH 4G80A 4ZUTA 1GOFA 2GCYA 5IFAH 4XHJD 2P48B 5JHDA 1ACZA 2P4AB 3S96A 1I8KA 5DVMA 4FTVA 4WJ5B 3WBDA 3SE8H 4F7MB 4G6MH 2HT3C 3AAZA 5EO0A 4ONHA 4H0GA 4C58B 2AK1L 5I8KL 5ID1B 4LKXA 4GAFB 4CL7A 4HIIA 2F74B 2R39A 4PJIB 3BX7C 5FECA 3FQRA 4IOIA 2HJLA 1U8QB 4XX1E 3EOBA 2PTVA 5GGVY 4R4BA 1CVRA 2EYRB 5EZIL 1FCGA 3HUJA 4HMDA 3X17A 1CLZL 1JZ5A 4OCXL 2GFBA 4JGJA 2G60H 1WBXB 3JV6A 4GXUM 3RNQB 2OZ4L 5IHUL 3N50A 3ARFD 3HB3C 4N8CL 1V7NH 3KR3L 4LASH 4M7LH 5I0ZA 3KS0H 4OLXH 3GSNH 4MAYA 3I6LD 1SYVB 3T4YA 5TQ0H 2PR4H 4MD4B 4P2OD 3WXVL 3KYOB 1S9XA 4R8WL 1XR8B 3DVGB 1P7KA 4WFFD 5HYJD 4NKIL 3O3DB 5KJRH 2H3NB 4BZ2H 1TENA 5FGCE 4IM8A 4XBEL 5MP6H 1WTLA 1OGTB 1U58B 1XR9B 4MSWB 1RIUH 1OB1A 4M8QA 1MNUL 4NC0B 4JFQB 2HVJA 5C09A 4YDJA 3CD4A 1RI8A 1Y6KR 4KUZH 3T3ME 3R1GL 3HZYB 5LXGL 1BEYH 4QHMA 3GJFB 3CSGA 3DARA 3FHAA 5CSZA 4KKNA 1UZ8A 4OM0L 4HWBH 1TXKA 4OCYH 5DWUH 1P7QB 4K3EH 3DSFH 3DGGA 4OZFA 4F33B 1JHKH 2EH7L 5F3BB 3QB7C 1KXTB 4NZTL 3TLRA 3IDNA 1KCRL 1ZGLM 1NBVL 5CBEB 5CEYB 1GRWA 3L3HA 4EDWL 2VLJD 5I1EH 1X5FA 3TA3A 2WUBH 1DBMH 1WF5A 2I25N 3FOMB 5CZVH 1QKZL 5F3HA 1K8IB 4LP5A 1I7RB 4CDGC 3VCLB 5I1DA 3QCVL 5K59E 4DKFL 4NUJB 2APVA 1HSBA 1KIPA 1G1CA 1N4XH 3EUUA 1S9VB 1PX4A 5BZWB 2WIMA 4JFDB 1JYNA 2LU4A 2Z31C 4TOYL 3EZ8A 3MRKA 5ITBL 4WTZG 3PWVA 4XVJL 3PHOA 4Z9KB 1O7SA 1OAUL 1RJYA 1T66D 4S1DC 3BHBB 4DGIH 3C08L 3SJVE 3DETC 2YA2A 3NPSB 4RIRA 5C09D 2FEDC 4X7SL 2AGJL 1R5VA 4K3EL 4D8PB 1FLRH 3OX8A 3ZMRA 4MXQC 4I0PB 4WI5A 1BX2A 2D7TL 2F9BT 4G6AC 3MBED 4MNGB 2EO1A 2O61A 1S7RB 3UTSD 1KT2B 3NFPA 5J7CC 3TIEA 4PRDB 1G1YA 4UTBL 1HCVA 1RJLB 5A2JH 3JTSB 2ICEB 2NR6C 4XCCL 4KMQA 3NAAH 1FIEA 2ATPB 4X6DB 4EJ1C 1KB5H 5C0BB 4WGVB 5EU3A 2A77H 3R0NA 3T2OA 2I9LB 1R24B 5F7WC 3UO1H 2PR4L 2VE6B 1N3NA 3MRQB 1LWRA 2I9TA 1YMHA 5CJBA 3O3AA 4HGMA 2J6EH 1T21A 4KKAC 3IGAA 4LASL 1ACYL 5HGBB 2I60H 2FX9H 3SE9L 5FCUH 1WWAX 1UYWH 5SX4I 2XXMB 2DLGA 3WJJC 4EUPG 5JDSB 1FPTL 1YY8B 4ELMB 5L8KB 4CW1B 1NEUA 5EZIH 5F44A 1FSKB 1T20B 4CRPA 2HFFB 4E42A 1DUYA 4OZIE 2X09A 1FE8H 2VZ1A 3VXSA 4ESKA 3VXPA 4P2YA 3ZKXC 1FYTB 2OSLA 4X5XA 2HYMA 1LE5A 2OMBA 5HHQB 4YFDB 2FB4H 2BY1A 5D1XA 1T6WA 4LPTA 2DWEB 5C0GA 4HMEA 1B0GA 3LDBC 4F3FB 3RIFF 2I9LA 4EIGB 1T2QH 3MRFB 1QA9B 1KELL 4IRSA 3TBVA 3FQTB 3LHPH 4HKBA 2RR3A 2P8PB 5K33A 3VXMB 1XH3B 4ZS7H 2XNAA 3UTQB 1GSMA 1AY1H 3NA9L 2CLRB 4F7TA 1SY6A 1FORH 2XKUA 3V4PL 5DK2A 2E5EA 1DDHB 1XGUB 5E2TL 5LGHH 2DMBA 1UM5L 5GRJL 3EW3B 2R0KL 3WHE0 5ANMB 4ZTPH 3IDJA 1W8NA 1CK0H 2ERJC 3OPZH 3BZFA 1FFNA 1WT5C 1T7ZA 4HZLB 2IH1A 2KDGA 9CGTA 1SBSL 1DCLA 3PHOB 5B3JF 3O2VH 4OZHE 4M1CD 1MVFA 3MLTB 5T5NG 3EJYD 4A6YH 3FMGL 5HJ3A 1JZ6A 2P1YA 3HMWL 1F3JB 3A6OA 4JDTH 1BGXL 4LNRB 3LB6D 4AEIH 1HE7A 1NCNA 5DK2B 2EC8A 2F5BL 4TRPH 5EBWA 3GK8L 5BV7C 3ZE0E 3PP3K 5F6HI 1W0YT 2I60L 4PRBB 3VXMA 1XGTB 5EBMA 2HRPH 5D1ZC 2FLBT 4PG9B 5AZEL 4XBPB 4CGTA 1I9JH 1FZOA 5ESAB 5JTWA 1BZ9A 1TETH 3TN0C 2XZCH 3K74B 4OLVL 1K8IA 1RUKH 4F33A 1KJMB 3X3FL 2VXVL 4HDIA 3IFOA 1YJDL 2H26A 3JV5A 5DA4A 2AXFB 3L3HB 1BQHA 1UGNA 4KXZI 2MSPA 4O02H 5D2NA 4R7NB 4N8VG 4N8VB 1O5DT 2R23B 4XCCH 3SDXB 5IW1A 5D7JA 3S4SA 5AG8A 1IGIL 2APBA 1J12A 4HS6A 5DI8A 4HZLA 3S5LB 3HMWH 2I24N 3ARZA 4DEPB 5IMMB 5FGSA 3HZVA 2NXYB 2WNGA 4J4PD 3SDCA 2LAAA 3VGHA 4NQXB 4N8VA 3OWEA 3ETBF 2VO5A 2LTQB 1SHMA 4MDIA 4R96B 1VFAB 4GMTL 1ZXQA 4ODUA 4G42B 3QIBC 2BY2A 1CE6B 3E6FA 1LNUA 3WYRA 1HH9A 4OD3H 4AEFA 4MZ2A 1SBBA 3UXFA 3C8DA 1H8NA 4JPKH 4B7IA 2GAZB 1UWXH 4HHAB 3TA3C 3T4AA 3GSXB 5HI4C 5E99H 5KW9H 5T1LD 5DLMH 4J3TA 2DDQH 3B8SA 3T0DA 3BD4A 2XPGA 3P3YA 1CTNA 1ZLVH 3N9GL 3GBNL 1FNSL 3EDKA 1D3CA 2PYEA 4PS4L 4JPWH 5D7SL 1WZ1L 3VXPB 1A6WL 4U7SA 1N5AB 3CFCH 5C6PB 2C3VA 5DD5H 4JQVC 5CZVL 5T1MA 2JB5L 4AIXA 1G7HA 4PY7B 4HUWB 1OPGH 2BP3A 2XWTB 5J3HD 1X5ZA 3OB0H 5E9DE 1QBMH 5I75C 5E1AA 4J23A 4B50A 4YLQT 4YC2B 3O0RL 4ISVA 3BKJH 3SDYL 4F37F 1CFNA 3S35X 2E9WA 1GIGL 8FABA 1SJEA 4S1RH 2X9WA 4NQDE 4K94H 2VLJB 5HD8C 1NGYA 4HC1H 4N0RA 4PLKD 1ZHLA 1P4BL 1D9KB 4X0KA 2F5AH 5F7UA 2HVKA 3WJLA 1U91B 3NFPB 5TQ0L 1XF2B 4FQLL 4N9GB 5GGQH 3DURA 4NJAH 2XQYG 3OXRB 4M1GL 2NNAB 2NYYD 2BHYA 1N64L 4GW4B 1V5JA 4IDJH 4KXZH 3KG5A 5FHAL 2XN9D 3C60D 4TNVK 4NDMA 3QHZL 1FBIL 2B1AH 5T1MB 1K4DB 3TO4D 2ZOKB 3WJJA 5E8DL 3QO0B 2R2CA 1JIBA 4BELD 2BDNH 2H45A 3EO9L 2IPUG 4G6ML 1NCCH 5HHMB 4ALAL 2CRYA 1FNGB 4M00A 3IU3B 4NSKA 5C86A 2IGFH 1X4ZA 2OTWB 5I16A 1I8MB 4OTXL 4OZGA 4XPHH 3D3VD 4WU7B 2XIDA 4OF3A 5D5MB 1HOCB 4PJCA 4FFYL 5GGSB 2FHCA 4M5YL 1A6ZA 4KZDL 1I3GL 1OOAA 1UM6L 1VACA 1D5BB 3QDME 2NY6D 4GLRH 4DKDC 1WBZB 4KTDL 3AROA 3D2UA 5KVDH 3WNOA 3QXTA 2PW1A 2XYCA 4GSDH 2R2EB 2EYRA 2VLKB 2A6KB 3BH8B 5D7JC 4G8GA 1FRGH 2J2ZA 1KOAA 1KNOB 4UT9H 3BH9A 4NZTH 4GAJL 4DW2L 5EZOL 3TNNB 3RVVD 4P9HC 1ZK9A 2LAGB 4Q0XL 4WRLA 2YRPA 4LPYA 1QZ1A 5J11B 3L3OB 4OM0H 2WBJC 3QDJD 3MRKB 3WDHA 2VDML 4A6YA 5EO1A 1BVKA 4FQ1H 4G9DA 2FJHB 3BKML 5ADPL 1Q0XL 3HB3D 4XNUH 1VB9A 3E6HB 1IZKA 4FMFA 5JIIA 1CGTA 5MENA 1Q9KB 2E7CA 1KLUB 2AEPL 4K8RH 4ZPVA 5KJRL 4JN1H 3EYUL 5DJ2B 5TE6H 2Y5EA 2WM0A 1YECL 5F3HB 1F4XL 2X40A 4FQXD 2YBRA 4NHCH 1SY6H 3BRDA 2ZUSA 1ZA3A 4LVEA 5E9DB 3UJIH 4ZXBB 5C0FB 3QUMB 1R3LA 4XC3L 3BIAX 4NNXA 3VMNA 1IKFH 2FJHA 2QSVA 3P9WB 5C6TL 4OIIL 4HXAH 3CK0L 4LCWB 3UBXB 4YDKL 3L95A 3EYQD 2VWEE 3H9YA 3HNSL 1EAPA 1AXIB 4NN6C 1NMBH 2DQIL 4RGNC 5JPNB 3DNKA 1DQJA 3H7LA 2B20A 4U1GB 1PKQE 2Z8VC 3VWJA 2AV1B 4XCEA 4FQ2H 3FQWB 1HNGA 1XGYH 5MEQB 4GAYA 1P69B 3QH3A 3DX8A 2WWMD 1W0VB 4L1HA 3NFNB 4Q58C 5JHLH 3BN9C 3DI2B 1QFWI 4RZCA 4JRWA 1UWGL 5EU4B 4XWOD 4Y16B 4TQEL 3ULVD 1L7IH 1P2CA 4HPYL 3DTXB 1JNLH 2Z31D 3JV0A 4Z7WA 1JNNL 3RY4A 4KVCL 1NCWL 3PWNA 1IL1A 4R2GD 1A5FL 1F90L 4MA7L 3DYPA 2CMRH 4LVNB 2IPUK 4WUKL 3FN0L 2R2HB 5C08E 2YEZB 1EBAA 3BN3B 4Y2DD 1DQTA 3SPVA 5HI5C 4PJ7B 5EUKB 1Z0NA 4PJCF 2YK1H 3KLAB 5FM8A 5GGRA 1HYSD 4LPVA 4N1HB 3IDJB 4OQTH 1A4JB 1F6LL 4Y4KA 1A66A 3KLSA 2PF6A 2O5ZL 3ARDD 3SDXA 2VB5A 5DK0B 4TVPE 5IM7B 4G7YH 3K3QA 3MLYL 4PD4J 3OG4B 3MX0A 2DLFL 4OGAC 5T1LB 2X4UB 4RRPA 4WO4C 2A38A 3ALPA 4YXLH 2D0HA 1R3KB 2P5WA 2FDBP 5IVNA 2C1OA 4HCRL 4NWTL 4ZFZB 1A6UL 3RKPA 4HWEH 4X9IA 4EUPB 1H0DB 5C0RH 4B0MM 1BP3B 4XGZA 3K4AA 1NUNB 5FKAA 1OP5H 2V7NB 3BZ4B 4Y2DA 1DZBA 3IVKB 4Y16D 1GOHA 4P3DB 4ZUVB 5EH1A 3MOAL 3W11D 2VDOH 2E8YA 4S0SD 3PQYB 4QXTB 4PRAB 1WTGT 2BVPA 4ELKA 1WIOA 4X6CB 4PJHB 5D70L 1EV2E 1HHGB 5H8DA 2KKQA 3NIGF 3V4VL 4QXGL 2DKSA 3STLB 4YHMH 1ORSA 3SKJL 1C8PA 4OV5B 1R5WA 1MIML 3QWRD 3KYAA 1IFHH 1D5IH 1NGPH 4JY4A 2GTZB 2NX5A 4NP4H 5J1AA 3KXFB 1IGFL 4Y4KD 1A4KB 4X6EA 3GMLA 3LZFL 5IQ7H 4HWBA 3OTTA 5JW3L 1QSVA 1CG9A 1BVZA 1XIWB 4JO4L 3L3DB 1RK0B 2OP4L 1RFDL 4OUOA 1MWAB 3OHXB 1T22B 1B0WA 3MJ6A 3NPSC 2FIKB 1BFOA 1CICA 3DRTB 1R3IH 1LK2A 2DWEA 4NFDA 3CFIC 3ZDYE 3REWA 4AT6A 2DL9A 3IDIA 1MCBA 4OZ4B 4P3CL 4L8BA 4ZFZA 1C5DB 2V7HA 3GSVA 3KPLA 3DUUB 4GRLB 1QFWH 3LIZH 2DS4A 1F2XK 3Q5OA 3RVXD 4PJHF 4DUVA 2X44D 1YQ2A 1QSFB 1XIWA 1CD1A 2DI9A 5AYQA 2YSSB 4YHML 1IAMA 2HMIC 3IFNL 1NGQL 2X1PA 4MNQD 5F9WB 1CFSA 3R06B 5BV7L 1GYAA 4O4YH 5IB4A 2BVTA 2AEIT 1U8MA 4L8DA 5IR1A 1ZGLP 4KJYB 3GI9H 3FO1A 4HW6A 3WO4C 4JFEB 3VFRB 3EJYC 5B39A 1ZLUK 5GS1C 2GK0B 1EVTC 4N0YH 3GJFK 4Y4HB 4EI5D 1EUTA 1YZZA 5GGVL 3GFUA 1VFBB 4NHUA 1X5YA 1HSAB 4PJ5D 4LSTH 4AEEA 4PRAA 5E4EC 2OXGA 1X5IA 2J4WH 2R69H 5BZWA 2DWDB 4PBVC 4P2OC 1QSFA 2XZQH 5HI3D 4ZUVA 3H9SE 2A1WH 2OI9C 2X5PA 1KFAL 3AMLA 3MBXL 4J3WA 4MJ5A 1IEBB 4L8BB 5DRNB 2V5SA 3S5LG 5J13B 4O00A 1VENA 4WHTA 1A7NH 1B2WH 2XFXB 4XMLH 3CNKA 2BRRL 1RZIB 3BKCH 4LPXA 2FL5B 2EE3A 3GSQA 4KRPD 3MCKB 4X7DC 5BOPA 5C3LD 1N59B 1RZGA 2RBLA 3PGFL 4K8RD 5I2IA 3V5KA 4WFHD 3MRNA 2NCMA 1UCBH 1U2HA 4OJFH 4ZAKB 2B0SL 2YMXH 1JGVH 4P9MH 3MJ7B 3C8KA 3O4LE 4M7KL 4R0LB 1TIUA 1EX0A 2X4UA 3AVEA 5T3XL 1Z3GL 1I4FB 2C7UA 3BHBA 1KBGH 1OARL 4R90L 3KNBB 5KVGL 4YDVB 4O2CA 5EORH 3CH8A 1F58L 3BIKA 1R3HA 4HKZA 4K2UH 1UXWA 3H9SA 3UJTL 4XZUB 3PWVB 4XVUD 1ND0B 4HF5H 5EZLB 1A6VL 1FFOB 4HK3N 4RMRA 5GGSY 3HZMA 2F53B 5E4IA 5T1KA 1VEPA 4JREB 1DE4A 1KCSL 4AL8H 3OKLB 1J0KA 1TZGH 2VLKA 2KL6A 1Q9WB 5DJDA 1T1WB 3VGDA 4YAQA 2IBZY 4C55A 1UKQA 5DMGD 5DJCA 3DX9B 2HLFD 1NAKH 2BVUA 1CXEA 1YEEL 1JWSB 4KDTC 3WNNA 1GPOH 3IXTA 5AD0B 4GG6A 4ZNEE 4GAYB 3KPSE 4U49A 1CD0A 2HTKD 5HBBA 4YIQA 5CGYD 4RAVA 1INEH 1I9IL 3DVIA 1UZ6F 3O6MH 3MNVA 2JB6A 4MCZB 4DFIA 4D9RD 3ARGC 1AP2A 5A2FA 5C0AB 3B6SA 4DUXA 2PYFA 4JE4B 2HLAA 4U3XA 3G6JF 1R5IB 5C07B 3P0VH 3OXSB 5TF0A 5CMAB 2VQ1B 2VAAA 3DBXB 4UAOC 4WW1A 3RGVB 1G7JB 3U7YH 4OJFL 1GZPA 3WN5A 2GY5A 1AR1D 1EMTL 3NIDE 4K3DL 3PGFH 3QIBA 3TBWB 2WANA 5GSVA 2DICA 5TDNB 5HHXL 2YXFA 1J10A 1J1PH 4PRPB 1KCUL 4NNXB 5SWSA 3DUUA 5K9OA 4LVHC 4JZJB 1ZANH 3PWPD 2ZUVA 1T0MA 2ICWA 4K94C 1CFQB 2XQBL 4WEUD 2AKRA 4QRUB 2YWYA 4DVRL 1MPAL 4J8RB 5DR5H 4TUOA 1Q9OA 4BK5A 2IQ9H 3C5ZC 4X6DE 1YN7A 4HJGB 4MQSB 4UDUB 1WV7T 3QQNA 1A4KA 5I19L 1CFNB 1ULVA 5BQ7A 3QIBB 3TBWA 1JWMB 1QFWM 1ZWIA 4QWWC 3BIBX 4PJDB 5CIPB 3AB0C 5SV4A 1RZJL 3BGMA 4JGMA 2DYPB 5IB1A 3K1DA 4QXUH 5ICXB 2AJUH 2QKIA 2R1WA 1V3JA 4Y88A 4DN4H 1AP2B 2RQ8A 3MSPA 4P59H 5D9SA 3TNNA 1KEML 2YEZA 4PJCE 1YMME 2K7QA 2ZSWA 5BZDB 4Q97A 2VH5H 3PL6D 2YOCA 5HGDA 1ZKAA 4OFYA 2ZUQC 2R2EA 3TV3H 2A73B 4K23H 4H8WL 4PBWD 4NCC1 4JO4H 1NUFA 3LRHA 1A7QL 1QRND 5D2LF 4DGYL 3VH8B 4F7PA 4AL8L 5I1LB 2JK5A 3NFNA 4L29B 4NUJA 1NCCL 4URTB 1C08A 5I75B 1X5KA 5AZ2H 2BDNL 4YEFA 1UZ6E 1CICC 4L4TA 2J8UE 4K71B 5F1OB 4XWGL 3STBA 2H2SD 4KQ3H 4GKZB 4XX1G 1QLFB 3B4NA 3MJ8B 4NQEE 3BQUB 5FHAH 4QCIA 3A67H 5EUOE 1FG2B 4GKSB 4R4FH 5KSVA 1RUQL 3BPNB 3MRGB 2L7UA 4HLZG 2OXHA 2X89D 3MV8B 1IC5H 3DHJA 3O9WC 4GW4A 4RAUB 5H94A 3SCMD 1WLHA 4KTYA 1UWEH 3S5LA 5BRZD 4POZC 2O93L 4OB5H 3LD8C 4D9LL 5AD0A 4U1LB 5CWSA 3TN0D 5HHNA 3TZVD 4N9GA 4MQ7A 5CP3H 4JQVA 4GKZA 3SOBH 2ITDA 5JORA 1A6UH 5DDHA 3EJZC 2XOTA 4KI5F 4MB3A 4QRPE 1CXHA 5IJVA 4KI5E 2V17H 4YE4L 5T5FL 2WBWB 5GISH 1VA9A 1T1WA 4NNPH 4LGPB 4RISH 1MLCA 3KDMA 1P84K 2APWA 1GGIL 1N6QL 1J8KA 4G7YL 3Q3GB 4OF8A 4NN7C 4KK9D 2O5ZH 3CZFA 1CR9H 3HRPA 1PFCA 1XCTB 2C26A 3OAZH 4K7PY 4M43H 2V17L 2YRLA 2HH0H 4RFEB 3IDYB 1D5MB 4YBHA 3S98A 1KENH 2IG2L 2F58H 5K9QG 3B9KA 2XI9A 1IC1A 5DHVB 3SDDB 3J8F7 3JV4A 4KDVA 3BH9B 2FZ3A 1T80A 1H3UA 4GBXD 5J9PA 3W0WD 1DL7H 2J5LC 4UIKH 5IEHA 2QJDA 3MUGA 3RL1B 1FH5H 3SGEI 3LKNB 5DVKA 4EQ2A 3VMOA 1UWGH 4P99A 3D3VB 4OZFG 5IVZB 5LGJA 1C5DA 2V7HB 3VD3A 1WC7A 1G7PA 4Y8DC 3FB8B 2HJFA 1LK3L 1KC5H 2YD7A 1T22A 3QUXA 3B3IB 2J6EA 4W4OA 3PIQA 1UEYA 2GIYA 1NMBL 4LSRH 1RIVL 1GGUA 4HFUL 4HAGA 3SDXE 1MRFL 3V4VH 1QR4A 4X7FC 4HULB 4LEXH 3GSUA 3U7AA 3GJFH 1YA5A 4APQA 4WTZA 1A6AB 2ZG2A 3CMGA 3LEVH 5FO9A 4JO2H 5HI5D 1IQWH 1KNOA 4PJGA 3RWJB 5AUMB 2VH5L 5FCSH 1P4LB 1NCBH 4TUJA 3O6KL 5D5ME 1WICA 4WO4D 2DYPA 5IB1B 3VWJC 4MJ4A 4Y4HD 2XZCL 5EIQA 5C0AA 4BQ6A 3OGOE 4KMTH 4JM2F 1I9JL 1FC1A 3L5HA 1QFHA 4XNQB 12E8L 2AJUL 3BFOA 5TE6L 4JN1L 4OLUL 2NY7L 2RJMA 4XB8A 3GSNB 4M43L 4PG2A 3TESA 1NGWA 4WWKC 1WFTA 4I48A 1HQ4A 4X9BA 1IM9B 4AEIL 1LMKA 2XWBB 3GM8A 1QNZH 3QZWG 3SGJC 3KPSD 3MRIB 1OTUC 15C8L 1MCDA 3KYNB 1GGIH 1N6QH 2ATPA 3GO1H 4L9LB 4X4MA 2BNUA 3OKDA 4Q6IA 5FYKD 4JM4H 1SBSH 1U8IB 2JF1A 1OAQL 1BD2B 1M1SA 1MHPH 4U0QB 3U82B 4GG8A 1A2YB 5INCB 3BP7A 2WINA 3QQ4B 2MNUA 3LKNA 2FHBA 2NR6D 3C5ZB 1P4LA 1FRGL 4M6NH 2F53E 4OFIA 1LE9B 4PY7A 1IAIM 1ZANL 1CIDA 4LLMA 1M6OA 2YWZA 1JNNH 3SPVB 2H1PL 3LKOA 3RKDC 1X6NA 2IMMA 3ARVA 2BXYA 1EMTH 3TBTA 2AJSH 4P4KD 2P24B 1ZE3C 5EWIH 1QTYT 3OR6A 1MHCA 1UM6H 5DZLA 3LHPL 4PGEB 5GJTL 3DLQR 1EO7A 2KPNA 1T2QL 2QQKH 4WO4A 2N4IA 5D7LE 3F7PC 1MQ8A 4KHXH 3OKEA 3NCYP 4PTUB 3SN6N 1S7WA 3BZEB 4DWHA 4BUHA 4KY1H 4OZIB 4LSQL 5GHWH 1YEKH 3HRZA 4QF1B 3K81A 1MFEL 4PGCA 3QH3B 3MRFA 1AC6A 3VFNB 4BQ8A 1IZJA 5EBWB 1BD2E 4PRDA 2SEBB 5L8JB 3OAYH 1NGZB 2B7DT 4WO4B 3TA3B 5HGAA 4MA1C 4Z7OE 4J1UA 5M7QA 2DWDA 2EYTA 3E3QC 3NCCB 3IDGB 2E3VA 4OGXL 1ZLUH 5E8EA 2X42A 4N9OB 5JPMB 3ARED 4KKBC 1IGML 2D7NA 4J3VA 3TYGH 1RJYB 4JFEE 3QXDB 4KJYA 1KEMH 4Z95L 1HI6B 4X6BB 5DYOB 5E5MB 4QHLB 3UO1L 4D0DA 3LS5L 2A77L 5IHBA 3R4DA 5INCA 5KSBA 3MRQA 6CGTA 4UOJA 2NY5L 1NGZA 1F58H 4K2UL 4M9OA 3V8CA 4JFYA 3NAAL 3U0WL 5IIEB 5CP7A 3B9EA 4BKLA 2ZWLT 3EYFA 5HYSB 3ORJA 3DECA 5B21A 3RVUD 2XXCB 2NZ9D 1OAQH 4RA3A 4LARH 3RUGB 1WCBA 4G42A 3OKEB 1MHHB 4BYHA 1EH9A 5I8CA 3GO1L 1WVZA 2I5YH 3BPCB 3ARFC 4I77H 4F15C 1KYOJ 2ZUWA 5CIPH 2P5EA 4U1KB 3BYTA 2BRRH 4NO3B 4WCYH 1T03H 1T1YA 3OKKA 3JWDC 3TH4T 4NKOA 5FO8A 2JIXA 1OAUH 4DOHE 3MBXH 2FGWH 2X9YA 4OZFH 1L9NA 3B9KC 1NFAA 4XVJH 4GSDL 3CFCL 4L3AA 1XZ0B 3QNZB 5A16A 3F7VA 2HT4D 3AAZB 2FWOA 3WS3B 5C0ND 3T2NH 2R69L 4ZUWA 4OLZH 1I3RB 1NCBL 1NFDB 3LQZB 1FG9C 5EULV 4WENB 4NN5C 5FA4A 3ZL4L 5CEZD 2Q7YB 1IGYA 1G7QB 3ULVE 5E0QA 4J3OC 4JZOB 2OBGA 2NY2D 2RGSA 1OAKL 4YO0B 3C9NB 4MAYC 4ZSOE 5IWLA 1N6UA 4XBGB 4G8EB 4PJIE 3SDCD 5C7XL 1HHIB 1KIPB 2ZG1A 1JZ2A 5F9JB 5HVFB 2YD8A 4NOBA 4MXVF 4AY0A 1OP3K 4F3FA 5J8OA 3HC0A 4LAQL 3GSNA 4Q6IC 2B1AL 4NKQB 5CSGA 2VLRE 3QHZH 1JZ8A 5FYJH 4WVRA 3MLTA 4G8FB 4JRXE 1SJXA 4GUPB 3MRPB 3TBTB 4MX7B 1LGVA 5HGDB 5ESVA 4IOFC 1HIML 4FABH 3KXFA 2EYSB 3G5XB 2WQ8A 3U0PB 4PJBF 3MMEB 3VXTA 4N5EC 3MBEB 3W0WE 4ACPA 5ILTL 3GJFA 4OZIF 1R5WB 4X7EC 5A3ID 4PJ7E 1EZVY 3MRGA 1E27B 2MQCA 2GCYB 3ALWA 2A6JB 5I73C 1I75A 3QBTB 4OI9A 1S78D 1IFHL 2JJTA 3L3GB 4HC1L 4RRPG 1Q38A 3QIUC 5BQ7B 3U2SB 4JRXA 5ETUA 3BSZH 1TJGH 3BW9A 4QT5B 4OLXL 4Y4FB 3WL9A 2FEDD 4AENA 4XCNA 2V2TB 2UZIH 2P45B 2Z9TA 2UUDK 4ZOCA 4GRMB 1UT9A 2EKSB 3AMKA 2WZPD 1QA9A 3RBSA 4YXKL 1BF2A 4OD2A 1HOCA 3BI9X 5F7DA 4LDEB 2HKHH 5HXMA 2VDNL 2VL5A 4Y8AA 3W9DA 4LNVA 4C59B 4PJEB 1JFQH 3FMGH 4RCAA 4POUB 2HWZL 1OAXH 4TULH 4MQ7B 4JRXB 1MUJA 3DX8B 4NFCA 3HUJB 2AK1H 5I8KH 2KQNA 4PB9L 3SE8L 3G5ZB 1EK3A 3D5OF 1A6PA 3HE6B 4HIIB 3OF6D 1S5IL 5TE7H 4D9LH 2D0FA 4QYOA 3VFOA 2YS4A 4HIEA 4OCNC 4LSTL 5HYSG 4DGVL 4L4JA 5H2BB 1ZGLB 5CBAA 5I76A 3GBMH 3LAFA 3NMEA 2FR4A 1I7UB 4YDVA 5DLML 2VLMD 3T0BA 3ARUA 2BERA 5SWZD 1YY9D 1XR9A 4LHJB 1QLFA 3C60A 1DQQA 5BV7H 2AJYL 4P23A 4E41D 1BLNA 4LGRB 5EC2B 1I8LA 3S7GA 3GJEA 4XTRC 1S9YA 2R0ZL 2CIIB 3MV9A 3C6LD 3RGVC 3UTPD 1X6LA 1GOGA 1HH9B 1TCRA 1QFWL 5GZOD 2UWEB 4ISVB 1CLYH 4XNXH 4UU9B 3NZ8A 5BS0A 3X3GL 4P3CH 5IVZA 4AQ1B 1LP9B 3CMOL 4Q9QL 2UYLA 3UDWA 2IFFH 2R29H 1MFAH 2R56H 4FQCL 2C3HA 5HHVH 3U46B 5E1HB 3ZKQD 2BZDA 4Y4FD 2BHZA 4D94A 4U6VL 4LVNC 5SWQB 1QSFD 4GXVL 3VD4A 4QHMB 3QJHB 2P46B 2W0KA 2WWKO 2XZAL 3CC5A 3BGMB 2JIXB 1CT8A 3D0VA 4YDJB 4QRRB 5IW1B 4LIQL 3QNYA 2GSGB 2EKJA 3MJ8A 5AZEH 1DQLH 2X70B 1RHHA 3DXAB 3SE3C 4ZOBA 1BQSA 3SDDD 4Y2OA 1OP5K 2ADGB 4HBCH 4S2SB 3LY6A 1D6EB 4JHAL 5ADOL 4UU9A 5I1DB 3RUGF 4OAWB 3VGBA 3TCLB 4Z7QE 4CNIA 1M4KA 1HXYB 4KKCD 1JF6A 3UMTA 2AJZB 1E4XI 2N7AA 5K9OB 1KXQE 4NUGH 2MCG1 3GM0A 2VLLA 4C83A 2X89A 3MRMB 2CK0L 1DQQB 3HMXA 2R0KH 3C08H 5F1SA 4H88H 1RHHB 4KRPB 5GSVB 1OTSC 4M3JA 4GRWF 3SY0B 3ARFA 4K8RL 1FL6B 1QUNA 1TJHH 3GSWB 2R1XB 4P5TD 3BZFB 4FA8A 4ONFH 1DQDH 1GGCH 3HR6A 4ZS7L 4HEPG 3PWUA 3VD9A 3HC4H 3NZHL 4MCYB 1ETZA 5ANME 3C8KB 2HFEB 4XPAH 4GBXC 3BEVB 4ZFFA 2X1QA 5L2JA 1T5XA 3DIFA 1JNHA 4J6RL 1QO3A 5EZOH 5ICYB 4U7MA 2D7OA 1Q72L 1J9CT 2H9GA 3AU1B 4LSPL 4JKMA 4IRSB 5BW7C 2XFXA 4M62H 5DHVH 1VESA 5E6IA 2W07A 5HHPA 1NLDL 3MFFB 4KVCH 1V3LA 4PJDE 1OF2A 1X5GA 1KPRA 3DSFL 4Y5XB 4PJ5B 5C0IA 4OCYL 5DWUL 1VEMA 1A1NB 2FYYB 4QT5A 2JJTC 5SWSE 2IAMB 1UYWL 2EIZB 1I3VA 3ZKMC 4JFXA 1MLBA 1XGQB 1B3JA 3DO7B 1OL0A 4DCQB 1DR9A 4WUUA 3GMPB 3QA3A 1EEUA 4JPIB 1RIUL 1KCSH 3MOQA 3V6OE 3MUJA 4ALAH 5BRZB 2DQDL 1DBKH 3H2WA 2EDNA 5KTEL 3QEQD 4BH8A 2NY1C 3QG7H 3O8XD 1KPUA 2NXYD 5B38G 4J3UA 1AHWB 2C3VB 3EKCA 4BJLA 2BVPB 3HLAA 4RBPK 4Y4HC 3T2QA 2FYYA 2BSRB 4LLWA 2A2QT 1MUJB 3UTTA 1CD9B 4M7KH 1OTUD 2Z4QB 43C9A 4I3RH 5HDBF 1NKOA 3BZDA 3TVMB 2AS5M 4P9ML 1H8SA 1KPRB 5GS2H 4M1GH 1BFOB 3DRTA 3HI1B 5KANG 4G7VH 5FIEA 4WHTB 4GQ9H 3FRUB 4RZCB 5D1XB 3F5WA 5JR1H 5FUZH 2AGJH 3L3DA 4HIHA 4X7SH 4M3KB 5CCKH 5SWSB 3GMMB 3L7FA 2I26N 3WIHL 1K3IA 5HYSA 4HWZB 4X6EB 4S0TD 5KVFH 1E4XH 4Y5VC 1QRNB 1P4BH 4FXLA 1AHWA 1MJUL 2EECA 1KFAH 1DN2A 2FX7H 3MRJA 1NBZB 3GSRA 5FYKH 2HFEA 5IFAL 2OS7A 1U92B 1NC4B 1YN6A 1SM3H 5TH2B 3RDTA 5E9DD 3SDYH 1VSCA 3ULUD 4LSUL 2Y25A 2O26U 1P7QD 1X9QA 3QPQD 2NY4C 3QNZA 2BOBA 3C2SA 3VWKD 1DN0A 2VDPH 4UNVA 4U1IA 2W91A 3WD5H 5JMRA 3W11C 4HQQL 3A6CL 2LU3A 5HYQA 1D5ZA 5KSUA 1NLDH 2M26A 4YR6A 2BJML 2VLLB 4P2QB 5EU3B 5SX5K 3VXOA 2CDFB 3MNWA 3OKOB 3EOYG 1U3YA 3L5WB 3VFMA 1P4IL 4ZYKB 3VRJB 4RWYH 4CN6A 1WZ1H 5L2KD 3C5SA 1MWAA 4PY8J 4XBPA 2PW2B 4U6YA 3WXWH 2D31A 2W9LA 2Z93A 3HI6L 4NNYB 3FOMA 2F8XC 2OTUB 2C1OB 5D1XD 3D3VA 5GGTA 2ICWI 3DWTA 4DKEL 4XCEB 5MENB 4PV9A 3AXLA 5KW9L 5LWYH 4QOKB 1NJ9A 1RMFH 3PV6B 1KPUB 3ULSB 1LP9F 3QT2A 1F4AA 1MNUH 3ROOB 1UZ8B 5JW3H 3NTCL 4QRPA 2FX7L 1QLEL 5B39G 1EVUA 1HCFX 1OSZB 1ZHKA 2IH3B 1PY9A 3VU2A 4QRQA 2AEQL 2XWJB 1MI5E 1FDLH 5IQ9B 2GI7A 3EO9H 5IB4B 4I4WA 1YMMB 5EUKA 4BZYA 4NC1C 2WP3T 3GKWL 2DB8A 4HS6B 5DI8B 1I7ZA 8CGTA 1OP9A 3WNLA 1FFQA 1FL5A 3IDGA 1RIHH 5E56A 1J87A 3ROOA 3PQYA 1HKLL 2P7TA 4I3RL 3SDAD 3E3QE 4F58L 3SGKC 5IEKB 4Z7QF 4KK9C 4RGNB 4U6YB 3SGDI 5EOCH 2BOCB 4X80H 3SO3B 4Q74A 4U1GC 1JI2A 4H1LA 4NKMB 3SKNB 1IEBA 1VCAA 2KZWA 1VACB 3MRCA 3VXQB 1PZUB 1H0DA 3QWOB 3X3FH 4M7LT 5K9KA 1Y6MR 4U6HA 5EA0H 4JFYB 4JO1L 1OTTC 3TWCL 5JQHC 3VRIA 2XZAH 3TGXA 1AD9A 3MRDA 4PB0L 3GRWH 4D2NA 3ARSA 5T3XE 1KN4H 5GRXG 5EO0B 1A14H 1LO5B 1F6FB 3WUWB 1DBJL 2M8XA 4XH2B 3WUWG 2P44B 2V6HA 4I0PD 4L3EE 2DLFH 3TYFB 4FZEH 3QUZD 4P46B 1ZVSB 4A6YL 3JUZA 4QY8A 3UBXG 1IGJB 2VZVA 3CFKA 4KUCD 5JMOC 4XCYA 1U92A 2B1HH 2IANB 1U2CA 3L5XL 1TVHB 4UT6H 4X7TB 4B7LA 4K9EC 4KC3B 1OQXA 1MCEA 4PJ5A 1MRCH 3FN0H 5KN5A 3HNVH 4H8WC 1FYTE 5I17A 1PY4A 4J6RH 4AT6B 4WU5B 3NABH 2P8PA 2ZUQB 1XGRA 3WFDH 3ARDA 3V5HB 4ERSL 5EZJB 1FZJA 5E2TH 3N9GH 5LGHL 1QEWA 3MC0A 4KDTA 4NZRH 5ALBL 5D5MA 5DGQA 5B8CB 1ZHNA 3TA3D 2J12B 5ICYA 2OYPA 4EI5B 4UBDD 2MQ0A 1JPSH 1BBJB 1JV5A 4NQCD 1GC1L 4PRHA 5T3ZH 3RPIA 3GBML 3G5VA 4FFVC 3U2SA 35C8H 4AM0A 3NCJH 1KN4L 3O3UN 4OQTA 1OCWH 3F7QA 1RZJC 1N5YL 3RNKA 2WQRA 3H3KA 3TFKC 4YXHL 1QBBA 2MFNA 3RWGA 4D8PA 5JOPD 1G7MA 4OFYD 4WW2C 4ZUTB 2EXWC 5IV2A 4LRIC 2NX5D 1ZWIB 5FYLL 2X6MA 3FN3A 2XZZA 1ZVYA 2NX5E 3IJSB 5F7LB 2DIJA 5BVPH 3BMWA 3KPNA 3KWWB 4FFZL 3R8QA 3ME0A 1VDGA 2GW5A 4CVZB 2BVQA 1HYSC 3EFDH 4WUUE 1JPFB 5KANI 4G8FA 2HKHL 1VPOL 1C7SA 1JPTL 1QRKA 4LGSB 5MI0B 3RWEB 2MMXA 3BUTA 4MZ3A 5FGRA 3FO2B 3HCVA 1J8HD 1HILA 3B3IA 2ADJB 3K8KA 2WLZA 3INUH 1JTPA 2V2XB 2ATKA 4NHCL 3D39E 2B8OT 1EEZA 1RULL 3HI5L 4Y4FA 3WL9B 5FKPB 1HHKA 1UJ3A 3BJ91 4QTHA 2VSDA 1BECA 1CXLA 3ZE2E 3M1BB 5JNYA 1NLBH 3ZHKA 3OV6A 1IGYB 4HIXH 5D7LA 4TRPL 3QXAB 4PJ8D 5L7XL 5AAMA 2HN7B 4ODTL 4HT1H 3ZYZA 1VKXB 4BZ1L 2VIRB 4FXKB 3GGWB 3B2UD 5FUCC 5BVJB 4JDTL 1NBQA 2PYFB 3G6JA 1HQRB 2VDMH 5B38A 2HT2C 2JB6B 4IOSD 1FO0H 3P30H 3ZKND 1NANH 1YQVH 1TPXB 2CK2A 4WI8A 3I02A 4XTRD 4DGIL 1BQUA 1MCRA 4GFTB 2ZUTA 3MACL 3C87A 5DF0A 4MXVE 3STZA 2ARJB 2BJMH 4CAGA 1D9KC 1JWUB 4LHUA 4TSBL 4HUXB 4YHOH 3O41B 2VSCA 2GSIB 3HS0B 2PO6A 4NRZA 1NGYB 3MJGX 4YHLH 3LV3A 1IMHC 1LD9A 3MV9E 2NXZD 2EKSA 1HHIA 2Q8BL 3QDHA 1KLFA 3ELAT 5GQBA 4X99B 4B53A 1UADC 1N4XL 3PL6C 2GKIA 4Q9RH 4NC1E 4RBPH 4XI5D 3DXAA 1Y18A 4FFYH 3MV7D 4F2MB 2W9EH 5CWSB 3T2NL 3MUHL 5CINH 1AO7E 2ZSVA 3L3JA 4LFHG 5TE7L 3WO3B 4Y1AD 4O2FB 4UV4H 4ZD3H 5C2BH 1ROWA 1P5UA 3HE7B 4OCWL 1NSNH 5ACZB 3BP4B 1OGAA 2G75A 3WS3A 1I1AD 1KN2H 1NBVH 2R4SH 5D7KD 1KCRH 1K6QL 3WIFB 3VXTB 3TCXA 2X4OA 2ADFL 2NTFA 1RJZB 4BFIB 5DK3A 1RURH 3OMZA 4I2XB 2I5YL 2ZOLB 3B2VL 2EYTB 1U8PB 4C54A 1NCUA 5D7LB 1F8TL 3EGSA 4KAQL 3LCYA 1CDYA 5L2KE 2H41A 1EFXB 4OF0A 4QTHB 1ZTXL 4JRYD 2JJWA 4GKNB 1INQB 3TM6A 3KPRA 1A6ZB 2ESVD 3SCMC 4G6JH 5IF0A 4OFDA 3WHE1 1HZHL 2ESVE 5EC2A 4YO0A 4JR9H 2QSCH 1Q94B 5HYIA 4MD5B 2DQDH 1YYMH 5INDB 2HT4C 2EE9A 2PKDA 5IG7A 4Z95H 4P5KB 2WLYA 5HPMB 4NBXB 2QQLL 4I2XA 2OJEB 2OR9L 5IROA 5T1KD 1P1ZA 2BK8A 2DBJA 3O0RH 2F74A 5IHUH 4Y1AB 2X4OB 3VRLF 1A1MA 2ZKHL 1U8MB 2Y7QB 1MY5A 4HS8L 1BBDH 3FONA 2D7TH 1G7HB 4ORZC 2HFFA 4E42B 4U1SB 1G7JA 1Y0LA 3B2VH 3CUPB 3CX5J 4TTGA 5DD6B 3RY6C 1ZT1B 3F65A 4ELMA 1UACL 4JRYA 4HIEB 4LAQH 2NY0C 4PJDA 4MX7A 3L7EB 3UC0H 4J1UB 4HV8B 4FQQA 4OKDA 2DM7A 3T8XA 2BSTA 3O2DH 4H0IA 1UJ3B 5C09E 4F7TB 4M93B 3W0WA 5ESAA 1BPVA 5DS8A 1LK2B 4JPWL 3OAYK 4KHXL 3CFJA 4XAWH 32C2B 2YA0A 5MENE 2VXQH 3NFSH 4AMKH 1XGTA 5F93C 1UCTA 4HFWB 3NZHH 3R0MA 1AGCA 2AQ3A 2Y06L 1AXSA 3GUTB 3GMLB 1U93A 3CLFL 4OLZL 1CFQA 1G9NL 2V9QA 4JPKL 5KSBB 4JFFB 5JIPA 1KIQA 4XNQA 4Q2ZA 3QEUB 3PWPE 4TSBH 4ODWB 5D93C 2YD5A 2Q87A 4KMLB 5I1EL 3BRGC 1G7IA 3MFGB 2NW2A 1FGNL 3G08A 5CAYB 3E8UH 3RGVA 4NQDA 3F7VB 1RZFH 5JPMA 3CSPA 5B8CC 5DO2D 3WEXA 4QXWA 4NUGL 3ARRA 5FV1L 5JW4M 5GRVK 4HWBL 4XNZB 4P49A 2VNCA 1EJOL 2H32B 1YPZA 5HDOA 1A3LL 1WAAE 3RI5K 5C08D 4QRPB 1I4FA 5FA3A 1E4WH 1IT9H 4IRZL 4KUZL 4WHYH 3S36X 4JHAH 2HTLD 3P4OB 4HUKB 4HT1L 2XNAB 4U6HB 2VAJA 3BJLA 1INDH 1ZLVK 5IB5B 2NY5H 5A40E 2IBGA 4BZ2L 1DQMH 4OZIA 4FZ8L 3DX6A 1KUMA 5FUCE 2D7PA 2ICEA 2VLRA 4KMTL 5D71L 2OR7A 3FQXB 5FUOL 3OZ9H 5L88H 4YAQB 1MCOL 3OR6B 2QEJA 3T8XB 3QULA 4HAFA 5J0BA 1PJ9A 4YK4B 1IQWL 1NL0H 1IQDA 4WWKD 3THML 3LEVL 4NM8H 1CGSL 1UQSB 1TZIB 3C6SB 5J9PB 3BDXA 3MR9B 3RBGA 1K4CA 3O2VL 5FO9B 3LQAL 5F88A 3WKML 2YD6A 4GW1A 3B9KB 3K2MC 2IH3A 3KNBA 1OSPH 1IARB 1KSRA 3DMMB 2DKMA 4PJ8A 3FO9B 4HC1A 1TQBB 2P5EB 1HEZA 4U1KA 3TPUB 2EDFA 5GHWL 4JDVB 5GGUA 1CQYA 1NJ9B 3MRBB 4K07A 4WNQA 1LK3H 2CLRA 1A3RH 2AJYH 4CMMB 3NCJL 3KYOA 1BQLH 1I9RH 2DF3A 5CUSL 1UXSB 1FORL 1TJIL 4DK6A 3NIFE 4P2RB 1WBYB 4BQBA 4P57A 4MAYB 3MXWL 1LQSR 2BOCA 4JFHD 2VZTA 4ZTOL 4U33A 1AHWC 3VXSE 3MRLA 1L6ZA 3L3KB 1JUFB 1DL7L 4UIKL 1T7XA 2EC9T 1NQBA 5F3BA 3CU7A 4PP2A 1T7WA 1I1RA 1MJ8L 1DUYB 1OAYL 1QBLL 5F7YC 3DHMA 2BNRA 4PJGB 2DIBA 3CJJA 5DC0A 3V0VB 3SDDA 5HVHC 3MLUL 2JTDA 2VYRE 5E6IC 1YEFH 2HJKB 5CEXA 4ODVH 1LE9A 1PW3A 4XP4H 1JCKA 1II4E 2BSSA 4M1DL 4OSUH 5HI3C 5HGGS 2Q8AL 4FZEL 4RNRB 1RVFH 1QSED 3AS2A 4MNQE 3BQUA 3SGKA 3DMMD 3IJYB 1G6RA 4NNPL 4RISL 1I1AC 1HHHB 3DROA 4Y5YB 3CXDL 3PWPB 2N56A 3FRPG 2J6EL 2X4PB 3V7AE 1NBYB 2XT1B 5C0CA 4Y0GA 2DRUA 5EA0L 4DZBB 3SHSA 4RGMB 3L5JA 5GGTL 3STZB 3NACL 2ZCKL 3EJZD 1YPZF 2P42B 1G7LA 4YQXL 5FYKU 1TVBB 4RFNC 5ILTH 1H15A 4X80L 2H32A 4CN1A 4MB5A 4UTBH 1ZHBB 3S3JA 2IH1B 2CJUH 1PQZB 3TPUA 2C4XA 5IJKA 4LEXL 5CZXD 5ID1A 3MV8A 3SE4A 1JZ3A 4WFHE 1RIHL 4LPUA 3S96B 4L3EA 4YH6A 1NC4A 1YN6B 2IC2A 4KQ3L 5ALCL 3V5DA 3MUY1 2A6KA 4LLMB 1CFSB 2E6JA 4KJPD 3QXAA 5GPRA 2QV2A 5BOZG 1A9BA 4P2OB 2YUZA 5C0CE 1Y18B 2OMNA 3N1MC 2OI9B 2ZZUT 3QXWA 4HS3B 3T0EA 3M1BA 2Q1EA 5JNYB 1KJ2A 4WHCA 1AGCB 1QLEH 1EO8L 1NKRA 3W39A 2DLTA 2YD2A 3T4YB 1MF2H 2YN5A 3BISA 3WE6B 3MOBH 4UIMB 2VLJE 1HSBB 1Q9OB 1AE6L 1D6VH 2YD1A 4WU7A 3TT1H 3UX9B 3QI9C 4DKEH 3L9RB 5C71A 3GMOB 1XF5A 4AJ0A 1CCZA 4F9LA 1T1XA 3WS6A 5LGJB 3ARBC 3ARQA 4NQUA 3CSYA 3VFUB 5DS8B 1AD0A 1OVZA 1QO3B 2VDKH 4GQPH 3MGTB 1R0AL 3T0VA 2FGWL 3PUCA 3VDCA 5GS2D 1WIPA 1C7TA 4WI7A 5DJ0A 3SO3C 2E27L 4Z78A 2AW2A 1SMOA 4TNVF 5DK0A 2JELH 1CR9L 1YY8A 4RDQG 4UTAL 3CFBA 4F8TA 4FQHA 4BSVB 4PV8A 1X44A 4UQ3B 3L95B 4HJ0C 4JREC 3UROR 2IWGA 2CDGA 3EYOB 5D7IE 5GS0C 4DZ8A 5D7IF 2F15A 1G7IB 2NW2B 3O8XB 3UYOD 3CXHK 5HPMA 3ALXA 4PJGE 2YZ1A 4HG4K 4CVXA 3MO1B 3U46A 3ZO0A 1NC4D 2PCPB 1IC7H 2BX5A 1P1ZB 5IVXA 2NTSP 1C08B 1AGDB 4LCYA 5KSAD 4DVRH 5FYKL 4ZG1A 2DTML 2WP3O 1IKNC 5GIRB 1Q1JL 3DV6A 5FKAB 4NPYA 1C16B 1EGJL 2UZXB 2YUVA 5HYJB 3KXFD 8FABB 1TCRB 3PJSB 4JVPA 1B0RB 5FUZL 5JR1L 1U3HC 3KAAA 4GO6B 4GQ9L 2OK0H 5GXBB 4Z7UE 4GKNA 2AK4E 1AGFB 4S10A 3ARGB 3VA6A 1V7NL 3KR3H 2BSTB 4UILH 4ZS6D 1T3FA 5EOTA 4PJXE 4WW2A 3HG1D 1DSFL 1OHQA 5T5NF 2ORBL 2CGRL 1WZKA 4JG0L 3ZHDA 3TO4A 5TGBA 5DHVA 4UAOB 3VDAA 5DJAB 4UDTA 4DFHA 1OLLA 1J18A 5JQ6H 4XWGH 5IBUG 4IJ3C 4U1SA 4X98B 3O2DA 3I9GL 3VGEA 4U1JA 1MELA 4R2GB 4NZJA 1Q8MA 4NGHH 1T83A 5F8QC 1MFEH 1WJ3A 4RFEA 1A7QH 1S9VA 3OKNB 1X7QA 5EU6B 2WBJA 1EHNA 1F42A 1W72A 3DV4B 4FNLH 2OZ4A 4W70A 5DT1L 1FJ1B 4LMQE 4NM4H 3MRCB 4GJTB 5DJZA 4R97C 2QTEA 4I18C 3TCLA 1W0VA 3MV9B 3SGEH 4KGLA 1T0MB 2ICWB 4IRSC 3KPRB 4S2SA 4NPYB 2EDDA 4P59L 1FAKT 3W5MA 5CILL 1V3KA 1FP5A 1YC8A 4PJFE 4K3GA 2I27N 2FJGB 3AB0B 1IILE 4HF5L 1FNFA 4WV1B 5DEZA 5BJTB 5C8JA 3VI3F 1NDGA 2DQGL 3HZKB 3TNMB 2H2PC 5IOPA 1CF8L 4FQIL 2GK0A 1U3HA 4KVNH 2X41A 4QHNB 5I19H 4QCIB 1KGCD 1TQCB 1C5BH 2YPLB 5TGBB 3OL2A 4IIQB 4LLUB 4HSQA 1S7QA 3JVGA 5HPOA 4HPOL 2R8SL 4FQXB 1W0WA 4ONFL 1HKFA 4P4RB 2NY1B 3KPMB 1TNNA 3HPLB 3F7YA 5FOBA 4PLJC 3X14B 4F2MA 4UMGA 1VGKB 4W81A 4PJFA 3SDAB 3Q1SH 3ZSTA 5IGXL 2NY5C 3ZHLA 3Q6FA 4L1DA 4YFEA 2VERN 2WBJD 2XZQL 1CE1L 1CICB 1MEXL 1KLUA 4TYUA 1RZ7H 2A73A 4P48A 5DJDB 3VG9B 4OF7A 3U1SH 4YHIB 3BD3A 4EKXA 5E2VL 4GRMA 4XBGA 2R0LH 3P0VL 4Z0BL 3TZVA 3WIIH 3KPNB 1UVQB 5DTFA 3GMNB 5E03A 3WLWD 5AYUL 1A9BB 4P2OA 1GGBL 3KJ6H 5ERWB 5I76B 2FR4B 1S3KH 1MRFH 4QRQB 3IDMA 4GT7A 4NBZB 1YJDC 4HFUH 2NY0D 3HAEA 3KPPB 4KU1A 4N0CD 5C2UB 3VFOB 4FQJH 5FYJD 1EHLH 3PL6B 4TTDD 5I8OL 2R1YB 4MCZA 1AFVL 5HHOB 3SJVB 4GAGL 3HE6A 4A2MA 4H25A 1RY7B 2HN7A 3ARBA 3BPLB 3QUMH 3VFSA 1N8ZA 4U6VH 2AP2A 4NKDB 1E4KA 1J8HB 3MLPA 1WFOA 5E5RB 5BO1L 3S36H 5TDOB 2R56L 3QIUB 3HTLX 3ULVF 1U8OB 3RL2A 3ZDYF 1EEQA 2AERT 5DRNA 3BDYH 4Q9QH 1L6XA 1PAMA 1QFOA 4KFZC 1BM3L 3QIBD 1K2DB 1IGFH 1IJ9A 3W39B 2X4PA 1QBAA 3BO8B 3F12B 1D5ZB 4PRNA 1AQKL 3MCG1 1D5IL 4EN3B 3D1MC 4KRLB 1MIMH 2DLEA 3O11B 4POYA 1VGKA 2CPCA 2X7LB 3SKOB 1KJ3H 2YD3A 3BP5A 5DJXA 2G5BB 1E28A 1MCCA 2AI0L 2CXKA 2ZOKA 4LCUB 2PO6C 3VGFA 1ZEAH 3VWJD 1BJ1H 1S7VB 4HIJA 4KHTH 2DAVA 5D5MF 2VDRL 3IFPB 4YUEH 3IETA 4HJJL 2BY3A 5A3IC 2R0WL 3F12A 1S5IH 1JP5A 3IXAA 3LSOA 3FT3A 3ARPA 5C0RL 4M4RA 3W9DB 4WIQA 3PWJA 3IXTB 1DUZA 4GG6B 5DJCB 1RU9H 5JZ7C 2NY1D 3VXQA 1TTUA 4YJZL 1OAXL 3VFPB 1Q9WA 2HWZH 3BW9B 1JFQL 2LV4A 3VFSB 1RZKC 4OKVA 1JPGB 2BNRE 4XC1H 4K7PL 4M93C 1ZEAL 4O4YL 5GGUB 1W72H 2J7LA 3FT4B 5ICZB 3ZKNC 1TITA 3MLVL 4Y4HA 4MLSA 4WFED 4EI6A 1I8IA 1ZSDA 3I75A 2A83B 3QPXL 3SCMA 2VOTA 2C7UB 4AQOA 4NC2B 1MY7A 3TYFA 1JGDA 3TO4C 3WFBH 2NYYC 1RK1A 4OGYH 4YPGB 3L6FB 3RP1A 3U4EA 2BXZA 4MGXA 5C0DB 2F8OA 3VFGL 1JNLL 3MODL 1ZAGA 3U36B 1Q9LA 1YEJH 4U3CA 3MV9D 1AQDB 5C0AE 1N0XL 1UUSA 3ULSA 1CGYA 1YEDA 2OP4H 4GRLA 5C0AD 5IFJB 1MRDH 3D2UD 3WFHB 1BOYA 1XMWA 5IBLC 3TV3L 1OM3L 1U8IA 1FZKB 2ZCHL 1NCAL 1HXYA 3VE0A 5I1IH 3QPQC 3FB6A 2PXYC 3QDGA 4KK8D 4L9LC 3VI4E 2VR5A 3PP3H 4G8EA 4NP4L 3CPLB 1FC2D 2Q20A 1S7WB 3BZEA 3L3IB 2APTA 4GOSA 5L9DL 5ENWA 3FTGB 5FFLA 1NUDA 4P4RA 3JVGC 1DJSA 1SJHB 4YBQC 2XQYK 3QDAA 3WFCL 1L7TH 3DVNA 4N0UB 5L2KA 1S3KL 3H9ZA 2BFVL 4CADB 5IM7A 2HFGL 1A47A 3P11H 5AYUH 3AS3A 5ISZD 2RFXA 1ZLWK 3U4EB 3FCTB 2Y4SA 5TH2A 3RDTB 2FJFB 3DRQA 1UB6B 3IFLH 1M6OB 4Q9CA 4XC3H 3R06A 3ZL4H 4OI7A 4NT6B 4I1NB 5IUSA 1TZIA 3C6SA 3T0EE 3MCLL 4FQHB 2BNQE 3SY0A 3OAZK 4L8DB 5IR1B 3Q48A 4AK1A 1A7PH 4YBLB 4I3GA 4LCUA 3N1GC 5CJQL 1MPAH 5DR5L 3IGAB 3RHWK 4L8CA 4LRNL 2XQBH 4JM2B 5T3ZD 5E8NB 2Y9RT 3AS0A 3EZJB 2YHGA 4CNIB 3HPJA 5EU6D 4NYLA 1MCSA 1TQCC 5GRZA 1XGPB 1S8DA 4IHOB 4XNUL 1H3GA 1WSST 1AC0A 4JG1H 1OP3H 5IB5A 4FQXC 4CUCA 1P7HL 5FEBA 4MA1B 2JIXD 3L5WA 1ORQA 1CDUA 1MREL 3C2AL 4MJ2A 1C5CL 3T0WA 4RGNE 4JJ5B 1JN6B 5CEZL 5CZXC 3SDAC 3MTRA 5KSUB 3ULUH 4JY4B 1EFQA 3M17B 1FVDA 2PN5A 1CDGA 3U0WH 1MJJB 3B5GA 1MVUB 3UBXA 1CDCA 5IEHB 1R5VB 4KJPC 4GG6E 5I15L 4LVOC 2BNQB 1XAUA 5F7HA 5TDPB 4JFXB 1NC2B 2GJ6E 2ZNXA 3STLA 4O51B 2NY2C 4TQEH 5DJ8B 3FO0L 5IB3A 2CSPA 4Q2ZB 3EDEA 4LF3A 5SV3A 5CS7A 3EO0A 1J1OL 4W68A 3W82A 5L6YH 3C5JA 3P4NA 2HAZA 4JY6B 5HVHB 2P8LB 4EOWL 3C09B 3DX6B 3MJ9A 4LCWE 5KZCB 2EH8L 5ISZB 1GH7A 4Y5XA 2IGFL 4NQVA 3ARBD 5C08B 4F15B 1Z5LA 1KXVC 3CH1A 3N1PC 3QG6B 3O45B 1YPZE 3I9GH 1AKJB 2Z4QA 43C9B 4XNMB 5E5UB 4E5XB 4YDKH 3NGBC 5EB9A 3QO1B 1FBIH 2OR8A 4MXQD 4A6YB 3V0WH 4PIRF 1T7YA 2V9RA 1M7IA 2XICA 4LOUD 3S35L 3T1WA 5T3XH 4KROB 2CGRH 5J3HC 5F1IA 2QQKL 1J0HA 1LEKB 4JY5H 4FQXA 2CLZA 5GGRB 1JRHH 4MJIE 1Y0LB 4YZFE 4LCWA 3GIVA 1UCBL 3RA7L 3ARDC 2GJ6B 2VZSA 4FQLH 2OL3L 3MMEA 4M03A 4QHNA 3MV11 1E4JA 1E28B 4RFNB 3V6OA 1A7NL 3QUZA 1XGQA 4XMLL 3WFEH 1WWBX 3VG0L 5D6CB 5DFVD 2DD8H 3KPSA 4GRLC 1OGTA 2F54A 4ZOAA 5B3NA 5JUEL 1MCKA 3HKFA 4K94L 4Y16A 1D5BA 4MAUL 1RUPH 3PF2A 4EBQL 2MPAL 1SYSB 2HJFB 1LD9B 2IBZX 1GGYA 1PD6A 4XP1L 1D5XA 3QR2A 5EU4A 4S1SH 1NEZG 4QKXB 1NEZB 3QI9A 1MCNA 3S88H 4J3XA 1JK8B 1YEHL 4ODXA 1KIRB 3RNQA 1QNZL 1FNEA 2XRAH 3LEYH 5D71H 5HDLA 4H26A 4UTAH 1BX2B 1AJ7L 4UT9L 5H37H 2ED9A 1WAAA 5I30L 4ZS6C 3DXAE 3SJVA 2LE9A 1MSPA 4JVUA 4U1MB 3GHEH 3LMJL 2LVEA 4G3YH 2F54E 2CR3A 5D7SH 3RWFA 5F8RC 4QRSA 4UV7H 2EYSA 1OWWA 1J8HE 1YDPA 4P23D 4IRJC 3OF6A 1MCIA 4ENEC 2RCSL 4TSCH 3QCTL 1QPPA 1CZ8H 4WV1A 2H3NA 5D2LE 3TH2T 4X6CE 2ENYA 3BMVA 4DQOL 1MQKL 3QUXB 5IQ7L 2GAZA 3LZFH 4MS8D 4NRXA 3T4AB 3SKMA 1MI5D 2YD4A 5IVOA 2N7BA 5EU5B 1MCPL 1Z9LA 1HILB 4GMTH 3GEWB 5E8DH 2VC2H 3NA4A 1PSKL 3HMXH 4HZAA 4MA3B 5CP7B 3DOSA 1U95B 1I1FB 4G5ZH 4DAGH 1PYWB 1SEQH 1YMMD 4H5SB 2LABA 2W60A 4Y7MA 4P2RD 3ULUE 1F4WL 2IFGA 1PLGL 2HMID 2ED8A 4YZFF 3TBYA 5EUOF 5ID0A 1JYVA 3RGHA 2AVGA 2ZSWB 5E24E 4LLYA 2NXZC 4PR5A 2VDOL 5E8PB 3BP4A 3KPQB 5LBSH 1U3HB 3A6BH 3QUYD 2ZCKH 1G9NC 3RWDA 4NKOB 5FO8B 2PNDA 2HLAB 3D18A 3MLWL 3O3BA 1DVFA 4RMSA 3E0GA 1XF3A 1HINL 1P84J 1FQ9C 2F58L 4PJ5E 4XNMA 5DRZA 4KKLC 5C3TA 4YXLL 1EEZB 1KJ2L 4L3ED 4ZUUA 3IB4A 4HKBB 1OY3B 3CLEL 3TJEH 2JE8A 4RQQA 4HUUA 1N7ML 2QQLH 5HYJA 1FNAA 3P2TA 5FHBH 4UIMA 4OD2B 3FAXA 4JDVA 4JM2C 4YHPA 4ODVL 3RQ3A 5CD5C 4WEBL 1I8MA 4C4KT 4LLDA 2HJLB 1ZS8A 3CDYA 4RAHA 2CIKA 3WMSA 5DD5L 4OCMC 1MFDH 3SOBL 4AH2A 3IJHB 5BW7A 5CGTA 4LVHB 4XP6L 3SBWC 2ICCA 1IGCH 5F7EH 4TTDC 4C56B 2CKBA 4PS4H 1T20A 4UQ3A 1NCWH 3OXSA 1ND0A 2EICA 4LKCA 1B4JH 2WAHA 4BQCA 4R4ND 5J6GA 2FO4A 3UBXI 1S7TB 5IMOA 4QGYA 3ZZ1A 4WW2B 2Z0BA 3CVHB 1F4YH 4HDIB 3T0XA 3BN9D 3J7HA 1YNTB 4OD3L 3O4LB 1KTDB 3MJ7A 5MEOA 2BNUB 5DRWA 4OZGF 3PHQA 4X0KB 2WIIA 1QYGH 4EDXA 4PG9A 5A43C 2ADJA 3RTQD 1DFBH 5I2IB 1I1YA 5L8LB 4A2LA 5EIVA 3CSBA 5MEPA 1BIHA 2DQIH 4X5LA 1HQ4B 5FO7B 1J1XH 2VN7A 3X12A 1SMAA 3WJLC 3EO1B 3NCMA 5E2WH 3C5JB 3VH8G 3HNSH 4LEOB 4TNWF 3FQUB 3MXVH 2X4QB 1BVOA 2ZJSH 1MFBH 1GJIA 5JXAH 3UYRL 5DJ6B 1S78C 4OCSH 1CFVH 1U3ZA 1X5HA 25C8H 4ZUWB 4YHOL 4PJFF 1IKFL 1BQHG 2HTKC 1NL0L 4ZFOB 2J8UB 2GT9B 5ICXA 2LQRA 3C5ZA 4P4KB 2XWTA 1MCOH 3BIKB 4HKZB 4WI6A 4PJEF 1CFBA 1FVDB 3O6FA 2Y36H 2NLJB 5TQ2L 3DVFA 1E4KC 3N1FC 3U4BH 3V2AR 1MVUA 5FGBC 4XCFH 2F53D 2Z31B 4FZ8H 1WIUA 2EE2A 3FZUD 4R7DB 5GRWA 4L5FL 3EAKA 3K0WA 3CCHB 3OQ3B 1EERB 2ENSA 4KUCF 1RZJH 4FMKA 2W60B 1S9WA 4K3JL 4NCDA 1DBAH 1U8KA 3LEXB 1MFCH 1P9MA 1FNEB 1AIFA 4OZHB 5I66A 1Q0XH 5ADPH 5EZJA 4TUOB 2IANE 4P9HH 5I8CB 5L7XH 2PYED 1FL3B 3NIFF 3AUVA 1EJOH 3HG1E 1XF4A 4G6AD 2IAMC 3UTTD 3RTQA 1M05A 3QWQB 2XTJD 1UXSA 3C9NA 1FLRL 2P5WD 4ONOA 3UTOA 1KJ2B 3HI5H 1CK0L 4WNQB 3U6RA 1YY9C 1FGNH 1L4IA 3SDCB 3X11A 3MUGB 5E6YA 4HXBH 5CHNB 3ZT7A 1JHLL 5EOQH 1JPTH 4PJXF 3V4PH 4OF5A 3JBG7 2EEAA 4ZQKA 3VXNA 1FN4B 4WUUD 5D96C 1S7XA 4X4ME 2EXYC 4JKKA 3C6LC 3RGVD 1UB6A 3MXVL 4WFGD 5JXEC 2NY6C 2FO1A 5ICZA 5AWNL 1I3GH 3I6GA 3AGVA 4X4XA 4GXUN 4XAWL 4DKFH 2RB8A 2CKNA 5DHYB 5D2NB 4XXDA 3RX5A 1U41A 1XH3A 3V52L 3WKNA 3BP6A 5C0BA 2X4QA 4JDZB 2FB4L 3SKUD 5D1XC 2Y23A 3I2CH 1QYGL 4F9PC 4H1LB 4NKMA 2W0FA 1NMCB 1S5HA 4U05A 1FZKA 4NWUH 4P2RA 5J12C 5K9QI 1M71A 1U8LA 5CEYA 2H2SC 5DHYA 1VFOA 3RWEA 1PEWA 5KS9B 3NN8B 1HHHA 5LAXA 4DJMA 4HS8H 4QLRA 1N64H 3Q5YA 1HSAA 5J1AB 2FZ3B 4B41A 3LDBB 5J4MA 5EO9B 3KPTA 4I9WE 3V7AG 1VADA 3HNVL 5EG6C 3O9WD 5C0BE 4XXCC 3QCUL 4WEBH 2A6DB 1A8JH 1JL8A 4IMKC 3L5XH 4JCMA 3WEXB 2XKSA 4Z7WF 4XPBH 4V2CB 3RFZC 4G6JL 3MREA 5I74B 3LN4B 5KVGH 1JPGA 3S3PA 2DTSA 2CIKB 4QNPF 1RZKH 4L9LA 1S9XB 3CDCA 3AREC 2NY0B 1DDHA 1XGUA 4KKBD 3G5YB 2W0PA 4LSSL 1OTSD 1BAFH 4M61B 2VLRB 1F8TH 4OCXH 1IAIL 1QBML 2D4FA 2D7QA 5I1GH 3EYQC 3VXOB 3DSNA 5ISZA 4X9FA 4IHOA 5C92A 1J7VR 2H8PB 4JO1H 6FABL 1U8KB 1XGRB 2DI7A 3BKCL 3MLWH 2V5RA 5DFTA 1KTDA 3VWJB 1OTTD 4NHUB 3WV0A 4XVUC 4NQTA 1ZA6A 2A1WL 4P0DA 1IM9D 1K3ZA 3MROA 1A6WH 3BQUD 2P24A 5ITBH 3QDJA 4RIRB 1AH1A 4F7MA 4HWUA 5EOCL 4OV5A 2P5EE 2X4TA 2DQJH 3Q2CA 2QKIB 4I5BB 2VIRA 4FXKA 1CD8A 3ZKSD 2FIRT 2IQAA 2DDQL 4JZNB 4LHQB 3O3AB 4JRYE 4YPJA 4AEHH 1CD1B 5DTFB 4I2XE 1QR1A 1PKOA 1EDQA 2Q6WA 4R2GC 4XNZC 3RHWF 4CMHC 4OIAA 5HYEA 4U1HB 4JJ5A 2VDQL 3P0YL 5DD1L 4R4NC 1N2RB 5F21B 1PYWA 1OF2B 4J4PC 5HGHB 3HCVB 2O5YL 2AV7A 3HUJE 2COQA 5SWZB 4J8RA 1BJ8A 2XKNA 1M7DB 1T1ZB 1JRHI 1MCQA 2QR0B 2AJ3B 4ZSOA 4P5MA 4LCCB 5HDBE 1FO0L 4ZNEA 4I13B 1KCVH 4M6AA 3VA2C 3OJMB 4U0RB 2L7JA 2QLVB 3KPMA 3TFKD 2LFGA 1CLOH 4U6XB 3HI6H 3BUYA 3ARYA 2GUOB 2X1XR 3RPKA 1QFPA 4MJ6B 1EZVX 4XMKL 1AR1C 1A7OL 1CDIA 4O02L 4Y4KB 3D0VB 1I7ZB 4N0FA 4Z7VE 5FF6B 1RK1B 4KK6C 4NQCE 2BHUA 2EXWD 3L5IA 3QEQB 3V4UH 1XCQB 3QRGH 5DMKB 4OUUA 3MUZ1 3QQ3A 3W2DH 5I18L 3BWUC 3HFMH 2EDOA 2VDPL 4Z7UB 1R3LB 1I9EA 2OZ4H 4MD4A 1ES0A 2IALB 5FGBA 1JF5A 5DFVC 1FNLA 1BGXH 3GMQB 5SWZE 4KJWD 4WTXA 3DJ9A 1J0YA 4PTTB 3Q6FB 3LN5B 5JUEH 4Z18A 5C9KA 3QNXB 2CIIA 2D31B 3ILPA 4M6OL 3SKMB 1FIGH 1HWHB 3O41A 2L4OA 4OI8A 4ZYKA 3B2UC 3RRQA 5KS9F 1U8NB 1DQJB 5CFHA 4YC2C 1OT1A 3KYMB 3FOLA 1OCWL 3BKYL 4GH7B 4ETQB 2VAAB 3DBXA 1JMXA 1TNMA 2EO9A 1A4JA 4XZUA 1NAMA 1LO2H 1NFIA 3F58L 4IRJA 4JLRB 3B6SB 1WFUA 3V6ZA 3JV4B 1RZKL 1MIEL 3QQ9D 3FT2A 5DZOA 2K7PA 5IOPB 4TPRL 5MERA 1Z9MA 2JCCE 5F96H 3D85B 4DN3L 1PEZA 1KELH 4XPTH 1EHAA 3BPOB 4E0RB 3RY5A 4P5TB 3AREA 2FH8A 5JW4Q 4H26B 5JXEA 5FGCB 2EDTA 1LP9A 3N0PB 5INDA 1HH6B 4XVTL 3RX8A 3QNXA 1LO3L 3MCKA 1HHKB 4H1LH 1U91A 3LH2H 3P40A 3PXJA 5D7LD 5D96B 1BFVL 1LEIA 4X6DF 3V79C 1Z9OA 2DBLL 4RGOH 1FE8L 4L4TD 2GFBB 3D48R 1KLGB 2Y6SC 3JWOL 1N6VA 1TZHA 2MJWA 1VERA 1G6RH 4V1DA 4KPHH 5DJYB 4ZFGH 3BWAA 3JWOH 5DD3H 3MO1A 4RGMC 1U6AH 3V6BR 5DEGB 3SE9H 2DN7A 2BNQD 1ACYH 3P0GB 2IPTH 1LILA 2R1WB 1NMCC 3FQRB 3QUYC 5DUML 5MERB 3IDXH 4MA8L 5J12B 3V52H 5DJAA 4BH8B 3T77A 1S7VA 2R4RH 1TPXC 1I85A 3G6JE 3HE7A 4EN3D 3CAFA 5E08H 4OGZA 5EU7E 1KTLA 1KB5L 4GG6F 3RWGB 5DRXA 4JFED 4FTVD 5F96L 3MQIA 3D69A 3LB6C 4XPGH 1T0PB 5DC4B 3BYYA 3M17A 3O6LL 5KZCD 4HXAL 1C12B 3M8OL 4D0CA 4V1DE 1JTOA 4U2ZA 3HG1B 5EBGA 5D6DA 4J4PA 1TMCB 5JW5A 3QFJA 2XPGB 3CFEB 1CDBA 1TZHB 1UA6H 2EEBA 4ZO6A 5TJWK 5J11C 1ED3A 1SY6L 2DQEL 3RY6A 4JM2D 4H88L 4X5WB 5CLTA 1LO0L 4OLEA 5EC1A 2GY7B 4ONGL 1F4XH 1YECH 2VDLL 5GGRY 2X10A 1NMAL 1UA6L 1WITA 2VXUL 1CIUA 3FFDB 2GTZA 5E94A 4YHNA 1DVFD 5BZDA 2OL3B 4ZFFB 5ADOH 1VGEH 3FO1B 3IAPA 5JDJA 3BKMH 4H1LG 1V7MH 2GJ6A 3H0TB 2EEDA 4YFLF 5KVEL 4PJ9B 2ZPKL 2DQTH 4JQIH 1L7TL 1I1AA 5E08L 3MLZL 5ABDE 1DQLL 2RFXB 4X4ZA 1ZHBA 3U4BL 3I3BA 4Q0XH 5CJOL 1KEGH 4LIQH 2X05A 5D8JL 1WEJH 2Y36L 3GMRA 3QUYA 5EUOB 3Q6GL 3PP4H 4LLQA 1DBML 2WUBL 5CGYC 1YYLL 2Q76B 1FLTX 1MI5B 1B6UA 5I1IL 2A6IA 3T04D 5B8CA 2XACC 1KPVB 4X7CC 1ZT7B 4OCSL 43CAB 2VXSL 2R29L 4KPHL 3V6FB 2FHFA 3B43A 4KTDH 5CKAA 1MFBL 2ZJSL 3MODH 3HPJB 2BCKA 3IU3A 3PWPA 4CKVX 2VZOA 1OAZH 3KPSB 1KCVL 4MJID 2WWKT 4M5YH 1C12A 5D6DC 4KZDH 4JM2A 1SM3L 4LNRA 1ES0B 2Q7NA 5GSRB 1IM3B 4XB7A 5DRXB 2QHRL 3RZCA 3QPXH 3ARXA 1NFDA 3LQZA 1R3HB 3QAZB 4QY8B 2BSSB 3OB8A 4NKIH 3P0YH 4QEGA 2P43B 3CDGA 3OKMB 2D0GA 4JCLA 1JGDB 5DO2C 1JTTA 4GMSH 5CCKL 5L0QB 4U0RC 4NZUH 1F4YL 3RDTC 2YUWA 4M7LL 5F7FA 3FFCE 5FYLD 5M95B 4CU8A 3PWNB 4YIQB 4DGVH 4YBLC 3FB7B 1RU9L 5DEFB 1KJMA 2Y1VA 4OLYL 4YDIL 1CLZH 3AXLB 5BCAA 1PZ5A 3REVB 5GGQL 3GSXA 5C0CB 1UH3A 3QDMA 2I07A 3UTZA 1NUGA 3EOTL 3QG7L 2D3VA 3DXAD 4CU6A 5KTEH 3UCRA 2W0FB 3QDGE 4M6OH 5KN5B 5C0GB 3DROB 4I18B 2QQNL 3CVIL 5HHQA 1KB9K 4HKJB 2VDNH 3ZKXB 2ICWJ 3RKDD 1IC4H 3FFCA 4PJAB 4LSSH 1VFBA 4PGZA 1ZVSA 5H35B 5CEXB 4U1JB 2K1MA 1IAKA 2KZ1B 5JXED 3MRRA 4X8XA 4PD4K 3BSZL 1CLCA 4XH2A 2XWJA 3HC3L 5JLZA 4W4OC 3IDUA 3QEGH 3RWCA 3U6RB 1AQKH 4LSDA 4LVOB 5IHLB 2PYEB 4Z78B 4C83B 5IW6B 1EJ6A 4F37K 1BD2A 3L1OL 1WAAF 4PV9B 3QHFH 1CQKA 3H3BC 3V8OA 1CI5A 4YGVB 4PGBA 2B4CC 1S7UA 1P9MC 1Q0YL 4ODSH 4PYHA 1EIBA 5TF1L 1B90A 1UB5A 1FNSH 4MDJB 1H5BC 4G43A 4AG4L 3QDGB 3LEXA 1UM4L 4PJEA 4ZUSB 3ULUF 4ODUB 5E99L 1T5WA 2GJJA 4R3SA 5B22A 3LKSB 1GVIA 1T0NB 1PSKH 2CLVA 2D2OA 3HMXL 2E7LA 2VC2L 5KSBF 2DQCH 4RMUA 1MCJA 1XIWC 4QHLA 5EO1B 3NGBB 5FB8A 1FZMB 4E41B 4FRWA 4Z7NF 3I2CL 2RIKA 1H3WM 2H6PA 4JFHE 4Y89A 2AK4B 1NGXB 2V5MA 4NJ9L 4WWKA 5AUMA 3T0ED 1VHPA 2CK0H 1NCDH 3DMMC 3PL6A 5BV7B 2FSEA 2CDEB 1E6JH 5I1CH 2UV3A 2UVFA 1T4KA 5D1ZD 1PX3A 2AXFA 2R9HD 1SEBA 3M07A 4AIOA 5F9WC 5DD0H 1RQ5A 5EU6E 3TT3L 2UWEA 5IESH 3GSVB 3K46A 5MEPB 2VKWA 4KKCC 2RAMA 4YNYA 3F5WB 5DHXB 2FEEL 3L9RA 4OZGE 4PJHE 3FRPA 3KGRA 5DRWB 3TJHC 1AJ7H 5E00B 3SBWA 3VCLA 1RUMH 2FD6H 2B2XH 5E4EB 2WUCL 4PGEA 4PJDF 3G5YA 3E2HB 5T1DH 4PJFB 3RVWC 4RMVA 3SDAA 3V0AC 4JAMB 1FO0A 3IDNB 3QO0A 2QADB 3QIWD 3EHBD 3NH7H 2MPAH 3UAJD 5CZKA 4FQCH 5DD6A 4EBQH 2IFFL 4NQDB 1JBJA 4G8GE 4QRTB 4PUBH 2YPLA 3ZTNL 5JDSA 3TVMC 3U0TB 3WUZA 4L5FH 4CJ0A 1X4YA 2G5BA 2NQCA 4Y5YC 1BZQK 3QUKB 3IT8D 5CILH 4PJHA 5TQ2H 2XY2A 1F02I 5EOCJ 1QD0A 4FFWC 4PJAE 3VFTA 1N3NB 4I8DA 2QQQA