4BQ9A

Crystal structure of the fn5 and fn6 domains of neo1, form 1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
205
structure length
205
Chain Sequence
b'TPMMPPVGVQASILSHDTIRITWADNSLPKHQKITDSRYYTVRWKTNIPANTKYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGATFELVPTSPPKDVTVVSKEGKPRTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTPGTKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NEOGENIN
publication title Structure of the Repulsive Guidance Molecule (Rgm)-Neogenin Signaling Hub
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 35
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bq9A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bq9A02
1AFVL 1D5ZB 1EERB 3GSWB 3MOBH 4P46C 3QUMH 3LV3A 2DM3A 4K23L 3GJFA 4X6CE 4M7ZB 3HMXH 2P47B 2WIIB 4N1HB 4MVBD 4G3YH 1A7BA 5J0BA 1HKLL 3HZYA 4GBXA 5HY9B 1E6JL 1Y6KR 2CQVA 1KTLA 3F58L 5TDOA 4OCWH 3HI5H 4JPIB 4OFYD 1OP3H 1D5ZA 4YDKH 2BJMH 3T0AA 3MLSH 1INEH 3ARQA 4NZUH 2YK1H 4OFKA 3I50L 2VXSH 4ZPTA 4C59B 4MAUL 5IQ9B 2QQLH 5JQ6H 2JIXB 2WIIA 2BCKB 5GZOC 1G1CA 2X1WL 4GW4B 4OCLC 5GGVL 1U92B 1YMMA 5HY9A 2FO4B 3LKSB 2X6MA 3P4OB 4Z95L 4LLYB 5DHVH 1HHJA 1K85A 4OLEA 4JPIA 2VDRH 1DANU 5BRZD 4UUJA 1U0QA 3RWGB 4XPTL 2ZKHL 4ZD3H 4Q0XL 3OKOB 2YR3A 3HZMA 5IQ9A 2JIXA 2BCKA 2P5WE 3QG6A 5C0AA 2O5XH 3HFML 2H32B 4GW4A 4GG6E 4OQTL 1U92A 1V7NH 4GW1B 3LKSA 3RKPA 4OIIL 4H20H 1DANT 3P4OA 2ZNWA 2E7LA 2N4IA 4LLYA 3GKZA 3BKMH 3SO3C 4DW2H 3WD5H 4ORGA 4QRSB 3RWGA 4YUEH 1TZHB 4LFHD 5FYKE 5C2UB 1DLFH 4MJ5B 5F7HA 2AI0H 4FTVD 3TP4A 1IZKA 1Z5LB 5AYQA 4Y2DC 1P4BH 2H32A 4GW1A 3MV8E 1J1XL 4PJDA 2NY2D 1FNLA 3WNLA 1TZHA 4ODTH 3W5NA 4MJ5A 3SQOH 3IDMB 3DUHA 4QXUH 3HI6L 1Z5LA 4R0LB 5IG7B 5LAXB 5DQDL 1JZ4A 4R6UA 5IMMB 1IEAB 5JNYB 4ZOEA 3DARA 1KOAA 4FFZH 3U79A 3W81A 1IAIM 5CP3H 1JP5A 5IW3A 1IQDA 3DX6A 3I6KB 4ZOAA 3VD7A 3IDXH 2OTWB 1I8IB 1CGTA 3ULVC 3LS5H 4WWID 4J6RH 3P2TA 4GRLD 3IDMA 5I0DA 1MJJB 1TETH 4R0LA 5IG7A 5LAXA 1D9KC 3PUCA 3D5OF 1BQLH 2ZG3A 1TTGA 1QRNB 4H1LB 5L9DH 3CD4A 3KXFD 2XT1B 1IEAA 5IMMA 5JNYA 3LPWA 3ABZA 2VLJA 3SDDA 4HIXL 4FQJH 3I6KA 4U0QB 3ULVL 3CFBB 1J86A 3CFCH 2OTWA 3BE1H 5H37G 1K2DA 4UDUB 2AJVH 5HHNB 1H8SA 5DTFA 1K4DB 3V5DB 3VXQB 3AROA 2KQNA 1MJJA 2NY3D 1LQSR 1WQVT 3MXWH 1QRNA 4H1LA 5TFSH 4CBPA 2G2RB 5IVXF 4LMQI 3RVXD 3EHBC 2ESVA 1DE4A 2AK4A 5F97E 3V6ZB 3RWJB 1YY9C 5HDQL 1GZPB 2NY6B 4HC1L 3K81A 5GRVL 3ARXA 5HHNA 1A6ZB 5IB2B 1K4DA 3QXDA 5T1KA 4HX1B 4NKQB 2FHBA 2G2RA 5ANME 4OZIF 3V6ZA 4NPYB 3RWJA 1T83A 2DLGA 3MA7B 4K8RC 1GZPA 3EOAA 4L4TB 4HMDA 1R3JB 4P2RE 2YPVL 3VXUE 1EGJH 1X9QA 1A6ZA 4FOMA 5HI5C 2J12B 4XP9L 4HX1A 1F2XK 5EULV 1DL7H 1KB9K 3QEQB 3GMNB 3RTQC 5E6IC 4K8RL 1HIML 4NPYA 3MYJB 5EA0L 4AMKH 1Q9LB 5HDBF 3O6KL 4GFTB 1R3JA 4NP4L 1R3HB 4QRQB 1D5MA 4YPJA 4P9HC 4OTXL 3J7HA 2I26N 1A4KA 1YQ2A 5EH1A 5JOFA 1A3LH 4CU7A 3H9SD 3OAYK 2BVTA 4OLUL 1ZHKB 4FA8A 2QKIB 3SDXB 3QEQA 3QIUB 4RGOL 3OV6A 2QQQA 3KYKL 3V2AR 2H9GB 3H2WA 3MYJA 3SE3C 2LVCA 4P9HL 5DVMA 4LASL 3VGHA 1UYWL 1R3HA 4QRQA 1BQHG 1HWGB 5BS0D 3WXWL 1KGCD 1RUKL 1Q9WB 4IS6B 4R4BB 3UPRB 1KCUL 3EGSB 3L5WB 4KZDL 4Z0BH 2QKIA 3SDXA 4AJ0A 3QIUA 3VXMB 4XVTH 3CFIC 1NLDL 2H9GA 2GCYA 2FIKB 4ISVA 4KU1A 4M48H 1QFWM 4RMVA 2EYSA 1RFDH 2OS7A 2YMXL 4OJFH 1VPOH 1Q9WA 1PY9A 4UI2A 4R4BA 3UPRA 3FHQA 1GOFA 4JQXC 5J1AA 3EGSA 4NO3B 3IU4H 3L5WA 4J4PA 2VH5L 4N0YH 5TF1H 3VXMA 1ES0B 4OF7A 3QFJB 2E6QA 2FIKA 1L6XA 2GJJA 1BFVH 2DI8A 5HHVL 2VDLL 1QLEL 1NEZB 1Q72H 3KYAA 3O4OB 1JYNA 5IP4A 1FFQA 1PEWA 2MQ3A 4HGWB 4UB0H 3WS6A 4JO2H 4P2QD 4UBDC 3OSKA 1FH5H 1HINL 1B6UA 1MJ7L 1QKZH 1B2WL 3QJFB 1UH4A 1C7TA 2I60L 1FIGL 3AS1A 3A6BH 1OAUL 1ES0A 5IVXE 3QFJA 3VW3H 3D48R 4GMSH 1NEZA 1MRCL 4S1DD 5DURB 5CD5D 1PD6A 3LHPH 4KDVA 4LPTA 4JQVA 3CH1B 4EBQL 4G8GD 5I8CB 3FRPG 4HGWA 4KK9D 3OAUL 2ORBH 2CIIB 4LARH 5F7FA 1I1AD 1K5NB 3GSNL 4NN7C 4AEIL 3QJFA 4Q9BA 4HHAB 4ZFOL 1ADQL 4X8JB 2MSPA 2K1MA 3K3QA 2QBWA 4LPXA 5I1HH 1INDH 1CWVA 5BVPH 5CZXD 2LTQB 4OT1H 4XC3L 1JTTA 1X5XA 3CH1A 5I8CA 1FO0H 2W60B 4G5ZH 2CIIA 1XMWA 1K5NA 2HH0H 2ZJSH 4H0GA 3REWA 2P5EE 1ACYH 4HHAA 3VWJC 4X8JA 1IM9D 1IBGL 4JDVB 3TM6A 1UGNA 5HHQA 2QQKH 3RL1B 4Y19B 4WI2A 1HXMB 3TBWB 4CKVX 4C57C 1KB5H 4YR6B 3SE4C 5HDBE 1RUPL 3CMOH 3CFEB 3VFGH 3GO1L 1LO4L 3OB0K 3K0WA 3QWQB 4FQ1L 2CUHA 1L0QA 1MIEH 4RFNB 2YKLL 1PVHA 1QBBA 3NCEB 5D96C 1MUJB 4JDVA 1E27A 4XI5D 4WNQB 32C2B 3P40A 4U1IB 1J10A 3RL1A 4LCWE 4Y19A 1YNKL 3BQUC 5H2BB 1CDIA 1L7TH 3V5KB 4KDWA 3CFEA 4CADB 1KFAH 3LD8C 2NTSP 2GSGB 1IL1B 3FB7B 5DT1L 1N5YH 2QHRH 4BKLB 1LO0H 2XWJA 5HHPB 5EO9B 1MUJA 1FJ1A 4WNQA 32C2A 4U1IA 4DVBB 1LO2H 1N64H 5DD6A 3N1QC 2BY0A 5H2BA 2IPKB 3V5KA 3FT4B 3C6LC 4QF1B 5LBSL 1EMTL 1H8OA 5HYEA 1DQDL 4I18B 1KN2L 4PR5A 5ESQB 1UZ8B 1IL1A 2GSGA 3FB7A 1FVEB 1IGIH 4HPOL 4MA1B 4KV5F 4BKLA 3D3VD 1M05B 2HVJA 5D6DC 4DVRH 1MCSA 3HZKB 4OLXL 3RNKB 3IFNH 5HHPA 4X7CC 4OM1L 2J8HA 4XAWH 2EE2A 4DVBA 5I0ZA 3KJ4C 4JZNB 4G9FD 4PS4L 3TH2T 2IPKA 3SGKA 5FHAH 3FT4A 4I0PA 2Q1EA 3BESR 1BECA 4QF1A 2VZTA 4I18A 1UZ8A 1FVEA 1MRDH 2ICEB 1G9MH 5B39B 1M05A 1BEYL 3HZKA 4XP5L 3RNKA 1ZTXL 5FYJH 2NW2B 4ONGH 3QDGD 3TNMB 4BZ1L 1I75A 3ARGD 3GSRB 5GGTL 2XICA 1Q9KB 3VGAC 5HYIA 4JZNA 5EU5A 4UOW1 1UXWB 4KTDL 1FNSH 2VR9A 2AEPH 4LSTL 5FKPB 1SMOA 1CU4L 2ATKB 4IMLB 1CXKA 2ICEA 3B5GA 5B39A 3OHXB 1MFDL 1BWWA 3VD9A 4WHCA 4NGHL 3O9WB 1IGML 4RMUA 2NW2A 3TLRA 5AD0A 3NA4A 3TNMA 4UZGA 1KLFA 3GSRA 4L5FL 3MV9B 1Q9KA 2FX9L 2HG5B 2X10A 4C55A 1I9JH 5F72S 5CS7A 3H0TB 3QG7L 3B9VA 5IWLC 4KQ3H 1PSKL 4DJMA 4HW6A 3HMWH 4IMLA 4PGCB 4NKIH 4UDTB 5JDJA 1P7QB 3U1SH 3MOBL 3OHXA 1MCBA 5IEKB 3NBNA 3QUML 1CL7H 2VDKL 3P11H 3O9WA 2IPUK 3HMXL 1CFVH 4I5BB 1DVFC 3GSQB 4G3YL 1J1OH 2P43B 4E5XB 3HE6C 1L4IA 2F9BT 3UROR 3E8UH 3DGGB 2E7MA 3H0TA 4L4VE 3VXRB 5BZDB 3RUGF 5ADPH 3CVHB 3I3BA 3LN5B 4OCWL 4PGCA 3HI5L 1P7QA 3IDNB 4R7NB 3QIBD 4YDKL 5MEOB 4NT6B 2YBRB 5IEKA 4RGND 2LE9A 2BJML 3MLSL 1INEL 2VLRD 4NZUL 2YK1L 4AY0A 5ID1B 2VXSL 4MXQD 5JQ6L 2QQLL 3BXNB 4I5BA 5ERWB 3GSQA 4QRRE 1ORSB 1U3ZA 4FHBD 4ZS6D 4E5XA 1RJZB 3BPNC 3DGGA 3VXRA 5BZDA 2VZ1A 2NZ9C 1TJGH 3AXLB 5D9SB 1B0GB 3CVHA 3LN5A 4NRZB 4X7SH 1MHCB 2VDRL 2IPUG 3AS0A 3IDNA 4R7NA 4HSQA 3WIHA 5MEOA 4NT6A 2YBRA 4LHUB 4ZD3L 1NGWB 3NGBB 4F3FB 5C0BD 5ID1A 5B8CB 1AGFB 3BXNA 4KGLA 4OF8A 5B38G 3PWPB 2VXTH 4YDVB 5ERWA 2O5XL 5F89A 1ORSA 1S9WB 3P77B 1V7NL 3R06A 1A3QA 1RJZA 4H20L 5D9SA 1B0GA 3BKML 5HHXH 1T7ZA 4MB5A 4NRZA 1MHCA 3U7YH 4DW2L 2IMNA 3GJEB 5DJYB 3WD5L 4YUEL 3EOYG 4LHUA 1DLFL 4KV5E 1FNGB 1NGWA 2X89D 1BZ7B 2AI0L 4F3FA 2AJXH 5B8CA 3V9FA 1AGFA 4LOUD 2APBA 5F1OB 1P4BL 1YY8B 3INUH 1S9WA 3P77A 3BOVA 4Y4KC 2DQGH 5DJCB 4JKKA 2UWEF 1WAAA 5K59F 4OIAA 3W9DB 3P9LA 2R1WB 3GJEA 2GEEA 3IYLW 1IC7H 5DJYA 5E2UH 2R2EB 3KPQA 3BYYA 2ADGB 2MJWA 4ODTL 2AXGB 3SQOL 5D93C 4N0CC 1BZ7A 2C7UB 3IXTB 3RJQB 5T5NG 4QXUL 1MNUH 5DC0A 2X05A 3MLTB 5EZIH 1JGDB 3V4VH 1XR8B 1AD0B 1QFWI 1YY8A 12E8H 3JTTB 4FFZL 4MMZC 5DJCA 1FZOA 1E28A 4WO4A 5CD3A 4ZUTB 4BQBA 3IDXL 3QUXD 4WW1A 3W9DA 2R1WA 2XKNB 4R8WH 4NKOA 2R2EA 2W65B 2ADGA 1IGCH 1S9YB 3LS5L 1M7IB 3O3UN 4J6RL 2AXGA 2D0GA 3UTPD 4I2XB 3LPGA 2C7UA 4TN9A 1TETL 5D70H 1U36A 4QOKD 3ARFC 2E8YA 2FECL 1BQLL 4AK1A 3MLTA 1W0VA 1T89C 3IS0X 4ENED 1JGDA 4HGKC 5L9DL 1XR8A 2WWMD 3VXSE 4JVUA 3JTTA 4WU5B 5DJ8B 3MRKB 3WIIH 4XXDB 3K1KC 2BVOB 3X12B 1SYVB 2DI7A 4X4MA 4WI4A 4FQJL 4EI5B 3E2HC 4ZUTA 3TO4A 1TNNA 3CFCL 5CJ5A 3BE1L 3VG0H 2XKNA 2NYYC 3BH8B 2XNAB 2W65A 1EFXB 5F6HI 1S9YA 2AJVL 1M7IA 4HIIB 4I2XA 1WFUA 3SKNA 3MXWL 3F7PC 5TFSL 4Z5RA 1ACZA 1JUFB 5AG8A 4G7VH 3E3QC 4PLKD 3BH9B 4WU5A 5DJ8A 3MRKA 4MQXD 4XXDA 3X12A 2BVOA 3RVUD 4XPFH 4Z77B 2KZWA 3V7MA 4EI5A 4EVNA 4CU6A 2P4AB 3ZKSD 3FQTB 3RUGE 3G5XA 5CCKH 4ZAKB 2XNAA 5F9AC 1EFXA 3CXHJ 1E4KA 4W81A 1KUMA 2IQAB 3IFLH 1T5XA 4NJAH 1W8OA 3KPRA 3HNVH 1JUFA 3GIVB 3BH9A 1WBZB 1MCJA 3T2PA 4LLAA 2H41A 3OG4B 4M5ZH 4Z77A 4PJ5B 3T8XB 1FCGA 1FVDB 5E5RB 3FFCD 3FQTA 5CBEB 3U0WH 1PQZB 3QCUH 1OTSD 1MCEA 4ZAKA 4MAYA 1EGJL 1ITCA 4Z7VB 4OFDA 2Q7NA 3DYPA 3QFDB 2IQAA 4ZNEE 1GC1H 5BCAA 2VLKD 1CF8H 1FYTB 1L9MA 1G7PA 4L29B 1DL7L 4LCCC 1V8HA 5F7LB 1WBZA 4R96B 4AMKL 4PJ5A 3T8XA 2R0LH 5GS1B 1FVDA 5CBEA 4KZEH 3PP3H 1BQSA 1A47A 5BVJB 1OSPH 2X4RB 3VMNA 3WJLA 4Z7VA 4KMLB 4OFVA 3QFDA 2XTJC 1A3LL 4APQC 3TZVD 1FYTA 1NFDE 3MRGA 2FNBA 1KIUA 3B9KA 2DDQH 4R96A 2NPLX 4LRNH 4J1UA 4XCNA 5GS1A 4X9FA 2UWEE 4CUCA 5K59E 1QG3A 4NN6C 5BVJA 4U1NB 2V5SA 2X4RA 3P0GB 4YFLI 5A2IH 3QDMD 3FQNB 5EZJA 1P2CB 1Q94B 4POUB 2B1HH 4P2CG 5BJTB 1KB9J 1ORQB 3I02B 4Z0BL 5I74B 5BV7H 5IVNA 4FP8H 4XVTL 1XH3B 3QPQC 3V0AC 5D6CB 4M48L 4HUVB 1RFDL 5JHDA 3RVWC 3HAEH 4CL7A 1BD2D 5SV4A 5FAAA 3LQMA 4U1NA 4OJFL 3VE0A 1VPOL 2YPLE 1LNUB 4KUZH 1YC8A 3FQNA 3AM8C 1P2CA 1Q94A 5BJTA 3L5JA 1ORQA 2JJTA 3IU4L 3I02A 3BEVB 4GBXD 4BZ2H 5KSVB 5TF1L 1EHNA 1XH3A 4PRBB 4NC0B 3UTQB 4CMMB 5D6CA 3O0RH 4P2OD 1BFVL 4HUVA 5GGSY 4GAJH 4LRIC 1YEKH 1NC2B 1OSZB 1Q72L 4XPAH 1PZ5A 3U30C 4X4XB 3GZKA 2WBWB 3S37H 2ZCLH 2EDLA 3S36H 1MQKH 3A6CH 1LNUA 4PRDB 3ULUD 4UB0L 4JO2L 5E8NB 5FO9B 1FH5L 2VSCA 3QWOB 1QKZL 2NX5D 4R2GB 1YMMD 5KSVA 3SCMB 4HJGB 5F9DC 2BVPB 3A6BL 4PRBA 4GRLC 3OKNB 4MXVF 3VW3L 2M26A 5D1ZA 4KKCC 4GMSL 2BX5A 1KN4H 1NC2A 1OSZA 3AY4C 3LVEA 2G5BB 3LHPL 1XGTB 4X4XA 3DYOA 3BP6A 2D0HA 3BN9C 4PRDA 2ORBL 5E8NA 2JIXD 5FO9A 4LARL 3SGDI 3QWOA 5C0AD 4Q74A 3VMPA 3EOTH 2Y1VA 5GGSB 3SCMA 4HJGA 1FORH 1I9EA 2BVPA 3TVMC 1FZMA 3ZSTA 4U7MA 1CVSC 3DRQA 3QQ3B 3OKNA 2G9HB 4Y5YC 4KK8C 5I1HL 4JM2B 1K6QH 1INDL 4ZO6A 5BVPL 4OT1L 4N1CA 5CEYB 1Q38A 1XGTA 5I1GH 1LD9B 3IAQA 4PB0H 2AQ2A 1FO0L 4G5ZL 4KI5E 5IHUH 5JR1H 4Z7QF 2HH0L 4LKXB 2ZJSL 4KVNH 3ZDYE 3SEPA 2X41A 5EU3B 1ACYL 3QHZH 5EU6B 2R1XB 3V4PH 3G9VA 2VE6B 2HT4D 4JG1H 5A3ID 3QQ3A 2QQKL 2BDNH 2G9HA 4F9LA 5IGXH 4JM2A 1BOYA 1KB5L 3S3SA 1LD9A 3CMOL 5GGQH 5H94B 4U6HB 3VFGL 3LEYH 1N8ZA 4CMHC 2J8UF 3W0WB 1HWHB 1FRGH 2DQJH 1MIEL 4TNVF 1XF4B 2N7BA 5JIPA 3CCHA 5EU6A 2VE6A 4KAQH 3D6GA 5I75B 2ADFH 3U6RB 1U8OB 2W91A 4DKFH 5KVMC 2HLFD 1L7TL 3KYNB 5F7WC 5L8JB 5DD3H 4PJAB 5H94A 1KFAL 4U6HA 4M6OH 3MX0A 5IHBA 1IGYB 1T2JA 1N5YL 3W0WA 1SJEB 2ITCB 2AQ3A 2QHRL 3STLB 1LO0L 1XF4A 3C60B 2VLJD 3SDDD 1I7TB 4L1HA 4L4VB 1RI8A 3U6RA 1LO2L 1N64L 1DQLH 3ZYZA 3KYNA 4YHOH 4NQDB 1I7UB 2DTMH 4JHZA 4PJAA 3C8HA 4QWWC 1IGYA 2BNQD 4KJQD 1IGIL 1QRND 1SJEA 2ITCA 4P5TB 3STLA 1CXIA 1IZJA 3C60A 2Q86B 5I66B 1NQBA 4DVRL 5DJXB 2ESVD 1G9MC 4WI6A 2AK4D 3IFNL 1I7TA 3N06B 3P30H 4XAWL 1A1OA 1RJLB 3D85B 3FQWB 2NXYC 3WXVH 1CR9H 3D69B 5FGBA 4FQXD 3CAFA 2FJFA 5FHAL 1OLLA 1SVCP 4NQDA 1I7UA 1XT5A 5L8LB 2MKWA 1CXEA 2YD4A 5T1KD 3H9ZA 3KYOB 3MROB 4BSJA 1G7JA 1H9VA 2OL3B 5BMFH 2ZUXA 4P5TA 1MRDL 4UNTA 1G9ML 3Q5TA 5AZ2H 3T4YB 2EDDA 1P84K 5I66A 1JGUH 5DJXA 1IRAY 3LKQB 1C08A 1WITA 1FL5B 5FYJL 3VJ6B 4ONGL 5D7JB 2NY6D 4O58H 1RJLA 3D85A 3RP1A 1X6LA 3BDYH 4MXVE 1FLRH 4H1LG 1A4JB 2A2QT 1A02N 1PX3A 3RJDA 3MBED 1FNSL 2AEPL 5K9KB 2DIAA 3KYOA 5C8JB 5GGVY 3T4YA 1F58H 4F7TB 1RPQA 3GFUA 1CGXA 3LKQA 1FNEB 4H8WC 4JREC 4QKXB 4QY8B 4EEEA 1FL5A 3VJ6A 5D7JA 2YN3A 1L7IH 3GSOB 3FZUC 1QSFA 1XR9B 3DLQR 4RSVA 2GI7A 3O2DH 1A4JA 3GGWB 1I9JL 1HYSC 3KPSE 4JKLA 4Y4HC 5K9KA 5C8JA 4KQ3L 5IROC 1J0KA 3HMWL 4NKIL 4P46B 3SDCC 3L3DB 3U1SL 3HE7C 1I85A 2X4UB 1PKQE 4S1DC 4TTDC 4F7TA 5CD5C 4Z7QE 1T1WA 2F5BH 1CL7L 1FNEA 3P11L 3U4EB 4OZHF 3AB0B 3L95B 3GSOA 1F4WL 1XR9A 1CFVL 1KPRB 4GRWF 1QSEA 1J1OL 4ZFGH 4U1HB 4MX7B 4W6XB 3RPIB 1TCMA 3RY6C 3E8UL 2XXCB 2GW5A 5ADPL 1OWWA 4GRMA 3JVGC 1QBAA 4P46A 3L3DA 5CZXC 3SBWC 2X4UA 4C54A 5JPNB 5IOPB 2KH2B 3VXSB 2J8UE 3MRIA 1RULH 1UJTA 1P4IH 1CS6A 3U4EA 2Z31C 3JV4B 1XF3B 4G43B 4XNYH 3VCLA 3L95A 2DQDH 3DXAB 1KPRA 5IW1A 1U6AH 3Q1SH 3ZTNH 1M7XA 2AXJA 4U1HA 4YHLH 4O02H 2CRYA 3RPIA 5T3ZE 1YEDB 4K71B 2WV3A 1TJGL 2NY4C 5EZLB 1JNNH 4X7SL 2DL9A 3VXMD 5JPNA 2CRIA 2AEIT 4CN4A 1VFBB 4PJHF 2JF1A 1XF3A 3JV4A 4G43A 4MZ3A 5DK2B 3WNKA 3DXAA 4W4OC 2VXTL 1NAKH 2ITDB 5F1IB 5SWQB 4OQTA 1CK0H 4TVPE 1KIRA 4NNPH 4K7PH 4XI5C 4WW2C 5EZLA 5HHXL 3V8CA 3U7YL 3FAXA 5DVNA 3O3DB 4LCIH 1VFBA 2CO6B 4KUCD 1T3FB 2AJXL 3RNQB 1NC4B 4JO3H 5DK2A 5KANI 1A7RH 1Q0XH 3BP4B 4XBGB 4M61B 4UNUA 5DEFA 5C0CA 4LLUB 2ITDA 5F1IA 5SWQA 1CXFA 3INUL 2YA1A 2DQGL 2EDHA 2FJGB 5TE6H 1OD7A 5J13C 4JZJC 1T1YB 4G8EB 3HCVA 5F3BB 1XGYH 3H3PH 5DMJB 1XCTB 2Q20A 5E2UL 1IC7L 4ZNCD 4XNUH 2CMRH 4P4KD 5MERA 3O3DA 3K7UA 4PFEA 4IOFC 4CVWA 1JFQL 1T3FA 3RNQA 1C5CH 1MNUL 3NH7L 2PETA 3BP4A 4XBGA 4M61A 5EZIL 4LLUA 5JPMB 1WISA 4UILH 2NY0D 12E8L 3DUUA 4AEEA 4PUBH 2FJGA 1GAFH 1QNZH 1T1YA 4E0RB 4F2MB 5JMOC 1DEEB 5F3BA 2P8PB 3M1BB 2VLLA 3GNMH 1JJUA 1XCTA 3KG5A 3NABH 3NIDF 4MA7H 5D4QA 4R8WL 2XTLA 1IGCL 2JK5B 3C2SA 5CGMA 3QXVA 5IV2B 5D70L 4U1GC 3G6JF 1JE6A 3UTSD 1HSAA 2B20A 1FHGA 3DPBA 5GSRB 3WIIL 1ZK9A 3FQUB 3QULB 5CSGA 5F96H 2YD9A 3T04D 4EIZC 4F2MA 4TUKH 2P8PA 3M1BA 2ED8A 3VG0L 3D87B 2DQTH 2EDKA 5C07E 4WFGE 5F7UA 3GK8H 2C3VB 4PJEF 5IV2A 4YHNB 1C12B 4G6JH 4OZHE 4XBEH 3T0BA 1U8LB 4G7VL 1K9TA 3PABB 4GRWE 2F53B 5GSRA 2BHZA 3FQUA 2YPLB 5FO7B 3QULA 2DJ4A 4XPFL 1XCQB 4PJGF 3UC0H 3FB6B 4HC1A 5CCKL 4XCCH 4L9DA 1TZIB 2HTLC 2OMBA 3AUVA 3CPLB 4MZ2A 2C3VA 4YHNA 3IFLL 4KKAD 5HD8D 4NJAL 1C12A 3HNVL 1GC1C 1D5BB 3D0LB 1G7QB 3PABA 2F53A 5FO7A 3GHBH 2YA2A 4M5ZL 4XMLH 4Q9CA 1XCQA 1H5BC 3U0WL 3V52H 3QCUL 3FB6A 4ZUSB 5MHSE 4HEME 3MRRB 4E42A 3CPLA 1N0XH 1HK6A 1CLOH 5JUEH 3ARBD 1GC1L 4JGMA 4PJHE 1CF8L 4WHTB 3ALWA 4I0PD 2C1PB 3EO9H 1D5BA 3QIBC 4M7LT 3X3FH 3D0LA 5B22A 1G7QA 4OD2A 3EUUA 4PJXF 4JCMA 3MTRA 4DZBB 1W0YT 4KROD 4NNXB 1RZKH 2P45B 4XMKH 2R0LL 4MXQC 2C3WA 3C08H 1R5VA 4KZEL 4ZUSA 1EAPA 3MRRA 1OSPL 4OFIA 4PRPE 4NZRH 1BBJB 4PP1D 1MAJA 5KBNC 3I85A 3MRFB 1QHPA 2YD1A 3KS0J 3B2UD 3BD4A 4WHTA 1R6VA 3BP7A 2C1PA 2GK0B 4QTHB 4YK4C 2DDQL 4J8RB 5IEHA 4DZBA 3IDYC 1RZFH 4LRNL 1BBDH 4PJCB 3MGOB 1CD9B 5BW7C 4FFYH 2AGJH 1MCIA 5I19H 3SE9H 1BBJA 3QI9D 5E5MB 2B1HL 2HMIC 4PGBB 2IBZX 5T5FH 1CG9B 5JTWA 4NZTH 2GK0A 1KXTB 2X4QB 3BGFC 2BNUB 4HAGA 5BV7L 4QTHA 4FP8L 3SE3A 4J8RA 1X5FA 5GZND 3S35X 5FCUH 1F6FB 5F6HJ 1OT2A 2G5RA 4PJCA 3MGOA 3DBXB 3I6LE 1Y0LB 2LABA 3O9WD 3NIDE 2Z8VC 2ZOKB 4KUZL 5E5MA 3P3YA 4P23B 4PGBA 5EBGA 2ZUUA 5MP6H 2I5YH 1CG9A 3CU7A 4BZ2L 5B39G 2X4QA 3H7BB 4YXKH 1ED3A 3D39E 1NL0H 3G6JE 2AJSH 4N1EA 5H37H 4I0CC 3O0RL 4NUJB 4GAJL 1YEKL 3K4ZA 2RFXB 4XPAL 5C92A 1U41A 3DBXA 1OOAA 4EXKA 3S37L 2ZCLL 3S36L 2ZOKA 3A6CL 3GI8H 4HIJA 3KPLB 2HT2D 4P23A 3QO0A 4M02A 5C09E 5FA3B 1ZLWK 2X7LB 2IF7A 4X83A 2D7QA 3FAWA 4PJEE 4JFDE 3WLBA 3QXWA 4X7DC 3H7BA 3NACH 4ZFOB 2MQ0A 2E6JA 3C8KA 1AY1H 4DOHE 2X4NA 3DVGA 2COQA 1AKJD 3EO1B 3EYQC 1YEFL 5EU4B 1F4XH 5IVOA 43CAB 1KN4L 2RFXA 4CRPA 3GSUB 2WWMC 4MS8D 5E1HB 1QR1B 4U6VH 4HS8H 1HNFA 3KPLA 4NN7B 3RX5A 1U8JB 3GSNA 5F9WB 5FA3A 1ZT7A 1EDQA 2X7LA 5I8KH 3EOTL 4ZFOA 1FORL 1FPTH 1Q0YH 2VITB 1ADQA 4EIGB 5JA8B 3VFVB 3MRDB 1LEIB 4YO0A 3EO1A 4P3CH 4JFQB 1K6QL 43CAA 1HH9B 5I1GL 1WZLA 4NSKB 3CDGA 4PB0L 1QR1A 3U9UB 3V8OA 5IHUL 2FECI 5JR1L 3QXAB 3FO0H 1U8JA 2H2PC 3ROLB 4KVNL 3VWJB 1CE6B 3QHZL 3V4PL 3NCMA 2VITA 4JG1L 1Z9OA 3VFVA 3TFKD 3MRDA 3F6LA 3Q6FB 5DF0A 2BDNL 1LEIA 3H3KA 3D0VA 5IGXL 1OW0C 4PJXE 4B50A 4XPBH 4JFQA 4FXKB 3EAKA 4I0KA 2V6HA 4P48A 1HH9A 4NSKA 5GGQL 3X11B 1WSST 4M93C 3LEYL 3U9UA 3QXAA 5L2KE 4QRPB 4NN5C 1FRGL 2DQJL 3VWJA 2AJZA 1JPGB 3C5JB 4LHUG 4KAQL 2VRAA 3KPSB 1KJ3H 3BPOC 3L3OB 2VUYA 4WO4D 1ZA6B 3Q6FA 1AO7A 3BQUB 2ADFL 1H3UA 4DKFL 4FXKA 3SE4A 1JYWA 2HFGH 1PKQB 5DD3L 5F1KC 3LD8B 3NCFB 5FHBH 3BRDA 4X9BA 4HH8A 4M6OL 1ONQB 1UEMA 1NCNA 2XWBB 3BVNB 1KLUB 4KKBD 4QRPA 5KN5B 4YGAB 5IKCB 1JPGA 3C5JA 5D1XB 2FHFA 1AC6A 5CEZD 1ZA6A 4IOSD 3OAYH 3UX9B 3BQUA 3TO4D 2R15A 4PY8I 1CICD 2Y07H 1DQLL 4ELMB 1G1YA 3SKMB 5J6HB 1TVHB 1F3RB 4YHOL 2DTML 4QHKJ 4FQLH 4NQVA 3FQXA 4M03A 3EKCA 1QA9B 4HAFA 5ESVA 1S78D 2XWBA 3BVNA 3RZCB 2ICCA 3O45B 4WEBL 2WP3T 4X6BB 3PQYB 4PB9H 3I9GH 2B5IC 3AREC 4PBXA 3T0ED 3P30L 3FQRB 1X3DA 3KJ4B 1X5IA 3WXVL 1CR9L 3WKNA 3MCKB 1YN7A 1EFXD 3C6LA 4HLJA 4PGZA 1TVHA 3D18B 3SKMA 5HYQB 5J6HA 2IBGA 3S8WA 1EHXA 3RDTD 3CNKA 5I1LB 2PW2B 4PJIA 3CU1A 5HPMB 2V9TA 5GSVB 3RZCA 5BMFL 3KPRD 1A9EA 5D6DA 1SVZA 3X3GH 5AZ2L 3SDAB 3OXSB 3PQYA 3EJZD 1JGUL 2O26U 4KVCH 4HK3J 5E9DB 4LP4A 2E9IA 3FQRA 3OGOE 4UOJA 2RR3A 4O58L 5GGTA 4O5LH 3IDJB 5T3XE 3BDYL 3MCKA 4X7EC 1FLRL 2LVEA 4MAYD 5HYQA 2VL5A 5I1LA 1OARH 2PW2A 4YHIB 3N1GC 4YIQB 4GMTH 5HPMA 5EO0B 2YC1B 5GSVA 4P2OC 3G08B 3VXPB 3ESUF 1F58L 3OXSA 5KAQG 3QUMB 1DP0A 4U6XB 5DEGB 1L7IL 4PJ5D 1BVKA 1RSFA 5CJ8A 1LP9B 4YJZL 1N2RB 3IDJA 3O2DL 1SQ2N 3GMRB 3H9HB 2WWKO 4YIQA 5EO0A 2YC1A 5F8QC 2AEQH 1P84J 3G08A 4IOIB 1FYTD 3VXPA 1EO5A 3B9KD 1FP5A 4L8SC 3QUMA 2F5BL 4PV9B 2F54B 1CFQB 5DEGA 2E7CA 5DRNA 3GMQB 2EDXA 1DVFB 1JHLH 4BJLA 3HMXA 5D7LE 1LP9A 1N2RA 3B5TA 4WEUD 4XHJD 4ZFGL 5KSAB 2RHEA 2DM4A 3H9SE 5MENB 3H9HA 3GM0A 4V2CB 4IOIA 1QLRB 1ND0B 3HNTH 3HR6A 3I3EA 3PHQB 1RULL 3ZLQC 4PV9A 2F54A 1P4IL 2HT3C 1CFQA 1DCLA 4XNYL 2I07B 4Y5XC 1QFPA 3GMQA 5JHDD 1DVFA 2DQDL 4X5LA 4BK5A 1U6AL 3HE6A 3Q1SL 3ZTNL 3QBTB 3BPNB 4L1DA 4YHLL 4O02L 4X0KB 5KSAA 1KGCE 1X4ZA 5C0RH 5MENA 5DHVA 5HHOA 5DD1H 1IM3B 1JNNL 4UOW0 1QLRA 1ND0A 8FABB 3LQZB 3PHQA 5DFVD 2PW1B 1CQYA 3R8QA 3TGXA 2VOTA 2VLMD 5FF6B 4CVXB 1YA5A 5GS2D 3OB0H 2I07A 2FBOJ 5I71B 5JZ7D 1ULVA 1NAKL 1T22B 5D7KD 1V3LA 1Z0MA 2Y06H 5DJ6A 1CK0L 3CZJA 4NNPL 4K7PL 4LBEB 2J4WH 5ALCH 1IM3A 3L5IA 3V7AE 1CIUA 4DEPC 8FABA 3LQZA 5F9OH 2PW1A 4JVWA 1M1SA 4LCIL 4CVXA 4FNLH 3HI1B 3S98A 4JO3L 1JZ7A 5FXCH 1URLA 1A7RL 2NXZD 3MZGB 1Q0XL 5D1ZD 5D2NC 5T33H 2FH6A 4Y1AA 4P2RA 3DI3B 2IANA 3VXUA 4XAKD 4Y4KB 5DVKA 4QLRA 4P2QE 2V9QA 4LBEA 4RA3A 5TE6L 2DLHA 4YWGH 1XGYL 3OKEB 3H3PL 1NFIB 2DI9A 4IEFB 1NBYB 2BSRB 3P9WB 1T7WA 1W2KT 2EZ0D 2CMRL 4XNUL 1AXSB 1C5CL 4JFEE 2ADJB 1F97A 1SBBA 4ODUB 4UILL 3TCXA 4Y4KA 5EORH 2V2TB 1OCWH 3KHOA 2XY1A 3D2UB 4PUBL 3MXVH 4NQEE 5CP3A 3VDAA 1GAFL 1QNZL 4IHOB 3IFPB 4U1LA 3BIAX 4TYUA 5HVHC 5HPOA 2CXGA 2YOCA 3OKEA 3QUYB 1NFIA 1VDGA 3GNML 3NABL 4MA7L 1KCKA 5D5MF 2BSRA 5C1MB 1J11A 1AXSA 3KLHC 1IARB 1KLGB 2XQBH 3ARFB 2W9LA 2YD2A 4HUXA 2ADJA 1J0HA 1ZT4A 4JM2D 5FIEA 4UT7H 2NNAB 3LB6C 5KSUB 4EDWH 3D2UA 3E2HB 5F96L 5IHLB 4IHOA 3IFPA 2QHLA 3MODH 4TUKL 1TVBB 3L3KB 3QUYA 3CGTA 1NGQH 2NMSA 1DR9A 2VJXA 4LSVH 5ELIA 2DQTL 2EDNA 3MRLB 4JHWH 5KVEH 3FONA 2EEDA 1ZGLM 4PLJC 3BISA 3GK8L 1KLGA 4QXWA 3TH4T 3ARFA 3THMH 1T89A 2PXYD 3JWNC 1YEEH 5J06A 5HHMD 1A6VH 4G6JL 3C87A 4XBEL 4BQ6A 1BJ8A 4WFFD 3QZWG 5KSUA 2QJDA 2IAMD 4PJFB 2F19H 4D9LH 4LQ1A 4CJ0A 3ARTA 3TBSB 2DQHH 1TDQA 5KOVC 4EN3C 4ZFFB 4PTTB 3L3KA 4WY7H 3UC0L 1AGEB 1MF2H 3ME0A 3MGAA 3MRLA 3IDGB 2Y5TB 4XCCL 4D94A 3UTTB 5IJVB 4N0UE 4RISH 2BRQA 1MWAH 1NCBH 1DBMH 4BH7B 3ES6B 3PWNB 3NFSH 1CLZH 3O2VH 4DGVH 4OD1H 1RZ7H 1NAMH 5D72H 4HEPG 4QHUB 3B3IA 4PJFA 5CINH 1LDSA 3GHBL 5HI3D 4XMLL 3CK0H 4ZFFA 5DJZA 1G9NH 1RZKC 1AGEA 1OHQA 4N8VG 3C60D 3V52L 4OCXH 3IDGA 4MJ4A 3UTTA 5IJVA 1EGJA 3TC9A 3ZHLA 4Z7NF 3U2SA 1N0XL 1O7VA 3QQ4A 1CLOL 4OZIB 1NEUA 4Q7DA 5JUEL 5T5NF 4BH7A 5JW4R 3ES6A 3PWNA 4BFGA 4LCCB 1OTTC 3EO9L 1SEQH 4NQDD 4RWYH 2GHWB 3X3FL 4QHUA 3VD4A 1BFTA 1ZHLB 2P49B 4BUHA 1OGTB 1IAIH 1RZKL 4JANA 4ZDHB 1VB9A 4XMKL 3D3VE 3C08L 1R3KB 1OPGH 4R97B 2XTJB 4NZRL 4XCEB 4B7LA 4APQB 2DWDB 4M4RA 4OZIA 1BVLB 1ROWA 4G9FE 2X70A 5B3JF 5BRZB 4E41B 3JV6A 1BJ1J 2CK2A 2FJHB 4LCCA 3O6FC 3BDBA 4OCNC 2ZPKH 1OQOA 5C08E 1ZHLA 2WUBH 5T1MB 1LEKB 5I1AB 3PHSA 5JIIA 1OGTA 1RZFL 1BBDL 3LSOB 4ZDHA 2P8LB 1AGCB 4NN6B 3VGGA 1JGLH 1J0JA 4FFYL 2AGJL 4QCIB 2I9LB 4BSVB 5I19L 3QDGE 3SE9L 5D7JD 1JI1A 2QR0B 4TULH 4APQA 2AJYH 5C2BH 2DWDA 4FFWC 1QSFD 1BVLA 2D31B 5BRZA 4E41A 5DJ2A 5T5FL 1I7ZB 2FJHA 1DZBA 4WHYG 4NZTL 4E9LA 3LEXB 3DO3A 4FTVB 3ARPA 2IBBA 2ZCHH 1Z9LA 1MHHA 5EC1B 5T1MA 1LEKA 5I1AA 4XZUB 4G8IB 5FCUL 2RAMA 4WI3A 3LSOA 3FMGH 2MQCA 1AGCA 1A5FH 1QRKA 3OZ9H 3WO3B 5E24E 5HXMA 4QCIA 2I9LA 4BSVA 1RIUH 1RUQH 3PWLB 5D5ME 3DSNA 4JRXB 4LCWA 1A1MB 4AH2A 2D31A 3LZFH 3MGTB 1QSED 5MP6L 2I5YL 1JPST 1NDMA 1JWMA 4RX4A 3LEXA 1ZEAH 1TFHA 4YXKL 1J1PH 4FTVA 2Q7YB 1NL0L 2AJSL 3GSVB 4KQ4H 5EC1A 4XZUA 4G8IA 4P46D 3U30B 5FGCE 3P0YH 1VEMA 2QQNH 4EUPG 1RK1A 3GI8L 3PWLA 4DCQA 4JRXA 2FX7H 1A1MA 1NCAH 2UZYB 2WWKT 4YPGB 3NACL 4XWOC 1GSMA 3IJYA 4GRLB 5BQ7B 1AY1L 1T7YA 4JO4H 3GSVA 5I16B 4LRIA 1MFAH 1F4XL 3KXFB 2Y6SC 4HKBB 4RGNE 3MPCA 2VLRE 1ZT1B 1WCBB 4U6VL 5GGRA 2OJEA 4HS8L 5GZOD 1VFUA 4YHMH 2QSVA 4M00A 3CSPA 5I8KL 2A6IB 3BWUC 3HLAB 4YPGA 5CILH 1FPTL 1Q0YL 4GRLA 3RWIB 4Y5YB 3V95A 1JZ6A 2Q8AH 5I16A 4U1MB 5I1IH 2EIEA 2GITB 5AWNH 1WTGT 4YH6A 3AY4A 3VRJB 4P3CL 3KXFA 1MCNA 4HKBA 1KB5B 2ZUQC 1ZT1A 3KLAB 1WCBA 1MPAH 5E0QA 5LKNA 1FO0A 3TO2B 4LLDB 3FO0L 5C0CD 4Z7NE 1KJVB 1UWGH 4QHNB 3IDUA 2A6IA 2GY5A 3HLAA 1A9BB 3I84A 3U9PH 3RWIA 1B4JH 4Y5YA 4R7DB 2GITA 4WUUE 3MRPB 4RAVB 5HD8C 4XPBL 3CUPB 3KS0H 1HSBB 1KB5A 3BYTA 1RJYB 3WNMA 1AGBB 3KLAA 3O8XC 4MJIE 4CDGC 4PGEB 4Y2DD 4CMHB 2YRZA 4HFUH 4LLDA 2I24N 2Z35A 35C8H 5ADOH 4K3DH 4PJ7B 2VZUA 4QHNA 1A9BA 3KVQA 3X13A 4J12A 3QP3A 1KJ3L 4JFHD 1HHGB 5I9QC 4R7DA 3DI2B 3CUPA 2R4RH 5I1KH 4JRYD 2HFGL 2A6JB 1HSBA 1ERNA 1WWBX 3BMVA 5FHBL 1RJYA 1AGBA 3CXDH 5IHZB 4TPRH 4PGEA 3L9RA 1P4LA 4BK4A 3JSSA 3SGJC 4PJ7A 4FABH 1KCLA 3EDFA 3H9SB 5GHWH 2XA8H 4X7TB 4LF3B 1T1ZB 3ULVD 5JW4Q 5HGDB 3CX5K 2Y07L 2A6JA 1CGYA 4FZEH 3OR7B 3UTPE 5A43C 4I13B 4JEGB 4QGYA 1JHKH 5KTEL 3W5MA 4FQLL 1D9KD 1UM4H 3T0VA 4XBPB 2YUXA 4QRRA 2NR6C 4TSBH 2M8XA 3QA3B 3QCTH 4PB9L 1OTUD 3I9GL 4TSCH 1S7SB 5BS0B 2O93L 3Q2CA 3WFCH 4MD5B 4X7TA 4LF3A 2NXYB 2UY7A 5HGDA 5GRVK 3ULUF 4GSDH 4P5KB 3BFOA 2BOCA 2IMMA 3RBGA 4Q6IC 1YPZE 3W82A 1BOGB 3NIGE 4XBPA 3P4NB 3MRHA 1XAUA 2DOCA 3EHBD 3X3GL 3QA3A 2APVA 1S7SA 2F53D 1YY9D 5E4EC 4KVCL 5BS0A 2AKRB 4MD5A 1F42A 5J3HD 4OZGB 1KACB 1ZHNB 2EE3A 4O5LL 3EFFB 4P5KA 4TQEH 3RKDC 1QPXA 3P73B 5I1EH 4XNQB 3MJ6A 1OARL 4C4KO 3ARDC 4JHAH 4GMTL 5CKAA 2A6KB 5GISH 3DVNB 3P4NA 1YNTB 1EHLH 1P9MC 2AKRA 4K8RD 3DHJA 4F7EB 4NM8H 4RGMB 2D7MA 4OZGA 1ZHNA 1AP2B 3OKMB 3EFFA 1U8MA 5D7IE 5HI5D 3P73A 1JZ3A 4XNQA 1S9XA 4FZ8H 3LKRB 1C5BH 2A6KA 3DVNA 4WFED 2AEQL 1YNTA 5HYJE 4LLQB 3RTQD 3VG9C 5I73B 5E6ID 2CDEB 3VFOA 3VFWB 2UY6A 4G8GB 4OGZA 5DQ9B 4F7EA 2H3NB 1WC7A 1JHLL 1AP2A 3OKMA 4G80B 5D2LB 4F37F 1Q8MA 3C2AH 1P53A 3B4NA 2YEZA 4U1JB 1BPVA 3I3DA 3LKRA 5IROA 3F12B 1JMXA 4LNRB 3HNTL 1J87A 4LLQA 2YWYA 1GJIA 2CDEA 3VFWA 3P0VH 2VUOA 4F57H 4H0IA 3HUJB 2L7UA 2DF3A 4PY8J 1MCWW 2V5YA 2H3NA 5EZOL 1SYSB 3U7WH 2YD6A 1SJHB 5D2LA 3O81A 4NFBA 3HB3C 3RY6A 1IM9B 3QDME 1JL8A 4L8DA 4U1JA 5DYOB 2HWZH 2A73B 5C0RL 4J3VA 4YHYC 2NY4B 3JVGA 1PLGH 3F12A 5SWZE 2PYEB 4ZODA 2EDFA 5DD1L 1JPTH 4NJ9H 4LNRA 3SBWA 4WTXA 1ZVSA 5EOQH 1EZVY 2AQ1A 5J11C 4XXCC 3HUJA 4V1DE 1WBYB 4HG4J 1U3YA 1CLYH 3HG1D 1F8TH 1PYWB 1SYSA 1VGEH 3TPUB 3RU8H 3REVB 1MCWM 4JDZB 1QD0A 4NZJA 4LSDA 1OWRM 5L8KB 3DROA 3QSKB 2Y06L 1IM9A 1I3UA 2J4WL 2A73A 2HAZA 4WW2B 4KK5C 5DDHB 2PYEA 5ALCL 1N3NA 2GJZB 1JV5B 5F9OL 5DMKB 4HDIA 1T66C 4F33A 4M9PA 2XQYG 4FNLL 1PYWA 4W4OA 3TPUA 5T33L 3REVA 4JDZA 4S0SD 1OGAB 3KPNB 1S8DB 4UBDD 3ULUE 1I1YA 1PY4A 4PIRF 2PO6C 4WW2A 5DDHA 4YWGL 2XG4A 4D9RE 4KXZH 2GY7B 1CICC 4L3AA 1E0OB 1JV5A 1KEMH 5DO2C 4U6TA 5DJAB 4FQQB 3ZT6A 4LGPB 1MLBB 2IEPA 3MLPA 4M6NH 3MMEB 1BP3B 1OGAA 3KPNA 5CJBA 3TEUA 1S8DA 4QHLB 5EORL 1FVCB 1MOEA 1OCWL 4J3OC 4DUXA 3T0EC 2D7PA 3MXVL 5L2JA 5I2IA 4LSRL 4NC1C 5JDSB 5AUMB 2E7HA 2DLIA 2ZUYA 4P0DA 4KY1H 3RDTC 1UKTA 1M7DB 2WM0A 4FQQA 4U1GB 2XQBL 3EYVB 5DJAA 3LOWA 2VWEC 1INQB 3B2VH 2Z93B 4OKVB 5IB3B 1KCSH 3MMEA 5E94B 5ITFA 4UT7L 5E95B 5E6ZA 3WJJC 5EBLB 2VMFA 5FYLE 4EDWL 4QHLA 1P1ZA 4DKDC 4S10A 3EYFB 2Q3AA 3ARGB 1JTPA 3MODL 2Z91A 1KNOB 4GXUM 1NGQL 1TIUA 5JDSA 4LSVL 1F90H 1F45A 2EKSB 4JHWL 5AAWA 5KVEL 3QXTA 5ICYB 4JFOB 3RZWA 1AO7D 5DQJB 1M7DA 3EYVA 2I27N 3THML 2FO1A 4X6DB 4Q9QH 1YEEL 5KSBB 1A6VL 1BJMA 2Z93A 2N56A 5E94A 5KG9A 4X9GA 1N0LA 5EBLA 4MXWH 1TMCB 1DN0A 2F19L 4D9LL 3SDXF 3EYFA 3ARGA 4N9OB 5GQBA 2DQHL 4IRSC 4QRPD 5IBUB 3OAZK 1KNOA 4WY7L 1MF2L 5F1NB 4JB9H 1G9NC 5FUCC 2BHYA 1GZQB 2EKSA 2X09A 5ICYA 4JFOA 4RISL 5DQJA 1MWAL 3VXNB 1DBKH 1NCBL 2MHAB 5IJKC 1MHPH 1DBML 5IB1B 3WN5B 2R0KH 2VZVA 3X14B 3NFSL 1CLZL 4DGVL 5KSBA 3JUZA 3DHMA 4OD1L 1RZ7L 1NAML 5KS9B 5D72L 3RGVC 1BVZA 5CINL 4UT6H 4X99B 3CK0L 3LCYA 1FSKB 1G9NL 1O0VA 4P3DB 3SKUD 1A3RH 5F1NA 2IWGA 1X5AA 4OCXL 1GZQA 5FO8B 4F15C 4AZ8A 3VXNA 2MHAA 1O5DT 4XNXH 5J8OA 1I3RB 4OLWH 5IB1A 5IUSA 3QIBB 4K2UH 3C6LD 3KNBB 4W6WB 2UVEA 1SEQL 4RWYL 1AQDA 5KS9A 4TNVK 2ILLA 5JOEA 1DSFH 1QRNE 1H5BA 1IAIL 5CGTA 2P5WD 3QB7C 1A7NH 1NCTA 1HQRB 4P3DA 5EIVA 3GMMB 2ESVE 1OAXH 3TIDB 1M6OB 1OPGL 4Y16C 3FT2B 4JE4B 1WF5A 5DJ0B 5FO8A 4OV6F 2EKJA 3ZHKA 4HZAA 2KUTA 4XC1H 1I3RA 1UM6H 3QIBA 5FYKD 3KNBA 4YK4B 3O4LA 1EEZB 2BY1A 1MJUH 2VISB 5BV7B 3RWFB 2APXA 4XP4H 2ZPKL 5LXGH 1T2XA 5C0BB 2IH1A 2P42B 2WUBL 1CXLA 3S4SA 1X4XA 1RQ5A 4X4YB 3GMMA 3CFDB 1JGLL 3TIDA 1M6OA 1W0WB 3HAEB 1HHHB 5DZLA 2BFVH 4HWNA 3FT2A 5DJ0A 3RWHB 3A67H 3CVIH 1T0MB 4TULL 5C2BL 1U93A 2AJYL 3IJSB 4QTIH 1OP5K 2R2HB 3BGFB 1EEZA 3QNXB 3CX2A 3GKWH 4N5EC 2ZUTA 3TV3H 1QSZA 2ZCHL 5C0BA 1ZMYA 3T08A 3S5LA 3FMGL 3VDCA 1A5FL 2LU4A 3OZ9L 5BW7A 2DN7A 1S7RB 1NSNH 1OAKH 1W0WA 1HHHA 3RWHA 1EBPA 4RZCB 1RIUL 1RUQL 4FQ2H 1T0MA 1LMKA 3BMWA 4L4TE 3IJSA 4I3RH 4PJ8C 1MELA 2FR4B 3LZFL 2FGZA 1ZGLA 1AHWB 2R2HA 3DETC 5FECA 3DX9B 1S7WB 2V2XB 3QNXA 5KZCD 1J1PL 2N1KA 4HLZH 3BZEB 2F8VA 4NCDA 3UDWC 4KQ4L 3AS2A 1OP3K 3OXRB 2MCPH 4WTZA 3DSFH 3QEQE 2W9DH 3P0YL 1S7RA 2QQNL 3PL6C 2F54D 3TT1H 3BIKB 1CN4A 3HS0B 2BZDA 1PGRB 1WIUA 4H88H 1HEZB 2FX7L 3QUXB 4LLVB 4CDHA 5HYSG 3HE6D 4NQXA 1NCAL 1SM3H 3DX9A 1S7WA 2V2XA 4YC2B 3BZEA 4JO4L 4QOKB 5HHOD 3JUYA 3OXRA 3TJHD 2YUVA 3M17B 3SDXE 1MFAL 1ZV5A 4S11A 4Y5VB 2FZ3B 2V7NB 3N1PC 4XHQA 3BIKA 4OI8A 1CGSH 3T2NH 3HS0A 3MO1B 1I1CA 1HEZA 3QUXA 4LLVA 5IIEB 2SEBB 4YHML 4X6CF 1G7LB 2JJSC 5TE4H 2NZ9D 5CILL 2JJWA 1JRHH 1YPZB 4GQ9H 2Q8AL 1QPPA 3BGAA 4FQCH 5I1IL 5AWNL 3GMOA 1CIDA 2PXYC 3M17A 3VXME 25C8H 1J0YA 5HGHB 1UJ3C 5DHYB 4JG0H 3X17A 2FZ3A 1MPAL 3WO4C 3ZTJG 4BSWB 1VGKA 4ESKA 1BIIB 4P2RD 4Y1AD 5IIEA 2SEBA 2IAND 4HPYH 3VXUD 1G7LA 1VENA 3VWKC 1UWGL 1JCKA 2ID5A 1HILB 4Z18A 2B2XH 4HCRH 3U9PL 1KC5H 1B4JL 1NCDH 1QFUH 1QLFB 2AJ3B 3WL9A 4PG2C 1BJ1H 3QFJE 5HGHA 1ZHBB 2W0LA 5DHYA 2VDMH 2FEEL 4BSWA 3DIFB 4HFUL 1BIIA 3FFCB 1AE6H 3UBXB 35C8L 5ADOL 3DWTA 1A0QH 4K3DL 4Y4KD 1WJ3A 4PJ9C 5DEZA 1OW0A 3HC3H 1QLFA 4L9LC 2VLKB 1T4KB 5SV3A 3GM8A 4ZTOH 1II4E 2R4RL 5I1KL 3VD5A 5TDNB 4JKWA 4N0CD 5I17B 1U58B 3CXDL 3O3EA 1FNHA 1T6VN 4TPRL 2GUOB 2CXKA 1NMBH 2R1YB 4X9IA 3FFCA 4FABL 2EDQA 3NIFF 4YDLC 1NH6A 3PWJB 5GHWL 5C0EA 2XA8L 5E2JA 3QQ9D 2VLKA 1T4KA 3TZVB 4OSUH 4FMFA 4LPWA 2XWTA 5TDNA 2J8UA 1CFNB 4FZEL 1ETZA 3KWWB 3ELAT 1JHKL 1U58A 1UM4L 3ARFD 4LPYA 2GUOA 2R1YA 4JPVH 4TSBL 2B5IB 1NLBH 4RMQA 5C3LD 5A2FA 3QCTL 1G6RB 3QJHB 4TSCL 3T09A 3FOMA 5D7SH 3WFCL 3MJGX 4HWUA 2XN9B 1KBGH 3FFDB 2NYYD 5FYKH 2FB4H 2QADC 4GSDL 1HDMA 5K93A 4LHQB 1CFNA 3T0DA 1KPUB 2XYCA 1EX0A 4Y19E 1BX2A 2NCMA 3MRCB 1BQUA 4MA3A 1GCFA 1NJ9A 3LV3B 1BD2B 3IXAA 3MLVH 3QJHA 5K9JH 3F5WB 1VEPA 3KR3H 4M7ZC 1N6UA 3TBVB 2XN9A 3FFDA 3O3BB 4TQEL 3IS1X 3RWCB 1FFPB 5I1EL 3BW9B 1KPUA 1T6WA 5E2TH 3NFNB 4P2OB 5GISL 3MRCA 3C09C 4R26H 1EHLL 4LVNB 1BD2A 4D2NA 3TNNB 2AEWA 3PIQA 3F5WA 3U4AA 4ZPTB 4IRZH 4NM8L 4LLWB 2PNDA 2XZCH 3TBVA 1QOKA 2DBJA 1NMCC 3O3BA 1EO7A 5J6GB 3MSPA 1ZLWH 1JN6B 2NX5B 1S9KC 2C26A 1YMMB 3O2DA 3RWCA 1FFPA 3CLFH 3TH3T 3BW9A 4GW5B 4FZ8L 1Q1JH 1HHJB 4IIQB 1J0IA 3NFNA 1QUNA 4P2OA 1C5BL 4AEHH 1SHMA 1UEYA 4UUJB 5IF0B 1WAAF 3BZFB 4L8SB 4LMQE 1TJIH 4M7LH 5C0NC 3TNNA 5LVEA 3WFHA 3HZMB 3FO2B 1OF2B 4HJ0C 4LLWA 3QG6B 5C0AB 5J6GA 3BKCH 2P5ED 2RIKA 1JN6A 2NX5A 1QTYT 2J6EH 3C2AL 2XTJD 4GW5A 2YRLA 5C9JA 4APQD 2UYLA 4IIQA 3T1FA 1L6ZA 4NYLB 5KVGH 4ORGB 4E41D 1H15B 5IF0A 3BZFA 4L8SA 5LWYH 3OKKB 2W92A 5AAMA 3BKYH 3IRZA 5DC4B 5ENWB 3P0VL 5JO5B 4F57L 1UWXK 1PG7X 3FO2A 1OF2A 1R24B 3U7WL 1DQMH 4M7KH 2AW2A 4PJDB 5MI0B 4R90H 2HWZL 4LCWD 1PLGL 4YHZH 4NYLA 2Y7QB 1H15A 1JPTL 1RK0A 2EDTA 5EOQL 4RX4D 3OKKA 4QXTA 3QPQD 3E1F1 5ENWA 5JO5A 4Y5XA 3NIFE 5J7CC 1R24A 1CLYL 3FOLB 1F8TL 1VGEL 3RVWD 3RU8L 5SWSB 3HPJA 4DFIA 1IQDB 3DX6B 3MV9E 4EI6B 4JRXD 2Y7QA 4RMTA 4HJJH 5IMKB 1UH3A 3IETB 1D6EB 5CMAA 5DFWH 1N4XH 1BFSA 4WDIB 5KAQF 3VFTB 7FABH 3TF7C 2V17H 3FOLA 2DICA 2JCCB 2BVEA 4S1SH 1IGFH 4UTAH 5SWSA 1OAYH 1MCRA 2VLJB 2AV7B 4LFHG 3SDDB 1G0DA 5EWIH 1EXUB 5ICXB 1KTDB 2ARJA 4EI6A 4QEGA 4R3SB 4U7KA 1I7RA 5IMKA 1K2DB 1D6EA 3IETA 4OQ1A 3VXRE 5HGGS 5DTFB 4WDIA 5H8DA 1KEML 5D2NA 3VFTA 4WRLA 4KKCD 2BNQB 2JCCA 5DZNA 3V4UH 4KJPC 4DK6A 4M6NL 2V9RA 3BN9D 2ESVB 4HIHB 2AV7A 1DE4B 2AK4B 3B8SA 2DQFA 1OTUC 2W0FB 1EXUA 3PHOA 5ICXA 1KTDA 1UADC 4R3SA 4FQXB 4G8FB 3S97C 3TVMD 1CDBA 3QXDB 5HGBB 3N1FC 4KK8D 4UT9H 5T1KB 4KY1L 2E7BA 2WBKA 5C6WH 2BNQA 4Z7VF 1F4YH 3ILQC 3B2VL 3NZ8A 2FIRT 4HIHA 1KJMB 5J12B 2W0FA 4F7CB 4P4RB 3KHQA 1YQVH 3FL7A 4RWHA 3EOAB 4OF6A 1NMAH 1ZANH 1DFBH 4KTYA 3PWPE 3ZKXC 3A0OA 4IRJD 4XRCA 2GFBA 1QFOA 2FWOB 5J3HC 5LCVH 4Z7UB 4FQXA 4G8FA 2DYPD 5DMGD 4KGJA 1F90L 3LEVH 5I1DB 1WAAE 3MBEB 3SGEH 1RMFH 5HGBA 4LVEA 5C0JB 3BD5A 1V05A 1F3JB 1KF9B 4Q9QL 1QEWB 4WWKC 4HF5H 2MKLC 4MXWL 1KJMA 4F7CA 4P4RA 1BREA 3TWCH 2FWOA 1D5MB 4Z7UA 1ZS8B 4JB9L 1A4KB 5JOFB 5I1DA 3MBEA 5C0JA 3K46A 1DBKL 1NGYA 1MHPL 4GS7B 1F3JA 2XZQH 2R0KL 4Q9RH 1QEWA 3QIUC 5DRXB 4EXPX 4PJGB 5CLTA 3FRUB 4DN4H 4UT6L 4K3EH 4I1NB 3RY5A 4QRRD 3NA9H 2YZ1A 5C09A 4X80H 2NW3B 2DMKA 1A3RL 1UZ6E 1ZS8A 4JFDA 1F5WA 1UB5B 1IILE 3S34H 4BM7A 4X4ME 5CEZE 5FUOH 4KHTH 4CN1A 4UIKH 4J4PC 4OLWL 1HOCA 4K2UL 1DBAH 5DRXA 4I2XE 4PJGA 4NO0B 2GCYB 4QWWD 3FRUA 4ISVB 5CUSH 2EYSB 4FQIH 2EC9U 1DSFL 4MHHG 2H8PB 1WEJH 1A7NL 2NW3A 3SOBH 3GSXA 4YX2H 1UB5A 1OAXL 1YC7A 3I6GB 5FYJD 5J1AB 2NXYD 1E4XI 2Q87A 4XC1L 5L88H 1F6AB 1UM6L 1K8DB 1OVZA 5HTSA 1FLTX 2EC9T 2QSCH 1MJUL 4NO0A 4RAUB 4XP4L 5L7XH 5LXGL 3KPRE 4N8CH 2H8PA 2CLZA 2P48B 1X5ZA 3K2UH 3O4OC 4JQVC 1FAIH 3WEXA 2BFVL 2BNRB 3I6GA 1YYMH 3A67L 3CJJA 3CVIL 3TN0C 5A40E 4LL9A 4ZSOB 1SBSH 4QTIL 4ONHB 1F6AA 2NY7H 1B90A 1K8DA 4RAUA 1FL6B 1EIBA 5GRWA 3GKWL 3TV3L 5JLZB 1EJ6A 3UZEA 1ZVYA 1NBVH 2KPNA 3GI9H 4YBQC 1NSNL 1OAKL 1KELL 2BNRA 2Z8RA 3RQ3A 4PJ5E 3FZUD 4FQ2L 3DVFA 4ZSOA 1H3GA 3BGMA 4I3RL 4ONHA 3OWEA 1HYSD 4NNYB 4P4KB 4Z7VE 4Y4HD 1FL6A 5DLMH 4NHUB 5JLZA 4OCMC 3SDCD 5EIIA 1FYTE 3HE7D 2MCPL 2BSTB 4TTDD 5E6YA 3DSFL 5MEQB 4M8QA 4JN2A 4G42B 4Y89A 2NY0B 2W9DL 3FN0H 2VERN 3V7AG 2L0DA 3TT1L 5EN2B 3KPOB 2CUMA 2F74A 4CJ1A 1JBJA 4Z6AT 4H88L 5EU7E 3REWB 1NGZB 4ODBD 5GJTH 5J4MA 4NNYA 4P4KA 1SM3L 5HHQB 4NHUA 1WTLA 2NY1D 5EOTB 3PP4H 4OGAC 2ED9A 1NBZB 5JXEC 1A6TB 5I30H 1RIVH 2BSTA 5MEQA 3UTSB 4G42A 3QWRA 1WK0A 2Z31D 2WZPD 5EN2A 2DBLH 3KPOA 3F7YB 1HXYB 3QDJB 3T2NL 4PJAF 1KSRA 2VQTA 1NGZA 1MCPH 4RFNC 5CJQH 1UB6B 3MCG1 1E27B 5TE4L 2EEBA 4L3CB 3DTXB 2NY4D 1JRHL 4GQ9L 5EOTA 2PYED 1NBZA 4FQCL 1A6TA 5DI8B 3UTSA 1FL3B 1UQSB 25C8L 3DRTB 2ZUQB 1U8PB 3MOQA 4JG0L 3F7YA 1HXYA 3QDJA 2BMKB 5DA4A 1UB6A 3KYMA 4HPYL 4PRNB 2XWJB 1GXEA 4A6YH 3HRPA 1XGRA 1FJ1B 2B2XL 4HCRL 4J3WA 1KC5L 4L3CA 3DTXA 1NCDL 2BRRH 2VZSA 2IQ9H 3CIQA 1QFUL 5DD6B 1BQHB 2MPAH 5DI8A 1XFPA 1FL3A 1UQSA 3C5SB 3I2CH 1PKOA 3DRTA 1U8PA 2J1KA 2VDML 4PR5B 4MA1C 2BMKA 4ZYKA 1AE6L 4W70A 2HVJB 1OGAD 2WLYA 3D9AH 4WHDA 1A0QL 4MNQB 4PRNA 3EO0B 4U0RC 3FN9A 2ZSVB 1DQQB 5I9QB 4ZO8A 3ARBB 3HC0B 1BQHA 4LIQE 4OBRA 4YDJA 4AIXA 4I0PB 4ZTOL 5IW6B 4TUJB 3C5SA 4IOFD 2OJZH 3GUTB 5F88B 3WE6A 4KROB 1TJHH 4BQ9A 1NMBL 3N9GH 1S5IH 4MQ7A 1LK2B 3S6CA 4MNQA 4C56A 3EO0A 1SJXA 3WFDH 5E7FA 2ZSVA 1DQQA 3ARBA 5L0QB 3HC0A 5EU5B 4ODHH 4OSUL 1VFAB 5IW6A 4TUJA 2R2BB 3GUTA 2OL3H 5F88A 5CSBA 4KKLC 4N90E 4X5XB 1H0DA 5DRWB 4UMGA 2ZUWA 3DV4B 4UAOB 3UJIH 4ONFH 1LK2A 1OM3H 1NLBL 4KWUA 2E3VA 2IJ0C 2F15A 1MH5A 2EEAA 5AD0B 5D7SL 3QI9B 1PG7W 3BKJH 4NBZB 1IAII 4EUPH 4NM4H 5FYKL 2FB4L 1CLCA 4JPWH 5EU6E 1VFAA 1EHAA 2R2BA 4Q6IB 3HR5B 4M6AA 1R5WB 4X5XA 2BXZA 5DRWA 2GJ6B 3DV4A 3FB8B 4WFFE 5ICZA 1IGTB 2R39A 1V3MA 1ZA3B 5E4EB 3MLVL 1UKSA 5K9JL 4JFXB 1XF5A 5JXAH 3LS4H 3QI9A 3KR3L 4YXHH 1JZ5A 3W0WE 4XVUC 3C6SB 2HTLD 3FRPA 4Q6IA 1MI5A 3VH8G 4QT5B 3HR5A 2RB8A 5GRUH 3OGCB 5E2TL 1R5WA 5ABDE 1JTOA 4PGDB 1VFMA 4Z7WB 1A7OH 1H3PH 2GJ6A 3OQ3B 4H8WH 3FB8A 1MHEB 1IGTA 1EO8H 1ZA3A 4PJAE 4JFXA 3PXJA 4HKXB 4IRZL 4IM8A 3OKDA 2XZCL 4L3EB 3C6SA 1PX4A 2HFFB 5C0GB 2XPGB 1Y18B 2C4FU 4FXGB 4QT5A 4XT1C 3ARDA 3PE9A 1Q1JL 3OGCA 4JFEA 1AKJB 2EE6A 1YN6B 4PGDA 4AEHL 4Z7WA 1U2CA 3ZSSA 5E00B 3DYMA 3TJHC 3VG9B 4FFVC 5IBUG 1MHEA 1P9MA 1Z6JT 4NQDE 3O4LD 4X6FB 1TJIL 4M7LL 3B43A 2J5LB 2DMCA 4HKXA 5B8CC 3S88H 2C4FT 3BKCL 5F89B 4L3EA 1T20B 1O7SA 2HFFA 3R06B 5C0GA 2J6EL 4F58H 3EDJA 2XPGA 3KDMB 1Y18A 5F3HB 3ARUA 4FXGA 5SX4I 3GBMH 2GSIB 4D9QE 3BZDA 1FIEA 1AKJA 1YN6A 5KVGL 1PBYA 1NUFA 1QACA 5E00A 3JXAA 3G5YB 3WNPA 1AR1C 5LWYL 4X6FA 1T5WB 3BKYL 5KVDH 5C3TA 3OB8A 5C71A 4PJBB 2AABH 3PWVB 2Q76B 2VZOA 2BC4B 3IGAB 1TCRA 4OLZH 3UZQA 1T20A 1DQML 4M7KL 4JQIH 3OKLB 1XIWC 3KDMA 5F3HA 4R90L 4HBCH 2DKUA 2GSIA 4YHYB 2HMID 4IDLA 3P9LB 4YHZL 1B4RA 2Z4QB 2YS4A 3KPQB 2D7OA 5J11B 4OZFH 3G5YA 1RZIA 3ULVF 1T5WA 1JNLH 1NFDF 4OD3H 3NCBB 4PJBA 4LDEB 3PWVA 2Q76A 5A2KH 1FAKT 2BC4A 4GXVH 3IGAA 4N9GB 2W9EH 4ZTPH 2V5RA 1A2YA 1D3CA 3OKLA 1FZOB 1I9IH 1E28B 4WO4B 5CD3B 3KPMB 2NZIA 4WW1B 5FDYA 1QSEE 1NGPH 5CIPH 2Z4QA 1GOHA 4HJJL 4NKOB 1RZJH 1JPSH 4XXCA 1N4XL 1E4JA 3HAEG 4XNZC 1U8QB 3CSGA 7FABL 2V17L 1JHTB 1W0VB 2J7LA 2VR4A 4N9GA 4S1SL 1IGFL 4UTAL 2CPCA 1OAYL 1MSPA 3SKJH 2D7TH 2FEEI 2PO6B 5EWIL 3KPMA 4NFDA 4EI5C 3TO4B 3VFPA 1FG2A 4Y7MA 1CICB 3QQ9C 1NGXB 5C0IB 4I48B 4B0MM 5FM8A 5F70A 3R4DA 4X9HA 4Q2ZB 3SKNB 1U8QA 2V5MA 5IB5B 2D03H 3EYQD 4K07A 1JHTA 1U95B 4Z5RB 2WNGA 1EUUA 3V4UL 4IJ3C 5DUPH 4LAJH 3F7VB 3PF2A 4F7PA 3T0EB 2VAAB 2PO6A 3MJ7B 3DXAE 2O61B 4EVNB 3TIEB 2HJKB 3STZB 1CICA 3G5XB 1NGXA 3DOSA 5C0IA 2EE9A 2Y25A 3OR6B 4GO6B 4I48A 1TQBC 4Z78B 1GHFH 3RDTB 4Q2ZA 4UT9L 2WINB 5IB5A 1T5XB 4ODVH 3UTOA 3KPRB 1U95A 1F4YL 5M94B 4ZG1A 3F7VA 2EXWD 2HFEB 3WHXB 4XX1E 3T0EA 2VAAA 3MJ7A 1YQVL 3MUY1 2J88H 2O61A 1NMAL 1ZANL 1DFBL 2H2PD 2HJKA 3STZA 3TIEA 4NIKB 5LCVL 4RRPG 3OR6A 4MAYB 2QLVB 3G5VB 4FS0A 4HK3N 4Z78A 2B1AH 3LEVL 3RDTA 1RMFL 4V2BA 2WINA 3QRFM 5GS0H 3PWUB 1G7PB 3L7EB 4U4BA 1A6WH 4HF5L 2HFEA 3T77B 1WV7T 3WHXA 2WIMA 4RFEB 4POZC 3ZE0F 3TWCL 1OD9A 5EU7C 1LDPH 1DBJH 4KI5F 4NQCB 3G5VA 5E1AA 4UU9B 1X44A 4GT7A 4PJCF 4YZFF 1YNLH 3ZDYF 5K9QG 2V5TA 1MWAA 5GS3A 3BAEH 4U7SA 3EJYD 5JW4N 3MRGB 3PWUA 4MYWB 2XZQL 3B9KB 4Q9RL 4WI9A 3L7EA 4WUKH 1NAMA 4G6FD 3T77A 4YFEA 2DJSA 4DN4L 4LPCA 4RFEA 4J1UB 4K3EL 4XCNB 1P6FA 5IQ7H 4P99A 4O00A 3NA9L 1GGBH 4X80L 5SX5H 4NQCA 3WXWH 4F15B 1RUKH 3S34L 4UU9A 2C9AA 5ACLA 5EZJB 5B38A 4Z8FH 3CZFB 5IJKA 3ALPA 2E9WA 3ULVE 4KHTL 4UIKL 2VABB 1DBAL 4I3GA 3UBXG 3WMSA 3ET9F 4OGXH 3K2MC 5CUSL 1KT2B 2BY2A 4FQIL 5JHDB 3QEGH 4CVUA 1WEJL 3MR9B 5E8OB 1CGUA 3SOBL 3UAJC 5CHNA 2HP4A 4TVPD 3LRSA 4UTBH 4YX2L 3ARED 3VE0B 5CLWA 1EUTA 3NN8B 2YWZA 4QO1A 3CZFA 5AEAA 4JZOB 2XN9D 4MCYB 3QEHA 3LDBC 1UFUA 5L88L 2VABA 3H42H 3PG2A 2QSCL 1QQDB 4GKZA 5L7XL 1U8NB 1KT2A 4ZXBC 1Z9MA 3U0PB 5DD5H 6CGTA 3MR9A 5E8OA 2JKXA 1G7IA 1PZ5B 3GJFK 1I8LC 4Y16A 1F3DJ 3K2UL 2F53E 1FAIL 5JORB 3NN8A 4EKXA 1YYML 2E6PA 3F8UB 4JZOA 2OR8A 4MCYA 1SBSL 5GGUA 4WUUA 4L4JA 3IDIB 4N0YL 2NY7L 4R2GC 3SCMC 2DLFH 2CKBH 1BM3H 1QQDA 1RV6X 4MJIA 4HBQA 5IFAH 1U8NA 1I8KB 5D1ZB 2NXZB 4TNWK 3U0PA 2KBGA 5F7NC 2A9NH 1NBVL 3GI9L 3SJVB 3BP6B 1J9CT 1FNFA 3MNZB 5JORA 3WS3B 5J89A 2ZG1A 4QHKI 4AEIH 2O5YH 3RI5F 2UUDK 4LSUH 3IDIA 3W9EB 1FZKA 5CP7B 4RBPK 4RCAA 1FZMB 5FV2A 3DRQB 5DLML 2JLLA 1I8KA 1JYVA 1R3IH 4KRNA 3WDIA 4N0FB 1IAOA 4GOSA 3SJVA 3PL6B 4PRHB 3FN0L 3MNZA 3EJJX 3WS3A 3S35H 3Q48A 3MV7A 2KQMA 4N5UA 4PJ8A 1U8KB 4LKCB 3W9EA 5GJTL 5CP7A 1YEIH 4JFFA 4YAQB 5FM4A 4WFGD 2CR6A 3G5ZB 3UDWA 4BUGA 2OI9C 3PP4L 2R9HC 1J88A 4WV1B 1J5OH 5I30L 1RIVL 4KXZI 4N0FA 2QV2A 3ZE0E 2GK2A 3PL6A 1KPVB 2HT3D 4OF0A 4PRHA 1N8ZB 3OJDB 4MGXA 2DBLL 3PGDB 5CZKA 1CGVA 4PJCE 4LVHB 4YZFE 1U8KA 4LKCA 4IRJC 1J0ZA 1MCPL 1IKNC 3CCHB 4YAQA 3BSZH 4NWUH 5DMGC 4JM4H 3G5ZA 4O2FB 5I75C 4ZOCA 2PXYB 4WENB 1AC0A 4WV1A 5HHMB 1CDCA 2ERJB 2GKIA 2RGSA 1UJ3B 1LE5B 1KPVA 2IAMB 4F37K 4ODSH 3WO4B 4ELMF 3OJDA 3PGDA 1UT9A 1HCFX 4G6AC 1CTNA 3OAZH 5SWSD 3VWKB 1MCDA 5MHSD 4BFEA 2JJSA 3WKMH 5JOPD 1RUMH 4A6YL 4XMPH 5GIRB 4O2FA 4LEXH 4EOWH 2BRRL 2IQ9L 3PNWB 2B39A 2VTFA 2PXYA 3HA0A 4PBVC 5DMIH 2MPAL 5FA4A 1EEQA 5E99H 1P6AB 1UJ3A 3I2CL 1LE5A 2IAMA 4CAGA 5DZOA 3TA3C 4PLOB 4HPOH 1I1RA 2LU3A 3SY0A 1LO5A 3N85H 3AMKA 4NCC2 3VWKA 4QHMB 3D9AL 2X1QA 3MREA 4PRPD 4F8QA 1Z0NA 1A1OB 5GIRA 4M3KB 4L9LB 4KFZC 3ARRA 3PNWA 3F65A 4PG2A 2X4SB 2FJFB 4XP6H 5FK9B 6FABH 1P5VA 4HXBH 5EB9A 4RIRB 2OJZL 1G7JB 4BFIB 4PBWD 1D5XB 4TOYH 4S0TD 1TJHL 3QYCA 3LH2H 3N9GL 1S5IL 4QHMA 5T3ZH 5EC2B 2BHUA 1KENH 1C08B 3RVVC 1CDJA 4NRXB 5KJRH 4BZ1H 1Z2KA 3WFDL 3QIWC 4PJ9A 3QAZC 2Q8BH 4L9LA 5TH2B 3K4DA 2F8XC 4JGJA 3UJJH 4FQHB 4ODHL 2X4SA 4FG6D 2DTSA 5FK9A 4QXGH 1LP9F 3BEWB 4RIRA 5GXBB 3KLHD 2OL3L 1ZWIB 1J8HB 4BFIA 1D5XA 5LGKA 2FLRT 1XZ0A 2DQCH 1A7QH 2EXYD 3VU2A 4ZPVA 3UJIL 1K4CB 3LB6D 1I85C 4ONFL 2CGRH 4TVPH 5JW5B 2HTKC 5EC2A 1OM3L 1S7UB 4TUOB 2WW8A 3STBA 1U3HC 4NRXA 1Y6MR 4H25B 2FX9H 1RHFA 1QSFB 1U2HA 3BKJL 2W38A 5TH2A 1OP5H 4BYHA 2QADB 4FQHA 4NM4L 2FEDC 4JPWL 3ZKNC 4Q58C 4PLJD 3U82B 3BEWA 4Z9KB 1AO7E 3VRLF 1ZWIA 3IVKB 1J8HA 2F5AH 4YQXH 2CK0H 1K4CA 2ZNXA 5JW5A 3MUGB 2VDKH 4OIBA 4OUUB 1T1WB 4ZS7H 1S7UA 4TUOA 2DKSA 3U4BH 2A77H 5JXAL 3AB0C 4H25A 3LS4L 4YXHL 4EN3D 4QRPE 2AVGA 5C09D 3RVTC 1QSEB 4XH2B 4RAHA 5E70A 1ZLVK 4JFDD 3DECA 3PGFH 5LJYH 3IVKA 5GRUL 4GRMB 5IFHH 3C09B 3GSWA 1A7OL 1H3PL 4PP2B 4UINH 4H8WL 2MOVA 3MUGA 4R9HA 4ETYA 1RVFH 1EO8L 4OUUA 3MRIB 1T1XB 2OSLB 5F7DB 1UCBH 3VCLB 2MNUA 1NMCB 2E5EA 5IW1B 3CLEH 4J7RA 5CKGA 3RHWF 4XH2A 3L5XH 2C3HA 3ZTJH 4K71C 3MRMB 3NPSC 2NY1C 2R8SH 4PP2A 4ELME 1OTTD 1V3KA 1B0RB 1T1XA 2E27H 4NO0D 2OSLA 4WGVB 1C8PA 4PJIE 5F7DA 4MA8H 5EDXA 1Z9SA 4JJHA 3MJ9H 1D7FA 3GRWH 1CFSB 4KJWD 3S88L 1ZVHA 2UV3A 3O41B 3PQYE 2FO4A 1CFBA 1KIRB 1DQTA 3CDYA 4GJTB 4F58L 3GBML 2X9WA 4H5SB 2WBJC 3MRMA 1NUGA 4OB5H 3RGHA 3O6FD 5HI4C 4GRWH 1B0RA 3OKOA 1LO3H 3KGRA 5KVDL 1X7QB 5J1SC 1N6QH 2HN7B 3C5ZD 1TNMA 2XXMB 2AABL 2P7TB 1CFSA 3ZE1F 5L2KD 5DEFB 5C0CB 5TDPB 3O41A 4OLZL 4UV4H 1GIGH 3DMMC 1VESA 4JQIL 2BNRD 4DQOH 5E9DE 4KRPD 4DZ8B 4HBCL 4FFWD 4NOFA 3SO3B 3JBG7 4H5SA 3HCVB 2NLJB 5CJXC 4QRSA 3RIFK 3UPCA 4DUWA 2FX8H 4B5EA 4K9EH 5MERB 3CDCA 1X7QA 1RZJC 2HN7A 1JNLL 1RURH 4Y2DB 1JRHI 4OD3L 3MLRH 4WFHD 4GG8B 2P7TA 1AIFB 4GXVL 5TDPA 2W9EL 1JZ8A 3ISWA 3DUUB 5TQ2H 1JPFB 4ZTPL 2A38A 1FC2D 1DEDA 4KMQA 4DZ8A 1I9IL 2MWCA 4DKEH 2DM7A 4NOBA 2NLJA 1LP9E 5EUOB 4B7IA 4PTUB 2VLLB 1NGPL 3AU1B 4JRYB 1ZOXA 1RZJL 1JPSL 3EYSH 1V7MH 3TYFB 3CXHK 4MNGB 4Y2DA 2Q6WB 4GG8A 1AIFA 5IK3B 3V4VL 1DQJB 1HSAB 1KJ2H 3QWRD 4NFCA 1JPFA 3SKJL 2F54E 2D7TL 4P57B 2WP3O 4G9DB 3HRZB 3JTSB 1I8IA 4PJFF 5EUOA 4PTUA 3AU1A 3VRLE 1MVUB 1NEZG 3OG6B 4JRYA 4XWOD 3TYFA 3WLWC 5MENE 4MNGA 3U0TB 1TVDA 1D9KB 5HHOE 5HSFA 2Q6WA 1IC1A 2D03L 2EH7H 2Y6SD 5IK3A 1UWEH 1A1NB 1DQJA 5DUPL 2X1PA 1X5KA 5F93C 4P57A 3IJHB 3CFBA 3QDJD 4G9DA 1X5JA 2JJVA 3OJMB 3HRZA 3JTSA 5T3XD 5DMYA 1MVUA 4UDUA 4CNIB 3V5DA 3VXQA 3AC0A 1GHFL 3U0TA 4MJ6B 1D9KA 1YEJH 4YE4H 2B7DT 4J3XA 4ODVL 1A1NA 2OQJB 5GS0C 2WQ8A 4LK4A 1DN2A 1LEGB 4ZMAT 3SQBA 1MAKA 3IJHA 3ZKXB 2DLEA 1NFKA 2J88L 2OMNA 4Y1AE 1T04B 2IANE 4CVZB 2FHCA 2WLZA 4CNIA 5IB2A 4E42B 1XF1A 2B1AL 4K55A 4MJ6A 3IFOB 4K3GA 5F71A 5GS0L 4WWKB 2EDJA 2OQJA 1LEGA 1MCLA 4OD2B 1A6WL 1YEHH 3ZT5A 3O8XD 5JQHC 3MA7A 3RA7H 1A7PH 5DC9B 4L4TA 5D7LD 1T04A 1R5VB 4Y0GA 1JI2A 1CDHA 4CVZA 5A2JH 1LDPL 1DBJL 2E9BA 3MUJA 1EAPB 4MNQD 4C56D 5LQBH 5ISZB 4EJ1C 1YNLL 2PKDA 3IFOA 1VADB 3BAEL 5EIQA 5J1TC 4WWKA 3ZKMC 4F8TA 3BP7B 3RTQB 3GMNA 5E6IB 1TITA 3ZE1E 4WUKL 3V0VB 5IEHB 4AT6B 2ZZUT 2BERA 1Q9LA 3WUZA 4KI5C 5IQ7L 5CJOH 1OB1B 4I9WD 4K94H 1CYGA 1GGBL 5ISZA 4Z8FL 4M5YH 1ZHKA 3BWAB 1VADA 2EECA 1LILA 3RTQA 5E6IA 2BK8A 3NCYS 3V0VA 3G9AB 4OGXL 4AT6A 1UWXH 2NR6D 4LCYB 1OB1A 3QEGL 4IMKC 1JZ2A 4NKMB 1XEDA 4UTBL 4LAQH 5ITBH 1FBIH 4IS6A 1K3IA 4J2XA 4P23C 3BWAA 5FOJA 1EVTC 4MWFB 3H42L 1ED3B 1MI5D 4NO2B 1JNJA 2YD3A 1GGCH 2BVQB 2D4FA 5EBMB 1KIPB 1HN1A 2Q3ZA 3HG1B 2GJ6D 4LCYA 5DD5L 1LGVA 3E3QE 3VDBA 1MRFH 4M3JA 2HJLB 4NKMA 4EQ2A 4M9OA 2LU7A 4PJFE 5AZEH 2VC2H 2UZIH 3TN0B 4HIJB 4PRAB 3QDHA 1CD8A 3MOAH 4NO3A 3QO0B 1QO3B 4HMEA 3RKDD 4KJYB 3UTTE 4KHXH 4MWFA 4HWBH 3WLBB 4DWHA 2DLFL 3UTZB 1A6AB 2CKBL 1BM3L 2Z0BA 4NO2A 3QXUA 3C8KB 3ARDD 4PRIB 2R23B 2BVQA 2X4NB 3DVGB 1KIPA 5EBMA 5IFAL 2X4TB 4JFED 3HG1A 2APTA 3H7LA 2B4CH 1UM5H 2A9NL 3ZYJA 1PFCA 4HXAH 2HJLA 1CD0A 1MQKL 3TN0A 2E8ZA 1MREH 4PRAA 4NQED 2K7PA 4JQXA 3CMGA 2O5YL 2VNCA 1J12A 1I3VA 1QO3A 2CD0A 1ZAGA 2M1KA 3GSNB 4LSUL 1ZT7B 4L3ED 5F9WC 4KJYA 1F13A 1TLKA 3WFZA 3UXFA 5E8DH 5CGYC 1X4YA 3UTZA 1A6AA 4PRIA 1YUHB 3WFBH 1WZMA 2R23A 4OZIE 2VXVH 4YO0B 2X4TA 1REIA 1R3IL 1FQ9C 3CDGB 1HHKB 2EO9A 1YMHB 2ZG2A 3S35L 1ZE3C 4Y4FC 5GRXG 4J3UA 1YEIL 4ZO9A 2XTJE 3PDDA 1YUHA 4PJ7F 2X40A 3BPCB 3BD3A 3D0VB 5BRZE 4E41E 2H2SC 1J5OL 1S3KH 4D0CB 2EXWC 1L0XA 1HHKA 2W60A 1F2QA 2AK1H 1YMHA 5D1QC 4OCYH 5T3XH 1ZXQA 3HB3D 4I77H 2AJZB 3BSZL 2Y72A 1LWRA 4NWUL 4JM4L 4G7YH 3JWDH 3MJ8B 1AO7B 1JF6A 3BPCA 1UH2A 5JXEA 1HXMA 3B9EA 3TBWA 4J23A 4YR6A 1R5IB 4D0CA