1J1OH

Crystal structure of hyhel-10 fv mutant ly50f complexed with hen egg white lysozyme
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/hydrolase
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
publication title The Role of Hydrogen Bonding via Interfacial Water Molecules in Antigen-Antibody Complexation. THE HyHEL-10-HEL INTERACTION
pubmed doi rcsb
source organism Mus musculus
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2002-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j1oH00
1U6AL 3P4NB 3DUHA 4QHKI 2E6JA 5FM8A 3IU4L 3ZZ1A 3QUXA 4JFXB 4OTXL 3I85A 4Y5YC 4RNRA 4ELME 4K8RL 4UUJB 3I02B 4MJID 3GMOA 4OI8A 3GSQA 4KJPD 3X3GH 1J8HB 3GI9L 3G6DL 3T0ED 2VITA 1G6RH 2AEWA 4FQ2L 5E0QA 3VFRA 3LS5H 3ZTJH 3T4AA 4NQSB 1IAOA 4KRNA 3WXWL 4NQUA 5DK2A 4U2YA 4MNQE 1NGXB 5HDBF 1KIRA 3HR5A 3UTSE 4UT6L 4R8WH 1XF4A 4WW2B 4X98A 2AQ3A 4GJTB 2XTJD 3R8QA 3S35L 4OZIE 4NPYA 1H15B 4OLVH 3SPVB 2P8MB 1Q0XH 4MHHG 3RGVC 5ENWB 4UOW1 5CGYC 5GHWL 3QRGL 2F5BH 2CH8A 4X4YB 5D93C 5EDXA 1CFNB 5J13C 4P5TB 3D69B 3WFEH 5IB3A 1CE6B 3NN8B 1Q9WA 3JVGA 4MXVE 4G43B 2Q7YA 3GSUA 4OF5A 1MPAL 1P4BH 1A8JH 3SCMA 2JCCB 1UG9A 1R5IB 1KLFA 2K1MA 3MFFB 3SGEH 4O2EB 3QYCA 4LRIA 5E1HB 3VXRB 5LGJA 1UKQA 1NDGA 3BPOC 1HI6B 1I3UA 2CR3A 3P0YL 3BHBA 4N68A 2WBJA 1D5BB 1UQSA 1CICA 4YEFA 3QH3B 3WUWG 2R4SL 4MNGB 3MV7D 4OCWH 4LLDB 2OR8A 2EC8A 1HHJB 2R1YA 1EJ6A 5IT2H 4NHCL 5JIHA 4PG9A 4K94H 3U36A 2F19L 3F65A 5HD8C 2VZVA 2R8SL 4PV8B 3ILQC 1HH6A 2Q1EA 1DP0A 4QTIL 3WL9B 4HPOL 3UZEA 4X6DB 2VZ1A 3NBNA 1JK8A 2YUXA 3EZJB 3D25A 3GMLA 2WINB 5TF1L 2QQNL 3QO0A 4IRSB 5D1XC 5GRUH 3N0PB 1KCRL 5DD5L 3HG1E 3KXFB 1K8IB 1A6WH 3B5TA 3GB7B 2MOVA 5DC9B 2VL5B 5FO7A 5DHVA 1PG7X 2ZUTA 3ULVE 4QXWA 5JPMA 2R2EA 3AY4C 3QWRD 5E7BA 4JY5L 3PIQA 4GUPB 2V7NA 2CRIA 2ICES 4JM4L 4M1GH 5J9PA 1DR9A 3B3IA 3QQ4A 5HI3D 3UTOA 5E6IB 1GZPB 1AHWA 4NO3A 4MCYA 1YEJH 1GPOL 4OGYL 1DVFD 3QCVH 4AT6B 4C59B 4EDWH 4HEPG 3SY0A 3CPLB 3OX8B 3QO1B 4KZDH 3B6SA 1TJGH 1ZA6B 4NBYB 3RWGB 1CU4H 4Z7QE 3MRCA 4NDMA 3VFMA 4HUKB 2WWKT 1ORSA 5GQBA 2CRYA 2VE6A 3EO1B 1CCZA 3QFJE 1J87A 1DFBH 5TDOA 1FDLH 3V5DA 3QDMA 3NCMA 1P7KB 4MAYC 1T0PB 5FUCE 4JDZB 5BS0E 2LVEA 2QSVA 5C07A 2DWDB 1RUKH 4B0MM 5LAXB 5IV2A 2VLKA 5MP6H 1KELH 2JF1A 4JO1H 5D4QA 3RZCC 4AM0B 1J05B 3FN0H 2A9MH 3ORJA 3PWLA 4ODTL 4G8FB 4NSKA 5D6DA 2YPLD 4L4VB 1A4JB 2MPAH 4JFEB 5E2VL 2A73B 4PJ7A 4R97C 1OARH 1BQHG 1OAKH 4X7SL 2ZOLA 4YK4C 3TBVB 1N0XH 3A6BL 4HIJB 1K3IA 4PJ7F 2Q87A 3D3VE 4O2FB 3ZE0E 2P5EB 3MLYH 1L9MA 1KCUL 3FKUS 1KN2L 3RDTA 2FRGP 3PDDA 4GLRH 4JFOB 1H3PL 2M2DA 3S37L 5E4EC 2NXYC 3IDGB 4JFDE 4OZGE 5F7UA 3S36H 4LMQE 2QQKH 4DTGH 1P1ZB 1GHFL 5C8JA 2YA0A 1UJ3C 5B3JE 4RMTA 4V2CB 5CLWA 4PR5A 1A7BA 4JM2B 1WAAE 4BFEA 3CFIC 4DQOH 2XNAB 1EXUA 3EOAA 1J18A 3OTTA 3OKDB 5HYQA 3Q48A 4GOSA 2XICA 3WNLA 1RPQA 2ESVE 3QZWG 1MCWM 2R1WB 4R7DB 3K2MC 3ARDA 5DF0A 3BZEA 1PSKL 2O61B 5TH2B 2FIKB 4QEGA 2C7UA 4G8EB 4IOFC 4KDWA 1T1YA 3MGTB 3UXFA 5J12B 4D9LL 5CILH 1W0YT 4WHDA 4OCXH 4NQVA 3FFDB 3HZKA 4I0CC 1HHGB 3V6OA 3OZ9L 3OHXB 4BZ1L 4IHOA 4LQFL 2D7NA 1N7ML 1G9NH 1QA9B 1IT9L 1YECL 1QLRA 3PGFH 3GMNB 3ZKND 4GW1B 4OLWH 4Y1AB 5FM4A 5J3HD 1FAIH 1WISA 4ZSOB 1RZKC 3KYMA 1UZ6E 3EYUH 2IQ9L 1XGYL 4A2MA 4GXUM 5DQDH 4NQCE 1MCQA 2DQDH 3ZYZA 4JR9L 3DUUB 5I71B 2SEBA 1T2QH 2X7LA 3REWB 1FVDA 4TSCH 3DSFH 1INEL 3ULVH 4K8RD 3L5IA 2Q8BL 2HVJA 1A14H 3O6FB 3TPUA 5I18L 1EUUA 3U4AA 1NJ9B 4O58H 1PW3A 2YBRA 3EO9L 4DVBB 1Q0YH 1I7RB 1UT9A 4Y4KB 5IVXB 3CK0L 3FB8A 4Z7UF 4XTRC 4WTZA 3LRHA 4K07A 1CVSC 4YHKL 4HGWA 3VRJB 1MRCH 3GK8L 4S1SL 1TNNA 4X83A 3QUXC 3MSPA 3MXVH 2I9LB 4HLJA 1AY1H 3T3PE 3STLB 4L1HA 2X09A 2NY2D 3O3DA 1BQLH 2EE3A 1JFQL 4NBXB 3ARED 1V3JA 1QFWH 1LNUB 3FT4B 3GJFK 3WJJC 3UZVB 4CADA 3VWJB 3MMEA 5IHBA 4Y16C 4NP4L 3QDJB 3VFVA 2EZ0C 3BEWB 4HS6B 1F2XK 4MSWA 2FX8L 3O6KH 3W11C 1AGBA 2H41A 4DFHA 2DQIH 5FHBL 2EIDA 1EEUA 1ADQL 1F45A 1OAXL 3QWRA 2IANE 1B4RA 1P7QA 2CGRL 2G75A 4J3OC 3VDCA 1DLFH 1AQKH 2XZAH 3I75A 2VRAA 3LKNB 4XWGH 32C2B 2H26B 1ZVHA 5E8PB 3MNZB 1MWAA 5DJXA 4M48H 3MCLL 5E08L 1ZT7B 5IJKA 3GI8L 1J8HE 1JNLL 4MAUL 1NCDL 4M61A 3GHEL 1MIML 4LRIC 5EBMB 2D3VA 4JKWA 1T1XA 5HHQB 4RZCB 3MLVH 1PY4A 4OI7A 2X1XR 2R0LH 1DQLH 3TEUA 4HLZG 2WIIB 2WBJC 1U2HA 4PJFB 3P73A 1JNJA 2BHZA 4LEXL 3PJSB 4I48A 1KTRL 4MDJA 2X42A 1W72L 2ZUQB 3SDCC 5HHNB 3FRUA 4CDGC 1R6VA 2VLME 2P44B 4PRBA 3CXDH 2AK1H 1N5YL 2CQVA 4HXAL 3V6ZA 6FABL 1IBGH 1DBKL 3J8F7 3KVQA 4ZO9A 3QUML 3TJEL 4PYHA 2BY0A 3DX7B 2BMKB 1U3YA 5K9KB 4MVBC 4E9LA 4Y2DD 2EC9U 3HMXA 3DETC 2YPLA 4P46A 3WUWB 5GJSH 3ZKMD 5TE6H 2C4FT 1U8KA 1V7ML 2ZCKL 2JCCE 1JJUA 1RZ7H 3VXPB 3BMWA 3U79A 3DX9A 1FRGL 2FJGB 4YGVB 5T5FL 1UWXH 3PXJA 2XG5A 2EDDA 1ACYH 1U8PB 3NGBB 1S9YB 3N9GL 4OT1H 5IHZA 5C08D 1X5GA 1ZHBA 2WUCH 1JHTB 1EO7A 3IDXH 3VMNA 4MNGE 1MREL 5CINL 4HWBA 2GT9A 5FKAB 1A7QH 3KLSA 3WFCL 1I1AC 1ZHLA 3IVKA 5GZOC 4LVNC 2ADJA 4IS6B 1R5VB 4I3RL 4NFBA 4GRWF 1I4FB 1OPGL 2Q7NA 2KBGA 1MVFA 3CFJB 1KULA 2EXWC 1DBAH 4P2QA 3LQAH 2D31B 4WWKB 4YDLC 4X6DE 1MFEL 1EGJL 3O2WH 3RI5F 3ARPA 4KGJA 4M7KH 4O4YL 3OB0H 1QSZA 4TSBH 3GSRB 1E6JL 2W60A 5KS9B 3PGCA 5K9JL 3KXFE 4JGUA 3QR2A 1NCUA 3SE4C 1YJDC 4HK3J 4Z95H 4P2CG 1PEWA 5IB4A 3RJQB 3BYTA 4H88L 4L8CB 3MRKA 4I9WE 2YMXL 2HJFA 1RUML 2PR4L 5SX5H 3BP4B 3CGTA 2AJYL 2Y07H 3QEUB 5DEZA 2P43B 4V1DB 3DTXB 1S9WB 4KI1A 1D5XB 4KZEL 4JO2L 4L8BB 1UCTA 1FL6B 4NYLB 5I66A 1CL7I 1N2RA 2F53D 5IWLA 3OKKA 1V3MA 1IC4L 4U1LB 1M05A 4U6TA 3QXTA 1CI5A 2BJML 4FZEH 5GSRB 3G5XB 3FB7A 4JJHA 5I1DB 1N6UA 1JBJA 5GS2D 3SJVD 4UT9L 3DUSB 5AAMA 3QUKB 3GSXA 3TO4A 2XN9D 3P3YA 3QIBB 4ISVB 1T89A 2QSCH 1BQHB 4QRPB 5B38G 1LWRA 4XP4H 3D9AL 2P24A 3HMWL 5E6YA 4FFYH 4RQQA 4HKBA 2CJUL 5C0JB 4P4KD 5JPNA 2RB8A 5JQHC 1OCWH 4FFZH 4IOSD 4M7LL 4GKZA 4KJPC 4WFED 3KYOA 3EYVA 5EBLA 4JFEE 3T0EC 2BOBA 4G9FB 3RL2B 5DJCB 3MACH 4QRRB 2OJEB 2ED9A 1W0WB 3OGCA 3V5KA 3K8KA 3OPZL 2P5EE 1JPFA 3EYFA 3MUZ1 2X4UA 1U8QB 5D9SB 3INUH 1XF2B 1Q9LB 2CDFB 4FQJH 5L88H 3C6SA 3A6CH 4AENA 5SWZA 3B8YA 2XTJC 1F4XL 3WFHB 1XIWD 3QZWB 4JREB 4O2CA 5JOFA 2AJUH 3FOLA 3F6IA 3KPRD 4O51B 5TE7L 4EN3D 2CKNA 1MELA 4FMKA 1OTTD 1Q9KA 3IDJB 1TFHA 1WBZA 2MCPH 1K8DB 1NLBH 1ZMYA 3SDAA 3OJMB 4F9LC 5FV1L 1DQJB 4L3EA 4U1MB 4UTAL 3MUGA 7CGTA 2IFGA 4EOWH 5IHLB 1CTNA 2VSDA 1P53A 1OAUH 5T1KA 1RJYB 3ALXA 1PKQA 3CLEH 3O9WD 4G7VH 1AIFB 4ZNEE 4I18B 1C16A 3AM8A 2BFVL 4QO1A 3LN9A 4PBVC 5KG9A 4YR6A 1S7SA 3L6FA 1M6OB 3GMMA 4UIKH 1MLBB 4MCZA 2FGZA 4NWUL 5B4MD 4XCFH 3RAJH 1IGTB 3ISWA 2QL1A 4DZBB 2V2WA 4KROD 4FQHA 3VFNB 1UJTA 3GBMH 4HPYH 4N8CH 3C2AH 4KV5F 4Y1AE 1JI1A 1MCIA 3PWVB 4YHPA 3NCJH 4ZSOE 5FV2A 3QP3A 2ZUWA 4PTTB 3S34L 4F57L 1ZGLM 1TPXC 3G5VA 1T4KB 2V6HA 1KXQE 2L0DA 4HC1H 3N06B 3UJJL 4A6YB 2VABB 4YFLI 4WFHE 1U8JA 1TJIL 2CXGA 1C5CH 4M1DL 4W4NA 4XAKD 4MD5A 2Y06H 4CAGA 1CXKA 5D71L 5HHVL 2YR3A 2H6PA 1EEYA 2QTEA 4Z7VB 3RZWA 2E9IA 1BOGA 5SX4I 1QO3A 2EDHA 3NTCH 2L4OA 4PY7A 2HAZA 3V4UL 5IVXE 1KPRB 4E5XA 4YHNA 4EI5D 5C08A 4AIZA 2DLGA 1T0NA 1LDSA 5B39A 5EUKA 1T0MA 2NX5A 4DKFH 5HI3C 5DUPH 4Z7OE 1YQ2A 2LE9A 3ZT6A 2NY1D 1M71B 4FN0A 1FO0A 4YPGB 5GGTL 2FH8A 4K3EH 3QUZB 1DVFC 1EEZB 5HHMD 4XRCA 2X89A 5FECA 2OXHA 2GTZB 2R2HB 4ENED 2OQJB 1MCOH 1FLRL 1HE7A 4YHLL 3X14B 3DO3A 4RX4A 3LS4L 4Z76B 2XZQH 1IZKA 4XVTL 1IMHC 5I8OL 4L9LB 3KLDA 1RZJC 4K7PY 4U6XB 3OR6B 1AGDA 1SJHB 3QHFH 5E8OA 2FIRT 3P0VH 3BPNC 3QDJE 3QWOA 4XPFL 5CP7B 3GDBA 1X5KA 1T03L 4HX1B 4M8VA 3Q5TA 2VAAB 1DEEA 1MCNA 5ALCL 2G9HA 4MLSA 3VFUA 4XVSH 1E27A 1HSBA 2B2XL 1FQ9C 3QI9B 2MQ0A 1GAFL 2R0KH 4YFDB 4WU7B 3IDMA 2XWBB 2A1WL 2JIXA 2ADGB 1BBDH 1D5IH 3MLPA 5F8RC 1ZVSB 5I8CA 2GY5A 3BD5A 4P9MH 3DVNA 3X13A 2D7MA 4ZUUA 2HKHH 25C8L 3CZFA 4Y0GA 4Y4FD 1ZLVH 4HZLB 4MXVF 1RULH 1KTDA 4BUHA 3EFDL 1KEGH 3GSOB 3D85A 2NLJB 4KMQA 4Y5XC 1YEDA 2GAZA 4JFPB 3MLSL 4ODXA 1MFDH 1A5FL 1EA9C 4OZHF 2ARWA 1EHNA 4PJFE 4YDKL 3P30L 1BJMA 1AKJB 2IMMA 3PP3H 5F3HA 1XZ0B 4AEFA 1HHKB 3HB3D 5GJTH 4QY8A 1KB5B 5D2NB 4Z77A 1FV1A 3K2UH 3P9MB 1HXMA 2J3SA 3PL6A 3V95A 2E7CA 2OJZH 3TWCL 4P4KA 4MWFB 3VGEA 2IGFH 4QXUL 5CSGA 1YEEH 1NAMH 2FNBA 4PS4H 2WWKO 4J3WA 5L2KB 4LKCA 2C26A 3T1WA 5DLMH 1P84K 2L7UA 5JO5A 3H3PL 1ZANL 3QNZA 5EZJB 1U58B 3HS0A 4IMLB 1WV7T 2UWEA 1QVOB 1YYLH 4PJ5B 5LQBH 3U9PL 1SJXA 4OF8A 3BKMH 1QFOA 4XC1L 2UWEF 4I5BB 1XF3A 1OSZB 2GCYA 2O26U 1UEYA 1HOCA 4PLOB 1BWMA 5H37H 4YXHL 1N6QL 2R56H 1WBYB 1U8HA 3ZKNC 2WZPD 1FZJA 5J3HC 3RVVD 4ALAH 5D1ZA 3KPRA 4EN3A 1R3JA 2AS5M 2RQ8A 1U8OB 5KVFL 2WANA 2FEEL 4KKAD 4CMHB 1X7QB 3SGDH 1YC7A 3MV01 3BWAA 3OKOA 2H8PA 3ROOB 2ITCB 4K8RC 4GKNA 2F9BT 3RU8H 4XP6H 1M7DB 3O9WA 4XPHH 2FL5A 5GS1B 1MLCA 1IGCH 5KS9E 3KPLA 4Z7QF 4ZD3H 1WEJH 4Q0XH 1KUMA 1KC5L 3IFNL 3W9DA 4JRWA 3QCUH 1V8HA 2HFGH 5C0RH 4JY4B 4XNQB 1LHZA 4XMKH 1RK0A 2ZJSL 4EXPX 2Z31D 5M94B 3DGGA 1JGEA 3PQYD 2IAMA 3BT2L 1Z0MA 1FZOB 4NJAL 5IQ9A 5E99H 4LLQA 3UBXG 3RPIB 1ADQA 1YEIH 3IDUA 2MQCA 2VR5A 4V1DE 4JB9H 1S7RB 2NY2C 3AREC 3S5LG 1ULVA 5LBSL 5SV4A 3IS0X 4LCCB 3H9HB 3ZKXB 3VFOA 4FZ8H 1BJ1H 1LO2L 1WLHA 3HE6A 1CDCA 5B38B 3BP5B 4I0PB 1QRNB 5EC1B 3V4VH 4HWEH 1Q38A 4XH2A 3U0TB 4G7YL 5BVPH 1UXWA 2W0FB 1JPTL 1ZA3B 3K8MA 1CFTB 1LO3L 3U46B 3Q2CA 5FF6A 5T1LD 4OZGA 4N0YH 4HJGA 5DD3L 4QRPE 1T5WB 3I84A 1ZHKA 5ICXA 3FTGB 1QLFA 1NPUA 3FONB 3CVHL 1W72A 4IIQA 4U3CA 4UDTA 5ADPL 1F90H 2NW2B 1RZIA 1WAAA 1AP2B 4OBRA 4DZ8B 5DJZB 3AM8C 1WAAF 4G9FE 5DZOA 2ESVA 3VDBA 4QRRE 4ZFOA 1J1XH 2Z8SA 4CW1B 1FPTH 2PW1B 2UUDK 5GSVB 5B8CB 1CLZH 1P4IH 1JNNH 4PGZA 2EDBA 3K0WA 1PYWB 4M6MH 1A6TB 4LCIH 5F7EH 3W81A 2K7QA 4S1QH 4H20H 3UTQA 4GG8A 1ZGLP 2JK5B 4V2BA 1K4CB 4OLXL 4XZUA 3RIFK 5I75C 1EVTC 4X6BA 3H6JA 3QIUA 4WTWA 3LN4B 4PB9L 5DRXA 4XBEH 4FQQA 2E8ZA 3G9VA 3SBWA 1C5DB 4TNWF 2MHAA 8FABB 4WEBL 3PHOA 3DO7B 3BPLC 4X4MA 3BX7C 2VXTL 4OFVA 3NCYP 4M5ZH 5EOCH 5F7WC 1LEKA 1BLNB 1HWHB 2GEEA 3C5SB 3EYQD 1KFAL 1JV5B 3I3EA 1J12A 4Y2DC 4NQCA 4G6AD 3E0GA 3ZKMC 2VZOA 1R3IH 4MD4B 1N64H 5DSCA 2I9TA 4KHXH 2ATPB 4Y4FA 1OTSD 1S7VA 1Q94B 1FNLA 2J6EH 3PABA 1CZ8L 2XTLA 5IM7A 2I60L 1K6QL 1HIML 1KT2B 1NMBL 5E2UL 4RBPK 5C0BB 3VXTB 5I1HL 5H2BB 4FQXA 4ZMAT 2IFFL 3KPPB 5IVOA 4Z7WB 3I6GA 2EYSA 1F3JA 1MCJA 4HMEA 1DUZB 1FBIL 1XGPB 2ATKB 3DVIA 4TOYL 1KJMB 1XAUA 3B83A 3WIHH 3RI5K 1Q8MA 2JB5L 1I9IL 3L3JB 4HDIA 1MJJB 1LE9B 1S3KL 3BKCH 3NA9H 4PJEA 3TN0B 3CFEA 1I8IA 1U9KA 1JF1A 3TNNA 3KWWB 2YXMA 2VLJD 4PJEF 4O9HL 1DUYB 4MD0A 3MZGB 3RL1B 2I07B 3FHAA 3HAEA 4KY1L 4I2XB 5EZOL 5F3BB 3KPSB 4ELKB 1PG7L 2V2TA 2X4TB 4HHAB 1AGFA 2XA3A 4DVRL 3MRRB 1NFDB 4NC0B 2Q8AH 4Z7VE 2DWEB 5JXAH 1F3DJ 5KANG 5ITBL 2DYPB 2OK0H 2AEIT 5FXCH 2HLAA 2VXQL 5HTSA 3MRQA 3H0TB 2HFFB 5E6ZA 4F2MA 3UTZB 3MLUH 3D39B 1IKFL 3WO4C 3C60A 3KG5A 3DMMA 4LSQL 2V9TA 1MRFL 4PREA 3N50A 1QSVA 5DVKA 2NY7L 5D6CA 4NQED 4DGIH 2BNUA 3WBDA 4KTYA 1YNLL 3KLAB 4BZ2L 1IAMA 2N7BA 4PJXA 1CLYH 3BP6B 3SKNB 3P4NA 4OF7A 4E42B 2F54D 4JFXA 4PJXF 2ENYA 4NKIH 2IG2L 3MRHB 4KQ3L 3NA4A 4RGOH 5I9QC 1O7SA 2ZCLH 1IC5H 4LKXB 3HC4H 2UZIL 4UUJA 1F4AA 2FGWL 1OP5H 5C92A 1R3HB 3L3GB 2WUBH 4X8XA 1NCCH 1AD0B 2IC2A 5HDQH 3BGMA 4RGMC 3MRLB 1NGXA 5D7JB 2V5RA 1G6RL 3LS5L 1E4XI 4TUOB 1FGVH 1WZMA 4WW2A 4NKOB 4P3WA 1IM9B 2HTKD 4MGXA 1H15A 3SPVA 2P8MA 3E3QE 3PQYA 5GGVL 1HEZB 3D48R 4HSQA 1AGEA 1CE1H 2KL6A 2YUZA 4R8WL 2LQRA 4P4KC 1P2CA 3T2OA 5DR5L 3WHE1 3QNXB 3N1PC 5M95B 5E1AB 2Q76B 4PJGB 4P57B 4RFOL 3D69A 1LK2B 5T3ZE 2FO4B 3MV8D 4BQ9A 1UENA 2BSTA 5E7FA 2XWTB 2J7LA 3N1FC 2W07A 1AO7D 2DMBA 3ARFB 4U7MA 2JCCA 1R3KB 3MFFA 2JCCF 4PRAA 4AEIL 3VXRA 3IAPA 1P4BL 5CIPB 1XIWC 1XCQB 1HI6A 2GK0B 4ZAKB 5D2NE 4LGRB 5T1LA 5GXBB 4EN3C 1YUHB 3QH3A 4GXVH 1GJIA 1OTTC 4MNGA 3GSNB 3MA7B 3NFSL 5I0ZA 5DHYA 2X40A 1QR4A 4DJMA 3O3EB 1JRHL 5CZVH 3RKDD 3VFGL 2B0SL 4YHZH 2CXKA 1E4WH 1PZ5B 1X5JA 2R9HD 3BZ4B 4LSPL 4NQDD 4IDLA 4DUVA 2XOTA 2PO6B 5IEKA 4NKMA 3WFDL 3O9WC 4WHCA 1MFCH 5L2KE 1ZAGA 4IRSA 1KGCE 3MRDB 1XCTB 2EDLA 4HC1A 5B4MC 5HVHB 1U3HD 4PJ5E 4G8GD 4LARH 1K8IA 4KROC 1KIPB 3B43A 2YRLA 4GT7A 1FGNH 4A6YH 3K4DA 1GGBH 4GUPA 2APTA 1EEQA 5EO0A 1GSMA 3BD4A 4M43L 5E6IA 3EHBD 1T04B 3T77B 1VFAB 3CD4A 1NEZG 4AT6A 5IESL 3SQOH 2V17L 3HE6C 3CPLA 3OX8A 3IKKA 4Q6IB 1C12B 5E8NA 3O4LB 1ZA6A 1V05A 4EDWL 1X5FA 3QCVL 5AZEH 1QEWB 4HUUB 2FB4H 3UBXB 3U48A 5IMLB 2BVQB 2GQHA 3CSYA 3EO1A 3QDAA 3BH9B 1CU4L 3MRFA 4NKDB 5AD0A 5MERB 4EI5C 4TPRH 5IR1B 3S5LB 5TFSL 5L8LB 4PRIB 3CMOH 4HWNA 1OW0A 2VTFA 1MAKA 3MA9L 4ZS7L 1QSFE 2NY1C 3Q6GH 2Q6WB 1L7TL 5DEFB 2BHYA 4OQTH 4OD2B 4JDZA 3TBTA 2B4CH 2DQGH 4ENEC 1VGEH 2DWDA 3G9AB 4TVPE 1QYGL 4PJCA 5TF0A 1G9MH 2NY4D 4JFFD 3V79C 4AM0A 4PJCF 3H9SD 1J05A 2XT1B 4RWYL 3KPQB 2HJLB 4L4VA 3REVB 2X1PA 4UDUB 1N4XL 3S9DB 4F7TA 5EZLB 3TBVA 3DBXB 4HIJA 4OF0A 1QRNE 1MHCB 3FN0L 1X4ZA 3C5ZD 4YXLL 2QR0B 1IGIH 3CFCL 5LGHL 4HXBL 5JIPA 5I30H 1RZFH 3BGFB 3GIZL 4HKXB 5MEND 4K2UH 4KMLB 1XF5B 5SWSD 4HLZH 2A74A 3IDGA 3MLYL 3QISA 4P59L 4PRNA 1P1ZA 2R39A 1VCAA 5E24E 4KPHL 3RY6C 2Z4QB 4XC3H 4X6EB 4J3UA 4R90H 2F54A 4JM2A 4LHJB 1CF8L 1QPPA 1VFMA 4HBQA 2PF6A 2XNAA 1DQQB 5HSFA 3OKDA 1IC1A 2XQBH 4Y4FC 5CJXC 1I7UB 3FO9B 1XR8A 4AQOA 3VFTB 2R1WA 4R7DA 4ZNEA 2XXCB 5TH2A 2DIJA 1KB5H 4P2OD 4UQ2B 1VACA 1AE6H 1G7JA 4HIHB 3L7FB 4FQXC 5C2UB 5D7SH 4WHYH 1CXLA 3FFDA 3KPOB 3S3PA 1TQBB 4TQEL 1CGSH 4G6KH 2YD7A 3HB3C 3C6LD 3TF7C 3R0NA 2F8OA 3K1KC 4AY0A 2H1PL 1N8ZA 1QA9A 2ITDA 5CILL 1JGDB 1H0DA 1NCAL 4OCXL 5DYOB 3RGHA 3HFMH 4P5MB 4Y5YB 3U6RB 3GMNA 2E9JA 4GW1A 4Y1AA 1X5AA 4ZSOA 4JKKA 3PGFL 4XNUL 3PGDA 5CSZB 1JWMB 1JPST 4X9GA 3DUUA 5BVJB 5ID0A 3MV8A 4F8TA 2EE6A 4OV5B 2PYFB 5IJVA 3REWA 3IDIB 4Z7NF 5DQDL 1LE5B 2FEEI 4PJAA 4S2SB 3O6FA 1KCLA 1T2QL 2PTUA 4PJAF 3PWPB 2EDWA 1NJ9A 1UYWL 4J1UA 5I8KH 5T33L 4TSCL 3JTSB 5C0BE 3TT3L 2ICWI 4DVBA 3BJLA 3RGVB 3S96B 4Y4KA 2J8OA 1SM3L 3MJ7A 1A14L 4Z7WE 1T21B 2QEJA 3RVVC 1SEBB 4AIXA 3D18B 5E2TH 3P9WB 4O58L 4XPAH 5D93B 1FL3B 5J13B 1MIEH 1TQCC 5AWNL 2NY3D 3F6LA 3VRJA 5C0GB 3TCLB 1NL0H 5C0AD 1JZ2A 3UJIL 3T65B 5CWSA 2EDEA 4KKAC 1MH5B 2EECA 3G04B 4U1SB 4WY7H 4RISH 1CFSB 3LRGA 3STLA 4MNHB 1BAFH 4I2XE 4NQDA 3MUJA 1IFHH 3KPSE 1TENA 4BFIB 1DBBL 1WICA 3VG0H 4ERSL 4LAJH 1LNUA 3FT4A 1NFDE 3T2QA 3VCLA 3VWJA 5HYSG 2DLFH 3BPOB 2LU3A 5F9JA 3SE3A 5GS0L 2ZSVB 4Y7MA 1HN1A 1F5WA 5HHPB 3MTRA 4F80A 3QDJA 1RY7B 1UH2A 4KUZH 1QFWL 3U4EB 1U3HA 5HGAB 4GG6A 3BEWA 4HS6A 3D39E 1ZK9A 2AJVH 2Z31C 5I1LA 4GG6F 12E8H 4TVPH 3CJJA 3C2SA 3W0WD 5KSBA 1CGTA 4Y19D 4TULH 2VDLH 4YNYA 1UCBH 5KSBF 3AMKA 3VGAC 3I50H 2DQIL 5FYKE 3P4LA 1UVQA 32C2A 4OD1H 2H26A 5E8PA 3MNZA 4IBLT 4U6HB 1NC4B 1AQKL 2XZAL 3DIFB 5D1XB 3GJFB 1IL1B 1ZT7A 4JRXD 4UZGA 5CEXA 5AG9A 4CVWA 3Q1SH 4HKJB 1PVHA 3UEZA 5L8JB 2DTSA 3FB6B 4PPTA 1B9ZA 4M48L 5EBMA 4F7EA 4GAJL 4P99A 3MROB 2D7QA 4OSUH 4W68A 4RZCA 5HHQA 4OCMC 2BCKB 1RJLB 2YRZA 2FSEB 4PJFA 1KTLA 5HDLA 1KJ2L 4LSTH 3Q6FB 4JGMA 1X5HA 4PJFF 3MLVL 1F97A 4POZD 3CX2A 4J8RB 3IJYB 3F58H 5HHXH 4RFNC 1I3RB 1UM6L 4GXUN 1KN4L 4R4FL 4KVCH 4YJZL 4PJGE 4C55A 4U2ZA 4QTHB 3EKCA 1HYSD 4GKOA 5K9KA 1IBGL 3IYLW 2E8YA 2W91A 1W8OA 3WUWA 1MSPA 1WVZA 4F9PA 3K46A 2CR6A 3HA0A 4LCWB 3T1FB 5FAAA 5FHAH 3C5ZA 2HVKB 2BDNH 3VXPA 1BHGA 4NHUB 4P49A 2EDNA 2FJGA 1BVLA 2VDOH 4TNWK 1R5WB 5E5MB 5TE6L 1JTPA 5TGBA 3BXNB 5FA4B 1U8PA 1S9YA 4NO0D 3HRZB 1RZ7L 2ZKHL 5SWSA 5IMKB 3CFDA 2L7JA 1F4WH 3RZCB 3MYJB 5FKAA 3H7BB 4R26H 1A7PL 1R5VA 3EYQC 3OWEA 5DWUH 3IDXL 4R97B 4X5XB 4G6AC 4YK4B 3MJ9H 4HF5L 5ECJE 2DICA 5EPMB 1VADA 3BKJH 5JW4R 4WWKA 3GNMH 3BO8B 1LO4H 1T66D 2FR4A 3VFPA 1ZLWK 3GRWA 1OTSC 4D3CL 1A3RH 1V5JA 3QXAB 5C1MB 5CBAB 3STZB 2IBBA 4GQ9H 3MV9B 3ZTNH 4P2OA 5E4EB 2NXYB 5KS9A 1MUJA 3V8CA 3W9EB 4MXWH 1V7NL 4M7KL 4Y89A 1EAPB 1NEZB 1I75A 4NZTH 3RNKB 3FT2B 3JWDH 1U8MB 1VB9A 2MMXA 3BEVB 4JAMB 4XAWH 1X4YA 2X1OA 2BOCB 4XMPH 3C6LA 1UJ3B 2VERN 3EBAA 4L8CA 3JWNC 3KGRA 1DE4A 5K9QI 1M7IA 3E2HC 3HRPA 3FQRB 1BZ9B 4GRMA 1NCWH 3TZVD 2YPVL 5I1GH 3QEUA 1BWWA 3UO1H 4CJ0A 4V1DA 5TJWK 2YC1A 4IDJH 1D5XA 5I0DA 2EYRB 3G5YB 4NYLA 1FL6A 3I2CL 1KPVB 4KTDH 3O4LE 2KPNA 3CX5J 4H0GA 2RCSH 4U1LA 1YDPA 15C8L 1DDHB 3V7MA 3B9VA 4RA3A 1HDMB 4XXDB 3G5XA 2FECI 2WWMD 4PRIE 4R4ND 5FYKH 2PUQT 2PW2B 3DUSA 3CU1A 3QUKA 2VDKL 4C56B 5EC2B 4KTEL 1WQVT 3QIBA 4ISVA 1Y0LA 1JGVH 3F7PC 1T3FB 2YD9A 3CLFH 1F00I 1F13A 1R24A 2HJKB 3LN5B 1FYTB 3SKJL 1IAIH 1HYRC 2C3WA 3NPSC 3E6FB 5K59F 2AERT 4LPUA 2PTVA 1G7QA 3E1F1 2QSCL 4BFBD 4MJ6A 5BV7H 2AXFB 1C08B 3NVQA 1BVKA 1ND0B 1DN2A 5HYJB 3VFWB 1YNTB 5F1SA 2D4DA 5EU7C 3VG9C 5F9DC 4G9FA 3RL2A 1RUAL 3QJHA 1FNSH 4QRRA 4NO2B 2EDKA 4DGYH 1OCWL 4UIMA 5I8EB 2I5YH 2JJTA 5D9SA 3T0AA 2DQUH 1XF2A 5ANMA 5EORH 5D8JH 3BPCB 3TO2A 3QUXB 4NN7C 3GKZA 2HTKC 5C70A 5D7KE 3WFHA 3QZWA 3LIZH 3W0WA 4FQJL 3O3BB 4O51A 4WUUD 5JOPE 4JDTH 4HFUH 4JHBA 4TSAH 2VITB 1N59A 3BSZL 3U4BH 1SJVA 2Z92A 3WNOA 3T4AB 2BNQD 1DSFH 5JMRA 1Y6MR 1KENH 4D0BB 3SGEI 1DQJA 3G6JA 4Y16B 1KIRB 4NCC1 4JGJA 3HR5B 3G6JF 2GSIA 2VDMH 5CIPH 4C54A 1YNKH 4WI2A 1RJYA 5AG8A 4I18A 4X98B 3U7YL 1EZVY 1JRHI 3O2DL 3VI3E 4OIBA 5IGXH 5E8DH 4S1DD 3OKLA 4EOWL 3T2NL 3BE1H 3CLEL 3GSNH 5GS0D 4PJ8D 1IGTA 2GIYA 1MHHB 2H3NB 1SYVA 3MUHL 1JZ4A 5EA0H 3VFNA 1B2WL 4UIKL 5T3XE 3P11H 1OAZH 4I3SL 3QRFM 3PWVA 4PTTA 4Q2ZB 5C09B 2VKXA 3ULUL 3RKDC 1DLHA 5JQ6H 3AAZB 3PV6B 4M7JL 3C2AL 2R9HC 3S88L 4QXTA 3LAFA 3PE9A 5E5RB 4U6VL 1K5NB 2VABA 2GY7B 1NLDL 1NDGB 1CBVL 4H1LG 1V3LA 3E6HB 1NAKH 3EO0B 3QXVA 4ZDHB 1FHGA 1F58L 2Q86A 4Y5VA 1U3HC 2WBJB 3NCEB 5KSVA 2C1OA 3PWPE 1WZ1H 5D72H 2Y06L 1RVFH 3SDCB 1CD8A 3IFPB 5E00B 1RZ8B 2YD3A 2PKDA 3DWTA 1WFNA 1KPRA 3D2UD 1U41A 1BX2A 4NO0A 1NBQA 4OZFA 4BQ6A 5HYSB 4TUJB 1DN0B 5J89A 5E70A 4YQXL 4PP2A 1MEXL 3EHBC 4C4KT 2C4FU 4MLIA 4OLZH 3QO0B 1MFBL 3ARYA 3QUZA 1BEYH 1EEZA 2F58H 3AS3A 5HGHB 1GC1L 1UADC 2OQJA 3EDEA 3MV11 1UWGL 4XGZB 4K3EL 4ODVH 5FO7B 3KPMA 4OQTA 3RWCB 3DX6B 3LQZB 5JPMB 1SJHA 3F5WB 5LG1A 5E2JA 4DN3L 5J56B 4Z8FL 4YC2C 1H9VA 3WNMA 4KAQH 5J9PB 1HZHL 3QQNA 5CP7A 3B3IB 2HRLA 4GQPH 3KYKH 4HX1A 5D96C 5I1CH 1FCGA 4NO3B 1I1AB 4LVNB 3P0VL 1CDYA 2FZ3B 4QGYA 2Y1VA 3QQ3A 1RI8A 4YDLB 3UC0H 3VXSD 4WU7A 3T04D 2YN3A 4JZOA 4XNMA 4OFYD 2NY4C 1B4JH 3VXMB 1VENA 4NZRH 2VE6B 4QRQB 1UGNA 1S7QB 4JKMA 5LGKA 4GLRI 1D5IL 5TDOB 1I3VA 5J06A 4X6FA 1OLLA 3C5ZC 3KJ4C 4HZLA 1S5IH 3U7WH 1TZIB 2G5BB 2NY5L 4LVEA 3GSOA 4EKXA 2HKHL 4JFPA 3EGSB 3RX8A 2D7OA 5C07B 5HGBA 1NGWB 1XGQB 1KEGL 4ZOCA 4P9HH 4NZUL 3PWLB 5L9DH 4NZDA 5L0QC 1KXVC 5F9OH 3D0VA 2Y6SD 3P9MA 4PJ7B 2DKUA 2ZOLB 3NACH 3SDYH 5GJTL 2BC4A 4F33B 1EUTA 4QT5B 3O3UN 1CDUA 3BAEH 4LLAA 2GJ6B 4JFZL 1A6PA 4LDLB 1FNGA 4P2OC 5L2KA 4YZFF 3NCFB 3ARGD 2OX5A 4LCWE 3RWDB 1YMMB 4ZS6D 5T3XH 1UM5H 1NAML 1U58A 2XACC 3R1GH 1FH5H 4IMLA 2VDRL 1QVOA 4PJ5A 2YSSA 1OLZA 1C1EL 3C6LC 4I5BA 1S9KC 4HGKC 1SBBA 1OSZA 4ESKA 1Y18A 1WWCA 3BP7B 3DJ9A 4XCYB 1WT5A 1J0YA 1AR1D 1EXUB 3EOAB 5HYQB 1YYLL 1NGPL 4MJIB 2LAAA 4WUUA 5GGVY 2VDQH 1U8OA 3T0EB 3CCHA 3X17A 2DDQH 1T1YB 4NNYA 3CVIH 3FT3B 4GMTL 1X7QA 4NQVB 4Q9BA 3AC0A 3ROOA 4I8DA 2ITCA 4M4RA 4LOUD 3BWUC 5BO1H 3GO1L 1WCQA 1E6OH 3KJ6L 3MV9E 1EDQA 1M7DA 1RJZA 1SEQH 3HE7D 2XTJB 5GS1A 3GFUA 1BECA 4OM0L 4YBQC 2FBJL 3H42H 2OR7A 2QV2A 3EJZD 3VD4A 3C09C 4N1EA 3OF6A 2XI9A 5CBEB 1GXEA 3KYMB 2EIZB 4JY4A 4LFHD 4F37F 3HNSL 1IGCL 3W39A 4B50A 3IFOB 1DTUA 4GSDH 3GM8A 4ZD3L 2WM0A 1GOGA 1LK3H 3EFFA 3EYSH 4LPVA 1OGAD 4KJYB 3FFCD 2NY3C 3OAZK 1QFWI 3SE8H 4J3SA 1FVDB 1B3JA 5BOPA 2HVJB 1AXIB 3TPUB 4OD3H 1BGXH 2YBRB 2X05A 2M8XA 2OM5A 2Y5EA 4Z7UB 2I25N 4OLUL 5CZKA 3E8UL 5B38A 3MCG1 3TP4A 4I0PA 1QRNA 5EC1A 3MV7B 4I4WB 3U0TA 1UH4A 2FATH 1MCPH 1ZA3A 3JZ7A 4C56E 4LSDA 1YEGH 4HV8B 1TPXB 2YUVA 1IC7L 3HHRB 3O3DB 4ZO7A 4G6ML 1NGZB 4QGTA 1T5WA 5C9JB 1FYTE 3SHSA 3FTGA 5B39G 3U83A 4PUBL 3VXQA 3FONA 3UTPE 1EJOL 1II4E 5TQ2L 4DAGL 3QQ9D 4KGLA 2NW2A 4U4BA 3ULUD 2XYCA 3BMVA 5HYJE 3NFPB 4DZ8A 3WIIL 5DJZA 1S9VB 4HS8L 4N8PA 4JQVC 1AGBB 2CMRH 3QUYD 4LHUD 1MJ7H 4CW1A 4BQBA 2H9GA 2PW1A 4KKNA 4MMXC 2VXSH 1CIDA 4LASL 5IB1A 1P7QB 3U30C 4HJJH 1PLGL 1J1OL 1PYWA 4YX2H 5MEOA 2CO6B 1A6TA 4Z0XB 2VDNH 4UB0H 1JNNL 1K4CA 4POZC 1F4YL 1DVFB 1MWAB 1UM4H 3HNTH 5DJXB 2JTDA 3LN4A 2X70B 3D1MC 1UB5A 1QHOA 5M7QA 1DBMH 1C5DA 4X7FC 8FABA 3DO7A 4CGTA 1BBJA 5GRWA 4UOJA 1ZGLB 1SY6A 5HDBE 1HYSC 3C5SA 3L3OB 3WKMH 5DMYA 3DURA 3BPNB 3OKMB 1FNEA 5IKCA 1QOKA 3O45B 4M5ZL 4Y5VC 3SGKC 4MD4A 3P73B 3NIGF 3DRQA 5ESVA 1HQ4B 3P4MB 5DMJB 1RUQH 2NY6C 1Q94A 4ODSL 1WFTA 4KDTA 1GZQA 4PRBB 1R3IL 1N64L 3NZHL 4KHXL 5F21B 4DK3A 2A2QT 5C0BA 4LPTA 3VXTA 5H2BA 3GMPB 1R0AL 3KPPA 2B1HH 4Z7WA 4H1LB 4QHUB 1FSKC 4PRPD 2ATKA 2HFTA 1VPOL 4Z7WF 2CKBL 3UTTD 3WSQL 5IB2B 2YPLB 3L3JA 5C09E 2VZUA 1CQKA 1LE9A 4HFWB 3KWWA 4LPWA 2BXZA 2BVPA 4K3DL 5FUOL 3WIHL 5CMAB 1T66C 3DX9B 2XPGB 1DUYA 3RL1A 5DD0L 3NA9L 1MI5D 2I07A 5MHSE 5GRVL 4X9IA 3KPSA 4Y5XB 4UNUA 4ELKA 5IHZB 1RIUH 2X4TA 4HHAA 1NFDA 2DQCH 5C71A 1J11A 5BW7C 5J7CC 4OGAD 1NFDF 2DYPA 4PFEA 3IVKB 3HI5L 3VA6A 2ADJB 2YD6A 3O41A 3H0TA 1H5BC 3UTZA 3IFLL 3BQUD 2HG5B 1JWSA 1IGYA 1QBML 1BM3H 2OK0L 1BIIA 4CUCA 2CK0L 3ZDXE 3ARZA 3UYRH 5F7HA 4OLYH 3TZVC 1W2KT 2ZP0T 2CK2A 1KIUA 4LLUB 3U0WH 1S7WB 1KB9J 3KLAA 1RMFH 5KSAD 5JNYB 1BIHA 4QCIB 4E42A 2W60B 3DI3B 2YD1A 3MRHA 5JDJA 1TETH 5FYJE 3PNWA 3X3FH 3L7EB 4H8WL 5IB4B 4RGOL 4NRYA 2RFXA 3MRKB 5TQ0L 2ZCLL 1IC5L 3HC4L 3RBGA 2HJFB 2R0ZL 3TH3T 4FABH 3ARTA 3LEVL 1N0LA 1JYWA 5D7JA 2WWMC 4ONHB 2WUBL 1HNFA 2B8OT 2OCFD 1JN6B 1NCCL 4TUOA 5AYQA 3G6AB 4NKOA 3KYNB 4LL9A 1IM9A 5I19H 5I66B 1N2RB 5AUMA 3VXNB 1EFQA 3U9UA 1FGVL 1H3GA 3OKKB 4M8QB 3HKFA 4FQIH 5CLTA 4AJ0A 3VXME 2FHFA 3FCTB 2BXYA 4P3CH 2Q76A 2J4WL 3L5XH 1LK2A 4EJ1C 2VUOA 1EH9A 4J4PD 4MDIA 3W2DL 5JA8B 4D94A 1QFWM 1OHQA 2D9QB 2DQJL 3BDYH 3GSXB 4ORZC 2XWTA 4YHMH 4YDIL 4EBQH 3QDME 4I77L 4K3JL 2UZYB 4HUVB 2F74A 1R3KA 4AEHL 4XNYH 5C07E 1WT5C 1DL7L 5CIPA 4HKBB 5JPNB 1XCQA 4LVOC 4AG4L 5IOPA 4UQ3A 3HZYA 4JY6B 5DRZA 1I3GH 4N0UA 3O81A 2NY2B 3KYOB 1YUHA 2EEDA 2WIMA 2BOBB 4JQXA 4PJ7E 3AREB 1NGQL 2B5IC 3MA7A 4DUXA 2KZ1B 5C3LD 3OGCB 3V5KB 3O3EA 1HILB 1U0QA 2IPKB 3EYFB 1JPFB 5ICYB 3CU7A 3BZ4A 1IGFH 4DW2H 2GJ6E 4NM8H 2PO6A 3C6SB 4AENB 4JPWH 2VZ3A 4HJ0D 4N90D 4PIRF 3ULUF 3TV3H 1MJUL 5CZVL 1D6VL 1TVBB 1QZ1A 4YHZL 4LHUA 4S1DC 2Z91B 4M5YL 1YMME 3MRDA 4O2CB 5FCUL 1AJ7L 3FOLB 5ELIA 1XCTA 2AJXL 2BVTA 4M02A 5ESQA 3BI9X 5GS0C 4PJ8C 2HMID 1MFCL 3RQ3A 4RMQA 4KFZC 1KIPA 5T1DH 3C08H 4IMKA 5KW9L 4MJIE 1CFVL 4I3GA 2QBWA 2FDBP 1C16B 1RD6A 4JRYD 3T0EE 5MI0C 4MQSB 2OP4H 4M6AA 1FGNL 1T04A 3FHQA 1KCKA 1VFAA 3MBXL 3GMMB 2IWGA 4MCZB 1A4KA 3OKNB 1T7VA 4TVSa 4XVJH 4KMTL 5CKAA 4Q6IA 2E7BA 3O4LA 2P5WD 3WE6B 2ZSWB 2X10A 4OM1L 2XTJE 2G60H 1QEWA 1A7RL 1NSNH 3QHZH 3FO0L 3SE9H 5I75B 4YO0B 3UBXA 5IMLA 4Y4HD 2BVQA 3UPCA 4RAUB 5FO9B 2QSTA 3BH9A 4OCRL 3G5VB 4NKDA 2BHUA 5AZEL 5MERA 5IR1A 1D6EB 3PG2A 3BPLB 4PRIA 3S98A 5DFVD 3PV7A 1NFIB 2R69H 4RMVA 3FO1B 3CAFA 4PRPA 5FYJH 4YPJA 3DHJA 2Q6WA 3KYAA 4Y2DB 4TPRL 5DEFA 5FYLL 1NCBH 4MD5B 4OD2A 4Q6YA 5DHVH 3LEYH 1QQDB 1U36A 1DQDL 1I85C 2H6PB 3BRGC 1MRDL 3Q6GL 3L3DB 3MOAH 1HQRB 3VRIA 4Z78B 2R23B 1QO3B 5JA9A 5DD6A 4Z7UE 1MI5A 2P8PB 1ZTXH 2HJLA 5FEBA 3MODH 4UDUA 5F6HJ 4BA8A 5EZLA 5C08B 4AIZB 1T0NB 4YHYC 3DBXA 4JO4H 5B39B 1A7OL 1JGUL 4DKEH 5C7XL 2Z93B 2QR0A 3MV7E 1G7LB 4JG1H 5KBNC 1QFUL 5HGDA 2VJXA 4WI5A 1LEGA 4KQ4L 4NCC2 4HKXA 4WI3A 4WWID 4R3SB 5FECB 5JORB 2A77H 1FE8L 1IGIL 1OQOA 4J23A 4ZTPH 1BZ7B 4JANB 5I30L 3UPAA 3I6LD 5K9OB 1RZGA 1YJDH 3FQUA 3UMTA 1WIUA 2LFGA 1NBVH 1OD7A 3ARBD 5E8OB 4N5ED 3QWOB 3D87B 3ECBA 1I9RL 3ZO0A 3AB0C 4BELD 4CMMA 4PRDA 1I7UA 3FO9A 4NNXA 4K71C 4WI8A 2G9HB 3VFTA 3VFUB 1E27B 4KVNH 3WO4B 1INDL 1C5BH 4M4PA 4UQ2A 4PBXA 2KH2B 1YEFL 1MY7A 1J0JA 3TC9A 4DEPC 3IDMB 3VI3F 3L7FA 3NFNB 5DZNA 3KPOA 4CVZB 2J2ZA 4MS8D 3SN6N 3K3QA 1PDKA 3WV0A 4C4KO 4ZXBD 5I8CB 2Y6SC 5I9QB 3DVNB 4EEEA 4X7TB 3U6RA 4G6KL 4ZUUB 2F53B 1BFVH 4G80B 5F6HI 2EO9A 3UX9B 1KTDB 5CJOH 3S4SG 1HH9A 3R4DA 2MJWA 2GAZB 4OZHB 5A2IH 3MREA 5C0IB 5BVJA 1YYMH 4RGMB 3ARGC 4HIXH 3SJVB 1LGVA 5F3HB 4OV5A 3IS1X 1AI1H 1KEMH 4ZS6C 3WFBL 2EYTA 2XN9B 4QY8B 5FUZH 1LE5A 3EYOB 3ZE2F 4Z77B 1FV1B 5AYUH 3GSVA 1HXMB 3QXDB 1FP5A 1A6AA 2C3VA 3OAUH 1AR1C 3RGVA 4P4KB 5GIRB 5HGGS 2KQNA 2AXGB 1MCEA 3OSKA 2N56A 43C9B 1FL3A 5ALBL 3HI1B 4EZMA 2YPLE 3EDKA 3L3KB 1OVZA 4JN1H 5C0GA 5J1SC 3RKPA 3VMPA 4LDOB 35C8H 5E2TL 3T65A 4LPYA 1UKSA 4KRPD 4DGVH 1MH5A 3G04A 5J11C 1MIEL 1Z2KA 3QNZB 4NN6C 3HS0B 5BMFH 1CFSA 2UWEB 5D7IF 4MNHA 4EUPG 4LOUC 3QAZC 1D5ZA 1NL0L 4Q9RH 3HN3A 2LU7A 4BFIA 2YKLL 2XWJB 2W92A 3HE7C 1WTLA 5FM5M 4WY7L 1J0KA 2DLTA 2EE9A 1EHLH 2X1QA 1XIWB 1BAFL 3EJZC 1FZJB 4MYWB 4OFIA 3KPRB 2DF3A 1IAKB 4EN3B 4JLRB 4HQQH 4X4ZA 1FC1A 2ZG1A 3QEHB 5CJBA 1E4KC 1LO0H 2W9DL 2ZZUT 3NABH 2BNRD 1FVCB 3WN5C 3BWAB 1TITA 3VXUD 12E8L 4TVPL 3O9WB 4BKLA 2FL5B 2H45A 4XP5H 1NC4A 1CLOH 3DIFA 5D1XA 3I50L 3GJFA 5DJ2B 2HH0L 2D03H 1JHLH 2V9RA 3ALPA 1RK0B 4OD1L 4HKJA 4KI5D 1NUNB 3DGGB 4KROB 3X11A 3FB6A 4FRWA 1JGEB 2RJMA 5HY9A 3WD5H 2CRZA 3AY4A 3RWIB 3MROA 3Q5YA 4ODHL 1RJLA 1XEDA 5CP3A 3Q6FA 4HCRH 1U3ZA 4HT1H 4J8RA 1KV3A 1KLGB 5IQ7H 3IJYA 4FNLL 3LSOB 3HE6B 2YK1L 1I3RA 5DHXB 3QQ9C 4U1KB 2BVOA 4YLQT 3ULUC 3NAAL 5SV3A 2UYLB 1I1YA 4XH2B 3F58L 2XKSA 1IEAA 2VLRD 3GHBL 5F7KC 4OV6F 1EFXD 3QUYC 2ID5A 3S7GA 4LNRA 3PWJB 4EI5B 5FF6B 1MWAH 4HJGB 4X80H 4LCWA 4OCYH 4L3AA 1ZHKB 1NANI 2VQUA 3D6GA 1DANT 2NY1B 2OTUA 1X5ZA 1R5WA 4KHTH 3BXNA 1W72B 5FA4A 4TNVF 5FHAL 1TLKA 3EOBA 3U0PA 1JUFA 4W6WB 2OMBA 3EOTL 5IMKA 4D9QD 4XCCL 2J12B 1DBJH 3JSSA 2UUDH 4KH2A 4Z6AT 1D7FA 3RZCA 3QUMB 3HI6H 3H7BA 1MCFA 3TYGL 4YHOH 5CEZL 3ZDYE 4NUGL 3LKRB 1YEKL 1X3DA 5FYLD 1JZ8A 3F7VA 4JZJC 1MFAL 1GC1C 4JCLA 1J0IA 3WUZA 3BO8A 3UTQB 5IFJB 4PD4J 4GG8B 3JV5A 1TCMA 4XZUB 1RUPL 3QXAA 4OUOA 4FQQB 3RVTD 4ZFFB 1O5DT 3ZE1F 5I15L 1N3NB 2MHAB 5I1AB 3PHOB 4Q74A 4MQ7A 3RNKA 3IJSB 3FT2A 1U8MA 1JNHA 3RNQB 1NEUA 2IBGA 3BEVA 4JAMA 3KHQA 4L5FH 4N9OB 1MCKA 2CD0A 3FQXB 3JWDL 4K7PH 1Q1JH 3FQRA 5IG7A 1BZ9A 1A02N 4XAWL 3L5HA 4GO6B 4G5ZH 4TUKL 1XFPA 4MZ3A 4QHKJ 4Y4FB 5KN5B 1S7VB 4DOHB 5BRZD 5C9KA 3PABB 5SX5K 5IM7B 1MCRA 5K93A 4RBPH 4ONFL 4TRPL 1NCWL 3CFKB 1P4LB 3O6MH 5IBLD 2EYRA 4GRWH 3G5YA 4RGND 2OZ4H 3ILPB 2APFA 2VR4A 4FQXB 4UINL 5DJDB 4JG0H 4PTUA 4HBCL 3I6GB 3ES6B 4OGAC 2EYSB 1HNGA 3RY5A 5LXGH 4XMLH 1SYSA 4D8PA 1HDMA 2NY5C 3BQUC 4PJEB 4XXDA 3CFEB 2OTWA 2RCSL 3VWKD 1XH3B 2PW2A 4AMKH 1JE6A 1IGJB 4Y88A 1WIPA 4WU5B 1I8KB 2EDYA 1T3FA 2NYYD 5KSAC 3LN5A 1FYTA 5DJ8B 3WDIA 2ED7A 2Y72A 3E6FA 5HYIA 4X0KB 2F5AH 1QBLL 2AXFA 3MNWB 4KU1A 1OP9A 4AL8H 5HJ3B 1ND0A 5FYKU 2VISB 1IAIL 1KBGH 2DQTL 5HYJA 3VFWA 2FYYB 1YNTA 3EIFA 3MFGB 2VAJA 3UROR 9CGTA 3CZJA 5C08E 1MQKL 1CL7H 5BV7L 4PREB 2VZSA 5I8EA 1L6XA 3LRSB 4WJ5B 3RVWD 4BSWB 1U6AH 2C3GA 3B2VL 4P2YA 4ZUSB 3IU4H 4OTXH 4OAWA 1TQCB 4PJXB 2AGJH 3BPCA 4XHJD 3GBLA 5EO9A 4CL7A 5JW4Q 1G7PA 4N9GA 3GI9H 3G6DH 1HSAA 5DK0B 4FQ2H 3O3BA 1CD9B 1LDPL 5B21A 3WXWH 4M03A 4OGZA 1L0XA 1ZE3C 4OQ1A 4J7RA 2ZNXA 1A6UH 1UEMA 3WJJA 1BOYA 4PGBB 1G7MA 3BGMB 4J4PC 4D0BA 4UOW0 4Y16A 5KVEL 3RBSA 1KB9K 3S35H 2A0LD 3U4BL 3V4PL 1TZGH 2Z31B 5GHWH 3QRGH 4KI5F 1QLEH 1MCSA 3PQYB 2BVUA 1AGEB 3S4SB 1P2CB 2A6IB 1MHHA 4IRJD 3VGAB 2H3NA 3A67L 4W6YB 3BE1L 1MPAH 2XG4A 2DN7A 5F96L 4QOKD 1QSFD 2F53E 4LVHC 2BSTB 4CKVX 2EDTA 5FO8B 4Q2ZA 5C09A 2CRMA 1XR9A 4N0CD 5CAYB 1U91A 3AAZA 3PV6A 2DQHH 5DO2D 3DYMA 4N0RA 3VGDA 2W0LA 1OAZL 4TVPD 4OZHE 3TH2T 1A1NA 1G6VK 1A6VH 4HJ0C 4PRAB 3HPJB 2VLRA 3P0YH 1K5NA 4YBLC 1URLA 5JHDD 1EFXA 3TJHD 4JQIH 3SJVE 5ACZA 2XN9E 3E6HA 3EO0A 4ZDHA 2V9QA 2BSED 4NQTA 4NHCH 5T1LB 2HMIC 1UC6A 4K7PX 5IROC 2F19H 1A7NL 2A6JB 3O0RL 5D2LA 5L7XL 5DHYB 3SDCA 1OQXA 1NAKL 3IFPA 5E00A 1RZ8A 1NFKA 4EUPB 4QTIH 5D2LF 5IUSA 4GBXD 3IXTB 4HPOH 4RFNB 4DN4L 1NGYA 5FGBC 5CD3A 5D72L 4WFEE 1RVFL 5IEKB 5TF1H 1EPFA 2QQNH 3QPXL 4NKMB 2H2PD 4TUJA 1DN0A 5HYSA 1B6DA 1YN7B 3MRBB 3ZDXF 1DCLA 4BQCA 1Z5LA 1KCRH 3MR9B 3O2VL 4WCYL 4HAGA 2FCBA 1QKZL 4ZOAA 2HT4D 5HGHA 2X4NB 2UWEE 3AU1B 1IGMH 3K1DA 2I26N 4JPVL 4QNPF 4XGZA 2FD6L 4JY5H 5F9WC 2F58L 3RWCA 3S3SA 4L3CB 3K80A 3DX6A 4JM4H 3LQZA 4MA8L 3ZKQD 4Y4HC 3F5WA 3KPRE 4BUGA 5BZDA 1GPOH 1TIUA 5EO0B 3TA3D 3G5ZB 3HCVA 5SX4H 2ENSA 1G1YA 3JV4B 5DFVC 2APWA 1I1AA 5IK3A 4YXKL 4F8QA 3H7LA 3ZYJA 3QB7C 3KYKL 3L95A 1OM3H 1CWVA 5K9QG 2FZ3A 4ONOA 1A3LL 5E8NB 2PXYD 2QLVB 3T0XA 2AI0L 4FP8H 3VXMA 4ZPTB 5IMMA 5CEZD 3CSYB 3UC0L 1FO0H 3MRFB 4QRQA 5AD0B 2WK2A 1S7QA 5EU3B 3WXVH 4UMGA 1RSFA 3SE4A 4NZRL 3HNVL 1I7ZA 1Q9OB 1TZIA 5A2LH 2G5BA 5CGTA 5EZIH 1DQTA 3RHWF 3T4YA 3TBTB 3E2HB 3OKEB 4OI9A 2GW5A 2AABL 3EGSA 4F3FB 1NGWA 4PJCB 2VLJB 2XKNB 4U49A 1XGQA 1P84J 5E2VH 4BSVA 1WUNT 5H94B 1YMHB 2XY2A 4XAKE 4F7TB 3ARBC 3PWNB 4LLWB 4N5EC 5E8EA 4P9HL 4F33A 3GBNH 4HIIB 4ODWB 4QT5A 1YY9D 1YQVL 4ZUWA 1H3PH 3MOBH 2UY7A 2GJ6A 2XZCH 2RIKA 3FQWB 2QADD 1RIVL 4MJ5B 4PV9B 2A74B 5AAWA 1VEPA 3RWDA 3BAEL 4PRNB 1YMMA 1EO8H 4NQEB 1GL4B 3BW9A 5BCAA 2FEDD 4MS8C 3LKPB 5CCKH 4F7PA 1V3KA 4FQCH 4ZXBC 2FH6A 3BP7A 3DYOA 3NPSB 2F54B 1UM5L 4XCYA 5E56A 1FH5L 1P69B 3SDDD 1PSKH 4MJIA 1XR8B 5GS2H 5DVOA 4R0LA 1CD0A 3CMGA 5JLZB 4D9LH 5A3ID 3VG9B 3T0EA 1PX3A 1VACB 1G7JB 3OZ9H 1A22B 1S7TB 3FT3A 1XGRB 4BZ1H 1N7MH 2XQYK 2B1AL 2E9BA 1IT9H 1JGLH 1YECH 2AXHA 2WNGA 3L3IA 4K3GA 3K8LA 3CVIL 1N8ZB 3M45A 3C87A 4H8WC 2ITDB 1H0DB 4NN7B 5C6TL 1Z9SA 3RA7L 3UYPA 4FXKA 3DV4B 2IQ9H 1XGYH 4X4ME 4ZUTA 3OMZA 5BO1L 2AK4D 5CBEA 2EIZA 4JR9H 3GMQA 4OB5L 3PGDB 4IRJA 3IFOA 3F7YA 1L7IL 1A0QL 3JTTA 4GW5B 1MHEA 2Z8RA 4KJYA 3JWOL 5FA3A 1LEIB 2MKLC 1INEH 4ZFGL 5ID0B 3MV8B 4F9LA 3R06B 1BD2D 2GKIA 5IJVB 4KRPC 2JELL 5I18H 1LK3L 4DOHE 4LGSB 1VERA 5I1EL 4PJAB 1AO7B 3EO9H 3ARVA 2APXA 3C8DA 2ICWB 3IDNB 4H0HB 3CK0H 4D0DA 1ETZB 4J1UB 3KHOA 4Z7UA 5JHDA 3MJ7B 4HKZA 4YHKH 3GK8H 4S1SH 2O5ZH 1KPUA 1CD1B 1EHXA 2QHRL 2FO1A 2YN5A 4M7LT 4PJEE 1S7UA 3MJ8B 3MV7A 4I4WA 3KAAA 5JR1L 1CGWA 4C57C 5CWSB 4GBXA 1JFQH 1A21A 4CVXA 4HV8A 4IRZH 5ICZB 2FX9L 4NQDB 2FATL 1MCPL 1NGZA 3B9KD 3VA2C 5C9JA 2OR9L 4NP4H 1A6ZB 4OZFG 1DQML 2NNAA 3VCLB 2IALB 5F9JB 4HEME 2FX8H 5I1IL 2VH5L 1FFOA 1GVIA 4B7LA 1U3HB 4HCRA 4GG6B 3M1BA 4G8GB 3NFPA 3HZMB 1S9VA 4KI5C 5I1LB 1ADQH 1Z9LA 1OAXH 2HLFD 2CGRH 2R4RL 2NPLX 3EOYG 4O5LL 3I3DA 4WO4D 1FCCA 5KSBB 4YNYB 5FDYA 3F12B 7FABL 3PDOB 4AQ1B 4PJXE 5GGSY 3TA3A 1EX0A 5KVGL 3MCLH 1UVQB 4Z0XA 2Z9TA 3WS3A 2BRQA 3DECA 2W65B 1DVFA 3GI8H 1JNLH 1YPZA 4LAQL 2X70A 2FHCA 3CVHB 1NCDH 4JFQA 5CEXB 3GHEH 1YPZF 1MIMH 1U3JA 2YEZA 4UB0L 3J7HA 5A1AA 3S36X 2DKSA 3ZL4L 4F7EB 5KAQF 1ZGLA 2IH3A 5KSUB 3ZHDA 4DKDC 1DBML 1UXSB 4LEXH 3L3OA 4YC2B 4RFEB 3OKMA 5EO1A 4GAGL 2GSGB 2GJJA 1W72H 3O45A 1KTLB 5EOQL 4TNVK 5D96B 1HQ4A 3P4MA 1FAKT 4UV7L 1N5YH 3PQYE 6FABH 4XPGL 1DBKH 1VKXB 2P47B 3QUMH 3TJEH 1Q72L 3Q3GB 3RIFF 5HHOD 3ZDZF 3UZQA 3GMPA 4X7EC 2NY4B 4H1LA 3V6BR 1XGUA 4JFFB 4QHUA 3H9SB 5JW5A 1NDMB 1J5OL 5ILTL 1V7MH 2ZCKH 5DD1L 5IB2A 1FIEA 2Q3ZA 1BREA 1T7ZA 4HFWA 2B1HL 5T5FH 1HKLL 1F6AB 2HFEB 3C5ZB 3KJ4B 1PZUB 3N9GH 5CMAA 4HULB 5C0EA 2XPGA 1BVLB 1JF6A 2UVFA 3VXRE 5GRVK 5TGBB 2IBZX 1JHKL 1B0WA 4Y5XA 3K74B 1U8LB 3WJLA 1MREH 5CINH 5MENB 2Q20A 5SWSB 3RVTC 3CFDB 3WFCH 5HPMB 3OG6B 3B9AA 1OPGH 2ZG3A 4XPTH 1TJHH 5L0QB 1BQUA 2OZ4A 5DK3A 4ZYKA 1FIGH 2VOTA 1CXEA 3FOMA 1KCVL 4ONGH 1EGJH 2HG5A 4XHQA 2D7TL 3RP1A 1VADB 4U1GC 1ZLWH 4O4YH 1CK0L 2WSKA 4LIQL 4QRUB 3T08A 5C0CD 2FX7L 2FR4B 3VFPB 3SDDA 4LLUA 1S7WA 1I7TB 3CDFA 5JNYA 3CH1B 4QCIA 4OF6A 3ETBF 3OBAA 3TT1H 4P2OB 5IBLC 1MUJB 4RGNC 5BXFB 3U0WL 3SGJC 4U05A 3NCYS 1OSPH 4K7FB 5ETUB 3L7EA 1KXTB 2VC2L 5IB5B 1FZKB 2YMXH 3IRPX 1RUMH 2PR4H 2APVA 3SKOA 3C6LB 1TETL 1DE4B 1M7IB 3HAEH 2HWZL 1ITBB 3JUZA 4GRMB 3VWKC 1K3ZA 1IAII 1ZWIB 4PD4K 1NBYB 4ONHA 4JO2H 2G2RB 4BK5A 2EH7L 2HKFL 1FG2A 1JN6A 3T09A 2YC1B 4A2LA 4BH7B 3N1QC 3G6AA 3NIDF 2R29L 4FABL 2NYYC 3KYNA 2ZG2A 5GGUB 1FORL 3VXNA 1UKTA 4GAYA 4UV4L 4M8QA 1ZHNB 4WI9A 1YDPB 4U1NB 5A43C 1AXTL 3FCTA 1U95B 4UT9H 4AH2A 4APQD 3CDGA 4OGXL 2G5RA 1OL0A 4NOBA 2WAHA 4FQIL 3C09B 4KUCD 3RVWC 3D9AH 4LDEB 1Y0LB 3L5XL 2IEPA 3HMWH 3ZT5A 3DX8B 3L1OL 1G6RB 1R24B 2CJUH 3SO5A 2NY3B 4HUVA 3ZKSD 3LMJL 4XHJC 3BDYL 5EUOA 4Q9QL 1H3VA 4M7LH 5C0AB 1G7QB 4PJCE 2VLJE 4ACPA 4WFFD 5EUOF 3K4AA 5DRNB 2AEQL 4MJ6B 3NPZB 4XBGB 4PGCA 1BFSA 1BVKB 4JY6A 4WDIB 3V0WL 4XNYL 4R0LC 4L4VE 4GMSL 4NNPH 3AREA 4M6OH 5EBWB 3QJHB 2F8XC 1E4XL 4UIMB 1HILA 2CIIA 2NXZD 2IPKA 3I9GL 3ZDYF 5ICYA 2DLHA 2X6MA 1F4XH 2A0LC 2Z8WC 5ANMB 1F3DH 3TO2B 2C9AA 5DURD 1TVBA 5TE7H 2Z91A 3W0WB 1TVDA 4NQEE 4Y19B 4PJBB 4JPWL 4IRJC 4E41D 1N59B 2Z92B 4UTAH 2CIKA 4OCLC 2F54E 2XV6B 4J3TA 1WITA 3G6JB 4CN1A 1VSCA 1QACA 1K4DB 5EN2B 5IMOB 2GSIB 4JRXB 1CDHA 4N0CC 1TXKA 2C1PA 3JV6A 5DO2C 5EU7E 1X5YA 3FB5A 5T1DL 1ZS8B 4NWUH 1PEZA 2MKWA 1ES0A 3OKLB 4P3DA 3WO3B 3TJHC 3OKNA 3DPBA 1AH1A 3U30B 2YZ1A 2JE8A 3DLQR 3NCCB 1BJ8A 1SYVB 3WE6A 2ZSWA 3WNNA 1U42A 1VHPA 4GRLD 4KK5D 4MA1C 4F57H 2AQ1A 4XVJL 4YO0A 5F72S 3HUJA 3QIWD 4NQXB 1KNOA 3QCTH 4RAUA 4GBXC 5FO9A 4XP1H 5DMIL 1ITCA 2ERJC 5D1QD 3UJJH 3HUJF 1DLHB 5INCA 3O8XD 5I1KH 4Z0BL 3AS1A 1A64A 2R2BB 4QXTB 1D6EA 3SE9L 1SHMA 1TJIH 5HHOA 3GGWB 4M1DH 2H2PC 1NFIA 4RSVA 1MJ8L 4XNZC 4YFLF 5D70L 3FO1A 5D71H 3F7RA 3MV8E 4NGHL 5DQJB 4Z7NE 1CYGA 1ZLUH 3MBED 4Y2DA 5F88A 1K85A 1UFUA 3BUTA 2HT4C 1QQDA 4WRLA 1Y6KR 2Q86B 4PJAE 4Y5VB 1AO7E 5KSVB 4X6CA 2C1OB 3V4UH 3L3DA 1HQRA 4Z78A 2NY6B 2R23A 4X6CF 1BQSA 3LEYL 4JPKH 2P8PA 4H25B 1BX2B 4NO0B 5FYJU 4LSRH 3WLBA 1BPVA 4NM4L 4OZFB 1OB1B 2V5MA 4U0RC 5GGTH 1QTYT 5GRJH 3TA3C 2A6DB 3MRGB 2Z93A 2X4PB 4PP2B 1FSKB 2K7PA 1G7LA 3M8OH 1FLRH 3VW3L 3B8SA 4YHLH 1U92A 4MAYD 2OXGA 4R3SA 4XVTH 5JORA 5KTEH 1HINL 4OCSL 5I8OH 4NQDE 2R0WL 3MCKB 4FFWD 2PXYC 1QNZL 1BZ7A 4JANA 3KPMB 4UTBH 1EBAA 1ZVYA 2AEPL 1MCBA 5K9OA 4F7CB 1KTKE 1T03H 4R96A 5L6YL 4ZTOL 4ZTPL 3IDYC 2VO5A 5ALCH 4GG6E 5DTFA 3RHWK 3IJHA 3AXLA 3MLRL 1H5BB 1GAFH 5KSBE 5DJAB 1BFOB 1S8DB 1YEHH 4MXQD 1OT1A 2H32B 3QQ3B 2NZ9D 3BOVA 3TZVB 3BN9D 1AXSB 1IKNC 4HZAA 3NFNA 5C2BL 3QULB 4JZOB 4XNMB 3NOIA 3KNBA 4CVZA 1GGCL 1S5HB 25C8H 4S1RL 4LFHG 3U1SL 5BQ7B 3M17B 5FCSH 4X7TA 1VFBA 1EAJA 4G3YL 4L4TD 4K3HA 2F53A 4X6FB 1IAIM 3MXWL 4G80A 2VDPL 5HXMA 3CFBA 3F62A 2DM7A 3MLSH 1YY9C 1A5FH 3MJ6A 3SDXF 4YDKH 4OZHA 3WJLC 2CLZA 2QADC 4KXZH 1X44A 5HGBB 5C0IA 2IF7A 5BOZG 1YY8A 3SJVA 4D0CB 4CN4A 1RAMA 4OFPA 2W1NA 2XN9A 3N1MC 3H3BC 4KUCF 2OSLA 2UVEA 5F9AC 3EYOA 4Q9CA 2FEDC 3RTQD 4ORGB 4MZ2A 4QYOA 3TWCH 3D0VB 3QXDA 3TYFA 1AI1L 4NN5C 1A9EB 4XP9L 3S3JA 2BC4B 4NZJA 5TE4H 3P9LB 3LHPL 5GIRA 3SDDC 4JFFE 4QHMB 4JJ5B 2AXGA 3H9SE 3HC0B 43C9A 5ISZD 4NUJB 3HI1A 4RDQF 2HTLD 3L3KA 5INDB 3H3PH 5A3IC 1FNGB 4W6XB 4YGAB 5GRXG 1ZANH 5MEPB 5LVEA 5IHUL 2ZUXA 3WS6A 2WQRA 4M3KB 4XC1H 4IJ3C 4JN1L 4YXHH 1N6QH 3QEQD 43CAB 2YSSB 35C8L 3AROA 3U7AA 4YE4L 4XPBH 2LTQC 1Y18B 2XWJA 2X4OA 5SWSE 1EMTL 5F7MC 1XIWA 4LVOB 5BV7C 5JW4M 3L5WB 1WFUA 4JFHD 5KVFH 4WV1C 4WUUB 4XTRD 4LHUG 2DQEL 1IAKA 4JLRA 1QFPA 1A2YB 4Z18A 3SQBA 1INQB 3CCHB 3QEHA 5DZLA 5T5NG 4DK6A 1LP9A 3DXAD 3O3AB 2B5IB 5IEHB 2DRUA 4NNYB 2IADB 2BNQB 4XBPA 1LP9F 4F58L 1FVCA 1B0RB 2IQAB 4H26B 3CNKA 2EIBA 1T6VN 2C3XA 2XIDA 3QDGD 3RRQA 3LZFH 1D9KD 3RJDA 2J8HA 2DBLL 1LO0L 4N5UA 1RJZB 1KC5H 2R1XA 3NABL 4YHIB 4P23D 5IBTH 4FQ1L 2HRPL 3QNYA 1PX4A 2CDEA 5DJ2A 3QEGL 2CDGB 4PJ8B 4RRPG 2Y23A 3W39B 3OAZH 4U1IB 5GRZA 3EFFB 2OL3L 3ZSTA 4M62L 4U6YB 3T8XA 2WLZA 4EI6B 4L8SC 1JHLL 3RWIA 1WCBB 5FOJA 3FQNA 4RAVA 5D1QA 5LBSH 1T6WA 5MI0B 3WEXB 3B9KC 1LO2H 5I76A 4L1DA 1TVHA 4RA0C 1KLGA 4LLYA 1EBPA 3LSOA 1T1WA 1EIBA 1X5LA 4U1KA 1RURH 1VFOA 4G7YH 1CR9L 2AJ3A 3RWFA 2UYLA 4LSVL 3SCMD 1LO3H 3T0WA 2HLFC 1MNUL 3T0VA 3TBSB 4WO4C 3MGOA 5DD3H 5ESAA 3L3HA 5EWIL 2MFNA 3D2UB 3PWJA 4EI5A 1JYVA 3CVHH 5K59E 1CICD 5FOBA 5TPWL 5ADPH 2DMKA 1KJ2B 3VXQB 1EVUA 5C0AE 3OJDA 5C0FA 2ORBH 5LWYL 2EH8L 8CGTA 2AP2A 3IAQA 3MRNA 2DL2A 1J1PH 3WHXA 2DLEA 2DD8H 2BRRH 3ME0A 3QUMA 2VL4A 4PGEB 2H9GB 5GGRA 3LKRA 1NBZB 4QXGH 5IB1B 1G1CA 3VMOA 4YHYB 3MLWL 1A9BB 4OLXH 5ANME 2DTML 5MEOB 3PP4L 5IFJA 4QRTB 3LKOB 1QP1A 2NTSP 1X6LA 5ITFB 3THMH 3W0WE 1CQYA 5I16B 4Y19E 4PJBE 1A1MA 2VXTH 1UB5B 5E4IA 4ZFFA 4UILL 5IFAL 2V5TA 1N3NA 1OAQL 1NMCC 5I1AA 1KFAH 3VXSB 1BBJB 3IJSA 5IF0A 2ADFL 3RNQA 1CDBA 3H3KA 4KJWD 4OKVB 3UP1A 4KK8D 4XNXL 3RY6A 5FFLA 3G6JE 1ERNA 3HMXL 2X2YA 4FG6D 5IFHL 3DURB 3FQXA 1FNEB 4JRXE 5IKCB 1F4HA 3I3BA 3VJ6A 3OAYK 1OGTA 3AB0B 2A83B 2YD4A 4L5FL 3ULSB 1BF8A 3DRQB 4JKLA 5ESVB 2VQ1A 3V0VA 2PNDA 2E27L 4CU6A 5CJXA 4CNIB 5KN5A 1K6QH 1HIMH 4K71B 1NMBH 1EGJA 3TVMD 1W8NA 1GZQB 4R4BB 3CFKA 1MAML 1P4LA 2IFFH 2J1KA 4G5ZL 2J88H 1D3CA 5I6XC 1QD0A 1E4JA 2DS4A 2JJVA 3ILPA 2O93L 1ACZA 1FBIH 2WV3A 4DEPB 5DT1L 3VGHA 4TOYH 4UNTA 1P6AB 1N5AA 5DJDA 4QF1A 2JB5H 1I9IH 2UV3A 3BISA 4HWBL 1MCCA 3ES6A 3O6ML 1FJ1A 2F15A 3QDMD 1CDIA 5JHLL 4O9HH 3GRWH 3MLZH 3FAWA 4JG0L 4OZ4A 1N6VA 1ZXQA 2XQYG 4LGPB 1XH3A 1U2CA 4PLJD 2BVPB 1PG7H 4P2RD 2AXJA 2OMNA 3MOQA 2VLKD 1IGJA 3KS0J 4WU5A 1GGIL 1I8KA 5F1KC 4LSUL 3OXRA 2HA1A 1ZT1A 5DJ8A 1UWEL 2CLVB 2VXQH 3ARGB 3O6LH 4X0KA 4P9HC 1IKFH 3MNWA 1I8LA 1AFVL 4LSQH 5HJ3A 2VISA 3O41B 1MFNA 2FYYA 3QEQA 3RDTD 2NY7H 3SO3C 1JWSB 1IGYB 1BIIB 1YNLH 4BK4A 4BZ2H 1JWUB 3LRSA 4WJ5A 1LO5A 4BSWA 5TDNA 4GKSB 4ZUSA 2IG2H 5J57B 1AR2A 1CFQB 2UZIH 4G6FD 3DXAA 5HYFA 4HG4K 2FGWH 4S10A 5J11B 1S78D 3PNWB 4PP1D 1MHPH 4NN6B 5DK0A 2AGJL 2FECL 2M1KA 3QAZB 3QDGA 3BVNB 1D9KA 4KK6D 2RFXB 4NRYB 4X5WB 3BRFA 3ARDD 4APQC 3HE7B 4QKXB 1NCTA 4P23A 4PGBA 3FZUD 1ZSDB 2D0FA 3X3GL 1SBSH 3WHE0 1XGTB 4NJ9H 4JO3H 3RIAF 1OWRM 1A6UL 1TZHA 5GGVH 4BM7A 2Z31A 2D9CA 1OGAB 3FFCB 5DR5H 5IW6B 1JI2A 5AUMB 3U9UB 3WN5B 1TZGL 4KKLD 4LLMB 3GJEA 3S4SA 4PG2C 3ZMRA 4RFOH 2A6IA 3AFLA 4OLVL 1QLEL 1Q0XL 1FNHA 5EOTB 4UT7H 4PY8J 5DXWA 2ICEA 4MDIB 2EKSB 3BH8A 3JWOC 2F5BL 5FO8A 3WS6C 5AEAA 1HCFX 2NXZC 1PQZB 3WFEL 4AEIH 1Z0NA 4HK0B 2F74B 3FO2A 3HPJA 3V6FB 4P5KB 2ICCA 2DQHL 5IOPB 4UQ3B 3HZYB 1C8PA 5FIEA 5CGMA 5DRZB 3UYOD 1A6VL 1PGRB 3NFSH 4N0UB 1RHFA 1JRHH 4JQIL 1A1OA 1MOEA 2A6JA 3VFGH 2B0SH 3BIKB 3B9EA 4LSPH 3AS0A 4YFEA 4EUPA 3IXTA 4LCYA 3WFDH 4OCWL 5F44A 1C7SA 5IT2L 4YZFE 4K94L 4JN2A 3QDHA 1YN7A 3MRBA 2EE2A 5JW3H 3RWEB 3MR9A 3QUYB 3BUYA 4LHUB 2X4SB 1X9QA 5ESQB 2X4NA 3O4OC 1DANU 3AU1A 3W5MA 4WUKH 2BERA 4NRXB 3KPNB 4GRLC 4KK5C 4L3CA 5GRUL 1IGML 5J6HB 5EULV 3KLHD 3QIWC 1A6WL 4PY8I 1WBXB 4LRNH 1HHHB 4M43H 4WUUE 5D1QC 1FFNA 1P7QD 3O8XC 3RWHA 5E9DD 5IESH 3GEWB 2V17H 3G5ZA 2VIRB 3O11A 3JV4A 4JKPH 2BNQE 5C0DA 3MRIA 4M1GL 1A4KB 1IRAY 2V7HB 3MBEC 4QHNA 5GGRY 1KOAA 1RIHH 5E03A 5DUBB 5GGTA 4JZJB 1HK6A 2W38A 1WWAX 4PGJA 1G7HB 1YEJL 1KJVB 5KZCD 3TIEA 4X9BA 4OZFH 1OM3L 4ZPTA 3ROLB 3TVMA 5TFSH 3VRLE 4KZDL 1IQWH 1TJGL 2ARJB 2B7DT 3GUTA 3MA9H 3VE0A 4ZS7H 5EU3A 4FP8L 1L7TH 2BVYA 1FO0L 1QSED 5T1MB 1ZEAH 4PRPB 5FDWB 1Q9OA 5H35B 3OKYA 2BVEA 1DFBL 1UA6H 1QYGH 3WXVL 4QHLB 2GHWB 3UTTB 1AC0A 5FK9B 5HI4D 3OKEA 4YBHA 1FDLL 4F3FA 4RWYH 2VLJA 2XKNA 4FFWC 3VRIB 5EZIL 1DEDA 2ZUVA 1N4XH 2N7AA 4P2RA 5DD6B 4MA7H 1NC2D 5H94A 2X9XA 1MI5B 4RWHA 5C6WH 1YMHA 1RUKL 4YXLH 1WIOA 3PWNA 2DIAA 4LLWA 4P46D 5MP6L 1KELL 3CFCH 4GW4B 4JO1L 5LGHH 2A9ML 4HXBH 2H32H 4HIIA 5EFIA 5JDSB 4ODWA 4DUWA 3GIZH 2MPAL 1VFUA 1OARL 3D0LA 5HGDB 1OAKL 1N0XL 1LEGB 3FQWA 1H3TA 4P59H 2EDQA 1OP3H 3BQUB 3GBNL 5F7NC 1BFTA 1VEOA 4MJ5A 4PV9A 4MXQC 1SJEA 4KPHH 3MOBL 5DUMH 5F1NB 5T3ZH 2NZ9C 2V2XB 2XZCL 1U93B 3BN9C 3BKYH 3Q0HA 4NQEA 1ODAA 2VB5A 1RZGB 2PYED 2ICWJ 3FQUB 1CF8H 3ESVF 3LKPA 5KSAB 3S36L 3CIQA 2QQKL 4DTGL 3UPRB 1EO8L 3FMGH 3ECBB 1T2XA 4XT1C 3LKQB 4X99B 4P2QD 5D5MB 4CMMB 4PRDB 5CCKL 3IGAB 4YH6A 4NNXB 3RUGB 4FQCL 4L29B 3T3ME 4ZFZB 4NRZB 3MZTA 1FN4B 5JLZA 4DQOL 3VD5A 2XRAH 4TQEH 3IF1B 5DMGD 1EK3A 1JTOA 1S7TA 4W4OC 1XGRA 2H1PH 5KJRH 1NCAH 1NAMB 3RTQC 5F8QC 5HVWA 1SVZA 1JGLL 2WMPA 3DV4A 4HUNB 4XNUH 3BRDA 5GPRA 4UI2A 3VXSE 3IETB 2AKRA 3S6CA 2E5EA 2J8UB 1G9NL 5TDPA 1HH9B 2Z0BA 4GW5A 4OLWL 2HTLC 1FAIL 3NIGE 4Y8DC 1LEIA 3MREB 3EYUL 3R06A 4YWGH 1GOHA 1WC7B 2EYTB 3SEPA 4PGDA 3DHMA 1UYWH 2DQDL 1I8LC 3A6OA 5T33H 3TT3H 1AO7A 1ZOXA 2RHEA 3GSVB 2ICWA 2IMNA 3IDNA 1SM3H 5CSBA 4WGWB 1ETZA 3DSFL 3HPLB 4WENB 1A6AB 2C3VB 3ULVL 3V7AG 3QJFB 4MMZC 2PETA 5AWNH 1RU9H 1F8TH 3TO4D 4PRHD 4NWTH 3UJIH 1CD1A 1Q0YL 1F6FB 3MJ8A 2OL3A 2O5ZL 1BZQK 4LVHB 5D7IB 1TTUA 4PJIA 3ARWA 3VI4F 1DBBH 1MRCL 3EDDA 4ERSH 4GS7C 4PJIF 1D5ZB 5ICZA 3MXVL 1D9KC 2Q3AA 5GS0H 2EXYD 4I1NB 4LBEA 1A6ZA 2ADIB 1AY1L 4YBLB 5F7YC 4P23C 4IRZL 4C83B 2IALA 4X8JA 4NC1C 4QWWD 2BY2A 1BQLL 2VLLB 2IPTH 2PTTA 4G8GA 5BZWA 3RVUD 3HZMA 1MVUA 5B3NA 1BVZA 3P77A 5SWZD 3C5JB 3MYZA 3O6KL 4KRLB 3F12A 5IP4A 3PDOA 4BKLB 5E9DA 4JRYB 3NCBB 3SDAD 4FTVD 4HUMB 2W65A 2YWZA 3D5OF 1UACH 1DLFL 5IBUG 3KDMA 3JVGC 3K4ZA 4L3ED 2OYPA 3CVHA 1T22A 4XWGL 1YN6A 4GAJH 2P5WB 5B22A 3X11B 5T1KD 1D5MA 5F9WB 3SCMC 5JXED 5GZND 2Y5TB 5HY9B 5KSUA 3FJTA 4Y4HB 3LB6D 1UXSA 1PD6A 1KJ2H 5IVNA 5DJ6A 4WFGD 3CSGA 4RFEA 1OD9A 2GSGA 4G42A 3MRJB 5D7LD 4NFCA 5DI8B 3TESA 1OGAE 2HP4A 3FFCE 1CICC 1E28A 1QSEA 1UM6H 2R0LL 4JPIB 1KN4H 1DQLL 3GMRA 1VKXA 5F1IB 4R4FH 2JLLA 1KYOK 3Q3GA 2BVOB 2DQFB 5EU6D 1H3UA 1I1YB 1IEAB 1JMXA 3CXDL 4AEEA 4JFFA 2AK1L 3MRMA 4M00A 4ZFOL 3H9SA 5DA4A 5I73C 1NDMA 1NC2A 4LNRB 1CG9B 4R6UA 1F6AA 2HFEA 4PYGA 4ZPVA 2OTUB 4WHYG 5GJSL 2ZKHH 5L8KB 1U8LA 3BESR