4Q9BA

Ignar antibody domain c2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
101
structure length
101
Chain Sequence
SEIAVLLRDPTVEEIWIDKSATLVCEVLSTVSAGVVVSWMVNGKVRNEGVQMEPTKMSGNQYLTISRLTSSVEEWQSGVEYTCSAKQDQSSTPVVKRTRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Novel antigen receptor
publication title The structural analysis of shark IgNAR antibodies reveals evolutionary principles of immunoglobulins.
pubmed doi rcsb
source organism Ginglymostoma cirratum
total genus 19
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4q9bA00
1QSEB 3H7BB 4U1IB 5TQ0L 3VFMB 3VMOA 4OD3H 5HJ3B 1IQWL 4P46C 4HPYL 4LLQB 4DQOH 5GZND 5KANI 1XR9A 4ZDHA 1UWEL 3NCYS 4P2OC 1OAQH 3K7UA 4GG8B 5SV4A 4S1QL 3MLWL 3I2CH 3SE8H 3V52L 4P5KA 3P3YA 4KI5F 5JTWA 5D70H 1VENA 4JGUA 3BEWA 4I18A 4JCLA 4MXVE 3BAEL 3DETC 4PR5B 2P46B 3ROOB 3NCEB 1MJUL 4MYWB 4YPJA 1QBBA 2O5YL 4D9LL 4LF3A 5C0AA 2B2XH 2KQNA 1MCSA 1BJMA 5HY9A 5MEOA 4DCQB 1WFTA 4PJHF 1UH2A 3D5OF 4X80H 3MTRA 3OKMA 2J6EH 1MI5A 1RJZA 3RX5A 5J3HD 1XEDA 1C1EL 1IAIM 3SKJH 5IMKB 5B8CA 2HFEB 1RV6X 4MA1B 3ZTJG 4X4ZA 4XPBH 1CICD 5FYJD 1IKFL 1TNMA 4XNXL 4TSBH 4OCXH 1E4XL 4MA7H 1C5CH 4U4BA 4XH2A 4WFGE 4HT1H 3AAZB 2F15A 1A6UL 4YHNA 2KH2B 3HLAA 1EBAA 2OQJB 4FQJH 4HV8A 1W72B 2CLRB 2IF7A 1LP9B 1Q72H 5FHAH 2EDRA 3RVWC 3UTOA 5LGJB 1IGML 1MCEA 4MAUL 2NY7L 4BKLB 4LARL 4Y0GA 4L3EE 1RIUL 1OTSC 3AREA 3QPXL 3QUYD 4YHIB 3MLSH 1NAML 5E1HB 1CBVH 1RY7B 4QHNB 5C08D 4LASH 5IOPA 4K9EC 3DARA 3VA2C 4HXAH 4JRXA 2OL3A 4F7MA 2VLKD 5DEZA 5JW5B 2UUDK 3VGHA 4KVCL 4HEPG 2DQIL 5CGYD 3OKDB 1JPSL 4GS7C 2NPLX 4XXCC 2X2YA 3GMRA 3LVEA 2YMXL 4QXWA 4F7EB 4Y4KA 4KZEH 3ULVC 5DFTA 1HILA 1JPGA 3RPIA 3F62A 4POYA 4YBHA 4ZUTB 2FBOJ 2IH3B 2O5ZH 4Z78B 4WEMB 4XNUL 3WIHL 4ODSL 1UA6H 3QQ9D 1JGDB 2NZIA 3RGVB 2E7LC 1RU9H 3FONA 5C0ND 1F4YL 3FO2B 4XAKD 5IHUH 3ULUE 1TVDA 3U30B 3OKKB 4PP1D 3D69B 5HYEA 2WV3A 1VFBB 3G04A 4RX4A 4LHUB 3F58L 2DWEA 2P5EA 5DD6A 2X1QA 4M93C 4ZXBC 1BQLH 2DMKA 1VKXB 4D3CL 3FT4A 5J7CC 2BSRB 2A2QT 4G5ZL 5JOEA 5GGTA 3VXMD 3I9GL 2DICA 1FNEB 1HSBA 1NGXA 4PREB 3W9EB 2PO6A 2JJUA 4HWNA 2Z93A 4MLIA 1MQ8A 3DXAA 1GZPB 2AV1B 3HZYA 5K9JL 1U2CA 3TJHD 4ODUA 2IQ9L 1IM3A 3GSXA 5CKGA 4Y1AD 1IM9D 4QRQB 1OF2B 4HCRH 2H6PB 3DX8A 4NO3B 3MCLH 2IPKA 1DBJH 1Q38A 4IHOA 3QJHA 3T2QA 3MLUL 1OAXH 4XPGL 1EEYA 5HHMD 1KN4H 2X4PB 5D9SB 1HQ4B 1BVLA 4YHPA 5I16A 5JQ6H 3OTTA 1T7ZA 1AKJD 4NUJA 2FGZA 3P0YL 1KPRB 1KIPA 4P3WA 2DKSA 2XA8H 4BUGA 1GOFA 1N59B 2AXGB 2P5WA 4GXUM 1TETH 2VQ1B 1W0VB 3BT2L 4XI5C 2XQYK 2YN5A 3Q6GL 2AJ3A 4G9FE 4N1CA 3GSOA 4NKIH 3TV3H 4BQ6A 4DGVL 4HUXA 1D5MB 2VISA 3HE7C 5DRZA 1LP9F 4GW4B 2CMRL 3KPSA 3OJVC 1XGQB 4HULB 3QI9A 5JHDA 1DL7L 3TIDA 4MAYA 1FNSL 2VXQH 1NBQA 2ZSWA 3RUGE 3VI3F 3RJDA 5C0CD 2CRIA 1BFSA 4BFGA 5T3ZH 5L9DL 1UZ8A 2AJSL 2EDDA 3HNSL 3BQUD 5KOMC 5AWNL 4H88H 1R6VA 1KN2H 2R2HA 4KV5E 1RZKC 5E2UH 1YPZA 3EJJX 1B4JH 1UM6H 4M5ZL 4UB0L 1CICB 3WFHA 1ZGLP 1X5AA 2ZNXA 1MFCL 3BRFA 5BRZA 3BDYL 3NPZB 5DJ2B 4U1LA 1PKOA 4XP6L 1KJ2L 1KCVH 1Z2KA 5E2VL 5IUSA 1NANH 5IT2H 3SO3C 1DUZB 1CLYH 3EYVA 5IMLB 3R8BB 5F7DA 4JFQB 4LDEB 2JB6A 1T0MA 4L8BA 4ZFFA 1H5BB 3BKJL 4NKOA 1J1OL 3HAEH 1KIQA 3BKCH 4LCCA 3QUYB 3QWRD 1I8MA 3O81A 3K4ZA 3I6LD 4G6KL 4HXBH 2BRRH 5DUMH 3ZKMD 1Q8MA 5H35B 1JZ7A 5C0BE 3AM8C 2O26U 3QH3A 2YR3A 2A9NH 1NFIA 4YHKH 2JTDA 1TQCB 4C4KO 3L5XL 4AL8L 2VLKB 4MDIB 3WXWH 3GGWB 3MLXL 3W0WA 4MA3B 1KTKE 2G60H 1KJMB 1XF4B 3E6HA 3IDGB 5I1DA 4O51B 3CD4A 4L8SA 5CSBA 4N1EA 1V7MH 4Y88A 4YHLH 3S37H 2NZ9D 5D7JB 4G6AD 1WAAE 3FCTB 1S3KL 2OR9L 3RU8H 2IAMD 2V2TB 1E4JA 4JPVL 4NJAL 4I8DA 5FV2A 4XVJL 1KCUH 1T1WA 4L5FL 2ZSVA 3HTLX 5HHOA 1CXHA 4DJMA 4V1DE 1RURH 3RHWK 2YEZB 3FT2A 4ZUUB 4PJDF 5E9DA 5DSCA 1PX3A 3TH4T 1P4BH 1NGWB 2WUCL 3TA3A 1GPOL 2ZUVA 4L8CB 4PJXA 5CEZD 5ISZA 5D1XA 3H9SD 4HKXA 1ZVSB 1HKFA 3CH8A 4QY8B 2CKBB 5GRJH 3E6FB 5I1JH 2V9RA 3IJSB 1EHNA 4YQXL 5F9WB 4N1HB 1MCDA 3F6LA 4JFEA 1IGJA 5IBLC 1S5HA 4KKLD 1RZFL 2E3VA 4PGBB 2PR4H 2FX7H 4J1UB 2RCSL 5TE6L 2OSLA 3PDOB 5JXED 4U6YA 4AEHL 2PYED 1JI1A 1FZJB 1G0DA 4Y1AB 5LWYH 3R06B 4LNRB 3MO1B 1X5YA 1A7OL 4YXKH 1J88A 5ESAA 1BBJA 2HKHL 4QHMA 2PW2B 3OF6A 1S7RB 4L4TE 1HHGB 1V7NH 3WD5L 3ARPA 4U0RC 1AKJB 3EOAA 4HW6A 3ARDC 2W59A 5FYJH 3BRGC 2R2BA 3L3IB 5DRNA 2MQ0A 4M1GL 3N85L 5MP6L 1AI1L 1RJCA 3CFKA 5LXGL 1QEWA 4OTXL 3PWVB 3KYMA 3QULB 3QEQE 3FB5B 2V17H 1AY1L 3BYTA 2V2XB 2AK4E 1QRNE 3OWEA 4LLUB 4PGEA 1OCWH 3J8F7 1KLGB 4YUEL 3O4LA 1NBYB 3RBSA 3VH8B 1DN0B 5I17A 2AJYL 1F8TL 1S5IH 2G9HA 3ELAT 4KK5C 4LKCA 4YPGB 4W4OA 4N0YL 4QOKA 5DD3H 4R6UA 2ARWA 2UYLA 5E2JA 2HJLA 5SWSD 2OM5A 2P1YA 4J3TA 4TUKL 5C0CB 3ZDYF 2BNUB 4L4VD 3T1FA 4WW1A 5HDQL 3U0PB 3C6LA 4KQ3H 1HXYA 3S35L 4I3SL 1JZ8A 4RMVA 3BI9X 4ZO6A 3BQUB 5IVZA 5CHNB 4XPAL 4C59B 1S9XA 1FO0H 3TYFB 2HRPL 1ZHNA 3QDMD 1E4KA 3VXQB 3WHXB 2VL5A 4JFDE 1EXUA 1NGYB 2Q86A 3OZ9H 3TBYA 2W0FA 1DE4A 5HVWA 4PRIB 1EGJH 2DMCA 1HHHB 4N90E 4X9FA 3KJ4C 2J5LB 1ZWIB 1PX4A 4GBXD 5BXFB 2FATL 5MEND 2X4SA 1N6QH 4KDTC 43CAB 2Z4QA 2HLAA 1MCKA 5CD3B 4O9HH 3EFFB 5TGBB 1SM3H 5SX4H 3CU7A 1G7PA 3GJEA 5T5NF 3IETB 1DEDA 1J0ZA 4RGOL 3HI5H 4E5XA 4JY4A 3C5SA 2GSIA 3ILPA 5DQ9B 1V3LA 3LKRB 1XGTA 4AYFA 3Q5OA 4EUPB 4Z7UA 2QSCL 5E70A 2WZPD 2R9HD 1A7RH 4XTRC 1FIGH 2VTFA 4UQ2A 4XNYL 4P9MH 2DLHA 3RVVD 2CKBH 4RSVA 4P4KA 3UTPD 1XT5A 4EI5D 3FB6B 2D0GA 3L3DB 2Q76B 2H41A 1JPTL 1WV7T 5HYJD 2IBGA 5DR5L 1U9KA 5HYSA 1SVZA 2BVQB 2YD2A 2VXSH 2YD4A 2NY2C 2R1YB 1CIDA 4KY1H 1F3RB 2IAMB 3RL2B 1DP0A 4FFZL 3IGAA 4W6WB 5KVGH 1T1YB 1FGVL 3CC5B 3JV5A 3GUTA 1UJTA 1OAUH 4MJIB 1N8ZB 4U1MA 5MI0C 5DK2B 1IT9L 2FEDD 4JE4B 3O3EB 3CIQA 2CLZA 5ENWA 1Y6NR 3S4SG 3NPSB 5SX4I 2PF6A 4LPCA 3M17B 2VDRH 4H0IA 3H9SB 4YR6A 3RAJH 3THMH 2QV2A 4WFEE 1FJ1B 3P11L 4PJ7A 4TVPD 2GT9B 1NBVH 2PCPA 3HUJE 1JGEB 4XWOC 4BH8B 2H26A 4HG4J 5BS0D 4G6ML 3WYRA 5FUOH 4FS0A 4ZFOB 5F7EH 2APFA 3VFWA 5IG7A 3N1QC 3MNWA 5IK3A 5JPNA 3HZKB 5I6XC 1LEGA 1P1ZA 3SKOB 3VFVA 1JJUA 5BVJB 5T3ZE 3L3JA 3OKNA 3LIZL 3UTZB 1A6ZA 4I2XB 1NEUA 1PY9A 4K7PL 5F7LB 1VFAA 2QSVA 2IQAA 3PF2A 5FIEA 4H25B 4U1HB 3MUZ1 3T0ED 4Z9KB 2EKJA 2FX9L 3KPRD 1JGLL 1BFOB 4O58H 4M1CC 4F2MB 5ERWA 3QQ4B 1MREH 5C07B 1NAKH 5HSFA 3KNBB 2DF3A 2EH7H 1IC7H 2GTWB 3JSSA 1WF5A 2H2SC 1SBSL 4TULH 3W11D 3D0VB 5JO5A 2BY0A 2X4NB 1E28B 1LO0H 1Q0XH 4LSQH 1CFVL 1RZJL 5KVEL 1ZVYA 4LHJB 3GRWA 2KUTA 4EJ1C 5IB1B 3DMMB 2AKRA 4L4VB 1HHIA 3GSNH 3VXSD 4ZMAT 1G7HA 4QXGL 3RL1B 4U6HA 4M3JA 1YJDL 5HHPA 2VDPH 1JN6B 1KB5B 1YQVL 1I4FA 4I4WB 1F2XK 5ID1A 1PSKH 4JQVC 5GS2D 2BVYA 2EKSA 5INCA 4KRMB 3MLTA 4OZHA 1SMOA 2ADGB 1I8KB 3V4VL 5T3XH 1I75A 3OR7A 2Z35A 3X11A 4R7DA 1A6AB 5IGXH 3H42H 1U91B 3ZL4H 3IT8D 4R90H 4TSCL 3I6GA 2FO4B 3UP1A 4GBXB 3TO4D 3IKCA 2AJXL 5MENB 2D3VA 2E9WA 5IEHB 1T5XA 1CVRA 4N8VA 3IYLW 5D2NB 3GBNL 1D5BB 2NW3B 5CEXB 2ZOKB 1MELA 3CFCL 1AFVH 1G7JB 4PJGB 1UCBL 4OM0H 1A1OB 3S88H 1EFXD 4NDMB 3MJ7A 2FECI 4OKVB 4OGAC 4TSAH 4GG6A 5T1MB 4QRUB 1CQYA 4CGTA 3CXDH 5CEZH 1U3HA 1A6TA 1MLCB 1MY7A 5TPWH 3NCJL 4XT1C 3VJ6B 4DKEH 2P45B 3OR6B 1AR2A 5D7LD 4RFEA 1CF8L 4D2NA 3E2HB 1EERB 4LSRH 5HYJB 5FKPB 4GW1B 3QUML 7FABH 1KCLA 3MRIB 4MS8C 1ZA3B 3JV0A 3QDHA 5ILTL 4RNRB 1TXKA 1NFDB 4X8JB 3KJ6H 5D6DC 3FT3A 1VACB 4E0RA 2OZ4H 5JW4N 3QIWB 5DJCA 5IM7A 3KPLA 3JV6B 5FYJE 5L6YL 2WAHA 4P46D 2GJ6A 1YUHA 2SEBA 1TPXB 1EZVY 3OJDB 1FFQA 1I85C 4ZPTA 1CDJA 3TVMA 1NCAH 4ODTL 3U79A 4R0LA 5FKAA 4G7VL 1P4LB 5IB4B 4P2OD 3BD5A 1A0QH 2AEWA 1ZA6A 4LVNB 2EH8H 1BAFL 2W9EH 3IDIA 1A21A 2L0DA 1FVCA 1IGFH 1YEEL 5BS0B 2LABA 1CIUA 3DETD 3V5DB 3JUZA 1ACYH 3H6JA 5I73B 4M61B 4O02L 2VLRD 2ADFL 1AXSA 3B9DA 2ITDB 1AIFA 5IROC 2PTTA 4FQQB 5C08E 1D6VL 3G5ZA 5HI5C 2AXJA 3NIFF 1JYVA 1A3LL 3KYNA 4HFUL 1MAML 2AEQH 3U46B 4HF5L 5J13C 3SE3C 1VEOA 4HUUB 3VXTA 1TZHA 2NY1C 3KLAB 2YZ8A 2DQCL 5D5ME 4LRIA 3ECBA 4JFXB 4FQXC 5EWIL 3C6SB 4I0KA 2UY7A 3U9UA 1A6VL 3T0EB 3DSFH 3KPRB 4L1HA 1K4CA 4JN1H 4U3CA 3BVNB 1B0GB 3D3VD 3O2DL 5ESQB 1ZHKB 2NLJA 4HMDA 4O00A 3FFCA 1OW0A 3O4OB 2EE3A 2ATKA 2BY3A 2ZUQC 3GIZH 3P40A 1AGEA 4XAKE 4LGRB 1XR8A 1HNFA 2FIKA 4WUUA 3R8QA 4HC1H 4UNTA 1FP5A 4LVHC 2LTQC 3QXDB 2JJSC 4JFOB 3SBWA 1EVTC 4NM4H 1JL8A 3LS5H 1RUAL 4PJGF 4MCYA 1UQSA 1OTSD 4X4XA 5E5UB 3NIGF 3VXOB 1VGKA 3VXSB 3ZHKA 3U4EA 5IVXE 2CO6B 3O6FC 1U8KA 4F7CA 4JKKA 3VXME 2G2RA 2Y6SC 4NN7B 4PB9H 3DX9A 2Z8WC 3ZYJA 4ZD3H 2VZOA 5C0DA 5A16B 4M7LL 1OTTC 4WTWA 4QRRD 3LCYA 5HHVH 4KUCD 3ARFA 1T2JA 5CCKH 3ULVD 4JFPA 2EYRB 1QVOB 4WWID 4NC1C 3TO4B 2HJFA 1CFTA 4NKDB 5HHME 1XFPA 1INQA 1IFHH 5EBWB 5FYLL 1JK8A 1U6AH 3RWCA 3JZ7A 3O45A 4LHUG 2ERJC 3V9FA 5JR1H 5IJVB 3Q6FB 1A1NB 1TVHB 35C8L 4RZCB 4LPXA 1MRCH 1EFXB 1P7QA 4B41A 2IALA 3MFGB 1YNKH 2VWEE 4QYOB 5B3NA 1FH5L 2AJUH 1QSFA 1DSFH 1RZIA 4OFKA 4WFFD 2W9DL 4ZXBD 1T1XB 1A4KA 1K6QH 4TVPH 3FQRA 5D7LB 1UYWL 4R96B 1JZ4A 4KK6C 3DV4B 2VOTA 3KLDA 4DVBB 2XZZA 1FNGA 3SJVA 3C60A 1D5XA 1M6OB 5AZ2H 2BJML 4U1NB 3ARUA 2V7NB 4M3KB 1MAKA 3QO0A 1L4IA 5ID0A 1ZS8B 4Z0XB 4PB0L 5IEKB 4NRYA 1IC5H 1QFHA 2R4RH 3W39A 4JO1L 1FBIH 2JLLA 3DVGA 3PQYA 4PJBE 5M94B 4KZDH 4IOFC 2XKSA 4WU5A 1FYTD 3S35X 1SJXA 3V5KA 1NGZB 1FL5B 4WV1A 5F3BB 3RTQC 1K9TA 3UDWA 5AAMA 3ZSTA 1KJ3L 5DVMA 3QFDA 1BM3L 1UT9A 3OXRB 1LHZA 4P2RD 3VFTB 4OZFA 3AFLA 3D48R 4KJWC 1HN1A 4XI5D 2YOCA 3MRLA 3PP4L 2BNRB 3RKPA 2N56A 4NNPH 4G3YL 2ZWLT 4DUXA 2H9GB 3PV6A 2PNDA 5DVOA 1DQJB 3HE7D 1YJDC 1JNLL 2VLRB 4XCCH 2AK1H 3I6LE 4UIKL 5I8CB 3VFPA 5HDBF 4WDIA 2J8UA 4MD0A 4R26L 2ED9A 3K74B 5GGQH 4DFHA 3ULSB 3WNMA 4Z7VB 2BRQA 3TNMA 4YGVB 4M48L 5ALCL 1ACZA 1NDMB 5GIRB 2DLEA 4CW1A 3MRHB 3BZ4A 3OSKA 1P7HL 1G9MC 3HN3A 3IXAB 5FM5O 2W38A 4JPIB 5F21B 4Z77A 2ICWI 5IFHL 3D3VB 5HI4D 3VD5A 3FQNA 1BZ9A 2ZG3A 2DL2A 4OLXH 1KYOJ 4JJ5B 4JRYB 4URTB 3IVKA 1UGNA 3NIDF 3DHMA 3EW3B 5JLZB 2I07B 1RHFA 1C7TA 1F4WH 4OB5H 1YYLH 1NCWL 1JUFB 1AGCB 3LS4L 2L7UA 1HH6A 2IANA 5TDNA 4HIIB 4MD4A 2E6PA 4NKMA 4HKJB 1KC5H 1RAMA 3F12A 2UUDH 4R97C 5KW9L 1WUNT 2Z9TA 5CEZE 2DQUH 3INUL 5KSUA 5JDJA 5I1AA 3EYOB 2DIJA 3GFUA 3VA6A 3VXUE 5CAYB 4QT5A 3QPQC 3MRCB 4PV9A 4XCNB 5C3TA 3QEUA 2PYEE 3K4DA 4GS7B 3T2NH 3UTTE 4MXQD 4UI2A 1X5LA 5KVDL 5D7IB 4E41A 3CSYA 2BMKB 2UY6A 1P4IH 1BIHA 1WITA 5T5NG 3AS2A 3HHRB 1AD0B 4UT9H 1S7WA 4WU7B 1O5DT 4U6XA 2OP4H 2DQHL 4K7PX 3O6LL 2AXFA 1E27B 1I3RB 5DD1L 2D03L 4FHBD 1K3IA 3D2UA 5BQ7B 4XC3H 3P4NB 4M93B 4ZPVA 3PXJA 4JGJA 4JVWA 4OI9A 2X4OB 4O5LH 5ADOL 3P4OA 1DEEB 2PTVA 1EFQA 2R69H 1SYVB 3H9YA 5D1ZD 2E5EA 1U58A 3IXTA 2UWEF 1HIML 1D9KC 4MZ3A 1JYNA 3RGHA 3RY6C 5FFLA 1ORSB 2PTUA 5JDSB 5GGSY 4N0UE 5SWSE 5IBLD 1NQBA 4PRHA 4H8WC 3TO2A 4E42A 3S34L 5E8PB 4F58H 2ORBL 1R3KA 1FDLH 3BP4B 4NQDA 4DOHB 2XXMB 4LPYA 4Z7VF 3OKOA 4NHUB 3QDME 3SY0A 1WBYB 1VERA 1MCCA 3RIAF 3QNYB 4G42A 1VFUA 4ENEC 3WS3B 3SDAA 1FYTB 3GKWH 3CPLB 1C16A 1XGYH 5GGRY 4UV4H 2E8YA 5DJDB 2ZG1A 3EFDH 3MRPB 5JNYA 3C09B 5KS9B 4OLZH 3UPRA 2I5YL 3ESVF 2AXHA 3ARDD 4P2RB 4UU9A 2LVEA 3VFOB 3RWHB 3GO1L 2C26A 4G80A 5J06A 1BX2A 2F54B 5FUCE 3O8XA 4QF1A 2E6JA 4PRDA 1X3DA 5MENE 1IEBB 4PTUB 1J1XL 3F7RA 4I0PA 1RK1B 1H3UA 3HE7B 1HOCA 2VDMH 4JY6A 2CJUH 4KK5D 1UACL 4U1KB 4DAGL 3TBTA 1ADQL 3WL9B 4GAGL 3TZVA 2FB4H 2BDNH 1CR9L 1XIWA 5INDB 2G75A 2FYYA 1FHGA 3SE4C 2IBZY 2GSGA 4PJAE 4Q0XH 5FO7B 5DLMH 5EBMB 4CN4A 4K9EH 5CMAB 1YY8A 2BVPA 3WIFB 1CLZL 3P73A 3UTPE 3QRFM 4HK3J 3K2MC 4LLMB 2FJGA 5HYJE 3OPZH 1RUMH 4QTIL 4Z95H 3HCVA 4PJEE 3DUUA 3ZT5A 1GGCH 1IGCL 1F45A 4KUCF 4UNVA 1NFDE 3CZFA 3ULVH 5MEPA 4IOIB 1QP1A 3BD4A 4CL7A 1FV1B 4H5SA 3EGSB 3SO3B 5IW1A 5I8KL 1IKNC 2X09A 1UJ3A 1U93A 1F4XH 4UT7H 4B7LA 4JPWH 4XP4H 2VMFA 1QFWH 4OD1L 5CJOL 1BZ7B 2ADIB 1KGCD 1MUJB 4UTAH 4XNQB 2MFNA 4XGZA 3W82A 2OBGA 2AVGA 1F2QA 5ITBL 2D31A 4P4RB 2ZP0T 3VRIA 1GGIL 2FEEI 4LCUA 2Y25A 4K7FB 3TBSA 4TVPE 3ARVA 3P2TA 4ODHL 3HZMA 2WIIA 4WI3A 5IMMB 2GUOB 3L7FB 1MH5A 3WNNA 4XTRD 1F3JB 4UV7H 2GAZB 2KZWA 5EU4A 3SDCC 4KHXH 4PLKC 5I19L 2DAVA 1FRGL 4K23L 4OZGE 4ELMA 5HVGB 5EOQL 4WCYL 5F70A 3CLFH 4ZO9A 4U1JB 4Q9RH 5E1AB 2NY2D 2AEPL 3GMMA 4DK6A 4HDIB 1JWMA 3GSUB 3PWLB 2YXMA 1RSFA 1LNUA 3G6JB 3VWJB 5B3JF 3DRTB 1CL7I 3RA7L 4B5EA 1B0RB 1O7SA 5IB3B 4CMMB 5DEFB 4Z5RB 4BK5A 2KBGA 3L5IA 2W65A 4M02A 5DRWB 4YHYC 5IWLA 1ITCA 1AHWC 3FB7A 4IRZL 1ND0A 5F3HA 3CSPA 1N5AA 5I1HH 2WM0A 5D1ZB 1HWHB 1QR1B 2R56H 1A2YA 1LK3H 4H0GA 5E8DH 3SDDA 4XWOD 5I0DA 2OL3L 1OAKL 4OBSA 3SPVA 1TCMA 1ZHBB 4FABL 2Q8BH 4Y4HC 1UKTA 1KXQE 5D93B 4L3EA 2I9LA 2DDQH 3FTGB 4R2GC 1PVHA 5EDXA 3WFDL 4YFEA 3LAFA 3BE1L 5LGHL 5JORA 1VADB 5E95B 1VESA 3MRQB 5T1LD 2ZPKL 5DHVA 1I8IA 5ALBH 4TQEH 2A83A 3GHBH 3KDMA 3S6CA 3SCMC 4KDWA 3DECA 1RZKH 3MREB 4GXVH 4PJFE 4TNWK 3TLRA 5EO1B 1ORQA 4WO4C 5EUKA 1FN4A 3MV7D 4M1CD 4HS8L 1KJVA 5F8RC 3LZFH 5HHNB 1MCJA 5DT1H 5GZOC 3OL2A 5GS0L 2H2SD 3QZWA 2DM2A 4J8RA 4Z0BH 5GGTL 1AP2A 2NXYC 5IESL 3BW9A 2F5AL 2F19H 4UAOB 4C83A 1QSZA 3VI4E 4JO2H 3AXLA 3T3PE 5DO2C 4HG4K 3GJFB 4X98A 2EEBA 4C55A 4OV5A 2Z31C 2JJTC 5D7LE 3RIAK 4NQXB 2NW2B 2Y4SA 3VMPA 4FXGA 1BOGA 2NYYC 3VE0A 3MNVA 1K2DB 2VLJD 1JRHL 3QSKB 4M7KL 1T20A 4OIIH 1OVZA 2O5XL 4AENB 1HKLL 4ZQKA 5DJ0B 3EJYC 5TQ0H 5IW6A 2YWYA 1OY3B 5IB5A 1IQWH 1H8OA 4QXTB 4HPYH 3KJ4B 3MRGA 4FOMA 3IDJB 2GKIA 4P57B 4AQOA 1HYRC 1UWEH 1UVQB 4MNQD 3G6JF 4L8DB 1PKQA 4S1QH 1BREA 3MLWH 4D0CA 4UUJA 2X6MA 1CFNB 1OB1A 3V52H 1OGAD 4D0DA 3BAEH 4OGAD 3V2AR 4A6YB 1MCIA 2VUOA 5ETUB 1MJUH 1DQTA 2O5YH 2F53A 4OIAA 3VMNA 4G9FA 1DQLH 1OHQA 2YN3A 4M1DL 4K2UL 3MFFA 1AJ7L 5C0IB 3PDGA 4OJFL 5DRXB 1YNLL 1EAPA 3TBVB 3QCTL 1C1EH 4MS8D 2I9TA 2OJEA 4TUJB 3IJHA 4P2YA 3T8XA 3HG1D 4Y5XB 3MC0A 4OCRL 3D25A 1AH1A 4NQEE 1IKFH 3TJEL 4XNXH 3UYOD 4QNPE 3NFPB 1E4XH 3HFML 4WW2C 2LU3A 2DYPD 5D6CA 5J12C 4GLRH 5C0EB 2AV7A 4PRAB 3OAZK 3D3VE 4F8TA 1A6UH 4LLVB 4P23A 2F5BL 3TPUA 4A2MA 3V6FB 1TVBB 1QLRB 3AY4C 3V5HA 5C0JB 3MJ8A 2C3HA 4XVTL 2B20A 1IGMH 5IW3A 4MAUH 2NY7H 3NCYP 4K3JL 4LARH 1G6RB 1RIUH 4JFYB 3STLB 3QPXH 2R1WA 3EDFA 5DHYB 1NAMH 1H0DB 1WBZB 4HUVA 3F8UB 2C1OB 3DGGA 4Z7WA 5IKCA 1LD9A 4N9GA 5J57B 3SDXB 5AD0B 5GSVB 3GSWA 2ATPA 4M9PA 3RWEB 4LQ1A 1CGSL 1ES0B 1T7XA 3VWKD 4HBCL 2DQIH 5HI5D 4F33A 2YD8A 1JPSH 2UZYB 2VO5A 5EC1A 2XKNA 1W0YT 2YMXH 8FABB 5FUZL 3S4SA 2NY1D 3EO1A 2FZ3A 2CIIB 3ME0A 2KPNA 4KTDL 2IADA 3U6RA 4FQXD 4QRRE 4XNUH 3WIHH 1RZ8B 4ODSH 3X14B 1E4XI 3GBML 4CADB 2IH1A 3ULVE 4GLRI 1AE6L 5D7IE 1F4YH 1PZ5B 3PWJA 3BH9B 1X5XA 2D0FA 4I18C 3HE6C 4X4ME 1YEGL 1B3JA 3LN5B 1PQZA 4MNGB 4HS3B 2DMBA 4QCIB 2DQFA 2BOBB 4AH2A 1GRWA 3F58H 4HIEB 1DQQA 1EEUA 4JDTL 3U0TB 4D3CH 2YPKB 5A2LH 4I9WD 1YEIL 5E5RB 1KBGL 3MYJA 4G5ZH 5FOBB 3I9GH 1FORL 1J11A 5T1KD 3LD8B 1A8JH 4PG9A 1KTRL 3B9KC 3HRZA 3KYAA 1DJSA 1KXVC 5K9JH 4A6YH 4YC2C 4FQCL 3BGMB 5DUBB 2APTA 5E2TL 1G0XA 5TE4L 5B8CC 2K3TA 2Y6SD 1FVDA 3ZO0A 2IQ9H 2EDBA 3BN3B 2D0HA 4FQHB 4PGDA 1G7MB 2BVOB 5DJXB 2Q8AL 1S9VB 3KYKL 1ZVHA 4LPVA 1OTTD 3QEGL 1YDPB 3X17A 3EDEA 2ESVD 3D39A 2H3NA 5IBTL 3MLUH 5DJZA 4XPGH 4DOHE 3BWAB 2EZ0C 4RDQF 5C3LD 5EZJA 1YMMB 4G7YL 4PJHA 2DBJA 5IQ9A 1G7IA 5CFHA 3ZDZF 4KRPC 3P0YH 5ITFA 4MNQB 2ZCKL 3PL6A 3AREC 4U33A 2YC1B 3BT2H 2DTML 3Q6GH 5KS9E 2X1PA 4P5MA 4DGVH 2X1OA 2DQEL 5B4MC 2CMRH 3IKKA 4AK1A 3ZHLA 3VDBA 3BJLA 3RKDC 3ARBA 1DL7H 3KPNA 1FNSH 3PGDB 3Q5TA 2UZIL 1RMFL 1JZ6A 3GK8H 2E9BA 4WI9A 4KK6D 4Y4KC 3O3BB 4NQCA 5L9DH 1T4KB 4HMCA 2AJSH 1NC4D 2OK0L 4P48A 3MOBH 5AWNH 2X1WL 4KKCC 4HGKC 4M5ZH 3ZSSA 4UB0H 1QBLL 4APQB 2AAVA 4JHAL 5C6TL 1MFCH 1P7KB 3MNZA 1EBPA 1IAKB 3C9NA 3BESR 4HH9A 3MROB 4KPHL 4NRXA 4XP6H 4NO0D 1KJ2H 1OSPL 1YMHA 2W0KA 4IOFD 4UDUB 1U8PB 5E2VH 2P4AB 1AO7A 2P42B 2VXVL 1OLLA 4JFDA 3RTQD 3A67L 3H3PL 3KPMB 3LRGA 3GMLA 1K4DB 1N0LA 3MV9D 1T83A 1J1PL 3BKJH 5LAXA 4ZNEE 4QLRA 1J1OH 2Q3ZA 4KJWD 1W8NA 1NCUA 3DI2B 1DBKL 4G6KH 5K9KA 4PJ9A 4N0CC 3ZKNC 2FGWL 4LLWB 3VFGL 1HDMA 5BV7C 1QSEA 3H7BA 4U1IA 1OWWA 3VFMA 1H3TA 5HJ3A 1RJYA 1NUDA 5L88L 4LLQA 1KXTB 3L5XH 4AL8H 4YE4L 2I25N 3VWKB 4ONFL 3MLXH 4IMKA 3GBLA 4YK4C 1X4XA 4JQIL 2XFXB 4GG8A 3B9VA 3L3HB 2Z8SA 4J7RA 5EUOB 3V0WL 5J13B 5E24E 3ZYZA 2WBJC 1H8NA 2NTSP 4OCWL 4PR5A 1FAIL 4FQXB 3ROOA 5E99L 5C6PB 4X7FC 1UM4L 3GMOB 4PJ8B 2Q7YB 1S3KH 2OR9H 4JPVH 4NJAH 4XVJH 1SYSB 3AUVA 4L5FH 4DCQA 5CJXA 5EZIL 2ZUQB 2C7UB 2XY2A 4JR9L 3QI9C 4ZSOB 3C08L 2BX5A 1BFVL 3WUWB 4D8PB 4Y5YC 4DVRL 2WUCH 4YFLI 2HFEA 4NO5B 1F11B 2YD6A 5T1KB 3T2OA 1JWUB 3LRHA 3MGAA 3QXAB 1CD8A 4NT6B 4UQ3B 4YQXH 1DQML 4L9DA 1RZFH 3AAZA 4OAWB 2RCSH 5TE6H 2CPCA 2CH8A 4AEHH 1I9EA 2OQJA 3MV01 2CLRA 1W72A 3QPQD 1LP9A 5KSBE 1A7OH 5LGJA 1NGPL 1BLNB 3OQ3B 2HKHH 4BKLA 2ESVB 5J1TC 3WJLA 2ZJSL 1A64A 4YHIA 3DUHA 4QHNA 4Z7OF 3WD5H 4OFVA 3MR9A 4LPUA 3UZQA 3IF1B 1MCLA 5JW5A 2IFFL 2MSPA 3N85H 4M1GH 1AI1H 5MP6H 5LXGH 5LGKA 1FNHA 2ERJB 4OTXH 3OKDA 1FL3B 3WEXB 4JY5L 1AY1H 4JFFB 4OLVL 4YIQB 4CVWA 2C3GA 1MCWM 4YUEH 5IFAL 4F7EA 2AJYH 1F8TH 3GRWL 5F7FA 4N0YH 1GAFL 4ZUTA 1UKSA 2IH3A 4JKMA 4Z78A 2EDWA 3H0TB 1JTPA 1JGDA 2B4CC 3RGVA 2Z0BA 4TUKH 3FO2A 3K46A 5HDQH 2QLVB 1D9KD 3S35H 3OKKA 4I3SH 3D69A 1NC4B 3VFUB 2D7OA 2R0WL 5E0QA 4XPAH 2I60L 3O6KH 1VFBA 2DIAA 3NCCB 3Q5YA 2HRPH 4LHUA 4PY8J 2MMXA 1I7UB 3S36L 1VKXA 3QUXC 5EUOF 2BSRA 3CU1A 4WWKC 3TYGL 9CGTA 1RQ5A 5ICYB 1FNEA 1OPGL 4ENED 1OLZA 5FA3B 1YEHL 4PREA 3W9EA 4HEME 1GZPA 2AV1A 3WSQL 3RTQB 3BGFB 5L2KE 4YX2L 2C9AA 2FATH 3DOSA 3X3FL 5MEQB 3H8NA 5D1XC 4ALAL 4PTTB 2XRAL 4QRQA 1OF2A 2J3SA 3CFDB 3REWB 4X6BB 4NO3A 5DS8B 4GFTB 3TN0C 3EUUA 3JV4B 3W81A 4RGOH 2ZUWA 3HPJB 4Y19D 1KGCE 2X4PA 1N4XL 5D9SA 1ZEAL 3GHEL 3E3QC 1HQ4A 4D0BB 5GS3A 1KLUB 2QSCH 1KPRA 4U0QB 1INEL 3TNNB 4XNYH 1N59A 2AXGA 3I75B 2VQ1A 1W0VA 5DUPL 1JPTH 1Q94B 2CRMA 5DR5H 1H3GA 4PS4L 1OP3K 1D5MA 4GW4A 4X6CB 4IJ3C 4BZ1H 1WZKA 1XGQA 4KMTL 2A77L 2OS7A 3B3IB 3ILQD 2VXUL 4HWEL 3UBXB 4FFZH 1GGBL 1FGVH 3GNML 5F8QC 4EI6B 4Q74A 1IT9H 4W4OC 1F6LL 3CAFA 2APWA 3CFEB 2D7QA 5KG9B 4XNZB 4X83A 4B7IA 1U3YA 3KPPB 5ICXB 3HR5B 5DJYB 3HMXA 1J0YA 1CICA 5F88B 1CT8B 1UWGL 3C6LC 3P11H 4M4RA 4ERSL 1GL4B 4FTVD 1EO8L 4G6MH 2Y1VA 1NCDL 5DJ2A 4FP8L 5CJQL 1FSKC 2EO1A 4NWTL 1DUZA 1N6VA 4JZNB 5IMLA 1FAKT 4JFQA 4MQ7B 2X89A 2GY7B 4KUZL 4RGNC 3SDXE 1H5BA 3LIZH 4J3VA 4PJ7F 5J4MA 3MRNB 4K7PH 1P53A 3QUYA 2QHRL 3SDCD 4PLKD 2W07A 4X9BA 3VXPB 3QDAA 5H35A 3PJSB 4R9HA 4LSUL 5F7WC 2VLKA 4MDIA 2FX9H 1JGLH 1H9VA 3GGWA 5K9QG 4MA3A 5C7XL 1KJMA 3IDGA 1MFEL 3RJQB 4O51A 3MV7E 1HCVA 1X5ZA 4X6DB 1SBSH 4KKAC 4XBEL 1WIOA 5JXAL 3N1FC 1CFVH 4PJ5B 2NY6B 1RZJH 4GKOA 5KVEH 5D7JA 4P4KC 3MV11 4ZNCD 2QQKL 2BK8A 1EHAA 3FCTA 3TH2T 2V2TA 2H32B 1WK0A 4QXGH 4BFEA 1YJDH 3T0WA 3DO7B 1YQVH 1DANT 2YEZA 3BWUC 4JO4L 4ZUUA 1ZTXL 4O2CB 4G8GD 4R2GD 2VC2L 3V4VH 1NGWA 4POZC 5JUEL 3WKML 3TIEB 4L8CA 2ED7A 4Y5VA 4N0FB 3LDBB 5B38B 1ZVSA 3FAXA 4GKNB 5I1GL 3MOQA 2VLJE 4QY8A 2CKBA 3E6FA 4TSCH 4WY7L 1CGWA 3IJSA 4PJIB 4X6CF 3SCMD 4PGBA 4J1UA 1RZ7L 4OZHF 3PDOA 1FZJA 3HC3L 4WO4D 4Y1AA 5KJRL 1QHPA 2X4TB 2EDNA 2YXFA 3GBNH 4MB5A 3R06A 4LNRA 3CFCH 3MO1A 1N5YL 3V4PL 1TLKA 1NDGB 4HGWB 1TITA 1UCBH 5GRXG 4J3UA 3SKUD 2LU7A 2PW2A 4NBXB 5GZOD 5EOCJ 1S7RA 2NXZC 1OGAE 1I7ZB 4X7EC 5CZVL 1CTOA 1AKJA 2NXYD 5F1NB 4X6EB 2CIKB 2B0SL 2CD0A 3NCJH 3L3IA 4Z7NF 1CVSC 1H3PL 1CF8H 5DO2D 1DFBL 3PWVA 3QUMH 3QULA 3FB5A 4GG6F 4ZOEA 2V2XA 3B5TA 1YEFL 4LLUA 2Z31D 1KLGA 1NBYA 1K3ZA 2PW1B 4J3WA 5ILTH 3VH8A 1DN0A 1T66C 1ITBB 5H94B 4YPGA 2NYYD 2XQBL 1BVKB 1DTUA 3HG1E 1J86A 3TCLB 5C0CA 2G5BB 2BNUA 3EJYD 5L6YH 2YA2A 5I66B 3U0PA 4PRBB 1T22B 4ZS6C 3UBXI 4MVBC 5IJKA 3BQUA 2VSCA 5CHNA 4OZIB 4ODTH 4HKZB 3TYFA 2Y7QB 3VXQA 3WHXA 1GJIA 3ARWA 4G7VH 5AG9A 4CU8A 3KYOB 3DYPA 1BAFH 1A6WL 1NGYA 5HBBA 4GW5B 1BZQK 1YEEH 4FTVB 4X6DF 4LU5L 4PRIA 1DBBL 3G5XB 3NFSL 5K93A 1HHHA 2IMMA 1CU4L 4O02H 3G6AB 4HK0B 2ADFH 1ZWIA 1CG9B 5BXFA 1D6VH 3MXVL 3KPOA 3M8OL 1A3LH 4RDQG 1MAMH 43CAA 2FO1A 5CD3A 2FH6A 4HF5H 3EFFA 2GJJA 5TGBA 1H8SA 2QHLA 1OSZA 3GSVB 2DQCH 3IETA 4JHZA 4ORZC 2V5TA 1BD2D 4OGZA 1V3JA 2X4UB 3LQAL 5EWIH 5EUOE 5GGVL 5HXMA 1A6VH 1NC2D 5DQ9A 3LKRA 3O2DH 4EUPA 4OGYL 1ZAGA 3PUCA 3FB8B 5GSRB 1REIA 1VA9A 3FB6A 3L3DA 2Q76A 5I71B 1EMTL 5DA4A 1I9IL 4TOYH 3QHZH 2JIXB 1U3HC 2BVQA 1ZHLB 1AHWB 2R1YA 4ZSOE 4NOBA 1RUAH 1GC1L 1A6PA 2WQ8A 3RL2A 2IG2H 1T1YA 4I9WE 4X8XA 3CC5A 4WGVB 4J4PD 5D2LB 4MJIA 1N8ZA 3VXNB 4M6ML 5DK2A 1U8HB 5CUSH 3MRFB 3O3EA 3KHQA 4G8GB 4R2GB 2E9JA 1J9CT 4M7LH 5T5FL 1HSAA 5JQHC 1CDYA 3H9SA 2AJVL 1FJ1A 2GT9A 1JGEA 4BH8A 3TVMC 4UOJA 4HUWB 4BUHA 3OG4B 4ZFOA 2DJSA 4WO4B 4P3DB 1N7ML 5FYLH 4GRWB 3HZKA 1QLFB 1N64L 4NC1E 3CLEL 5F9DC 3SKOA 5BVJA 5F7KC 2F8VA 4U6VL 5FCSH 1P6AB 5DQJB 35C8H 3HE6D 1JCKA 3UTZA 4PJCE 4I2XA 1J8HE 4YAQB 1FH5H 2CGRL 1SEQL 4HFWB 4H25A 3WFCL 1YC7A 4DEPC 4RIRB 1T03L 4BA8A 1VB9A 2NXYB 2W9DH 4M62L 1WT5A 4U1HA 4ETYA 5C0AD 5F89B 4ODBD 1E6JH 1BFOA 1EDQA 4MGXA 1DZBA 2BHYA 1RK0B 1UYWH 3PHSA 1EEZB 4F2MA 5DJ8B 3QQ4A 3SQBA 5C07A 2ID5A 1MI5D 3B9KD 3KNBA 4LRIC 1KCRH 3PWUB 2WINB 2GTWA 3EZ8A 2BJMH 5J1SC 3D0VA 3GB7B 2HG5B 2X4NA 1E28A 4F37F 5DVKA 1OAYL 3MJ9A 5D1QA 5AAWA 1L7TL 4PB0H 4K55A 3AB0C 3MRDB 4U1GB 4LLDB 5IB1A 4JO1H 1OW0C 3DMMA 2CDEB 4L4VA 5I1IL 3I50L 5EIIB 3RL1A 1UZ6F 1KB5A 4I4WA 3UXFA 3T0AA 4KRPD 1KJ3H 1BM3H 2A6IB 5GJSL 1MCNA 3ARED 2ADGA 3S36X 1I8KA 1RIHL 2V5RA 1UG9A 1OWRM 2IMNA 3PP4H 2NY3B 1C08B 4G3YH 3MV9E 4M6NL 3GDBA 1A6AA 1T0PB 1U91A 2DI8A 4RRPG 3LEVL 1JNLH 5D7KE 5B4MD 1XF2B 3T08A 4UIKH 1MF2L 1T89C 2CQVA 2FO4A 3RKDD 3BPCB 4GBXA 1KENL 3X12B 5MENA 4R26H 5IEHA 3N0PB 1FZKB 5D2NA 5FO8B 1D5BA 2NW3A 4F9PA 5CEXA 4WFGD 2ZOKA 5TF1L 4U7SA 2ARJB 3ARFC 1PD6A 1G7JA 5ALCH 4PJGA 2V5SA 1H15B 3IDNB 3CSGA 1QKZL 4NDMA 1BD2B 4OKVA 1NC2B 3BJ91 4KKCD 5IFHH 4QXUL 4LKXB 3L1OL 3OG6B 4QRUA 5T1MA 4NO2B 4JQXA 4KTYA 3OAZH 1MLCA 3BISA 3VJ6A 5ICZB 4WW2B 1BQSA 3OR6A 2FBJL 1MLBB 3U9PL 3V4UL 3FRPG 3MBEC 5HI3C 5MERB 5FKPA 4GW1A 1NCWH 4BQ8A 1C5BL 5D71L 3LS4H 4KH2A 3QISA 3MRIA 1ZA3A 4LRNL 4GRWF 1TCRA 3BP5B 4RNRA 5TH2B 5JMRA 1NFDA 5EOCL 4X8JA 5J11B 4WHDA 4LSTL 1VACA 3LEYL 3T65A 3R0NA 4ODXB 3QIWA 1TJIL 3DXAD 1XCTB 3ZKND 1WJ3A 3C60C 5KW9H 4ODVL 1RVFL 5EOTB 2LU4A 1B6DA 4H1LB 3JV6A 2NY5C 3INUH 4HIXL 3LB6D 2VKXA 1A47A 2FLBT 1A3RL 3OJDA 5GGSB 4XZUB 4Z7QF 3ZE1E 1P4LA 5IB4A 2AEIT 5IMOB 3GMNB 5FDWB 5ACMA 1JGUH 2WBJD 4K3DH 4WV1C 4YZFF 5BS0A 5KVDH 3UDWC 2RR3A 3EYUL 3V5DA 1DCLA 4M61A 2P5WD 3S5LB 2ITDA 5GGRB 4FQQA 1P2CB 2VZ3A 3WUWG 4DUVA 1EHLL 3QUKB 3HE6B 2DQHH 3U46A 2JJWA 3O6LH 3K0WA 3OJ2C 1IGYB 4KHTL 4HK3N 4HUUA 2HH0H 2D03H 3QI9D 3KLAA 3QIUC 3CK0L 4Y7MA 2ADJB 5DQDL 5JHDD 4LFHD 4JFXA 3UCRA 3C6SA 3T0EA 3KPRA 5ADOH 2I27N 3BVNA 1B0GA 1RFDL 4WTZA 4DK3A 5ESQA 2DQGL 4AMKH 1HIMH 4DN3L 3BKYL 3B9KB 1ZHKA 1GSMA 4YC2B 2CDGB 1M71B 3S34H 2HJKB 4PRPD 3LQAC 2ORBH 3ZE2F 1LEIB 4GAJL 3QXDA 5C0FB 4JFOA 2NTFB 5BRZD 5C0RL 4GUPB 1RZGB 3OX8B 3F65A 1G7QB 3FQXB 3VXOA 3B2VL 3BZFB 3VXSA 1UEMA 2VQUA 5FO9B 4IDJL 1LO5B 4GKZB 4ZO7A 2VB5A 4KRPB 2I5YH 1YA5A 5I74C 5AUMB 3WXVL 1NCTA 3GO1H 2EEDA 4PJIE 2Z8RA 1MCWW 4M8VA 5A16A 1WCBB 2VDKL 3MLPA 1QHOA 1B2WL 2DQJL 1J1XH 3B5GA 1GC1C 3TBWB 25C8L 4F7TB 1M1SA 3ULUL 4ONGL 4PUBL 3PWPE 3WNKA 1UACH 2EYRA 1QVOA 4DAGH 5H37G 3TO4A 1LILA 1ADQH 5CJBA 4GAGH 4Y19E 4NKDA 1MFBL 1CR9H 5EBWA 1D7FA 5IJVA 3AVEA 2A6DB 4IRSB 3Q6FA 4H1LH 1A1NA 1TVHA 1N26A 4RZCA 1EFXA 5DMGC 4LP4A 4QYOA 1CLZH 5HHXL 5I76B 1KCKA 4JZJC 4TUOB 1XMWA 5CIPH 1RUPL 2QADC 4QTIH 2CRZA 1T1XA 1T21B 3QUXD 3MOAL 1IGCH 1QSVA 5BW7A 3DX6B 5D7LA 4WWKD 4EXKA 3IFPB 4R96A 4XPTL 5FYLE 4DVBA 5I8KH 4LDLB 4UZGA 5DMJB 1M6OA 2K1MA 4G6FD 4U1NA 1MCHA 4OD1H 5CJOH 3D6GA 2V7NA 5DI8B 5EU5B 1I3GL 5E00B 1ZS8A 4Z0XA 5IEKA 4OZIE 1IC4L 3TN0D 5ITBH 3WDHA 5BV7B 3BH8B 1GGIH 4ODHH 3FO9B 1NGZA 4FTVE 1FL5A 5F3BA 4OT1L 1L9NA 5D96B 1MWAB 1B90A 3OXRA 3VFTA 1KF9B 2R1XB 2MTPA 3SDYL 3OF6D 4WVRA 2BNRA 5I19H 1MHCB 2QQNL 2WBJB 4BELD 4EVNB 1FRGH 4K23H 5E7BA 2H9GA 5CP3A 4ZOCA 2WNGA 2XWTB 1DQJA 5H2BB 1V05A 2CK0L 5EOQH 4WCYH 2VLRA 5I8CA 4GQ9L 3BMVA 2WWMC 3O8XC 4MXVF 2P8MB 1M7XA 1UXSA 1WWBX 4LIQL 1DBML 3RA7H 4I0PC 3ULSA 3O4LD 4Z7VA 1MFAL 5DD0L 4ELKB 4N8VG 3DTXB 4WGWB 4YGVA 1NDMA 1F00I 3KHOA 5GIRA 4Y5YB 3MRHA 3TZVC 3BPLC 1QTYT 1XGPB 3IXAA 2FNBA 4JPIA 4IRZH 4P59L 3D3VA 3IDXL 1CXLA 2E7BA 4XWGL 3UJTL 3C6LD 1URLA 4L4TD 3CFBB 4JJ5A 4JRYA 4MQXC 2OL3H 3WDJA 1OAKH 5JLZA 4FABH 5KVMC 1YPZB 1UCTA 1JUFA 4PRPB 1AGCA 1CE1L 1SJEB 2YD7A 4LVEA 1OARL 5D2LE 3WFDH 2VDNL 1S7XB 5LGHH 3BE1H 3FOMB 3UYRL 2EC9U 3FKUS 4RGND 3C2AL 4HIIA 3VG0L 1QFUL 2AK4D 1OT2A 1QRND 4S10A 3QR2A 2WP3T 2ZPKH 1QD0A 3VW3L 5HPMB 1GGUA 4P2QE 3IS0X 2BFVL 5IBUB 4JFZL 3EYOA 4GMSL 4YWGL 3RUGB 3KAAA 3RWFA 1CFQB 4YO0B 4HS8H 3D0LB 3MRCA 4XCNA 4NQVB 3UZEA 1YYML 2VZSA 4AEFA 4RFNC 3EYQC 5IR1B 3DRQB 2YUXA 5DVNA 5GS0H 5LKNA 5LJYH 3HMWH 4KKAD 5D7IA 3L3GB 3P4MB 5IVNA 5GGTH 3RDTB 2BMKA 5IESH 1BQHB 2F5AH 3FHQA 3N50A 4P4KD 4X7TB 3MZGB 4RMQA 1AD0A 4PLNC 4UT6H 2OTUB 3CZJA 5D70L 4N90D 5BV7H 4WU7A 2VE6B 1AGFB 2X4QB 1JHLL 4TNVK 1E27A 1I3RA 4MHHG 3N1GC 3RNKB 4OV6F 1LE9B 3ULUF 3NACL 1CD1B 5BQ7A 1VFOA 5JMOC 3P4NA 4YBLC 1GOGA 3QO1B 3QUXB 3FN3A 4I5BB 2B2XL 4QRSB 1JRHH 2X4OA 2Y23A 4M7KH 4WWKB 1DEEA 2O5XH 1HKLH 1PGRB 5C0BB 1SYVA 1AGBB 5IWLC 3HB3C 3F7YB 3PHQB 3MCG1 2H1PL 1ORSA 5JDSA 1M7IB 3QJFB 1JVKA 4JJHA 2AGJL 1JF6A 1BVZA 5E8PA 2QSTA 1MCRA 4PP2B 4TSBL 3BP4A 3RVTC 2RFXB 3SDDC 3U2SB 1U8LB 1U36A 4NHUA 3CDCA 3TN0B 1QLEL 1T1ZB 1U8NB 1WBYA 3I3DA 3PNWB 1G9NL 4HWBA 4OF5A 3U4AA 3QNYA 1MCOL 3WS3A 1FYTA 1KEGL 3CPLA 4M00A 2NXZD 5DJDA 3MRPA 2GK2A 1G6VK 3OJMB 4TN9A 4BH7B 4CVXB 5FA4B 4P2RA 3VFOA 1OP3H 3RWHA 5FXCH 3LV3B 4P9HL 3P9MB 4EXPX 4M1DH 3EDKA 4K2UH 1YQ2A 2F54A 5EORL 4V1DB 1LVEA 3F5WB 4OJFH 1IEBA 1YNLH 4PTUA 3WNLA 5LG1A 2FHBA 2XT1B 3QCTH 1ZANL 4C58B 2HYMA 1RK1A 4W70A 3HE7A 2J88L 1FFOB 4JPKL 1JRHI 2N7BA 4I77L 1T66D 5DC4B 4U1KA 4OCRH 1E0OB 3WL9A 1BD2E 1AXTL 3TJEH 4P49A 5INDA 3HFMH 1UKQA 5C09D 5AZEL 4QHUB 5B39B 3FFDB 4BYHA 3RIFK 5FO7A 4HIJB 4KJYB 5EBMA 2F5BH 2CXKA 5CMAA 5JIHA 3TWCL 5DJAB 3WIFA 4MVBD 3RUGF 5T3ZD 4XVTH 4LLMA 2GTZB 3LOWA 4K3JH 2Z91B 3C6LB 2EECA 3VGBA 3NGBC 4G8FB 1MCBA 3O2VL 4L4TB 4KWUA 1FFNB 4KV5F 5IVZB 3NCBB 4IOIA 5SWZE 1FV1A 4ZNEA 3EGSA 4M43L 5E8EB 4HGMA 4CAGA 5GPRA 1CGSH 5GS1C 4HBCH 3K1DA 3WJJA 5FYKL 3QEQB 1BZ7A 2ADIA 5HDLA 2AK4B 1QRNB 5I9QB 2RGSA 4J3XA 2BY1A 1FVEB 1MUJA 1TNNA 4XNQA 4XP5L 5DWUL 3KS0H 4O4YL 4XP1L 5FUZH 2QTEA 1QA9B 3FRUB 4P4RA 4KTDH 2OMBA 3AM8A 4YHOL 4K7FA 1G7LB 3GBMH 4JKPL 3L9RB 5D7SL 1T2XA 1AE6H 5L7XL 3IDMB 4P5TC 3N1MC 5IMMA 2GUOA 1UFUA 3L7FA 4XXDB 1F3JA 1YEGH 5SV3A 4W6YB 2P8PB 4JY4B 3V6OA 4XB7A 5TDPB 4OZFG 3MA7B 2BNQD 1U3HD 3ZKSD 4U1JA 1YEIH 5E1AA 1KBGH 1D5ZB 4EDWL 5I8OH 4HDIA 4J12A 1FORH 3GSUA 3PWLA 3G6JA 1XF5B 1NUNB 3VWJA 5C0AE 3MRRB 5HYSB 4L9LC 3DRTA 5AG8A 1B0RA 2DJUA 4KU1A 5IB3A 4CMMA 5DEFA 1SY6A 1W72L 4FQCH 5E2TH 4Z5RA 5TE4H 3H9HB 1WAAF 5DRWA 1OP5K 1MI5E 3NA9L 1CGXA 4XRCB 2Q8AH 3RP1A 3KYKH 4FG6C 4OCYL 2VZVA 4YBQC 3GUTB 1J7VR 5GISL 3QEGH 4IS6B 3SGKA 5IBTH 1V3KA 5D1ZA 2A73B 1QR1A 2GJ6D 1KIUA 1I1RA 2VQTA 3MLRL 1J18A 3TVMD 1NUGA 4G7YH 4F9LA 4H88L 1ZHBA 5BZWB 3VFSB 4Y16C 2ZCKH 1RD6A 4CMHB 3FTGA 5SX5K 3PWNB 3UJJL 1NSNH 5B22A 2DTMH 2EEAA 1VADA 3EOTL 1KTLB 1X4YA 2LE9A 3CUPB 3MRQA 3QWOB 2DQEH 3FQTB 2NXZB 3QAZC 5A3IC 5GGUB 1I7RB 2GQHA 3MREA 2X44D 3HZVB 4MD5B 5KN5B 4DZBB 4AG4L 4YH6A 5EO1A 5DMIL 4JRXE 1QYGL 2UZIH 1RMFH 1IGIL 2BSED 2VH5L 5HHNA 4NZJA 3VXRD 3CNKA 2OK0H 5FOJA 5J9PB 4WI2A 4Y8AA 4G43A 1QBLH 1KPUB 4M9OA 5LCVL 4JHAH 4NWUL 5KVFL 5C6TH 4YDIL 4WNQB 3HUJB 5SWQB 5C09B 4IRJC 3RY5A 1QBML 4KPHH 1TDQA 2IGFH 1OSPH 1INDL 3GJFA 4WUUD 3EO9L 2VXVH 1HH9B 1NCCL 2WK2A 4NQXA 1G0YR 3A67H 3H3PH 2NW2A 3BPNB 5EN2B 1J1PH 1IEAB 5J6HB 3FN0L 2Q20A 4K3GA 1K2DA 3RU8L 1AR1C 4BQ9A 1DBKH 2OLDA 4XAWL 2Y36L 1KFAL 2FGWH 3CMOL 4KI5C 4AENA 2GY5A 5DJ0A 5F1SA 3Q3GB 4QXTA 5L88H 1R24B 2PETA 3ARGC 3DXAE 4YE4H 3IDJA 4ONFH 3TP4A 4P57A 4N5EC 3RVUC 4JQIH 4V2BA 1UVQA 3I85A 2VZ1A 4L8DA 3LQZB 3LRSB 2EIEA 5E7FA 3DURB 2P48B 3V0WH 1CFNA 3B83A 5ELIA 4NFCA 4X6FB 3ARFD 1WBXB 3HAEB 2BVEA 5K9OB 3P30L 4OCWH 1FAIH 5E4EB 3WN5B 2IWGA 5E99H 5I1KL 4A6YA 2YD9A 5ETUA 2VSDA 2ZOLB 5JW4R 5C1MB 1UM4H 1VGEL 4ZTPL 4LLYB 1P7QD 2P5WE 4JREC 3MBED 2XACC 5HI3D 5EZIH 5C0IA 1G9NC 3IAPA 1Z9MA 4JR9H 5DRXA 3C08H 5JPMB 2BNQB 1TQBB 3BO8B 1BFVH 3TBVA 3HMXL 3WO4C 4LPWA 4DVRH 5CEYB 4TUJA 4WHYG 1NCBH 1I7TB 5H37H 4Y5XA 3BGAA 3NN8B 4LLAA 4M03A 5JHDE 2R0KL 2YPLD 5TDOB 4P9HC 1XCQB 5EA0L 3SJVD 1DQMH 3C60D 4PG2C 5C0EA 5E6IB 4PRAA 1RUQL 3C2SA 1G9EA 4NN6C 4LLVA 3O11B 2WIMA 1WTGT 3SKNB 4M5YL 3V6FA 1TVBA 3RVXC 5HGHA 2YKLL 5C0JA 1CDCA 5KSAC 1GXEA 3AMLA 1NGPH 1YPZE 2VN7A 3PQYD 4PRPE 2MPAL 1G6RA 4JFYA 2YBRB 4XCFL 3STLA 1IQDB 1PDKA 3S5LG 2ZJSH 4QWWC 2EXYC 1WZ1L 5DHYA 3K8LA 1WBZA 1H0DA 2Y07L 5BRZE 2C1OA 3SDXA 5AD0A 5GSVA 3OMZA 4M7JH 3RWEA 1IAOB 1U8MB 1Z0NA 3VFNB 2IFFH 3HUJF 4B0MM 1ES0A 1JYWA 4JY5H 4OLVH 1NCNA 2X70B 4NSKB 1UEYA 5IFAH 4JVUA 8FABA 1XGRB 3QIUD 2CIIA 4DEPB 4IMKC 1G84A 3ARSA 3GRWH 5J6GB 1GAFH 2E6QA 1ZKAA 1RZ8A 4RWYL 3X14A 4CADA 2W0LA 3W0WE 1PZ5A 1J05B 3BH9A 2VN4A 5HPOA 1U92B 1YN6B 2FSEB 1QRKA 3VXRB 3LN5A 5EH1A 3I02B 4MNGA 4HS3A 2R0WH 3MV8D 2I60H 4MXWL 4QCIA 2BOBA 3WFBL 4WRLA 1ZGLM 4HIEA 3H2WA 1A02N 5F96L 3S36H 2WW8A 3EBAA 3U0TA 5K59E 1SBBA 2YPKA 3AB0B 3RZWA 2CKBL 5FOBA 5H8DA 3TYGH 1S9KC 4OI7A 1YEHH 3CMGA 3AS3A 5C2BL 5C08B 3WSQH 2HFTA 5DUBA 3BGMA 5HHOE 4YX2H 1V3MA 1BOYA 4OQTA 4MA1C 3X3FH 4FQHA 4KC3B 4ALAH 5E9DE 1FO0B 2XRAH 2BVOA 3FOLA 5DJXA 3MMEB 1S9VA 4P2CG 5JW4M 4LSVL 1JHKL 4PJXE 1YDPA 5D5MB 3HNTL 5ISZE 2ICEB 3QNXB 5T3XD 2OCFD 3RI5F 2QSQA 3BWAA 5CBAB 1N4XH 1ZEAH 3GHEH 4B53A 1YMMA 3O6ML 4FXKB 2BOCB 4AIZB 1INEH 4MNQA 2WQRA 3E3QE 3WJLC 2YC1A 5DUPH 4OI8A 1CXEA 4PPTA 1NANI 4PS4H 1JIBA 4F7PB 4E9LA 5JW3L 5DMGD 2JCCB 1KELL 1FZOB 3QCUL 1INQB 3VU2A 4G6JL 2QADD 3OKLB 3OB0K 4KMTH 2A77H 4NRZB 1LGVA 3MJGX 3PGDA 2VXUH 4HWEH 5FECB 5IVXB 2RIKA 4Q2ZB 1GGBH 4RRPA 5DZLA 3VXMB 1MRDL 2IPTL 3MBEB 1CD9B 4ZUSB 3GNMH 2J7LA 3D2UD 1T4KA 2ED8A 3VXUD 4HS6B 1P9MC 4LCIL 1HZHL 3O4LE 5J8OA 3BHBB 3K3QA 3BZDA 4RA0C 4Y2DC 1IM9B 4APQA 1WIPA 2YPLB 4QOKE 1UWGH 3BOVA 3QZWG 3UTTD 4ERSH 3U30C 1P7KA 3HR6A 1IAKA 1EO8H 4KJPC 1NCDH 3G6DL 4FP8H 4FXLA 3MROA 5CJQH 4YLQT 4UDUA 2XV6B 1U8PA 5HHMB 4NWTH 3UZVB 4B50A 5KTEL 4NRYB 3JTSB 3KPMA 4GKSB 2MJWA 1K4DA 3FRPA 4KUZH 1CXFA 2QHRH 2IEPA 1MY5A 4GAYB 5J0BA 5FCUH 4LLWA 4RGNE 2EDTA 4WJ5B 4RAUB 3D9AL 1PSKL 3GSRB 2EYTB 4LSUH 3NABL 2R0ZL 1JV5B 1ERNA 3VWKA 2WWMD 3O8XD 2DWDB 1F3DH 5C7XH 2XFXA 4L3CB 3PV6B 1OAZL 4RA3A 2ZZUT 3L3HA 1B0WA 5CGMA 1MFEH 1YEJL 5EUOA 1A7BA 5BO1L 1L9MA 3QIUB 2LV4A 4XBEH 4D94A 5JXAH 2WSKA 5I1EL 3TZVD 3D87B 3DVNB 5I30L 5A2FA 5FM8A 2VERN 3CCHB 4D9QE 4ZAKC 1JWSB 4IM8A 2XTLA 4PJBB 3GMOA 5D5MF 2QQKH 4ODWB 4Z7UE 4OLWL 2OMNA 2Q7YA 1UXWB 4PJ8A 2ZCLH 5DC0A 3VFRB 3QA3B 1SYSA 1A22B 4GAFB 4MQXD 3MV8B 3RBGA 1F6FB 2C7UA 3CFIC 4ZSOA 4JO4H 1ZTXH 3WUWA 4D8PA 2VDOL 2VC2H 2JJSA 4DKEL 5JUEH 3WKMH 5IBUG 1MJ8L 4NO5A 3IAQA 1F11A 4TYUA 1EK3A 5T1KA 2XZQL 5I1GH 1JWUA 2M2DA 1VSCA 4WY7H 3QXAA 4ZFOL 4NT6A 4UQ3A 5BVPL 1WLHA 3NZHL 4YDLC 1Q9OA 4PGZA 5E08L 1HH6B 3GSNB 4OAWA 1RZ7H 1FG2B 5I74B 2B5IC 3HC3H 5KJRH 3IS1X 3C5ZA 1M7DB 5IVXF 1ODAA 1EX0A 4K7PY 1CYGA 1N5YH 3V4PH 2FR4B 1BLNA 5IB2B 1BQHG 2ESVA 3QQ3B 2OTWB 3EYQD 4C57C 5I18L 4X7SL 1BMGA 5CZVH 5KANG 1I8LC 4JHBA 1H5BC 2B0SH 1ZLVK 3IF1A 1RIVL 3I6KB 1H3PH 3E8UL 2WP3O 1DFBH 1FL3A 2NY5H 2BC4B 3WEXA 4JFFA 4YIQA 1YEFH 1I1AC 4JZJB 1IBGL 1G1YA 3MJ9L 3O3DB 4HLZG 1CE6B 1Q9WB 2OX5A 5I15L 1R3JB 5DFVC 1JE6A 2XQBH 3H0TA 4H26B 2XN9D 1DLHA 3GI9L 4JFHD 3DSNA 1KB5L 1Y18B 3JVGA 3HB3D 1S9WB 2E7HA 3VXUB 4ZPVB 5C09E 1NC4A 3VFUA 5EZOL 4OZFH 3JWOL 5L2JB 5D72H 5D7JC 2PYEB 4HD9A 3ZT6A 4BFIB 3RPKA 3UTTB 3RVTD 4AT6B 1I7UA 1U95A 4JM2C 1A6WH 4FQLL 4AEIL 4PP1C 4XMPL 4LU5H 5ICYA 1DBBH 1QQDB 1N3NB 3NFSH 3T1WA 4IBLT 1CU4H 4MX7B 3NA4A 4G9DB 3GSQB 4LP5A 1MHEB 5DMKB 1U8IB 4WFHE 3RTQA 4MB3A 1BF2A 1S9YB 1A7QL 3MXVH 4PJBF 1WIUA 3M8OH 3QDGD 4Y5VC 5MEQA 5DYOB 1Z6JT 4HKBB 2A9ML 4PTTA 3K1KC 4AIOA 3CFDA 3REWA 3KGRA 5F7YC 5DS8A 5F9WC 1B4RA 3JV4A 1KT2B 3TJHC 6FABL 3FL7A 3FN9A 3LQAH 3HPJA 5GGVH 4JAMB 5B39G 5CGTA 1X5IA 4D0BA 4Y2OA 1K5NB 1X6LA 1KLUA 1CLOL 4QF1B 4OGYH 3TNNA 2GW5A 4N0UB 5SWSB 3T2PA 3I75A 1JF1B 1Q94A 4LCWD 1U8JB 1EMTH 1FYHB 2A1WL 3DBXB 1CCZA 1I9IH 3SO5A 2MQ3A 5EB9A 3MGOB 4X6CA 1BHGA 1IFHL 1S7TB 3QDMB 1R3LA 3DROB 5E4IA 3RZCD 1ZLUK 2BNQE 1Q9LB 3LSOB 1GC1H 4BQCA 1ZMYA 3UBXA 3QB7C 3ZTJH 2X1XR 4Z76B 5EZLB 2AJUL 1JNHB 4EI6A 4M6MH 2IJ0C 2JE8A 3BXNB 4S2SB 5DK0B 4PY8I 2EXWC 5IHBA 4NGHL 3VGEA 1UWXK 3CFEA 1PY4A 5KG9A 3V79C 5ICXA 5T5FH 3HR5A 2DKUA 5DJYA 1A7PL 5CSGA 3H3BC 2PXYC 5F88A 1CT8A 2AJVH 4YDJB 1A3QA 1KB9J 1IAIL 2FJFB 5E94B 3BQUC 4JG0L 4U1SB 1BJ1J 5FHBL 1U42A 5F6IC 4HUKB 2GJ6E 1N7MH 4JZNA 3ZDXE 4LSPL 4PJAB 1N64H 4MQ7A 3T3ME 3CLEH 4P5TD 4U6VH 4QTHB 3O9WC 5FM4A 3MRNA 4DKAA 1DQDL 4RFNB 4EI5B 2CGRH 1MQKL 1SEQH 1CTNA 3OHXB 2J5LC 2MKWA 4PJEB 3VXPA 5KAQF 1T03H 1CDHA 4XMLL 2F53D 3ALPA 1Y0LB 4M62H 1GOHA 3PJSA 2HWZL 3IRPX 3FO1B 3QIBC 4U31A 4OLYL 3G5VB 3LKOB 4EN3D 4KRLB 4X6DA 4EBQL 3NVQA 3S9DB 3V95A 1A14L 4YBLB 4LEXL 3VXRE 2F9BT 3LMJL 4PJ5A 3WNOA 1OAYH 2GJZB 1L7TH 4JEGB 4FG6D 4HPOL 2XN9B 4YBQD 4KFZC 5CP7B 2W65B 5I1IH 4DN4L 3V8OA 3I50H 2H32A 2HVKB 3RY6A 3V6ZB 2GFBB 4PBXA 3DO7A 5LQBL 4G8EB 3STZB 4Y16D 2FLRT 4WUUE 4XBPB 5GJSH 4O2CA 1RIHH 2DLFL 3ARYA 3TIEA 1FL6B 4OZGB 4N0FA 4M6NH 4MWFB 5B38A 1PFCA 1ZV5A 4GKNA 2ICWB 1YYLL 4L1DA 4PJIA 1MF2H 5A3ID 4NQED 3NPSC 1KENH 5BJTB 3QDGB 5FGBC 2X4TA 3TF7C 1PG7H 2DQDL 5GRVL 5TF1H 2V7HB 1WWCA 1NDGA 4HGWA 4KKLC 3QFJD 4ZODA 1QKZH 3G08B 4ZFZB 4ZFGL 2J2ZA 3PABB 1ORQB 3BD3A 3W5MA 4OIBA 5ACZB 2NY0C 4QXUH 3L1OH 1I7ZA 4UOW1 1MHHA 2JCCE 5F1NA 1BGXL 5FB8B 1HWGB 2B8OT 4IOSD 2CIKA 1Q1JL 4K71C 3RVWD 3V0VB 4IRJD 3SE4A 2FBJH 3U9PH 3V4UH 5AYQA 5JIIA 4LEOB 1Z3GL 2X7LB 1DN2A 1ZE3C 2EE9A 4LCWB 1C5BH 5D71H 1HHJB 4NFBA 1WT5C 4HSQA 2FL5B 4LRNH 2PW1A 4PJAF 1QSFE 4D9RE 5EOCH 3RZCB 5H94A 1T3FB 4LSTH 3LEYH 4PV8B 3NGBB 2VJXA 3ARRA 3Q1SL 1NLBL 3BP6A 1TJIH 4KI5D 3C5JB 4ODVH 5AEAA 3TCLA 1RVFH 3GMQB 4PJFB 2G5BA 4PJEF 2EIZB 4HIXH 2YPLE 2QL1A 5I66A 2CRYA 4PRBA 1T22A 2ARJQ 3VE0B 3MODL 3ARGD 3SJVE 1A3RH 3IAGC 5D1QC 2E27L 5GS1B 2KQMA 1NFDF 2HKFL 3QRGL 4N5ED 2HN7B 4HKZA 2Y7QA 1YN7B 3Q48A 4MDJB 3VG9B 3DMMC 2YPVL 4PYHA 1S7VB 3KYOA 4DGYL 5F9JB 1WSST 2C3VB 4GW5A 4AEEA 4FTVA 3S3PA 4I48B 2XWJB 3PQYE 3G5XA 3TT1L 3EYUH 3X13B 5ANMA 3G6AA 4HK0A 3P9LB 4WUKL 4ZUWB 1GGTA 3JWOC 4HZAA 4H20L 15C8L 2BXYA 3S96B 1CG9A 1LEKA 4CJ1A 4DW2L 4P5TB 4XMKL 1EHLH 1HINL 4CVZB 1I9JH 4KHTH 3JTTB 2LAGB 1IE5A 2OTPA 3GSVA 3CK0H 5CINL 4GBXC 5DQDH 5FF6B 2X4UA 1VEMA 1X7QB 1SEBA 5D2NC 43C9B 1WISA 1VHPA 4JKLA 1DUYB 4OZGF 3QUZA 1RFDH 2J8UE 1U8QB 1NKOA 4QHLB 1OP5H 2DQGH 3FB8A 4DN3H 4L9LB 3BKYH 4EN3B 4ORGB 1TFHA 1HXMB 5GSRA 4EDXB 2HMIC 2XTJC 2VR9A 2A6JB 4P46B 1F90L 1N6UA 3RVXD 2JIXA 2FEEL 4GAJH 1ZHLA 3MV8E 3EJZC 5DHVH 2YSSB 4JM4L 1AHWA 5KSAD 5HYQB 5IF0B 5C0RH 2DI7A 1NH6A 2AV7B 4P2OB 1TTUA 1RZJC 1XZ0B 2MHAA 1GHFL 4HQQL 3B2VH 4CNIB 4QWWD 1AO7D 2EXYD 8CGTA 5SX5H 4WTXA 3DX7B 3S3SA 5D2LA 4IDJH 1A1MB 4GRLC 3VXNA 4X7DC 1WEJL 1OD9A 4Y16B 5F7UA 1U8HA 3WXVH 3MRFA 3STBA 3QEHB 3PGCB 4G8GA 1T2QL 2VDKH 3QIWC 1B2WH 2IANE 5IQ7L 2DQJH 3M1BA 3VRLE 25C8H 4NBZB 4FQIL 2ATPB 3ULUH 3H9ZA 4ONGH 3CFJB 1CL7L 4PUBH 1BWMA 3QAZB 1ZGLB 4NQEB 4HUWA 2D9CA 5T3XE 1MJ7L 3LHPL 2JB5L 1MFBH 5M7QA 4WO4A 4P3DA 1BJ8A 2HP4A 1QLFA 5FYKD 5C0GB 3CH1B 3IFOB 4PJFF 4FRWA 5DQJA 4CJ0A 3QFJB 5BOZG 1HE7A 1IL1A 4YAQA 5HHXH 3IJYB 1SHMA 4HFWA 2DM4A 1RUPH 2ZUXA 3IFLL 3NH7L 3U4BL 4JKWA 3VGDA 4RIRA 4E41E 2MKLC 3QNZB 1J8KA 3RX8A 2XWBB 2X9YA 2EDKA 1V5JA 5F89A 3MOAH 4MJ6B 1Z5LB 3L3OB 4ZYKB 4IRJB 1RK0A 1EEZA 1ETZB 1MFDL 5DJ8A 1A9EB 3BSZH 4XPTH 3FHAA 3LEXB 2HT3C 3PWUA 2WINA 3VI4F 4N8CL 3T3PF 4FMKA 1MRFL 3GB7A 2HG5A 4EKXA 1I3GH 4HWBL 3BUYB 3UC0L 3HRZB 3MRDA 4LLDA 1ZXQA 3RWGB 1XH3B 1IC4H 4KK9C 2CDEA 1EJ6A 3NBNA 4QRRB 5CILL 5HHQA 5EIIA 3ARGB 3ALWA 4PRHE 4OT1H 2WUBL 4QGTA 2W60B 2A6IA 3MSPA 4NQDE 3SEPA 5I1LB 4O2FB 3SDYH 4LQFL 2XG4A 4JANB 1C08A 2QQNH 1H3XA 3VGAC 5EBLB 2CK0H 3O0RL 1TJGL 4N8PA 1XF2A 3UMTA 4GQ9H 1YECL 3MUGB 3BPCA 4XC1L 4ZXBB 3X12A 3WV0A 4Q6IC 1FZKA 5FO8A 1I1CA 4LIQH 5IHZB 1DBMH 2DQTL 3MCKB 2MCPL 4UIMB 2ARJA 1MFAH 5DD0H 3VRJB 5GXBB 5EU6D 3IDNA 1H15A 5DA0B 5LBSL 1YEDB 1BD2A 2FJHB 3CDGB 1NC2A 4LKXA 4PBWD 4NO2A 5IP4A 3B4NA 4Y2DD 4P59H 3IDXH 1M05B 4XWGH 3UJTH 3K2UL 4DKFL 5ICZA 1YZZA 4ZUVB 1MLBA 4KJPD 3TC9A 3G9VA 4NN6B 5MERA 1HK6A 4LHUD 2V9QA 3NOIA 2FWOB 4JLRB 1CE1H 4QNPF 3W2DL 1OM3L 3AY4A 1OARH 5HYFA 1LDPL 5BW7C 2VDNH 2F19L 1TZIB 3BP5A 5D8JL 3UYRH 5KSAB 5TH2A 2EYSB 5GHWL 3VG0H 1QFUH 4JZOB 3VH8G 4Q9QL 4ODXA 2ZNWA 1XCTA 2FX8L 3DIFB 4J4PA 2BFVH 5EOTA 1W0WA 1UM5L 4JFZH 3DUSB 3LKSB 2HFGL 4GMSH 4YWGH 1HQRB 1VEPA 5GGSA 5FGCE 3TT3L 5GRUL 1JYXA 3LY6A 1YYMH 3MRBB 5C8JB 1RJYB 5IMOA 3B2UC 3V0AC 4PBVC 3CJJA 3GMNA 1UC6A 5FDWA 4HHAB 1PW3A 1T04B 4KKBC 3D18A 3PP3K 3HKFA 2AP2A 4ZAKD 3S5LA 4BQBA 5GGRA 3ZE0E 2ITCB 2JELL 1P2CA 1SY6L 1CFBA 1BEYL 3QUKA 3HE6A 5F97E 1AD9B 1JHLH 4NM8L 4NZRL 3ULVF 1BIIB 1IGYA 1R0AL 1DLFL 5D7IF 5L2KD 1NGQL 3NACH 4Y4FC 1R3IL 4ELME 4FQ2L 2ADJA 4Q58C 5C92A 1DQLL 1DVFC 3HNVL 3PV7A 2VXTL 4XCYB 2R39A 1QBAA 3CGTA 4XP9L 1AC6A 1PYWB 3B9KA 2H1PH 2F74A 4EUPG 2XN9E 2B7DT 4JFHE 2AGJH 1MOEA 2CDGA 1M71A 2HJKA 1LEIA 4X5XB 5C0FA 4GMTL 2NTFA 1P69B 3WKNA 4GUPA 1QLEH 1G9NH 1RZGA 3OX8A 4HJJL 1G7QA 3FQXA 1R5VB 1MCOH 3BZFA 1KEGH 1LDSA 4TTGA 5FO9A 2X89D 1LO5A 4GKZA 3EDJA 2MNUA 4NHCL 1MJJB 2V5MA 4HX1B 4OUUB 5AUMA 4P9HH 5E56A 4YDKL 2YUVA 3LKQB 1KCSL 1KNOB 1U0QA 1WCBA 5EORH 3RHWF 5TQ2L 3QDGE 1CXKA 3OB0H 1CZ8L 4IIQC 3TBWA 1TJHL 4F7TA 1ZANH 1F4HA 1I1AD 3MR9B 2VZTA 5GRVK 3IRZA 1I1YB 2J88H 4JPKH 4OFYA 4I77H 1QFWI 3GI8L 5KS9F 5DFVD 3D85D 1QPXA 1AXTH 2BSTB 2VDLL 2DTSA 4OFIA 4NNXB 4KRNA 5AZEH 1HEZB 5E8NB 5KAQG 3JWDL 2A6DA 4IRSA 5EU6B 3HS0B 5HGAB 3TWCH 1NJ9B 4LL9A 5K33A 5KSBB 1SMAA 3WS6A 5I76A 4TUOA 5D7JD 4LCWE 4Y2DB 4OFPA 1FZMB 4JM2D 2VABB 1T21A 3O2VH 3DX6A 4HZLB 4IDLA 3LN9A 1A7NL 2V6HA 1ONQB 5DTFB 2QQLL 3IFPA 1S7UB 4DTGH 5DJ6B 3U82B 1S8DB 4LAQL 4M43H 3MUY1 3MUHL 1EVUA 4U0RB 1GCFA 3ARDB 5FYKH 5ABDE 5DI8A 5EU5A 3U7YH 5E00A 3OKEB 1LO4L 3AU1B 4XP5H 5DWUH 4O4YH 4XP1H 4A6YL 4R4NC 3BH8A 4YHOH 1NAMB 3ARQA 4JKPH 3FO9A 5E6ZA 5D7SH 1TTFA 1ZT1B 5L7XH 4U49A 3T77B 3REVB 1MWAA 1EJOL 1PKQE 2X05A 4YJZL 3MLZL 3QG7L 4NQUA 1I3VA 3ZZ1A 2J4WL 4M8QB 2R1XA 4JHWL 4YHZL 3IU4L 1MHCA 3UTSD 2WBJA 4EVNA 3C09C 2XWTA 3ROLB 4X9IA 5H2BA 3EOBB 4R3SB 4PJDB 4ZAKB 4EDWH 3L5WB 2F53E 2H8PB 2P8MA 5A1AA 4JN2B 4EIZC 1R5WB 3MA9L 1HI6B 2O61B 4RMTA 4LOUC 1W72H 5L2KB 4ELKA 3DTXA 4KVNL 3QP3A 1L7IL 2MCG1 3NA9H 3K81A 2EXWD 1FFPB 4Y5YA 1XGPA 2R8SL 1G6RL 4OCYH 3RNQB 5GISH 2HVJB 2KDGA 3GK8L 3EYSL 4NNYB 2PXYD 2BCKB 4Z6AT 2BZDA 5TFSL 3CFBA 4AIXA 3MLRH 3MOBL 4TRPL 4YDLB 1Q0YL 4LIQE 2B5IB 4BSWB 4PRPA 5HI4C 1SJEA 3UJJH 4D9LH 1S7XA 3FOMA 2GK0B 4NP4L 2Y06L 3O9WD 4FFWC 3EOTH 2NQCA 4PRID 4KAQL 4WI4A 1FCCA 1ZLVH 1ZSDB 2XPGB 5KSBF 5HPMA 5IIEB 4Z7WE 4FFYL 4AG4H 3WJJC 5C71A 3QIBD 5DMIH 1QYGH 2GIYA 4LSSL 2NY2B 3RUGA 2XKUA 1IGIH 1CFQA 2M26A 4YO0A 3D0LA 3LKNB 4NQVA 1GGYA 2VH5H 3LKPB 1I1AB 4NPYA 3L3KB 5IR1A 4NCDA 3DRQA 4OD2B 5MI0B 3B6SB 4BSVB 3D85B 3L3GA 3QFJE 4UNUA 3P4MA 4YNYB 3RDTA 2IPUG 1BQHA 5LCVH 5KVFH 4NWUH 3PHOB 4ISVB 4YDIH 5DD5L 3WHE1 1FPTL 4X7TA 3V6OC 1QBMH 4MXQC 1KB9K 1XAUA 2OTUA 3MGTB 1TZGL 1INDH 1NLDL 3LN4B 3EO9H 2VE6A 1AGFA 2X4QA 4OQTL 5F7HA 3QG6B 1NCCH 1MPAL 4I1NB 1EIBA 5FGSA 1QFOA 3RNKA 1LE9A 4KMLB 1CD1A 3P0GB 3FN0H 3EO0B 5I6XB 2GEEA 3QO1A 4KVCH 4JM2B 3SKMB 1U41A 3FMGL 3VWJC 3QUXA 4QRSA 4I5BA 4XAWH 2EDXA 2X41A 2Y36H 1KFAH 3A6BL 4WWKA 3CMOH 4MJID 2Z8VC 5DC9B 5C0BA 5T1LB 4F3FB 1AGBA 4JDZB 4WI8A 3F7YA 3PHQA 1PLGL 3CX2A 4WTZG 1M7IA 2IC2A 1LE5B 4QHKJ 1KJ2B 4KI5E 5GRYA 3L7EB 3QJFA 4KROC 4RFOL 4Y5VB 1P5VA 3SGKC 4PP2A 3CVHA 5D1ZC 2RFXA 3MV7B 2YD1A 3U2SA 1U8LA 3HPLB 4F9LC 3TN0A 1T1ZA 1U8NA 2Y5TB 3OGOE 3PNWA 3D39E 3UTQB 3P30H 1R5IB 4LPTA 2J12B 5I1KH 5D93C 2NY0D 1D5IL 4NZUL 5DXWA 4PJHE 2MQCA 4DZ8B 1VGEH 1WAAA 2K7PA 4ZTPH 4BH7A 4CVXA 3DVFA 5FA4A 3LV3A 4NYLB 3P9MA 4PFEA 4X0KB 3PIQB 4LMQI 4V1DA 3F5WA 3UTSB 4WI7A 1ZLUH 4BK4A 4GH7B 3O6FD 3HMXH 4L29B 1FFOA 5ESVB 3MLVL 3GMPB 2R0KH 3RWDB 5C07D 2VLJB 1UB6B 3O41B 5EA0H 1UWXH 3UYPA 5A2JH 4QHUA 3WCYA 5B39A 1RUQH 3FFDA 4N9OB 4HIJA 4KJYA 4ZOBA 4NQCE 1CS6A 4K94L 4M5YH 5DJAA 2YKLH 5D1QD 4CU6A 1S7SB 2N4IA 2J6EA 2GTZA 3TESA 5EU3B 4UAOC 1AQKL 3DMMD 2MPAH 2PXYB 1J8HD 4R8WL 1WZMA 2Z91A 4XCFH 2XNAB 5T1DL 4G8FA 5I8EB 4L4TA 1WZ1H 1FFNA 1OGAB 2Y07H 3JWDC 2VITB 3DHJA 3O6KL 2M1KA 1SJVA 1T0NA 3F6IA 5F6IB 1AO7E 5E8EA 1EHXA 4XPFL 4JVPA 3WMSA 4QEGA 4F57L 3TGXA 1KG0B 3QEQA 4OM1L 2EDQA 3O9WB 2AK4A 1QRNA 2W92A 1FVEA 2VKWA 1MCPL 3SDXF 1QA9A 3FRUA 1QSEE 3KPOB 3HNSH 4MA8L 1G7LA 3QIBB 3OGCB 4P99A 3HG1B 4RWYH 4JM2F 3N1PC 1Z9LA 3L9RA 5JHLL 1PZUB 3IDMA 3G5YB 2NX5D 3BIBX 1OSZB 4K8RL 4NQSB 5E2WL 1J5OL 3CVIL 4U3XA 5AYUL 4XXDA 4W6XB 1C12B 2DYPB 3BDYH 2HMID 2P8PA 2XTJD 5FYKE 4YEEA 3QYCA 4MXWH 3QDJD 3WFBH 5TDPA 3ZTNL 4G8IB 5EPMB 3MA7A 2R0LL 5GS0C 4XPHL 5EC2B 5F96H 2VDQL 2XZCL 3EJZD 4FZEL 4C56D 1D5ZA 2FCBA 2EC8A 4NZTL 1WVZA 1XF5A 1I1FB 3KPQB 4YFLF 5D7KD 3MRRA 2PO6C 4HAFA 1HCFX 5C2BH 3HC4L 4GRLD 4BZ1L 1PEZA 5KSVB 3H9HA 4Y5XC 4XRCA 4JB9L 1T7YA 5ECJE 5HGDB 4O2EB 4R4FL 4LSVH 3QIWD 1EV2E 3NFNB 1JHKH 3T0DA 3HNTH 4IS6A 4LSDA 5DDHB 4U2ZA