5I1GH

Crystal structure of human germline antibody ighv3-53/igkv3-11
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
219
structure length
213
Chain Sequence
EVQLVETGGGLIQPGGSLRLSCAASGFTVSSNYMSWVRQAPGKGLEWVSVIYSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARYDGIYGELDFWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FAB LIGHT CHAIN
publication title Structural diversity in a human antibody germline library.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 213
sequence length 219
ec nomenclature
pdb deposition date 2016-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1gH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1gH01
2WWKT 4WW1A 5JW5B 4P5MA 4LKXA 3IDXH 3V0AC 2YPLB 2M26A 5DYOB 3KYOB 3QXUA 3UC0L 1XH3A 4EI5B 2Z92B 4O02L 2FJGA 4N0YH 1KN2L 1RZKL 5E70A 5C0JB 3OQ3B 4ONGL 3LQMA 3CUPB 3IDJB 2XKUA 3K46A 3QUXB 2H26A 4Y4KA 3ZDYF 5C6WH 3DMMC 4HPOH 3ULSA 4PRBA 4EUPG 5I8EB 1AQDA 1J8HA 1G9NC 4X9IA 4IRSC 3VRLE 5EIIA 4MZ3A 3SKOB 2X9YA 3WUZA 2J2ZA 1WZ1H 2EYSB 5ALBL 3NN8B 3C6SB 3LS4L 3BEVB 5TE6L 5GRYA 3WUWG 4B5EA 3D3VB 1ZSDA 2VWEE 3UJIH 1J8KA 3FO2B 4DVBA 3O4OB 4RMSA 5I66A 1VGKA 4MD0A 3FO0L 4OZIF 1NSNH 5BMFL 5GGRY 1KELL 1LD9A 4G7VH 4UT7H 4R0LB 3QWRD 5ITBH 4G42A 5CGTA 4GO6B 1R3KB 1FG2B 2AKRA 5E99H 5EU6E 4WEBL 5DRXA 3OMZA 3F7YB 4HF5H 1FO0L 4U2ZA 5CUSL 1QD0A 3EOTH 3BSZH 3MRBA 4NN6B 1LO4L 3UZVB 2VJXA 2OR9H 1UZ8A 3ILQD 4ZUVA 1CDHA 1MF2H 1ZLSH 2Y07H 4JN1L 2YK1L 4RBPH 5FKAB 3ARBD 1H3VA 3LEVL 4W4OC 2WQRA 4XMPH 2AJZB 4JFED 3MRDA 1AR1C 2CK0L 2JJTC 5ICYB 1EEQA 3VXUE 1I9JL 4XNXL 4OKVA 5SV3A 2NYYC 4XPBL 5ISZE 5GRVK 4X4YA 5HD8C 1IGIH 3QA3B 2EXYC 3MRQA 3DO7A 5EU3B 4QHNB 5KVGL 3FMGL 2EXWC 1I85C 2FO4B 3TBYA 1MJ7H 1NC2A 5DMKB 2FH8A 3QH3B 3UPRA 1QSVA 3SOBL 5JHLH 3FL7A 3S3JA 3QIWB 4Z7VB 1CXKA 5DJZA 1DVFD 3O4LD 4GW5A 1I1AD 4MMXC 1QO3B 1A9BB 1TJGH 3TCXA 5TH2A 4U49A 2JK5A 2QQLH 4U1IB 2ESVE 4AK1A 4HJGA 3C5SA 3ISWA 5IIEA 4PJ8B 5HPOA 2AXHA 4GKZA 4HLJA 2BDNH 3H9SA 3MGAA 4S10A 5GRJH 3TWCH 2VERN 2R1XB 1AHWA 1E4WH 1MFEL 2F19L 2DQFA 3HI6L 5GHWH 3G5VA 4QWWC 4V2BA 4K7PY 4I5BA 5D72H 3ULUE 4QRQA 25C8L 4PJXF 1Q94A 4E0RB 1IGJA 2XA8L 3FOMB 3L5XL 5IM7A 3WS3B 5DMJB 1OAUH 1ADQA 4XX1G 3VG0L 4NSKA 2AXFB 1T83A 1U8JB 2FEDD 2ZSVB 2HWZL 4GXVH 3NPZB 4M43H 5IVXB 5JUEL 1D6VH 1ND0A 2A77H 3VE0A 1IAMA 4E5XB 3IDMB 2VXUL 3D0LA 1N5AB 4M6OH 1C5BH 4FXKB 1F8TH 4YHNB 3P4OA 1S7VA 4LCWA 2HMIC 3GRWA 5C0AA 2FNBA 4O2FB 4HGWB 4N90D 3N85L 4ONOA 4H20L 5KW9H 4Y4KD 5FCSH 1T89C 1BVLB 1CT8B 4U6HB 3E6FA 3SBWA 1QVOA 5FCUL 5IBUB 3QISA 4W68A 1UYWL 1S9YB 4JR9L 1J8HD 1ZS8A 1I3GH 3QUXC 4WHYG 5GGTH 2AJYL 4DK6A 1X44A 5IG7B 4PP2B 4CJ1A 2AAVA 2O5ZL 3GSOB 4FXGB 3MNWB 2DQCH 3WFCL 1X5YA 5T33L 4OGYL 2BNUB 2X70A 1KIRB 3MROA 4XP1H 4ZUWA 2WQ8A 5MEOA 3VGGA 4G6KL 5I1DB 3T4YA 2Y7QA 4HUVB 2OSLA 1J87A 3SGEI 5I17A 4P5TA 1T0MB 3B9AA 4IJ3B 4TUJA 4JJ5A 1G9MC 4NC0B 1DQJB 5JIPA 3HA0A 3MJ7A 1NDMB 3O4OC 1GCFA 4BKLB 1ORSA 4FZ8L 2KZWA 1NAML 4WHCA 4S0TD 4NRYA 3SPVA 4NNYB 2LVCA 4R0LC 4F80A 3GMQA 3LKSB 3HZMB 3P3YA 3HNSH 5DEZA 1INDL 1CFNB 1B90A 3WIHA 4IRJC 4KKAC 1KTDB 2ENSA 2RCSH 3L7FA 4JREC 3U7WL 5F9OL 3V6OC 4GG8B 5C07E 4OZFB 3GMLB 3QFJD 2DF3A 5DHYB 3AGVA 4K9EL 4PJ9C 4Q7DA 5BVPH 1S8DB 4F2MA 4NQXA 1QKZH 4KKCC 1NC2D 2GAZA 5D1XC 4YHLH 1LE5B 1S7QB 2Y9RT 1KENL 4LVEA 3V4UL 3KYMA 1OARL 3FQWA 4O9HH 1XMWA 2X4TA 2IH1A 3BE1L 4RISH 1IKNC 1KGCD 1BREA 1FVDA 2RHEA 2WMPA 1T5WB 4JN2B 4P48A 5HVFB 1YEJL 2J88H 3QIWC 1X5FA 4U31A 4KUZH 2FJHB 3H9SD 2DQGL 2XQBL 4FQLH 5LCVH 5FUZL 1A64A 2D7PA 1A6VL 5ESVB 4L1HA 1JHKH 2CDGA 4NNPL 5LKNA 4XBPB 3DROA 3ARGA 2P48B 5GZNC 6FABL 5AZEH 1RUAL 3C60A 1A6WH 1Q0XH 2FH6A 1LNUB 1FVCB 3ZT5A 1QUNA 1VPOL 2D7NA 1RZGA 1HEZB 2UWEE 4LAQH 1MCJA 4ZQKB 3BAEL 2GJ6E 1OTSD 3ZDXE 1HKLH 4X6FA 2WBJC 1CGVA 2OBGA 4NPYB 2AJSL 1CFVH 1MCHA 1B0GB 5CWSB 4XBGB 1QLRA 3PHOA 1R3LB 4S1SH 5FEBA 3B5TA 4J3OC 2V2XA 2A9MH 3Q1SH 1MH5B 4GMSL 4LCWD 4ZFGH 5C0AD 3NBNA 4Q97A 3NH7H 3MLVL 4LEOA 5IMKB 2NXZB 3U1SH 1K3IA 2KBGA 3FB8B 5HHXL 1TETH 4RFEB 1UWXK 2JIXA 1Z9MA 4X6DA 3WN5A 4M7JL 4NC2B 5AUMB 2X89A 3VFSB 1TXKA 4N8VG 2NY0D 4G8GE 5T1KB 3V4VH 3WLWD 1VERA 1UM4L 4JFDA 3RNQA 3BT2L 4FP8H 8FABB 2D7TH 3BOVA 3GSVA 3F6LA 3E0GA 1RUKL 2YRLA 2H3NB 5EU6B 3GJFB 4LHJB 4ELMA 3MACL 4P5TD 1MLCA 3KPTA 4GKNB 4JY6A 1SJXA 4OM1H 5IWLA 1AXSB 5HYJA 1EO7A 5C09A 3EHBC 1G7MA 3L95A 1FH5L 5CSZB 3BRGC 1MHEA 2A6JA 4R26H 3RL2B 3CCHA 4IJ3C 3VXUB 4XC3H 1WK0A 3HUJB 4OSUL 3DOSA 5ISZB 1MCNA 3D39E 4EN3B 3O3AA 2AQ1A 1U2HA 1LO0L 5GISL 3LN4B 3O6FC 4AT6B 3SGDH 5DJYA 3E2HB 1T0NA 5EZIH 3MLYH 3MZGB 4U1MA 4RA0C 4Z8FL 2WW8A 2ESVB 4KRPB 4UMGA 5FYLL 2OR7A 3A6CL 3SGJA 5EULV 1T6WA 5L6YL 4Y88A 2CR6A 3ZDZE 2FEEL 5ITFB 1PSKH 4L8DB 1JHTB 3KYKL 3RVTC 1UQSB 2GTZB 1U8NA 2OTPA 1RURL 4Y8DC 2OTUB 5KS9B 1AE6L 3C8KB 5J12B 32C2A 2VOTA 2A2QT 1HXYB 2R0KH 3DTXB 5HVHB 3RP1A 1JMXA 2GHWB 3GI9H 4QOKE 1P5UA 3CFDB 5HHME 4URTB 3E1F1 5HGHA 3BP4A 3O3EB 4JY5L 5F7DA 4LPTA 3DUUB 4JKMA 4KTDL 2DQIH 2BJML 4BZ2L 4BSWA 1JPFA 1J1XH 3O45A 5GGTA 5MP6L 2W65B 3CVHL 1T03L 1AGCA 5KN5A 3ARGD 4K7FB 4HUUA 3C60D 5D7SL 2VDNH 1KIQB 5GQBA 4OLUL 2V9RA 1YC7A 1ZLUK 4OFPA 4CDHA 4LCCB 2VZ3A 5CILH 1NCTA 4I2XA 4XB7A 4GG6F 3PDDA 1QNZH 1YN7A 2X4RB 1GOHA 3MNVA 5B38B 3OB0H 4P4KD 4EIZC 4K3GA 4XVJH 4QHLB 1KB5H 4ZNEE 5LJYH 2BOCB 3P0VH 4CAGA 4NP4H 4OZGA 3C6LB 1PZ5B 1IL1B 2LTQC 3B4NA 2QSQA 1NAKH 4FQQB 4LPUA 4S2SB 5SX5H 4AJ0A 4PJBE 4FFYL 1I8KA 3A67H 3L3JA 4E41E 3JXAA 2EKSB 1S7UA 3NA9L 4CU6A 2Q8AH 1CL7I 5JHDA 3JTSA 1BX2B 3LZFH 4GRLA 4K8RL 3QUZB 5FV1L 1AJ7L 1RJYA 2JIXD 4S1QH 3UTQB 3DHJA 2ED8A 3U0WL 5I30L 5I8KH 2X89D 3SN6N 3CXHJ 2EIDA 1D5XA 2NXZC 2ZWLT 5GGVY 4Y2OA 4JFDD 1DBMH 4GUPB 3KPMA 3LPFA 3X11B 3TBTA 1RK1B 3HMXH 1ZOXA 1FQ9C 4CVXB 4ZS6C 2VWEC 3PABB 1LEGA 1ZTXL 2E6PA 2YUWA 5F6HI 3EJJX 4KRMB 1F11A 4XCNA 3WEXA 5FK9A 1BD2B 4D94A 4ODBD 1U8HA 2BERA 3O2WL 4P2YA 4BM7A 4M7ZB 1T20A 4IOFD 4Q6IB 4DKEH 3CSBA 3GJEA 3RTQB 5HYJD 2FHCA 5C09D 4EXPX 3S35X 2QKIA 4PJEA 4PLOB 1RZIA 1KJ2B 4JG1L 4X5XB 2UYLB 3GM8A 4X6CA 5CEXB 1UWGH 2VR9A 1EPFA 2B1HL 1BPVA 4PPTA 4NT6A 3BZ4B 3Q3GA 2BSRB 2CKNA 5C07B 3BZEA 4ZXBA 1DL7L 3LHPH 5LAXA 1D5MA 3HHRB 3SDCA 4ZG1A 5GPRA 1F00I 2XZAH 4XAKD 4JAMA 1M7IB 4MD4B 1T22B 4MA7L 4O4YL 5H2BA 1F13A 4NHUA 2VISB 4HPYL 2XTJE 1U91A 5I76B 1CFSB 4HJJH 3MRHA 5LWYL 5FUOH 2PR4H 1NDGA 1GGIL 4MXVF 2ZP0T 4Y7MA 5EUKB 4NQVB 2VDPH 4MNHB 2NZ9D 2BRQA 3MV8A 2DWDA 4HCRL 2FO1A 4LIQL 5K9JL 2NZIA 2EYTB 3UDWA 3M17B 1W8NA 1LK3H 2W0LA 5IB2A 1YEHL 4TOYH 3HS0B 3OXSB 3TLRA 3MOBL 4QT5B 1JL8A 1DLFH 3N1MC 2UWEB 4UUJB 5J12C 1I7RA 5D8JL 3ZL4H 3QO1B 3PXHA 2GJ6B 1P7QB 1FNGA 1WSST 5HVHC 4EVNA 5KSBA 5E2VH 3ULUC 3VXRB 1U8QB 3TYGL 4X99A 3HNVH 1PLGL 5DF0A 4WNQB 1QBAA 4MX7A 3MV9E 4KK9C 1EO8L 2C3GA 5EBWA 5JMRA 3H9YA 3QFDB 3OKLB 1V7MH 2MPAH 2P7TB 1DUYB 1RU9H 3O3UN 1ZVSB 1OAXH 1FL5B 5B8CA 5KVEH 2H32A 3EYUL 5C7XL 2WNGA 4Z7UF 4LCCC 1G7PB 1YEGL 1MRFL 3GNMH 3R1GH 1KFAL 5CLWA 2FWOA 3KLDA 3DBXA 3S3SA 3KYAA 1JHLL 5D2LF 1I8MB 4HS6A 4D9RE 1TITA 5IHZB 1IM3A 3IFLL 4G8GB 4FMFA 4L5FL 1JUFB 3TJEH 3W9EA 4MAYB 5JHDD 3C6LC 2NY3D 1M71A 4GRLD 4UTBH 1TVHB 4FQ1L 1JGEA 1TVBB 4ZPTB 5JXEA 4WY7L 2PW1B 1WAAF 3TO4A 3CH1B 3X13B 2VDML 4ONFL 4BFIB 3FB7B 1LMKA 3ME0A 5T5FL 3WSQH 5L9DL 3DX6B 5EFIA 4OZHA 3NCCB 1JZ2A 1FZJA 1NGYA 1AY1L 2NY6B 2QQNL 5DVKA 1DBAL 3JV4B 5D1QB 1RVFH 3MRCB 3ARFC 4Y0GA 1WIUA 1YEKL 4NKMA 1TNMA 2D31A 5TDPB 2R1YA 4M02A 4KZDL 3CAFA 1FGVH 1UB6A 4APQC 3MFFA 3C87A 5EWIH 2MMXA 4NO0B 5I1HH 5ICZA 4LKCB 4M7ZC 2VQTA 3QIBB 3QDAA 4PJIE 5JPNA 2V5RA 2LVEA 4GW1B 5AD0B 4ZXBD 2ED7A 4Z78B 2C26A 4MSWA 3LKOA 4FABH 3RVVC 3PIQB 1PY9A 3SDCD 4DUWA 1U42A 4PJDE 3U83A 4YDKH 4OT1L 3MJ9H 1Q8MA 4KUCD 1CGXA 3OJDA 1NKOA 4AIXA 4GRWF 1XF4B 1KEGL 1YYMH 1O7VA 5ANME 3CSYB 3LIZH 4U0RB 3HPLB 3KPSE 4JO2L 7FABH 3VGAB 1KB5A 4D3CL 4QOKB 3PWVA 3MJGX 2YXMA 3PGFH 5HHMB 1ZLWK 1SYSB 5HPMA 1QR1B 3MV8D 3RL1B 2BCKA 1BFVH 4FRWA 3I9GL 2IPKB 4ONHB 4ZOBA 4QRTB 5E5UB 3NCYP 4PJ7F 3JV6B 3BKCH 1KN4H 4WCYL 4ORGA 5IJKA 3GIZL 3RWJA 1B0RB 1I8LC 5E8PB 5T1MA 4XPTH 1BJ1H 3IJHB 1UT9A 5KANI 5KSAB 4D9LH 4EDWL 1CDYA 4LFHD 5L88H 4HXAH 2YD2A 3HMXA 3OGCA 4IOIA 4KK5D 3I3BA 3QNXB 5B22A 5JIKA 1UVQB 3WIIH 3BPCA 4POZC 3IJSA 4M3JA 4PJBB 1QFUL 3BQUA 4HIEA 4FQHA 5TPWH 5EZLB 3VGFA 3C5ZD 1K5NB 1KPVB 3PV7A 3UTSB 4G6ML 1GZPA 1YNTA 3EO1A 2ZPKL 1OGAB 3RWDB 3UJTL 3OJMB 2OMBA 4RQQB 1AO7A 5T5NF 3STZB 2Y5TA 1XCQA 1GL4B 4HX1B 3LKNB 4ZYKA 4ODTL 1V7NL 4BJLA 2CLZA 3MV01 2ZOLB 3K80A 1PX3A 3GUTA 2P8PA 1IM9B 4OTXL 5TDNB 4XGZB 5AYUL 1MJJA 1UM6L 4P59H 1OT1A 3MLRH 1G7LA 3ZT7A 1LDSA 4TUKH 5EOCJ 3HB3C 5JXED 3G6JF 3P0YH 4R7NB 3BISA 4HFWA 2V7HA 3TO4D 3V0VB 4ODUA 1TDQA 4P3DB 2HTLC 2YZ8A 5ADPH 3QO0A 2VDRL 1H8NA 2B5IC 4MDIA 4JDTH 2ZNWA 1S9VB 1NFIB 3FKUS 1TQBB 4ODXB 1QEWA 3LDBB 3AS2A 3GO1L 4YJZL 4PV9A 2EDOA 1N4XL 3O2DL 1R5VA 1P4IH 3BJLA 5F9JB 1C5CL 2DQTH 1WTGT 2X40A 3L9RA 3QUYC 2JCCE 3T0VA 4WENB 3UYRL 1UWXH 2X7LB 4N9GA 5FOJA 2NY6C 1IQDB 1P53A 2NY2B 1ZEAL 4FZEL 4F15B 2F74B 4OLXL 4ODHL 3KXFA 4GOSA 1QP1A 4LARH 2XTJB 5F21B 5KANG 3TNMA 4NO3B 4YHIB 5GJTH 4JANB 3MBEB 4LVHB 1LP9F 1KPUA 4YAQA 3VMNA 2R29H 4HKXB 4FG6C 5IHUL 4YHYB 2HP4A 4PLJD 4K94L 4XAWH 1BVKB 5CFHA 4H5SB 4LGRB 3LAFA 1XGPB 4NWUH 4MB3A 2XWJB 3GSXA 4PGBB 3BUYA 4Y5VA 1E4KA 4RGMB 5GZOD 2NY5L 3BH9A 5J6HB 1A6ZA 4U6YA 2EC9U 4YK4B 4KK8C 3Q0HA 1WEJH 4HSQA 1NBVL 1Q1JH 5E6ZA 4KMTH 2YC1B 2R2CA 3J7HA 4X7TB 3QYCA 5BO1H 3H0TB 5KVDL 5CEYB 1I7UA 3K81A 3QRGL 2XNAB 3ZE0E 1CIUA 1CTOA 1N0XL 1P2CA 1U8OA 3N1GC 5J89A 4R9HA 3GSUA 1A7BA 1N6VA 2ZOKA 1YECH 3HZKB 3FRPG 1F58H 3TT1L 2FGWL 2VL5B 5DK2B 4LLWB 4YXKH 4AYFA 1FO0B 2B2XH 5MHSE 4PJXE 5JQ6H 5J1TC 3FFDB 1A6AA 5EOCL 1K8DA 3UEZA 5FYKE 4F33A 4Q0XH 4L4VA 3RY6C 3TA3A 2C7UB 1KLUA 1MEXL 1CGUA 4PS4H 1B6DA 4BELD 4RGND 4JKPL 3PHQA 5DUBB 2C5DC 3BYYA 1A3LH 1H3XA 2P8MB 4I3RH 3WD5L 2BVQA 1DEEB 5KSAC 4MA8L 5F7HA 1MFAH 3BQUD 1WFTA 3OKDA 4KDWA 5DD0L 1WCBA 2Q7NA 4G6FD 4NHCH 3WL9B 2BVOB 1CICA 3REWB 5E8OB 1D7FA 4NRXB 3BGMB 3UPCA 2NR6D 3PWJA 1AO7D 1L9MA 4GKSA 1TIUA 5HY9A 1C16B 3EYOB 3S35H 3P11H 1U9KA 1YJDL 4MNQE 5FHAL 5IGXL 1N6QL 1OVZA 1A5FL 1EEZA 5SX4H 3JUYA 1ZLUH 3HFMH 3UTZA 2BVUA 2XRAH 5E6YA 4YHZH 3IT8D 4EI6B 1RPQA 5FYLE 2LU3A 3W81A 4D8PB 4LQFH 3I75A 3VD5A 4LAJH 4M6ML 3VCLA 2GI7A 3S5LA 2GSGA 2R4SL 3MJ9A 4Y16A 4QGTA 1IAKB 2BFVL 1U3YA 1A9EA 3RIAF 5I1KL 2VITA 1YYLH 1E6OL 4JKLA 2CRYA 5IROC 3V2AR 3IXAA 3R06A 3IDNA 4U4BA 1G9MH 3ECBB 4AL8H 4LQ1A 2FL5A 1IGTB 4WFED 4M3KB 5I75C 4HS3B 4I18C 12E8L 4KAQH 1A7RL 1DN0A 1OSPL 4C83B 35C8L 2G2RB 4KHXL 2FR4B 3VXMA 1A3RL 2ADFL 4PJIB 1JF6A 1N3NA 1CLZH 2XKNB 3RGVC 3LDBC 3THML 4PGEB 4WW2F 3F7VA 3OX8B 2XZZA 4Q9BA 4NKDA 5HDLA 4PJGF 1FE8L 4JDVB 2WSKA 4Q58C 1WV7T 3W9DB 3CLEH 3KXFD 3VFMA 1S9XA 5HGGS 1BQLL 5DRWB 3RNKB 2VAAB 4Y8AA 3DI3B 5EPMB 2APTA 3MBXL 1B2WH 4P57A 1F90H 3MRKB 2F8OA 4F15C 4B7IA 3PWNA 4WUKH 4FQJH 4KFZC 1JWMB 1MCCA 4LLDB 3W82A 4FQXB 3ZKNC 4KPHL 3TZVB 5IFJA 3CMOL 2H8PA 4LVHC 3AB0B 3OSKA 1HOCB 5F1IB 5HDQL 4WFGD 5J1AB 1Y18B 4YHYC 1RUML 4WU5A 1I7ZA 3LQAC 3KLHC 3A6BH 3CDGB 5JW3H 1JK8B 3TIDB 1ZT4A 4M1CC 4MA3B 4UOW1 4IRSA 4L1DA 4GKOA 1RJCA 4RGMC 2R0LL 4JFOB 4R4NC 5E9DA 3HI1B 4YK4C 2IALB 1QSEE 3KYNA 2MCG1 2X4NA 5KTEH 3C9NA 3MO1A 3S98A 4DZBA 2XZCL 1LE9B 4KROC 3AREB 2IQAA 4ZDHA 3B2UD 4F7EA 3GFUA 4GH7B 5DD5H 3TIEA 4L4VD 1QPXA 2GK0A 3Q6GH 2HN7B 3TA3D 5C92A 5JLZB 4PB0H 1VHPA 5C9JB 5ID0A 1DQQB 2VR4A 5DJ2B 1BIIB 2GYSA 5HYSA 2DLFL 1LO2L 5DJXB 4PREA 2ENYA 2ID5A 4XB8A 2XPGA 43CAA 1CICD 4FS0A 1KLGB 4JZOA 4XC1L 3ZHDA 2J8OA 3CFCH 1NMCC 2I9TB 1A0QL 5INCA 5K93A 4W4OA 1E27A 3IU4L 2ZUQB 5C0GB 2OK0H 1HINL 5FGBC 2CLVB 3GMNB 4PV8A 5LXGL 4RZCA 1XIWB 5I8OH 5D2NA 2ICWI 5KOMC 4L8CA 1OM3H 5K9QG 1UEMA 3J8F7 1J0JA 3SQBA 2FX9H 4JRXA 1I85A 2DQEH 1BOGA 4XZUB 1FNFA 4OZIB 1FFPB 2XWBB 1YMHA 4GW4B 3VXOB 4Y16D 1MUJA 1FRGH 5E8EA 3RVXC 1XR9A 1OPGH 2DL2A 5CJ8A 1JF1B 3OAYH 3MLZH 1RZ8A 2PO6A 1OCWL 4HBQA 4JB9L 2MCPL 4ZPVB 4RNRA 1T1WA 2BOBA 2FSEB 4Q9CA 4ZOAA 1KIPA 5E08H 2E9JA 4PYHA 5JQHC 3H3PL 3VI4F 1J8HE 1CYGA 2KZ1B 2BSTA 4FFVC 5ELIA 3VXMD 2BMKA 4HKBA 4TSBL 3IGAB 4AIOA 4LCYA 3VFVB 2XN9A 5DQ9A 1AD9A 2WUBL 4DKFH 3VH8B 1E28A 4DGYL 4KY1L 4ALAH 5I1LA 3WXVL 1V5JA 1T3FB 2D9CA 3R8BB 3KPQB 5IP4A 1NCDL 1DFBL 2V2WB 3QDMD 1R3IL 5E5RB 3U48A 1F3JB 1T66D 1UWEH 4P9HC 1UACL 4IHOA 3TPUB 3OKMA 4L29B 4Z7NF 5GS1C 4P99A 1C8PA 1CG9A 1OP5H 4YHPB 2VQUA 4G7YL 4PRNA 1X5IA 3RX7A 3WKNA 1GPOL 5C0IB 2VABB 4OZFH 2W91A 3TVMB 4X98A 3WO4C 3TCLA 3OBAA 4PR5A 4U1NB 4C56E 2AJ3B 5JW5A 3VDCA 2ZUYA 1MCRA 2O26U 2YPLA 4R97C 2DTSA 4WWKD 2D0FA 3QAZC 5DYOA 3KYOA 4BFBD 1IE5A 2EH8L 4EI5A 1TQCC 2Z92A 1T89A 2OR8A 4FQXC 4DAGH 1VKXB 3TZVC 3MXVL 1JPSL 5C0JA 3MJ6A 4I48B 3GBML 1H15B 4NOBA 3CUPA 4BUGA 3IDJA 4IRSD 3QUXA 4PJXB 4PD4K 1BEYH 5TE4H 5CZVH 2HYMA 3VRJB 3QFJE 1Q0YL 4BUHA 3ZSTA 5I8EA 1IMHC 1C1EH 1PG7L 5C0BE 2B4CH 3SKOA 4Y2DC 1KGCE 2EYSA 3K3QA 1JN6B 5CD5D 1CLYH 3OXRB 3NN8A 3OAUH 3ZYJA 3C6SA 1FFNB 3BEVA 4YWGL 1JBJA 4TPRL 3D3VA 3AREC 3NABH 3UROR 4NQDB 5HBBA 3FO2A 4C58B 1ITCA 1A7NH 1E6JL 1NQBA 4MNQB 4U05A 1MCOL 1HQ4B 4NC1E 4EOWH 1F4AA 3K74B 1EH9A 4R0LA 4LLYB 4X9FA 1R3KA 1FG2A 1TZGH 1XGQB 1YNKL 3V5DB 2X4OB 1TTUA 3F7YA 4LSTL 1AR1D 2AW2A 4JRYE 5IEHB 1YA5A 4QEGA 3ZYIA 5F89B 1S78C 5CKGA 2X4UB 4K9EC 2OJEB 2EXYD 2WUCH 3B2VH 3O6KH 5FKAA 5DA4A 5C86A 3AM8C 2EXWD 2F58L 4JRXD 2AJZA 2O61B 1P84K 5ICYA 1IC4H 2GJZB 2RQ8A 3W5NA 4FMKA 3QA3A 4TYUA 1KJ3L 2BY2A 1IKNA 4XCFL 4QHNA 5EU3A 2PO6D 3L3GB 3EO0B 3I50H 2FO4A 5FKPB 1TFHA 4LCWE 3CVHB 1B4JH 5DMKA 3QH3A 4X9HA 1JYNA 1P69B 3QIWA 3GJFH 4Z7VA 1A1NB 2YXFA 4ZODA 1QO3A 1A9BA 2F8VA 1N8ZB 4U1IA 1NGWB 3OKEB 2PTUA 1J12A 1EHAA 2EZ0C 4PJ8A 4PJ5B 3HC0B 4YHMH 4Y5YB 1P4BH 1SY6H 4G3YL 4NM4H 1A4KB 1XFPA 5C6TH 5E8DH 3CZFB 2A73B 2R1XA 3WXWH 5DDHB 1OAYH 4FXLA 4AMKH 5IVOA 2P44B 2XACC 5A3IC 1MHPH 1IVLA 3C5JB 4TRPL 4M5ZL 2VIRB 4E0RA 3FOMA 2YPVL 3WS3A 2QSCH 3VGDA 4GBXB 2JB5L 2AXFA 1X3DA 1U8JA 2E6JA 2ZSVA 4MXVE 5CIPH 2PXYC 2HG5B 3G6DL 1W0YT 5DR5L 3LH2L 2AEPL 3RWFB 5IVXA 1CXEA 3BKJH 4KDVA 2YPLD 3GGWB 2ZUUA 4E5XA 2CRZA 3IDMA 1QSEB 4EI5D 5JDJA 3RVWC 3TN0C 2HFFB 4GRMB 5ALCH 4YBLC 3BI9X 1N5AA 2B0SH 4FXKA 3B43A 3QULB 4PR5B 4YHNA 3U0TB 1DJSA 3QUXD 3RBSA 5C8JB 4O2FA 4HGWA 5FYJL 1HHHB 3T3PF 5JOEA 1RFDL 3W11C 1MLBB 1JFQH 1BVLA 1CT8A 1T7XA 4U6HA 4HMEA 5IFAL 4HFUL 1MJUL 1S9YA 1MCFA 4BQ6A 1SQ2N 4YX2L 2JJVA 4K3DL 4I0PC 4LP5A 5IG7A 2W0KA 4PP2A 4K23H 1JZ5A 3JWOC 3FCTB 2F5AH 3Q2CA 4LMQE 5DLML 4GAYB 4ZD3H 3WS6C 3GSOA 3JWNC 4FXGA 3P77B 3X14B 3MNWA 3JWDL 2BNUA 1KIRA 1DQDH 2R0WL 4ENED 3D3VD 1RJLB 1WZKA 4J8RB 3EKCA 3EYSL 4X5WB 2G9HB 1SBBA 4AENB 5I1DA 3F7QA 4HUVA 1CFTB 1T0MA 1BECA 4DOHE 1DBKH 2X1XR 5H37G 3HRPA 1F02I 1JNLH 4XPAL 1DQJA 4NJAL 1NDMA 1DQLH 2QSVA 2FX7L 1R6VA 4BKLA 1FFOB 5KBNC 3BMWA 3F5WB 1JNHB 1XR8B 2DBJA 4KKAD 3EO9L 3ARDB 4NNYA 5DJ0B 3UTTB 2M8XA 3LKSA 1WAAE 1C08B 3VFOB 3MOAL 2WK2A 1T7ZA 3HZMA 1X9QA 3NCJL 2D0GA 1CFNA 1YEIH 2PKDA 4AEIL 3SKMB 3KS0J 3IF1B 1KTDA 4MAUL 4KQ4L 2IH3B 4OCXH 4UILL 1NGQH 1S3KL 4GG8A 4I0KA 3GBLA 4OZFA 3GMLA 3H7LA 5DHYA 1N2RB 2RB8A 5DEGB 3C2SA 1S8DA 1XGUB 3QQ4B 1GGCH 1LE5A 5BW7C 2P1YA 1S7QA 3QIWD 4E9LA 4MCZB 3LRHA 3K8MA 3HAEG 2CRMA 4P46B 2FEEI 4X6DE 3T2QA 1T5WA 4JN2A 4QKXB 5E4EB 1WWCA 5I74B 4M4RA 1QRNE 3F58H 2Q6WB 3MODH 4JFDE 1KJ2H 4PJ8D 4XP6H 4HWEL 1I7TB 2FJHA 1CXLA 3ABZA 3LEYL 5FO7B 1HIML 2F53B 1S9WB 4XCYB 1JJUA 2JJSC 4QHUB 5ESVA 1QSZA 1TZHB 4F37K 1K3ZA 4YUEL 1MQKH 4QHMB 1U92B 4W6XB 4XBPA 5ACZB 4C56B 1TJIL 4GRWE 5TE7L 4U7SA 3SE8H 4DFHA 1A1MB 5IESH 2QADB 1XF5B 1LNUA 1FVCA 3HMWH 1G84A 5HYJE 5C09E 1JNNL 5TF1H 1HEZA 4ZQKA 3MA9H 1SJEB 4FFZL 4OCSH 1IT9H 4NZTH 5F7WC 4NPYA 4MJ5B 4OF0A 1B0GA 5CWSA 1T1ZB 4XBGA 1DDHB 4S1RH 3QFJB 1NUDA 3ARBC 4XMLL 1R3LA 1PGRB 1JP5A 2H45A 2DM4A 2KKQA 3H8NA 4HG4J 2Z31B 2JKXA 5TQ0L 4PJ7E 1ERNA 1YQVL 4JO4H 4XAKE 5C0BB 1MH5A 3I02B 3FO1B 4HZLB 5I1JH 5IMKA 2NY7H 2SEBB 1YN6B 3FB8A 4OQTH 5FO9B 3MLXH 4RFEA 4GG6B 5B39B 2YD5A 3MLPA 5AUMA 1DVFC 1TCRB 3VFSA 4LCIH 4ZUSB 1RUPH 5T1KA 1I1AC 1HYRC 1G1YA 2NTSP 4JRWA 4P2OB 1GGBL 1HHIB 2DYPB 2FB4H 8FABA 4TNWK 1BF2A 2AJXL 4D2NA 4I13B 2ZJSH 2H3NA 3MUJA 5EU6A 3GJFA 3SJVE 4OI9A 4OGZA 1D3CA 4I8DA 1QBML 1BAFL 1CLCA 4JRYB 1KEML 1A1OB 5IJVB 1A3QA 4K3EH 4GKNA 4O00A 3K2UL 5ECJE 2IMMA 1AXSA 2UZIH 4H1LG 2A83B 2ATKB 4Y19E 3SY0B 4DTGH 5CSZA 2QQKH 2IC2A 1CDGA 3GI8H 1SY6A 3RL2A 3VXUA 4HUXB 4LPVA 3HUJA 4P2RE 1BIHA 5ISZA 3NTCL 4LNVA 2ZKHH 3G6JE 4OCYL 5E2UH 1P9MC 4EN3A 4IIQC 4P49A 4UIKH 4G9FE 5J3HD 4FTVB 4R90H 3LN4A 1VFAB 3KHQA 4AT6A 1SJVA 1N64L 3WFBL 4WGWB 4CADB 3HCVB 3KLAB 4JCMA 2VZTA 4M48L 5E6IB 5C0RL 1UZ6E 5IBTL 3RVTD 2ESVA 2P5EE 4WU7B 3BPLC 4EXKA 4Y4KC 3HI5L 3KPOB 3MV7E 4G6JL 2EDWA 5T1DH 4Q74A 1ZHLB 5ITFA 4YFLF 2R4RH 4U6XB 3S37H 1U8PB 3NACL 3NIGF 1JHTA 1MFBL 2K7QA 4L8DA 3RWHB 5JORB 1UQSA 2GTZA 1CCZA 3LQZB 5KS9A 2OTUA 2XQYG 3BKYL 3C8KA 4N1HB 3AS0A 5IB4B 1HXYA 3DTXA 4LCUB 3AMKA 1GZQB 1CU4H 4P46C 3CFDA 3DRTB 3VFGH 3O3EA 1M05B 3DUUA 4LSQL 3CK0L 5E4EC 5I74C 1LP9E 3BP7B 3GK8H 5TFSL 2RFXB 1XGTB 4OF7A 1X6NA 3EYFB 2W65A 5C08E 3MFGB 1W0WB 5I71B 4K7FA 4PB9H 4G5ZL 1KIQA 4MQXD 1UXWB 1KUMA 1MHCB 4LCCA 2EDDA 2NX5E 2P45B 4FNLH 2X4RA 5J8OA 5B38A 4R8WL 4MNGE 2QADC 3D9AH 3DARA 3IAGC 3CLFH 2E6QA 4H25B 4QHLA 2BOCA 3AUVA 1BBJB 2AVGA 1BGXL 3C6LA 1PZ5A 1IL1A 3QNYB 4FQQA 4S2SA 5IB5B 1AQKL 1OP9A 3OTTA 3GSRB 4F58H 1KB9K 5ILTH 2EKSA 3BVNB 4F9PC 2NXZD 2IAMB 1NCWL 3UO1H 5EO9B 1BX2A 3QUZA 1OP3H 4OGXH 1NH6A 1S7WB 3WNOA 4NO2B 5BJTB 2FRGP 1MELA 3T0EB 3UTQA 4ZS6D 1R3HB 2XIDA 2FHFA 2FBJL 3K8KA 4XNZC 2B1AH 1UENA 1MFCH 4Z7UB 5T1KD 1N5YL 1I9IH 3MA7B 5L8KB 1QLFB 3WHE1 2FCBA 3M8OH 3QWQB 3NIDF 4DOHB 1EBAA 2D2OA 4GUPA 1Y6KR 4WEUD 3X11A 1RK1A 5D2LB 4CVXA 4D9QE 5FHBL 3PABA 4LF3B 2EE6A 1DBBL 3QHZL 5I1CH 3DRQB 5EU6D 1REIA 1CGTA 1K6QH 4J3TA 5DD1L 5IVNA 1AGEB 1BD2A 3IXTB 3MUGB 3PGCB 4CBPA 4JLRB 4BQ9A 4NC1C 2ARWA 4Q6IA 2VN4A 1U2CA 1IGMH 2MKLC 3RTQA 4LRNH 2APBA 2YKLH 3QQ9D 4P4KB 3S4SB 1KJ2A 5D1ZD 4X5XA 3SDAB 2UYLA 5CEXA 4OLEA 3AVEA 3CPLB 1JIBA 3VXUD 4G6AC 3MLTB 4P3CL 3VFUB 3BZ4A 2BSRA 3CFJB 5C07A 5LQBH 5F6IB 4LSDA 4KJQC 4EN3D 1JPST 4DGVL 3EDKA 1EDQA 4WHTB 1KCRH 4OGAC 5JTWA 2QR0B 3L5IA 2DIAA 1M7IA 4MD4A 3CDYA 4CNIB 1DSFH 2VLME 2ZNXA 4U3HA 1MWAL 1T22A 5ICXB 1RIHH 1UKQA 2VISA 4PRPE 1TMCB 2XQYK 3CFKB 1I1RA 4KVNH 5I76A 1CFSA 2IFGA 4CN1A 2ESVD 3R8QA 4KRPD 1QRNB 4KI1A 4LK4A 1UXSB 2BSSB 4IMKC 3I2CH 3UBXI 2ZUTA 5F1KC 3F6IA 1MPAL 2UVEA 3SBWC 1Q72L 1X5AA 2W9DL 5E6IC 5EUKA 4NQVA 2GCYB 4MNHA 4S1DD 4KZEH 2IMNA 2EYTA 2NY0C 3OL2A 4Z7QE 3M17A 5J9PB 3AY4C 4HQQL 3WLWC 4PJGE 4IM8A 3UC0H 3HS0A 4GRWB 4NZDA 4O2EB 4EEEA 2DDQL 3OXSA 4O02H 4JO3H 1HH6B 4OQTA 2EDEA 1KN2H 1TPXB 4HXBL 4QT5A 3QHTC 2DKMA 4ONGH 4KK9D 3BXNB 2UWEA 2ZUXA 1I9RH 4UUJA 3UXFA 3HKFA 2VB5A 3QO1A 2GJ6A 1P7QA 3EOAB 3O41B 1QA9B 1UKSA 4EQ2A 3VXRA 1U8QA 5GSVB 2C4FT 3QT2A 1NLDL 4KJWD 1ZXQA 4A6YL 1GC1C 1RZJL 4WNQA 5JXAL 4KH2A 5BOPA 3QFDA 3LQAH 3OKLA 2P7TA 1DUYA 4PJ7B 4N1EA 5I71C 1BFTA 1ZVSA 4XP5H 1FL5A 4NKOB 3LS4H 5TE6H 1KIUA 3BZFB 3DUHA 1G7PA 2BRRL 2IAND 4ZS7H 4DVRL 2D03L 5FB8B 3C6LD 4OV5B 3P30L 2BC4B 5BVJB 1I8MA 5F9AC 1U6AL 3VGBA 1IJ9A 3FO0H 2CQVA 5IHZA 3MCLL 4G8GA 3BUTA 2LV4A 1JUFA 5BMFH 2HFEB 4OFYA 1KELH 2AJUL 4JHWL 3D25B 4MAYA 2EIEA 2WV3A 3WIHL 3W2DL 3DI2B 2CMRL 1UGNA 3QUZD 1TVHA 3QDJB 3ILPB 3EZ8A 1TVBA 4ZPTA 5CUSH 1FO0H 2PW1A 5EN2B 1YY9D 3CH1A 2ZCKH 3X13A 2E7LA 4BFIA 3EOBB 1NFDF 3FB7A 3SJVB 1LO4H 2IAMC 3QIUB 3QUKB 3DX6A 4RIRB 4JN1H 4Z6AT 2YK1H 1ZGLM 1XAUA 4WWID 5A40E 3RJQB 3VXTB 4WRLA 1J0ZA 2J3SA 1V3KA 1H5BB 1G7IB 1I9JH 2YA2A 3JV4A 4Y19B 5D1QA 3MRCA 3T0WA 3UBXG 5A16B 1BD2D 2QSTA 3MRPB 1EERB 2AXJA 5KVGH 5IKCB 1KCKA 4P2RB 5KVMC 3BFOA 4XWGL 3G6JB 5EUOF 5TDPA 5CSBA 3RTQD 4JY4B 3JZ7A 3SOBH 5BQ7B 2R1WB 5GRWA 4PP1C 1JYXA 4G9FB 3C60C 5F7FA 3CXHK 2Q20A 4NO0A 4LKCA 3DXAE 2P46B 4NWTL 1Q9OB 3QIBA 4JHAL 4UZGA 4GW1A 3WJLC 5AD0A 5C07D 2AXGB 1TTGA 4Z78A 4P4KC 3PIQA 1UJ3B 2P5EB 4ODVH 5JW4R 2OXHA 3REVB 2VXQL 3MV7B 4MYWB 1G9EA 5GJSL 3DIFB 4ZTPL 2X2YA 1XF4A 2VXSL 5F6IC 1MFEH 2F19H 5IVZB 4JG0L 1YEDB 3HI6H 2EIZB 3OAZK 4LU5L 3CSYA 3VI4E 3HPLA 4NFDA 25C8H 5B21A 4Y5XB 2XA8H 3L5XH 2R8SL 4QOKA 1FPTL 3OB8A 3GMPB 3VG0H 5B3NA 1SYSA 1QR1A 4J2XA 4GFTB 2HWZH 5DJ6B 3RL1A 1LP9B 2ADJB 1I4FB 2IPKA 1MF2L 3BWAB 4ONHA 3O9WB 4QRTA 2Y07L 5C08B 3JV6A 3VFNB 4F7PB 3KPRE 3RY6A 4B41A 3MXWH 3RKDD 1EGJH 1B0RA 5E8PA 4H8WL 2NX5B 3IJHA 3UJJH 2GJ6D 1P7QD 2O5XH 3GZKA 3N85H 4H20H 3IU3B 1SEQH 5KSAA 1LO3L 3SO3B 4HIJB 4IOFC 4R6UA 5BS0E 4MNGB 3VXRD 2Y72A 5I0ZA 1TPXC 4X6EB 4ZNEA 5BV7L 1F4YL 3RI5K 2BP3A 2HH0L 2DM3A 3QNXA 1JWUB 1UVQA 2WLZA 2I27N 1N7ML 4EKXA 1TJGL 4PJBA 2PNDA 4LBEB 4J3WA 5EZLA 3PQYB 5J4MA 2O5ZH 4AG4H 5GS2H 1K5NA 1KPVA 4M5YH 3UTSA 1QFWL 4OFDA 3WFCH 5T33H 4WI4A 1NEZB 4JQXC 1OGAA 3QNZB 3RWDA 4RQQA 3TYFB 3STZA 3MRLB 4HX1A 3LKNA 4QCIB 3V5KB 4BFGA 1E4WL 1QFPA 4M62L 2ZOLA 4OJFL 4G8GD 2HTLD 4OFYD 1A2YB 1IM9A 4MHHI 4MAYD 5TDNA 4W81A 4XGZA 5D72L 4NQSB 1HI6B 1NBYB 5SWZE 1FVEB 4R7NA 4YFDB 3V0VA 3DVIA 4P3DA 3PNWB 2PCPB 3F12B 4PJAF 1IGCL 2F15A 1S9VA 5EH1A 4GS7B 1NFIA 1U8IB 1INDH 2A77L 4ODXA 4PRDB 3GHBL 3SDDB 3CC5B 5H94B 5F1OB 5EIVA 1X5GA 3V7MA 1X4ZA 2NY6D 3U7WH 3KG5A 1K4DB 5D1QD 5F9OH 5F9JA 4PGZA 3QIUC 3L6FB 2FECL 3DX8B 4K9EH 3SQOL 2X7LA 4HDIB 4AQOA 5JW4Q 5SWQB 2CD0A 1IQDA 1MREL 5F7EL 3T0DA 4CUCA 4LLVB 1KENH 3R0NA 3C5ZB 3V4UH 1OARH 2JJUA 3BE1H 4NO0D 1MCDA 1EJOH 2DJUA 5GGTL 2F74A 3QIBD 3UMTA 5GSRB 1YEJH 3BIKB 4FG6D 3P4MB 2X44D 4PRPB 3U4AA 4NO3A 4YHIA 4JANA 3MBEA 4DK3A 1TCMA 4TVPL 4U1SB 2DQGH 2XQBH 5FUZH 5IT2L 4HKXA 1A6VH 1J1OH 3VI3F 2AP2A 4KK8D 4WW2B 1BVKA 4NNPH 3B9VA 4H5SA 1XGPA 1OAZH 1UJ3C 2XWJA 4HULB 4PGBA 6FABH 1CXFA 1RUAH 4PJGB 4MGXA 3R4DA 3PP4H 1VSCA 3W5MA 4P4RB 1VPOH 4GRLC 5J6HA 1FHGA 4QOKD 3ULVF 4UQ3B 3EW3B 4BFEA 3BAEH 5MI0B 2E7MA 1TJHH 4N5EC 4W70A 4YLQT 2YC1A 5EU5B 2YN5A 3O8XD 2CDEB 3NZ8B 3H3KA 3H0TA 4X7TA 5CEYA 2AJSH 4Y5XC 2ADIB 2XNAA 1M7DB 3HR6A 3ZTJG 1FYTE 4CRPA 3MGOB 3HZKA 1U93B 4Y4FB 2HA1A 1OW0C 2G60L 2VL5A 5DK2A 1VEMA 3GHEL 3DVNB 3L3KB 4LLWA 4NM8L 1FO0A 1QSFE 2DL9A 3FFDA 2J4WL 4GXUM 1YPZF 5KSAD 5DS8B 1QKZL 2DQJH 2C7UA 1Y6NR 5ADOL 5HHXH 3U4EB 4OBRA 5DUBA 4B7LA 5HDBF 4M7JH 3QCUL 2P8MA 3NZHH 4BZYA 1NC4D 1DTUA 4RISL 2EE2A 1DEEA 4YZFE 2YSSB 1UM4H 2BY3A 3SO3C 4LL9A 4DKDC 3QDME 3WL9A 3BT2H 2BVOA 3REWA 5E8OA 3UTSD 4NRXA 2CKBL 3BGMA 1BVZA 3CFIC 1OGAD 2FATL 5E7BA 4X0KB 3SDCC 1RUKH 4JQIL 4MS8C 3T3PE 4FQLL 1C16A 1FV1B 4G8EB 3EYOA 5F7NC 5FF6B 3MACH 3BP5B 5C0DB 1JHKL 3JWOH 1IM9D 4EI6A 4JZJB 5AZEL 3EOYG 4D8PA 1GGTA 1KNOB 1FH5H 1K8IB 2UUDK 2XFXB 4XXDB 5CINH 2F54E 4TULL 2MTPA 4UQ2B 3CZJA 1IAKA 4OSUH 4XX1E 2HFGH 1C5DB 2IADB 5F7LB 1LO0H 5DZLA 2DMCA 5EIQA 5GISH 5I0DA 3ECBA 3HPJB 1IGTA 4HS3A 4C83A 2G2RA 3DXAB 2FR4A 3QBTB 4Z8FH 4GS7C 4UDTB 1EAPB 4PJIA 4ZFGL 2XICA 2R2BB 3RUGF 2YWYA 2XKNA 2X5PA 5FYLH 1J10A 3A6CH 1JGDB 4PGEA 1H3GA 5L6YH 4R4BB 1TETL 2R2HB 3OX8A 1ZGLB 1BQHG 1T1XB 2MWCA 4J6RH 2G5RA 2NY2D 2ITDB 5JO5B 4KK5C 2NY4D 5F7MC 3KYKH 4JDVA 4NZRL 1QG3A 1RURH 1EGJA 1JPGB 3W9DA 1AE6H 3MUY1 2XTJD 5DRWA 3RNKA 3ZKND 1R5WB 2VAAA 5CS7A 5DA0B 1K4CB 5CZKA 1ZANL 3C5ZC 5EPMA 2H2SC 3MBED 5B8CC 3MRKA 4UV4L 2WM0A 4YXLL 4JY5H 1Q9LB 2JF1A 4KTDH 2BJMH 1JWMA 3BGAA 3IKCB 4LLDA 3WFEL 1VENA 4FQXA 4NDMB 3VFPB 3TZVA 1OTUD 5MP6H 1IAIL 3MCG1 3KLHD 1YY8B 3CVHH 2BNRE 1T03H 3S36H 5DI8B 3JTTB 3QI9B 1HOCA 1F5WA 4N5UA 5D7SH 5F1IA 5D2NE 5J1AA 3O3DB 4R4ND 1Y18A 1JPTL 1RIUL 3KPRB 1CDBA 4QHKJ 4WW2C 1FNHA 1GVIA 3CDGA 1JK8A 4M7KL 3TIDA 2P47B 4MA3A 4XVSL 4PYGA 4JFOA 3HI1A 5BS0B 3AU1B 2IALA 3WDIA 2VL4A 4ELKB 4OFKA 1LE9A 2R39A 5MENE 4NZJA 2HVKB 3AREA 4FFYH 1INQB 3NA9H 1NCBH 3EUUA 1HZHL 2PYEE 2HN7A 1PFCA 4Y4FC 2AERT 1AJ7H 5JLZA 3O11B 3QZWB 4ZSOE 5HHNB 5HJ3B 5C9JA 1DQQA 1H0DB 5DJ2A 3SE3C 2P5WE 4MVBC 5I30H 1BIIA 1KCVL 3M45A 4L8SB 5DJXA 2WINB 3H42L 4DKAA 4D9RD 3UYOD 1KLGA 1OB1B 2GIYA 5F44A 2VSCA 2I9TA 1ZTXH 3S96B 1KXTB 2KQNA 3ARPA 3EYQD 1SYVB 3MUHL 5SWZB 1AXTL 4NQCB 5C0GA 5AAMA 3AAZB 4PRIE 2CLVA 4WVRA 1X5LA 3GMNA 2R23B 1XIWA 1J1XL 2GK2A 4PLJC 3S97C 3ULVL 4DWHA 3ET9F 2H1PL 2XG4A 3WNMA 3SGKC 2KL6A 2LU7A 5TGBB 2AEQH 4L9LB 5MERB 4UINH 3PP3H 5IW6B 4XZUA 4BYHA 2YPLE 5GZOC 4OZIA 1FFPA 4CVZB 2XWBA 1FCGA 4KV5F 4OIIH 4GW4A 2B1HH 1FZOB 3VXOA 1Z5LB 1JF1A 1NCAL 4M7LL 3T65B 4XVJL 1KB5L 2Z93B 5E2JA 4JVWA 4D0CB 4ZPVA 4X4ME 3BDXA 2FSEA 4M4PA 4EUPB 4NBZB 1FJ1B 5IJKC 3EFDH 4MA7H 4L8BB 4K71B 4O4YH 2A0LC 4OF6A 4HPYH 1RV6X 4I1NB 2OQJB 2PF6A 2HAZA 3IGAA 3OPZL 3VFVA 5J0BA 1CQYA 1EV2E 3LZFL 2KQMA 3VH8A 5DD3H 3WFHB 3WUWB 1T3FA 3V8OA 3KPQA 1IBGL 2V2WA 4HCRH 4J1UB 1F3JA 3VW3L 5JW4M 3TPUA 3PWPB 3BDYL 3BQUC 4XP9L 3KAAA 4JKWA 4L29A 1YEHH 3B9KB 5CD3B 4WTZG 1UJTA 5CEZL 1FORL 3HG1E 4YHPA 4LLAA 3RIFK 3RPIB 4TN9A 3MOBH 4K3JL 5CJQL 4YDLB 5C0IA 2VABA 4MXQD 1FYHB 3TVMA 5D8JH 2ZG1A 3TZVD 4ETQB 2V5YA 3HNTL 4U1NA 2AJ3A 4K55A 4WUUE 1ZLVH 3FTGB 3VWKB 3N06B 5GS2D 1PLGH 3KPPB 4U33A 2Y1VA 1EO8H 1FYTB 3GBNL 1VKXA 1MHHB 3BN9D 2EEDA 3MLWL 4I48A 1H15A 3IFOB 5GXBB 4EBQL 1QSFB 4PJXA 1CLOH 2J8UF 5C7XH 3EYUH 3JWDC 3VRJA 1YEGH 1KFAH 3T0BA 4X83A 1HSAB 4OUUB 2Z0BA 1JHLH 1JE6A 4Z7VE 3OAZH 4LPCA 2C4FU 3IFLH 3KR3L 4L3EB 5I18H 4L5FH 2Y36H 4QNPF 1JN6A 3Q6FB 3EZJB 3QDMB 4HD9A 3OXRA 4DUVA 3O6LH 5K59F 1FFNA 4G8IB 4FQ1H 1AP2B 2FLBT 4WY7H 4K7PX 4NQDA 2G75B 2VDMH 4PJCF 3WHE0 1KT2B 4MNQA 5L9DH 1SEBB 1HQ4A 1LK3L 4ETYA 4TOYL 2L7JA 4YXHH 3MR9B 4LLYA 5I19L 2PTVA 1XGQA 4L8SC 3UTPD 2VKWA 5A2JH 3V5DA 4OD3L 2X4OA 4WWKB 1ZK9A 2F54B 4C4KO 5IEHA 1YEKH 1XIWD 5F89A 2X4UA 2OJEA 5E2VL 4KZDH 1AD0B 2OI9B 4Y5VC 1E4KC 3RWCB 5IVXE 3QDHA 3M07A 2BVTA 4V1DE 2O61A 2GJZA 5EC2B 2DOCA 1U95B 1DUZB 2V17H 2QHLA 2EYRB 3L3GA 4L9LC 3EO0A 1QFWM 5FKPA 3S3PA 4HHAB 3CVHA 5IMMB 3IDYB 3FFCE 5I1GL 1MRCL 3GNML 3G5XB 1KV3A 5LGKA 5EBGA 1A1NA 5FXCH 3IDGB 4X7DC 1CE1L 1BQUA 1N8ZA 2A6KB 2JJSA 4P2QE 1QTYT 1NGWA 3OKEA 5HGBB 2EEBA 4JO2H 4PJ5A 1L9NA 1ZKAA 5A3ID 3HC0A 4Y5YA 3TA3C 5GIRB 2QL1A 1A4KA 3QWRA 1ACZA 1FZMB 3CZFA 2A73A 3U46B 5DDHA 3WSQL 4M00A 3I9GH 3C8DA 2BNRB 2QEJA 1QOKA 4PBWD 3ESUF 2DIBA 5FYJU 3C5JA 4WCYH 3WNKA 2VIRA 1RHFA 2CRIA 3GIZH 3QQ3B 1RVFL 1XGYL 4GBXA 3TVMD 5BCAA 3VD4A 1F3DH 1SVCP 5FGCE 4RWHA 4TTDD 2X1OA 2HG5A 5IK3B 2K1MA 3MRMB 1EUTA 3RWFA 2Q7YB 4WEMB 3GGWA 4YDLC 1FGVL 3UP1A 1B4RA 1QSEA 2FLRT 1CTNA 4LSSL 2HFFA 4QXGL 4GRMA 4HMCA 3B83A 1AIFB 3HC4L 5L2KD 4XRCB 1QFUH 5FYKU 3QULA 5MENB 1I3RB 3U0TA 3SCMB 3VWKC 5C8JA 4YDIL 5MHSD 2HRLA 4G6MH 1HHHA 2O5YH 4FABL 1MLBA 2ZPKH 4NQUA 2PYEB 3UJTH 4YDKL 1GC1H 4ZSOB 1D9KB 1J1PL 2CLRB 1OGTB 4Z18A 1B0WA 5H8DA 3U7YL 1XF2B 2A9NH 5DRZB 5EO1B 4ODTH 2P5WB 1V7NH 4HV8B 4G9DB 2RJMA 4M61B 3FO9B 1PG7X 3IS0X 4OTXH 3EGSB 3FCTA 3DO3A 4GAYA 2EDJA 2ORBL 5D96B 3X14A 3P77A 5AYUH 1I75A 1UM6H 2KPNA 4XVTH 1RJLA 4X5WA 4J8RA 3PGFL 4NQDD 2G9HA 4UIMB 5HI5C 3QJHB 3OR6B 4M6NL 4PJHF 4AENA 4HC1L 3D2UB 5CAYB 1MWAB 5FOBB 4MNQD 1CFTA 4PRIB 1S7TB 4DGIL 1T66C 1ONQB 1NGPH 3K4AA 4RDQG 1P9MA 4TVPE 5FYLD 1N4XH 1J86A 3O2DH 4JM4H 1W0VB 4J4PA 1FFOA 4NUGL 3F5WA 1JNHA 4M93B 1XR8A 2MHAB 5GS3A 3F65A 3BEWB 3ARDA 3UYRH 5DJ0A 3UTTA 4HCRA 1VGEL 3VJ6B 4D9LL 1C08A 3VFOA 1CVRA 1NFDE 3X3GL 3QB7C 4ERSL 3SKMA 4WWKC 4KHTL 1CZ8L 3EBAA 3IF1A 1ZEAH 3WIIL 3DYMA 2IH3A 4O5LL 4OLXH 4CJ0A 4ODHH 3BPNB 3U30B 5I73B 1N2RA 2OI9C 1B88A 5DEGA 1XGUA 3QQ4A 4G80B 1SJHB 4WDIB 3HE7B 4LVNC 4MCZA 3QR2A 4MJIB 4A6YB 2ZZUT 2HLFD 1G9NL 4R4FL 5CGYD 5EUOE 3ARXA 5IHUH 4P46A 2IPUG 4XPHL 4K94H 2VDOL 3W39B 4OV6F 4TNWF 3IDYC 4N8VB 2UUDH 1LEIB 5AG8A 2Q6WA 3MCKB 2YMXL 4J3VA 4PJ5D 5CD5C 3CX2A 1ZT7B 4U1LB 4P59L 5DUML 1I7TA 1ZAGA 5DJ8B 3HG1B 1BM3L 5FO7A 1T7WA 1NBVH 2F53A 1S9WA 4XCYA 3FN9A 4QHUA 1TZHA 5KVDH 4QHMA 1U92A 3G9AB 3QRGH 5ACZA 4C56A 4WUUB 1A1MA 2I07B 1XF5A 3FQNB 4POUB 3TT1H 2IBZY 4HK3N 3RA7L 4GBXD 3FZUD 4HKJB 2DQTL 1SJEA 3MRIB 4RGOL 2DB8A 3HUJE 5D2NC 5SV4A 4MJ5A 1MEXH 5C0CE 4F9PA 1T1ZA 1FNLA 1DDHA 1Q9KB 4JKPH 3QFJA 4LGSB 5GGUB 2DMKA 5K9KB 1QSED 1TLKA 4YHOL 1A7OH 3WD5H 2Z31A 5SWSB 4MA8H 5C0BA 3MYZA 3I02A 3FO1A 5I15H 4HZLA 4GRWH 4ZAKB 2XY1A 1JWSB 2PO6C 2SEBA 4KTEH 5GJTL 1YN6A 5FO9A 3TPKA 1CD1B 2R2EB 1I1FB 4GG6A 5DGQA 5B39A 4ZOCA 1PEWA 1BHGA 2W9EL 5FHAH 3SCMC 1MAJA 1TCRA 4ZUSA 1IAIM 2RGSA 1A5FH 4JPIB 3TNNB 2L4OA 3K7UA 4P2OA 1HHIA 2DYPA 4CN4A 5CBEB 1Q9WB 1U36A 1D9KC 3U9UB 5KS9E 4X7SL 3U6RB 4M6MH 1EAJA 1ED3B 1P5VA 3I3DA 3MRFB 3KDMB 2YD8A 5DFTA 2R4SH 4U1GB 3T4AB 4W4NA 5FA3B 2BFVH 4XVUC 2Y6SC 1P1ZB 4XP4H 5I1KH 2CK2A 4JRYA 1A1OA 3ALPA 5IJVA 5BO1L 1E6OH 5D96C 3UCRA 1J0YA 3RKPA 5JR1L 1U3HB 3DV6B 1T2QL 1J9CT 2A83A 2ATKA 1MFDL 5F96L 2J6EH 3SY0A 1A7RH 1OSPH 4J4PD 35C8H 4V1DB 4KHXH 2B2XL 1MAKA 4HUXA 2ADFH 3ES6B 5JQ6L 2YRZA 3ARDD 3UTTD 4UI2A 1J5OL 1NMAL 4Q0XL 4HKZB 4FTVA 3FFCB 1VFAA 4M93C 4CADA 4IMKA 4EI5C 1ES0B 1FE8H 1G6RL 4BSJA 1WBXB 1P6FA 2IANE 2IPUK 3BGFB 3HCVA 4I3RL 3KLAA 5F9WB 3IJYB 5E6IA 1MFAL 4L4JA 4YIQB 1BQLH 5IMLB 2BVYA 4GQ9L 4P2QB 2AEIT 3MBXH 4WU7A 4UT6L 3AY4A 1IARB 4HIXH 2APXA 3KPOA 4KMQA 5DFVD 5BV7B 1ZHLA 3BPNC 1A4JB 3C08H 3MZTA 4P46D 4U6XA 5HYQB 1U8PA 3RWHA 3STBA 3U30C 2FBOJ 4DCQB 4KPHH 1GJIA 3QDGE 5JORA 3LQZA 2NXYB 5F3BB 2VE6B 5FM8A 3HFML 5HDQH 1EIBA 1T7YA 5IB4A 4YHZL 2YD6A 4LCUA 3LKPB 3SE9L 4LQFL 4RFOL 1GZQA 1RUMH 2ICEB 4MDJB 3DRTA 4OLVL 1M05A 5ABDE 2F53D 3HZVB 4ENEC 3PGDB 4N9OB 3PV6B 5E1HB 3BP7A 5D5MF 2RFXA 1XGTA 1YYLL 2D4DA 1BD2E 3QXAB 5FGCB 3EYFA 2C3HA 1FC1A 4P3WA 1W0WA 4C56D 1J0IA 4J23A 3VI3E 1PD6A 1G9ML 3CX5J 2QADD 3L3OB 1IC5H 1UXWA 1MHCA 3UYPA 4PJFF 4DN4L 3ARUA 2H6PB 3QPXL 3M1BB 1WF5A 3ULVE 3RU8L 4NN6C 1CLZL 3RDTB 1ODAA 4OLWL 4H25A 1NEUA 1BBJA 4OD1H 3QWOB 3QNYA 4Y89A 1X5ZA 4JFZL 4Z95H 5IB5A 2Z31D 3O2DA 4M7LT 4U0QB 5C0BD 3GSRA 4YQXH 5FO8B 1FIGL 2EDBA 3ARVA 4JHZA 2VZSA 3BVNA 5EORH 4HMDA 2IAMA 2DLTA 4YFLI 5DMIL 5EO9A 1B2WL 5HGDB 2EC9T 1S7WA 3TV3H 1A0QH 4NO2A 5BJTA 3D69B 3T0EA 3IU4H 2J5LB 1R3HA 3BW9B 1HINH 3BRFA 2L7UA 2UZYB 5LXGH 4ZAKC 4Z7UA 2LAGB 5HDBE 3MA7A 9CGTA 2D7OA 1QLFA 3NCEB 4R96B 4P2OD 2DYPD 1Y6MR 1JGVH 1A7PL 5D2LA 4HG4K 5IV2B 4PJ8C 1OQOA 4LF3A 4QRPE 1XF1A 1EO5A 1ITBB 1KB9J 3DRQA 2I25N 3ETBF 3A6BL 1AGEA 3IXTA 3MUGA 3PGCA 5FGRA 4LOUD 4JLRA 5J11B 3INUH 1XZ0B 4JRYD 3T2PA 4G6AD 4K2UL 3WJLA 1WAAA 1FAIH 2MCPH 4I3SH 4UB0L 5CZXD 1CK0L 3EYVB 1NFDB 4KJQD 3QEHB 4X6BB 5DD6B 3VXRE 4P4KA 5KTEL 3S4SA 5DK0B 3SDAA 2YEZB 4N8CL 4RMWA 4OGAD 5I8CB 3CPLA 3FONB 3KHOA 3MLTA 3VFUA 1AGDB 1RIVL 1U3HC 2X10A 3CFJA 4TSBH 1NGXB 4PG9B 8CGTA 5DD5L 5T3XL 5MEQB 1SMOA 2WUBH 2E9WA 4FTVD 4WHTA 1ZA3B 4KY1H 2QR0A 3WXVH 1KJMB 4CNIA 2AI0L 1R3IH 4YC2B 5EUOB 1N59B 1FCCA 5E6ID 2B20A 5ICXA 1UACH 1CGSL 3VRIB 3CFKA 2I9LB 1RD6A 1QRNA 4RMUA 5JA8B 1PQZB 3WYRA 5JMOC 1UXSA 4HJ0C 1E4JA 2BSSA 4G7YH 5GGSY 3WNLA 5I1EL 3CFCL 3RUGE 1JF5A 2B39A 1GPOH 5L2JB 1RK0B 1MAML 4M1GH 5BRZE 2GCYA 2OK0L 2CH8A 3P4NB 5C2UB 5A2LH 5CJOL 5DJDB 5J9PA 2NNAB 2A74B 5E95B 1GYAA 4KKBD 4O2EA 5BV7C 3B8YA 4WFHE 2EH8H 2CKBB 2DQEL 1HH6A 1JPSH 5H35B 2NXYC 2YRPA 3GBMH 3BXNA 5KSVB 3FHQA 5D1ZB 3EOAA 3O41A 1QA9A 4F7CB 1DEDA 1Q0YH 5GSVA 5C0CB 1R24B 5T3ZL 3ZKMC 3HE6B 4JQXA 5E08L 1A6UL 1PYWB 2R0ZL 3ULUF 4HH8A 4PJ7A 2Q3ZA 4M03A 4P23B 3GSQB 3OZ9H 1QBLL 4NKOA 1EA9C 4YWGH 1EFXB 4TPRH 3BZFA 1B9ZA 1QFWI 2VLLB 5HHVL 5FB8A 1BLNB 5J3HC 1KPRB 4OV5A 2BC4A 5CIPB 2EDLA 5BVJA 2J6EA 1SMAA 3IFNH 1E6JH 2RIKA 3RDTC 1MCOH 5GS0C 2BVPB 2HFEA 15C8L 1DR9A 1MIEH 3D25A 4OCNC 2IAMD 2DKUA 1JRHL 1AR2A 3D85B 3QDJA 1OLLA 3ILPA 3NIFF 3T0ED 4LSTH 4XBEH 5EN2A 2YPKB 2VN7A 5TDOB 2IPTH 4XNQB 3ROOB 1LK2B 4DFIA 3EOBA 3JV5A 3SJVA 3QCVL 3QIUA 3QUKA 4NJ9L 4JJHA 4RIRA 1J88A 2F58H 2VDQL 5JZ7C 2J5LC 1FZKB 3VXTA 4GJTB 5EOQL 1H5BA 1G7IA 4Y19A 1YUHB 1O0VA 4PP1D 3FOLB 5A16A 3MRPA 1IEHA 2EDHA 1E0OB 1KJ3H 3BDBA 3QCTL 2YD3A 2FECI 1VEOA 3MNZB 4HWBL 4P2RA 5D7KD 5IKCA 5E00B 1VFBB 2QJDA 1GOGA 3RI5F 3G6JA 2IGFH 5CZVL 3ZKXB 4AIZB 4WO4B 4JY4A 5BQ7A 2B4CC 2R1WA 4ODSL 4C55A 4G9FA 1JZ8A 4PJAB 4MQXC 3SDAD 4ZUTB 1IZKA 4OF5A 1Q9OA 2IANB 3O0RL 3O81A 2AXGA 4KV5E 3DSNA 1S7RB 2GUOB 3OAUL 1UJ3A 2P5EA 1QQDB 1EXUB 3REVA 3UTSE 5DC0A 1JYWA 2DKSA 5DMGD 3MV7A 2VC2L 3DIFA 1TENA 5T1LB 1OGAE 4QXUL 3RRQA 5JOPD 5IVZA 2V2TB 1YEDA 3QDGB 1H8SA 3JVGC 4Z0BH 2EIZA 5EA0L 2NY1B 2BY1A 2OMNA 1QRND 1OL0A 4Y5XA 1IEAB 1TZGL 4TVSa 4YC2C 2XYCA 3CIQA 3GMPA 1G0XA 1XCTB 2JB5H 1CDJA 1L0XA 4MB5A 1OW0A 1T0PB 5DJ6A 1LP9A 2ADJA 5DR5H 4F7MB 1I4FA 3B6SB 3LH2H 2AEPH 3O3BB 3BWAA 3O9WA 5C08A 4FQ2H 3VFNA 4F7PA 2OYPA 4RWYL 3U79A 1CWVA 5JOFB 1VACB 5DTFB 1QFOA 4PFEA 3V0WL 2NX5A 2X1PA 3V5HB 2OXGA 1EZVY 2VDLH 3T2NH 1SHMA 3IU3A 5FYJH 1RFDH 3I50L 4HIJA 1ZHBB 4MNGA 3RWGB 2VLJE 4X6EA 5IFAH 4U1JB 1D6EB 5J13B 1MJUH 1JZ4A 1CD9B 1NCNA 4Q2ZB 3WIFB 4K3DH 3QQ9C 1JWUA 2C3VB 5D1ZC 4LNRB 2DN7A 3K2MC 4LASL 4LBEA 5FFLA 4UT9L 3NPSB 3I3EA 1OD7A 3PQYA 5DLMH 1NCCL 3SDXF 1VFMA 2DLEA 3JWDH 4EN3C 3HE6C 4X80L 1NEZA 2R0WH 3L3IB 4YHML 1P4BL 3QNZA 3U9PL 1SY6L 3EYSH 3D18B 3AROA 4NM4L 1ZGLP 3TYFA 1GRWA 1YPZB 2MQ3A 2OTWB 3MRLA 5FDWB 3I6KB 5E8DL 3E2HC 3WXWL 4QCIA 3GDBA 4N0RA 5FM4A 3V5KA 1OAYL 1FGNL 1F3RB 2EO9A 2OZ4L 2VR5A 1A2YA 1MHPL 3TFKD 1FLRH 5HHQB 2AGJL 4NJAH 1ZHNB 4KRPC 4NQSA 4TNVK 1HI6A 2Z8VC 3QDJD 2FX7H 2MKWA 3S6CA 1NBYA 4Q6YA 4QRPB 1BJ8A 1FVEA 5K59E 3P0GB 1DANT 3EO9H 2I60H 3PNWA 2PCPA 3SJVD 4HS8H 5CP3H 3F12A 2VMFA 3LD8B 4S1DC 3QIUD 1LWRA 1IEBB 1U8IA 3NCJH 3BKJL 3WFDL 4PRDA 3SDDA 4DN3L 3CC5A 5H94A 3GM0A 4RBPK 1K4DA 4NIKB 1QACA 2UV3A 4MAUH 4Y19D 3G08B 2I24N 4KQ4H 4UILH 1S3KH 3WBDA 2XG5A 1UA6L 3L6FA 5F7UA 3DX8A 4JO1H 4P2RD 1MI5E 4HDIA 5IBLD 3ULUL 5SWQA 1OOAA 1FN4B 1WICA 4G9FD 1WT5A 3BP6B 3QXTA 4LLVA 3C5ZA 4KJWC 5DC4B 1A7QL 4DW2H 4QF1B 1KG0B 3ZYZA 4ODWB 1L0YA 1MCWW 5EU7E 1QR4A 5GSRA 3BIKA 3P4MA 3ZKXC 4WO4C 1XEDA 4PY8J 4GT7A 2IQ9H 4PRPA 2V5MA 2CO7B 2P5ED 5EO0B 3CMGA 3LEYH 3V6FB 4U1SA 1HIMH 3MV7D 4NKIL 3RUGB 1AGFB 5BRZB 1KACB 4OQ1A 4WW2A 5JDSB 3KJ6H 1IAII 5TE7H 4N5ED 4PJGA 3OWEA 1U3ZA 4EUPH 2DQHL 4P4RA 4QRRE 3T3MF 2NLJB 3QUZC 1JNNH 2UY6A 4UQ3A 2Z4QB 1DE4B 3ZYOA 4FFZH 1YY9C 2NY1C 5EU5A 4NNXB 1KLFA 2CDEA 2DJSA 3NZ8A 3UAJC 4GAJL 1NUGA 1Z9LA 3LN5B 2E5EA 2ADIA 3O9WD 1M7DA 3V6ZB 5C08D 4I9WE 4LSRL 5GRUL 4XMLH 4X7FC 1KBGL 3MGOA 1UM5L 4E42B 1U93A 3UZQA 4Y4FA 3WDHA 5TQ0H 3SGDI 1YQVH 1D5IL 3L3KA 3DVNA 4X9BA 3SKNB 1WTLA 2NX5D 3GSNB 1NMBL 2XXCB 3SE3A 5A2IH 2HKFH 1FAKT 4CW1B 5DS8A 4Q6IC 5DWUH 3RTQC 3U4EA 1NFKA 5C9KA 3KS0H 3WNPA 2YSSA 4MS8D 4AM0B 3ULVC 4YDJB 1GGYA 1A14L 3PQYD 5IFHL 5J13C 1O7SA 1YNLH 4XMKH 4IBLT 5GGQL 3MLUH 3MODL 1KJ2L 4XP6L 2AJXH 4Z0XB 4NYLB 3SGKA 4X0KA 3KWWB 4I3GA 1FV1A 4G8EA 5IB3B 5FF6A 2FJFB 1BAFH 1DN2A 1KEMH 3BP5A 4EQ3A 5C0DA 5IEKB 2HJKB 3DYOA 4JZJA 1MVFA 3O8XB 4LFHG 5CGMA 5D7JB 1KNOA 3VWJB 4D9QD 3V4PL 1K8IA 2XFXA 2YZ1A 4XXDA 4X9GA 3TJHC 4JFXB 1AKJB 3ESVF 4UQ2A 3S8WA 1A02N 4OCSL 4OCYH 1R0AL 1C5DA 4RRPG 5AZ2L 2IADA 2YR3A 4PJHE 4XNMB 2XA3A 3D5OF 4OI7A 3DLQR 3SDDD 3HPJA 3LSOB 1MJ8L 2MFNA 1A8JH 1N64H 3WFBH 1X4XA 2Q86B 3U36B 3LD8C 3RKDC 4F8QA 5C0RH 3DXAA 5IW3A 2EDXA 1EAPA 4UDTA 2R2BA 5I1JL 1NC4B 1TNNA 4QHKI 1JGDA 1X6LA 3HI5H 4R4BA 5E2TH 2R2HA 1ZGLA 4G6JH 1G7JB 1T1XA 4U1KB 3RZCB 2H2SD 4WI9A 2ITDA 3QEGL 3QXDB 5JO5A 3NACH 4OF3A 2VLMD 3GKWL 3VD7A 1JPGA 1V3LA 3BKYH 2RAMA 1YMME 2CUHA 3ZDYE 4PRPD 3HZYB 1R5WA 1K4CA 1PX4A 2CJUL 3QJFB 4MQ7B 3ARQA 3MREB 3H9HB 4RAUB 1BZ7B 1Q9LA 4LSQH 4JPVH 3CK0H 5L0QB 1FFRA 3IKCA 3G9VA 3UTPE 1L7TL 4HIIB 1FSKB 1GH7A 2ILLA 2QHRL 4NDMA 4O58H 3VFPA 1D5ZB 1YY8A 2AQ2A 4K3EL 4TSAH 1CQKA 5DI8A 3JTTA 3QI9A 4MAYC 4EDXB 2Z35B 3W0WE 1V3MA 4QTIL 3O3DA 1NJ9B 3KPRA 2X4SB 3FT4B 3ZT6A 3AXLB 4WHYH 3T8XB 5DT1H 4OZIE 2E7LC 5INDB 4GAGL 5JIHA 1EEYB 4CDGC 4UIKL 4LRIA 5BS0A 3AU1A 2VLJB 1BGXH 1OTTC 2EEAA 4N0CD 4ELKA 1WVZA 4HW6A 5EOTB 4Y4FD 2DQDH 3BPOB 1AQKH 2GTWB 5D1QC 2HVKA 1INQA 4MVBD 2NW3B 1FG9C 2NY4B 4YE4L 1NCWH 3MYJB 4TQEL 1KCUL 2YD9A 2FD6H 2ZG2A 3O11A 3QZWA 5HHNA 5HJ3A 4DEPB 1NGZB 1UH3A 5T1DL 2J1KA 1H0DA 5L8LB 2J8UB 4L8SA 5J56B 4OCMC 2WINA 3I85A 3ZE1F 1A6TB 3QIBC 2COQA 1H3TA 4J3SA 3V9FA 3EAKA 1DBJL 3RIFF 5IF0B 5D71L 5FHBH 4BQ8A 4XNUH 1OB1A 3GKZA 1ORQB 3DMMB 4OF8A 3GMOB 1DBBH 3S96A 3QHZH 1YDPB 1SYVA 2XY2A 5DD1H 5SWZA 4PRHD 4NQCA 1ZVHA 3AAZA 4QRUB 4ZUUB 2R23A 3SEPA 2AK4E 1MCBA 1F2XK 5I1IL 4PJCB 1OF2B 4WI5A 2I5YH 5TGBA 4L9LA 5MERA 3MRGB 4U0RC 1JV5B 5IW6A 2G5BB 3VGAC 4CVZA 2D3VA 1FZOA 1Z5LA 5L8JB 5TF0A 3VXSD 3V7AG 5L2KE 2A0LD 3O8XC 3T65A 1S7SB 4JPKL 1MI5B 2Z93A 2ARJQ 4D0CA 2ICWB 2ICCA 2VZVA 4D0DB 4EUPA 3X12B 1FJ1A 1MWAH 4L8BA 3IETB 3DXAD 1XF3B 4N1CA 2OQJA 1ULVA 4PTUB 1Y0LB 1WWWX 5BXFB 2KH2B 1UKTA 1MIML 4OGXL 3ARYA 1Q72H 2W9DH 1VADB 2EDQA 5M94B 3WFHA 3WUWA 2QTEA 4J1UA 4NQDE 1EHNA 3NAAH 5DQDL 3PWPA 1BBDL 2W38A 3SGEH 4IDJL 3B9KA 5CD3A 5FYJD 2DDQH 3VA2C 1U0QA 3DWTA 3RWIB 3O6ML 3EJZC 4HXBH 4RFNB 3RPIA 2VH5L 2XI9A 4QRRB 2CGRL 1AC0A 2DTML 4ESKA 1IC1A 4Z7WF 4KI5F 4PJDF 4OLZL 3BIAX 1HHGB 1LGVA 4ETQA 2WP3O 1RULH 3FTGA 1WIOA 3VWKA 3QI9D 4A6YH 3PG2A 3KPPA 1CE6B 1KTLB 5L0QC 5JXAH 1KSRA 1FYTA 1U41A 1FSKC 1MHHA 3KPRD 2EE9A 4KDTA 3QEQB 4YFEA 1EHLL 4KJYB 3IFOA 3KGRA 2EECA 1QSFA 5LQBL 4K07A 5B3JF 3LKRB 3ZKSD 1QBBA 2BRRH 5BS0D 4KKLD 3OB0K 4DVRH 2CXKA 2D03H 1TQBC 1KCRL 5L7XH 4RX4A 3P30H 5DGRA 1HSAA 2VLKE 4OUUA 2YHGA 4WHDA 1U6AH 1T04B 1RUQL 3DHMA 3PL6B 4L3EA 3P73B 3T2OA 1RIHL 5SX5K 2AJUH 4JHWH 3LS5L 4GMTH 2DIJA 4OD2B 4Y1AB 3Q6FA 3NGBB 2CMRH 3QDMA 4ZFZB 3W2DH 4G8IA 3BPOC 1AP2A 5K9QI 1PKQE 5C71A 4OCRL 4QRSB 4PJ5E 2VAJA 1JZ7A 2G75A 2NY2C 1SM3L 1G6RB 2DM2A 2NY4C 1KT2A 2AV7B 1RZKC 1NUNB 1SEBA 4DEPC 4BA8A 4PGCB 2XTJC 3BMVA 3MR9A 4HZAA 3FJTA 3BH8B 1HQRB 3MBEC 4JO3L 3GMRB 5EZOH 2Z91B 4WWKA 5SWZD 2F54A 3IKKA 4NQCD 1IRAY 3DV4B 1I9RL 1Z9SA 4X8JB 4XWGH 3E6HB 4JZNB 3U4BH 3BYTA 1OTUC 4LGPB 1CBVL 2WAHA 4PJHB 1AD0A 3BIBX 1QLEL 3PJSB 3RWCA 5KJRL 1I1YB 3LQAL 4NWTH 2DWEB 2HVJB 4ZFOL 2LQRA 4QO1A 4JHAH 4KQ3L 4UNTA 2XZQL 5EC2A 1BFSA 1U95A 4XP5L 5D6DC 1DUZA 2EYRA 3MRNB 4HHAA 4PUBL 5IMMA 2VZ1A 5D7LE 1NAMB 3UPAA 2VXQH 4ZS7L 4K7PL 3G5XA 5ERWB 5GJSH 4ZTPH 5CP7B 2VXSH 3IDGA 3QG7H 4JG0H 4XPFL 3SDYL 1J18A 2A6KA 4I0CC 4LU5H 4R7DB 1YMMB 2P8LB 5JIIA 5HGBA 5AEAA 1HSBB 5BOZG 2JCCF 2R8SH 4X8XA 1FPTH 5GIRA 1FFQA 1ZMYA 1BQSA 3ALXA 3QRFM 4IRJB 3S5LG 2ZCKL 5EU7C 1FZMA 4JREB 3U46A 1UADC 4WI6A 3CSGA 3LMJH 3SE4A 2E27H 1JNJA 3QUML 3PWPD 1HWGB 2BNRA 4KK6C 3B9KD 3G5ZB 2VXVH 5E2WL 4PJ9B 3FT2B 4WIQA 2VDKL 3RZWA 2HT4C 4PRAB 5D1XB 3W0WB 1S5HB 4OCWH 2HTKD 3QQ3A 4U7MA 1MCWM 3WKML 2WIIB 4H8WH 4XI5C 5D9SB 3EYQC 3MGTB 2BSED 1P4LB 2XWTB 4YH6A 1LO3H 1PW3A 2OL3L 5IK3A 3MRMA 3H6JA 4FQIL 2Q7YA 2LFGA 4HAFA 3VWKD 4RFNC 3UTTE 5BV7H 4LIQE 1F4YH 2HH0H 3IVKB 1FYTD 1KF9B 5IR1B 4OLYL 1UH4A 2CUIA 4CU8A 5IQ9B 3RAJL 2JB6B 1AIFA 1N7MH 3RWEB 4XRCA 3S88L 5MENA 1I3RA 3SCMA 1QSFD 2IBBA 3LB6D 1IAOB 1X7QB 1QFWH 1WIPA 1SBSL 1VFUA 4I77H 2PYEA 4ODVL 2LABA 4F7TB 1QYGL 1RHHB 5DXWA 4RX4D 4ZSOA 4EJ1C 1D9KA 2CLRA 4HIHB 1OGTA 4PBXA 1XF2A 4PLKD 5DRZA 3V79C 3ZE0F 5EO1A 2P5WA 3L3DB 4HV8A 4G9DA 4M62H 4M61A 3VDAA 4OJFH 5DZOA 4L3ED 3HAEB 5HI5D 1YEFL 4UBDD 2O93L 3FO9A 4NRZB 3EGSA 2HKHL 3DSFH 1MCKA 4JFFE 2WBJB 3FQUB 3TT3H 5F7YC 3PDOB 3PL6C 3ZLQC 4UIMA 4B53A 3QJHA 3OR6A 1KYOJ 1T4KB 3D2UA 2N1KA 1IGCH 1MWAA 5FOBA 4PRIA 2F53E 1S7TA 2X9WA 3NGBC 4P9HL 3VFRB 5GS0H 2W07A 5DJCB 2AK4B 1ONQA 3WE6B 4BZ1L 3GHBH 1LEKB 3AC0A 3DX9B 4PTTB 4EIGB 1QFHA 4JM2F 2V7NB 2CIIB 3MXWL 1W0VA 1EGJL 2F54D 2MHAA 1IKFL 5CKAA 4MXQC 3UJJL 2O5XL 3BEWA 3NIFE 4L9DA 3SQOH 4JFYB 5D7IF 1SEQL 3VJ6A 5L2KB 1MREH 1DANU 4DQOL 3AB0C 2VO5A 5F7EH 4C54A 4NQEB 5HHOE 2PYFB 1ZWIB 3Q48A 1DQML 4X4MA 2HRPL 3T77B 3BN9C 5HYSG 2HJLB 3CSPA 4J3UA 1S5IL 2EE3A 2Q3AA 5DVOA 4AG4L 3D0VB 4M5YL 4RAVB 5C2BL 4G80A 4TVPH 4IRZL 1SJHA 4WDIA 1CL7H 3HE7A 2OP4L 1FL6B 3PE9A 1WFUA 4MJIA 4A6YA 5IT2H 1ZLWH 4GG6E 2VNCA 1CXHA 4ZTOH 1QZ1A 2D9QB 3W39A 4YEEA 4RDQF 1PG7W 4N8VA 7CGTA 2ERJB 1LEIA 3BKML 5SX4I 1ZHKB 3TO2B 3MCKA 3NFSH 3FT3B 5E1AB 1ZT7A 4U1LA 5LGHL 5FECB 2BZDA 4H0IA 5DJ8A 3HG1A 4OB5L 3O6FB 4R2GB 2NQCA 4QXWA 3TBVB 2APWA 4QXTB 2W9LA 1WZMA 5ACLA 3DGCR 5C0FB 2BNRD 3ZE2F 1NLBL 1WITA 4WUUA 1OAKL 3MQIA 1NL0L 5KZCB 2I07A 3SKJL 3FQNA 5D70L 1OWRM 4H1LB 3FAXA 2WWMC 2G60H 3GHEH 1QHOA 4HKJA 4NM8H 2N7BA 1GXEA 1Z6JT 2ZUQC 3MRIA 2J4WH 4OAWB 1F97A 1XIWC 5ADOH 1WISA 5FM5M 1Q9KA 5D5MB 5GGUA 5ID1B 5K9KA 4KXZI 3QCUH 5A43C 1YEEL 4FTVE 2VLKB 4UNUA 1BF8A 1AI1L 5SWSA 1EJOL 1MVUB 3MV11 5MEND 4PY7B 3SCMD 2R9HD 2P24B 2DI8A 4ZAKA 1JWSA 4KWUA 2Y25A 5EBLB 2CKBH 1F4HA 4PJFB 5E5MB 2PYED 2V9QA 2LE9A 2FATH 1CD1A 2R2EA 1I1FA 4JQIH 1D9KD 3FQTB 1PKQB 4FN0A 2E9IA 5I1AB 1VDGA 5F70A 1J1OL 2P5WD 2VQ1B 3D48R 4NUJB 3IAQA 4LDLB 4XVUD 1OAZL 2Y6SD 4JPIA 5IQ7H 3TNNA 5ESQB 1I3UA 5CBEA 4RMVA 1Q9WA 3U6RA 3U9UA 1FDLL 3PP4L 3FAWA 2CSPA 1ED3A 1JZ3A 3MRFA 3KDMA 1RZ7L 4TULH 3SDXE 3T4AA 3NCYS 2LTQB 5FA3A 2CDFB 3D2UD 1TJHL 3B9EA 1OWWA 1P1ZA 1P7KB 5J6GB 2F9BT 4PRID 3SO5A 3ZSSA 1KC5L 2X4PB 1KCLA 1U3HA 3DV6A 2GEEA 2LAAA 4V1DA 4NGHH 4M9OA 1G1CA 4A2MA 3GEWB 3ES6A 3TVMC 2WBKA 2R56H 1OD9A 1YC8A 4TTDC 1J05B 1RZFH 2DQJL 3B5HA 1F4XL 4HKZA 1JGLL 1V05A 2AK1H 5D7LB 3FFCA 1TVDA 3MRJB 3D1MC 5M7QA 4F3FB 1ES0A 2MQ0A 1WBXA 3NZHL 4NZRH 4YBQC 3IJYA 3F7PC 4YIQA 4IMLB 3ARSA 5IMLA 3BN3B 3CFBB 2A6DB 4JFHE 4P2QA 2VRAA 4HAGA 4NZUL 1ZANH 4XNYL 2DJ4A 3HE7D 4UV4H 4LLUB 4YXLH 1KXVC 4MJID 3OJ2C 1A4JA 3WFEH 1K9TA 4KGJA 5HYQA 1CIDA 4DCQA 3T0EE 1IAIH 2H32H 5FYKL 5F3BA 3JWOL 2VE6A 4Z7UE 4JPWL 1CF8L 3LKPA 1BWWA 3OKKB