4BQ9A

Crystal structure of the fn5 and fn6 domains of neo1, form 1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
205
structure length
205
Chain Sequence
TPMMPPVGVQASILSHDTIRITWADNSLPKHQKITDSRYYTVRWKTNIPANTKYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGATFELVPTSPPKDVTVVSKEGKPRTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTPGTKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NEOGENIN
publication title Structure of the Repulsive Guidance Molecule (Rgm)-Neogenin Signaling Hub
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 35
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bq9A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bq9A02
1RK0A 4O2FA 1MJ8L 4ZOBA 5HHOE 3BE1L 4M8VA 1OAUL 3VG0H 1NCTA 2QSVA 4DGIH 4QHNB 4MNQD 3FJTA 1KLUA 3TN0C 4XAKD 3ARTA 3LS4L 2ED7A 4LLYB 3C09B 4LNVA 2A9NH 1BM3H 5GQBA 4NQVA 4GUPB 5D1XB 3OKNB 3PWLA 3BESR 2OTUA 5DZNA 5BRZE 1Q0XL 3U9PH 1TZIB 3LAFA 3GRWH 2YD4A 1TETL 1R3HB 1X5GA 3IFLL 3M45A 3JBG7 2F8OA 1KJMB 4N0YH 3ARQA 1J8HE 4DUXA 3MLZH 1CIUA 4BK5A 2CIKA 5ISZA 4UQ2A 5IBUG 2WBJD 4F9PC 3K46A 4TSBL 3MNZB 4RAVA 2ADIA 1IAIH 3RTQB 5D2LE 3H3BC 4RQQB 1T7YA 4QCIA 1BX2A 1MHHA 1A4KB 3HI6H 3OF6D 4K8RL 3VXRA 3IETA 3BP4A 5HY9B 4LCUA 2UYLA 5HGHA 3WIHA 3C87A 3RRQA 4XCEB 3ARWA 1ND0A 4HT1H 2Z93A 3DIFA 3A6OA 4CAGA 2Z31A 4ZUUA 1NCAH 4O2EB 3EUUA 4KTEH 1LVEA 2WUCH 4I2XE 5T33H 2PXYA 1IAOA 2LAAA 4Y5YC 2Q1EA 1FVDB 3ZSSA 3JVGC 4N0UB 5JXED 1D5MB 2R56H 4HJ0D 4PD4K 3KVQA 2VMFA 1UKSA 4YHNA 1WBYB 4LL9A 5I1IL 3TO4B 1AIFA 3L3JA 5T3XE 5MP6L 3MYJB 3GMRB 3SDCB 2WP3O 3U2SA 5E4EC 5AZ2H 5J1SC 4LQFH 3QDJE 3IU3A 1XF4B 5T1DL 1PQZA 3CUPA 5D8JH 4LVEA 4NNXA 4TQEL 2X4UA 1CXFA 1CGUA 3SQOH 5DQJB 2NY7L 3ZDZE 1C5DA 3H7BA 3S34L 2W9EL 4JHAL 2NY5C 3B5GA 1FGVH 1GRWA 3U46B 1UM5H 2AV1B 3HFMH 1IGJA 4KI5C 3SGKA 2XICA 4EDXA 5I1DA 1BQLL 3SE8L 3QNXA 3QIBB 1MCJA 4M5ZH 4R2GB 4OJFL 3U36A 1NLBL 2VR4A 4QRRB 3MGTA 2VSDA 4UV7H 1VGKB 4H20L 2Q6WB 2EDWA 3PWUA 5EU7C 3ULUH 5IOPB 1KTDA 1N4XH 5DK0B 5I8OH 2BDNH 1ZANL 4ISVB 2NR6D 1KEGH 2XZCL 1QKZH 1QFHA 4HKJA 3KJ4B 3D85B 3QUZA 2APFA 4ZUWB 1NLDH 3PV7A 4HXBL 4RAUB 4M1DH 2D0HA 3CFCL 3RUGA 1KIRA 4LPVA 5HD8C 2OL3H 3OTTA 5DUPH 2ESVB 5CD3A 3DXAB 4X80H 2BHZA 2NY3B 1RK1B 3MLYH 4L4VD 4EVNA 1R3IL 1RZJC 4YZFE 3LN9A 1EHLH 4TRPH 2VXTL 1GHFL 4OLUH 1BF2A 3NIFE 2KQNA 4L9LA 1MAML 5F7LB 5K9KA 2Z4QA 1NBQA 3AROA 3MRPA 2BXZA 4O58L 5AD0A 1OWRM 5EA0L 2AXGB 2OJEA 1G7QA 4NBZB 4XMLL 3TIEA 4WCYL 2D2OA 4OCXL 1NGXA 1YNTB 4PJEA 3MRGA 2BSTB 3RL1B 3U4AA 3EZJB 5GIRB 4OLZH 4P9HC 4ELKA 3ZTNH 5KBNC 1RFDL 5HHOD 2B4CC 2OZ4A 4UDTB 1S9XA 1J1PL 4HG4J 2VDQH 3GSRA 4H1LH 5MERB 5D1ZB 2A6KA 3R0NA 1FBIL 5D70L 5C0RL 5C9KA 2V7NA 3UO1H 5E9DE 3GHEH 1JTTA 3SE4A 1RU9H 4I0PD 4N1HB 5BRZD 5F1IA 4ALAL 4ZFOA 3CFIC 3VA2C 3FB8A 1A7OH 3QAZB 3B2VL 4YPGB 4PRPE 3CDGA 3S37X 3S96A 1GCFA 3DO3A 5D93B 3WFCH 5K9OB 1WICA 1J8HD 1A7PH 2EYRB 5CUSH 3RI5K 4X6BA 5E95B 4PJ9C 4L3CB 3RBGA 1KIPB 3ARRA 3RZCD 3SDAC 1IL1B 1AQKH 4G80B 4KV5F 2R1XB 2VZUA 4XPAL 1QEWB 2GEEA 1W0YT 3QEHA 2HRLA 3BP7A 4YK4C 4Z5RB 4HD9A 3KWWB 4RGNB 35C8H 5BXFB 4Z0XA 2CPCA 4CMHC 1B0WA 4MWFA 1AGFB 3O2WH 1F13A 1FAIL 4AY0A 3HS0A 1Z9LA 1LP9E 3MRHB 5HPOA 5IF0A 1ZS8A 1G7PB 5HVHC 3CH1B 1RMFH 3HN3A 1F00I 2BNQA 2UWEA 3CVIL 2V9QA 4OFYD 1CLZH 2WINA 4LFHD 1OP9A 3D39B 4PJFE 4X6DF 3TA3C 1HSBA 3LKRB 4D2NA 5KOVC 5C0IA 2D4DA 2IGFH 4HIHA 3BQUA 3S97C 4GRLA 3V5DB 4K71C 4Y4KB 3TBSB 4YBQD 3MC0A 4XI5D 5FGBC 1FL5B 1YUHB 1KJ2B 2R2EA 5ETUA 3TO2A 4HIIA 3LKPA 2Q20A 4PJGB 1ZHBB 2Y36L 4RNRA 3IVKB 1F11A 1DQLL 4GG6E 3MBXL 3CSYB 5DHVA 1ZA3B 4M62H 2YUWA 4NQDE 2XNAA 3QDJD 1Q9LA 2D7TL 1U0QA 4PJAE 5CGYD 3O8XB 4U1SA 2OQJA 3BYYA 1NDGA 1EV2E 2FX8L 2H26A 4LASH 3P30H 4PJCA 1UZ8B 5T1MA 5LJYH 1A3RL 4MXVE 4XI5C 4JM4H 1NUDA 1Y0LA 4OT1L 1JWSB 5GS3A 5MENE 3LH2L 3HLAA 5DQDL 2H41A 1QSEE 4X8XA 1B2WL 2VABB 5I74B 1Z2KA 2FYYB 4N1CA 4DKFH 1OT1A 3DVGB 2PO6A 3RDTB 1JN6B 2ZUSA 4MD0A 4OCNC 4JFOA 4PJXB 4Y89A 5HPMB 5BOPA 5F1NB 4DN3L 1PX4A 2AP2A 3MJ9A 1T1ZA 3FB7B 1S7WA 3ABZA 4E41B 4QRPB 4UTBH 3HMXH 3G6JF 2XRAL 5EH1A 4Q9CA 2D31B 3K2UH 4ODXA 3D0VA 2QHLA 3QRGL 5BV7L 4IDLA 3ZDXE 4U6VL 4YQXL 3ZYZA 4PV9A 4TUKH 1SMOA 5I9QC 4G6KL 3TYGH 4GMSL 1SBBA 3OAUL 3D0LA 1OT2A 1FAKT 4NZJA 1TITA 4HJJL 1RJYA 5DHYA 5I1KH 2Y5TA 3SJVB 2FECL 1MY5A 2GY5A 1HH9B 1T89C 3NN8B 1HIML 2XIDA 1YDPB 4AM0B 1KCSH 1KCVL 1YJDC 2EDOA 2YD8A 5C0NC 1QBBA 4K7FB 3RJQB 3VFWA 3WFHB 4LSTL 1F6FB 2EDLA 5DEGB 5EOTB 3SCMA 1MCPL 4H0HB 1INQB 4D0CB 5ALCL 5DD3L 3SY0A 3IDIA 5L8JB 1OAQH 2EIBA 3VRLE 2ZUXA 1ZHKB 1U93B 3KYMB 4DZBA 5DJYB 4BA8A 4JO3H 4U0RC 4WHYG 3WE6A 3L3OA 1MUJA 5D96C 4NCC2 1HXMA 3D48R 4ZAKC 3FQRA 1MLCB 3WL9B 1JZ4A 3QHTC 3DSNA 1KJVA 5E9DD 1INDL 1EO8H 1MVUA 3QA3A 5IFHL 5F3BB 5FIEA 5GPRA 3PWPB 3MUGB 5DSCA 4XP9H 3FQUA 1X4XA 2DYPA 5EU6B 3NGBC 4PRPD 2P8MB 4MAYB 1HI6A 5CP7A 4L5FL 2RGSA 1QRNB 3S3JA 2IADA 4HXAH 3HI1A 2F54B 4LIQE 1JV5A 2IWGA 2DQIH 5L2JA 5CLTA 3NFSH 5CD5C 4G9FA 3QIWD 4MSWB 2M2DA 3GK8L 1JZ6A 2Q3AA 2CMRL 5EO0B 1T04A 1CF8L 3GSXA 3K8KA 3C5SB 4JFFB 4OFIA 4B5EA 2GKIA 2NY4B 4JPWL 1VADB 2GTWA 5EORH 2MOVA 5GS0H 4WW1A 5C70A 4U1LA 1N2RB 1JHLH 2QSCL 5DC9B 4MD5A 4LCCA 2J8UF 1NAML 4PRDB 4NRZB 3CLFL 3LKNA 3SDYH 1A1NA 4FQXD 4JFDA 4FQCH 1C16A 3ZSTA 1AP2A 3UJJL 3K4AA 1L0QA 2NY0D 3T0BA 3LQAL 3OGOE 5A16B 2VDNH 3VMNA 5IW1A 3RX8A 1MREL 1SJHA 2GJJA 4ZFZA 2ZUQB 5KS9A 5EZOL 2OS7A 4UDUB 3W0WE 1HYSD 3JXAA 4GRWB 4N9GA 4XNUH 4G6AC 1J87A 2JELL 2WLYA 5DD1H 5JTWA 1YY9C 1FNGB 2ORBL 4KJWD 1I4FA 3D69A 1KCUH 4NQDD 1QFOA 4N9OB 1RZFL 3SE3A 5D1QB 4HBQA 4HQQH 1U8PB 2HFFA 1DQDH 4X98A 5E2UL 1FYTE 1KN2L 1HH6A 4OCSH 3EJJX 3ZKXB 5IMLA 4P2OA 3L5WA 2WIIA 3FOLB 3ULSB 3RBSA 3EOTL 2CGRL 1IJ9A 3ARGA 5GZNC 2Q87A 2D7NA 2O5ZL 4XNXH 2IQAB 3L3GB 3O81A 1QLEH 2VUOA 4ZO7A 5MEND 1A9BA 1EXUB 4NZRL 4NBYB 3QIUD 1QSED 1K4DB 2P45B 5E8NB 1OOAA 5D7JA 3MRNA 3HZKB 1YYML 2YPLE 1CFQB 4KKBC 4ZS7H 1BQHB 5I19L 4BQBA 3BX7C 4Q6IA 4NC2B 4M9PA 3O9WA 3QDMA 4XPFH 4CADB 4I0CC 1HHKA 3KLAA 3D87B 1FORL 2VRAA 3QXDB 4GAGH 4P3CL 3NIDF 4JDZA 2BVOB 4ZDHB 5EBLB 1UWXK 4XVJL 5IESH 1P5VA 1CDYA 4XPTH 43CAA 5KSBB 5JDSB 4U05A 5MEOA 3DVIA 1XR8B 1CR9H 5IEKB 4LMQE 3ZLQC 3DV4B 3X12A 1BVZA 4ODVL 4J6RL 1S3KL 1MCFA 1OP5H 1LDPH 5E1AB 2CD0A 5I18H 1W72H 3PL6B 4D9QE 4AJ0A 4LPYA 4GBXB 4R4BA 1X5KA 3B9AA 1XR9A 3GJFB 4OF5A 4YR6B 1XIWC 4LHUA 3G08B 3V6OA 3W82A 2K3TA 4OD3L 1MHCA 4BFGA 3GKZA 1JNLL 4Z7UA 1UG9A 2PYEA 3AS0A 4OCRH 4P4RB 1U8HA 5F96L 1R0AH 1KCRH 5TFSH 3CZFA 1P69B 4DGYH 1NMCB 2YBRB 4KTDH 1TZGL 5DZLA 3PQYE 4MNQB 1CXEA 4RMQA 2AJXL 4BFIB 1SY6H 3BDYH 1L9NA 1Q94B 5I1JH 4F7PB 3S4SG 4JZJC 4QLRA 4E42A 3E2HC 2H3NB 1CICA 2BCKA 4LAQL 3QQ4A 5ITFA 1BAFL 1Q9OB 3OKKA 2GK2A 4HHAB 4LSUL 1WITA 3VJ6B 3FRPG 4AEHL 5IHLB 1PZUB 3TBVA 1HQ4B 3C5JA 3EFFA 3RGVC 1LEGA 2EO1A 4NM4L 4QT5B 5JR1H 3JTSB 2IH1A 2WBJB 3OR7A 1IT9L 2CDEB 2GJ6E 4OLYL 1PLGH 4PY7B 2EDXA 3CFJA 1CWVA 4YAQB 4QHMB 4LCYA 4FQLL 2AABH 2X4OB 5I30H 2E9BA 3CZJA 4IM8A 4N0CD 4Z95H 4NQEA 2PUQT 3L9RA 1ZT1B 3IDMA 4HKXB 3VE0B 1K5NB 3VD3A 3GGWA 4PJDF 4LRIC 4KMLB 1RJLA 4LPTA 5FGCE 1ZMYA 3A6BL 3FB5A 3TYFA 1IBGH 2XQYG 4ZS6C 2EIZB 4OF6A 3K2MC 5DMIH 5CEZH 3ULUC 4FQ2H 3W0WD 1KG0A 4YEEA 3TC9A 3FB6B 2IMNA 4NWUH 5F6IB 3VGDA 1BIHA 1KB5H 2R8SL 3MMEB 3KYOB 4U6TA 4OD1H 2AJVL 4WGWB 3RNQA 5L6YH 3KS0H 1WBXB 4E5XB 3X11A 3CDFA 1VSCA 4OZGB 3NIGF 2EH8H 2W60A 4OZFA 3MUZ1 3OGCA 4HDIB 5F9WC 3ULVH 1FYTD 4WWKA 2ADFL 3ILQC 3SKOA 1Z9MA 3HC0B 4BSVA 3O41B 4FZ8L 5E99L 1RZGB 2Z8RA 4ODTL 1DVFC 1MRCH 4RFNC 4UB0H 5I66B 3NTCL 4DKDC 3KPOA 2ED8A 2N7AA 3V4PH 4H1LG 3EO9L 5I2IB 1GGBH 4NGHL 4I77H 1P1ZA 2KZ1B 4Z7VE 5M95B 4EUPH 3GMOB 4F57H 4OZIF 4URTB 5B4MC 4HIEB 3FN3A 4P3DA 4HCRH 1S7VA 1G6RL 1U9KA 4MJ6A 4X5WA 3LDBB 2FL5A 4BH7A 4ZNEA 1OHQA 5SV4A 1GC1H 2HFGH 4JQXC 1KXTB 3MO1A 4WRLA 2AJSH 3KPLB 1RULH 5EU5B 3QT2A 5MEPA 3KHQA 4LLQA 2EYSB 3PGFH 5DK2B 5F7DB 5E5UB 3TBWA 3EJYC 1G9NL 1KBGH 4R90H 1HILA 4ZTPL 5EO1A 1NGZB 2CUHA 5A1AA 3WS3B 4L4VB 1F2QA 1QHOA 2ILLA 1J12A 5EBMA 3UC0L 2WWMD 2MPAL 3BD3A 2BP3A 4MJ5A 4P9ML 4AZ8A 3BZ4B 4RZCB 2OR8A 3BQUD 4P5TC 1KTKE 2WW8A 1TJIH 4YXLL 1MOEA 1Q0YH 4AL8L 4XBGA 2OYPA 5DFVD 5I8EA 4XMKL 5GJTL 4ETYA 1FIGL 4YHOL 4D9RE 5CIPB 1QO3A 1LE9B 1BGXL 5T3ZE 1R5WA 1GPOL 2X4TA 4DKEL 5HHOB 2DLHA 5DQ9B 2DICA 4BZ2L 1CD9B 2X9XA 3PQYD 1MFDH 5JOFB 5IB1A 1U41A 2NY6C 4MMZC 1MF2L 4Q6YA 4LSRL 3L5XL 1EBAA 2X70B 5DMKA 4I0PB 5BRZB 5C3TA 1UYWL 4WUUA 4YK4B 4NJ9L 5F3HA 4Q9RL 4Z7WE 1KNOA 3CC5B 1GVIA 4TSCH 5H2BB 2I5YL 5C8JA 4OB5H 1G0DA 1A1MB 1FSKC 4PRHA 1IGIL 4S0TD 4U6XB 3VD9A 5DJZB 4KXZH 1J8HB 5IJKA 1HQRA 1NFDF 2NY2C 5CZXC 1NANH 3QO1A 3WXVH 1DN0B 4KI5F 1IE5A 1ZV5A 1N59A 3I3DA 3OJ2C 2O5YH 4IJ3C 1E4WL 1H8NA 2YKLL 4BK4A 4HG4K 2ARJB 4JO2L 5D2LB 4L9DA 2GJ6D 2VLJE 3UJIL 4Q2ZA 1KULA 5AWNL 4C57C 4RCAA 4C4KT 2YD6A 32C2B 5J13B 2P8PB 1LDSA 1A4JA 3QG7L 5IFJA 4ONHB 4ZXBD 3CVHH 4OZGF 1KEML 1IFHL 4PLKC 4AG4H 4F7EB 2ENSA 5BMFH 1CGTA 4G43A 1E6OH 4UTAL 2ATPA 1IGTB 4I2XB 4XP1L 1CT8B 1EEYB 3BDXA 2DQDH 1AJ7H 1DBAL 4XVUD 4GQ9L 2X4NA 3DHJA 3MRMA 1X7QA 3HAEH 3QUYA 3GSNH 2F5AH 1QFWM 2AV7A 3VXNB 4X9GA 3V0VB 5HYSA 4HUXA 4DAGH 3U79A 3IU4H 3QDJB 4NHUB 4H0IA 5IIEA 1CFVL 1XGYH 5IMOA 5HI5D 2C7UA 2HT3D 5MI0B 1MJJB 1R5VA 4IDJL 1S9VA 3EGSA 4BKLB 5FO9A 4PJBE 4IBLT 3MRRA 4UV4L 3OR6A 3UROR 5DD6B 4JCLA 2OK0H 1KTLA 2R23A 1F5WA 2C3VA 2NNAA 5TQ2L 1VFAA 5J11C 4QY8B 1U8LB 4P2RA 3RQ3A 4L3EE 2BVUA 3NZHH 1AY1L 1CE6A 3QI9D 1JWMB 4HUWA 2XG5A 1V8HA 3JTTB 3QJHB 5D7IF 4NKQB 4PJHE 3RWIA 5E5MB 2HJLA 4X6CE 3H9SA 4J7RA 1FCGA 4LOUC 3HG1A 4JKPH 4RGOH 1UKTA 2YUXA 3HI5H 2XWJA 1JF6A 1CIDA 1FZOA 1CFSB 4R3SB 3WNNA 1I8KB 1HXYA 5EZJA 1JPTH 1U8OB 1CLOL 2Z91A 1QNZH 1FZKB 5GGVH 2EE9A 1P7KB 3CFEA 3RWEA 3QEGL 4YNYA 4JFDD 3PHQA 3E8UL 2P4AB 2RFXA 3HUJF 1SQ2N 1KN4H 3IS1X 5FM5M 3I85A 4HUUB 43C9A 3JWOH 1P53A 3DETD 1RUMH 3TP4A 1J1OL 4LLUB 1JRHL 5GS0D 2JJSC 1A7NL 4YUEH 4DFIA 2VE6B 1FZJA 1HSAB 3HE6C 4PR5B 2PTTA 3O3EA 4X4XB 1FZMB 1QBLL 1T0NB 4NJAL 4TTDD 1I3RA 3WJJC 1ZLUH 4OM1H 4D9RD 2G5RA 3RIAK 5T3ZD 1Q9KB 1PY4A 3WN5C 1PFCA 3LB6C 3L5IA 5IHZB 4DW2L 2SEBB 2B2XL 3X3FH 3DX7A 3P4OA 4Z7NE 4FFYH 2R2BA 1AGCB 4P23C 2NY1D 3R06A 5GS0C 1JNHA 1YMME 4IIQA 1I1AC 2A6DA 4NRXB 1T6WA 4RMUA 5E9DB 1JPFB 1U8QB 2XKNA 1S7RB 1KENH 4M1GH 3FFCE 4S1DD 2FIKB 4KDTC 2FECI 3UTSE 3NCJL 1A2YA 1PW3A 1A21A 3BO8B 4PLNC 3ULVE 1XCQB 4PRPB 4PJ5A 5EOQH 2R39A 2BRQA 1U8NB 4JG1H 3FT2A 2YXFA 1KUMA 2J88L 3RHWF 2APTA 1LE5A 3S5LA 4CVWA 4MCYA 2DBLL 3MLUL 1RZIA 1BZ9A 2NYYD 2VOTA 5ESQA 2QKIB 1GGCL 1UJ3A 3QIWB 5AYQA 1QHPA 4QGTA 3MLWH 4WV1C 1ZWIB 4J4PA 3O6MH 4ZQKA 2B20A 3B9KA 3H7LA 2VLJD 2VKXA 5DJ8B 2J8OA 4GKSA 5HYFA 4CBPA 4CW1A 2NXZD 2FHFA 1NAMA 4A6YB 1CGXA 2VQ1A 5EC2B 1LP9B 1S78D 3H2WA 3NFPB 5LWYL 3EOAB 2ID5A 3EBAA 3EOYG 4FQXB 1QFUL 4HK0A 2CR3A 3NA9H 4FG6D 2A77H 1FFNA 3FQWA 4JRWA 1U3HD 5IR1A 3INUH 2Y9RT 5GGSA 2NY0B 2G60H 1P7QA 4PJFB 3WHE0 4HF5H 4JFEA 2HG5B 3CNKA 3O3AB 1JNNL 5M94B 2VKWA 4S10A 3CK0L 4YO0B 3MRQB 3B3IB 4RISH 4WEBH 3V4VL 3RA7H 2YC1B 1RY7B 1V05A 3JUZA 4OD2B 4GG6B 2DKUA 1X5AA 2XTJC 1RUKH 4J3XA 4NQDB 3K1KC 4FG6C 1I8IB 3SDDC 1IGCL 4PJAB 3MLVL 3MLRL 3UYRL 2R1WA 3BIKB 2AXFA 3WIHH 1L6ZA 2VH5L 3PP3K 1MWAB 1DQML 4JFXA 4U6YA 5IW6B 2EEAA 4RSVA 3ET9F 3Q3GB 1KT2A 2X42A 1AQDB 1NQBA 1JHTB 4P2QA 2XZQL 4P5KA 1NJ9B 1MFEH 2XWTB 2GJZA 4OCYH 4XWOD 3WEXA 3ARBD 3F58L 3GMPA 3TBYA 5C0FB 5MENB 3NIFF 1NC4A 2CDGB 3QIUB 4L3ED 4OZ4A 1QSEB 5JW4R 4QRUA 5LG1A 2DD8L 4RFOL 1IAIM 5FV1L 4EOWL 5AZEL 2AJZA 2QTEA 2G75A 3WFEH 1AO7E 1ZGLM 1EGJL 1NL0H 1C5BH 3L95B 4HFWA 2W91A 3P73B 4ODWB 5D6CB 2HYMA 4JO4L 1VGEL 4KKAC 1D5BA 4JHBA 5FYKH 1IM3B 4NHCL 3SOBH 2FJFA 1JP5A 2FEDC 3QEQA 1ZVYA 5DJXB 3B5TA 3REVB 4GRMA 2HFEA 4LP5A 1BZ7A 5FYLL 3UPRB 5FFLA 3DMMC 3BPLC 1BVKB 1LK2A 5CZVH 2VXUH 1NKRA 4X8JA 1BD2D 2HJKB 1NBVH 5KVFH 1ACYH 5IB5B 3MV8A 5F9DC 1JCKA 4MA8L 1F3JB 4XP4L 4K07A 5IBTL 4U1KA 1SBSL 5HHVH 4OAWA 4CVZA 1U92A 4KJYA 5KSAD 5IEHB 1ZTXL 2IAMA 3ARFD 1RZKH 4FQQB 4MCZB 2V5YA 3DRTB 2ICES 2VLKA 1UWGH 3G5YA 2E27L 4IMKC 2PW2B 4P57B 3WLBA 1QPXA 3PABA 3BWUC 5CBEB 4Y2DC 5EUOA 3KPMA 3P0GB 1GZQB 1BQSA 5E7BA 1A7RL 1V3KA 2FB4L 5EG6C 1J11A 2W65B 1YMMD 3Q48A 1KLGB 3U6RA 1ETZA 4BYHA 1C7SA 3T77B 3CMOL 3OXSB 2H32A 2P24B 4B7LA 3QDGA 4ZUSA 3OKEB 4ELME 5IB2B 5EOCL 3UTSD 1D5XA 1FL3B 4HFUL 1OAXH 1AI1H 3WJLA 1NUFA 1OARH 2YSSB 3EJZD 2ZUWA 4OLXH 1F8TH 4X6EB 4RWHA 2GSIA 4LK4A 1DBKH 5TH2A 3VFPB 4EKXA 2X1PA 1QQDA 3ZKMD 2QSQA 2PF6A 3KJ6L 1HN1A 5HHPA 1AXSB 2AEPH 2ADJA 2WV3A 2YEZB 1DEDA 5IHUH 3RWJA 5EIIB 1TVHA 2OZ4H 5DRXA 4I18C 3VMPA 4EUPG 1MCKA 4PJAF 3LMJL 4OF7A 1IKNA 2XZAL 5EFIA 1JZ8A 3VW3L 3ULVC 2YPVL 2RAMA 5D7LA 3TJEH 5IMMA 1R24A 4XXCA 5HYJE 2E8YA 1WBZB 3L1OL 2XFXA 4PUBL 3GB7B 4AIZA 1PVHA 5F7KC 4ZYKB 1U8KA 3TV3H 1WZLA 5DJ0A 4HS8L 2NCMA 5ACZA 4Y16A 3VWKD 2J4WH 4EXKA 4G6JH 3REWB 5EN2B 1FL6B 3D2UA 1UCTA 4FFWC 4MGXA 3TEUA 1T03H 3KLHD 3W0WB 2V2XB 1GC1C 3HPJB 5F7FA 4JKWA 4YDJA 4H88H 1SYVB 2BNUA 4LSPL 5D2NC 1D5ZB 4KK6C 1B4JH 5F72S 1I85A 3UTOA 4GSDH 3WNOA 1OTUC 1BIIA 1EZVX 3IFNL 1FE8L 3PHOA 5C07A 3LCYA 3GKWH 1FYTB 2P5EA 1KJ2L 1CFNB 4PY8J 1FO0A 5I1AA 4J2XA 5J3HD 4GKZB 2OP4L 4FXKB 5IBLC 1PG7X 1XGRB 1ZT4A 2YN3A 1A6AA 3SGDI 5KW9L 5E6ID 1DEEB 1MFBL 1T7VA 2P8LA 1L0YA 5IV2A 4W6YB 5AUMB 1G6RA 1D6EB 4Q7DA 4LRNL 3VFUB 3DX9A 4N0FB 2RR3A 1ADQL 3U4EA 2W9DL 4KHXH 4JKLA 2C1OA 1X44A 4ZD3L 1AO7D 2D9CA 4NO3B 3MBEC 4NIKB 5DHVH 1V7NL 4YXKH 3RWGB 4Z7QF 2X4RB 3CX5J 4J3SA 4TUOA 4YHPA 3D3VA 4U33A 4HULB 2ZSWB 3KNBA 3RP1A 5JO5A 3IDNA 2E3VA 4WUKH 2F74A 3VRLF 2V5RA 2ZUYA 2CK0H 2DIJA 1MHPL 1G7JB 3MLTB 4PRBB 1XGQA 1X3DA 1NFIB 1FRGH 3UBXB 1IZJA 3O2VH 4NPYB 1IGFH 3BFOA 2GUOA 12E8H 3ZT7A 3GSUA 1UVQA 1I8LA 5F7UA 5GZOC 1NEUA 4JFPA 2F9BT 3WS6A 5DJAA 1CZ8H 2R0KH 1GGYA 3AM8A 2Y1VA 4MHHI 5GGQL 3B9VA 3LEXA 2B39A 2X89D 5GS2H 1YEEH 3RWFB 1SYSA 4UT9L 4I4WA 1MNUH 5BJTA 3MJ9H 3ZO0A 1FSKB 3RU8H 2CLZA 4ZFFB 4UT6L 2FIRT 1TZHB 4ZUVA 2DQHH 2NX5E 2PCPB 4J3TA 2DM3A 1FNEB 4AH2B 3ULUF 4XZUB 3PQYB 5FF6B 3HAEG 5GRUL 4IJ3B 1YEFH 3GUTA 1S8DB 1VACB 1JGEB 3C5ZA 3LKQB 2AKRA 3A6CH 1EIBA 2YZ8A 1J0KA 4OM0H 4PB9L 2FWOB 4RMVA 3MOAH 3C9NB 2Y7QB 3OBAA 4CDHA 5A40E 1IAKB 1KYOJ 5I8KL 4JREC 1NDMB 4QXUL 3VRJB 5KSUB 4I3SH 4PV8B 4YE4L 1LO5A 3HC4L 4JM2D 4F58H 1TNNA 2Z8WC 4NZUH 3FQNB 2E9WA 2JLLA 2HKHL 1WFTA 2VLME 1F4XH 1HHIB 5J12C 1R3JB 1BJ1H 1ZEAH 4G8GE 2GJ6B 1F58L 3S8WA 3PWNB 4JZNA 3I2CH 4PGCB 2DQTL 3F7VA 5CJQH 3I6KB 5DDHB 3VXTA 1NEZB 2IPUG 2YPKA 3PF2A 1FPTL 5DMGD 4ZXBB 4HX1B 3GJFK 4Y8DC 5C9JA 4LVNB 1R5IA 4WI9A 5ICZB 25C8L 1KJ3H 3DX6B 5FYKE 3W81A 5ID1A 3EYFB 2OTPA 4L4TE 4APQA 3HB3C 4GFTB 5HYJD 3GSVA 2VDMH 4EIZC 5IJVB 3TVMD 2C1PB 3B2UD 4WO4C 1QSFA 1I1YB 4UNTA 4PYGA 4U1NB 5FGCB 2PETA 3GHBL 4MJ2A 3QCTL 4OKVB 3F62A 4L4JA 3LPFA 4K9EH 3TPUB 4X7SH 3T65A 4XXDA 1DR9A 4DQOH 3FOMB 4YXHH 2EXWC 1VDGA 5L8LB 3O6FA 4CN4A 1AKJD 1MCCA 4HS3A 2AEQL 3RY4A 1MHEA 5FO8B 1BFVL 3QPXH 4JANB 1H3TA 4FQHB 1HEZB 3WUWB 2QR0A 4I8DA 3G6AB 2AGJH 2VDPL 2YUZA 1BFTA 3B2UC 4JY6A 4PGEB 4K3EH 5K9JH 5GJSH 4JRXE 1WSST 4LKCA 3RY6A 5D6DA 4I48B 3BZEA 4LARH 5LBSL 4M6NH 3OMZA 3LKSB 3SKNA 2Z92B 4WW2A 4I5BA 1BJ8A 4L8DB 1XF1A 3JWOC 2Z35A 1YEJH 1IAMA 4OSUH 5C92A 5BVJB 1C5CL 1J88A 3QI9B 1RJZA 2MNUA 4Z7VB 3CJJA 2OXHA 1A6UL 1FGNH 1O0VA 4N8VB 4FQ1H 3GMNB 3MRBA 1RHFA 1OD9A 4TNVF 3JV4A 5D9SA 3ZKSD 1KFAL 4J8RA 3WFZA 3OXRA 1G7MB 4QO1A 3NCYP 3UP1A 3W9EB 1LHZA 5ICYA 3C6SB 5I1EL 4HBCL 4LLAA 4KRPC 2JJUA 3IJHA 4S1RH 4P48A 4FQIH 4O02L 3R8BB 2NZ9D 3NCFB 4OLVH 1EUUA 4M1CD 2VL5A 1K8DB 3RPKA 1T7ZA 3T4YA 2RCSL 3OKOB 1BEYH 8FABB 4PG2C 3WDHA 4MB3A 4IRJD 1DLFH 1OQOA 1P4BH 2ZOLB 5ECJE 1P2CB 4JPIB 4ZFGH 4Y4HD 1G7IA 1NAKL 1J0ZA 4S2SB 5KANI 4MNGB 3RKDC 1F90L 4HKZB 4PP2B 3ZL4H 2LV4A 3OG6B 5JQ6H 3TZVD 3H42H 4FP8H 2KH2B 1NH6A 3MLSL 4F15B 4M1CC 3MOBL 5ADOL 2LABA 5HJ3B 4R0LA 1A0QL 1D9KD 5KVMC 2GTZA 2NX5D 2IEPA 2IH3B 3L3IA 2OX5A 3EYSL 1OSZA 3G5ZA 3H3KA 2NY1B 5JNYA 3SDXE 1CD1A 1LO4L 1UM6H 4DEPB 4NT6B 4RDQG 4RRPA 2R0WL 3MRJB 1CD0A 4JRYE 5EO9B 4QRTB 4JHWL 1EFQA 1VPOL 4EDWH 3MFFB 3WXWH 3HMWL 1JRHI 4QHNA 3B43A 4YHKL 4Z7WB 3IDYC 2H2SD 3QHZL 4TSAL 3R1GH 4LLYA 1T2JA 3WV0A 1RAMA 4GUPA 5D1XA 1ED3B 3OKNA 5KJRL 2ICEB 2C26A 2QADC 5EZIL 4JN1H 5I1CL 3UCRA 1TZIA 1MJ8H 1MVFA 3BE1H 1R3HA 1E0OB 4F2MB 1OAUH 2VLMD 2IPTL 1KJMA 3O0RL 4PJ7B 4G8GD 2ADGA 3LS4H 2VLJB 2FBJL 3QWRD 5FCSH 2NXZB 4GAYB 4HZAA 4J3UA 1Q0XH 2Y06L 3MNZA 4JPVH 4QHKI 1NFKA 3MA7B 3RTQA 3FO1B 2Z31C 4RQQA 4PTTB 2WWKT 4LPWA 3IFLH 4PRIE 4L4TD 1S9YB 1H0DB 1N8ZB 2D03L 1U3HB 1A4KA 3LHPL 4XGZB 1KGCD 5IWLA 2MKLC 2PXYC 5HY9A 1FVEB 5J7CC 4L1DA 4XCEA 5GRJL 1JF5A 1QTYT 4O5LL 3QCVL 1DN2A 1M71B 3LEVL 4TSBH 3Q1SL 5E0QA 3SGJC 4PY8I 1YEGL 2P5WA 4O2EA 4XPBL 1RUPL 5ITBL 3ALPA 1JTOA 4J3OC 1W72B 1FVDA 3MUJA 2X09A 4K8RH 4N0UA 1D5MA 2X4PB 4BSJA 4Z77B 1WBYA 4ONOA 1H3GA 1S5IL 3HKFA 3MROB 3TO4A 2F8VA 3NCEB 3MYJA 1FJ1B 2FR4B 3SDCA 4JRXD 3TFKD 4WI3A 5I0ZA 4PJBB 2VXSL 5HGBB 4C55A 5ENWB 3EYVB 1XF4A 2CQVA 1RV6X 3SGKC 5KVDH 3BAEL 3ARBB 1DQQB 5DQJA 1HNFA 1MJ7L 5I1IH 3ZTJH 4L3EB 2EDTA 2EKJA 1P7HL 3KPSE 5MP6H 1TQBC 1FNAA 1OQXA 3MTRA 3P4MB 3U46A 1EGJA 1KPVB 4KQ4L 2AV1A 4PJHB 4X6CB 4ONFH 3RVUC 3VFNB 1RZKC 5T1DH 3A0OA 3BH8B 2K1MA 3MA9L 4TQEH 2VQTA 5GSVB 2D0GA 5A43C 3QUZC 1Z9OA 2B1HL 4R4FL 2NY7H 4QRRA 1VGKA 2Q6WA 4KZEL 2ZCKL 3S34H 1U6AH 2QQKL 5IOPA 4JHAH 4OZFH 5F1KC 5C0AD 3RHWK 1IEHA 1W2KT 3RVWD 5DK0A 5L9DL 4U3CA 3ARDC 4ISVA 3MGAA 4S1SH 3GMLB 1BQLH 3SE8H 3D85A 4K94L 2NXYC 4ZUWA 4ENED 4F80A 3WYRA 4OJFH 1JFQL 2H1PH 4IHOB 4RAUA 4X9HA 4B7IA 4HPYL 1NLBH 4HWNA 4H20H 4HS6B 4L9LC 4LPXA 3TNMB 2ESVA 3DXAA 2VDLL 5LXGH 4RX4D 1VERA 3MCLL 1AGDB 5KSAB 4X4YB 2XZCH 4LCIL 2JF1A 2RB8A 4U1GC 4XH2B 5E2TL 3ARFB 3TJHD 3S6CA 4MNHA 1AXTL 4HXBH 5T5NG 2XKUA 3CFCH 1H5BB 3NABL 5E8DL 4QHLA 2AXGA 1IKFL 4Q58C 4GAFB 4P46D 4RGMC 3IXTA 3JUYA 3K3QA 1R3IH 2YK1H 1YNTA 2VDOL 2BSTA 1KB5B 1YMMB 1TCRB 3VFRB 2ATKB 3O2DL 4HLZH 1GHFH 1KELL 3DX8B 1ZKAA 1I9EA 1PSKL 4JRYD 1MAMH 4UDTA 3S7GA 4YIQB 3FFCB 4NN7B 5IB3A 4FN0A 4DUVA 5MERA 5D1ZA 4O58H 3UTSB 5F7EL 4OLEA 5EA0H 3X13B 2X4SB 4UILL 1WIPA 4QTIH 4F7TB 5I1GL 2A74B 2WUBL 4OCXH 4Y8AA 3WO3B 1MI5E 1TVDA 1RQ5A 1N5AB 5KTEL 1RFDH 5DRNB 2LQRA 4YPGA 1X4YA 5D5MF 3K80A 1FBIH 5D70H 4K7PY 3UTQB 5C0RH 5K9OA 2EYRA 3DLQR 3LQZB 1KXQE 4RBPK 4LSQL 4L3CA 4I3RL 1KIPA 1IL1A 4ALAH 1HKFA 4G80A 5DF0A 5DUML 3V5HB 2R1XA 5IUSA 1QEWA 1NC2A 3ECBB 5EC1B 5FXCH 5J1AB 1RI8A 4Z5RA 4PRID 1NMBL 3KWWA 5BXFA 5DD5L 3F7YB 1AGFA 1E28B 3VWKB 1OWWA 3MRHA 3STLB 4GRLC 2GAZB 5DRWB 1G7PA 5A2KH 9CGTA 2HLAB 3CH1A 1SVZA 4KMTL 2FO1A 4XPAH 2AQ1A 2PKDA 3LKRA 1FNSL 1LO3L 4HIJB 5D71L 4JHZA 4POYA 3V5DA 1FAIH 2H2PD 3N1GC 4Y4KA 3TBSA 4G9DB 2BFVL 3DO7B 1FL5A 2BVQB 2BVTA 1YUHA 1KJ2A 2FHBA 3ES6B 3AB0B 4PJGA 1ZHBA 3CVIH 3IVKA 2HTKD 4UBDD 2MJWA 3HNSL 2K9UA 3CSYA 1ZA3A 4LVOC 3P4NB 5DMYA 2JK5B 3O8XA 5E6IB 1MRFL 1A3QA 2R29L 4M00A 1EJ6A 3C6LD 3MR9B 1ADQA 5HVWA 4KZDL 2QQNL 3FL7A 3FAXA 3VH8B 1UZ8A 3BKJL 3BPNC 3KPSD 2PO6C 4ETQB 1DQLH 4DKAA 3MBXH 1UEYA 5EBWB 4CUCA 1C12B 1QFWL 4G6ML 1JWSA 2D7TH 2N56A 1AO7B 3VFVB 3D9AL 1KOAA 3MJGX 2VABA 4G42B 2BJML 2FYYA 2DQCL 5FEBA 2FX8H 1XF3B 2ARJQ 1JN6A 3KPRE 1JGUL 2CRMA 2HRPH 4P4KD 4GXVL 1KF9B 4JJ5B 1NGYB 1BOYA 3C6LC 4NN6B 4PJXA 5HPMA 1A3RH 5F1NA 4NRYB 4Y19D 3KPNB 3VXME 4YWGL 4OT1H 4YDIL 2OR9L 3FB7A 3MLPA 5EWIL 4E41A 4QRPA 4YHYC 3LH2H 1CTNA 2PW1A 4WFEE 2D31A 1B2WH 2HN7B 3UAJC 2P7TB 3O4LE 1KIQB 3FO9B 2CKBA 3IT8D 3RNKB 4CU6A 4LP4A 4TVSa 3S88L 3ULVF 5LCVL 2OI9B 1OSPH 3Q6GL 4DN3H 1KACB 4KUCF 3AFLA 5B8CB 1SJEB 5KVGL 3MNWB 3UJTL 4DGVL 3CX5K 4F8QA 2Y4SA 4MJIE 2XRAH 1HHGB 3C60D 1V7ML 4NKIL 5FUOL 3EIFA 3SCMC 4JREB 3QRGH 5BV7H 7FABL 1HH9A 2ZWLT 4EI5D 3KYKL 4JE4B 5I71C 5JORB 4U6VH 1YDPA 3G9VA 4AM0A 1A64A 4YQXH 2QHRL 4HUNB 4M7JL 5C0CE 5E5RB 2WP3T 4GMSH 4K7FA 3WFHA 2BSSB 1F6AB 3VFOB 3HE7D 1DUZB 4BUHA 5EOTA 5DEGA 4LU5L 4BQCA 4HJJH 3TBTB 1INQA 4D0CA 3N85L 5CMAA 1VHPA 2MMXA 1TVBB 1ZHKA 1HIMH 1U93A 3KYMA 3N50A 4NUJA 4ELMB 3QWQB 1OGAA 3H8NA 1KCVH 2ZPKL 5H37G 3TCLB 1MLCA 4K9EC 4JM2B 3WL9A 4HWUA 5SWQB 4LSTH 4X6DE 4ZPTB 2VC2L 3PWPA 2ZP0T 3MUGA 1MI5D 1MCPH 2W0KA 4UOW0 1YY8B 3G6DL 5ALCH 4GLRI 5DD3H 2FBOJ 4A2MA 5JA8B 1T22B 4N68A 4R96A 5GGUB 2ITDB 3ZKQD 2P8MA 4MAYA 4OV5B 2VTFA 3KS0J 4OCMC 1QRNA 4G3YL 1BHGA 2F54A 1AR1C 1BBDL 3T3MF 1NCBL 1INDH 1YZZA 5IFHH 4K7PL 3MRCB 4MSWA 2BXYA 4CVXB 4JQIL 4LCCC 3WSQL 1B9ZA 1XFPA 4NO0D 5CHNB 5DO2C 3QZWB 2Q8AL 5EO0A 1WFUA 5F70A 4OTXL 3C5SA 5GXBB 5HYJB 4JFFA 3STBA 3O3DB 5TJWK 2WAHA 4NC1E 3TVMB 5L8KB 3GI9L 4L5FH 3TPKA 1VADA 3ARPA 3FT4B 5KN5B 2W38A 1N2RA 1P4IL 3MUY1 1AC0A 4A6YL 4MA7H 4PRDA 4NRZA 3GK8H 5C09E 1I1RA 1UM4L 2CMRH 1OGTB 1Z5LB 5DJDB 1CF8H 2C3GA 2GFBB 1WCBB 1AKJB 1OAYL 5A16A 2EDFA 1H15B 4YHML 1JK8B 1V3MA 4JPWH 4OZHF 2HT4D 3SE3C 4O9HL 1L9MA 4ZNEE 2QSCH 3L5JA 3ARED 5DI8B 4IEFB 4UDUA 3PP4L 5F88B 5HI4C 1NAMH 4FABL 1UCBL 3DVNB 4YC2C 1CQKA 1CS6A 3G6JE 5DTFB 4P2OC 3V7AE 3UJJH 1FNGA 2R9HD 4KAQL 2YZ1A 2E7HA 5D1QA 3C8KB 3ARGC 3SO3C 1MREH 2VZTA 2HLFD 1U8PA 5E94B 5EZOH 3D6GA 2JIXD 3MXVL 3BSZL 1QSZA 3JWDH 1CYGA 1AFVL 1A7QL 2JELH 3J8F7 3RIFK 1FV1B 4Z9KB 5D7JC 2IALB 4M7ZC 3FOLA 1MWAL 3AREC 4HWZB 3ULSA 4I9WE 5DWUL 5MEQB 3BD5A 3VXQB 4M43L 2ZUTA 3DYOA 5JIKA 4Q6IC 3OX8B 2IQAA 2GIYA 3L3GA 3O9WC 4KC3B 1RZFH 5A2JH 3R4DA 3BRGC 1EXUA 3NFNB 2CRYA 4I13B 4DCQB 5IG7A 4LVHB 5E2UH 1K4DA 1U3YA 3W2DL 4M93B 3IJSB 5E8NA 2J6EL 5GGTL 4JFZL 3G5XB 3HZKA 1CFQA 1BQHA 3KPRD 4LHUG 5DYOB 3IS0X 4IRSD 3EOTH 4CADA 2CGRH 2ICWB 3EYOB 2O5XL 1RIVL 2O5ZH 4Y5XB 3VXMD 2FH6A 3QXDA 1FDLH 1FN4B 1MPAL 2BVOA 4JCMA 4ZDHA 4CRPA 4NZRH 2XOTA 2R2HB 1MCSA 4XB7A 5KSBA 4IRJB 5FM4A 5C0EB 5JDSA 3O4LD 4FTVD 4HAFA 3UX9B 4G5ZH 1XR8A 5I17B 1YYMH 5IEKA 1J8KA 4Y4HB 3P77B 3DV4A 4P2CG 5I19H 5HDQL 2FSEB 4HLJA 4U0QB 4P59L 5C0BE 3TZVB 2HTLD 4MD4B 2FGWL 3V6OC 3KYNB 1FORH 4LLWB 2CJUL 4P3CH 5E1AA 2NW3B 1WF5A 1YPZE 3PL6A 2LTQB 2EZ0C 4NSKA 4MJID 4XVJH 4GBXA 3UTTE 2ZG1A 1D9KB 2NX5B 3GJFA 4PJ8A 4RMSA 3MV7E 5C0CD 4YR6A 3G08A 4ODVH 1NCAL 4J6RH 2ADIB 4HMCA 2X7LB 1S3KH 4C54A 2CUMA 2PR4L 1SJVA 3T1FB 3IFOA 1HK6A 3IDUA 1JMZA 1CICC 2DJSA 3V9FA 2DI8A 3VGEA 3CFDB 1MLBB 1CDGA 2YBRA 1JTPA 4FNLH 2GYSA 4MNQA 4BFIA 2J8UE 2WK2A 2YD5A 1Q94A 3LEYL 4F7PA 5LVEA 2IANE 4XHJC 2Z31B 2H3NA 4OD3H 1JNLH 1ZGLP 1ZOXA 3MNVB 5F96H 1NKOA 1Q9OA 4WGVB 1YA5A 3QIBD 4HHAA 1CL7L 3VJ6A 1IAOB 4AYFA 3IDXH 1HQ4A 1MJUH 5J6HB 3FT3B 4K8RC 2AJXH 3QUXD 4G8GB 4YHNB 4QT5A 1FG2B 1R3KB 3JTSA 1OPGL 4MXWL 3CSGA 2WBJA 5A2LH 1GAFH 1XH3A 1UM5L 4LAQH 2CDEA 4TNVK 4PLJD 1AD0B 1BAFH 2HVJB 1I7TA 4LIQL 3JVGA 4LSUH 4HC1L 4Y5VB 4AEHH 4PY7A 1Q8MA 1PQZB 2H32H 4M5ZL 4L4TB 3O3BB 4YAQA 4QHMA 2AXJA 1DL7L 3OF6A 1TIUA 1XGPB 2X4OA 4NM4H 1OVZA 5SWZE 4KK8D 4OKDA 6FABH 2DOCA 4EJ1C 3QH3B 4KJQC 4UU9B 2W0LA 2VLRE 1WAAF 1XF2B 1ZT1A 3UTZB 4HKXA 3VE0A 4RIRB 4FFZH 1K5NA 4OLYH 1TDQA 3N1PC 4N8PA 1CDIA 2J12B 1GZPB 5JXEA 3NAAL 3SN6N 3WFBL 2OL3L 2P48B 1ZT7B 4X80L 4NC1C 2EDEA 3FB6A 2E7BA 1WFNA 4WWKC 4JRXB 3OAZH 3MMEA 1CXKA 3KYOA 5JUEL 4TRPL 3D5OF 1AXIB 3SGDH 3OPZH 5HI3D 2BHUA 3A6BH 4MQSB 3B6SB 4E5XA 1WBXA 1KCLA 1V3LA 1J0JA 5HDBE 2X40A 4RFEB 5E8EB 3ARDB 4HDIA 3UZQA 3HC0A 3HR5B 4LCWE 3O41A 1RZGA 4YPJA 2P44B 4I1NB 2R8SH 4HLZG 4U6HB 4NOBA 5I66A 4JR9L 3W11C 2AJVH 5JLZA 4ODUB 4AEFA 4OUUA 4LHJB 1H9VA 5TPWL 5I2IA 1UWXH 3HNTH 3GMOA 1DQJB 2C3XA 2BOBB 3A67L 4HIEA 4CN1A 1HWGB 2ZZUT 2ADFH 5C0AB 2EE3A 4FZ8H 5E99H 3FONB 2DQUL 1QYGL 3W5NA 1OLZA 1FO0H 3KPLA 5EU5A 3NTCH 5HBBA 4XX1E 4ELKB 3CXDL 4YGVB 2FO4B 2EYSA 3EO9H 4LDEB 3GEWB 3PG2A 1HHJB 4NGHH 5DK2A 5F7DA 5FUZL 3DUUB 2KKQA 5K59F 4F9LA 2BVPB 1A7PL 5CUSL 1NGZA 4G8IB 4PP1D 3F7QA 3EDDA 4NQTA 5JXAL 1UC6A 3WS3A 3MREB 4L4VA 4KVNH 2HP4A 4XVTH 5C0BD 3D39D 3LY6A 3WMSA 4FOMA 4TVPH 1RVFL 2V5MA 5JA9A 3BZ4A 4RZCA 3S96B 2WSKA 2AK1L 2F19L 1G9NH 1ORSB 4D0DB 3NPSC 3UTTD 2YA0A 4ZTPH 3O6KL 4X6BB 3LS5L 4ZO6A 5FM5O 4P46B 1R6VA 3O2DA 3MV7D 5CIPA 3SDXB 1LE9A 1U58B 3UC0H 2D7PA 3NOIA 1D6VL 4JRYB 5HHOA 5DQ9A 3V79C 1SEBB 4HMEA 4YXLH 4GG8B 3NCCB 3X14B 4AL8H 3TLRA 5JOFA 5GJTH 1FIGH 4YHOH 2IAND 1WFOA 4X9BA 5IJKC 4PJDE 3I9GL 2X70A 1BGXH 2YD9A 1I3GL 1I1CA 4I0PA 4KK9D 5BRZA 5I16B 1F4WL 3CC5A 1GPOH 3HZMB 4JFEE 2HT2C 5H2BA 4DKEH 2YD2A 1A1MA 4BZ2H 5BVPH 4U6XA 1A9EB 5B39B 4MVBC 4OFPA 3V6FB 1K4CB 1Q9WB 1J8HA 1KLFA 3OB8A 3RDTD 3H9HA 3ARVA 4NQCE 2DWEB 1G9EA 1DN0A 4U3HA 1MF2H 4LSRH 3L5XH 1T5WB 1C1EL 1NSNL 3RZCA 3B83A 1UYWH 4YEFA 5HYSG 2E7LA 4NJ9H 2ARJA 4Q9RH 3K7UA 5D2LA 2I5YH 2QLVB 3JV5A 3TH2T 3VWJD 3NIGE 3IAPA 4U1SB 1IGIH 3QUMB 1MEXL 3PGCB 4PRIB 32C2A 4WU7B 2P8PA 3DI2B 4U2YA 4ONHA 3RUGF 4OGAC 3BGMB 4R8WL 5SWZD 1OAZL 1K8IB 3QNZB 5CJ8A 4B53A 4MA1B 5JHDE 3UTPE 5GGRB 4OFYA 3QUYC 4JO2H 1GIGL 1J86A 3UJIH 2ARWA 1IGTA 4I2XA 3SJVD 1DTUA 3HMXL 4XP6L 4OZIE 1CT8A 1EEYA 4KUZL 3QG7H 4UINL 5L2KE 1KEMH 1IC4L 3BMVA 4RMWA 2XPGB 3VXNA 1P5UA 3V0VA 4XRCB 4PJEF 1G84A 2GI7A 3L7FB 4UTAH 1Z6JT 4K3DL 1YEHL 3ZYOA 1T1XB 3L5HA 4EQ3A 4XP1H 3QDJA 3NBNA 4NHUA 1KPRB 3T2OA 3S36L 1DBAH 4GQ9H 1MJJA 3C6LB 4BKLA 4GQPH 1W0VB 1FFOB 3F7RA 5EUKB 1WWBX 3VXUE 3KPSB 3VDAA 1X5YA 3BW9B 5DD6A 4LCWD 4YHYB 5E1HB 2C4FU 4QY8A 1U8LA 5EU6D 1DE4B 4KROC 2XI9A 4E9LA 5KSVB 3BT2L 5BV7C 4IOFC 4MAYD 5I8CB 4GW4B 1JWMA 2Y6SD 4CDGC 4JO3L 4IDJH 2BX5A 5IQ9B 3JTTA 4XPHL 2VN4A 3QJHA 4KXZI 2XXCB 3S35H 1NBZB 5JZ7C 5E5MA 4P4KB 4UV4H 2XQBL 4LLVB 4CJ0A 5EIQA 5ACMA 3IDGB 2DDQL 4Y4FD 4JLRB 1OTSD 4R3SA 1CFSA 1AY1H 1I8KA 4HIXL 4J12A 2VZSA 4LNRB 5CZKA 1U36A 2HWZL 1U8OA 4HGWB 4ORGB 5I6XC 1FZKA 1JYXA 2Z8SA 1P7KA 2DQIL 3U7WL 4D9LL 1YC8A 2UWEF 4HUUA 4JGMA 1QFPA 3C60B 4P49A 4JGUA 4LLUA 5F21B 4XVSL 4M7LL 2VE6A 1NFDE 4EI5B 3VXSE 4ODBD 2QJDA 4PR5A 5EORL 3E0GA 4Y2OA 5GS0L 4X4XA 1FZMA 3BHBB 3QQ3B 4POZC 1T0NA 1BBJB 3S5LG 3E8UH 5C2UB 3ARZA 4IIQC 3HE7B 5IKCB 3DI3B 3P11L 4XNZB 5IVZB 4DTGL 1DQTA 5IHZA 1J1OH 1JRHH 2SEBA 1A7NH 3QCUL 3HTLX 5LGHL 2J2ZA 5DVMA 5T3ZL 1URLA 3P0YL 5AG9A 1AHWB 4NDMB 3BXNB 4ERSL 3BKMH 1YN6B 5KG9B 4C56E 5IT2L 1QBLH 4NRXA 1S7UB 1ONQB 3PIQB 4PJCF 5E9DA 1U8QA 5DD1L 1S7RA 3ZT5A 1MI5B 2FIKA 2KL6A 1MCQA 3VU2A 3GBML 5J1TC 1UJ3C 4DW2H 1JHKL 1L0XA 3BO8A 2B2XH 1HCVA 1FP5A 1XCQA 4J4PC 4PRPA 1MCIA 3B9KC 1U8NA 3T0EE 1AC6A 3FFDB 5I73C 4NQCD 3O4OB 4NKOB 1OB1B 1EVUA 3RY5A 1JPSL 4ODSL 2QKIA 3QIWA 2A2QT 4BZYA 4NO0B 4OGYL 4AEEA 3NCJH 1ZWIA 1BVLB 4N5ED 1DUYB 1U8MB 5DJ8A 4X9IA 1CQYA 5BZDB 2YS4A 5EB9A 4HK3N 5FA3B 4A6YA 4YC2B 1K3ZA 2J88H 4WI6A 2HVKB 1HH6B 1KV3A 1XCTB 5EC2A 1I7ZB 2AJUL 2DBLH 3JWDC 1LP9A 3MLUH 4ZS7L 4P2OB 3NFPA 2WIIB 3EOAA 3AAZB 4FQXA 1GGCH 3EOBA 4S11A 5JHDD 5B3JF 2A6JA 4PS4L 2GCYB 2VWEC 3TN0D 2DI9A 4PJFA 2HG5A 3O3AA 5D7IE 2AI0L 2GK0B 5L2KD 1T1WB 1PY9A 4YO0A 3MRQA 3AREB 4TULH 3B3IA 4B0MM 3DBXB 5LWYH 4TVPE 1H3WM 1C7TA 5DEZA 2YC1A 1P84J 4OD2A 4GG6A 4WTWA 1W72L 4NQDA 3FRUB 1I8IA 2ZOKB 5F89B 1JNNH 3EO1B 3BIKA 3CK0H 1XZ0B 2JIXB 1MWAA 3V4VH 3HUJE 1KC5L 2DQEL 5B38G 5IW6A 4G6FD 1PZ5B 3VXUD 3Q3GA 3Q0HA 1AQDA 1JHTA 5HYQB 2I07B 3RVVC 1R0AL 1NJ9A 2XWTA 4HAGA 4R9HA 1IGCH 5MENA 5C0FA 1X5HA 3MLVH 2J6EA 5GGTA 3UYRH 1A6ZB 3QIUA 3BPCB 1QSEA 2APWA 2E8ZA 2VH5H 1TFHA 5FK9B 4WWID 3QXVA 1RIUL 1DQMH 3KPPB 3MACL 3NCYS 4XHQA 1A7BA 5EIVA 3GSWB 3KPRB 2IFFL 4UQ3B 4IRSB 3L95A 2XZQH 3P0VL 3P73A 4ODWA 1U8HB 1WTGT 4JDVB 1XF5B 3VXMB 4O2CB 1IM3A 4R4NC 3F58H 5DJXA 4W4OA 3REVA 1UWEL 3O4LB 2DD8H 4FTVB 3E6FB 1PKQE 2H9GB 3OKMB 4RFOH 3TM6A 3UPRA 1OF2B 4FZEL 4EOWH 5AZEH 3S3SA 1BVKA 4KH2A 3OQ3B 3ESVF 1EGJH 5DLML 1H8OA 2HJKA 2IAMC 1XT5A 3QPQC 3OKKB 1VGEH 4JO4H 5IB5A 3JSSA 4NHCH 1MCLA 3DTXB 1F3JA 4YDLB 4X7EC 4JY4B 1BJ1J 4MJIB 3ZKNC 3QXTA 1G9ML 2LVCA 4OFDA 4UIKL 5BZWB 3RKPA 3CPLB 5FYLH 3VXSD 1TTFA 2W0PA 4KI5D 5KS9F 5DZOA 3AXLB 5IEHA 5C0CB 4MCZA 1ZHLB 3Q5TA 1NGQL 2A6IA 5GRYA 4MA8H 3M17B 4XP4H 4PIRF 5IBTH 2PW2A 2GT9B 4P57A 2CIIB 2YOCA 5FYKU 5CBEA 1GZQA 3N06B 4PREB 1ZTXH 3WJLC 4C56D 2W65A 4RMTA 3AMKA 3ARSA 1KLGA 4KRMB 3EHBC 1T2QH 4UAOB 5TE7H 3T77A 3OXSA 1KB5L 2P24A 4X6DB 3GMMB 3FCTB 3OKEA 2E27H 5HD8D 5IB2A 1IMHC 1FL3A 1ZA6A 3CIQA 1NCDL 3U4BL 1A7RH 2YSSA 3QUXB 2R1YB 4BZ1L 4X6EA 2FB4H 3T0ED 2FRGP 1T1YB 2WIMA 3VFPA 1CU4L 3ULVL 1IKNC 4HC1A 3CMOH 4X5LA 1SEQL 1AXSA 2YEZA 4XXCC 2DLIA 5EOCH 4JG0L 5F7MC 5EIIA 3TWCL 1ITCA 4HFUH 2YRLA 2YD7A 2MKWA 4OZFB 4MDJB 4Y16C 2ZUUA 2CH8A 5FHBH 1MH5B 2X5PA 2ED9A 5DJ2B 3T0EC 3H0TB 1CL7I 1LNUB 4QGYA 1WBZA 3LD8B 3GB7A 5C09B 5AG8A 4ZYKA 4ZSOE 5GGVY 4X0KB 3VXPB 1N5YL 1CE1L 4W6WB 1S9WB 4R7NB 1P1ZB 1TQCB 2J5LC 2JE8A 2UVFA 3LMJH 1T4KB 5CJXA 4QWWD 1U91B 3REWA 1KBGL 5EN2A 2XZAH 1FL6A 1I85C 4U2ZA 3VW3H 4MHHG 2YPVH 3PP3H 2YD1A 1UXWB 2V2XA 3W0WA 1A6WL 2B5IB 3N1FC 3HPJA 3L1OH 4Z7UF 3MO1B 4PUBH 4L8CB 4YDKL 1SYVA 3G6JB 5FYJU 1D5ZA 4HS8H 3SE9L 3ROLB 4PJ9D 4X4ZA 4WENB 3SDAD 3U0TB 3OAYH 2YWYA 3ROOB 5ESVB 1FYTA 4QWWC 4K2UL 1CFNA 4NNPL 5IVNA 4WI2A 4GKZA 4FXKA 1GJIA 1XGRA 2V9RA 3GZKA 1ZLVK 4G8EB 1QBMH 1DEEA 4LSPH 5IFAH 2X05A 4YBLB 1KB9K 2O61B 3BUYB 1M05B 1B0GB 4OQTL 5AUMA 1D6EA 3VFUA 1G9NC 4N0FA 1FE8H 1HZHL 1KJ2H 1IARB 2OP4H 2YUVA 3TA3D 4KKLC 2AJYL 5KW9H 4NO3A 5D72H 1BREA 3J7HA 3RWGA 3BP5B 2W59A 2X4RA 2BY3A 3NPSB 5GSRB 3OG4B 1DSFL 3BISA 4HWEL 3L3DA 1I8LC 4EQ2A 3NZ8B 1ADQH 3WS6C 2W9DH 3MLTA 4PRBA 3QRFM 1AGEB 5JPNB 3WXVL 1NFIA 3AM8C 5IMKB 3UBXA 4XWGH 4ZD3H 1MRDL 1S7SB 3LN5B 2P49B 3FO0L 2ZJSL 1MFCL 1V7NH 5C0BB 2K7PA 2B8OT 3U30C 1YPZB 2Q7NA 2Z8VC 3JZ7A 3DPBA 3UTTB 4AEIL 1MHPH 2C3HA 3P2TA 4IS6B 4JFHE 5T3XD 3RWFA 1JZ5A 3MV7B 1E6OL 2DN7A 5F71A 4XBPA 3C5ZC 4ZFFA 2DL2A 1TZHA 2UVEA 2VXVL 4WNQB 2PCPA 1FNEA 2NTFB 4L8BB 4UI2A 4AH2A 3U0PB 2CKBH 3B8SA 3PQYA 4XZUA 5FF6A 5CWSB 3U82B 2J8UB 1S8DA 3RL2B 1VACA 4UT9H 2F5AL 3LKQA 2IANB 4LMQI 3UBXI 2FWOA 4PGDB 4GLRH 4UT6H 1EVTC 3C9NA 2Y7QA 1S7QB 2XN9E 3ME0A 4MS8C 4DVRH 2F8XC 3BIAX 1IAKA 3VFGH 2DS4A 1NDMA 5KSUA 4OLWL 3SQBA 3VRJA 4PV8A 4X7TB 2P5WE 2Y25A 3MSPA 4R97B 3IFPB 4F33A 3BH9B 5T1LD 3QWOB 2PNDA 4CNIB 3FQNA 4OGXL 4PB9H 2FGZA 1HHIA 1R3JA 4FFVC 1Q72L 5DJ6B 4APQC 2GJ6A 3PWNA 3VWJB 4PGCA 5I8KH 4QXUH 3I6KA 4YE4H 5C0ND 5DDHA 3NZHL 3HC4H 2VN7A 2CLRA 3GMQB 1NEZA 4ZXBA 4BH8B 4HX1A 5SWZB 5ICZA 3DX6A 3OR6B 3EYFA 3DGCR 4YBHA 4N90E 2HKHH 4GS7B 5GRWA 2VLRB 3HMXA 3I84A 4CVUA 1VFAB 3LPWA 5IJVA 1OCWH 3O6FC 2FDBP 3BPOC 4XCFL 2C1PA 2ZKHL 1ZVSA 5ERWB 2DQTH 1I1YA 2Z0BA 3OV6A 4U1NA 4OKVA 4ZAKD 4NQSB 5JW4N 4X6FB 1FPTH 1YNLL 3TPUA 5KANG 1JPGB 1EEQA 2GITB 25C8H 4GT7A 2BVEA 3KR3L 3RY6C 4Z7QE 5D6DC 2ZCHH 4KK5C 1T83A 1BQUA 1HKLH 4AQOA 3JWOL 5FO8A 1JZ3A 3IXAB 2J8HA 4JANA 4WW2C 4FQHA 3GHBH 5LGKA 3QCTH 1HEZA 1HXYB 4KI1A 2AJ3B 4EN3D 4K23L 5AYUL 3G6AA 3RX7A 5CD5D 4PGEA 5HHME 3PDOB 4S0SD 4IMLB 2X41A 4I48A 3V6BR 1T7WA 4MQTB 3LKSA 4LCWB 5FCUH 2AEQH 2Z92A 4ODHL 2DMKA 3T4AB 4L8DA 1BFVH 3KGRA 3OJDB 2XG4A 1TENA 3QHFH 3IF1B 1EERB 1YPZF 2VDPH 5BVJA 1YQVH 4WTZA 4FFYL 3QI9A 4Z7VA 4OFVA 2PTTB 4EN3C 4UOJA 4GRWH 1U95B 4N8VA 5J6GB 5F6HJ 3GMNA 3HCVB 5LBSH 5SWSE 2FD6L 4NOFA 4Y4FB 1G7MA 4LPUA 1CDHA 5IK3B 3W9EA 5HHQB 3C6SA 3ULUE 3KXFE 1A02N 3WO4C 5I15L 3MQIA 2VZ1A 3T2NL 4G6AD 2N1KA 1A6UH 3IB4A 1MQ8A 4C83B 3FMGL 3IKKA 4NWTL 1YY9D 4NNYB 4RRPG 3QULB 1YEIL 1DJSA 1K8DA 2YN5A 1KFAH 3OKOA 8FABA 1IC5L 4L8SA 2I24N 1NCWL 5FAAA 2ZOLA 4HBCH 1P2CA 4JPIA 5FDYA 2MCPH 1PDKA 5L0QC 4S2SA 1U8IA 4OCLC 4O02H 4R0LC 4MNGA 4HKZA 5H94B 4PP2A 3T0AA 1VFMA 4WY7L 4WFGE 1F4YL 2V17L 5GZND 1DBML 4JFHD 1NGPL 2BY2A 1BLNB 2CKNA 2ERJB 3P9MA 4JDTH 3RVTC 3DSFL 3WHXB 3OKLA 5HJ3A 2G60L 3QISA 1HINL 2GY7B 3QUKB 3HC3L 4KKBD 3T0VA 2A9ML 1CDBA 1NAKH 2IH3A 3GJEA 3N0PB 4PD4J 5INCB 4I3GA 3NPZB 1F90H 3C09C 4EXPX 4BFEA 2RHEA 4NT6A 5D1XC 1Q1JL 4CN6A 1S5HB 3T8XB 3PUCA 3MLSH 4HK0B 3CU1A 1R3LB 3HRZB 5EO9A 4QRTA 4PJDB 4RGNE 2CXKA 3MFFA 5ADOH 2DTMH 1JNJA 4Z7WA 2XN9D 4XBEL 4KGJA 1A0QH 4FMKA 4DOHB 3EYSH 3KG5A 3WIIL 5LKNA 3SKJL 4X99B 2ICEA 1LO4H 1I7UB 3GJFH 4RAHA 2R0WH 1BWWA 1LO2L 3EDKA 4NQCB 1JIBA 4J3WA 3GFUA 2NZIA 4JHWH 4M03A 1VPOH 4F2MA 3BKYL 3RTQC 3HMWH 4TOYL 2R0ZL 4YHKH 1LEKB 3QHZH 4PJ7A 4OCYL 4TSAH 2N7BA 2VLJA 3HZYB 1I1FB 4X7FC 5IWLC 1XIWD 5HVFB 1W8OA 5KJRH 4GAYA 5HDBF 5EZIH 2DTSA 5GS1B 2IPKB 5I1CH 5DEFB 3MA7A 1MIML 4JAMB 4PTTA 5T5FH 1TMCB 5JHDB 3VI3F 4N90D 3LRSB 4MA3B 3U7YL 1S9YA 2IPTH 1H0DA 4QNPF 4XGZA 1U3HA 3O0RH 3NH7L 3PJSB 2F58L 3TN0B 4GW5B 2FBJH 1FVEA 4QOKE 3AS3A 4OZIB 2DLGA 2FEEL 2IG2L 2OCFD 3IAGC 1L7IL 2NLJB 5GGRY 1M71A 5L2KB 1J0YA 4LSSL 3VCLB 3FTGA 3TO4C 1VA9A 2VXUL 2C3WA 3SDCC 3DVFA 2QQLL 2D03H 3LHPH 3RGVD 4YHLL 1RUQL 2X4PA 2D3VA 1IM9D 5GRJH 3H9YA 4Z77A 3BZFB 1KXVC 3CFKB 4CJ1A 4QF1B 1PEWA 3MROA 1CGVA 3LEVH 1U3ZA 3Q1SH 1FJ1A 1NCNA 5HHMD 2FR4A 4XPBH 1QRKA 1RUPH 5ITBH 4PJBA 5HGBA 1BECA 4X7CC 1M6OB 4G6FB 3EYVA 3VXUB 2VR5A 3QEUB 3FQTB 4H8WL 15C8L 3L3KB 4NCC1 1UWGL 4P5MA 3BJ91 1VFUA 3ARBA 1DQQA 2VSCA 1FLRL 4R2GC 1N6UA 2YA2A 3ELAT 3M1BB 4L3EA 4CVZB 3RVXC 2I9TB 3P4MA 4P99A 3B9EA 1KPVA 1N7ML 2IAMB 4PJHA 4X6CA 5EPMB 4Y5YB 3VFNA 5SWSD 3BH8A 1U2HA 5GSVA 3KJ4C 3VDCA 1FVCB 1G0XA 4ZS6D 1MJ7H 4F7CB 3ULUD 3KXFD 4KQ4H 2EO9A 3S98A 5E4EB 2CR6A 4FQJL 5TDPB 5JW5B 4M3JA 2NY3C 4NO2B 5DGRA 1EMTL 3GMLA 1ETZB 1BD2A 3MA9H 5CFHA 4LEXL 3V7AG 4IHOA 3SHSA 1OGAE 2B1HH 3BWAB 4R4FH 4KZEH 2ZCKH 3DGGB 3FHQA 2QQKH 3ILPB 3TNMA 3ILQD 1NFDB 3VXSB 5L88H 5IQ7L 1CVSC 1DVFD 1AGDA 5HYEA 5KSAA 4X4YA 1MIEL 5DC4B 4XH2A 2WQ8A 4K94H 3ARFA 5HHPB 1W8NA 4PYHA 3GO1L 4MDIB 4XT1C 2OSLB 1TVHB 1H5BA 5B4MD 3GM8A 4YHZL 4WVRA 5FOJA 2F54E 4Z78B 4TPRL 2VDLH 4G6JL 5D1ZC 3MCLH 1MCOL 1XGTB 3F5WB 4JZOB 5DVKA 4OQ1A 4LCIH 1RZ8B 1KB5A 4C56B 1YMMA 1TCRA 3VFRA 2ATKA 4PGZA 5E2TH 1GYAA 4HW6A 1ITBB 1EAJA 3DX8A 1AXTH 4NZTL 1CGSL 2XFXB 4YIQA 3EJYD 1BPVA 3QAZC 2WANA 3UTSA 5E8DH 2XY1A 2XA8L 3VI4F 3X13A 5KVEL 2X4SA 2MQCA 1IKFH 5IHBA 2BC4B 4F7TA 5D93C 1DZBA 2A74A 1E6JL 3T0EB 2VDOH 1B6DA 2YPLD 1WJ3A 3O2DH 2LU4A 4NP4L 1KELH 5CIPH 1N5AA 1PSKH 4WJ5B 4PBXA 5DRNA 4P5TD 1FNFA 4ZUTB 3FHAA 3UTQA 5F7EH 3RFZC 1P9MA 4UILH 3NACL 4RGNC 3LQZA 4HKBB 5I1GH 2WUBH 1RURL 5FKPA 3EO0B 5CILL 5FGSA 2A0LC 3OZ9L 3QNYB 5ALBL 4CMMB 2E7MA 1FO0B 3V5HA 1UACL 4KHXL 4FQPA 5KTEH 1UB6B 3ECBA 5EC1A 2ZNXA 5DVNA 1U2CA 4QXWA 5J1AA 2BMKB 4G7YL 4QKXB 3F7YA 4TUJB 1E28A 1Y6NR 3QUML 3V52L 4D9QD 3PHSA 4QOKD 3VWKA 2NY6D 4LSQH 3DX9B 3STLA 5D7IB 3M8OL 2GAZA 2VISA 5DRWA 4I3RH 4M61B 3GNML 2HLAA 4Y4KC 2O26U 3DYMA 5DUMH 4H25B 1E4JA 5EDXA 1WWCA 5TE4L 3I3EA 4KHTH 1NUNB 1WCQA 1NMBH 4HIJA 5L7XH 5DD5H 4LQ1A 3I6GB 3O8XC 4HEPG 2NY2D 1YECL 4PJ9B 5CZXD 2HA1A 4G9DA 2BNRE 2F74B 3DO7A 1UFUA 5F7NC 1CZ8L 1GSMA 2BVQA 3AS1A 3ES6A 3SDAB 2WBWB 4MLIA 5F6HI 2DMCA 4KMTH 1N6QL 1OAKL 3QQ9D 3EYQC 4KKNA 4NQXB 3HUJB 5I1HL 2EYTB 2F5BL 2ITCB 3P4NA 5FO7B 3DUHA 5GHWL 1FNSH 2DQGL 1I3UA 2JK5A 1FYHB 5D71H 5E6IA 3ZYIA 4CMHB 5D7KE 4OQTA 3BIBX 5BS0E 1VB9A 4PLKD 1FCCA 3MR9A 2BFVH 1I9RL 5DJAB 5HVHB 4Y1AE 5I74C 1LO0H 1JMXA 3VH8A 1BOGB 2ZSVB 4ETQA 4Z8FH 3HNSH 5EBWA 1YN7B 1C12A 3MRFB 3TA3B 1A6TB 1AO7A 4HUMB 5FKAB 3VFVA 3QQ9C 2GHWB 1M7XA 4MB5A 1MRFH 2R29H 3S37L 2QSTA 1BWMA 3HZVB 4K71B 4G42A 5ESAB 1XF3A 4M6ML 1HYRC 3VGHA 4KZDH 1NGYA 3BKJH 4E0RB 4NKMB 1PKQB 4K3HA 4NRYA 3KPNA 2XTJE 1QFWH 1CCZA 4NZUL 1I7RB 2XTLA 3AU1A 3D9AH 2R15A 2ZUVA 4D8PB 5CCKH 4WHTB 2HN7A 1WZ1L 3E6HB 1A1OB 2P7TA 2BJMH 4KKCC 1KIQA 4BUGA 2DQCH 3FO9A 3RNKA 1JGUH 4GXVH 4MX7B 3QJFB 2X89A 1KSRA 5B8CA 4M6AA 2OR9H 5FA4B 3MRKB 3SGEI 3MNWA 5EWIH 5D5ME 4ZO9A 1HHGA 1RZ7L 3RWDB 1XEDA 5K9QG 4K3GA 1UQSB 2OJZL 3ZHDA 4LLMB 5DK3A 4O00A 5JORA 1J7VR 3Q5YA 4HEME 1ZLWH 3S88H 5LCVH 3Q6GH 2DQJL 2EDBA 1G6VK 4LOUD 4B50A 2EXYC 1YMHB 2BSSA 1F6AA 3VFOA 1DBJL 5IVXA 1DUZA 1M7IB 3ZDYF 1J1XL 5KVGH 4JB9L 3IDJA 3UJTH 4W68A 4DGVH 3TBTA 4DWHA 1X4ZA 4NKIH 5FUOH 2X44D 7FABH 1X6LA 3P4LA 3KYKH 3DECA 4EBQL 4Z7OE 1YQ2A 4ELMA 2NW2B 3BN9C 4V1DE 5J89A 2JCCE 4M7JH 1FNLA 5I9QB 1EAPB 2YRZA 3TCLA 4AQ1B 5MHSE 3THML 4JM2A 5C2BL 4BSWB 2VIRB 5SWQA 5D7SL 5CAYB 5T1LB 4LU5H 4ZPTA 1YY8A 3O6FB 3N85H 4HZLB 1T22A 5GGUA 5JHLH 2ITDA 2X10A 2FZ3B 1WWWX 3HE6D 4OV5A 3OJVC 3GSOA 1XAUA 1ZSDB 3VD5A 2NY4C 4FRWA 2VC2H 3MRCA 2CK2A 4CVXA 3G6DH 5IB4B 5CHNA 3LB6D 3QZWA 3V8CA 4MB4A 1S7XB 4XTRC 5HYJA 4Z76B 3MPCA 4U0RB 1HOCB 3O3DA 3TVMA 4P23D 1PYWB 4ZSOB 5FDWB 5D96B 2DBJA 3EKCA 3FT4A 1I1AD 5C08E 5KN5A 4N0RA 4ZAKB 2WLZA 1BBDH 1QVOB 1NCBH 4PJIA 4FQIL 2ZUQC 4K7PH 4PRAB 4JQIH 3WSQH 4LSVL 4YGAB 5LGJB 3Q2CA 4DVBB 2R0LL 2HMIC 4NCDA 2Q8AH 1OGTA 1Z5LA 5DJDA 2GFBA 4OTXH 1WCBA 2CRZA 1AKJA 3NGBB 1BEYL 3GIVB 1H15A 1JK8A 3GI9H 3O6LH 1G7LA 1F45A 5CEZE 2P1YA 5D1QC 4EN3B 1P4IH 1CTOA 5DI8A 5F88A 3IJHB 2BNRD 4A6YH 5HHNB 3DVNA 1BQHG 4OF8A 2EKSB 1UM4H 5DTFA 5C0JB 1OTTC 2R4RL 3T4YB 1Y6MR 1OAYH 4QXTB 4GXUN 4XC3L 3BVNB 4YHMH 5CJOL 3C8KA 4R7DB 4KQ3L 2OXGA 4LHQB 2YHGA 4WDIB 1NCCL 3BN3B 5BS0D 2XACC 5E94A 2V2WB 2AK4E 5HTSA 1J0IA 3PP4H 3W9DB 2C5DC 4FABH 1RHHB 1UCBH 5TDOB 6CGTA 4TNWF 4Y1AD 1FV1A 2YMXL 2E5EA 4UT7L 4HWZA 3IYLW 5MEQA 3MJ7A 4KJPC 4KAQH 3VXQA 1JZ7A 3G5VB 3HA0A 1QPPA 1ES0B 2HKFL 1RPQA 5DVOA 2R2CA 3NFNA 3WXWL 4DCQA 2V6HA 1IQDA 3IJSA 4XPGL 5E4IA 3BSZH 3G5XA 1AFVH 2VAAB 3F6IA 1A7QH 4BJLA 4G7VL 3MV9E 1DLHA 1MWAH 5DYOA 5D2NE 5DWUH 2ICWA 3EYOA 4M43H 2XTJD 3UEZA 1GGUA 4Y5XA 1FN4A 3SDDD 1MCWM 4QXGL 2R2HA 3D25B 5E8OB 4IRJA 3FZUC 3PL6C 4NFBA 5C0EA 3W2DH 1Z3GL 3V95A 1A5FL 2J6EH 3F8UB 3NVQA 2A83B 4JFZH 5F9AC 5GGTH 2PTUA 4GBXC 5I17A 4RWYL 4Y4HA 3P77A 3EDJA 2JB6B 2FSEA 4MQXC 1I9JL 2ZG3A 1IEBB 3I75B 5DT1L 1OL0A 4PJ8C 4KMQA 3TZVA 4JPVL 4MD4A 2F53E 2O5XH 1RIVH 4PG9B 3KYNA 1CI5A 4LLWA 2NW3A 1MPAH 2BSRB 3RZWA 3MODL 4H5SB 2ADGB 4YJZL 1NMCC 1UEMA 3T3ME 1D9KA 3GIZH 2NX5A 5HDQH 2FATH 2W9LA 1UH4A 2P46B 4P59H 1RUAL 1EFXD 2X7LA 4JQVA 2FGWH 4KKAD 3T1FA 2ICWI 2CJUH 2FEDD 5EU3A 1EK3A 1MLBA 3CFDA 4WW2F 3VGBA 1Y18B 4ZOAA 5IM7B 3VXOB 2XN9B 3DMMD 4V1DD 2LVEA 5MHSD 1HE7A 5IROA 3UMTA 2JB5H 2Z9TA 2P5WB 3V6ZB 5TQ0L 2PR4H 1CDUA 2B7DT 3MNVA 2WBJC 2UY6A 2DL9A 2UZIL 3MXWL 4OZHE 3CAFA 2XT1B 4HGMA 2BRRH 5BQ7B 1KPUB 5KVDL 4OI9A 4JJHA 5J6HA 3FT3A 3Q5OA 3IJYB 3LQMA 4G8GA 2GSGB 1FG2A 1R3KA 3SGJA 3LEYH 3QWRA 1XIWB 3GBNL 2D7QA 2EDJA 4S1QL 4AENB 5B38A 2H8PB 3WKNA 1AD0A 2HVJA 1ZGLB 5T1KD 1CL7H 4ONFL 4Y5VA 5CGMA 1UA6H 4Y2DD 4L4TA 3O3BA 1UT9A 4O4YH 1XGPA 5HGDB 2MCG1 1OPGH 5CSZB 4QRSB 1CLYL 1U6AL 5JXEC 4MXWH 5C08D 4HJ0C 3QH3A 4JZJB 3E2HB 1H3PL 3NMEA 4UU9A 3BKCL 1XF2A 3O11B 3G9AB 1NGWA 3RAJL 3UTZA 4LIQH 4RIRA 4S1SL 4HC1H 4XNYL 5F6IC 4Z0BL 1DL7H 2XXMB 3RGVB 2H1PL 3MX0A 1GZPA 3DRQB 1IGML 1DCLA 1IM9B 2CLVB 5CEZD 4N1EA 1ZT7A 3ARYA 3T0WA 5LXGL 4JO1L 3S4SB 3KPQB 5C0GB 5HHMB 5FECB 1BJMA 4JRXA 2BOCB 3PNWB 1E4XL 2E6JA 3DROB 4L29B 4OBSA 3B6SA 3FFCD 2CUIA 1VKXB 3NAAH 2WBKA 3WFBH 2FEEI 2RQ8A 4WFFE 4RFEA 1F42A 3ARDA 2MQ3A 3BYTA 5E8EA 3ULVD 2AK4D 3CDCA 2IBZX 4KUCD 3HR5A 1E4KA 2YK1L 3LDBC 1U8JB 3MV01 4U6HA 4U4BA 5I1LB 5JUEH 3UXFA 4K94C 5FYJH 3WHE1 4MNHB 2NR6C 4ODUA 3TT3H 5SWSB 1N0XL 1YEDB 4ONGL 2DB8A 1DQJA 1QR1B 4FFWD 2BOBA 4QHLB 2EIEA 3KXFB 4QTIL 4IOIB 5C0AA 4F9LC 3H6JA 3IXTB 3FONA 4XCCL 5J0BA 1C08B 3MV9D 4KK6D 4JR9H 2APVA 4YGVA 5TPWH 2FO4A 4MLSA 3AY4A 3PGDB 1HHJA 2Y07L 5IB3B 3DUUA 1OTUD 1OM3L 3BRDA 2OL3B 4HPOL 4LEOA 3A67H 2BVPA 5F9WB 5CSGA 4J3VA 4NUGL 5ID0B 4G8IA 3RWHB 5IBLD 4RX4A 3MREA 1UZ6F 1WVZA 2DQUH 1QYGH 1DVFB 2ZNWA 4J1UB 4RFNB 3DV6B 3DWTA 4JEGB 1INEL 4QHKJ 2F53D 2F15A 3WKML 3CXDH 4UUJB 2DQFB 5FUZH 5FV2A 1TJHL 1ORSA 4D0DA 4XC1H 2HH0L 1F3DH 5LQBH 1NPUA 5JXAH 5E2JA 4P46A 1QP1A 3MBED 3SDXA 5BW7C 1U58A 4DN4L 1NC2B 1RVFH 3HPLB 4I0PC 4JRYA 4Q74A 3BMWA 2AK1H 1FQ9C 1SEBA 4H1LB 2F19H 4GG8A 1B88A 5HGAB 3X14A 1HDMB 1IILE 2CRIA 5J57B 3O6KH 2M1KA 3LS5H 1L7TL 3TNNB 2YXMA 1WAAE 1CDCA 3TT1L 1EX0A 2HFTA 3OJMB 4NQUA 3BDBA 5JOEA 1T21B 5GGSY 2YPLB 5I16A 2VDKL 4ZTOH 1QZ1A 4LFHG 2XKSA 3RZCC 1D6VH 3HZMA 5GZOD 3RIAF 4P5TB 2E7LC 1ZE3C 2FX7H 4U1HB 1A9EA 5B39A 1YEKL 3V6FA 3QFJE 1K4CA 1Q9WA 5J13C 2HAZA 2DWEA 3S35X 1GGIL 5ICXB 3BD4A 1JYNA 3I9GH 1T5WA 1I3GH 4K3JL 4XNQB 3CMGA 3T0DA 1F4WH 3CCHB 2QBWA 3QFDB 1D3CA 3ZHLA 3CD4A 3QUMA 1OP3K 3EFDL 3PGCA 1REIA 4PRIA 4WU7A 3ZHKA 1EO7A 3ZE2F 3BGMA 1L4IA 4D3CL 4QOKB 2UZYB 1KTRL 1K8IA 2NY6B 5F93C 3VGAC 2HRPL 3NCMA 3QNZA 1C1EH 1NSNH 4F37F 1EJOL 4YBQC 5GGRA 3H3PL 1QG3A 5CP3A 4R26L 1WUNT 2WQRA 3BJLA 5F8QC 5TE6L 1MEXH 3CLEH 3QB7C 4PRNB 3GDBA 3L3HB 1F4AA 3OKDB 5ISZE 4R8WH 1TTGA 1QA9B 3MRIB 5CGYC 1OAZH 3EYUH 2VO5A 2NY2B 5MI0C 5C7XL 1OSPL 4EIGB 3EDFA 2P43B 2XPGA 4KVCL 4XRCA 3VRIB 3MGOB 4MYWB 3L7FA 1GIGH 3I6LE 1T1XA 2FX9L 1ERNA 3VXRE 2PW1B 5K59E 4XP6H 1KPRA 4KU1A 4KUZH 4UINH 5TDNB 2EEBA 1D5IL 5IW3A 2CKBB 1IC4H 3C6LA 4HMDA 4WFFD 3RWCB 1W0VA 1FFOA 5ANMA 1M7DB 5EUKA 4CGTA 3KPSA 3LRGA 4GO6B 3HB3D 3BW9A 1OW0A 4K3DH 1MY7A 1CFBA 1YEHH 2UUDH 1YYLL 4PBVC 4XCNB 5F7WC 4Q97A 4WO4D 3BI9X 3S36H 1DE4A 1N26A 3MZGB 5KSVA 5BO1L 4F3FB 5I75C 5I8CA 4GW4A 5D4QA 1PBYA 1A6PA 1MELA 5IQ9A 1QD0A 4X9FA 1NBZA 2EXWD 1VCAA 4KFZC 4P4KA 1IZKA 4NO5B 1T0PB 4NM8L 2I9LB 4LLVA 1X5LA 4Y19A 3IDGA 5H8DA 2R69L 4YFLI 5CMAB 4JLRA 2MHAB 3BT2H 5DJCB 4LNRA 4NUJB 2Q86B 1OGAB 4HGWA 4ORGA 4XPHH 4HUVB 5ILTL 2ZG2A 2XQBH 3TH3T 1J5OH 2DDQH 5EU4B 5TGBB 5C71A 5J11B 2B0SH 1NMAL 1ZVHA 2H6PB 4M6OL 3C60A 3ARXA 4R96B 1X5XA 3FN0L 4HIXH 5EOCJ 2HWZH 4YX2L 4EI5A 5GRZA 4Y88A 3PV6B 4HWBL 1XGUB 4HV8B 4Q9BA 3BHBA 2X1XR 4XNMB 4EI6B 3QQ3A 5H37H 2AAVA 3U7WH 1BBJA 4MA7L 4D9LH 1GOGA 1H3UA 3HE7A 3I50L 4PJGF 5IKCA 1TPXC 1QLFA 1PD6A 3K74B 1YNKH 5FHAL 5IVZA 5HHXH 3RUGE 4ZO8A 4KRPD 5C6TL 3AVEA 4M7LH 4XVSH 1N3NB 1O7VA 1AHWA 4V2BA 1S7TB 4NDMA 3BXNA 4L1HA 1YN6A 5KG9A 2G2RB 5F9JB 4GKNB 1S7UA 5E2WL 1ONQA 1WEJL 3PIQA 4IRZL 3P11H