4Q9BA

Ignar antibody domain c2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
101
structure length
101
Chain Sequence
SEIAVLLRDPTVEEIWIDKSATLVCEVLSTVSAGVVVSWMVNGKVRNEGVQMEPTKMSGNQYLTISRLTSSVEEWQSGVEYTCSAKQDQSSTPVVKRTRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Novel antigen receptor
publication title The structural analysis of shark IgNAR antibodies reveals evolutionary principles of immunoglobulins.
pubmed doi rcsb
source organism Ginglymostoma cirratum
molecule tags Immune system
total genus 19
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4q9bA00
4YNYB 2WNGA 2GJZB 2A9NH 3PGDA 2DLFH 2UY7A 2X1QA 4Z7WB 1BM3H 4UT7L 4DKFH 4X8JA 3W9EA 1DUYA 2FECL 3ZTNL 3MJ7B 1FIGH 1I9RL 5MENA 1YUHB 3B8YA 5EU5B 3U9PL 1FC1A 3MOBL 2NY0B 4ODVH 2AK1H 5BV7C 5K9OA 3JV5A 3ME0A 1DVFA 4OZIA 5JQHC 2F54A 2YD1A 3OKLB 4LRNL 3FT3B 1NBYB 1G9ML 3HNSH 3PGCB 3Q6FB 1OY3B 1JGEB 3DSFL 4OZHF 5E94B 3MCG1 3HC3L 1RSFA 2QQNH 3GMNB 2P5EE 1DANT 5F3BB 4HD9A 4PP2B 3T09A 5IR1A 5FO7B 1CTNA 2PTUA 4PRNB 3T0WA 4PP1D 4HHAA 2GJ6B 1UQSA 1T04A 4K7PH 4KDVA 1TZGL 3HMXL 4NRXB 5EN2B 5C09B 4K23H 3LQZA 4OQTL 4J3UA 3G5VB 3WO4B 1H8OA 1KCLA 1AQKH 2QQKH 2J1KA 4OGXH 1KPRB 1MCSA 1CICD 1WLHA 1YEGH 4M5ZH 4XGZB 1L6ZA 1QFPA 2EXWC 3PABB 3NCYP 2OL3L 2X40A 3B3IB 5IHUH 3DV6B 4RWHA 5DD6A 4U1MA 1A5FL 3O6FC 3L3JA 3SBWA 3A0OA 5GGVH 3BT2H 4CADA 2ARJA 1T3FA 3NCFB 4ALAH 3MRQA 4O9HL 1S7TB 2Z35A 1FFOB 2D03L 4BSJA 1I1FB 5C0CD 4LF3A 3D3VD 3LEYH 3FT4B 3KXFA 1SJEB 2OZ4H 4PV9A 3O6ML 2BSSB 3TWCH 5C08B 3IDUA 3WE6B 3DOSA 1CE1L 2V9RA 1J10A 4Z0XA 3BXNB 2HVKB 1U8JB 4NQVA 3W5MA 4LLUA 2FNBA 3JWOC 4PD4K 3QIUD 5IW3A 5HBBA 2YUWA 2M1KA 2VN4A 3CDFA 5KSAC 2NYYC 1MI5A 2VDRH 4NKOB 4XPTL 1I1AD 3VG0H 1RUKL 1R5VA 1EFXD 1WWAX 3QIUA 1VACA 4LQFL 1BX2A 1F90L 1BZQK 5HHMB 2XWBB 4TQEH 3X3GL 4KJWD 3TNNB 3QI9A 3UTPD 4PJCE 3PIQA 3DYPA 2EE3A 4JR9L 2GT9B 2XTJD 2ZCKL 4YWGL 5JA8B 1FNEA 1D6VH 3RWHB 1UWXH 2YPLB 2OBGA 2GTWA 5IVXB 3LY6A 4F7EB 3U0WL 4WFFD 1D5XB 4BFBD 5LXGH 3L3OB 4LSPH 4LVNB 5JQ6L 3U36A 4PB0H 1D5ZB 5TQ2L 4LHUB 1Y18A 3F6IA 1OW0C 4Z7UA 3DIFB 4LVHC 1VKXB 3I02A 4MQXC 3U1SH 4PRHD 2VE6A 1NSNL 3SKJH 2DQGL 5DT1L 4QXTA 2FIRT 1YYLH 1WAAE 5KZCD 2AJXH 4MWFB 4A2LA 4KU1A 2R8SH 2V2XA 4G9FA 1EMTL 3BEVB 2DJ4A 5TE7L 1EZVY 1PAMA 1X5IA 4GW1A 4P9ML 3SE8L 3HLAA 4WUUE 4PJAA 4F37F 1D6EA 1CGUA 4YHIA 4AQ1B 1GC1L 2APBA 5GS0H 5D71L 3MREA 3DBXA 1J1OH 4TUOB 2VC2L 1DBJH 3NAAH 4HKZB 1T83C 2FSEB 1GIGL 2YEZA 1CIUA 5EO1B 1LK3H 1KT2B 2BNQA 2DTSA 2NXYB 4P3CL 2YC1B 1HILA 4XP4H 5E6ID 3IDXH 2JF1A 4YAQB 3MRCA 1NANI 1RZFL 1I8MB 2P5WA 3MMEB 4QWWC 3GIZL 4JCLA 3B8SA 3X12A 1U93B 5JTWA 3IF1B 1J0ZA 1E27A 4IRSC 5B38B 1UEYA 3BYTA 4L3CB 5IFAL 4I0PB 2GITB 5DK2B 5E6IA 3U6RB 4RRPA 3GSNA 4PJGE 3QG6A 3RWEA 3MCKB 1Z9MA 2DQUH 2OYPA 5B38G 4I48B 1VA9A 3PP3K 3CFKA 4WI5A 3ULVF 3PGFL 4GSDL 1EO5A 5DMJB 4BQBA 5MEOB 5F7EH 5C0ND 3AFLA 1VGKB 3H0TA 2Q1EA 1A6AA 4J3VA 3PQYB 1XGRA 1UYWH 1VESA 1ND0B 3C2AH 2ICES 3BVNB 5IV2A 2UWEE 4LPYA 4FS0A 4X0KA 1A7RL 1C1EH 4OZGA 2DQCH 1IAMA 2NY5H 4NQUA 3LKRA 1NCCL 4FMKA 5D7JC 4Z0BH 5DRZB 3W11C 3OHXA 1UKSA 2L7UA 3BGFC 2KPNA 5DJXA 1DBBH 2VOTA 5DJAA 5JHDB 3T3MF 5KG9B 2X1XR 1L9NA 5KSBF 1FVEA 2X4UA 2BVPA 1MJUH 3MODL 5SWZA 4GFTB 5IF0B 1HNFA 4EOWL 1MRFL 5TPWL 2IAMD 2NZ9D 4Q74A 2MOVA 1MHEA 1WUNT 4MNQD 1J8HE 1E4XL 4OLVL 4DGYH 3H9SD 4WFEE 5TE4H 5E8EB 1BQUA 5DQJA 2OK0L 2YK1L 3ARFC 2F58L 3CLFH 2DKMA 4KY1H 2VDQH 4R26H 5C1MB 5BZWA 1JGDA 1YMMA 3IDJA 5CZVH 3EFFB 4MNQA 3HE7B 3H9SA 4ZO8A 2XRAH 4K71C 5F1IB 2AJVH 4ODHL 2A0LD 4U05A 4W6XB 3PWUB 4I2XE 4H8WL 4QOKE 2HFFA 2I60H 2E8ZA 3Q5TA 3GIVB 4G9DB 5HVHC 1DQJB 2Z4QB 4HK3J 5I66A 3QUZB 4TSAH 1NDMA 3RIAK 2XPGB 4UDUA 4J3TA 2ZUQB 3MV7B 3RHWK 1A4JB 5IEHB 5DRWB 2R39A 5ESVB 1OM3L 3AMKA 5SX4I 3LN4B 2PETA 1SMOA 4JN2A 4XWOD 2Y1VA 1FYTA 3X3FL 1CLZH 2QR0B 4GJTB 3TZVC 2PYFB 2Y4SA 3FO9B 4OZHB 3N85L 1MNUL 2A77L 2BVQA 1WT5A 2PW1B 4XPAH 3JWNC 4LEXL 1GC1C 1A6WL 3CCHB 3CUPB 3LDBC 4LU5H 5EPMB 3U2SB 4OTXH 4Y8AA 4C83B 1T1ZA 3H42H 3HB3C 5GGRB 3NIFF 4OLXL 1W8NA 2W1NA 4U0RC 3EYQD 3AROA 4DKEH 1X5XA 1TETH 4KTEH 4RDQG 3PWPE 2EH8H 3DMMD 3LCYA 1UKQA 2Q3AA 1GGBH 1YEEH 3QDGD 4NO0D 2R4SL 2ZUWA 2XA8H 4K94C 2ADFH 3WFEH 4U1KA 5FFLA 1QFHA 1WFOA 3T4YB 3SKNB 4ZS7L 3QIWB 1JNJA 2VLJD 5AWNL 2VXQL 5JW5B 2VDNL 3LRSA 5GS1B 5ICXA 3MLSL 4PJ8B 4DKDC 5KVFL 4HIJA 4FABH 2AJUH 4DZ8A 1F42A 2OJEA 1D5IL 1CLOH 3AS3A 4BFIB 2VDKH 4BH7B 5BVPL 3MLRL 1XCQB 2VLJA 2Q86A 4QF1B 5EZLA 3HE6B 5SWSD 4PY7B 3SY0A 4XPBL 3NMEA 1QRNA 5I17B 2NW3A 1TZIA 3FOMA 1CZ8L 3NN8A 1VB9A 4PGBB 5DHYB 3ZKMC 4X4XB 1HHIA 1G84A 4WIQA 4JZJA 3MV8B 3CZFA 3W39A 3QUYB 5F9JB 5GRVK 1NGQH 4P46C 5SWSA 3TVMB 3DX9B 3I6LD 1F6FB 1YC8A 2HTKD 5D7KE 1IEBA 12E8H 3MNVA 3C08H 3V0WH 3CVHL 3QFJD 5I1LA 4XWGL 2DS4A 3ARRA 4JREB 4ZTOH 4OUUA 2OSLB 3QULA 4KDTA 2RCSL 3WSQL 5IBTH 5CJXA 4PG2A 1C08B 3WFBL 3DRTB 5C9JB 3WIHH 3JWDH 4JLRB 1K3IA 5INCB 1T1XA 2DQIL 4OJFL 3QFJA 3VXMD 2H41A 2VXVH 2WBKA 3ULUF 3DYOA 4YIQB 3QYCA 4QYOA 2FIKB 4YZFF 5ICYB 5LAXA 3LEVL 4C56E 5D7SH 2IGFL 3I9GL 4CN1A 4XCEB 4LCWE 3QCUH 4H8WC 3SOBH 3E8UL 2Z8SA 1IT9L 5C0CE 4YDLB 2FX7H 1HH6B 1N5YH 3D6GA 5GSVB 4MJ2A 2IANB 1LVEA 4XP6L 4NM8L 3GNML 3MNWA 5HVGB 1I8KA 2L7JA 1KELL 5GGTA 1O0VA 1Z3GH 1VENA 1I1RA 1PY4A 3D2UA 3L7EA 3PL6D 1XGTA 4AEEA 4QHNB 3TH2T 3MOAL 4L9LA 1GXEA 1BEYL 1N4XL 2EDRA 1R3KA 1RZ8B 2W38A 5EORH 2G5BB 2Z31C 1J9CT 5CLWA 4LLYA 1PKQE 4P2RA 4J1UA 1T6VN 2DDQL 3ZE2E 3VFPA 5CFHA 2WANA 4PJDA 1X7QB 1WIUA 4OFVA 1OSPL 5EZJB 3UXFA 3SN6N 3IDYC 3KWWB 4S2SA 3QUMH 3B4NA 5IM7B 4MJ6A 1MREL 2XTJE 1VFAB 2FD6H 5HVFB 5D7IF 3K1KC 1SBSL 2BY2A 5JUEL 2QSCL 4ZO7A 1NH6A 5E08L 1C5DA 1UCBH 4LNVA 4BKLB 5T33L 1F3DJ 4XNUL 5FUCE 1HWGB 1WWWX 3QDJD 5DEFB 4GG8B 3S4SA 2NMSA 3B2UD 4G80A 4KXZH 5IMMB 1HHKB 1DQQB 5KW9H 1JPSH 1OAYH 1L0YA 1MLBA 1CFVH 3CH1B 4G8GD 4AIZB 1DEEB 4GMTL 1OD7A 1OGAA 2QJDA 3MNZA 4CW1A 5BO1L 2ATPB 3RWDA 1W72B 4NCDA 3C60C 1U0QA 4M4PA 5DA4A 2V2WA 4JVWA 4YUEH 5JOPD 1QR4A 2XXCB 4WWKA 1G7HA 3RVTC 3ARDC 5EU7E 5EUOA 5ADPH 2ICCA 5DJYB 5DQ9A 4GRWE 4GW4A 4UQ2A 2ESVD 2ORBH 3MGTA 4G6ML 1X5HA 2K1MA 2BY3A 5IBLD 5I76B 4IOFC 3H7BB 1ZHLA 2WUCL 3HHRB 4S0TD 2GQHA 4R4FL 1U3HD 2EDNA 3OG4B 5H8DA 3VXOA 3HZVA 1X5JA 4MAUH 4NM4H 3OG6B 3DVGA 3GEWB 2R56L 3VGAB 4RWYL 2B2XL 1OL0A 2VLLB 2Y6SD 4EDWL 4KKBC 3FCTA 2GSGB 4K3DL 1TZHA 4FP8H 3CMOH 2CDEA 3IJHB 3N50A 3VH8G 2IQAA 1P84K 4K8RL 3G9AB 5D2NA 1NCBH 1F8TL 1BECA 1G7MB 4YX2H 3G6AB 2VTFA 3FOLA 2X4TB 1A4KA 2XNAA 3RKDC 1YJDH 4UUJA 4JFXA 1H5BC 3MJ8A 4YPGB 2QSQA 4LSQL 4ZOCA 5BVJA 4XCYA 1I3GH 4OZIF 1FNGA 4JRXA 2B39A 5I74C 3LQMA 3U7YH 3BKYH 3M17A 4NQSB 4CU8A 1QUNA 3SGEH 5T5NF 2GIYA 3EOBA 1AGCA 2V5MA 4OQ1A 4M4RA 1HOCB 3QCVL 3QJHB 3WJLC 5IHBA 4HZLA 1KB5B 1FG2A 1ZSDB 1I1YB 2VLKA 4GRWH 4DOHE 1E6JL 3G08B 3RGVC 1G7JA 3C8HA 5EU6E 4OCYH 2I26N 3O2VL 4PJEB 5KANG 1T20B 3MLPA 3RU8L 1LO2L 5BMFH 3O45B 4J8RB 3LIZH 5E8NB 3QXVA 4BM7A 3CXHJ 1VFUA 4PJBF 3IXTB 3N1PC 4PRIE 4Y16D 5F71A 4RGNB 3FQRB 5I30H 2F5BH 1MCOL 5IB5B 3AY4A 4F33B 4DVBB 1MCJA 3W0WE 4YQXL 4F8QA 1MRDL 4Y16A 3S36X 2VLRB 5EO9B 1M7DA 3CDYA 4ZOAA 2KUTA 1Q9WA 4N0FB 2HT4C 2FATL 1ZS8A 3IAPA 1A6ZB 4N1CA 3T2NL 1WQVT 2GAZB 3B9KD 1ADQL 4QRSA 1FGVH 2F8VA 4I18A 3S5LB 2H3NB 1YEKH 3FZUC 1QPPA 1CXHA 5D1QA 5EIIA 4YHPA 1H3UA 1PQZA 4X6CE 4QHMA 3S5LG 4JDZB 1ZT4B 1BBJA 5CINL 4R96A 5B39A 2OZ4A 5KVEH 2E27L 1T1WA 4Q6IA 2V2TB 4CUCA 5D6DC 1RURH 3VFWA 3UJJL 2H2SD 3E1F1 4M1DH 3MLTA 1N0XL 2PXYA 4KRPD 4PJ9D 4DN3H 1IAKA 1JZ8A 1DBML 4HEPG 1CR9H 4PB9H 4H1LA 4RQQA 4ZD3H 2H8PA 5HI3C 4HFWA 2UYLB 4N5EC 3RVVC 3TA3D 3ESVF 4ZUSA 4WGWB 3EYSH 2FZ3A 4PJFF 5IMLB 2N4IA 5CBEA 2EEAA 4JO3L 4D8PB 1KCKA 5SWQA 3QDGE 4TSCH 2EZ0C 3DGCR 5IW6B 3IETA 2E7BA 1R3JA 3P9LA 4CMMA 2G5RA 4K8RC 1FNHA 1AO7D 1OARL 1NKOA 4UTAL 1A7NL 5E4EB 3MLXH 3UZQA 4Z7UF 2A73B 3EJJX 4NO3B 2YHGA 3GRWA 1P6FA 2X1PA 1U8OA 5IVNA 3V5HA 3SE4C 3TV3H 3W9DB 1RZ7H 3P0YH 4ZSOB 4KK9D 2EDWA 2F74A 3GMOA 4U1SB 3ZE0E 5LKNA 1F97A 4LNRA 2VKXA 5CP7A 3S97C 3FO0L 5CEYB 3WKMH 3HMWL 5E7FA 4L8DB 1PG7W 1S5HA 4BUGA 4CVUA 4PJAF 2ZWLT 4Y1AE 2HJLA 3LKSB 3SKMB 3BYYA 3ZKSD 5EUKB 3GKWL 1A1OA 1FQ9C 5CS7A 2HMID 4P3DA 4XC1H 3T2OA 1HHJA 5K9QG 1SJVA 1M05A 2JTDA 5ADOH 5ITFB 3QRFM 3WDHA 1SJXA 2IPKB 4FQHA 1MCBA 1SVZA 4CNIA 4Y7MA 3ARSA 4MCZA 1JJUA 3VXRB 5D7IB 5MP6H 1BP3B 5IT2L 3RX5A 4JRYB 1FZKB 2AXGB 5L2JB 1MAML 5IG7A 1E4WH 2HT2D 2JK5B 3T65A 3IS0X 1B0WA 1WGOA 1IM9B 1KJ3L 4MA7L 2WWMD 1CGTA 2J5LB 3JBG7 4UI2A 5IUSA 2IG2H 4RFNB 2ICEB 4PJCA 4DUWA 1LE5A 5C8JA 3P4OA 1CFSB 4PJ5E 5HGAB 1YEFH 4R0LB 1EAJA 1LD9B 1TVBA 1DBAL 4QRPD 3JV0A 4WJ5B 5JZ7D 3KYAA 3SDXF 1XF2B 4FFZH 1FSKB 2HJFA 4AJ0A 1WWCA 3BKCL 4MCYB 2Y5EA 3OR6A 3I85A 4HCRA 3QAZC 5JXAH 1JBJA 1T2XA 2Y7QA 1OCWL 4ZPVA 2ZUUA 2IF7A 3AREB 4KJPC 2DWDB 4E41A 5FHAL 2Z93B 4JM2D 4NZUH 3BRFA 1ACYL 1JHKH 1QVOB 1WAAA 4LCIH 4XCCL 1T6WA 4P5TB 1YEDA 4Z7VA 1ZLWK 3IVKA 2DIAA 5TDNA 3TT1L 3NZHL 5J8OA 2YMXL 5D1XD 1CGSH 4GRLA 4WUUA 5DTFA 5IIEA 4JM2A 4OSUH 4NOBA 4GOSA 5D2LB 5F3HA 3PWJB 2PO6D 4GAGH 5T5FH 4JPIB 3P3YA 1YDPB 1RUAL 4LCCA 3P9MA 3C8KB 1RJYB 5BV7H 4AH2B 4J3OC 4JFED 4RMUA 3DVFA 2A38A 3QDJE 3PGDB 1M71A 2CH8A 5EOCH 1X44A 4GQ9H 5H2BA 1IBGL 1VFOA 2BSRA 1HIML 4X8JB 3STLA 1MPAH 3W9EB 1DUYB 5ACLA 1ZGLP 5MENB 4FG6D 2VAJA 1ZEAH 5C07E 5K9OB 4XCFH 5HDQL 3ZYOA 1DVFB 1ORQA 4OZIB 2YSSA 2F54B 4PJGA 2VZUA 4GAJH 5T3ZL 5E9DE 3B83A 3HRPA 2YN5A 1NAMH 3MC0A 5ANMA 1FFPA 1J1XL 2CRMA 4PRDA 3TESA 2ID5A 3QQ9D 4U6XA 5IR1B 5DRNA 2EDQA 5MERA 4JKMA 1IVLA 3WV0A 4W4NA 4HHAB 2YN3A 1UQSB 2ESVE 2UWEA 1L7IL 1LP9E 1T04B 3I75A 5E00A 1JGLH 3UX9B 5IJKC 2Y07H 2B1AL 3LQZB 4S1SL 4LMQE 3HZKA 3PXHA 2R1YA 3ZKND 2VLMD 3KLAA 4GKZA 2HWZL 4H0HB 1N59A 1PLGL 5DC4B 5DD6B 4OGZA 4U1MB 2Z92A 3L3JB 4HGWA 3V8OA 4CADB 2ARJB 1T3FB 2GSIA 2A1WL 3MRQB 1AE6H 2A9ML 1HE7A 2OJZL 2OP4L 3JWOH 5EU4A 3WS6A 4CVZA 2Z35B 4M3KB 1S78D 3UJIL 3NPSB 5I1EL 4JQVA 4LF3B 1CXIA 5FUOH 5HHOE 3AAZA 3KXFB 1UJ3C 3M45A 4PV9B 1P4BL 3VFTA 2DKUA 5DXWA 1IGCL 5GS2D 4BZ1H 4QRRD 3RY6C 4Z0XB 3D25A 5ILTL 1TJIL 4NQVB 4LVEA 4LLUB 1KIUA 1GGUA 2EDDA 3WN5A 3ARYA 4Z7QE 4I2XA 3RNKA 2V9QA 2DICA 1FFRA 2MKLC 4J23A 4QOKA 4AK1A 1DLFH 4JKPH 1MI5B 4EIGB 1FRGH 2D7PA 3DO3A 1IEAA 1R5VB 1GOHA 5HI4C 3RTQD 3QIUB 3U83A 1VACB 4IRZL 3MACL 2JELH 3GM0A 3ARBD 1MLCA 2X89D 3IDNA 1OP9A 1BX2B 2WSKA 2AEWA 4P2QD 3C8DA 4KK5C 4EUPH 3QI9B 3QIBA 2MHAA 4KMLB 1CDIA 3PIQB 2BERA 4OCRL 4UT7H 3CFEA 2DQFA 2HA1A 1B4JL 2FEEL 1FNEB 3HNVH 1CLCA 2X89A 4PRPD 1WWBX 2GTWB 4U2YA 3TC9A 3MXWL 3UBXI 3S98A 1BHGA 1KJ2A 1NBZA 1RUQL 4G42A 5CILL 1DN0A 2V5YA 1G9NC 4YHLH 3QUXA 2FX9L 3IFLL 3BZ4A 3U36B 3HG1A 3PWPA 1HINH 1Y18B 5F93C 4Z7UB 5C0BD 1FG9C 1I7UA 3I02B 2VE6B 4OF6A 1AC0A 4JANA 2HJKA 4RFEA 4CMHC 2CLVA 4QXTB 2VISA 3DXAE 3MROA 4H20H 2ZUYA 2DJUA 3SDCD 3JUYA 2V2XB 4TNVK 4G9FB 3ZTJH 4TUJA 5EBLA 3ARPA 4OQTH 2Q8AL 4OF5A 5D96C 4GW1B 2H32H 1RZJL 2KH2B 3HLAB 3FO2A 3HRZA 4PJAB 3VWKC 4XVJL 1LEIA 2C4XA 1D6EB 4ZAKC 1E4KC 3ARQA 4I3SL 5KZCB 4YHIB 1ZHNA 1Y6MR 2HFTA 4IRJD 3MREB 3DBXB 4OF3A 1OTTD 4Q2ZA 2UUDH 1N2RA 3U82B 1NL0H 3R8QA 3U7AA 1VGEL 2YEZB 1ZXQA 2R1WA 1UACL 2A74A 3VWJD 3U7WH 2BNQB 2D03H 1ZHKA 1G6RL 1HILB 4PS4L 5JW4R 3MRCB 1M7IA 2P5WB 4OCWL 4X7FC 3OXRA 4HIHA 3AGVA 3O8XD 1A22B 3X12B 3LKPA 3O9WA 1E27B 4LPCA 4AENA 1KJMA 4X98A 3U4BH 4EN3D 1R3LA 3T0EC 5E6IB 4GMSL 3GSNB 3QUMA 4L3EE 4HH8A 3QG6B 3RWEB 3VGDA 4U7MA 1AHWA 4GUPA 5HGBA 2D7OA 1DP0A 5DLML 1IM3A 3CFKB 1AO7E 1A6UH 2VXSH 2OR9L 4RRPG 5C6TL 2BHZA 1RUKH 5A2IH 5BS0E 3H0TB 5L0QC 1A6AB 1IC5H 1QBLL 1T89C 5C0AE 1XGRB 4LQFH 4F15B 3H6JA 3P2TA 4C56A 5IV2B 4X0KB 3T8XA 4OZGB 2YPKA 1IC4L 4XH2A 3SDAD 3LKRB 1V3LA 4LCWA 1YMHA 3OHXB 4XMLH 5IWLA 4MA8L 4JR9H 5DJXB 1INDL 2A6JA 5DJAB 1JN6A 4RMWA 4TULL 1MSPA 4R8WH 4ZQKA 5EUOF 2C4FT 1UENA 1E0OB 1FVEB 2X4UB 2BVPB 3CX5K 5SWZB 1NCWH 3RX7A 1MIEL 5CEXA 4J2XA 3MA9H 4ONGL 1P7KA 5I1AA 1MHEB 3UJTL 4F9PA 3RPIA 1IC7H 1A3RH 2WIMA 5JQ6H 5DQJB 1JHLH 5TQ2H 4BQ6A 3EJZC 3JVGA 4NQED 5BZWB 1JGDB 1YMMB 1VEMA 3IDJB 3TYGH 4GG6E 3ZE1F 2WP3T 4M1CC 2IBZX 4OCMC 2DQGH 5DT1H 3NABH 4KMQA 4MNQB 5JIIA 3WNMA 3H9SB 4MXWL 1XT5A 3ILQD 4OKDA 5I71B 1EMTH 4R2GD 4P9MH 3SE8H 1G0DA 2HFFB 2EDXA 4GAYA 3BPOC 3M1BA 3BDXA 4KK6D 5DHXB 5I66B 1NDMB 3S96A 1GC1H 2A6DA 4UDUB 4QRPE 3VCLA 3BPLC 4U1GC 5HYQA 2VC2H 2B20A 3STZA 1NGXA 1LO3L 2YD8A 1GIGH 3EBAA 3ZDZE 4JN2B 2DB8A 5IQ7L 1FYTB 3ARWA 4YDVA 2AVGA 1AR2A 1WF5A 4LDEB 4P3WA 2NY6B 3SCMD 2J7LA 2P8LA 1EBAA 3MGAA 1FYHB 3OB8A 4WHCA 2ZUXA 3GMMA 2BVQB 4NZRH 2DIBA 5DEGA 4EJ1C 5I15L 5IFAH 4L3AA 3GSXA 4Z7QF 3UAJD 4K94H 4JFHD 1IL1A 1L0XA 1JUFA 1T1ZB 3SCMA 4YBLC 2CDGA 5E03A 1B2WL 5J1AA 4POZC 5CZXD 4DCQA 3PGFH 4GSDH 2Z8RA 3H8NA 1C5CH 3C6SA 5DS8A 1NCAH 2AEPL 3K4ZA 1U8LA 3WFHA 1VEOA 4M48L 1A7RH 4U1KB 1EX0A 4RA0C 3SO3B 2J8UE 1NKRA 4F3FA 3MLZL 3LRSB 4LBEA 5ICXB 3TEUA 1K4DA 4HIJB 3DGGA 2QHLA 4DZ8B 4U4BA 2FH6A 2OJEB 3VI4F 4YXHL 2JJVA 2WBJC 2LU7A 4NKIL 4CVXA 4FZEL 2V9TA 3LMJL 3OGOE 3GJFH 3IU4L 2ZG2A 5DK0A 2W9EH 2VLJB 2Q86B 1U92A 3L3GA 5EZLB 4NQDE 4DEPC 2HT3D 1H3GA 1BOGA 3SY0B 1MRFH 1QRNB 4WRLA 3EHBC 2NW3B 1TZIB 3FOMB 3NN8B 1E4XH 4OLVH 5DI8A 4GBXC 1EVUA 1Z9SA 4F7MA 1RU9L 1HHIB 1VDGA 1F4WL 1BF2A 4JZJB 2OK0H 3CZFB 2F58H 3W39B 1X3DA 3W82A 1T22A 2V17H 4YHYB 1IEBB 3MNVB 1DQDH 2YRPA 4N90D 5I1LB 1T03L 3OAZH 2DMKA 2VWEC 4G7YL 1ODAA 4OUUB 2RGSA 4O2FA 3NCJL 5JHLL 3QULB 4H25A 1OSZA 3OJ2C 4H8WH 2ZCHL 4URTB 1CDYA 1A7QL 3D0VA 4G6JL 5I18L 1T1XB 2Y36L 3BMVA 3IAGC 3QFJB 2AJSH 4WW2A 2GY7B 4QYOB 2YWYA 4TVPL 2VZ3A 3BH9A 5LAXB 1P5VA 3EOAA 4ZMAT 4FQIL 1OM3H 1JHTA 5EU6A 4O00A 1JGVL 1OAXH 5FF6A 2BCKA 2X9XA 1EK3A 4JVUA 4YR6A 1QSEA 2VJXA 3FMGL 3N85H 2EE9A 4PRIA 3CU7A 1JNNH 4Q0XL 5I1CH 3MNWB 1XR9A 4AEHL 2IFFH 5IVOA 1YEHL 1J7VR 3D2UB 3L7EB 4OLXH 1R5WA 3W0WA 1AD9A 2F53E 3NFPA 1XGTB 2J6EH 3GBMH 1MVUA 4N1HB 4L9LB 4JY6A 1G1CA 3D39D 4KI1A 3V5KA 1T1YA 1R3KB 5EZOH 3BAEL 5HHXL 2H26A 2J8OA 5D1ZC 3U48A 4L5FL 4LLYB 4Z8FH 4P2RB 2E7LA 4J1UB 1NC4D 2R4SH 3VFPB 4N8VA 1ETZA 2X6MA 3F12A 4PJDB 3QDME 3BQUC 5HD8C 4IMKA 1IAIH 3FRPA 4S2SB 5AWNH 2VXQH 4P2QE 5IOPA 2V5RA 4X6CA 4HKJA 4MJ6B 4RAVA 4ZFGH 4Y4FD 1RJCA 4XNZB 5KVFH 1JV5A 3DX8A 1SM3H 1YYML 1FC2D 1Q94A 4PRPE 3LZFL 5J12B 1C5DB 4AEIL 4OLYL 4PGEA 2DJSA 4OGYL 1BLNA 3FFCA 5CHNA 1UWXK 5E70A 1ZOXA 3GHEH 1NEZG 1MCWM 2C3HA 3OSKA 2YXFA 5DR5L 2W0KA 4MXVE 4D9QD 3RDTD 3S4SB 3RPKA 4LAJH 3S37X 4G6FD 4G80B 1ZLUH 3SKOA 4GKSA 3U30C 1XZ0A 2GCYA 1CF8H 1MLBB 4M00A 4P9HL 5GGQL 5GGSY 1JCKA 4QT5A 1K6QH 4JFQA 1OGAB 3CVHH 1G0YR 3O0RL 2GKIA 4R97C 3MNZB 4XWGH 2IWGA 4M6NL 1FNAA 2NQCA 3QHZL 4CW1B 3VRJA 3RWJA 3RWDB 3WSQH 3FN9A 2V2WB 3IB4A 4YHOL 5F72S 4FFVC 4FRWA 1KXQE 2DQIH 2ZNXA 3SDDD 1HXYA 4OJFH 4WWKB 3SE3A 1GZPA 3OKEA 1OGTA 3SJVE 1G7HB 4J6RL 2H6PA 3BN9D 3VFRA 4IM8A 2F15A 5EUOB 3KJ6L 4MZ3A 5DQ9B 4GW4B 3N1FC 2VDPH 4UQ2B 1I1CA 2CKBH 3QT2A 3MGTB 4EQ2A 2VB5A 3VFGH 1WISA 1ZHLB 4Z7VF 4D0CA 3RI5K 4Y2DD 3VXOB 1MJJA 4JGJA 1MCWW 4LVOB 1IT9H 3HZVB 4M1GH 2NY4B 5GGUA 3BH8B 3DVGB 4JM2F 2CKNA 1I9IL 4ZXBC 2XZCL 4Y1AA 1UZ6E 4D2NA 1MCHA 2MKWA 1P7QA 3FCTB 1OVZA 1TZHB 5FAAA 5T3ZD 3RIFF 3VD9A 2MQCA 2CDEB 3V6BR 2KKQA 3DWTA 4OB5H 2APFA 2IQAB 2LU4A 2RJMA 5D2NB 1TCMA 4RISL 3GSWA 3BWUC 3RL2A 1N4XH 4N0CC 2BNUA 3FOLB 3QEUA 1A4KB 3CGTA 2XNAB 3FT2A 1QSFE 1FZMA 3D0LA 4UUJB 4JFXB 3MJ8B 3QXWA 5BRZE 4ZYKA 3QB7C 1X9QA 1CVSC 5BVJB 3HZYA 4XCYB 3W2DL 4BSWA 3QP3A 1FNGB 4R4ND 5TE6L 1CXEA 1F2XK 2HLFC 4JRXB 2HTLD 1P4IL 5CIPH 1ORSA 1MREH 1FH5L 3M17B 2CPCA 3QBTB 3ZSSA 4WW1A 5DZOA 2IFGA 3X14A 4HUNB 4ISVA 4FTVE 2LE9A 3EOBB 4PJ5A 1AGCB 4K07A 2XI9A 2QSCH 5E08H 5E2UL 4HZLB 1BQSA 4MS8C 3WD5H 1FG2B 2VLKB 3LS4L 1G7JB 5IROC 5I6XB 4F80A 5F88A 1LGVA 1FGNL 4G6AD 1CLYH 1NAMA 4U6HA 2APTA 2C1PA 3QPQD 3CLEL 5DUPH 2R9HD 3D18A 4X6FA 1P7HL 1RFDL 4NN6C 3QXUA 3MUJA 5HYJD 2DAVA 4TRPH 4GMTH 5DD0L 3PHQA 3O6FA 5C0RH 4OIBA 1P1ZA 4FQCH 4HUWA 5BO1H 2QQLL 2B8OT 2Y5TA 3K81A 1FO0H 4Q9QL 1MFCH 4Y16B 2I24N 3LS5L 3VE0A 4LGRB 1M7DB 2DI9A 1N7ML 5FA4A 1Q9WB 5F9WB 3O11A 3PV7A 3K2UL 4Y0GA 4J4PD 1ZS8B 3L3KA 1A6PA 5IB1A 4QRSB 4I18B 4G6MH 4DUXA 4YBQC 1KCSL 5D1QB 4PR5A 3EYOA 4YHPB 5EIIB 1BGXH 1QO3A 4YFDB 3H3BC 1PQZB 3OAYK 4LIQL 4QHMB 2XYCA 5KSAA 3E0GA 1XCTA 1BBJB 4KQ4L 5J6HA 4FQ2L 2W07A 4R96B 1UXSA 5B39B 3PHOA 1T7ZA 4RFOL 5DURD 1T1WB 4Q6IB 2B2XH 1GOFA 2VMFA 4NIKB 4EDWH 2YD3A 3VFWB 3TFKC 3UMTA 5B39G 5FCUH 1DL7L 3MLTB 2CSPA 2PXYB 5T3XL 2D4FA 4K8RH 1IAKB 4PLKC 1KLUA 5E9DA 4N8CH 3O3DA 4PLJC 3MRPA 3B2VH 4RQQB 4EI5D 1CDBA 4Z5RA 2H8PB 4OF8A 4RGMC 4HFWB 4ZUSB 1V7NH 2FJFA 2FZ3B 4MMZC 1UM6L 4NNXA 5CBEB 1JYXA 1UFUA 5SWQB 3DETD 4PJ7F 3L7FA 4KRNA 3LQAL 5C0GA 3IETB 3EKCA 4LSQH 1DBKL 1R3JB 1LP9A 3P9LB 5E6ZA 4CMMB 2B5IB 1B6UA 2YUXA 4EUPA 5CGYC 1RUPL 2YKLL 1RIVL 2D7TH 1B90A 3ULSA 1OW0A 3BHBA 1M4KA 3TBVA 1UWGH 2HRLA 1QEWA 3QCVH 5B21A 3TJHC 1U8OB 6CGTA 3V5HB 4RGOL 2R69L 1IKFL 2WUBL 3U79A 2F74B 3GMOB 1NGZA 3VXSD 4KC3B 3O3EA 3RU8H 2IBGA 5DGRA 1KG0A 1YY9D 1XF4A 4LNRB 5CP7B 2CIKA 4JFYA 1S5HB 5HHOA 4ODXA 3BRGC 4HK0A 4JO2L 4IIQC 2HJLB 4JAMA 5GZND 3FQTA 5DRXA 3VXSA 4HIEA 1A1OB 5F7WC 1T83A 4N90E 4HF5H 4NWUL 3UYRL 4I0CC 4P3DB 4X6DA 1HHJB 2NY1C 1J0HA 5FYJL 1MRCL 1M05B 1ZMYA 1D9KD 2H32A 4FQXD 4FQHB 2EDOA 4CNIB 4MCZB 4HC1H 4ZFZA 1ADQH 1A21A 1B88A 4MHHG 4XI5C 2O5XL 2X4PA 3GFUA 5IG7B 3T65B 1JK8A 3N1GC 1EAPA 4L4TD 3WXVL 4FQXA 3HUJA 3CDGA 3BD3A 4JEGB 3S37H 3C5ZD 4X4ME 1PW3A 1RJLA 4JHZA 1GGCH 4PJCB 2A83A 3ZLQC 4L8SC 5C6WH 3C2SA 1LE5B 5C8JB 1F11A 3P4OB 4HAFA 5FKAA 4L4TA 4UNVA 1TVBB 1S9XA 3UJJH 3C5ZA 3VG9C 1N0XH 4AEFA 3K46A 3TBYA 3FQUA 3RUGE 2ADGA 5D7JA 1CVRA 2HJFB 3VXUD 3LB6C 2EDHA 4ERSL 3K74B 4OLWL 3OR6B 2QTEA 1DBMH 1W72L 3VFMA 4AMKL 4APQC 5GRXG 2Y7QB 5FOBA 2AGJL 5FCSH 4ZPVB 2DTML 5GISL 5FYJU 1MCEA 1A14L 4E41B 3UTZA 5T1LA 1Q72L 4BZ2H 1O7VA 3DXAA 3WUZA 5IHZB 1BVLA 1CD1A 5DWUL 1YEDB 2NXZB 4LOUC 4Z7VB 3IVKB 4JREC 5TDNB 1B9ZA 3ARFA 5L2KA 5E8OA 2AK4E 4GRLB 4U6VL 1A7NH 4OKVA 1FORH 4WUUB 5DTFB 5IIEB 4JM2B 1BQLL 2FGWL 5F3HB 1I85A 2DF3A 4M8QA 1MHHA 5CEZL 4LCCB 2NY0D 4WGVB 3P9MB 3V4UH 1Z2KA 1QFWI 1IMHC 3OV6A 4XPFL 4HPYL 1M71B 2CR6A 1NMAL 5H2BB 1RZIA 1DDHA 1MEXL 3GGWA 2ERJB 3H3KA 2BSRB 3HMWH 1QNZL 3STLB 5FGBC 2XA3A 2BHUA 1OLZA 2R0KL 4YDLC 1GHFL 1S7RA 3KPTA 2GJ6D 1ORQB 2YSSB 3G6JA 4PJGB 5HPMA 2UZIH 4PJHE 4KTDL 3TZVA 5CD5D 4K3EH 2BC4A 3QA3A 4NN7B 3HS0A 3MPCA 1MQKH 5C0IA 4X5XA 3S35L 5ANMB 2FL5A 5L9DL 1FFPB 4PRDB 3A67L 4U6XB 5DRNB 3EOTH 5MERB 5BS0A 2XN9E 1MAMH 4NN5B 5C0AA 4LARL 5IB3A 4UT6L 1KN2L 2EC8A 4KZDL 4HJ0C 5AZ2L 1Z0NA 2UWEB 4JQXC 3G6DL 5HDBF 1KB5L 1UM4H 3I75B 2KL6A 4EVNA 5E00B 2R2CA 3UP1A 5ENWA 3VI3E 3BUYA 3HZKB 4B41A 5GRVL 2R1YB 5JXEC 1JYNA 4X8XA 3KLAB 3NGBB 4IMLA 4GKZB 2VZSA 2LU3A 5IFHL 4PJIE 1G7IA 1N59B 1ZLSL 4XC3L 2VUYA 4N1EA 4MD0A 4EI6A 2Z92B 4HGWB 2LV4A 1ZVSA 2GSIB 3FHQA 3BKCH 1ES0A 4CVZB 3CXDL 4HQQL 3VD5A 2J4WH 5ITBL 2AEQL 4W6YB 4FNLH 1JTOA 3AAZB 1SY6A 4NKDA 3X11A 1OCWH 4LCYA 5E99L 3ULVC 2VDML 1CXFA 3VFTB 2FLRT 1A7OL 4GG6A 2XY1A 1OAUL 1CK0H 1N64L 2GI7A 2J88L 5D7LA 1TJHL 1PEWA 5F97E 2ZJSL 1ACYH 1JNLH 5IKCA 5J11B 3D25B 4LASH 3EDFA 5C86A 5DMGC 5I73B 5HHMD 4OM1L 3WN5B 3RJQB 3TT1H 3NZHH 1FCCA 4AZ8A 4I2XB 3I3DA 3RNKB 3NCMA 4QOKB 3LRHA 1NFDF 4P46A 1BAFL 3NA4A 4TVPD 2NY3B 1YN6A 1Q0XL 3GJFA 1RIUH 2YPLD 1IEAB 1RUAH 4LPUA 4UILL 4Y4HC 3WFZA 1JWUA 5LGJA 1U8KA 3T0EE 5EBGA 1T66D 1H3PL 1MLCB 4OZ4A 3O4OC 3IDNB 1AQDA 4X9HA 1JF5A 3RVXC 1G9NH 5FDYA 1KB9K 4P23C 2FJHA 3QIBB 4Z77A 2MHAB 2EICA 1WIOA 3L6FA 3CFEB 2DQFB 2JCCA 2E9JA 2FGZA 4LHUD 3T3PE 4GH7B 3TCLA 4CN4A 4PUBL 5FO8A 3HI1A 5HI5D 3HAEH 1VFBA 3ULUL 4YJZL 1KJ2B 1A7PL 4G42B 2DD8L 4AM0A 1DN0B 2E7HA 3QUXB 3BZ4B 1NFKA 4ZS6D 4OZFH 4PGJA 1G7PA 3HG1B 3PWPB 5D5MF 4OD3L 4HBCH 4TUKH 2YPVL 4WUKL 1I7UB 5DYOA 5TGBA 3VGGA 4JANB 2IQ9L 1R0AL 2HJKB 4RFEB 2CLVB 2VISB 3ROLA 3MROB 2YD5A 5CJ8A 1B0GA 1MCDA 3CC5A 4Y2OA 3ZT5A 2XWJA 4OV6F 4TUJB 1M6OA 5EBLB 4S1SH 2R23A 2AJZA 2NXYD 3QEQD 3L5WA 1WBXA 3FO2B 3HRZB 2Z31A 4LSRL 1LEIB 3RUGF 5EA0L 1ZHNB 3DYMA 3Q6GL 1FL6A 3CSYA 1IAOA 4Q2ZB 4I0PD 1N2RB 3D85A 2YUVA 3QEQA 2A1WH 2OJZH 2OP4H 3JUZA 2J6EA 2R1WB 2A74B 2H9GA 4F58H 3I2CL 2HAZA 4ZPTA 5HJ3B 4QGTA 1ZHKB 5EOCJ 5I1EH 1YQVL 4OFYA 5GS0C 1M7IB 2CK2A 4LSVL 3W81A 3OXRB 4HIHB 1P4BH 3V4PH 2VKWA 3LKPB 3O9WB 4P2OC 3VA2C 3PQYD 1TMCB 2D0FA 3O2DH 4AENB 1KJMB 4X98B 3NPZB 5GJSL 3SQBA 1R3IL 1R3LB 3CK0L 5IMOA 1WEJL 4FXKA 1TJIH 2EYTA 2O5ZL 3BDBA 4WU5A 3QUMB 1H3VA 2HFGL 4O02L 1AHWB 4GUPB 5EWIL 5HGBB 1OAKL 2ZSVA 1IM3B 1CXKA 5J0BA 3BD4A 3KDMA 5JHDD 4M6ML 1U3ZA 1RV6X 8CGTA 4XP1L 1VADA 3GO1H 3DUSA 4WO4C 2VABA 4UTBL 5KVGH 4UZGA 2QQQA 4IRZH 1F4HA 4C56B 3HPJA 2RHEA 3T8XB 1ZANH 4KJQD 1JRHI 3CU1A 2YPKB 3TN0C 3ZDYE 3C60A 4XH2B 4LCWB 5GGRY 1YMHB 5GRJL 1LEGA 4OCRH 5DJCA 2B4CL 2DN7A 2A6JB 3UTTE 2A6KA 1B4JH 1V5JA 3BGMA 3MBXH 2ENYA 4ZUVA 1GL4B 1U36A 1JN6B 3ARDA 1I8LC 1LWRA 4ZQKB 3OGCA 2DQDL 3TIEA 5JIKA 1OD9A 4PJHF 3IFNL 2NNAA 3QQ3A 3HE7D 5CEXB 5CILH 2E8YA 1RK1A 2PYEE 1P7KB 2F53A 5I1AB 2FX9H 3K2MC 3RPIB 3MJ9L 1JGUL 3LKNA 4M7LH 3MX0A 1LO0L 4JY5H 4M6OL 1CYGA 3QUZD 2BDNL 2CKBA 2V6HA 5GSRA 4XTRD 3MV7D 4XPGL 4A6YH 3ULUC 2DQJL 3O41A 2OI9C 3UZEA 1NANH 4X7TA 2MQ3A 2W92A 3BKJH 3QDMA 4XB7A 2L0DA 4EXKA 2WBWB 2LFGA 4LHQB 2AQ3A 4TTGA 2MSPA 4GAYB 4JPWH 3MV9A 5F1SA 3DVNA 3M1BB 3MV01 4XVJH 3ZZ1A 4I3SH 5BJTA 3S96B 4JN1L 2A6DB 2MJWA 1H5BA 3VCLB 1OTUC 5JW4Q 5F96L 5HYQB 2VWEE 4NZDA 5DVKA 2WWKT 4C54A 1C8PA 5KS9A 5FYKL 2PYFA 3STZB 1NGXB 1VGEH 3L3HA 2EIBA 3VXUE 1UACH 3PF2A 5K59F 4YDVB 1XGYH 4CRPA 1LNUA 5EIVA 5A43C 4D9RE 3ET9F 2GUOA 4OCXL 2P8LB 4I3RH 4OCWH 3GMMB 3WJLA 5IGXH 1S7UA 5DEGB 35C8H 4YK4B 5HGGS 2NPLX 2HLAA 3NTCL 1QKZL 3RGVA 3GSXB 3HCVA 5BCAA 2AXJA 4KZEL 4L8CA 2CUMA 1IL1B 1CDHA 1FVCB 1JUFB 4GMSH 4MQ7A 3SCMB 5CIPA 3UO1H 3QIWD 5I1HL 2CDGB 3ARGC 5J1AB 4JFOA 2FHFA 2NY7H 4DCQB 4FN0A 5L6YH 2VQTA 4PJ8D 3BD5A 4ELMF 5B3JF 5C6TH 3TO2A 1MHPH 3SJVA 1ZT7A 5HDLA 3C6SB 1QBLH 1ITCA 3QEGL 2EE2A 5DS8B 1WZ1L 4GRWB 5C3LD 1U8LB 2E9BA 1GPOL 4MB4A 3WFHB 1MY5A 5FA3A 9CGTA 4E42A 4MVBC 3HE6D 5GZOC 1MFAL 3MRMA 3ZHLA 1E6OL 5DFVC 4F3FB 1AGDA 4C4KO 4MA8H 4LBEB 4EBQL 5ISZA 1O7SA 3MV8D 4L29A 1N8ZA 3DJ9A 3N9GH 5B22A 4RFNC 1K4DB 4ZTPH 3QUYD 3DGGB 4JPKH 5DC9B 1MWAH 3TVMD 4CVXB 3MTRA 1YNTA 4ZO6A 4UV7H 5DK0B 5A3IC 4ZFFA 5I1IL 5T3XD 1U92B 2VXTL 3L3GB 1MIEH 1A1MA 4E0RA 1BOGB 1FO0A 2D7MA 2Q7YB 4LFHG 3ZHDA 2EE6A 3P73A 3C6LC 1K4CA 3UJTH 5DI8B 3ES6A 5C09E 4F7MB 3CZJA 3EDKA 1D5MA 3MR9A 5F6IC 1RZKL 1IGFL 3LEXA 2X41A 4UINL 1J0YA 3T0VA 1T22B 3BPNB 3VXTA 3WIIL 2EDJA 3FN0H 1QSFA 3FONA 2ZKHH 3TO4C 4O2FB 4UNTA 4H25B 4QXUL 4H0GA 4HS8H 1TDQA 3GI8L 1DQLH 3D0VB 3RZCD 1UKTA 1QBMH 4YXLH 1NFIA 4WW2B 4FTVA 3FHAA 3QH3A 2IAND 3QWQB 3I3BA 1OAQL 3BH9B 2DIJA 5C08E 1CD0A 1T0MA 2JB5H 3EOAB 4QRUA 4K3JH 2VQUA 4Z7OF 1LO3H 5LBSL 1AR1C 1AP2A 1JHTB 2JE8A 2X9YA 2ZPKH 3D87B 1F58H 3JWDC 5EU6B 5FF6B 4U3XA 5IQ7H 3RZCA 2BCKB 4YR6B 4X83A 3NIDF 4X7DC 1QSEB 4WI8A 1IGTA 1CD9B 2CGRH 4AL8H 4PRIB 3RAJH 5TFSH 3SE4A 2R2HA 2GK0A 2ZCLL 1XR9B 5FYJD 5GXBB 1C5BH 1S3KH 4A2MA 1R5WB 3W0WB 1AD9B 3NFPB 4WEUD 1A9EA 1B2WH 1MVUB 3PWLA 3VGEA 4JY6B 3V5KB 1T1YB 2R0WL 1ZGLA 1N26A 2H26B 4OM0L 5DJDA 1S9YA 5IVXE 5I1KL 1MJ7L 1YEJH 4N8VB 1JTTA 1ETZB 3F12B 4X6DF 4EEEA 4MXQD 3CNKA 4DTGH 5IOPB 4X6CB 4HKJB 2COQA 4RAVB 4WFHE 5DMIL 1RIHL 4M62H 1JV5B 3DX8B 1CN4A 3MA7A 3DX7A 4DQOL 4YXHH 1YNLL 3FRPG 1CFNA 1Q94B 2DMBA 1GRWA 4FZEH 4NKIH 4PP1C 1MUJA 3K0WA 4PGEB 3EO1A 4HT1L 4KROB 1XGPA 3SGJC 1BLNB 3FFCB 5CHNB 3NBNA 2KZWA 4S11A 5FGSA 3HUJF 2EO1A 2VAAA 3KGRA 5EO0A 5ECJE 3AB0C 1F4WH 2X5PA 3GSNL 1F6AA 3SKOB 4HC1A 4GKSB 3FFDA 1CICC 2BOBA 5I1GL 1EJ6A 4XB8A 1ADQA 1XZ0B 3BO8A 2GCYB 4NQCE 3R0NA 3NPSC 1YPZA 4QT5B 5F7DA 3Q0HA 1NMCC 4JFQB 4TNWF 2R15A 4DGIL 1T03H 4ENED 2NY2B 1P53A 4PREA 1CGYA 4JO4L 3HI5L 5ABDE 3VRJB 3RWJB 3KPNA 3QNYA 3A6CL 4R90L 4JB9L 3ISWA 1TQBC 4G6JH 4ONOA 5I18H 1MJ8L 2YA0A 1HXYB 4JG1H 1GZPB 2ZNWA 3OKEB 1OGTB 5FOJA 5DUML 2DI7A 2H6PB 4LCUA 3VFRB 3IFOA 4M43L 4X6EA 4TVPH 1H0DA 1YN7A 5CCKH 1BD2E 1I7RA 4FQIH 1A3LL 3QIUC 2XQBH 2RBLA 4D0CB 2I9TA 4JFZL 1MJJB 3VH8A 4I9WE 2WLZA 3MUZ1 5GGUB 4HIXL 1I1AC 2E7CA 2OQJA 3R1GL 2CO7B 4Y1AB 7FABH 4XVSL 1P7QB 2OTWA 1HI6A 5ACMA 2BJMH 3GSRA 1U3YA 4POYA 5LWYL 2DM7A 4KJWC 4M61A 4Z7WF 4TPRH 5F21B 3B6SA 3HKFA 2XTJC 3GSWB 2OM5A 3RL2B 3BAEH 2VXUH 4MYWB 3RBGA 2BNUB 3F7RA 1ZK9A 3F7YA 4V1DE 3QEUB 4JO1H 3FT2B 3S3SA 2X44D 5DDHA 5BV7B 1ONQA 5F6HI 5HSFA 1FZMB 3D0LB 3NACL 1KTKE 3GBNL 1MCCA 3NIGE 4ZYKB 2VSCA 4Y89A 4HWEL 5JPMA 3HZYB 1KTDA 4BSWB 2D31A 3G6JF 2JIXD 4X4MA 4Y5VC 2XZAL 1ORSB 4NPYA 5IFJA 3JV6A 5F1OB 3DHJA 3M8OH 3VRLE 4JE4B 4WW1B 3AU1A 5ACZA 1CGWA 4ISVB 4X80L 4PJ5B 4RGND 4P5MA 1PG7X 1F45A 2JIXA 4OGYH 4XAWL 2C1OA 5F88B 4IDJL 4NWTL 3I50L 3DECA 1JPFA 4X9GA 2XKSA 1Z5LA 4ZNCD 5JDSA 4MSWA 1NAMB 2VLRD 5EFIA 2HKFL 2C3VA 4U6HB 2C1PB 3WFCL 3CD4A 1J11A 3D18B 4X6FB 3QDHA 2LAAA 2JKXA 5GGQH 3O4LE 3OQ3B 3PHQB 3O6FB 4ZFOA 1HQRA 4TYUA 1MFBL 4M6NH 1P1ZB 4HUWB 4RIRA 1W0VA 4IJ3C 3BKML 4FQ1L 2Y5TB 1U8QA 2X4SA 5A16A 5TF1H 3MGOA 3VE0B 1PGRB 2C5DC 1OTSD 3MCLL 5DQDL 5FA4B 5GS3A 1UJ3A 4I0KA 1EV2E 2DBLL 3HR5A 3O11B 4OZHE 3FL7A 4P59L 4J6RH 4KMTL 3L3KB 4KAQL 5IB1B 1X6LA 4PRBA 5E8DL 1KACB 1KYOJ 4HDIA 3RY6A 1A47A 3BIKA 3EYOB 4PR5B 4Z9KB 4QXWA 1QO3B 4K9EC 4W6WB 2CRYA 3LKOA 4HMCA 5KSAB 1XCTB 5J6HB 1UXSB 2BNRE 3PHOB 4HFUH 5J56B 5C0NC 1I9IH 2AERT 2QADC 2UVEA 1DQML 5B4MD 3O3UN 4KUZH 4FOMA 5FXCH 4XP5H 1J12A 4KGLA 1KLUB 4OCLC 5E9DB 3O3DB 4RISH 3MRPB 4Z5RB 4AG4L 5IVXF 2IBBA 2JCCF 3V79C 2FJFB 3VDAA 4NNXB 1DFBL 2VITA 1U58A 2XN9A 4OD2A 3WNKA 5JDJA 3L7FB 5C0GB 4MJIA 2IAMC 2NZ9C 3U4AA 3JV4A 4CDHA 1LP9B 2XY2A 4LDOB 5TE6H 4PG9A 4EUPB 5EZIL 4YHMH 2C9AA 3ULSB 4K3HA 3MV8E 3BHBB 4LVHB 2X7LA 3LN5A 3TBVB 5J06A 1SMAA 4EUPG 4PJIA 1QEWB 5E2UH 4RX4A 3HAEA 3BE1H 3O2WL 3AXLA 2PKDA 4LSSH 5ID0A 1RULL 1U9KA 1LMKA 3LS4H 2A0LC 3VA6A 3GJFK 1NGZB 1I3RA 2XFXA 1P9MC 3O3EB 4X4YA 3HTLX 2A2QT 1KG0B 5AG9A 1XF4B 1SBBA 2CIKB 4JFYB 2JJWA 5HHOB 3VXRD 4H26A 4ODXB 4ZAKA 1E4KA 4HK0B 4OCSH 5DD0H 5FHBH 4JAMB 5GGSA 3RNQA 1FPTL 5IEKA 4JRYD 2J2ZA 3FQTB 4GRMA 5DRXB 3VXSB 1VPOH 4HIEB 2VH5H 4JDTH 4XWOC 4X6DB 1HZHL 1S5IH 2BZDA 3C09C 1IM9D 4JJHA 2M2DA 4ZNEE 3OAZK 4KVCH 2H32B 1CCZA 1UZ8A 4OLUL 1N7MH 4RMRA 4XHQA 3DHMA 3ZTJG 4X7CC 3MFGB 4ZFZB 3RZWA 2XZQL 3PG2A 4R7DA 3GHBL 1JPTH 1IM9A 2X4PB 3LHPL 4ZG1A 3ZSTA 1JK8B 3KYNA 1EAPB 1JZ3A 2P24A 4FQXB 3HUJB 3CDGB 5AAWA 2PTVA 3EYQC 4NRZA 4TSBL 1UH3A 5E5MA 2EDYA 1RJLB 4Y88A 3DMMC 1H8SA 3DUHA 4F7TA 2A83B 4YHZL 5CJOL 1F11B 4N68A 5FKAB 4L4TB 4FFYH 4P99A 2ENSA 1T89A 2K3TA 4YHKL 3ARED 3MO1A 1S9XB 2L4OA 3O2DA 5FM5M 3RWGA 3C5ZB 4UAOC 3DVIA 1DL7H 1U42A 1U8NA 3NA9L 3TBYB 3FQUB 1CL7I 2ADGB 5D7JB 4W81A 3F8UB 4OI9A 3BGFB 4P5TD 1S7WA 4CJ0A 2CLZA 1QFWL 3VFMB 4BELD 5FOBB 3LOWA 5LQBL 4QHKI 1BJMA 2EIEA 5J13C 1J5OL 1UM6H 4X9FA 1OT1A 1FE8H 2NTSP 4ORZC 3BESR 5ALBL 3M07A 1OT2A 3FN3A 5T1LB 3UTZB 4F57H 4X5WA 5JLZA 1X5FA 2BVYA 1KYOK 3DXAB 1TQCC 5EU3A 5JIHA 1BVLB 3NOIA 1CD1B 4OGAC 2F8XC 3ARFB 5L2KB 5E8OB 2I07A 1MAJA 4OKVB 3HPLA 3P77A 4HUUA 3ULVE 4R3SA 1ZT1A 1N6QH 3ARZA 2HTKC 5CJQL 5MEND 4M8QB 4H5SA 1MHHB 1UWEH 1IFHL 2OTPA 1BWMA 5FYKD 4RGOH 1IKFH 2F8OA 4F9LC 2WUBH 4K71B 1I9JL 1DVFD 3AC0A 4XAKE 1X4ZA 2O5YH 5CWSA 3TPKA 2ATKA 2F54D 4JKWA 2WV3A 1RZIB 2FX8L 3ROOA 1DDHB 1CI5A 3GGWB 2A6IA 5MHSE 5HVHB 5F9DC 1A7BA 4GXVH 3TH4T 2CMRL 3T3ME 1KCRL 3LH2L 1ZLUK 4JO2H 4B50A 3TT3H 1YEIL 1S7RB 4A6YA 5KSBE 2FH8A 2Q8BL 2W91A 4PY8I 1AFVL 3KPRE 4NWUH 1J05A 3UYRH 5KS9F 3T2PA 1KC5L 1WC7A 1II4E 3G6JB 5HPMB 3TZVB 1JYWA 2BC4B 2OCFD 3QA3B 3HS0B 2A9NL 5IB4A 5C0IB 3IKCA 4X5XB 2Q6WA 2FL5B 4JFDA 1BM3L 5D72H 5CEZE 4RDQF 4L9LC 1PG7H 3MRFA 3MLYH 1ACZA 5BS0B 1FIGL 5C0AB 2Y72A 5IB3B 3BFOA 4XMPH 4UB0L 1NGWA 4ODVL 4XNQA 2NX5E 5DF0A 3PL6C 1PD6A 4M3JA 3EO9L 4S1DD 3SPVA 4IOIA 4EVNB 4WHTA 2QHRL 5ENWB 1F13A 1QSVA 3BUYB 3MFFA 3UTTA 3KPQA 1MIML 4DFIA 4HBQA 4IMLB 1CU4H 3KXFD 5DHVH 3CFCL 3ULVH 1BFOA 1G7IB 3CIQA 4WV1C 3KYKH 4WEBH 2ADJA 3WNPA 4MD0B 4EI6B 5J12C 4C59B 2VDLL 1CG9A 1ZVSB 3B9EA 2PYEA 4KK8D 1ES0B 4OLWH 2APWA 4K55A 4K7PL 1FBIH 1F4YH 1MF2H 2UZYB 4AMKH 1UCTA 3ARXA 5DJ2A 2PW2A 2AGJH 5CBAA 4NKDB 3X11B 1AQKL 1INEL 2QQKL 1MI5D 2WBJA 3KPSA 4LCYB 4WFGD 4OGXL 1X4XA 5GISH 3EZJB 1YA5A 1YEGL 4GG6B 3BN3B 4Y19E 5D7LB 1B0RA 1Q8MA 2HG5A 5IKCB 3K8LA 1I75A 4NP4L 4NZTH 4GBXA 3B2UC 1P4LA 4PJEE 3J7HA 3NIFE 3QI9D 3PWVA 3AMLA 1OB1A 2QEJA 1BQLH 1MWAA 4P46B 5E1AA 3LEYL 3LN9A 1YN6B 3GJFB 5CEZH 2FWOA 4P57A 1JWUB 5LGJB 3TWCL 5C2BH 5JMOC 1U8KB 4QXGL 1BJ1J 4MA1C 4OZ4B 1AQDB 1BZ9A 4XPFH 2X9WA 1NMAH 2FJHB 4Z77B 3L6FB 1EVTC 1RJZA 2JCCB 2VZVA 1EBPA 2R0KH 3TCLB 2R2BA 5TH2A 5FO8B 3HI1B 3OWEA 3RVWD 1GGIH 1VFBB 5IBLC 3MUY1 4AM0B 1U3HC 1DJSA 4G9FD 1F02I 1NUDA 1G7PB 5TDPA 5L9DH 3MSPA 3Q2CA 2Y6SC 1CFBA 1UC6A 4AIOA 1V3MA 5DYOB 2FEEI 5TGBB 4LARH 4UT6H 2QBWA 1KN2H 2VUOA 4G5ZH 4KZDH 5EBWA 3GRWL 1G9MC 3ROLB 1B0GB 1QOKA 3DV4A 3CC5B 2XWJB 3P4NA 1M6OB 1KBGL 2R23B 2BNQD 2AJZB 2P46B 5E2VL 3L5WB 4LSPL 1WBXB 5D1ZA 2Z31B 1HEZA 4PB0L 2P5WD 3ULUE 4NUJA 2ZUTA 5J6GA 1FL6B 1FLRH 3CSYB 3S34H 4YZFE 3U1SL 1IAOB 3MBED 3QNXA 3SKJL 3D85B 4JGMA 3IDYB 3QEQB 1KJVA 5HYSA 5I1JL 5AG8A 3QPXH 5DMKA 3CXDH 3OXSA 2AJXL 2H9GB 4ZPTB 5I75C 4BZYA 3K80A 4FQPA 3A6OA 1OWRM 2FB4H 4R7NA 1JRHL 2BMKA 3UTSE 2VDMH 3F65A 3MBEA 3QHTC 1PZ5A 4WI4A 4UU9A 1N64H 1RHHA 5DD1H 4XHJD 1TJHH 2ZJSH 2VIRA 1AKJA 3TJEL 5IMOB 4FXKB 2RIKA 2EYTB 3HFMH 3MRGA 4WU5B 1DBJL 5IQ9A 2RAMA 2E6PA 2FCBA 1QR1A 2ZSVB 5L8JB 4OFDA 1LK3L 3KDMB 4Y16C 4DKAA 3IDXL 2AABL 1VADB 3EW3B 3DUSB 1YPZF 2VABB 4UILH 1UVQA 3CJJA 2AKRA 1V05A 5SWZD 3HPJB 1H3PH 4LLMA 3RIAF 4I18C 4CU6A 3C60B 1LK2A 3LSOA 1RVFH 4HPOH 3RHWF 1NCNA 2XTLA 1LEGB 5DJCB 4M8VA 3AUVA 2DQUL 1T7VA 5JR1L 2A6KB 3BGMB 4ZUVB 4QHKJ 3B9KC 4HCRL 3ARDB 3B5HA 4LEOA 4XNYH 5D7IE 1WZLA 3P40A 3FQWA 1YMMD 3OGCB 3TIEB 4JRYE 5F7EL 1EGJH 4Y5YC 4JG0H 3ULUH 5T1KA 2NNAB 1A7PH 3C2AL 3QQ3B 4GLRI 2AQ1A 2DD8H 3DURA 2D2OA 2ICWJ 1RK1B 4BH8A 1C1EL 5I19L 2DQCL 2F53B 4ZOBA 2P45B 2R2EA 2E5EA 3RWIA 2Q87A 3LKNB 4KI5D 5B8CC 4Z76A 4ZXBA 1FVDA 2H2SC 2R29L 3EYVA 2CKBB 5GSRB 4KQ3H 1R0AH 4TOYH 3O41B 4KRPC 1EHXA 4X7TB 3BP4A 4PJ9C 1U8IA 3QDMB 2R4RL 2KDGA 3QISA 2W0PA 4LAQH 1DEDA 1FYTD 5K9JL 5FV1L 4PGDA 4GS7C 1OLLA 2BY1A 4NBYB 3TA3C 3MV9B 2NY6D 3DVNB 3CLFL 3WDIA 4EDXA 2VDQL 1WSST 5EA0H 5BJTB 3ARVA 4PY8J 4R26L 1HKLL 1T4KA 3Q6GH 5D93C 1H5BB 1QFUH 3CFJA 1NQBA 5CZVL 5KS9B 3EDEA 3WLWD 3L3HB 4IDLA 2W59A 5I74B 3EZ8A 3I2CH 2NW2A 2AJVL 5DD5H 4CN6A 1LNUB 1NCTA 1PJ9A 4RNRA 1YQVH 2GUOB 4LSVH 5E1HB 1CE6A 1OPGH 4NQCA 2MCPL 1S7UB 1WCBA 2X70A 4N0YL 6FABH 2HLAB 1ERNA 4TSAL 4PJEF 5KSVA 1CS6A 1XGQA 4KK9C 3RGVB 3HCVB 3JTSA 1R3IH 3VFSA 3CK0H 3DRQA 4L8CB 4IS6A 4MQ7B 2HFGH 4O02H 4KWUA 5CIPB 4NRYA 5EWIH 1OAKH 1NLDL 4WHDA 1CLZL 4JFOB 1A2YA 2VN7A 4D0DA 3TO2B 5KJRL 3SJVB 1ZT7B 4UTBH 1F6LL 2YD9A 4XVUD 1KOAA 5HHVH 4XPAL 5GRWA 2MQ0A 4X99A 3ZDXF 2HMIC 1BD2A 5FA3B 4E42B 5AZEH 5J1TC 3EYUL 3MRMB 1QRND 3KLHD 4LGPB 5F89A 4OZIE 5GRJH 5KVDL 1AGDB 4KHXL 5BW7A 4R9HA 5ISZB 4DKEL 4L29B 1N8ZB 2EYRA 3QCTH 4KTEL 4KVNL 2EH8L 4M7ZC 2HT2C 1YEEL 1YNTB 3IFNH 4ZFFB 1EPFA 1A64A 1A1MB 2XACC 4E0RB 1FL5A 2WWMC 1FO0B 3BIAX 4XNMA 3P73B 2X1WL 1K4CB 1EZVX 3J8F7 3B5TA 3ES6B 1Q0YL 1W2KT 1D5MB 3MR9B 3BZDA 3LEXB 5MI0C 4DK6A 1GJIA 1LO0H 2X42A 4WWID 4YDIH 4PJBE 3MJ6A 3VXTB 4V1DA 5JZ7C 2BDNH 3RJDA 2AJUL 4MJ4A 4XPGH 1QSFB 4S0SD 1CLOL 2DQJH 4NJ9L 5JMRA 2VDKL 3FONB 3THML 2YZ1A 3B43A 2VDOL 3PDGA 1JNHA 4L4VD 1KLGA 4JHWL 4G3YL 1NFIB 1QPXA 4FTVB 3QH3B 1G6VK 5HY9A 1IRAY 1NGQL 4JM2C 4N9GA 1A6VL 2V7NA 2J3SA 1T0MB 3FAWA 4QRUB 2M26A 12E8L 5JOEA 3C08L 3V0WL 1AP2B 3T0BA 2B0SH 4L4VA 3D2UD 3SGDI 3RZCB 3D3VE 4ZTOL 3WLBA 1KJ2L 1MFDL 5D1XC 3BIBX 4MJ5A 3OX8A 3GI9H 1EFQA 5IBTL 1ZTXL 5HPOA 1MHCA 2E9WA 5SV3A 1XF3A 2OTUA 4KV5F 1IGTB 2F19L 2PO6C 1BFVL 3E2HB 3O4LA 2R2HB 2VXVL 4OF0A 4P2RD 2GK0B 1QKZH 1KSRA 1IQDA 1EO7A 4U6YA 4KZEH 5IMKA 1WK0A 5D7SL 1H3WM 1AIFA 3QZWA 3SDYH 3EYFA 1A9EB 1SEQH 3QRGH 3PWLB 5HHNA 3OZ9H 4NJAL 1QBAA 1ZGLB 1KXTB 3EFDL 4IIQA 4ODWA 5DJDB 2FX7L 1N5YL 4PJFE 3QEGH 1S9YB 1WZ1H 4OLZH 3SE9L 5H37H 5M7QA 1HQ4A 4NYLA 4F8TA 1MFAH 3UTPE 5IP4A 3L3IA 3OAUL 1BREA 1NEZA 4MNGE 1R5IA 4O51A 2MMXA 2CRZA 1JMZA 2WQRA 2BNRA 3QQ9C 4FQLL 1TVDA 3MA7B 3DX7B 1MCPL 4Z7UE 4WFFE 1CFNB 5EORL 4FQJL 4XBPA 1PY9A 4FZ8L 4FXGA 4JVPA 1MUJB 3EO1B 5I1IH 4JY4A 1OGAD 1XGPB 1WBZA 5E7BA 5F70A 5IW1A 2BSTA 5CGTA 3JSSA 1CDUA 2V7HA 2VAAB 1BBDL 5FM8A 5EO0B 2Y25A 5IJVA 1F6AB 3F58L 4L8SA 4NT6A 3ZKNC 3FFDB 2BOBB 4PRHE 1AD0A 3BO8B 2V5TA 4WWKD 4PJAE 2FD6L 4JQVC 1YPZB 5GJTH 2ILLA 5F7DB 1QYGH 2LTQC 3HA0A 2DM4A 5BOZG 4PREB 3RY5A 3U9UA 1MCKA 2VQ1A 5CKAA 4HIIA 2W0FA 4XPHL 3KPNB 1AY1H 3QNYB 1CD8A 1S78C 3QAZB 5AUMA 3QWOA 4UBDD 5J11C 5TDOA 4LSUL 4APQA 4KPHL 2NY4D 3TBSA 4HWBH 2P5WE 5KW9L 4LCUB 1OAYL 1AXSA 3IFOB 4X6EB 4NQTA 5I8EA 4L4JA 1AGBA 4WNQA 1H0DB 4CL7A 4U6TA 5J4MA 1YN7B 4X7EC 4CKVX 2EH7H 1I7RB 1H3TA 2QL1A 1T2QH 4G43A 3V6FA 3BH8A 4GKNA 2H2PD 4RBPH 4OT1H 1EIBA 3D9AH 2I9TB 5D2LF 2PUQT 3VH8B 3V6OA 1E4JA 3MZGB 3NH7L 4LLVA 1XEDA 2OQJB 3RTQC 5F7FA 3K4DA 3EAKA 3IKKA 2ZCLH 2OTWB 1HI6B 3ARBC 3R4DA 4OAWA 3SDXE 3GSRB 2ORBL 4Y5XC 2I9LA 4M61B 1I3UA 2IADA 3WJJC 4LRIC 1NGPL 1F4AA 3B6SB 4JRXD 1FIEA 4ZNEA 4KUCD 4UT9H 5FGBA 2R0WH 4MAUL 3F7YB 4N0UA 2PN5A 5DDHB 1ONQB 5EG6C 2Z9TA 2CUHA 2VLKD 3ZL4L 4AIXA 1NGYA 1PEZA 5JPMB 3LV3A 1KTDB 2D31B 1CGXA 5M95B 4NPYB 3P0VH 1FZOA 5IFJB 3JV6B 1RIHH 3WDJA 1CT8A 1BQHB 3AU1B 2EIZA 3L5XL 5ACZB 1XAUA 1YNLH 4YX2L 4WTZA 4P5MB 1YMME 3RA7L 4CJ1A 5I1DA 4HT1H 2JIXB 5JIPA 4PJXA 4JQXA 4P49A 3SDCC 3EDDA 1YJDL 1BQHG 2C1OB 4MNQE 1I4FA 3H9SE 4P4KD 4NCC2 3MLVL 4M9PA 1I3GL 1JPFB 4G8FA 1Z5LB 5JDSB 4MSWB 4JFFA 5JXEA 5EFIB 2C3VB 3U7YL 5I1GH 3BKYL 2LVEA 3SQOL 1EO8L 3ALPA 4IRJC 2I5YH 3PHSA 4P4KA 4F2MA 1OTTC 2XG4A 5LVEA 2CDFA 5J3HD 4ZFOB 1HQRB 4JO4H 4RIRB 4YC2C 3RVUD 3NZ8A 1W0VB 4M7KL 3VWJC 1EDQA 2ED9A 1U8QB 5D1QD 2X4SB 2VERN 3EIFA 4K9EH 5A16B 4R90H 1FYTE 3MGOB 2JJSC 3L95A 5BMFL 4QTIH 4HUKB 1MJ8H 2CUIA 1UJ3B 3HR5B 5DHVA 3O8XC 5DUMH 5DK3A 3OPZH 4PRBB 4AYFA 3MQIA 4EN3C 4HDIB 1S7QA 1A3LH 2F5BL 3LKQA 1ZV5A 5DVLA 2PXYD 3BIKB 1UA6L 4YHNA 1GGTA 2O61A 4JFZH 4JPVL 3LKOB 4NC1E 3VMPA 5DD3H 3K7UA 4HIXH 4P23D 3G5YA 3CDCA 4NBZB 4Y4HA 1PVHA 1HN1A 4F7PA 2YS4A 5KSBA 3WUWA 1FGVL 1WICA 3KPRA 2AEIT 3SDAC 1NEUA 3ZKXB 1HYSD 1T5WA 4P23A 2P5EA 5EOQL 4OUOA 5F7KC 3VFUA 4S10A 2NZIA 4NHCL 5C2UB 4GQPH 5KVEL 4QNPF 1FNSH 3BDYL 1L7TH 1TLKA 2VITB 1U58B 2OMBA 2XN9B 4OD2B 3KR3H 3NACH 3NCEB 3GBNH 4NNYA 3IXAA 4M7JL 2VLJE 4MJIB 1RURL 2NX5A 3JV4B 4HS6A 4HWEH 1UT9A 1QRNE 4PG9B 2XZAH 4P2CG 4LGSB 4DN3L 2HKHL 3V7MA 1IGIH 5F7LB 2MPAL 4ZD3L 1RUML 2X7LB 3LN5B 4X80H 2IPTL 4PJIB 1U95A 5SWSE 3HAEB 3AXLB 5ID0B 4CMHB 4L1DA 1FFNA 3ILQC 4TSCL 1T5XA 4HAGA 4IDJH 3S7GA 3I50H 1I3RB 2XFXB 4R2GC 3C5JA 4X4YB 5D96B 4MQTB 3HAEG 1BVZA 4UMGA 2HKFH 4KK6C 3VWKB 3OF6A 3I6LE 4FQQA 2QV2A 1QLFA 4H26B 4ZAKB 2Q76A 3QFJE 1V7ML 3MLXL 5GGSB 3RNQB 5IEKB 2RFXB 4OZFG 4GRMB 1MFBH 4Y19A 4MD5A 1IQWH 4HKXA 4Z95L 1RZ7L 1RMFL 5E2TH 3VMOA 1JF1A 2FHBA 1YY8A 3VXME 1UZ8B 3MCLH 3SCMC 3E6HA 4JRWA 1HK6A 2KQNA 2DOCA 4H88L 1CL7L 1R3HA 4MX7A 4KMTH 4P2OA 1J0JA 4R7DB 3F5WA 3UAJC 4JHAH 4NNPL 1INQA 3KYNB 2P24B 1K8IA 2GJJA 4XC1L 4JZOA 4NRZB 5CZXC 1MCIA 4RMQA 5E5MB 5ADOL 3CXHK 4F7TB 1VCAA 4WO4A 4BQ8A 3CFIC 5L0QB 4HK3N 3MO1B 4OZGF 2BK8A 5MP6L 2BX5A 1DQMH 2FO4A 3RWGB 4E41D 4RA3A 4XMKH 4TTDD 3TN0A 1U8NB 4QRQA 4PJDE 5DO2D 4BK4A 3WL9A 3Q1SH 3G5XA 4XNXH 4O4YH 3GKZA 1KNOA 2NXZD 5C0FA 1S7WB 2CLZB 4MAYD 1L6XA 1I8LA 4GRLD 3BJ91 3QQNA 1EUUA 2AJYL 3RGHA 4WUUD 2DBJA 1DFBH 5F9OH 5IHZA 1OAZL 1ZE3C 2HT3C 1KULA 4X5WB 5JLZB 1E28B 1UJTA 5H94A 5BQ7A 1NAKL 5EU3B 4MAYA 2WINA 1AXTL 5GRYA 4FFWD 3WFDL 2F5AH 5L88H 2I07B 1RAMA 3HPLB 3P77B 4HUUB 5JXAL 4R3SB 1ZT1B 1MQ8A 1EGJA 1S8DA 4H5SB 2ZZUT 3O2WH 1G9EA 4TVSa 3I3EA 3V8CA 2DLGA 4KI5F 3VW3H 5CWSB 2ATKB 5IHLB 2DYPA 3EGSA 3MLWL 2IALA 4GO6B 3CAFA 1KENL 3ROOB 2P1YA 4G8GE 1B6DA 2A6IB 3BPOB 4PTUA 5DA0B 1D3CA 1HH9A 2EXYD 3BPLB 4U1GB 5MEQA 4A6YB 5EUOE 4GAGL 2P48B 1ZVHA 5T5FL 2DKSA 1J05B 1PX4A 1UH4A 2WAHA 1HZHH 5BV7L 1BVKA 1LO4H 1WC7B 1PZUB 5JOPE 3AVEA 1F4XL 4D3CH 1IKNA 4OLUH 3RL1A 5IB4B 1SYSA 3IKCB 3ELAT 2Q6WB 4JFDB 3FKUS 1NCDL 1MPAL 3MRFB 1GAFL 3LHPH 1HYRC 4I4WA 2J8HA 4JDVA 3ZE1E 1X5KA 1ZEAL 1NGWB 2YD4A 4XNQB 2H1PL 4YBLB 3PDDA 3WHE1 3SPVB 4IOIB 3ARGA 4TSBH 4WHTB 4WY7L 2EDTA 4ONHA 1TCRA 4GAJL 4WFED 2QLVB 3MFFB 3UTTB 4ODTL 3KPQB 5CJOH 5ESQA 5KOVC 1NAML 1BFOB 5EC1A 2N7AA 3ETBF 3QWRA 5B3NA 2ADJB 3RFZC 2B1HL 3NA9H 3TYFA 3BPCA 1J8HA 1ZVYA 1CG9B 5KANI 1U8PA 4PD4J 2PYEB 5CSZA 2CXKA 4Y4FC 4WDIA 1JGLL 1QFWH 3EDJA 5DJ2B 2Y06L 4QOKD 4UIKH 4DVRL 1JVKA 2PW2B 5CBAB 3KPOA 4P48A 2WBJB 2XXMB 3KPSB 1J5OH 2NY3D 1EEUA 15C8H 4Z7NF 1R24A 5ALBH 4NFDA 1ZWIA 4DEPB 1D5BA 2QSTA 1B0RB 2HG5B 3RDTC 3C6LA 3TBWA 3KYOA 4GBXB 1P4LB 1XIWD 2GK2A 3S36L 1AE6L 3JWOL 3QIBD 4JQIH 3PWVB 2AI0H 4TNVF 1OB1B 3REWA 1MWAB 3JTTA 5E1AB 3PNWA 5FUOL 3FB6A 1IFHH 2FWOB 3E6FA 4P57B 1XIWA 1ZHBA 2P47B 3TO4A 1I9JH 3HNTL 2BHYA 4PRAA 1KEML 1BZ9B 4KKNA 2AW2A 3ZTNH 1I9RH 3QUXD 1CFQA 3SDDC 3U9PH 1MCRA 3MOBH 1TTFA 4YGAB 5EIQA 1RJZB 3HG1D 3PWPD 3BN9C 1KCRH 5I9QC 1DLFL 2R2BB 5KSUA 1YEIH 5TH2B 3VI4E 4G6KL 1XH3A 3IU3A 1AFVH 4LRNH 3WIHA 1G9MH 3PXJA 3DSFH 2JELL 3HC3H 5KAQG 4Y2DC 4NO5A 4I77L 4NFCA 2X2YA 5A2JH 3KS0J 5TDPB 1DN2A 1MOEA 2HP4A 4ODUA 2ZSWA 4PGCA 4I5BA 3HNVL 4YPJA 3ABZA 1TZGH 3HMXH 4UB0H 1BFSA 3GUTA 5EBWB 5C3TA 3RKPA 5DZLA 3DV4B 4G8IA 3EO9H 4LLQA 2G2RA 2ZOLA 3P4NB 2QHRH 4WCYL 2OL3H 4YHLL 2ITCA 4Y4KD 3KYMA 4ORGA 1OP3H 1MIMH 1YNKL 5D1ZB 2FJGA 1BIIA 1HEZB 3CFCH 1A5FH 3C9NA 2D3VA 4D9LL 1HINL 1SJHA 4PJDF 1G7QA 4NUJB 5J6GB 1TXKA 1MH5B 3O9WD 5D7KD 4O9HH 2UY6A 5IESL 3BQUB 2VDLH 5HJ3A 4R4NC 3QNXB 2HTLC 5HYSB 4Y4KA 1KJVB 2NR6D 5I16A 1WV7T 2B7DT 4H20L 5A2KH 5DMKB 5CKGA 3OXSB 4KDWA 2P7TA 2GFBA 3O6MH 4BFEA 4LPXA 1JPGA 4R7NB 2BMKB 1INEH 5DGQA 5HYSG 1CE1H 5E2WL 4PJBA 3MBEB 5JORA 1PZ5B 4E9LA 4UU9B 3KJ4C 3SGJA 1RHHB 3RWCA 3UDWC 4HV8A 2FBJL 2VIRB 3MRKA 1AKJB 3WKNA 4C56D 4NP4H 4G6AC 4XRCA 3MRGB 5IQ9B 5K9QI 1NL0L 4LCWD 1JZ4A 1QR1B 4XPTH 3U30B 1CICA 3QPQC 3U7WL 2R9HC 1EHNA 3DPBA 4JM4L 1UVQB 5C6PB 1F90H 4R97B 2AKRB 1XF1A 3X3GH 4QXGH 1KTLA 4LLMB 3DO7A 4M93C 3U4BL 2ZCKH 4YWGH 1LK2B 3IYLW 3LSOB 1PYWA 5C0CA 3D3VA 3QQ4A 2YXMA 1MY7A 2C26A 4J4PC 4UOW1 1NJ9A 1RI8A 4KKAD 4LEOB 4H1LH 3U0WH 1A6UL 2VXSL 3FQWB 43CAA 2P8MA 4HX1A 2VL5A 5T1KB 4POUB 1IC5L 3RWFA 3VD7A 2WM0A 3DURB 4O58L 4BH8B 2N7BA 2AXHA 2R2EB 3RWIB 2BVEA 4NC0B 1C12A 3L1OL 4XMLL 1I1AA 4HWBA 1PKQA 4Z76B 1NSNH 4ZXBB 1EFXA 1FVDB 1M1SA 3Q3GA 5SX5H 4PJFA 3V7AE 5FKPA 3EYVB 1ZA3A 1VHPA 4R8WL 4NZJA 2GY5A 3GRWH 5TE7H 1QBBA 3BP4B 1U8IB 1NCWL 43C9A 3L5HA 1G7LA 3AS0A 4EI5C 1KBGH 4MNGA 3MA9L 4LL9A 2Y23A 4P4RA 4PGDB 4KKLD 4S1QL 4ELKA 5E2VH 1IC7L 1A3RL 2W9LA 4UQ3A 5D71H 1JHLL 4WEMB 4EDXB 3DETC 5A2FA 1T4KB 1JYVA 1AGFA 3TYGL 4E41E 1DSFL 1RHFA 3CFJB 5I0DA 4KUCF 2I25N 5DFWH 5ESAA 4HLJA 3BZEA 3NABL 1RQ5A 4P3CH 5I1JH 4LHUG 1RZJC 4Y5VA 1TPXB 1RZFH 2NW2B 1UH2A 3GIZH 2CIIA 4OFIA 4Z7VE 5FEBA 4R4BA 1KIRA 3MRBA 4RNRB 4NQXA 1JRHH 4PRHA 1CE6B 4NQCB 3IFPA 5EBMA 2PCPA 1FVCA 1WCBB 2X70B 3E3QC 4N8PA 1XGQB 5KSVB 4PJXF 2WMPA 3JTSB 3VFSB 3TJEH 3DRQB 1IILE 3VMNA 3UZVB 4IS6B 3KHQA 1YY9C 4QEGA 4NRYB 4WHYH 2VNCA 3MRDA 3P0GB 1FZJA 3DX6A 1A2YB 2W9DL 4HZAA 5E5UB 1UADC 1CDCA 3MYJA 4NN6B 4D0DB 3HI6L 5GZNC 2AABH 3PJSA 1DUZA 1QD0A 3KPPA 3GSQA 4LFHD 2FBOJ 3MLUL 4ODSL 4JFEE 3A6BL 5D9SA 1UB5A 4EQ3A 4NZRL 1NCCH 4X99B 4NUGL 1BD2B 4U31A 5EDXA 4XZUA 4K94L 1D9KC 5F89B 4FQXC 2LAGB 3OB0H 1BFTA 4NFBA 3BEWA 3QHFL 5JR1H 2EYRB 3MODH 4HCRH 5ANME 4ONFL 1QP1A 4EOWH 1NCUA 2Q7YA 2UZXB 4YDKL 5TPWH 1SY6L 1C5CL 1NCAL 3SDXA 1FL5B 2QADD 3C5ZC 4XNMB 3CVIL 4F37K 2YK1H 5I19H 3O3AA 1ZAGA 7CGTA 4U1JA 5F1KC 3V5DA 2HVJA 1KEGL 2EECA 3ECBA 3K1DA 1J1PL 3CFBA 4PYGA 4V1DB 2R29H 4LPWA 4ODHH 1A1NA 4MD4A 2W9EL 4K2UL 1SYVA 2R4RH 3FQNA 5EU6D 3L3DA 1KCUL 4WI6A 1PFCA 1TITA 4RMVA 5K9JH 1IGJA 3ARUA 2VLME 4RGMB 1QSED 1T0NA 1JNHB 2R0ZL 2ITDA 1KLGB 2N1KA 2C7UA 4ETQA 3MRRA 4PRID 5HY9B 4NHUA 3TBTA 1HKLH 4YGVA 4N9GB 2V17L 1WFTA 3SGKC 2V7NB 2IAMA 1I85C 3X3FH 1EXUA 3GMQA 1DQDL 4U1NA 4L4VB 4HSQA 1MNUH 2A77H 3W0WD 3WLBB 5F8QC 4MJ5B 3OX8B 4PV8A 4LEXH 1MHCB 1A6WH 1XF3B 2OTUB 1EJOL 1AGEA 3Q5YA 1FV1A 1XF5A 2MCPH 3KAAA 4QY8A 2NY0C 3O4LB 4QRRE 2AJSL 1NMBL 4N0YH 1I7TA 1U6AL 4XBEL 3V52L 1SQ2N 1IQDB 4U6YB 1J88A 5IMKB 5I8OL 2GYSA 1IZKA 1AIFB 1P9MA 3QZWB 3OAYH 3EYFB 4HULB 1NLDH 1OAXL 4C58B 5IVZA 4LLWA 4PTTA 5HHNB 4WU7A 1S9VA 3QZWG 5KJRH 4IIQB 3DTXA 4ODWB 2R0LL 1RD6A 2W65A 1JNNL 4ZS7H 1Q9OA 5I1CL 4KROD 5JW4M 4PJ7E 2VDNH 3FFCD 2R1XA 2DRUA 1HQ4B 2NY1B 4NYLB 4RAUA 4Z18A 3EYUH 5CD5C 3L3IB 2FEDD 3MLSH 2IFFL 5F7YC 5KVDH 1NEZB 4KHXH 3WO4C 1KUMA 1R5IB 3MRNA 4DGVL 4O51B 4J3SA 2VR9A 2EC9U 2CLRA 5D70L 1D5IH 2J6EL 2P8PA 1IARB 3GBML 5BVPH 3MLRH 2BNRB 3HG1E 4KVNH 4XBGA 5EZOL 3P30L 3RI5F 4HUMB 1QACA 4XPBH 2DM3A 4XBPB 4FXGB 1KPVA 4KKCD 4JY4B 1SVCP 1CZ8H 3LPWA 4Z8FL 1WBZB 2NY2D 4U3CA 5IW1B 2BSTB 3F7VA 2DQTL 1EA9C 4PJCF 3OKMA 5FM5O 2V7HB 1TFHA 3DMMA 1S7XA 1IAIL 5C0BE 1Q0YH 5IJVB 4L8SB 4NT6B 1AD0B 4ZFGL 3QDGA 4NO0A 4CGTA 5D8JL 1SM3L 3IDMA 4LSTL 5CMAA 5GS2H 3VG9B 3B9DA 1PSKL 3U4EA 4NJ9H 2RCSH 2EDFA 1FDLL 1C7TA 3WFBH 3THMH 2XWTA 3U9UB 3WHXA 5M94B 2VQ1B 3GHEL 4HIIB 2ZUSA 5HYEA 2W0FB