1J1OH

Crystal structure of hyhel-10 fv mutant ly50f complexed with hen egg white lysozyme
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
publication title The Role of Hydrogen Bonding via Interfacial Water Molecules in Antigen-Antibody Complexation. THE HyHEL-10-HEL INTERACTION
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2002-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j1oH00
3ZTJG 3LQMA 3QO1A 4U1JA 4AEEA 3H0TA 2AI0H 1L0YA 2DQGL 4PJ8A 1V7NH 5T3XD 2OR9H 1L4IA 3JSSA 3L6FB 4LPTA 3VGHA 3HE7C 5DURB 3SE3C 2G2RA 1GIGH 2BP3A 4MLSA 1OB1B 3P4NB 3HZYB 2I60H 4KK5C 3IU4H 4OZGE 3MRRB 1R5IA 5DQ9A 4ZNEA 3GMPB 3DX7B 4KVNL 1OTSC 4TN9A 2ZCLL 2GYSA 2W92A 1NAKL 3BEVA 3TZVA 5E4IA 3T1FB 3VFWB 4PJHA 2NW2A 3B5GA 5SV4A 2R56H 5FUOH 4LDEB 2CXGA 1MWAH 3VXMB 3SE4A 1OCWL 4QRRE 4HF5L 4XVJH 4OZHB 1QEWA 3NGBC 4ZUWA 3MXVH 4QHKJ 4E5XB 5HI3D 3KYMB 2EH8L 5HYQB 4YDLC 1FSKB 3JUYA 1PX4A 2FIKA 2XICA 4PJBE 2VLJB 4Y2DC 1W72L 3SPVA 4AENA 4JRWA 4WUUB 4MA1C 4HHAA 1NBZA 3RVXD 4HS3A 2IAMB 3A67L 3FQXA 3MMEB 3PWUA 5D1QB 5H94B 3U0TA 5DDHB 1JPGA 2NXYC 3FQNA 1IQWH 1FC2D 5EIVA 2EDXA 3GBLA 4Y2DA 1YPZF 1UYWH 2V7NA 4OZHF 2AK4E 4B7LA 1T0PB 3RKPA 5IWLC 1XGUA 3LN5B 5CJQL 4KJQD 4KZEH 4U1GB 4XCFL 5KS9E 4PTTB 2OMNA 3NFPA 1E0OB 3OKLB 3PGFL 4WHTA 3RI5K 4Z76B 1DDHB 4K9EC 1F02I 1GGIL 2J5LC 2A0LC 3L3GA 4EXPX 2AJSL 4BSWB 1IGFH 4PJAB 3G6JE 1Z3GL 1QBBA 1UEYA 5DRXA 3U4AA 3UBXB 3FOLA 3AAZB 1JVKA 2CLZA 4LU5H 5D1XD 3OAUL 2HTLC 3OPZL 5FKAB 5FHAH 2V5TA 3VGAB 2GJ6B 5CSBA 4PS4L 1P4LA 4C57C 4LSRL 1J7VR 5EFIB 2P4AB 1J0JA 1OAYH 1QBML 3U6RA 3BZ4A 3GSOA 3VWJB 4LHQB 3GRWA 1RJYB 2OLDA 4LMQE 1QO3A 1S7XB 3NAAL 5FUZL 1LMKA 1PYWB 4OJFH 4G8FB 1I7UA 2FYYA 2ZG2A 4JY6A 4HT1H 5SWSE 4UDUA 2AK1H 3I3DA 1KB9K 2FCBA 3WNOA 4NFCA 3ARVA 4RWYL 4XPBH 5JW5B 4I8DA 1I1YB 2VLRA 4D0BB 1B90A 1ZHBB 3KYAA 4Z7UA 4ZPTB 4LP4A 4GG8A 1TJHH 4LL9A 3FTGA 1S5HB 2D7OA 3RHWF 3D85B 4Z5RB 1OGAA 1WIUA 5KVGL 4XNQA 4MCYA 1JNNH 4J3WA 4PRIA 4L8SB 3V7MA 3T1WA 3C87A 4TOYH 1JHLL 1GOFA 4WCYL 5CGYD 1WK0A 1NH6A 4LCUA 3TBVA 5JXED 3BN3B 4E41D 1IMHC 4G9FE 4PGDB 4TRPL 5A2IH 1BVKA 4C56B 4KVCH 3CX5J 1L0XA 1EEZA 3FMGH 4PJ5A 3RWIA 2EDNA 1KENH 4DKEL 2WP3O 4NN7B 5LXGL 3QQ4B 2MCG1 3UO1L 5ICYA 3QR2A 4ZQKB 5JHLL 1HNGA 1NMCC 1CL7L 4GG6E 4OBRA 4LCYA 1WWCA 2P24A 3B9DA 1MUJA 2D0GA 4ZUSA 2G75B 1RY7B 4XC3H 5HGHB 4XCYA 4ORZC 1TENA 3SGEI 3RX8A 3QDMD 3GUTA 3KDMA 1DBKH 2J6EH 2QQKL 1CLCA 3RPKA 3W2DH 2P44B 5ADOH 5FECA 5JPNA 3V9FA 4OCYL 5KSVB 2HWZH 4LSSL 4NQUA 2LTQC 4QRPB 1MELA 3ELAT 5BMFL 3MV9B 3EYFB 3QNZB 3S88L 5CJXA 3ARGC 4EI6B 3FB7B 1D5MB 3VWKC 5K59F 2VR9A 2WANA 5EULV 1NFKA 4GKOA 2VC2H 1AXSA 4DVRH 3VI3F 4ENEC 4YK4B 3SDDB 2DQFA 3I85A 4CW1A 3ARGA 1FNLA 3VWKA 4X98B 4X7TA 1JWMB 7CGTA 4PJ7F 2VQ1A 1J12A 3WBDA 5CILH 1VPOH 3N1PC 5E9DD 2X6MA 5B4MD 3CFDB 5E8OA 4LFHD 2W9DL 2A6DA 3QG6A 3TT3L 3RUGE 4NQDE 4Z7VE 3MXWH 4TSAH 2HT2C 1KCUL 4OD1L 2F8VA 3W9DA 2DKSA 2YA1A 2X4PB 1Q94A 2MQ3A 2ENSA 2W1NA 3HAEH 3FO1B 3NPZB 3V6FA 1XCQA 1BFVL 1MCOL 2XWJB 4YC2C 3QUYA 4WGVB 4YE4H 1ZLWK 3BT2H 3CFBA 4XVSL 4BQBA 3L7EB 3UTTA 3TLRA 1H8NA 2QKIA 4QHMA 2FEEI 4XAKE 4ZUVA 2D7MA 3FAXA 5E5MA 4MDJA 5DJ2B 4JFHE 1KJ2B 1QRNE 3G5VB 3FFDB 4JFEA 3WEXB 2XKSA 3SJVA 4LVOC 5DWUL 2D0FA 2BVUA 5LAXB 1EVTC 4KHXL 1W8NA 3MNWA 3SKMA 5DMGD 1U3ZA 1GZPA 3ZMRA 1CFQB 5SWQA 3SY0A 2X4TA 1G6VK 2F5BL 2Y5EA 2VXQH 3QG7H 2F8OA 1ZLWH 1XIWA 4NM4L 5GS0H 2VL5B 4OF6A 3HRZB 1IM9A 1TCRA 1XH3A 1FC1A 1OAUH 2CJUL 4HGMA 5DMKA 4HLZH 4XNZC 1AGBA 4Y5XC 3O45A 4JGMA 4NSKB 1U95B 4OFKA 1A7RL 3GM0A 3UYOD 3A0OA 2KL6A 3MO1A 2C9AA 1FRGL 3SGDI 4U1LB 4IIQA 3SE8L 2V9TA 4JRYE 5IMKB 4CMMB 3CFJA 3S4SG 3BGMA 1FHGA 3VFUB 5J6GA 3R8BB 1P2CA 4HH9B 1JZ7A 3ZKXB 1BJ1J 2YPLE 5FOJA 3WFHA 5FOBB 3O4LE 4K7FA 2VE6A 4NN5B 1GGTA 4P5MB 4NZJA 4MAYB 3LHPL 4CU7A 1H5BA 3ABZA 1YEHL 1C08B 2HLAA 1PFCA 3NFNB 3IETA 1A14L 1I4FA 3FOMA 4PJCB 3WV0A 3B2UC 1A47A 1Y0LB 1PQZB 5J1AA 4DGYH 3FN3A 4PBVC 3SGJC 1RPQA 4HWNA 5E6IB 2Y07H 2XY1A 2Y06L 2IC2A 2G5RA 2KKQA 5T1KB 4OCXL 3SE9L 3JV0A 2VDQH 5FYJD 2XXCB 4RAHA 5GGUA 3BIBX 2A74B 3HFML 5ADPL 4AEHH 1NFDE 2HH0H 5IM7B 4A6YA 1DANT 5F1IB 1QSVA 5GPRA 2WZPD 3BH9A 4X6DA 4GKNA 4KRNA 4KKNA 4F7EA 4UZGA 3ULVF 5IQ7L 5D2LA 2YD1A 5IEHB 5D7IE 2AI0L 5AUMA 5IOPA 5C09E 3MZTA 2A83A 1HSBA 5HHPB 3RU8H 3FRUA 1D5XB 3RGVB 4Z9KB 4QYOA 4V1DD 2YD6A 5EB9A 3WNMA 4FMKA 4IHOB 5J11B 2PCPB 5BVPH 3UPRA 2OZ4H 4KI5D 1GIGL 3GHEH 4YGVB 3VCLB 4XWOC 5A1AA 4Q2ZB 1A3QA 2LU4A 2I60L 3IU4L 1Q9WB 4GBXA 2BOCB 2XV6B 2DI9A 3GBML 2A9NH 4XH2A 2OTWA 2X4SA 5GS1A 1RUAH 1OAZH 1LO2L 3BAEH 2ILLA 1U8HB 1VFMA 3SGKA 3MLTA 5MEND 1JN6A 2R56L 1TTGA 1F5WA 5FUOL 2BRRH 5KN5B 1MWAL 4WV1C 4XVJL 4L9DA 1DQTA 3MXVL 3FFCD 2GY7B 4IRZL 4RMVA 1G6RB 3BDYH 4LLYA 4FQ1H 5DFVD 2GSGA 5IB1A 5IHZB 5DRWA 2C26A 2X4RB 4KDWA 4MGXA 4XTRC 5HHMD 2E27H 3MA9H 3QWOA 1S7RB 3BD5A 4FNLH 4W81A 4KRPD 3D6GA 3V8CA 2Z31C 2DKUA 2VLME 3CVIH 1IQWL 2A6IB 1AGDB 4HGWA 1ZSDB 2YD7A 1XGPB 2VLKD 1AR2A 2GJZA 2Q6WA 2IFFH 1T4KB 4I3RL 5L0QB 3NZHH 1NCTA 1FPTL 3C6SB 3GJEA 1AO7D 2PYEA 2OS7A 2Z31A 2P43B 4FXKA 1BQLH 1TZHA 3WFDH 4KY1H 4G6JL 3K81A 2R1YB 5I1IL 2BVEA 1P4IH 1IM3B 4IJ3C 1BBDL 2XTJE 1HINH 1D5ZB 3QNYA 4JDTH 3RAJH 1GSMA 4LU5L 4PJXE 4GRWB 2EE2A 1RJZB 1UADC 5FHAL 4OGAD 2QSVA 4QLRA 3SOBH 3TO4C 1EXUB 3F6IA 3O41A 1RZGB 5EIQA 3QDHA 3PNWA 4GRMB 4P4KD 2DJUA 4PY8J 2V2TA 3VXNA 5CEXB 4OJFL 5E2TH 4HT1L 2CIKA 3KWWB 2AK1L 1QSZA 1GGCH 4LRIC 2XY2A 4XPBL 2HFEA 1LE9B 3DROB 5GRYA 4U1KB 3D2UD 2F53E 4HG4J 5I2IA 4HH8A 1KN2L 3ARDD 3T8XB 3JTSB 2H8PA 5LQBL 1TJHL 3BW9B 3WHXA 4N5EC 1JGEA 5J56B 3EKCA 4G8GA 4MHHI 1M7DB 1JNNL 3ETBF 5FGRA 4H88H 4M9OA 1RUQH 4M93B 4I2XB 1BMGA 4F7CB 4HUKB 4KVCL 5JIHA 4QXGH 4YEFA 5JMOC 3MRJB 1KENL 4OF5A 1SVZA 3SKOB 5DXWA 5ANMB 4I18B 2AKRB 3I3EA 2MSPA 3FQWB 3STLB 4QWWD 3TA3D 4R7NA 4QKXB 5JZ7D 4ZOBA 2A6KA 1ADQH 3AXLB 1YN7B 4ZO8A 4PRBB 1CDBA 1F6AA 2EDFA 4XC3L 1DUZA 1DBKL 2J6EL 4X8JA 3W2DL 5ADOL 4LVNB 3AY4A 3NFSL 4TVPE 4ZFZB 1AIFA 5IF0A 1F8TH 2HWZL 4PREB 5D4QA 1TPXB 1KEMH 3GSNA 5BRZE 1GVIA 1NBYB 1J11A 1KCLA 3QJFA 3V6ZA 4H8WC 4J3UA 2ZKHH 1T22A 1NAMB 2DMCA 4P5KA 3Q5YA 2W0FB 5GGRB 2VC2L 4XHJD 4CJ0A 4RIRB 4XP4H 1J5OH 1WFTA 3WLBB 5TJWK 3ES6B 2DLIA 1BLNB 4GS7B 2ZG3A 1T0MA 3BP5B 5EU6A 2PTTA 4AY0A 4Q6IB 5CILL 3ZYZA 4I0PB 3PP4L 1IE5A 4FQXD 3U9PH 1JUFB 4PJDB 1S8DB 4PJFF 1ZGLP 3UTSE 4JN1L 3MXWL 3MRBB 4OIAA 1QSFE 4J23A 5I1DA 1KB5A 4JJHA 5F88A 5E99H 5EU4B 4HC1H 1CICB 3WNLA 5DZLA 1CVRA 2JF1A 1LDPH 3QQ9D 5C0CA 3MLVH 5GIRA 4JKWA 1IEAA 3BT2L 4XP5H 3JBG7 1N7MH 4BFIA 3LD8C 5DMJB 2EDWA 1WTGT 5L9DL 1E28B 4P5TC 5HDBF 4MJIB 4WW1A 1UEMA 3FO9B 4OQTH 5C0AD 1QSEA 1UXSA 3ECBA 3EO9H 4NCC1 1NKOA 3GDBA 2ADGB 2VXQL 3CK0H 3QG7L 1X3DA 2UWEB 3MFFB 3F12B 1XGYH 1XCTA 2ATKB 5F3HA 4P5TA 2GY5A 5T1MB 1YUHA 3KPMB 3VXUE 4OZIE 1OAUL 2F54E 4ELME 1K4DA 3P2TA 4XVUD 1LP9E 1QHOA 1NCCH 4Q0XL 4XRCA 3V0VA 2IAND 1U3HD 2FJHB 2CUIA 3I75A 4NC1E 4HFWB 2BMKA 2X2YA 3HG1B 2FD6L 2I07A 1JGDB 1U8PB 2XNAB 3WFZA 4TNWF 1HI6B 3S8WA 1A2YB 4QHLA 5J4MA 5LWYH 4TNVK 5EN2A 4MCZB 4WO4C 3QEHB 1A21A 1UWGH 1R3LB 4EVNA 4Y5YA 1H8OA 4OLWL 3DO7A 3QCTH 3FZUC 1AY1H 1TVBB 1U93A 1P7QA 3IDXH 2C3XA 1R5VA 4RFNB 2C1OB 3W5MA 2W65B 3HLAA 1G7MB 2AGJH 4WO4A 4HPYH 3D3VA 2F74A 4YNYB 4M02A 4DGYL 1O0VA 4JFFE 2JIXB 4KU1A 2IJ0C 32C2B 3VI4F 2Y07L 1KJVB 5GRXG 4G7YH 3F8UB 3OKDA 4Y16D 2AJ3B 4LIQH 5AZEH 4AEHL 4D0DB 4QEGA 4ZMAT 4CADA 1A6ZB 4JJ5B 5I1CL 1S78D 2HH0L 5GGTA 2GI7A 4TVPH 3O6FB 3MRKB 1GHFH 3ARQA 1B6UA 4MZ2A 4RMRA 2GITB 3DGCR 5LBSH 2NY3B 5F93C 5EZIH 4Z78A 3RU8L 5KVDH 1I75A 1NGWB 4IRJD 5IBLD 5HY9A 4J8RB 5I74C 1GXEA 1K2DA 1NC4A 1ND0B 4UDTA 5BVPL 1VFUA 4P3DA 2P5WD 2OZ4L 1IILE 1UB6A 2Q3ZA 1MCSA 1VEOA 3G5ZB 3VMOA 4PLKC 4ODTH 3ZYJA 2ZSWA 2QBWA 3HHRB 3LKOA 4UIMB 4R96A 1CL7I 3RVUC 3MUGA 1MF2H 2A9NL 3BE1H 1UZ8B 1NANI 1RUAL 1OAZL 1RK1B 1CZ8H 3BAEL 3T0EB 4DKAA 3LPGA 4MD5B 1ED3B 2BRRL 4R90H 2NXZB 2R0WL 1YY9D 1U8MB 5A43C 1YEEL 3AFLA 4JKMA 1A0QH 4JFZH 35C8H 3L6FA 3PXJA 3R06A 1J1XL 1SEBB 4KK8D 5CP3H 1RK0A 4GLRI 3BDYL 5HHNA 5GZOD 4FQ1L 1OB1A 3P4NA 3HZYA 3ARZA 3MRRA 1JZ8A 1BX2B 3TBTA 4LLMB 1KELH 4CVXB 4JZNB 4Z7WB 3T1FA 3EOTH 4ELKB 1J88A 3ZE2F 2E27L 3MA9L 1NC2B 1ODAA 5HHVH 1P5UA 2ARJQ 4FNLL 3NIFE 5D5MF 2DM7A 1UGNA 3QIBC 4RA3A 4UINH 3QAZC 3VD5A 3VRJA 3CVIL 1YPZA 4P2RD 4YDKH 4Q9BA 4OZHA 5F6IB 1JGLH 1AE6L 1DQJB 1KGCE 1J8HE 4JO2H 1P7KB 1RIUH 4E5XA 3C60C 3KYMA 4FTVD 4Q9RH 1UCTA 5IB4B 1I8LA 3LQAH 2IFFL 3ARBB 3NZHL 2VAJA 4JKPH 2WWMD 2VLJA 3SDAD 2XA8H 5A40E 1A7PH 1BQLL 2EKSB 4WUUA 3WFDL 4KY1L 3QIUD 4NQXA 1S7WB 3ZO0A 4Z7WF 3VXSB 3S34H 5DRNA 4U1GC 2YUXA 5IEKB 4FN0A 2IAMA 3BPOC 4QOKE 1P4IL 3C60A 3MMEA 1G7JB 5D1QA 5H94A 3NZ8A 1HINL 1KT2A 5DDHA 4RWHA 4JDTL 1NGXB 5TH2A 3RAJL 4YFLI 2QADD 4L4JA 1JTOA 5J1SC 2BVQB 1OP3H 4N8CH 5EU3A 4Y4FD 4OIIH 3LN5A 2FATH 4IOSD 3ZZ1A 5KVFH 1KTLB 1JMZA 3CFIC 2M26A 3OKLA 5F9JB 3O9WD 3UJIH 1DDHA 4XPTH 5IVXB 1V05A 2BFVL 2VIRB 4RGNE 4BSWA 5A3IC 3K2UH 3BHBB 1DBJL 3OWEA 4PJAA 2C3HA 2R2EB 4TUOB 3S9DB 3A6CH 1GGCL 3TPUB 3UBXA 4MX7B 2E8YA 3AAZA 1NCAH 2DQEH 3MBEB 3S96A 1JPST 5FKAA 4QHNA 5I9QC 1WAAE 2WAHA 5JHDD 2GJ6A 2VXUH 4Q9QL 4Q97A 3RKDC 5EFIA 5HYJD 5D7SL 4N90E 3VDBA 4DQOH 3VWJA 3QPXH 4NO5B 1RJYA 1MCIA 4H88L 1WISA 3NMEA 2Q7NA 1S7XA 3RJDA 1PYWA 1RUQL 1DEDA 4NBZB 3ZTJH 2GSIB 3ALWA 5GQBA 3O81A 5B3NA 4QXGL 1XR8B 3WUWB 2AJYL 5D2NB 1RZJL 3UP1A 3D39D 5JW5A 1S7TB 1PEWA 1I1YA 4OZ4B 1YECH 4D0BA 2IBGA 1ZHBA 4KJYB 3OF6D 5CEYB 1UM5H 1JFQH 3LVEA 3S3PA 1S5HA 2M2DA 3SDXB 2PO6B 3D85A 4Z5RA 4BFGA 4FXGA 1LGVA 4EI5B 5ID1B 1OAXH 1U8QB 5HGBB 5L2KB 1HSAA 4PBXA 3GSUA 1BQHG 4C56A 1F8TL 1KTKE 1QOKA 4HXBH 5ACZB 3UAJC 2FHBA 3OGOE 2XN9E 4MNHB 5HHOE 3F62A 1SMAA 3L3HA 3PF2A 2ZKHL 3IGAB 1KLUB 3QQ4A 2XA3A 4ZQKA 2RB8A 1F11A 4LSDA 4EDXB 3IT8D 4XP4L 1J5OL 1LEKB 2G75A 4H25B 5HGHA 3GSQA 25C8L 5D7LE 2EDDA 4L3CB 1H3XA 3WO4B 5IQ9B 3GNMH 4KTYA 3PDOA 5KSVA 4QRPA 5ID0A 1TVDA 3HUJB 4K55A 3IFOB 5F7YC 3EYFA 4L9LC 3QNZA 3U9PL 4N0UA 1IGTB 4EI6A 3FB7A 1D5MA 5EZJB 1SY6A 4NQTA 5FDWB 4KMLB 3X11B 5E99L 4HC1L 4UOJA 4KK6C 2YUVA 2FO4B 4CKVX 3MLVL 4Y5VB 5MEQB 1HOCA 1FYTE 4X98A 5I8CA 1VESA 1LNUB 4DGVL 3ZKSD 1WCBA 1N7ML 2R23B 3SO3B 1A6TB 3CFDA 1T1ZB 3PL6D 4GUPB 4L4TB 3ZSSA 1DL7H 4QO1A 1OT2A 1H3VA 2JJSC 4F57H 2NX5E 4PIRF 3IDMB 3V95A 4OQTL 4HUWB 4PB9H 2ORBH 1A9BB 3K7UA 3K8MA 3EO9L 4F3FB 2X4PA 3QFDB 1OPGH 5CINH 5IIEB 4Y4KB 1X5FA 3FO1A 1JYXA 4LLQB 2P49B 3DLQR 4PGEB 2XWJA 1HDMB 2JJSA 3S7GA 4LCWB 3L7EA 4X5LA 4KI5F 4IRSB 3QDJD 1EAJA 4TUJA 3TIEB 1NCCL 1KJ2A 1T83A 2Z93B 4PD4J 3RX7A 3W0WB 3GSRB 4PJIE 1P7HL 4LNRB 3G5VA 3FFDA 1PKQE 2EIZB 5JDSB 2VN4A 2B2XH 3A6BH 4P0DA 1FLRH 1ZAGA 4H0GA 2CXKA 5LWYL 1QNZL 1NGQH 4L4VD 1FL3B 1CFQA 4M1GH 3GK8L 1H3TA 1C16B 3DNKA 4XNXH 1UWGL 3JV4B 2X9YA 3HRZA 3BZEB 3MR9B 3FN9A 1EHLH 1S7UB 1AY1L 4JGUA 3IDXL 4N5UA 5HYSB 4OLYH 3E2HB 2PUQT 4NSKA 2V5YA 3ROLB 4ZNEE 2AGJL 3KS0J 4HPYL 1TJIL 1NGYB 2VZOA 4HS6B 3Q3GA 4KKCC 1LVEA 4U1LA 3ARWA 3NACH 5F44A 4W70A 2XQBH 4YHNB 4JCMA 4CMMA 4PJHE 3HS0B 2VB5A 2WBJC 4KDTC 3VFUA 4AIZA 2P5EE 2QSCH 3ULVC 5GSRB 3IFNH 3TCLB 5FOBA 1T5WB 2AVGA 3IFPA 4P2QB 5KSBE 2YPKB 4TVPL 4NO2A 3K1DA 3QUZB 1MFDH 1MHCB 1OP5K 4OUUB 1K8DB 4KMTL 3ZSTA 4ZFFB 1Q72H 1F3DJ 1PQZA 5BV7B 4MNGB 1TTUA 1E4JA 4QRRD 5LBSL 3KPRB 1CXFA 1M7IB 5EZIL 5KVDL 5E6IA 4JM4H 3KLSA 4P49A 1GC1H 2V2WB 1T0NB 4I13B 3C6LC 4JE4B 3O3AB 5TE7H 2A74A 3FB5B 5GHWH 1EERB 1OAQH 3MLZL 3RGVC 4DOHE 3G6DH 5IM7A 1BQSA 2R1WB 3QEUA 1MQ8A 5DS8A 5C08B 2ZP0T 1CIUA 3LKNB 2F8XC 3BE1L 3KPOB 5I6XC 3UTQB 3H9SD 2MFNA 3C6LA 4MNQB 2AABL 1NUDA 4EUPB 3A6OA 3L95A 5IEHA 5D9SB 5HHPA 2AK4D 5F72S 1D5XA 4M1CC 3RGVA 2JELH 2NY0D 5EUOE 2NY4B 3QH3B 1WZ1H 1SYVB 1Q9LB 35C8L 4JFZL 4IHOA 2PCPA 3EOAB 3N0PB 4NKIL 1IC5H 2HKFL 4YGVA 2Y6SC 1G84A 4Q2ZA 4AZ8A 3RNQB 1QFWI 1Q9WA 4WY7H 1T2JA 5DD3L 4RRPG 5DGQA 1KELL 2BY3A 1MEXL 3EGSB 5HHVL 4D9LL 5GGVY 3MLRH 3DHJA 1U8HA 1FO0B 4HV8B 3ZE0E 2J8UF 1NCWL 4UINL 3D48R 43CAA 5KN5A 3MV01 3ROOA 4HJGB 2NY2C 1K5NB 4YDKL 5EDXA 1JGLL 1WEJH 2DLGA 4JO2L 1X6LA 3LDBC 1RIUL 4GRLB 5GS0D 2CK2A 3MLYH 4Q9RL 1G6RA 2VLRE 2B0SH 2ZG1A 3LQAL 4RX4D 4PRPE 3UBXG 4Z7UE 4JKPL 4X7DC 3L7FB 4Y1AB 4OLXH 5IHZA 2XA8L 5CJ5A 5F8QC 1A7PL 1QBLH 1OGAE 1X5LA 4J4PD 2X4RA 5SWSD 3ZKMC 1CDJA 4PRIE 1RIVH 3S34L 2HJFB 3B9KC 1OQXA 1N5AB 1UJ3C 4Y8DC 2A38A 1SMOA 7FABL 4JQXC 1DLHB 5DA0B 5CHNB 2B1AH 2A6IA 1AGDA 5D70L 5ETUA 1S5IL 1MAKA 4N8CL 1ZSDA 1HHGB 3Q0HA 5D96C 5C9JB 4OIIL 3V52H 4RBPH 2FATL 2VR4A 2Q7YB 1T4KA 5KVFL 3B3IB 3C6SA 3OG6B 3H3PL 4JQXA 4G9FD 3UJIL 1WBZB 1IL1B 3T2OA 1INEL 3O6KH 4BZ1L 2R1YA 3K2UL 4LF3A 2HJLB 4KKBC 1EO8H 3P0VH 4ZXBD 2BZDA 3SN6N 1D5ZA 2J4WH 2EDKA 1KFAL 1NCAL 2DQEL 5IJVB 2BSSB 4LMQI 4QT5B 1UKTA 4K8RH 1RJZA 3S36L 1ZK9A 3N50A 4EN3D 1ITCA 3SDCB 4PJEB 3JWDH 4KQ3H 4NO3B 5CS7A 1KNOA 1EXUA 1MY7A 1D5IH 3PV7A 5EBMB 4DQOL 3QPXL 4DEPC 4GRMA 3BGFB 1XEDA 2NY6B 3GIVB 1ACYH 1CDGA 1X4XA 3HC4H 2X89D 5DHVB 3CFEB 1MJ8L 1TETH 4GXUN 1BVZA 2BSRB 4HEPG 1FZMB 3RTQC 3TH3T 2IWGA 1LE9A 3DROA 1FH5H 1YECL 2JCCB 3T8XA 3NCFB 4OUOA 4JO4H 1UM5L 3BW9A 2YUWA 5EZLB 1IGCH 1M7DA 1CI5A 3LB6D 1GGUA 5KW9H 3FRPA 1FQ9C 3UZEA 1OAXL 1CIDA 3D18B 4RA0C 3PP3K 4I2XA 1N6VA 3P4MA 5J3HD 2X4UA 3X14B 4F7CA 3GMRB 3MLSH 2YRPA 4HXBL 1HEZB 3MRJA 1WICA 5IV2B 1A7OH 1AJ7H 5J12C 3SKOA 3OKKB 4NQDD 3AS0A 5ANMA 4FA8A 2EDLA 3CH1B 2A77L 4I18A 5FCUH 4LVNC 4MS8C 3LN4B 3STLA 4YJZL 1DEEB 3DMMD 4XAWH 4U1NB 1YN7A 3UROR 4BUGA 4PRBA 3QUXD 1QRKA 3VRLF 3X13B 3OXSA 4MSWB 3KPQB 3PP3H 4MDIB 2CUMA 4JDZB 1JYVA 4G6AC 4S1DD 4XAKD 3DX9B 4ZFZA 2D9CA 5CD3B 3B8YA 2AJUH 4PREA 1QRND 5E6YA 1WSST 3P9LB 1UVQB 3V4UH 4PJFA 1M05B 5EUKB 4G80A 1NAMA 4HJ0C 3Q5OA 3CXHJ 1U6AH 5DHXB 2W0FA 5GGRA 5JIPA 2H6PB 4W6YB 4RIRA 3WLBA 1D7FA 3GMQB 2IPUG 1JRHH 4PRNB 3ES6A 5CLWA 1UACL 3B4NA 4ZPVB 2CKNA 3BP5A 4Q6IA 1IKNC 3QEQE 4I0PA 2DBLL 4UOW0 1JK8B 1DL7L 3W39A 4PJDA 1S8DA 5KOVC 5EOCH 2WIIB 4F57L 1SJVA 4JRYD 1DBAH 3MRBA 4WDIB 4WU7A 3U4EB 1EX0A 4QRQA 1P1ZA 4PB9L 1PLGH 2ORBL 3NTCH 5EU4A 3G9VA 1CICA 1IKNA 4AJ0A 1OPGL 4FQCH 1X5ZA 2LU3A 3AC0A 2DJ4A 1NDGB 1MI5B 1UZ6E 3O4LD 5JNYB 4TSBH 4LHUD 3VFNB 4R4ND 2L7JA 3HI1B 2ICCA 5JO5B 2FGZA 2P47B 3SDYH 3TJHD 4PGBA 2JKXA 2EEDA 4L3EE 2E9BA 1LWRA 2R0LH 3HCVB 3R1GH 1X5JA 1E28A 5IK3B 3PJSB 5DD6B 4MJIA 5HI3C 2B2XL 3A6BL 1ZV5A 1FLRL 1EHNA 3WN5C 4X6DE 4HS8H 3HE6D 2NY7L 1NGQL 4M1GL 2VXTH 5D2LE 5IFHH 2FLRT 2ADGA 4P9HH 2UWEA 3MFFA 3F12A 3RVXC 2EDJA 2ATKA 1XR9B 2MCPH 1EHLL 5H35B 3PG2A 4DCQB 5DJ0B 1TQCB 3WN5A 2Y25A 2B5IC 4OLYL 1CFSB 3WIFA 3MODL 1CTOA 4YFLF 1A6PA 2VWEC 2FJHA 3REWB 2JJTC 2W07A 2BSTB 2ERJB 5C0JA 4HFWA 1IJ9A 3EYVB 4KJQC 4JANB 3HG1A 1JGDA 5C09D 3F7PC 1CLZH 1U8PA 3B6SB 2PR4L 1ZWIB 2C4FU 2XNAA 3NACL 2WUCL 4PTUB 5MI0B 2XQBL 1FCCA 5T3XE 2ZUVA 1HI6A 1LO0H 1ZLVK 1T3FA 3TBWB 4MCZA 2FSEB 1XGRA 4BZ2H 4CDHA 1R3LA 5I71B 2QSCL 4Q74A 3IFNL 2A2QT 5BS0B 1TVBA 1CGXA 2I9TB 1WFOA 5D1XC 1RZFL 2C1OA 2W65A 3ESVF 3KXFB 5JOFA 2H26B 4ETQB 2W9LA 1N6UA 1G7MA 4KUZH 3ARTA 3MRQB 4YNYA 1Q72L 3IDJB 3UDWC 1ZHNB 2P45B 4LPXA 2OQJB 1V3LA 2DRUA 5ECJE 4LSUH 4KJWD 2BC4B 32C2A 4JM4L 4X6CB 4UTBL 3K8KA 1GC1L 2AJ3A 1HXYB 1D5BB 4YDVB 5TE7L 4CU6A 2R4RH 4UI2A 5GHWL 4D0DA 1Y6NR 1OAQL 4UNUA 1A6ZA 4JJ5A 4MQ7B 3G6DL 3MV8E 5EC2B 5D7JB 5C0FB 4LSTH 1TZGL 2EDHA 4S0TD 3O6FA 3MRKA 3RBSA 4YFEA 4FFWC 3GM8A 4Y4HB 4K3HA 1EEQA 1NLBH 4OGZA 4GXVH 3I50H 4XNYH 4ZSOE 2VLMD 2GITA 4P3CH 4U6HB 3VFRB 3BMVA 2DTMH 1DVFB 3BPNB 1HH6B 4AT6B 1T7ZA 1SYSB 1UQSA 5CGYC 3S36X 4PV9A 5JXEC 4CN1A 2PKDA 4J8RA 1ONQA 4WHDA 5HTSA 3T0EC 4HWUA 3QCUL 1IC5L 4PRHB 1DQLH 5C3TA 3G5ZA 4C58B 1BD2B 4OKDA 1C7SA 4UIMA 5EZOH 5F7NC 1AGCB 1UZ8A 2X4QB 4JRXB 3N06B 4HIHB 3TPKA 3DRTB 5FB8B 2XTJD 4E41A 4ZYKB 4U7KA 5J6HB 2FBJH 3T0EA 2NY1B 5I73B 3MLRL 4MD5A 1ED3A 5EO9B 4NHUB 5EO0B 1TQBB 2VDML 1U8MA 4H0IA 2HTKD 4UTAH 3IXTB 4P4RB 2IH1B 2PXYD 1WEJL 1SEBA 4I77L 4LLUB 1A64A 3MLYL 1AP2B 1L9MA 3AREB 2B0SL 4HX1A 3CU7A 5FO7B 1IARB 1BX2A 5CFHA 1UB5B 3RVTD 4JPKH 4LLMA 4I3SH 4CVXA 4JZNA 1NBVH 4Z7WA 3DVFA 4ELKA 1RIVL 1B2WL 5FK9B 4K94C 1NC2A 1RJLA 2HVJB 3KPSB 3RIAF 1F4YL 2F53D 5L88H 1UA6H 3T0AA 1X44A 4P23B 3BRDA 1CD9B 1XF2B 3T65B 5F8RC 4JREB 4NNPH 1DQJA 1YEGL 1P7KA 1QLFB 3V52L 1UH4A 2FZ3B 5IB4A 3RY6C 3ARBA 3TN0D 4H0HB 3BDXA 1F4WH 1ZS8A 4F7TB 2EKSA 3O6KL 5I1JH 1S7WA 5IEKA 1TJGH 3QIWB 4X7EC 3PDGA 4LPVA 1KCRL 1K8IB 3FRPG 2J4WL 1NGXA 3D87B 3MV7B 3D9AH 2DL9A 4K8RL 4HGKC 4XXDB 3JWNC 2BVQA 4YAQB 3SCMD 5BCAA 5A16A 2E6QA 1G7LB 2EE3A 1ZHKB 5HSFA 3JWDL 4KQ3L 4NQCB 1KTLA 1F58L 3WNKA 3MBEC 1D5IL 1IAIM 5F9JA 1F4XH 3QDME 2JE8A 3M17A 5IESL 4TVPD 4NCC2 1BP3B 1ACYL 1V7ML 5IVXA 5CBEB 2VIRA 4K7PH 2FGWH 3CDGB 3HC4L 5DMGC 1TETL 3E3QC 2R2EA 5DT1H 4NZTH 4LCIH 1K9TA 3AUVA 4MX7A 5EU6E 3PWJB 3MBEA 4C59B 2APBA 3VDCA 1ZVHA 1FH5L 3VXRB 3NH7H 1OARH 5C0RH 4J7RA 5DVKA 5DD0H 1PY4A 4JO4L 1UXWB 2YPVH 2ICEB 5D2NC 4XX1G 5KW9L 2QQLH 5DEZA 5C0BB 1XF3A 3VG9C 2D3VA 2GSIA 2PO6C 5E9DE 5C0CE 3MLSL 3DVNA 4OFPA 1XR8A 2XKUA 3RWJA 3WUWA 5DO2D 1A7OL 1AJ7L 4EI5C 4IOFD 5D2NA 3UTSD 1C12B 5E8NB 4AK1A 1S7TA 1QSFD 4KUCD 5FCUL 5T33L 4OZ4A 1SM3H 1UWEH 4RNRB 4RFEB 5CEYA 4X5WA 5F97E 4I48B 4KZDL 3SDXA 2PO6A 3DECA 4XAWL 4FQPA 3MGTB 3SQOH 1QSEE 3ZDZE 2XG4A 4EI5A 5ID1A 1U8QA 5C86A 5HGBA 2CLRB 5L2KA 4HWBA 4WTZA 3HPJB 1KULA 5ACLA 2J3SA 3MRGB 4FQLH 2AJUL 5IVOA 4H5SB 2P8MB 4MNHA 2AXFB 3V4UL 3U30C 3WO4C 1KLUA 4MB4A 8FABA 1A3RL 1U6AL 3PWPE 4JM2D 2UZIL 2HAZA 1EJOL 4XBPB 2CKBA 2X4OA 3CFKB 4EDXA 3GEWB 1LDSA 1FL5B 2BCKB 1JRHL 4H25A 5IUSA 2E6JA 3VXUD 3TJEL 4HPOH 1VFBB 2F54D 4L3CA 4NJ9H 5H37G 2GT9B 5IQ9A 5TQ0H 1YYLH 4OZGF 5T3ZE 2BNRB 8CGTA 3HUJA 2MNUA 3IFOA 3MJ7B 3PHQB 4XZUB 1G7PB 3EO0B 4D94A 5EOCL 2NPLX 3QULA 5EZJA 5IVNA 1DBAL 4KI5C 5FDWA 3MUJA 4X7SH 2ID5A 3U79A 1PLGL 3NTCL 4HBCH 3D3VE 1I1AD 3X11A 5IBTH 3HZVB 2ARJB 2FO4A 3BQUB 1N0LA 2HT3D 2YBRB 2EE9A 4P2OD 4LSQH 4V1DA 1DFBH 2VDOH 4Y5VA 4TSBL 5HDQH 2AQ2A 5MEQA 3SDYL 1LNUA 4PJBF 5HYFA 2R23A 1QFUH 1A6TA 2EH7H 1JV5A 3EJYD 2BNQB 1BPVA 3HE7B 1FNAA 2R0LL 5M7QA 3R1GL 4MYWB 3KYOB 2GJJA 4LVHC 3IDMA 4JFFD 3O8XD 4LBEA 4KKAD 3GSNH 4B7IA 4E42A 1A9BA 5DFVC 4HS8L 3C5ZD 3INUL 4HZLA 3STZB 1I9JH 4F3FA 1IC4L 3RVVD 2QHRH 3QFDA 5IIEA 5IFHL 4Y4KA 4FP8H 1RIHH 5GISH 4LLQA 4P9HL 1UT9A 4PGEA 1HDMA 2JJWA 4LPYA 2HRLA 4AENB 2MCPL 4KRPC 1E4XH 5TE6H 4IRSA 3NGBB 4DZ8B 1CR9H 3TIEA 4ONOA 2Z93A 3W0WA 3GSRA 4LNRA 4M3JA 2EIZA 5JDSA 3WLWD 4YDLB 4O9HH 3PQYB 3G6JF 1F3JB 2XACC 3L3JB 1MCLA 1U8LB 1JZ6A 4GW4B 2V7NB 5AG9A 3E2HC 4LASH 1VACB 4MA1B 3WL9A 1FL3A 3S98A 5L7XH 4KMQA 1YYMH 1C16A 5D8JL 4G6FB 1BF8A 5FYLE 3JV4A 4BZ2L 3LKPB 3TCXA 3BZEA 2NXYB 3MR9A 4NO0B 1KB5H 5F7HA 1S7UA 3BJ91 5HYSA 4J3OC 1CXIA 3NIGE 1A7QL 3BFOA 3ROLA 1AO7A 3VA2C 1KCSH 4URTB 4OGAC 4KUZL 5IB2B 3DO3A 5CP7B 1NGYA 4HS6A 3AS1A 5MENE 2OL3L 4DUWA 3QRFM 4LSUL 4YHNA 4N68A 5IFJB 4P4KC 4LOUD 2DIJA 3IRZA 3QUZC 3GI8L 3WJJC 3VXME 2NQCA 3QNXB 5GSRA 3TCLA 4B50A 3DXAB 4OZHE 5HDLA 4APQD 2R4RL 1XF5B 3QXUA 4EJ1C 2Q86B 3QXWA 1X5IA 1MVUA 1AKJD 1A4JA 1T5WA 4P2QA 5FKPB 1K4CA 2AQ3A 3DSNA 2YPKA 3OX8B 4LSTL 4NUJB 4FRWA 4CMHB 1MRCL 3OAYH 3ARDC 1L6XA 4GAFB 5HHME 5D1ZD 2VLJE 3OKEB 3QUZA 4JG1H 3D1MC 2H2PD 1U8OB 4OUUA 1K8DA 1NLBL 2Z0BA 4WUUE 4GXVL 3I50L 4XNYL 2C4FT 3C9NB 4P3CL 2DTML 4OM0H 3P77A 5HYEA 3KPRA 1ZGLM 1M7IA 2YA0A 4NZUH 1KGCD 1J8HD 1MHPH 4U3CA 4QNPE 2V2WA 4FQ2H 3D2UA 5DTFB 2EXWD 4JFDB 1UM6H 4GG6F 1DQLL 3TV3H 4LCUB 1EGJA 2BVTA 4O5LH 4R6UA 4RAUB 4NQSB 5DLMH 3U7WH 3VFPA 3QQ3B 1UWXK 2R1WA 1F4HA 1JWUB 1EEZB 5EZOL 5C08A 4MXVE 3RWIB 4GH7B 3LKNA 5T3ZH 2JJUA 4QOKD 3KPOA 4QWWC 3TA3C 3UTQA 3CLFH 2RCSH 5JZ7C 1LK3L 2FBJL 3DV6B 1OD7A 4MNQA 5ERWB 1RVFH 4EUPA 3P73B 5D9SA 3AMKA 4PJAE 3RUGB 5B8CC 2CO6B 1DE4B 4EBQH 3QH3A 1NUGA 4UTAL 1SYVA 1Q9LA 1FNGA 1OLZA 3IS1X 3TA3A 3EOAA 2P8LA 4XCYB 5BXFB 3F65A 2WLYA 5MP6L 2CSPA 1A1NB 3RNQA 3E8UH 4LEOA 3DYOA 5FECB 5GRVL 3LRHA 1BAFH 1TCMA 4RGND 1HYSC 4JPKL 2KDGA 3ARXA 3MCG1 4I3SL 3ZTNH 5B8CA 4OF0A 3OSKA 4XHJC 3EGSA 3G6AB 1FO0A 1RUPL 4HV8A 4WHYG 5ITBH 5GGTH 5F7DB 3CX5K 3S37H 4HJGA 1CF8H 1K5NA 1WFNA 3RUGF 4NNPL 2LTQB 4Z7QE 4N90D 1D9KD 5J13C 2DQFB 4X7CC 4GRLA 3O2DA 2R0ZH 3EIFA 4EKXA 3H9YA 15C8L 5JQHC 4FQXC 3ARGB 2LFGA 3L7FA 5HPOA 1MQKH 4Y1AA 1F4WL 2JB5H 3S5LB 4PJGB 5I1JL 1ZE3C 4R3SB 5E8OB 2HJFA 1TJGL 1ZT7B 2XZAH 3BDBA 1N5AA 4G9DB 1FCGA 2BSED 4IDJL 1DLHA 3ALXA 4C56E 3QQ9C 1CFNB 4G6ML 5CHNA 4PJ9D 3D9AL 3ZT6A 1XZ0A 5T3XL 3CU1A 4WI5A 3U82B 3QHZH 1XCQB 3WUWG 4NC0B 5FYLH 3VMNA 4P46D 5AYUH 3B3IA 3CFBB 2EECA 2VISB 1F4XL 4EIGB 2YPLB 5F6HI 1IL1A 5EORL 1W0YT 2EC9U 4QHMB 4ZUVB 4DN3H 1FGVH 3DIFB 3QSKB 3GO1H 3O3UN 4K7PL 2FGWL 2HJLA 3RVWD 1S9YB 2ESVB 1WCQA 5DT1L 4NZTL 4JFEB 2VQTA 4LCIL 5HI4D 1Z9SA 5HHOD 3SJVB 3W81A 4OV5A 2JTDA 1FL6B 5IJVA 2BSSA 4QRPE 3SKMB 2FO1A 3RDTD 3MV9E 3NH7L 1OARL 4WTZG 3BRFA 3UC0H 2X4TB 2YR3A 4BQ9A 3SDCA 4PJEA 2YPVL 4XVUC 4NO3A 1KG0A 4TTDD 5EBMA 1TCRB 1U3HC 4LVOB 1CG9B 4YUEH 4R2GD 3GMNB 1OWRM 2QQLL 3ZHKA 3GIVA 4Y8AA 5E95B 5GRUH 3HI6H 5DHVA 3CFEA 4KTEL 3X12B 2BSRA 1W0VB 3MO1B 3HNVH 4CN4A 3G5XB 2XIDA 3WMSA 1U3HA 4IMLA 2VH5H 4G8EB 1SM3L 1UWEL 2JCCA 4XNZB 4UBDD 1ES0A 4Y5XB 4G7VH 3BGMB 4QRTB 1A02N 5BOPA 3VW3H 5EZLA 1NMBH 5E56A 3LS4H 4XBGA 3FQUB 3KNBB 3WFHB 4OZFB 3LPFA 5I1HL 3QXDB 2VE6B 4HCRH 3D18A 4IMKC 1T03H 3X14A 1NFDF 1XF1A 1YZZA 3EW3B 2HFGH 4LDLB 4FQLL 3GMRA 3RHWK 1UJTA 5DMIH 1HEZA 1I4FB 1KJMB 4ZUUB 5IV2A 2NX5D 4F37F 4Y16C 5C9KA 4PBWD 2G9HB 3LN4A 2YN5A 5FM5M 5C07D 4F58H 5D7IF 1AFVH 1S78C 1QLRB 2VSCA 4B0MM 5CKAA 2VKXA 2WP3T 5GGUB 4MQXC 3X13A 2DQUL 4MSWA 3KPQA 4MDIA 4JDZA 5F7LB 4HPOL 1E4KC 4TQEH 4A6YB 4NJ9L 4DWHA 1MLBB 4TULL 5TQ0L 4V2BA 3DX9A 1YYLL 3V6BR 2BY2A 4GKNB 5IBLC 1JTPA 3P9LA 1UVQA 4F7EB 5F9WC 5EUKA 1BGXH 1ERNA 3TH4T 4NRYB 2A83B 5I0DA 3FRUB 5E1AB 5B38G 3FCTB 1E4KA 1ZLUH 5FDYA 4X7SL 2VZ1A 1QVOB 4HBCL 2H6PA 3AS3A 3CZFA 4PJ8D 5IBTL 2VRAA 3GMQA 1TTFA 1A7BA 4PRNA 2FEDD 1O7VA 3NBNA 4LSQL 1DFBL 5HDQL 2YD5A 5I1KH 3BPLB 1ZMYA 4PB0H 1JI1A 5DZNA 4KXZH 1QFUL 2EH7L 1JK8A 1YY9C 4K3GA 2CO7B 4KK8C 1JN6B 1AXIB 3TZVD 4JQVC 4K8RD 3K4AA 1EHAA 5GZOC 3GSNL 4N8VA 4XXCC 3U4EA 3SKUD 1HQRB 2APTA 3NIDE 4JN2B 5HYSG 1I9JL 4PJCE 2O5XH 2P5ED 3KPNB 2QHRL 1RUKL 1YN6B 4FP8L 2NNAA 4BSVB 1RIHL 5ACMA 1NDGA 1IBGH 1MI5A 5JNYA 4NWUH 3Q2CA 1R6VA 3VFNA 4FABH 3HI1A 4HMDA 5JO5A 4ZS6C 4LARH 1E4XL 1B88A 4U1IB 4WV1B 3IAPA 3R4DA 2GK0B 1CR9L 1CBVH 3QWOB 3OKOB 1V3KA 3HCVA 2A9MH 3ZYOA 3PJSA 4J12A 4O9HL 2AS5M 2AEIT 2DYPD 1TQCC 2X05A 1M4KA 2D2OA 3GSWB 1MHHB 2WWMC 3FT4B 3SDAC 1WGOA 4JPVH 1EDQA 1KIPB 3R0NA 5L7XL 2GJZB 1YYML 3QIUC 2Q6WB 4Y2DD 1SY6H 1J1PH 2X42A 4HXAH 4NRZA 5FO9B 2PYEB 1VGEH 2Z31B 1KB5L 4FTVA 1XR9A 4WI9A 5ALCL 4N0FB 5H35A 4DCQA 5DJ0A 3DGGB 2QADC 1CFSA 3QEGH 3BKJH 3SDAA 5HVWA 1J87A 2IG2H 4Z0XA 1KCSL 3REWA 1RJCA 1ZT4B 2BSTA 4F9LA 3EYVA 1KXTB 2BDNH 4JANA 3B6SA 3BOVA 2YD9A 4PTUA 2FH6A 2ADJB 4I4WA 1NLDH 1FVCB 4C83B 4KV5F 4H26B 1FV1B 1FFRA 4D9QE 4ZNCD 2FSEA 2IPUK 3DUHA 4IJ3B 5KG9B 1CK0L 3M8OH 3CSBA 5HJ3A 4EUPG 5BS0A 4X0KB 5FAAA 2O5YH 4WWKD 3KXFA 2H26A 4ETQA 1TNNA 1A9EA 4JG1L 4U1MB 5KZCB 3TO4B 3MRQA 5BRZB 2R39A 3IKCB 3IDJA 1ZHNA 4RMTA 4UV4H 5C0GB 5D7JC 4OM0L 4D9RE 1KJ2H 5CGTA 3BWUC 3IJHB 4IS6B 1U58B 1YEJL 5F9AC 1RULH 1MHPL 1Q1JH 4LNVA 4G8GB 4HULB 4HW6A 2VLRD 1IKFL 1Y6MR 4Y4HC 3TVMD 4D0CB 3JXAA 1HXYA 1QLEL 5DJZB 1MIMH 1T2QH 4YDVA 1UM6L 3BPNC 3TV3L 2G5BB 2KZWA 5JA9A 4O5LL 1OGAD 2MQ0A 5DLML 3U7WL 5EC2A 5FO8B 4OGXH 5D7JA 4PRID 5K9QG 2CD0A 2QLVB 4JVWA 5T3ZL 4K7PX 1E27B 2RCSL 4Y4HA 5C0IB 4Z7NE 1TVHB 4UT6H 4ZOCA 1ACZA 4MJ6B 1RVFL 4PJ5D 4U6HA 1JWSB 3WYRA 5KAQG 1DVFA 5I8EA 4R7DB 3IDGB 4UAOC 1HH6A 1CFVL 3AVEA 4AT6A 3RZCD 1SYSA 3D39A 3FO2B 4C54A 2Z8SA 4MA7L 1HYRC 4MA3B 1X5KA 3FB6B 1JZ3A 4XI5D 1HWGB 4WFGD 1F6AB 4UT9H 4GRWE 3O11B 4PRHA 1N26A 3E8UL 1BD2A 1CT8A 4K71C 1RZ8B 4QTHB 4F8QA 4U6YB 1BAFL 4RAVB 1RFDH 1N59A 1AGCA 4JRXA 4HIHA 5FB8A 1JNLH 1JRHI 3DRTA 3QPQC 4ZYKA 5IP4A 4OTXH 3ARFD 5I17B 2VXVH 2OCFD 5ITBL 4MMZC 5GGTL 4P5KB 5AZ2L 5EA0H 2AXHA 5EO9A 3S37L 4NHUA 3V6OA 3K4DA 3P4LA 2X44D 1CF8L 1LE5B 1MWAA 3RL1A 1QYGH 5JHDE 2N7BA 3IXTA 4KUCF 4P4RA 2IH1A 4P59H 4LLUA 3BWAB 1AP2A 2R0ZL 4L1HA 4NJAH 2O5ZH 2VJXA 3QZWA 4D8PB 2JB5L 1UB5A 3MUHL 5DYOB 4HD9A 4ELMB 3VWKD 5FXCH 2HVJA 3UX9B 2Y7QA 3VD7A 1T5XB 3QFJB 4P23A 5ILTH 1ZHLB 1XF2A 1YJDL 3T65A 2BK8A 1REIA 1OHQA 2CMRH 5ANME 4K07A 1QLFA 3EYQD 1A6UH 2FZ3A 4JM2F 4GAJL 4KTDH 5FYLL 1AR1D 3BP6A 3PL6C 1VA9A 5AYUL 5EBGA 2W0PA 3PWLB 2HLFD 4K3JH 2AJZA 3RA7H 4F7TA 4U3HA 4BFIB 4DN3L 1FGVL 3QUYD 3GO1L 4ELMF 3QIWA 4KKLD 4PV8B 1LP9F 3QUKB 3UTTD 1NGZB 1K8IA 4DUXA 5C8JB 1PD6A 2UV3A 1KXQE 5T1LD 4XXDA 4XX1E 4YAQA 2YXFA 3H6JA 1CGYA 3UC0L 2CDEA 1G7LA 1ZHKA 1IEHA 1A6VH 3LD8B 4NQCA 5E2JA 2D4DA 4P5TB 1BF2A 1G7HA 1FDLH 4WNQB 1K4DB 3VGFA 1XIWD 4F9PC 5CBEA 5GRUL 3WIHL 1G6RH 4YXHH 2WV3A 4XRCB 1IM9D 3CDGA 3HI6L 4WI8A 1XF4B 1NQBA 3QDJA 5EU5B 2FIRT 1OTUD 3QA3B 4FQIH 3HNVL 3O3DA 4MWFB 3V8OA 1F13A 1SEQH 3HMXL 3KJ4C 1G7IB 4RISH 5B22A 1J1OH 3VXRA 2MTPA 5EN2B 3VFGL 4PJDE 4G7VL 1UXWA 4YGAB 3VW3L 5IKCA 2ICEA 4EVNB 4PLNC 1NMBL 4F7PB 2GCYA 3PWNB 2GFBB 3VGBA 3LS4L 1W2KT 2B7DT 5HDOA 1CE1H 2EC9T 4HCRL 2ZUSA 3MCKA 1PG7L 1T03L 5C0BA 2G60H 1DN0B 1IGIH 2EDYA 3LOWA 4M6OH 2P7TA 1T7XA 3CLEH 4AIXA 3CH8A 2HFGL 3RIFF 1I85A 2F74B 4U2YA 5A2LH 4W6WB 1CYGA 1C12A 1U8KB 4Z95H 5E8NA 3ZHDA 4MMXC 2HMID 1SJEA 3BESR 4RNRA 1QACA 4EOWH 4RFEA 1AFVL 4MJIE 4I48A 3SKJH 4XMLL 1YQ2A 3U46B 1NJ9B 3MGTA 1U8IB 2BHZA 5F7WC 4GRWH 4A2MA 4CBPA 4O02H 1DQMH 4TQEL 4Z7OE 3TBYA 4MD4B 1IGYB 3HPJA 2J6EA 4OZGA 3WKNA 2UWEE 3MRGA 4H5SA 5DD5H 5F1OB 3FN0H 2P8MA 2XZQH 2AXFA 3C08H 1NFIB 3MRFB 4MA8H 4NRXB 5ISZB 3UZVB 4XBPA 1EZVY 4L4VE 1NC4B 3HG1E 3CFKA 2VYRE 3H9ZA 2IMMA 1FL5A 5D72H 3HA0A 1UKQA 2BCKA 1YMMB 3OGCB 5D6CB 3MRIB 4X80H 5HD8D 2AEQH 2GT9A 3D5OF 5I1KL 4RMQA 2NTSP 3MUGB 5I16A 3BIKB 1WT5A 5I74B 3MJ7A 4JFXB 1IC1A 2NY0C 3PHQA 4GBXD 1G7PA 4XZUA 4BJLA 4UT7H 3EO0A 4ODSH 3RWGB 1T2XA 2DIAA 3NIFF 3MOBH 1I9RH 2P46B 4OI8A 3R06B 1HXMB 2XWBA 4NIKB 3HZVA 1RK0B 2ARJA 5F21B 3BQUA 5HHNB 3OR7B 3BZDA 3MRCB 3HAEA 2YBRA 2VO5A 1IVLA 1GPOH 1IBGL 4XBEH 4FABL 3T77B 1A6AB 3TBTB 4FFZL 2Y5TB 2KUTA 5TPWH 1HH9A 4XPHL 1IZJA 3HMWL 2BNQA 1CBVL 3HE7A 1HHKB 2A9ML 3SE3A 4AIOA 5GS0C 3PHSA 3KYOA 3VRJB 2V17H 3ARSA 5B39G 1YPZB 3GKZA 3STZA 4JPVL 1RI8A 3I9GH 4HKJB 4J4PC 3KJ6H 2BXYA 1NAMH 1J1PL 4HXAL 3QIBB 3QAZB 1VGEL 3MV8D 4YHYC 4NQXB 4X9GA 4ZS7L 4QXUH 5DRNB 4DZ8A 3BKJL 1VEMA 4L8CB 3C60B 3H9SE 3NZ8B 1KT2B 5SWSA 2VDRH 3DPBA 3PQYA 5TH2B 2BDNL 3L3JA 1F3JA 4LGPB 4M4PA 1U8LA 3DX8A 3WHE0 4GW4A 4NUGL 1CU4H 3VD3A 1LD9B 5EU3B 1NLDL 3S37X 1VACA 4A2LA 2BERA 2AEPH 4R0LC 5AD0A 4Q58C 3QHFL 1WAAF 1CTNA 3OJDB 3BPOB 3WXWH 3LKPA 4NBYB 3M8OL 1QZ1A 4NO0A 4ZXBC 4TNWK 3PV6B 5E8EB 1A1MB 1AHWC 2O5YL 5DQDH 3DUUB 4M7LH 5FGCB 5IWLA 3OL2A 3SO5A 5IB2A 4ZOAA 1U42A 5CP7A 4CL7A 4YPGB 3S96B 4UV4L 2XN9B 4Z7WE 4OGYH 4QHNB 4ZXBA 2EO1A 4WJ5B 4CMHC 5IFJA 1RULL 3MZGB 1Q1JL 4QY8B 1AHWA 2EICA 3AMLA 1T80A 4RMUA 5H37H 3QNXA 4HKXB 1MIML 1T2QL 1WWBX 3DXAA 2BVPB 1XF5A 3MJ9H 1NEZA 2Q86A 2N1KA 3CCHA 3DSFH 4HIXH 5FKPA 5D7LB 1SJXA 4OGXL 5I9QB 1S7QB 4X4YB 3OX8A 4NUJA 1CVSC 1IRAY 3MGAA 3KPPB 2OP4H 2W0KA 1F42A 3OKEA 2VITB 2EYTB 3C2AH 1U8OA 2X89A 5DMYA 3C9NA 3LB6C 3VXSE 3O2WH 3D0LB 4G6KH 5HGAB 5GS3A 4FFVD 5DTFA 2J12B 3ZT5A 2V5SA 3I6LE 4FXGB 4JFDA 1JHTB 3L3IB 4LK4A 4YWGH 2PYFB 5F9OH 4RAUA 1HSAB 1LO5B 4NQSA 1HHHA 4M5ZH 3QQ3A 3GSUB 1ZXQA 1JWUA 4NGHH 1XFPA 4U7SA 1RFDL 1FYTB 2I24N 3GBNH 3WXVH 1JNLL 2EDBA 1YEIH 4N0CD 3L3HB 4OTXL 1ZA6B 3DV6A 5IVXE 2VXVL 3DMMC 5ERWA 5CEZE 1S9WB 1UENA 3P73A 5EA0L 3QWRD 4G42B 3RUGA 1DE4A 2D31B 1F11B 1U9KA 5BZDB 2EDTA 5EC1A 4P59L 4S1DC 5EOQL 4ZAKD 1MRDL 3GSQB 4LLAA 1TLKA 1HCVA 5BXFA 5ESVB 2ZWLT 2BRQA 4NJAL 1BBJA 1A1NA 1MCCA 3H2WA 4PJ7B 3PDOB 4LKCB 43C9B 1ZANH 1EFXB 1PG7X 5ID0B 3MBXH 1T1XB 1KPUB 3G6AA 4N0UB 2ICES 5EU6D 1QRNA 5GRWA 1R5WB 5F7DA 3KR3H 2NR6C 3CVHL 5ILTL 5KANG 2E7LC 1HCFX 2MOVA 4RGOH 1UKSA 2CMRL 2BJMH 3EYSH 4RMSA 4L9LB 3STBA 4KTDL 4BSJA 5F6HJ 1HOCB 2DDQH 5E1HB 2CRMA 5I8CB 4K3JL 3MYJB 3SDXE 3RA7L 3X3GH 3S5LA 4PJGA 1WCBB 2KQMA 3UYPA 5C0CD 3O0RL 2E7LA 4Z0BH 4R3SA 4KROD 3UZQA 1ZT7A 2W59A 4G9DA 4OCWH 4NKMB 2CLVB 5L2KE 5SWZB 2YRZA 1XT5A 3GSVB 2ICWJ 4PJIF 5F7FA 1CFNA 5EPMB 1E4XI 1KXVC 2DMKA 3LKQB 4NZDA 4R4NC 3ALPA 3MRPB 4M7ZC 2UY7A 3DUSB 2HT4D 3TJHC 1A6VL 2XQYK 5H2BB 4NN6C 1QSED 1N5YH 1BFTA 2LABA 2CK0H 5LVEA 1BZ9B 3QXTA 3IF1A 1FDLL 2VISA 4FMFA 3FT2B 2YPLA 2RFXB 3UTZA 3EDJA 4TUJB 3DIFA 3EO1A 4QHUB 1G6RL 5KTEH 4YXHL 1S9YA 2ESVA 3DYMA 5KSBB 5HHXH 4E9LA 2FECL 1KIQB 4FQIL 1FL6A 3HNTH 1N64H 1SEQL 3PWPD 1IZKA 3HUJE 4KPHH 1J1OL 2OSLB 4J3TA 1HK6A 4JHWH 4PJHF 1T6WA 3T3PE 1YMHB 3EOBB 5F7EH 5CD5D 1RZJC 3NABH 1CG9A 2F58H 3GMNA 3JWOH 1KN4H 1CE1L 4HUNB 5H8DA 4TTGA 2G60L 1IGIL 5T3ZD 4M6OL 1FFNB 1F45A 3TYFB 3CLEL 5DFWH 3X12A 4N9GB 5CCKH 5KSBF 2P1YA 1P7QD 1BHGA 3MGOA 5AWNH 2YN3A 1W0VA 4YHOH 3Q3GB 5C2BL 3G5XA 4RGMC 4Z95L 2DM2A 5J1TC 3ZYIA 3N9GL 1P6FA 4G8EA 4WO4D 4PD4K 4L4TE 4CVUA 3D3VD 4EOWL 1OW0C 4Y5XA 5DF0A 5E08H 2V5RA 4QRTA 4AIZB 3SKJL 3ZDXF 2SEBB 3QI9B 5E5UB 3FQUA 3H8NA 3KNBA 2K9UA 4OZFA 4M6NH 2RAMA 3QXDA 4O02L 1DQML 4IEFB 2X1PA 3IFPB 4JFYB 2XPGB 4LQ1A 1N6QH 3D25B 2HP4A 4PUBL 4NO2B 1OW0A 2WBJB 4WHYH 1LO3H 2R0KH 3FN0L 4R4FH 4N1CA 2XZQL 1KJMA 5FHBH 4ZUUA 3RBGA 4LCWE 4YHMH 1FIEA 2C5DC 2IPKB 1NCNA 3C08L 5CEZH 4MA8L 2YC1B 2G9HA 1F4AA 3W0WE 2VN7A 2VUYA 2ZOKA 4GAGH 3JVGC 3HPLB 2GK2A 3ULSB 1QLRA 5DR5H 1OGTB 5D72L 4WUKH 5EUOF 1XMWA 4JG0H 3WDIA 3SGJA 1MLBA 2OMBA 2AEQL 3QEUB 4PRPB 5DS8B 5KSAB 1S9XB 2D9QB 2B1HH 2J8HA 4N1EA 5MERA 3TC9A 1FZOB 5DC4B 3UXFA 2X7LB 3R8QA 3L9RB 4YHKH 4UT7L 3C6LB 4ODSL 3L95B 4NRYA 1V7NL 5E1AA 2OR9L 3FCTA 3WIIH 5HPMB 3ZE0F 3BPLC 3MOBL 1I9RL 1QVOA 4ODWB 5FYLD 4NT6B 5I6XB 3IDNB 3MRLB 4HC1A 4YFDB 1J0YA 3QXAB 1R3HA 2Z92B 4NHCH 2XTJC 5TDPB 4XBEL 1GPOL 5DURD 2X1XR 4OF8A 1QQDA 4Z7UF 4MJ4A 5TPWL 4PYGA 4O2FB 3MRMB 2R69H 2DQIH 5I8OH 2PXYC 1VENA 4P2QE 43CAB 4HWBH 5DUPH 2HVKB 4FQQB 3ROOB 1NMAH 3WO3B 4EXKA 3VFVA 3DVGA 4S2SB 1GGYA 1HQRA 1I9IH 2WWKT 3QDGB 4JN2A 4L8BB 4NOBA 4OQTA 1T66D 5F7MC 5JDJA 3GMLB 4X4MA 3RVTC 3KPNA 4MNGE 1V5JA 3VXMD 1JF5A 3OKNB 1YN6A 4XP6H 4Y19B 4JZOB 4BSVA 1NAML 3KPRE 5GXBB 2XRAH 2E9IA 5L2JB 2NY2B 4U1IA 3L3DB 4WV1A 2GK0A 3E0GA 2VLJD 3LDBB 3OKOA 3LKRB 3TT1H 4WUUD 3VGDA 3DETC 2VDRL 4OFVA 5C08E 3KHOA 5ETUB 2IAMD 2ED7A 3TN0C 4NKDA 1CU4L 3GSWA 1UYWL 1MHHA 2VXSH 3CPLB 4LCCB 4LGRB 5D1QD 4X6FB 3FT4A 5E24E 5BJTB 2AEPL 2GW5A 4MNQE 1KIPA 4KZEL 3B9KB 3WXWL 1BREA 3CFCH 1UJ3B 3RL2A 2XI9A 5FO9A 1X5YA 4TVSa 3QXVA 1RURH 2GKIA 4F33A 4KJPC 4N0FA 1QFWM 2YHGA 3TN0A 3RY5A 3DGGA 4LF3B 1IGFL 4HDIA 5DQDL 5D96B 2W38A 4KRMB 1ZT4A 2EO9A 5GZND 4NNYB 4PPTA 3I3BA 1HKLH 1WZMA 2F5AH 1OM3H 3WNPA 1I7TB 2QTEA 1IQDB 2ADJA 2OL3B 2DL2A 4XVTH 1FVCA 4C83A 1YY8B 4AG4H 3H42H 4YR6B 4H26A 1FV1A 3VFOB 1B6DA 3VA6A 2HJKB 4M43H 3SBWC 2VNCA 1KNOB 1OAYL 1QFHA 5KG9A 1G0DA 4XB8A 2GJ6D 2BXZA 4F80A 3EJZD 3MJ9L 4X0KA 1FG2B 3DSFL 4HIXL 3VWJD 3LQZB 2E5EA 1MRFH 3QCVH 2D7NA 2OP4L 1F6LL 4U1MA 4Y1AE 3TO4A 3C2AL 4LLVB 5BRZA 3IKCA 3N1GC 3O4OC 4WGWB 5E2VH 4DEPB 4R97B 5C0GA 2OJZH 1NGPH 3IJHA 4IS6A 1U58A 1FJ1B 4YBLC 4G6KL 4O2EB 4D0CA 2YUZA 5FYKD 5DJZA 1HIMH 4LRIA 5CIPB 1AGFB 3RTQB 5M95B 4TOYL 2P48B 2G5BA 5DO2C 3D85D 2V2XA 4IOFC 4YWGL 5IMLB 3LKSB 4M5ZL 3P4MB 2X4UB 5FO8A 1KACB 4NGHL 1R3KB 1I1RA 3FMGL 3C8DA 4UNTA 3DBXB 3T3ME 3C8HA 3GBNL 3WXVL 1E27A 4G3YH 5C0IA 3QEQB 4IDLA 2OR8A 4ISVB 3I2CH 3MOAH 1TVHA 3ZL4H 4C56D 3L5HA 1M1SA 3GHBH 4MJ6A 5JPMB 1I7RA 1JWSA 4P9MH 4R7DA 3IDGA 5TDOB 1G9MH 3T04D 3UTSA 3S5LG 4Y7MA 1GZQA 3FO2A 3OR6A 5GS2H 4NQEB 2WBKA 4PRAB 5EOCJ 4MA3A 2UZYB 3FB6A 4ESKA 3GFUA 4LIQE 3OXSB 5J12B 3EJJX 3O11A 5CP3A 4AQ1B 3GMMB 3JZ7A 3LS5H 3ARUA 1RZ8A 4PJEE 4QTHA 4OD2A 1LQSR 4BH8B 4U6YA 2X1QA 1ZANL 4RAVA 2OTUA 4W4OC 1NSNH 3MBXL 4JZJC 3ISWA 4FQJH 4JM2C 5HBBA 4PJFB 4X4XB 4K2UH 4L3EB 4G80B 3LQAC 2FWOB 4PG2C 5I17A 4QRPD 3MV9D 3F7YA 3MREB 2I26N 1LE5A 4DVRL 4KXZI 4RGOL 5GSVB 3C09C 2MKLC 4W4OA 2BJML 3TP4A 5BV7H 4X9HA 3EYSL 4JM2A 3BWAA 2R29H 2JCCE 4HQQH 4NC1C 1CFBA 4PG2A 2WW8A 2DDQL 3SDDD 1KV3A 5DQJB 2FB4H 2K3TA 4PGJA 4D8PA 2FX8H 1UZ6F 3X3GL 1VPOL 5DYOA 3VRLE 3UEZA 5DHYB 1VADB 2F54A 4Z0BL 4ELMA 5TQ2H 3W39B 3HNSH 4MB5A 1WJ3A 4OCWL 1EGJH 4S1QH 5F7KC 1U41A 1F6FB 1ORSB 1RQ5A 4TSAL 1T5XA 4WU7B 2HT3C 1P1ZB 3QFJA 4QRQB 1ZHLA 4P2OC 2EIDA 4ZD3H 3KLHD 4YIQA 3G08B 4X6DF 5E94A 1QG3A 1U92A 4EUPH 1VB9A 1N5YL 3CXHK 4K3DH 1KJ3H 1RZIB 3EJYC 5D2LF 4YH6A 3RWDB 2CK0L 4YE4L 4CJ1A 3PWLA 5DK0B 4PGBB 2QSTA 2WINB 4P2OA 1ZGLB 3O8XC 3OHXB 5KTEL 2KZ1B 4TPRH 2ZCKH 2YD4A 3C5ZC 4PV8A 5AG8A 4NFBA 3QUKA 2IGFH 5SV3A 1NGZA 2FJGB 5HHXL 3QUMH 3GSXB 3RVVC 5C8JA 1B4RA 4OZFG 1DJSA 1N64L 5JW3H 4KPHL 1SVCP 3BKYH 2O26U 1JE6A 3U2SB 2CDFB 3EFFA 1FO0H 3MJ6A 5CAYB 3O8XA 4FHBD 4JHWL 1AI1H 5GS0L 5F7EL 4ZFOB 2Z8WC 1F90H 4WNQA 5CJ8A 3JWOL 1KN4L 4OCNC 3WN5B 2X10A 2O61B 3WIFB 3O2DH 3W9EB 4FZEH 5J06A 4U05A 1KYOJ 5CCKL 5C0JB 2BHYA 1XF4A 3D69B 5DI8B 5AWNL 5EU5A 2WQ8A 3QA3A 4LLWB 4YHOL 4MWFA 3SHSA 1G7IA 3NVQA 2DI8A 1H3GA 5FM4A 4WTWA 1EAPB 1T3FB 3J7HA 3QT2A 2B5IB 4P3WA 3T4AB 2Z8RA 5E08L 2OYPA 3A67H 1XGRB 1H8SA 5J9PA 1R24A 1SBBA 4F7PA 3PWNA 2GFBA 3B5HA 1VGKB 2I9LB 4M6NL 1MSPA 3H7LA 1DN0A 5A2FA 5JOFB 1MI5E 1LO3L 4KKCD 3I02B 4XCFH 4R4FL 5FF6B 4Z8FH 4LOUC 5FHBL 4NP4H 4MAYD 4YHML 2P8PB 4C4KO 3NCYS 1U8KA 3BYTA 5GRJH 4DTGH 1MAJA 5CEZL 3X17A 4APQC 1MCQA 2AJSH 5DC0A 4KRLB 5D1XB 2DICA 3DX6A 3UTOA 3IJYB 2VDQL 4M62H 3U46A 1NJ9A 4WUKL 1U8IA 4QF1B 5E6ID 4JG0L 2R4SH 5D1ZC 5T1KD 3JUZA 1E6JH 2H2PC 2EE6A 3BISA 3VD4A 3BXNB 4NYLB 4RDQG 4MD4A 3ME0A 4KFZC 1IGYA 1WWAX 4APQA 4WRLA 5KBNC 2B1HL 3SEPA 3HZMB 1AKJA 5I19H 5FUCE 3LAFA 3MUY1 1FZJB 4YHKL 2EDOA 4OAWB 1NFIA 2EDRA 3MRFA 5FUZH 4NRXA 1VERA 5DHVH 5ISZA 3WIIL 2X70B 1UQSB 1IAMA 1MJJB 4PV9B 1ONQB 2R8SH 2NY5H 1U0QA 2LVEA 4XHQA 1B3JA 2GEEA 1YMMA 3OGCA 3GHEL 5D6CA 3MRIA 3RGVD 4NHCL 4GW1B 2YMXH 2X41A 3UMTA 4JO1H 3RWEA 3P9MA 2R69L 3BIKA 4MAUH 4E41B 5KVGH 4JFXA 5BS0E 2DQIL 5I8OL 5D5MB 3RWGA 4JHAH 3UPAA 1NDMB 5DUPL 5FM5O 2MPAH 3KXFE 5CSZA 1I9IL 4OLVH 4M8VA 4D9QD 2YD8A 1EIBA 2DQDH 1HXMA 4RGNC 5DD1H 4XP6L 3H7BB 4HX1B 3OR7A 3MRCA 5CZVH 2ZUXA 2N56A 1A7NH 4X6CE 2N4IA 2XRAL 5BVJB 3T77A 1A6AA 2ITDB 2Y5TA 3BUYB 3QDMB 5JW4N 2XKNB 1IAOA 3QO0B 5IR1B 1FZKB 1RJLB 1JNHB 2MHAA 1BVLB 1HHKA 1NANH 4PLJD 1D9KC 2HFFB 4GJTB 4J2XA 4OI9A 4BH7A 1TNMA 1FFOB 3OXRB 4D9RD 4AH2B 4OCYH 2EEAA 2VXSL 3B2VH 3UJTH 4YZFE 1T1YB 4HKJA 3V0WH 2HG5A 2WK2A 2B4CH 4GLRH 3CFCL 3ULUE 3QIBA 1D9KA 4CRPA 1RURL 1ZS8B 3ZDYF 1BQHB 3ZKND 1H15B 4PJ9C 4L8CA 1TFHA 1BD2E 5E9DB 3KYNB 1HKLL 2F5AL 1G9NH 1OM3L 1MCRA 4P46C 1JCKA 1DLFH 4JRXE 3EDKA 1LD9A 5I1GH 1HWHB 4XVTL 1MCPH 5A16B 4DAGH 3H42L 5HVHC 5DEGB 4PJ9A 5JORB 3SOBL 3OJDA 4UV7H 2PETA 2FECI 5E2UH 3V6OE 1ZEAH 3M17B 5HI4C 5E7FA 3V0AC 1KCUH 5IB3B 4K7PY 4OD1H 3PV6A 2IQAB 4P46A 5E8EA 5E2TL 4FS0A 4QTIH 1A1MA 1L7TH 4CVZB 3DUUA 3RDTC 1GAFH 5ITFA 1MRFL 3QCVL 4LSPH 1GC1C 1F2XK 4OCRH 1I3UA 1MCOH 2Q8AH 5A2JH 4DVBB 2ATPB 4YPGA 4J6RH 5E2VL 2XN9A 4TTDC 4YDIH 2OJZL 1KLGB 2AV1A 3OV6A 1NGPL 4WJ5A 1T20B 3L3KB 2Z4QB 3KPSE 4QY8A 4QRSB 5JW4R 3BZFB 1HIML 4HKXA 2BVPA 1QA9B 4U0RB 1S7SB 1XF3B 4OV6F 5D7LA 1MFEH 1S7QA 2LVCA 4X4YA 2F5BH 3DVNB 3KPPA 3RWJB 4Q7DA 4UBDC 1UC6A 2VITA 2EYTA 3MOAL 3ZL4L 4W6XB 3GHBL 3RY4A 4UQ3B 4P9ML 4C55A 1G9ML 4X8XA 4M4RA 4KK9C 3TBSA 4WFFE 1AC6A 4X5WB 2OTPA 1AC0A 3VG9B 3D0LA 5HGAA 1ADQL 3MV7E 1JHTA 3IDYB 1YNTB 3L3IA 4S10A 3LS5L 2PYFA 1LO5A 2NMSA 2FRGP 4NQCE 1FYTA 1KEML 1IFHH 1NSNL 4YX2H 4UU9B 5DJDB 5IT2H 1PDKA 2YWYA 1ZA6A 5CZXD 1T7WA 1S9WA 5IW6A 8FABB 3IRPX 2CH8A 4NQVB 4G42A 3EDFA 2CKBB 2D31A 2X4OB 5C71A 5BZDA 3LRSB 4XCCH 4NDMB 2H9GA 4JLRB 5BV7L 5J0BA 1Q8MA 3VXRE 3MC0A 2R29L 4MB3A 1TDQA 4HQQL 1PX3A 5ESVA 3RP1A 5HGGS 3U30B 2UYLB 1QR1B 4PJ7A 1J0IA 4LKCA 4B53A 43C9A 2FX8L 1M6OB 1EFXA 4BFBD 1T1XA 3IXAA 1KPUA 3ESUF 3HNSL 5EU7E 1EGJL 4S1QL 5JLZB 4PJ8C 5C0BE 3QULB 4I0PD 1R5WA 4MQTB 2FEDC 1CDIA 4HBQA 3CIQA 2D0HA 4Q9CA 5I1EH 5K9KB 1LDPL 4L9LA 2ED9A 4V1DB 2R2CA 1HQ4B 4K3DL 5IQ7H 1KJ3L 3ULUH 2DLHA 3RIAK 2AJVH 1CICD 3H3BC 4XP5L 2VOTA 3EZJB 3MYJA 2GHWB 3TZVC 4K8RC 1L7IH 2WWKO 1JV5B 4WI4A 1FNSH 4ODVH 4TPRL 2ZCKL 3VFSB 3JWDC 2IGFL 4NKMA 5EBWB 2CLVA 2GAZB 3QUML 5SWZA 3SE4C 3GSVA 4YO0B 4LBEB 3P4OB 5EPMA 4E42B 5JW3L 4HZLB 5C07E 5MENB 3LKQA 3GBMH 4PYHA 4N0YH 3BKYL 5I0ZA 3MRPA 4MJID 3DUSA 3G5YB 3VMPA 1FO0L 1LO2H 5H2BA 3CK0L 1EMTH 1AI1L 1INQB 1XGYL 4XMPH 5JR1H 3TWCH 5KVEH 3FFCB 5DK2B 2GIYA 1BZ9A 3T2QA 1WBXB 2P5EA 1F90L 4LVHB 3FT2A 4FG6D 2NYYD 2RFXA 2VDPH 4LP5A 2YA2A 3O2DL 4QHUA 5CUSH 4IRZH 4FZEL 4OSUH 1MVFA 2Z35B 5KSBA 1FVDA 3NIGF 1KIQA 5HHMB 1PBYA 3HRPA 2BNRE 4HAGA 4KRPB 2COQA 1ZVSB 2OSLA 3WL9B 2DYPA 3HG1D 5BQ7B 3VFMA 1N2RB 1BZ7B 5JOPE 4F8TA 1DSFH 1YMHA 3EOBA 5T5FH 2VLKB 4WFHD 3QCTL 3MTRA 5CWSB 3RNKA 3JTTB 2BNUA 3BI9X 3TYFA 1FFNA 4BQ8A 1J9CT 1AO7B 1BWMA 2YSSA 4N9GA 3QI9C 3MRDA 4I3RH 4Z8FL 1AGEA 4XGZB 1FPTH 4NP4L 4XC1H 3BKCH 5GRJL 4DTGL 1N3NB 3VJ6B 2BNQE 2IH3B 4G6JH 3VXPB 1YDPB 3KYKH 4ACPA 5I1IH 4G7YL 5L8LB 1BBDH 4M62L 5INCB 5EUOA 2JIXD 5JXAH 4WWKC 2SEBA 3QI9A 4QNPF 1U91B 2R4SL 4LIQL 5AZEL 3F5WB 1MVUB 1A4JB 2FH8A 1JTTA 1E6JL 5D6DC 4JFYA 1K4CB 2XPGA 3O2VH 4DGIH 3D25A 2Y9RT 4P4KB 5E4EC 2WBJA 1NL0H 1GHFL 4KDTA 5I19L 4KGJA 4M00A 3PXHA 4MXVF 1A8JH 2IPKA 4WWKA 3IS0X 3TVMC 4NKOB 5JW4Q 3DJ9A 3O6FD 5FGBC 3P77B 2YC1A 3NCCB 2FJFB 3ILPB 4XMKH 4XP9H 5KSAC 5D6DA 3VXOA 3F7QA 3GJFB 3MQIA 3HPLA 3QISA 3ULSA 3PQYE 2R8SL 2NY5L 3D2UB 4PJAF 2NY3D 3GIZH 3ARDB 4LEXH 3WSQH 1OGTA 2EYRB 2AXGB 5F7UA 4ODTL 4RZCB 3T0WA 2YMXL 3VFPB 3TVMA 1KN2H 1EV2E 4PRPA 5FGBA 4FFWD 4CNIB 3ZKQD 1OP5H 1CDYA 4JO1L 5LQBH 5KSAA 1S9XA 1MF2L 2V7HA 2HN7B 4GW5B 1FZOA 2X7LA 4MAUL 1WC7B 3RZCC 1I1FB 4HEME 2OXGA 3L9RA 1CZ8L 4POYA 2J8UB 2QR0A 4JHAL 4XI5C 3VG0H 2D7TH 4BZYA 4R90L 2ARWA 1ZOXA 5M94B 4UUJB 1EEYB 2MPAL 5HPMA 1KLFA 3T0ED 4ODWA 4OLVL 1A0QL 4I3GA 1FNGB 1DQDH 2DQDL 3TA3B 1HE7A 2NXZD 4NT6A 2P8LB 3IDNA 5DD1L 3RWHB 3MRLA 3RZCA 2PNDA 3EDEA 1OVZA 3NPSC 5F1KC 5I1LB 4Z7QF 3QXAA 2Z92A 1WZKA 5CZVL 5TDPA 4LEOB 1A7NL 1FP5A 3ARFC 5JIKA 4DUVA 4NBXB 3U9UB 3KPLA 5B8CB 2YD3A 1A22B 1U2HA 1QBAA 4O2FA 4ZO7A 1NBQA 3MRMA 3B9VA 2A73B 3EOTL 3DXAE 2E9JA 2F19H 5CJXC 3IAQA 4HWZA 3PUCA 4GMSH 2J2ZA 1RZKH 5CBAB 4P9HC 2HVKA 3CUPB 4FQQA 3GB7B 2IF7A 1NC2D 3E6HB 3NFSH 3ARFA 4S2SA 3WNNA 4L8BA 3QDGA 1VSCA 3GMLA 3B2VL 3UJTL 1U8JA 3V0WL 3OKNA 4Y19A 4JZOA 4HMCA 2B4CL 5L2JA 5C6WH 4LCCC 1QFWH 1GL4B 1W72B 2DQTH 3PHOA 3ARBD 1MFCH 3L3DA 3OB8A 4JFDE 4P99A 3U0PB 5CZKA 1UH2A 5J13B 1CXLA 3U36A 3LKRA 2R15A 3EYQC 2QEJA 4FQXB 3VXSD 4F2MA 1G9NL 4PJ5E 1AR1C 1XZ0B 1D6EB 1DLFL 3CPLA 5I1GL 3QJHB 4LCCA 3K74B 4L5FH 4X6FA 1MCPL 4ZO6A 4DAGL 2HLFC 5BJTA 3PGCB 3PP4H 4BA8A 2WBWB 1PZ5B 3N1MC 3I6LD 3B9KA 3RWCB 2NTFB 4UV7L 4WFGE 5E2UL 1I3RA 3QUYC 4J3SA 1UJ3A 1ZEAL 4KKLC 4JN1H 1K3ZA 3PE9A 1WFUA 5F71A 5ICZA 3QP3A 4XPTL 4XCNB 2XTLA 3MRHB 2VTFA 4QTIL 1L7TL 2FR4A 3M07A 1GAFL 2AERT 4LSPL 2QHLA 3A6CL 4NNYA 2UVEA 3BD4A 4OCRL 4U4BA 4OV5B 2RJMA 5CEZD 2Q8AL 4HIJB 1AD9B 4UOW1 1I7TA 4J6RL 1IQDA 4NOFA 2E9WA 2OL3A 4YDIL 1YY8A 2VXUL 1H0DB 4YR6A 3CAFA 5C0AB 4J1UB 3MBED 1Z5LB 1P53A 3VFOA 1XIWC 1Z9MA 1KG0B 5K9JH 2HJKA 5T1LA 5L9DH 1MCKA 4PRDB 4JR9H 4R97C 4QXTB 3RWFB 1OTUC 1BJ8A 5EO1A 1FG2A 5IW1B 1CGSH 4DK3A 1LEIB 2IBZX 1MFEL 2RHEA 3LQZA 5GJTH 1N0XH 1I1CA 5LG1A 4G5ZH 4LLVA 4GXUM 4YBHA 3JV5A 4IIQC 4PJGE 4DFHA 5JMRA 3MRNB 2IANB 1U3HB 1HHJB 4GSDH 4AEIH 1C7TA 3BP7B 4IMLB 1JZ4A 5GRZA 1ES0B 2WSKA 1J0KA 4LAJH 1FJ1A 1JFQL 4JAMB 4Q0XH 4O2EA 1AQKH 3BPCB 4NNXA 1FN4B 4XBGB 5CIPA 3WUZA 1AGFA 2FD6H 4ZOEA 3RTQA 3W11D 2IQ9H 1HN1A 12E8H 4L3AA 5IROC 4F15B 3HB3D 2PO6D 2YOCA 2FX7H 5IMLA 3LKSA 1H5BC 3DOSA 2ZUTA 5I1AB 2HMIC 4U1HA 1R3KA 4EI5D 1IFHL 3DBXA 4YX2L 1MY5A 1GJIA 2FLBT 5L2KD 5IT2L 2W60B 3UTTE 3QEQA 4ISVA 2XZCH 4OLWH 1X5AA 5JPMA 1PZUB 3UYRH 4MQSB 5IW3A 4OFYA 5IROA 5TDOA 5HGDB 2ESVE 4JFEE 3SJVE 1JF1B 5J8OA 4NQEA 3P40A 4PRAA 2MKWA 4XCCL 2Q87A 3C5JB 5ABDE 4K9EH 3WFBH 3GMMA 4Y16B 4NPYA 2H32B 3GNML 4BH8A 3OKMA 4YHIB 3GRWH 4KI1A 2NLJB 1N8ZB 2IFGA 4X4XA 1KIRB 1KIUA 1HILB 5FGSA 4L3EA 2FWOA 3EOYG 1PG7W 2DOCA 3T08A 2YZ1A 1HZHH 5I1CH 4X6BB 3MREA 3PABA 5HD8C 3CVHB 4HK0B 3CZFB 5GSVA 5SX5K 3NIDF 4IRJB 4WVRA 5I1EL 4PJCF 5F9WB 3ULUL 4GBXC 3RX5A 2AJVL 3HC0B 2DWDB 4OLEA 3HN3A 2P5WB 1DZBA 5DQJA 5GS1C 5FV1L 1CLYH 1BOGB 1L7IL 1Q0YH 2JK5B 1OL0A 2DBJA 1VADA 5DHYA 1FNSL 1JPTH 3SGKC 4ODVL 1ORSA 5K93A 4N9OB 4QCIA 5DK3A 2ZNWA 4YQXH 4L4TD 4N8VB 2VDLH 5SX5H 4N0YL 3WDHA 2DN7A 3G08A 2X40A 5CINL 3VFTA 2NNAB 2I27N 1W8OA 1EMTL 2ZSVB 1EZVX 1RZIA 1TXKA 4XMPL 3TWCL 5JR1L 5KVEL 1JZ2A 3RWDA 4R4BB 3OKYA 2D03H 2R0WH 5DK0A 4Y4KD 5B3JF 1Q9OB 3I6GB 3W5NA 2WINA 1YEEH 2MMXA 2VDPL 3IDIB 4XP1H 4M61A 1ZGLA 1J1XH 3BEWB 3OHXA 2XWTA 4MVBD 5CUSL 4OSUL 4PP1D 4LLDB 1S3KH 2APFA 4LCWD 2YK1H 4QXWA 1J8KA 2FJGA 4IRSD 3GSXA 1GOHA 1X4ZA 3W0WD 4OBSA 1MPAH 4HUXA 5B21A 4X99B 5GGSB 3U2SA 2CDFA 5J89A 4P2RB 3BX7C 4H1LB 1JL8A 4XNXL 4NRZB 1OSZA 1MFBH 1DSFL 5T5FL 4ZFOA 3LIZH 1EVUA 4FTVB 4ZODA 3V5KB 4I5BA 4ONGH