4BQ9A

Crystal structure of the fn5 and fn6 domains of neo1, form 1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
205
structure length
205
Chain Sequence
TPMMPPVGVQASILSHDTIRITWADNSLPKHQKITDSRYYTVRWKTNIPANTKYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGATFELVPTSPPKDVTVVSKEGKPRTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTPGTKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Repulsive Guidance Molecule (Rgm)-Neogenin Signaling Hub
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords NEOGENIN
total genus 35
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bq9A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bq9A02
1E27B 4F7EB 4DVBB 4H25B 4K23H 3MLUL 3NTCH 1Z3GL 3EHBD 5IW6A 3D6GA 1UXSB 1UA6L 3KPPB 8FABB 5EOCH 4DW2L 3HG1E 1AXTH 4NQVB 1L7IL 5DURD 1JPST 2K7QA 3VXUA 3OAUH 1YMME 4NCC1 2CIKA 1ADQL 3HE7A 3DRQA 5JLZB 3MV9D 2AJYL 5DHYB 1D5ZA 2VL5B 4OCNC 4EOWH 1DSFL 2ED8A 3BP6B 2H2PD 4RBPH 4NWUH 1DBBL 4FFWC 4PJ8C 5J9PA 4G8IA 3K4AA 1KPRB 1KN2L 4QWWD 4JFED 2ADGB 3PDOB 5CP3H 5F9JA 4AK1A 3BEVA 4URTB 1C08B 3EO9H 1ZHLA 3NIDF 2CUMA 4X99A 3F58H 4KY1H 4HX1A 5GS1C 2X10A 4ZXBB 1JGEB 4XPBL 4OLYL 4IMLB 1X5HA 1XGPB 5IBLC 3KLHC 4HKXA 2X44D 4XXDA 4QRRE 2AKRA 3CH1A 3L3DA 1DE4B 1J7VR 2EDYA 2DN7A 3K3QA 3OWEA 5DRZA 5LBSH 3F7YA 5EZIH 5DHVH 4W6YB 5E9DE 1MH5B 3U7YH 1PKQE 1IC5H 3T0BA 3FRUA 4KMTL 3T04D 5AZEL 3LV3B 3VXPA 1FC2D 4M7LH 4OLXL 1G7LB 2APXA 4M43L 5T3XL 3P4NB 4WWKA 1EV2E 1WAAF 4F33A 4S1RH 1EZVX 3BN9D 5JW3H 2MPAH 4ODTH 2B5IC 5TDOA 2JELH 5J9PB 4C4KT 3VD5A 3BSZH 4IS6A 3WD5H 5EA0H 4WUUD 1YQVH 4YC2B 4CMHC 1REIA 4NUGL 4PRBA 1CT8B 4TVPH 2ESVD 2P44B 3TJEH 1AQDB 2R9HD 3H9ZA 3JV6B 1XGQA 3BZ4B 1YNTB 1ZHNB 4DN3H 5JHDA 4LHJB 2HG5B 4U1SA 4FFVC 2UY6A 4Z78B 2AJSL 2X1OA 2ZNWA 4HJ0C 3UZVB 2R29L 4FQIH 4JKMA 4O00A 2R39A 4PJEE 4OIIL 1BIHA 1QR1B 4NJAL 1KTKE 1V3JA 1FAIH 2WSKA 1E6JL 4ODXB 5EN2B 1DBJL 5D7IF 4WTZA 2ZOKA 3RWEB 4JFEE 4NQDB 3TESA 3JBG7 4WV1A 4FMFA 1P53A 2X6MA 4S11A 3U4BH 3ZKMD 4FXKB 4MVBC 5HVHB 1MVUA 2YR3A 3B3IA 1R5WB 1KNOA 1IAKA 3WKNA 2EH8L 1YPZF 1WC7B 4K3JH 3BGMB 5C2BH 4AENA 2WUBH 4U1HB 1W0WB 4PJIF 4LLYB 2K3TA 3VW3L 4AJ0A 4DEPB 3QDJD 2D7MA 2CJUL 1XCQA 1F42A 4YHLL 4XBGB 1A14L 3ET9F 4U6YB 4QO1A 4WU5B 4KV5E 5C0AE 1QG3A 4GBXA 3BZEA 4RRPA 1P1ZB 2AV7B 2JCCA 4TUKH 1JN6B 3MLRL 5JZ7C 4UQ2A 3QR2A 4DOHB 3EJYD 4JZNB 4Z7OE 1OCWL 5IB4B 5A2LH 4GQPH 4YUEH 3S37X 1AIFA 1FPTL 3DARA 1HHIB 1MFAH 2AJ3B 3V6FA 4XBGA 2HLFD 2BNRE 4W68A 4R26H 2SEBB 4OTXL 1EHLH 2Q87A 4YWGH 2RFXA 1BF2A 2R1YA 5GRVK 4OCXL 1FNLA 2EYRB 2GSGA 5KAQG 4P3WA 4AZ8A 2BOBA 2WIMA 5E8OA 3BDYL 2FZ3A 4GRLD 1KEML 1U2HA 2H8PB 1NJ9A 2D0GA 4R8WH 5I73C 3L3KA 1A5FH 1VFMA 5KOMC 5ISZE 2BVEA 2VLJA 1WZMA 3HLAA 5BMFH 4LSTH 4NSKB 2LU4A 3RAJL 3QHFH 4Z7UF 2Y9RT 3LEVH 4WTXA 2O26U 1CXHA 2ZUVA 1GOFA 3OAZK 4WHTB 5LKNA 2QL1A 4YHZL 2Z8VC 1YY8B 4O4YL 2V5MA 1UVQA 4LEOA 4TVPD 3IJHA 5TGBA 3QJFA 1T1YA 5JR1H 1GC1H 1KBGH 3AROA 5ANMA 4MAUL 1S5IH 2DQDL 5EUOF 5I8OL 4F2MB 2QEJA 2BVOA 2JIXA 1OSPL 1DDHA 2J4WH 3QEQD 2Q76A 3QIBD 4RGNE 1Z5LB 1CE6A 3WJJA 3HS0A 1MELA 4GG6A 1I8IA 2WQRA 3Q6FB 1R3HA 3LS4L 3G5XA 5I6XB 1H15A 3CVHA 3DYMA 5FHBH 1U6AL 5ECJE 1X4XA 4G8GB 2CLZB 2LU7A 1BVLA 4HG4K 1K4CA 4Y88A 2Y36H 1IKNA 3MBEA 1P84J 1S8DB 1R3LA 3LKQA 2ITCB 3AAZA 1NGWB 4OGAD 1K3ZA 1HINL 3F7RA 4G80A 4PG9B 4PJXA 1J8HB 4JB9L 2M26A 4GRLA 1FZOA 2R0ZH 3H7BB 1H5BA 2Z35A 4JRXB 4PFEA 4XP5H 2D7NA 2EDXA 1LO4L 4BH8A 1TZIB 4LKXB 2E9JA 3T3ME 4MWFB 1S5HB 4ZAKB 1A6WL 4KTDH 3BD3A 4KMQA 3C6SA 5DUBB 2VXTL 4L3ED 3TN0B 1KFAL 1IAOA 3OKNA 3VI3E 4MNHB 1X6LA 5F71A 5GRUL 4OD3L 1WEJH 1JZ4A 5D1QA 2W9EH 1SEQH 4LCUA 4NQEE 3A6CL 5DD1H 3OJ2C 2PETA 2V5YA 3B9KD 4JM2C 1F6LL 1S7VA 1IAIH 4OZGA 5JXAL 3I6KB 1CBVH 1MCKA 3FFDA 2I07A 2X1QA 3VI4E 4DUWA 1OAKH 1UADC 1U8QA 1QYGH 3T3PE 3LN4A 5I1KL 1X5LA 2W1NA 2QV2A 5E2WH 1CL7I 1MWAA 5IJVB 5GRUH 2DQIH 3SKMB 3MV9E 5J3HD 4P23B 2EECA 4XCYB 1MLBA 2YUVA 1IE5A 1P4BH 2VXTH 3ARDD 3C5SB 1ODAA 1A6WH 1XH3A 2BJMH 2Y7QB 3NZ8A 5CJ5A 3BJLA 4EN3B 1L6ZA 1NCUA 4O9HL 4XP5L 1NMBL 4RGMC 4K55A 4PJFE 2A83B 3UDWC 3B5HA 1OAUH 3STZB 4KDTA 2P7TB 2VDPH 1FIGL 3VGHA 1ZSDB 2VR9A 4HZLB 3MV9A 4DGIH 4N8CH 3FB6A 3F7VB 3ZE1F 5E5UB 3WNLA 2AGJH 4NRXB 1MHEA 5T1MA 2B1AL 4KKCD 4ELMA 3P4OA 2XZAH 4P3DB 3QIUB 1P6FA 4Z7OF 4PJBE 1NBVL 2W0FA 4PJGA 1U36A 4X6BA 3FB7A 3CDCA 4LQ1A 2LAAA 5I8OH 1BFSA 4QRPB 2VXSL 4LSQL 3HNSH 4OIBA 5DJXA 1EMTH 3UTQA 1MJJA 3G6JB 3O4LD 3L9RB 4X8JA 2YPLD 2DQGL 4HLZH 4IM8A 3VGGA 3CXHJ 1OW0C 2YK1L 1IFHH 3ABZA 3RAJH 1XIWD 4G6JH 1YEHL 5HY9B 2CUHA 2Z31C 2GTZB 5J3HC 3WV0A 25C8L 1NDMA 4Y4KB 3T08A 3BISA 3EDFA 1VACA 4GXVH 4L3AA 1U9KA 5IV2A 2B2XL 1A9EB 1T1ZA 5EU6E 4C59B 1WT5C 3V95A 2A38A 2KZWA 4X98B 2R2CA 4M9OA 2X2YA 4OCXH 4OTXH 4QXGL 5DJCB 3WUWA 2ZOKB 2ZPKL 3MRRB 4EXPX 2MCPH 3CC5B 1OLLA 4NNYB 3AREA 4MNGB 4Q6IB 3CU7A 5SWQB 4JDZB 5C08B 2J5LB 3ZZ1A 3TYFB 4CMMA 4IOFC 3ZTNH 4OLUL 3SDAA 5I1LA 2YXFA 4UQ3B 3CUPB 3I6LD 1T22A 1SJXA 3RNQB 1Q72H 2WIIA 1QEWB 5D5MF 1NQBA 4HK0A 4JKLA 2KDGA 4QOKB 3T2OA 4M6NL 4JZNA 5FUCC 3HN3A 5D6DC 5IJVA 3H9SB 5ESAB 4ZODA 2JCCB 4IOIB 1KELL 5BZDB 4LP5A 3SDCA 4JFZH 2VLRD 2EH8H 1EAPB 1BREA 2HJLA 4G43A 2VDQH 2IBBA 2HWZH 4LEXH 2YD8A 2GSGB 3UAJD 4N1HB 5DSCB 5C0RL 1IGFL 4D0DB 2XNAB 2QQLH 2W0KA 4U0QB 4XI5D 3FOLA 2YSSA 3NIDE 4LARH 5HGBA 5IWLA 2FBJL 2BC4B 4KDTC 2V2XA 1FAIL 1VERA 4NYLB 3QUMH 4YPGA 1LEGA 1RZGA 5DD3L 1BD2A 3EYFA 4YIQB 4MA7H 2D7TH 5DEGA 4AH2A 4M7KH 2NY3C 3VH8B 4P57B 2GJJA 4PJCE 4KI1A 2WLYA 3MFFB 1I8MB 2IG2H 5DMIL 1BF8A 4LBEB 4GQ9H 3RUGF 3PJSB 4MJ6B 3LS5L 3HC0A 1OM3L 5E5MA 2WV3A 4RMTA 1DBAH 5AYQA 3ELAT 2FJGB 2H3NA 4BJLA 3WUWG 2V9RA 2ED9A 2EYTB 3D5OF 4LHUB 1T04A 4N0UB 4AIXA 3KR3H 4GS7C 4HKZB 2NY3B 1AO7D 2P1YA 2VYRE 3BIKB 3GSNL 4E0RB 4M6ML 2E8ZA 2Y5TA 2HMIC 4PRHA 1MAKA 2X09A 2NPLX 4D9RE 3LPFA 5T3XD 5T3ZE 4GFTB 3MRCA 1LVEA 2Y06H 1IGJA 5L6YL 1VFAB 4Y4FB 5GS1A 3I6LE 4NM8L 4PLNC 1S8DA 4LVEA 2XTJC 3BH9A 5L88L 1OTUC 3MLSL 1NKRA 3TBSA 4LOUD 4PV8B 1N5AB 2PYFB 4M5YH 5KSAB 4XVSL 4XMLH 1H15B 2JKXA 3VE0A 1D9KD 3N1PC 5EBMA 3WMSA 2ICWB 5KTEH 3GSRB 1OP5K 4ZG1A 4XMPL 1DDHB 1E4JA 2JE8A 2ZUUA 1ZHNA 4ZFGL 1D6VH 3VFSA 3BIKA 4YC2C 3FOMB 3V6BR 1J8HA 3UPAA 2JJUA 2CIIB 2BSSA 2B5IB 4ZFOA 3CUPA 3U46A 5JPMA 3BUYA 4JPVH 1HSAA 3MRLB 5EG6C 1VADB 3MBEB 1N59A 1C08A 3NCBB 4JKKA 1YPZE 1F90H 3DMMC 1J5OH 4JG1L 2XY2A 5DI8B 1MI5B 2UWEA 4NZTH 5HHOE 1A6AA 4QTIH 1ADQA 2VABA 3C5ZC 5FYJU 4BZ2L 5I66A 5J6GA 1JZ6A 3NABL 4JKWA 2H32B 4JFFD 5FUOH 1GHFL 3AFLA 3ARXA 3EDDA 4LAQH 1JNHB 3MA9L 3VMOA 1Q0XH 4Q2ZB 3OKDA 3PABA 4UZGA 1WBZA 1FG9C 2JJTC 3DO7A 4F7MB 5GS0H 3CLEL 3LAFA 4HFUL 1TJGH 5E08L 3SGKA 4M48H 4Y8AA 3GM8A 1F58H 1UWXH 1EEUA 4LSUH 3EYQD 4L3EA 4P59L 2OK0L 1X4YA 3ULUF 4FQHB 1MF2L 2F5AH 5IVXA 1FNEB 4FQQB 4ODHL 4OD1L 4I48A 2J8UF 2XPGB 5GGTA 3WIHH 3S5LB 4JFOA 3ETBF 4F15C 1JNLH 3L3KB 5DWUL 4L4VD 1LMKA 4CGTA 3V8CA 5DDHB 3VFTB 4KTEL 1EVTC 2IANB 2H9GB 3R4DA 1EFXA 2P5EA 3D85A 5DJAB 3I3BA 4KQ4L 1AGCB 4ORGA 4ZTPL 1BZ9A 5T1LB 1SEBA 4JZJC 4IOFD 3QFJA 5CZXD 4LSSH 4U1HA 3U4EA 5HVFB 3ULVH 5MEQA 1D9KC 1LO0H 2P43B 2CH8A 4I9WE 5BVJA 4C56B 1R0AH 4K3HA 4PJAA 2XIDA 1XF5B 1BQHG 4YDKH 1S3KL 4IOIA 3RWEA 2DQHH 1XIWA 3QISA 3HC4H 1A3LH 1CF8L 4OZ4B 3VFPB 1DVFA 3RVWC 4JE4B 5CILL 3SPVA 3S88H 5KVGL 3FT2A 4KZEH 4PJCA 1ZANL 2J1KA 4KC3B 1UH2A 4D3CL 3BH9B 4ZUTA 1XEDA 4N0FA 4AENB 1BJ1J 1U58B 3HRZA 4G9DB 4G8EB 1CR9L 4EDXB 4Y2DA 4PJ5E 1SVCP 4C54A 2EKSB 1NC2A 4APQD 3TVMC 1IC7H 3WFCL 2WANA 1WSST 3MLYH 5DD0H 3MODH 3TPUB 5K9OB 1FVCB 3U9PH 1MFEL 1PSKH 4YZFE 5HHQA 1GGUA 4LLUA 3OR7B 3QIUA 1SYSA 5I18L 4X4YA 1AKJB 1E28A 4HCRL 2HJKA 3A6BL 3VFMB 1DTUA 4LU5H 4MJ2A 1A2YA 1VA9A 1CE1L 2ESVA 2WINB 5IB1A 1DLFL 3SKJL 4DAGH 5GZOC 2HMID 3ZHDA 1KCLA 4X80H 5D7JD 1KF9B 5I0ZA 5JORB 4GO6B 4CU6A 3IAQA 1DEEA 3CFCL 5IHZA 3SDAC 3DXAD 1TJIH 5D70H 1DQQA 4K7PX 4LCYB 5BW7C 1A4JB 3MXWL 4K9EC 4U05A 4F58L 3AY4C 3W0WE 3WIIL 3BKYH 4PJBF 3KPMB 1HH6B 1U8NB 4G8FB 3KNBA 3VXSE 2CDEB 5F6HJ 2PNDA 2P8PA 1T6VN 3JV5A 3LN4B 2VL5A 2R2EA 3V9FA 3OG6B 2V7HB 4XPHL 5D7LE 4HWBA 3C2SA 3GI9H 4MQSB 4JDVA 3IDXL 2PYEE 1IAIM 2EXYD 4P5MA 4PJ9C 1HQ4A 1U8KA 1I7ZA 1WVZA 2QADB 3QUMA 5IVZB 4OZIE 1HHHB 3KPRE 5FV1L 5A2KH 4CMMB 4K7PL 4ZTOH 1OWWA 3QHZL 4PRHB 4FG6D 4KRMB 4NQCE 5KS9B 4PJDF 5IROA 1RPQA 1LD9A 2OQJA 2R0KH 1UG9A 4DAGL 1MRDL 1RVFL 2C3HA 4BQBA 1U0QA 3WFZA 4OF5A 1D5ZB 1MCLA 4XB7A 4IDJH 3LZFH 1UCBH 3BRDA 2WWKT 1GAFH 4U6TA 5T33L 3CFJA 3RZCA 2Y6SD 1NFDB 5I1EL 3CMOH 2AQ3A 2R2BA 1XGUB 4NOFA 5KW9H 5IGXH 3PGCB 1EX0A 1KG0B 2BSTA 2DM7A 5IW6B 1LEIB 4KK8D 3ME0A 5IBUG 5D1QB 4GBXD 2AV1B 4CNIA 1XGYL 3ARFA 2WQ8A 3QI9A 2P45B 3HUJB 5AWNH 3DSFL 5GGSY 4LDOB 2VLME 1RIVL 1OAZH 4CW1B 5FYKL 2ZG1A 3K0WA 1XF4A 3MROB 3U30C 4JRXA 2D7PA 1NC4B 5E2JA 3SHSA 5D7SL 2LFGA 3WHE0 4K71C 2QR0A 5IVZA 4F3FA 3KS0H 5HI3C 4D3CH 3TO4A 3RPKA 4PP2B 3K8LA 1QEWA 3BGFC 3KPTA 1YEGH 4PJDA 3LRSB 1R3JA 2BVPA 4LRIC 4YX2L 2F74B 3FT3B 4P2RE 1CL7L 4LPWA 5ALBL 1X4ZA 4N90D 4HLZG 5DJ8A 4DTGH 3GBML 5DD5L 1U3HC 4XCNA 3Q1SL 2UVFA 1RZ8A 3VFOA 2Q6WA 4RISH 3IFOA 4ZDHA 1MQ8A 5DS8B 1I4FB 5IVNA 1MCQA 4LCYA 4XNZB 2D03H 4KQ3L 3S36H 3QXWA 1BBJB 2X9XA 1LE9B 1XCTA 3PF2A 3MXVL 3QYCA 3QUYC 1WIOA 1CICB 4XAKD 1RHFA 3V6ZA 5FO8B 4MDIA 1ORQB 3VXNB 3V79C 1EJOL 2V7NA 1QP1A 4Y4KC 5HDQH 3QCVL 4KK8C 4N68A 1JNLL 3WHE1 3T0EE 3HG1D 1CT8A 4PJEF 5ACLA 3RIAK 1KJVA 5MENE 3G5ZA 2BCKA 1RIHL 3C08H 1MVFA 4MAYC 4WUUE 3B2UD 3UPRB 1R5IA 1MF2H 3CSGA 4X9IA 2FO4A 3FRPA 2Z93A 3TJHD 5DMJB 5GHWL 4PLJC 4QHUB 1YYLL 2X70B 3IDJB 4LCUB 1G7LA 5DFWH 2ATPB 3WIHA 3QCVH 4ZUWA 1WC7A 3CLEH 1G7IB 1F6FB 5LGHH 3ECBA 1PLGL 1LEKB 1SJHB 2WNGA 4UILL 1MH5A 3LSOB 1JZ3A 2G5BB 5CS7A 1Z9OA 2W0LA 5GRJH 2H26A 2D03L 3MX0A 5HDBE 4Q9CA 2XTJB 2EYSB 5EIIB 1CU4L 3KJ4B 4HEME 2DQCH 1WFOA 4PRAA 4L9LA 1G9NH 5D6CB 4ZSOB 1D5BA 1INEH 3CVIH 3LD8C 1RZ7L 4EZMA 1H8OA 4LCIL 3QUKB 1QRNE 3FT2B 1N26A 3D48R 3DX6B 5HYEA 5AZ2L 5BV7H 5A2FA 2EDLA 1WTLA 1KJ2A 4P23D 3LRHA 3SE8H 3DV4B 5E6YA 4CVUA 2DIJA 3BE1H 5A2JH 1HHGB 1M6OB 3I50L 2F53D 5C07D 3DXAE 3ARED 4OV5B 3QI9B 1P5UA 3O6LL 1JTOA 1C1EH 4KJWD 3PWUA 2X9WA 1U8OA 2VISA 1DVFC 2XN9B 3V5HB 2ZKHH 2AJZA 2CXKA 2VQUA 4M5YL 4QRSA 5GRZA 2B7DT 3MA7B 2HH0L 4NT6A 4JM4L 3HI6L 5GISH 4MDJB 4NWTH 4ELKA 4DGYL 5DJAA 2PTVA 5IJKA 1B0RB 4RFNC 1JL8A 3LKNB 5HBBA 4WUKL 4ODVL 4Y2DC 4HKJA 2VH5L 1HKFA 1KTLA 3G08B 3OF6A 3MREA 3GIVA 3T3MF 1I3RB 4Y5YC 1J0HA 4XNMB 3MRFB 4JFHE 5B4MD 3SGKC 1U93A 2AJVL 4D9QE 3A67L 1AKJD 3CH1B 4EUPB 1FNSH 5E8NA 3R8BB 6FABL 1RAMA 4OB5H 4WEBH 4XCFH 1F3JA 3W82A 4JHAH 3VWKA 3OKNB 4OF0A 1DEEB 3UYPA 1GPOH 4NQXA 2W9DL 3MV8A 1KCSL 2OJEB 4NGHL 3M1BB 5L2JA 3VWJD 4IHOA 4WEMB 1JUFA 1R24A 1DJSA 1NKOA 4G80B 4PG9A 4Z5RB 3UC0H 1JRHI 5D1XD 3ALWA 3V6OC 1Y18B 2DM3A 2R8SH 3WN5A 1X7QA 2IPKB 2Y6SC 4Y16A 4WFHD 2FEDD 5LWYL 2NW2A 1QVOB 4MB5A 4WWID 3CDGB 2QQLL 3QNZA 1IC4H 3PIQB 1UWXK 3MR9A 1I8IB 3QUXB 1NGQL 1HXMB 4R6UA 4XBEH 1DR9A 4PJ8A 4X5XB 2CMRL 1XF3B 2CDFB 5I2IA 4LEXL 3JWOH 4PRPB 3S4SG 4U1KA 5E8DL 2OTPA 1SY6H 2J6EL 4ZS7H 4NKDA 2NY4C 3F6IA 4F58H 3I02A 4DK6A 1CDHA 4EDXA 1JPTL 1DFBH 2FGWL 4KKNA 3MJ7A 1X5XA 2VOTA 3QIWC 3MLXH 5H8DA 1BFVH 2DBJA 4EDWH 4OLZL 4YR6B 3QA3B 4LLWB 4YQXH 2CGRL 4WFFD 4OGYH 1CZ8H 2ZNXA 3PXHA 1AGCA 3GSVB 4MDJA 1AO7A 4N90E 3UYRL 3IFNH 5CGMA 3D0VA 4B50A 4PG2C 1CIDA 1HYSD 2ATKB 4WCYH 2JIXD 2BVQA 4OCRH 4XGZB 4JJHA 5GSVB 2D3VA 2ZCLL 1DQTA 2LABA 4MS8D 2G75B 1P7HL 3MRKB 3J7HA 2R0WH 1FCCA 4WENB 1AR2A 5DD6A 2P5EE 4ZQKA 1FE8L 5DD0L 4EEEA 3QNZB 3DX7B 3PGFH 3LOWA 1N64H 3JXAA 3KHOA 3RKDD 4K8RD 3FQRB 1MLCA 4E42A 3MJ9L 2X4RB 1U8LB 1KLGB 2F53E 5C07E 3WFEH 1N7MH 4G5ZL 5I9QB 3OG4B 4L8DA 4Z0BH 1KLFA 1RZ8B 1OT1A 3WLWC 4PRIE 5CCKL 3KLAA 4LQFH 4OZFB 2UWEB 1JGVH 2EKSA 4KZEL 3S96B 3DSNA 3S88L 4M61A 1G7MB 1FP5A 1NEZB 4AM0A 4YQXL 1QA9B 4OUUA 4Q0XH 5C0BB 4FA8A 3ARYA 5BOPA 2CRYA 2VSCA 4PJDB 4E42B 4HIEA 4RDQG 3CFBA 1ACYL 3MOBL 3NCYP 3ROOB 4KHTH 2P5EB 3D85B 4Y19D 3HHRB 3R0MA 3D69A 4Q58C 2B1AH 3O45A 4OZHB 3G5ZB 1F8TH 3EOBA 2GK0A 3MRMB 5AD0A 3X12A 4XZUB 4HUVB 3OXRB 2M2DA 1CYGA 5DD6B 3CDFA 4PD4J 1BQUA 4I3RH 5IVXB 4JM2A 4NZRL 2IAMA 3DRQB 1ZLUK 3FZUC 2PO6A 1X5IA 3WJLC 2APBA 4YBQD 3U6RA 4BSVA 5C09E 4Z77B 2EXWD 2R8SL 1D9KB 2MQ0A 5F88B 1ZHBB 5MHSE 4N0YH 3RVVD 2CLVB 2DD8L 2Q86A 5AYUH 4Y4HD 3SGEI 1PEWA 1QFWL 1MIEL 3MRQB 3V4VH 1NCBL 5C92A 4MB4A 4Y19A 2GSIB 2HA1A 2AJXH 3HZVA 5ACZA 5BV7C 2Y5TB 2NXYD 4JVPA 4JFDB 1YEDB 4HIHB 1JGUL 4Y2DD 1KULA 4PB9H 1UZ8A 5DJCA 5K9KB 4ZUVA 3WEXA 4PRPE 2YMXH 3TCLB 2EYTA 3DHJA 2DQEL 4XMKH 1NANI 1JRHL 3DBXA 2AEPL 3BP7B 1AFVL 2AI0L 1D5BB 1RU9L 5FCUL 3LV3A 1DLHB 1WEJL 3EYQC 1VCAA 3SKUD 2QQKL 3EYUL 2VH5H 2FJFA 1A1OA 4YEEA 4QTIL 3FO1B 3GMMA 3SY0A 2Z0BA 4TRPH 4BQ8A 4FS0A 4PUBH 3CCHA 2IBZX 4YPGB 4XXDB 1LILA 4ETQB 1UT9A 4GW5B 1WGOA 5KSBA 3HPLB 1U8PA 2ZKHL 4L9LC 5E4IA 3K7UA 1HWHB 3LQAH 4NQUA 4H8WL 2ED7A 1YJDC 5D7JB 1YEKL 1ZT7A 1DQQB 2AJZB 5KTEL 1VFBB 1GIGL 2PUQT 3F62A 5JOFB 1NBQA 4UINH 1ZE3C 1ZK9A 3O2WH 3ZSTA 4U6VL 4OGAC 4MNQE 3VG0H 4OF6A 1JJUA 1HEZB 1DQLL 4E0RA 5T1LD 2QBWA 5F96H 2HVKB 2MQCA 5FA3A 4U1JB 1EVUA 1INEL 1M1SA 3CVIL 4WHYH 1QFWM 4HKBA 5T5FL 3OPZL 1VPOH 2DRUA 2NLJB 4MZ3A 5D7KE 1ROWA 3ARGD 1FHGA 3TT1L 4NOBA 3VJ6A 2GT9A 3IF1A 5BRZB 3OAZH 3D0LA 4Z6AT 1O7SA 3HC0B 4P2YA 4PJFA 5HHME 1QLRA 2ZUTA 2DI8A 3CFBB 1MJ7H 4UV7H 5D6CA 2AEPH 1DP0A 4P5MB 4Y4HC 5SX5K 3SJVA 5HPMB 4OLWL 4HS6A 1VSCA 4MJIE 5I75C 2AEQL 4WO4D 4U1MA 4A6YH 1DANT 4EIGB 1YNKL 1ZHKB 4BZYA 3OAYH 2FECI 1N8ZB 5IUSA 1A6VH 5D93C 1FYTB 4LCCB 3FQWB 1A6UL 2IG2L 3V4VL 5CJBA 3BW9A 1P7KB 2K9UA 1X5AA 2YHGA 3DROA 3MRHB 3TFKC 4ZFFA 2FYYA 3X3FL 4OCYL 3S8WA 1K4DB 5GGUA 4Y5VA 4G8GD 4R3SA 5CJXC 5HY9A 4YPJA 4Q9QL 3AMKA 2H3NB 1ZA6A 1QO3B 2F8XC 5E99L 1EJOH 3RX7A 3UTZA 1Y6NR 2HFEA 2W38A 4UUJA 4RX4A 1BQLL 3MV8D 3V7MA 4JDTL 1QRKA 3MXVH 4KK5C 4PJBA 1PBYA 3O3BB 3BHBA 1EEYB 4IIQA 1IGFH 2FHBA 1XF5A 4QNPF 2AV1A 3BKMH 4TSCH 4TQEH 4ONFL 4NN6B 2BNQB 4UV4L 2A6JB 3MJ6A 3L5JA 2HLFC 4I0PB 3QUYB 4JFZL 4Z7WE 2W0FB 1RUQL 3BUTA 3IETB 1RUPH 1M05B 3VW3H 1S9VA 1C5BH 4WUUB 2ENSA 4I1NB 4XCCH 2GYSA 4GW1B 1RUQH 2H2SD 4HJJH 4PGBA 3BP5A 4PY8J 4U6HA 3GSVA 2AVGA 1CL7H 4KPHL 4ONFH 3OAYK 1GZPB 3SCMC 4TQEL 2G9HB 5HYSB 3IYLW 4RA3A 4MCYA 2I9TB 5I1AA 1RMFL 4ZUSB 4U1IB 2JJVA 3FHQA 1NMCB 1IM3B 4KVCL 4S0SD 5IW1A 1I8KA 3N1QC 1RZFL 4K9EH 3VI4F 4FQLH 4IBLT 1ES0A 3KDMB 3SBWC 3M17A 3QULA 5J11C 3THMH 1RIVH 1VACB 4K7FA 4GRWF 4EN3D 3EDKA 5GRWA 4JPKH 2JJSA 3RNQA 3E0GA 2FWOA 3NFSL 3BPCA 3ULUL 3UBXG 1GYAA 1T7WA 3ZO0A 4BH7A 1V7MH 4N8VB 3OTTA 2APFA 1JVKA 1MJ8L 3L3HA 3QAZB 3V7AE 4H0HB 2VLJE 3H3BC 3QIBC 4P2RB 1MUJB 1NAMH 4UNTA 5E8EA 2ESVE 4L3EE 4XNUL 2VE6B 3GRWA 5LVEA 3NH7H 4G42B 3RVXC 1NSNL 4NHUA 1KTRL 2HN7B 5IW3A 4J1UA 4P5TD 4JY5L 2YRLA 2YWYA 5FYKE 1ZMYA 4GUPB 1NPUA 1MI5A 3BD5A 4OCRL 1PKQA 2JELL 4U1LA 3S3PA 3QRGL 5DFVC 2OJEA 5TQ0H 2D31A 1JWMB 4XHQA 5EUKA 5JOEA 2OP4H 5DK0B 5C0BD 4RZCB 1EHNA 4U6XA 5EU4B 5KN5A 1I1AB 1EMTL 1JBJA 3QDME 5T5FH 2HKHL 4R97C 4J3UA 4QXTA 4H0IA 5EOTA 1U3HB 5FO9A 1GGYA 4LIQE 4HZLA 2AV7A 1HNGA 3VG0L 2FLBT 2VLRE 1R3LB 1A7PL 3SQOH 4YFLF 5JQ6L 3ARGC 3JWDL 3WS3B 2Z31D 2ZCHH 2VR5A 4NZDA 2XKSA 5IB5B 2YKLL 3RL2A 5BZWB 5HHMD 3RI5F 3VGDA 1NGQH 4XBEL 1FVCA 5GZNC 4OJFL 1MCJA 3EJJX 2EO9A 2A9ML 2HT4C 4LPVA 4ZOBA 3FB5B 2VITB 2VZ3A 2B4CH 3T8XB 4EUPH 2J8HA 4GRLB 3O2DA 4TTDD 5TE6H 1UM6L 3MJ9A 4NNPH 1A1NA 1UJ3A 5KS9E 2CLRB 4EOWL 4PRHE 1TJIL 5D70L 1OQOA 4A2LA 2B0SL 3CU1A 3SE9L 2DLEA 2XYCA 4R97B 5EUOB 1KCRL 4WHTA 4NGHH 3RPIA 5EC2A 4DFIA 3RVXD 2LVCA 3RY6A 5C71A 3U0PB 1I9IL 1WFUA 2GT9B 3VJ6B 3C5ZA 4W4NA 1Z3GH 1C5CH 4LPUA 1CE6B 5C0JB 1FL3A 2V5SA 1IAIL 1T5XA 1ONQA 4XMKL 2FX7H 1QFPA 4MA3B 1XH3B 5D7KD 4ZMAT 1FNSL 3IVKA 5I18H 1MCPH 1INDL 2E9WA 3WFBL 2YS4A 1ZTXH 1WWCA 2RCSH 1HZHH 1YN6A 1KPVB 1KV3A 3W0WB 4KKLD 2JJTA 3G6JF 4XRCB 5DYOB 2Q8BH 5JDJA 3RWIA 3EYFB 3HE7C 4YIQA 4RGNC 2VLRB 1KFAH 2H45A 1MCFA 2VLKA 4PGDB 5KZCD 4LVOB 1NCAH 4G8GA 3RDTD 2Z4QA 3E6FB 3TBSB 5F7KC 4MJID 1QPXA 3CVHB 3W11D 3VFGL 4N0YL 3SDXB 5DSCA 1Q9KA 1HINH 1YUHA 1CTOA 1K9TA 4PBXA 3P4MB 2QKIA 4WHDA 1HN1A 3DHMA 4J3OC 3MUGB 4NZRH 2YWZA 1MRCH 3T65B 3HE6C 1C1EL 3NPSC 3QUXC 1NC2D 3PDGA 5GS0C 4Y0GA 4GAJL 4JREC 4L8SC 4L3EB 3TN0D 2ESVB 1KJ3L 2QQNL 5INDA 5HHOA 1QSFA 1T4KB 1J8KA 1OSZA 2YPLE 3H42H 5DQ9A 4TVSa 1D5XB 1H3TA 1HHIA 3ARQA 1IGCL 5T3ZD 5T3XE 2YOCA 5D7LA 5CKGA 3TIEB 5DHVA 4J8RB 4KWUA 1AHWB 3CSPA 4J4PA 4PJ5B 5B3NA 4ZDHB 5K9KA 5KAQF 3D25B 2NY6C 3ARWA 4PS4L 4BFEA 4LDLB 1FLRH 4H88H 4JCLA 5CCKH 1RZGB 1FH5H 4KZDL 2NNAA 4JY5H 3VCLB 2A6DA 5CEZL 3ARGA 2AK1H 3BOVA 4QYOA 1ZVYA 4HMEA 5CWSB 2YUZA 4M7ZB 1JZ8A 3MUY1 5D2NA 3JTSA 3V6FB 3QFJD 2CKBH 1TZHA 4HV8A 1YYLH 3VA6A 7FABL 3BH8B 3NPZB 2X1XR 4JZOA 4C56E 4EVNA 5DEFA 3FCTB 2WWMD 4JFOB 4XZUA 1N4XL 2YD9A 4X4MA 1KN4H 1HHJB 2NY0D 5KSUB 4TNVF 1V3MA 4X6CE 5GS0L 4TUOB 1TVHB 3UTSE 2K7PA 4YUEL 2E7CA 2VZSA 1G6RA 3MNZA 4UDUA 1N5YL 3MBED 1ZVHA 3HNVH 4X6BB 5FUOL 1IAKB 1CZ8L 1KPUA 2R2BB 4OGYL 2A1WH 4UT7L 5L2KB 3C09B 1DQDL 3QNYB 4HJJL 3PWJA 4BSWA 3UXFA 1KPVA 2VXUH 3MRDA 5E1AB 4I8DA 4HS6B 2KZ1B 4UAOB 3JWNC 4Z7UB 4APQA 1FYTE 5I15H 3NN8B 5FYKU 4X6DA 4YX2H 2DI7A 4GKSA 4HXAL 4LRNH 1MCWM 1P84K 2FJHA 4M8QB 2ADGA 5DUML 2XXCB 3U46B 2CIIA 4H5SA 5D71H 3LKRA 4K7FB 5BRZE 3QEGL 1A7QL 3PWNA 5D96C 1GCFA 2ZUQB 2GUOA 3EJZD 3B83A 3MRBA 3WDHA 5ITBH 2R4RL 3V52L 1BGXH 5IW1B 1S9XA 3GSXB 1N8ZA 2G75A 3X3FH 2R29H 4L3CA 4P2QA 4NP4L 3BQUA 3B9VA 3CH8A 3FO9A 5DTFB 2XKNB 5IQ9A 3VDBA 1U8NA 4G8FA 2EDKA 1KTDA 2FHFA 4RNRB 1EXUB 3RWCB 1YEEH 5F9JB 4F7EA 2FEDC 2BY3A 4K3GA 2DMBA 4DN4H 1EAPA 4P4KD 3MJ8B 2Y23A 2VR4A 4A6YL 4UNVA 3FQUA 2AW2A 4OLWH 5EFIB 2J6EA 5FYJD 3H9SA 5ESAA 4S1SL 1ACZA 3B8SA 3K1DA 5FM8A 4GAYA 4L4TD 3CCHB 4UOW0 1HEZA 5EU6D 5EWIL 1QHPA 3BAEH 3LB6D 4NQEA 4NP4H 3E8UL 2E8YA 3NFNA 43C9A 3AS3A 4C57C 1FFPB 5F96L 5DGRA 2QSCL 3D2UA 3HI6H 5GISL 5ITBL 1N5AA 1G7QA 1KPRA 3F12B 2PW1B 4A6YA 1BWWA 4P4KA 3V4UL 4XPHH 4HJGB 2ADJB 1UM5L 4MNQA 2EDFA 4WFFE 4P57A 2RAMA 1HNFA 4NPYB 4XC3L 5I1IL 3BQUD 2OJZH 3C60B 4XP6H 1DVFD 2OSLB 1U3ZA 4NQCA 1S7TA 5AZ2H 1M4KA 2OR9H 1RJYA 4A6YB 1QFUL 1T3FA 2DWDA 3LQAC 3D18A 1OTUD 3KS0J 4HC1H 4OIAA 4WTZG 2C1PB 3CFCH 1IAOB 3MGAA 3MRJB 3N85H 4PJCB 5D1QC 1L7IH 3D39D 2DM4A 1DQDH 4CU8A 4DW2H 2MSPA 3PQYA 4QLRA 1T0PB 5C09B 1RK0B 1N5YH 1B0WA 5F1NA 3IFLL 1CFBA 4YBHA 3IFPB 2AEWA 4UB0L 1JK8A 1YY9C 5DJZA 1J18A 1NLDL 4OZHE 4EI5C 1RZJC 4U1LB 3V2AR 4PRID 5C2UB 2XZCH 2V2WA 1MCDA 4PR5B 4ESKA 1WZ1L 4WTWA 4O58H 2JCCE 5GGSA 5D7JA 4X6FB 4R7NB 1MIEH 4WFGD 2WBJD 5FA4A 1RZJL 3LEYL 1AD9B 1YJDL 3NFPB 1SBBA 4I4WA 3SDCD 1P9MC 4L3CB 4QOKE 4WO4B 1HHJA 3GHEL 3ARUA 2UWEE 3BDBA 1IMHC 4NQSB 4MHHI 4G6JL 1N6UA 5FB8A 4LEOB 4RA0C 4E5XB 2J88L 3WXWH 1IKFL 1OP9A 4I3RL 5HYJE 4HW6A 3BFOA 4Y5VB 3TZVD 4MXWL 2F19H 5DR5H 3O9WD 2JK5A 5BJTB 1W0WA 5INDB 4HUNB 5CJOH 1K5NA 4RWYH 4Y4KD 4RAVA 4YAQB 4BM7A 3DO7B 2NY2C 1QA9A 3OHXB 2X89A 3ULSA 1QZ1A 1T1XA 4Y5XB 5D2LE 3S35X 3TO4C 2VKXA 3SBWA 5ID1A 1U2CA 1A02N 4MCYB 2FZ3B 3HPJA 5GS2H 1EFQA 4OM0L 1NBVH 5DVKA 5EZLB 3TYGL 4Z7UA 1G1YA 4KXZH 4PJ5D 2A73A 3OKMA 1Y6MR 1T66C 2HTKD 1MCNA 4HC1A 4UIMB 5I66B 4RWYL 1E4KC 3IKCB 5DQDL 5KG9B 4BK4A 1T83A 2IPTH 5EZJB 3PWPB 2CKNA 4I0PA 3QEQE 3QAZC 1U8IB 3K4ZA 3W9EA 4JRYD 5E7FA 1OGTA 1P4IH 5DWUH 3RY6C 1GC1C 3HCVB 4TOYH 4FQXA 4JFFE 1OARL 4QRPE 3B9EA 1NL0L 4PJ8B 4X5XA 3HB3C 2DF3A 3ZHLA 4QHKI 4ZNCD 1YUHB 5EO1A 4EN3A 1I85A 3EOAA 1UB6A 4F7CA 1I4FA 1TJGL 3MRHA 3ULUC 5CBEB 2F58L 4W4OC 3GMRB 4HIEB 1GGCH 2FX7L 1ETZB 2L7UA 4TPRH 3ARZA 2NTFB 1CGSH 1FFNB 1KIRA 4GRLC 5ICYA 4KI5F 2YEZA 5IFJB 4OD3H 2PCPB 3MOQA 2OZ4L 4U31A 4PP1C 4G7VH 5T1KA 1DBMH 1GXEA 4EDWL 3GMMB 3CSYB 4JJ5B 1Q9WB 2J2ZA 4H5SB 1J5OL 4Z0XA 4GS7B 3OGCA 4OCWL 5CGYD 5BZWA 4F8QA 5E00B 5KVDL 3K46A 4PJ9A 2AABL 4KRLB 3QFDB 5CLTA 3QWOA 5I1GL 5E5MB 1ZA3B 3CLFH 2HFFA 1D6VL 2A9MH 1FZKA 4UTBH 5F1SA 2AQ2A 4APQB 1Y18A 3A6OA 4YHIA 2X4SA 4JZJB 4PD4K 4XMPH 3J8F7 5DC4B 3RBGA 4XRCA 5FHBL 2XACC 1U8MB 5JLZA 4WW1A 1NGZB 3LS4H 1LEGB 4NQCD 5JOFA 2ZCHL 2B1HL 1R24B 9CGTA 4NHCL 2W92A 4XMLL 3ZTJG 3P11L 5L88H 3PHOA 4CJ1A 3EYOB 4J1UB 1Q9KB 3ZT5A 5KVFH 1S78D 5MP6L 2GTWA 3FN0H 3Q6GH 3O11A 1V3LA 4FNLL 1I9RH 2X4SB 1BOYA 1J8HE 3SDDD 3BWAA 4B7LA 1KCSH 3SKOB 1VHPA 1B3JA 2W9LA 3HG1A 2X41A 5DJ2A 2GK0B 3MRMA 4LU5L 5AD0B 5TGBB 1YN6B 3QHFL 4PJHF 1FZOB 3H7BA 6FABH 2CLRA 2XRAL 4G8GE 2VLMD 4XPTL 1OW0A 3BT2L 3MNWA 3DXAB 4L4TB 5FECB 2R23B 5GGTL 4PJIA 4WW2A 3M07A 3ORJA 4M4PA 5INCA 1FL6B 2EC9T 3CD4A 1MRFL 4JEGB 3QSKB 1ES0B 3BKJL 1BPVA 4JM2D 1QLFA 1K8DA 3VWKC 2NXYC 1DCLA 3Q5TA 3VXRD 1JHTA 5JZ7D 1Q9LB 3DIFA 4G42A 3ILPB 1R3IH 3W5MA 3MZTA 3QI9D 4K8RH 5GS2D 2YUXA 3LSOA 1NGPH 2CIKB 3ARPA 3SE4C 3NBNA 1OPGH 1A7QH 2XTJE 3O11B 4NO0D 1U3HA 4G9FE 1K2DB 5FKAA 1OCWH 3W11C 5IEKA 3TV3H 2V6HA 2NR6C 5IB2A 3PHOB 5A3ID 5CP3A 2BNRA 1FJ1B 2AEIT 3OX8A 4XBPA 4TUKL 3QUKA 2XV6B 3DX7A 5EO9A 3VFUA 5EDXA 1L7TL 4HZAA 5HPOA 15C8L 1X5GA 3ARBC 2R0LL 2X89D 2VQ1B 3D2UD 5DMKA 1VESA 1EIBA 4H26B 4ZXBC 2ZJSH 1WZLA 1TPXB 3V0VA 4G9FA 4LSDA 3BIBX 2CRIA 1D5MB 2BNUA 4W70A 5ISZA 3T65A 1Q38A 1CGTA 4UV4H 2BNRB 3CX5K 5C0CB 3TIDA 3QEUA 2NCMA 5E00A 1NMAH 3BN3B 1K4DA 5MEPB 1B90A 1L9NA 4UDTA 3BZFA 2ZUQC 3KYOA 3BW9B 4ZFFB 1QHOA 1GGTA 3BPCB 3C6LB 3ZYIA 1H0DB 5L8KB 3GSOA 4PJGB 3U2SB 5J6HB 2VKWA 2FO4B 3B2VH 3QQ3A 1JPGA 4PLKC 1UXWA 3X14A 4KVNL 5C0AB 1F4WL 4JY6A 4OLEA 4NQSA 4JFQB 2LQRA 2ICWI 1FCGA 4PTUA 1CGWA 4LGRB 4JFXA 3NCYS 3NFPA 3ARDA 3QZWB 4P59H 4LSUL 4C83B 1BZ7A 4BZ1H 5DEZA 4ONHB 2B2XH 4CVXB 4EBQH 3LKSB 4Z95H 3OX8B 4GXVL 5F9WC 4HFUH 3KLSA 4R0LC 1CGXA 4DCQA 1DQML 1RUAL 3L3JA 3WLBB 1AGFA 4DGVH 1AD0B 3LQZA 4JFEB 1YQ2A 3DVGA 1Y0LA 5GIRB 5EORL 2VIRA 4KJWC 1FLRL 1IM9B 5FYJE 5FGSA 1T6WA 5JUEH 3GJEB 1G7HB 2DQGH 2HAZA 1Z9SA 5C1MB 4KAQH 2EKJA 3D39E 4EI6B 3U4AA 1EEYA 4LIQH 4GAGL 1IBGL 3OPZH 2PXYD 5C09A 1BFTA 3UTTA 1F4YH 3GGWB 3BPNB 5TPWL 3SJVB 5FOJA 3O6FA 3I3DA 1MJUL 4JKPH 1DQLH 3CJJA 4TSAH 5DD5H 4JVWA 2R23A 4HH9A 5J1AB 1UYWL 1M05A 4UINL 1ZLUH 5D1XA 3U30B 1GIGH 5HVHC 2AGJL 4Q9RH 2HFFB 3UO1H 3PQYB 5E0QA 2XFXA 3PL6A 5JHDD 5KS9A 4DVRL 2FDBP 4QHMB 2EE6A 5JIKA 3QHTC 1J1PH 1WBYA 4YFEA 3FKUS 1TPXC 4CAGA 5C0CD 4ALAL 3QP3A 1NCNA 5KOVC 4JFHD 1NGYA 2BFVL 3BP7A 2GQHA 3UTZB 4ZOCA 4Z8FL 1NUGA 4MD4B 4P9HC 1BVLB 3CNKA 4XP9L 1NCAL 1ADQH 1PKQB 1QQDB 5E9DB 2D4FA 4OZIB 1K85A 4UOW1 1OGAD 3S4SA 5ICYB 1P4BL 3BPLC 3GMNA 4X6EA 3P0YL 3HAEA 5JW5B 4XNYL 3NCMA 1UZ8B 5HYIA 1HZHL 2PYEB 4KFZC 4I4WB 5J6GB 3OZ9L 1TCRA 4ZS6C 4Q9BA 2R15A 3L3HB 3GSNH 4F2MA 4O5LH 5L9DL 3LMJL 4IDJL 4ELMF 3WNOA 1FNFA 1JZ2A 2IALA 1MRDH 3DX6A 1C7SA 4Y4FD 2W9EL 2H32H 1FBIH 2D0FA 3RQ3A 5IOPB 1U41A 1V3KA 3BVNA 3C8KB 4LHQB 4QCIB 4P49A 2Q3AA 3QHZH 4RMSA 4WY7H 5FDWA 2WINA 4LSVH 1NBYA 1YMMB 4K94L 5IFJA 4YHPA 3QJHB 4J7RA 3TBTA 5CIPH 5C0GB 3CXHK 3I2CL 4KJPC 4U1JA 4KH2A 2FGZA 1IQWH 3EDEA 4NKOB 3GI9L 5E8OB 5IROC 1NCTA 3DYPA 1HKLH 4WWKC 2DQUL 4Y16D 4OI8A 5B22A 3WO4C 4NT6B 4JO3H 3INUL 1HE7A 3OB8A 5A3IC 3FO9B 5DT1L 4Y4HB 4GMTL 4YH6A 1UXSA 5DURB 3M8OL 3IRZA 1IQDA 4QHLB 4G6MH 4Y5XA 2X7LA 1E4KA 5JTWA 1FV1B 4LSRL 4KHTL 1MI5D 4Y2DB 1RFDH 4P5KB 1C8PA 4G9FD 3GMQB 4X6DB 3KPNA 2C7UB 1N0XH 4R9HA 4PJEA 3WYRA 2Q3ZA 2R4SL 1BFOA 3BO8A 3W39A 3X12B 3T77B 3QB7C 2E6JA 4ZUTB 2B8OT 3VG9C 3QFJE 3PWLB 2PKDA 1S7SA 3CMGA 4MA1B 4CVXA 3GJFA 3X11B 5GZND 5DZOA 3QRGH 3O6FB 1L0XA 3O6FC 3C60D 5E9DD 1R6VA 1I3UA 3LEVL 3WFEL 4MS8C 4R96A 2D7QA 1WFTA 4HCRH 1AGEB 2C9AA 1KIQB 4H20H 1PY9A 3WCYA 2R1XA 3TA3D 4PGEA 2EH7L 2UYLB 2N1KA 5B38G 4N9GB 3VFWB 3P9WB 2MCPL 5BVJB 1IM9A 3AM8A 3X14B 4L29B 4LRIA 3BDYH 3PP4L 3KLAB 5FYJH 1V7ML 5F97E 4HS3A 1X44A 1WWBX 4R4BA 2ZCKH 3X3GL 4PLJD 4FABL 1UJTA 3O8XB 1EERB 5IR1A 1KCVL 4ODXA 3NFSH 3VGAC 4TVPE 1J86A 5TQ2H 2ILLA 5BS0D 3RVUC 2YD2A 1QBML 1P4LB 4YR6A 3THML 5DTFA 4HV8B 4TUOA 4GXUN 3F6LA 5CHNA 2BMKB 4POZD 3ZT6A 1WFNA 3V0VB 5EBGA 1FFOB 1F11B 5EBWB 5GRVL 1JNNL 4WCYL 3L6FB 2IANE 3LKOB 4X7EC 4M61B 1XGTB 3Q3GB 3UYRH 5LXGL 2JJSC 3HCVA 5I1HL 3L3OA 5FA4B 4Z7WF 1Z2KA 4U1KB 1FO0A 5E6ZA 3VXMA 4XC1H 1C5DA 4GRWB 1BFVL 1H0DA 1G9EA 2R4SH 4UU9B 4R2GD 2CJUH 4IS6B 1N0XL 3C60A 1RUPL 2FGWH 1S78C 2AXGB 3WE6A 4Q2ZA 5HHQB 1CQKA 4ZAKD 4OF3A 1LO0L 2DWEA 4ZS7L 1D5XA 3FO0L 4NPYA 1VGKB 4HHAB 4AY0A 1AGBB 4PTUB 1ZGLM 5F7YC 4OCLC 2BERA 5A16A 3AY4A 2W60B 3D25A 1JWSA 3GSWA 3WNMA 5KBNC 2EDJA 4Z5RA 3VFNB 1AGDB 3EBAA 4JN1L 4KDVA 5K9QG 2PW1A 1A7NH 3ZMRA 4ONGL 1PG7L 2WP3O 3BP4B 1UKSA 2X4NB 1FZMB 3HZMA 1JPFA 4XNZC 5GGRB 2MKWA 1KB9K 4X7TB 2XTJD 2HT3D 3C6LA 5GJSH 1BVKB 3T1FA 4KI5C 2ERJB 3UZEA 5HHOB 3ZDYF 3RGVC 5BXFB 1NDMB 5J13C 1I7ZB 1BAFL 3QUXA 2GTZA 2Q7NA 3T0ED 1UH4A 3NIFF 1Q8MA 3BEVB 1AE6H 1TQCB 1PFCA 3DX9B 1TTGA 1PZ5A 3D39A 4DN3L 1QBLL 4PJHB 1S9KC 3K80A 3IDGB 4DKDC 3HUJA 3W39B 3FO2A 2PYEA 1CDIA 3LKNA 4LCWD 2FEEI 1AD9A 1SHMA 3ARDC 3H6JA 1YQVL 4C56A 5DUPH 5FM4A 2F15A 1KTDB 4JFPA 4LVOC 1F2QA 5AAMA 5IVOA 4S1RL 2V2WB 3TEUA 3EHBC 5AG9A 1CXEA 3D87B 4NQXB 3TT1H 2PXYB 3MR9B 2Q1EA 2E7HA 5AZEH 2IAND 2NY5C 4PLKD 3GDBA 1E27A 1IAII 1WBYB 5ENWA 1LO4H 3BWAB 4Z8FH 4MA3A 3AM8C 4RDQF 1ED3B 4ALAH 3MJ7B 1CLZH 4J3SA 1PG7W 1WAAA 1MHCA 3HR5B 1OGAA 4D8PA 4FQQA 3EYVB 1KXVC 4NN7B 1U8KB 2P4AB 3HI1B 1EXUA 3KJ4C 3NZHL 3MLVH 4ODSL 4BFGA 4JFQA 2OSLA 1FORL 4WI8A 5FF6A 4P2OD 1LO5B 1U8QB 4GAFB 2F5BL 3QG6A 3I6KA 1IGYB 1T0MB 1TIUA 4LCIH 3MUGA 4ELME 2DTMH 4Y5YA 3MREB 5EOCL 5BS0E 5MEPA 4Y1AB 1OF2B 2E7BA 1EA9C 1OTSC 4RMQA 5E9DA 1B0RA 3JVGA 3D3VD 3UCRA 5FFLA 4P2QE 1UENA 2C3VB 2GHWB 4QXUL 3TZVC 1HSAB 3WJLA 1ZT1A 4UILH 1KJVB 3TA3A 3NN8A 4HK3J 1T0NA 1A5FL 5HD8D 1MSPA 3D1MC 4QXTB 2YC1B 1LDSA 3DVFA 4PB9L 5E8NB 1FSKB 2I27N 1G7HA 1B0GB 4PJAF 1CFVL 4YXKL 2XWJB 5SWSE 3TNNB 4N0RA 4DKEL 3CVHL 1OP5H 4GQ9L 4HULB 2C3WA 4I18A 3O4LA 1OTTC 1ZT4B 4I13B 4O2EB 5AYUL 2EDRA 3CX2A 1ZEAL 3O2VL 1I85C 1XT5A 3KYOB 4LPTA 4HXBL 3E6HA 3VCLA 3WFHA 2X05A 2HT4D 3IDJA 3TPUA 3H3PH 4L5FL 3S3JA 4P46B 1W8NA 5I8CA 4LAJH 4LARL 5C86A 4QT5A 2P5WE 2DOCA 2J7LA 4PRAB 3DIFB 5C08E 1PQZB 4HWEL 3RWGA 3WIFB 1GZQB 4KQ3H 1NMAL 4JREB 2VWEC 3VXRB 1ETZA 2H26B 2ORBL 4MX7B 1KEGH 3B9KA 4P4RA 3BH8A 43CAB 5IFHH 5KVMC 2I9TA 3D9AH 3QIWA 4I3SL 2C4XA 3QDMD 1S7WA 2WP3T 2NX5B 4P46A 3OKLB 3M17B 1W72B 2EDTA 3QULB 4IRSD 1FJ1A 3RL2B 4O2FB 4K3JL 1BX2B 3H7LA 4Q0XL 3KHQA 4NQED 4QEGA 1JI2A 1AC0A 4JDZA 5C08A 1QFHA 4O2EA 3FTGB 5E24E 3TLRA 1MQKL 3CX5J 2P8MA 1RZKL 3NA9H 3QUZA 3KGRA 2VDML 4DKFH 1MOEA 1XFPA 2E5EA 3TV3L 1Q9LA 2DYPB 3HRPA 2VLJD 3RFZC 2FD6H 4NKIL 4X98A 4R90H 3DUUA 5DRNA 3G6JE 4XWOD 2X4TA 1A4KB 3D3VB 2YBRA 3DSFH 4I0CC 5AWNL 3QCUL 1UC6A 1QO3A 3UTPD 1EO7A 2YD3A 1IL1B 2ATPA 2QR0B 4HD9A 5SWSD 2DLTA 2QHRH 3HAEG 1II4E 3MMEA 3FB6B 1S7QA 4PJBB 5HDBF 3BKJH 5I74B 4F7PA 5IG7A 3FQNB 3AREC 4P2RA 5HD8C 1EEZA 5GGTH 2HRLA 3WDIA 1BHGA 3GIVB 1FNEA 1DL7H 3QG6B 5IQ7L 5FOBA 4JR9H 5C0NC 4YK4B 5IKCB 3RU8L 3BSZL 3EGSB 4Z0XB 4PTTA 4U2YA 2NX5A 1XR9B 1F3DJ 1Q1JL 3MUZ1 2BK8A 3MV7B 3ARSA 2EXWC 1UEMA 1JV5B 1PGRB 3C5SA 1TZHB 4GG8B 4QOKD 5AUMB 2A9NL 2KBGA 4AYFA 4HIJB 4PJFB 3GIZL 4LCCC 3HAEH 4FNLH 3QO1B 1JF5A 2NYYC 4LGPB 3WIFA 3TA3C 3SDCC 3QDJA 5F93C 2D2OA 3NMEA 2VITA 4OD2A 1S7VB 5D1ZD 5F9OH 1A3RH 1I1CA 3FB5A 5M95B 3MV9B 1K3IA 2I60L 3IDXH 2CRMA 3BP5B 4N1EA 1WV7T 4NC2B 3KYMB 5I1CL 5ANME 4ACPA 3MV8E 4UT6L 3JWOL 2DJSA 1I1RA 5F9DC 3ARFB 3L1OL 3C60C 5F89A 5TDNA 1ZT4A 3INUH 5SX5H 4JO3L 4N8CL 1C7TA 5ESVA 3LRSA 3BGAA 2BHYA 3HI5H 4X8XA 3NZ8B 4NQEB 4L8BB 2I60H 4P2RD 3P30L 4AQOA 3AU1B 2W0PA 5IB3A 2FLRT 4KKAD 4X9HA 3VXOB 1T03H 4IOSD 2IFFL 1G7PA 4OZGB 4PJHA 4XCEB 1DBML 1N0LA 3L9RA 2VC2L 1CXIA 3BEWA 3GJFK 3P77B 1T3FB 35C8H 3G6DL 3V5KB 4Y1AA 3D2UB 4HG4J 3AMLA 4PJ9B 3O0RL 3HPLA 2F54D 4JN2B 1CBVL 2HYMA 2Z4QB 3E6FA 3HPJB 3IDMB 4Y89A 5KSBE 5IMOA 4WHYG 4LNVA 2AJUH 5ANMB 1G0YR 4CADA 5CSBA 5JA9A 2VLKE 4KROD 1RUML 2Z31B 4YHNB 1GGIL 4HKXB 2X1WL 4N8PA 1KIRB 3MODL 3CFIC 5KN5B 2XY1A 2NY2B 5I71B 2IWGA 3VXNA 4NZUL 1YEDA 4YLQT 2Z91B 1SQ2N 4UT9L 1RULL 5ESVB 2G2RB 4KHXL 3HR6A 1B4JL 2AXGA 3WE6B 2VDKH 1G7JB 3O8XC 5EO1B 5KG9A 1G6RH 4HT1H 3QUMB 3EO0B 4RMRA 4L8CA 3MCG1 1S9WB 1LO3L 1G9NC 4LMQI 3L7EB 4NBYB 5DF0A 4WO4C 3RWDA 5GS0D 1BJMA 2IPTL 3TNMA 3QNYA 3LH2H 4BSJA 2OTUB 4D2NA 4Q9RL 3MLWL 1RK1B 5KVGH 2VJXA 4BQCA 1AD0A 1SBSL 3SE8L 1RUKL 1CF8H 2FSEA 3KPPA 1U58A 2MMXA 3HRZB 3L95B 3R0NA 1S3KH 4RAUA 1AJ7H 3D69B 1YEFL 5E4EB 4DVBA 3RDTC 4MAUH 4NN7C 3FQTA 2HVJB 3RX5A 3D3VE 5F72S 5LCVL 1KENL 4X4ZA 1UCTA 2V5TA 2W91A 3T0WA 5JUEL 3SDDC 4RBPK 4J6RH 2BVTA 2IH3A 3GI8H 1BJ1H 2GUOB 5I1AB 2DKMA 3KPRD 4UIKL 4S2SA 4V1DE 4FRWA 4D0CA 4DOHE 1H5BB 2LTQC 2Z35B 3TVMA 2BOBB 1VDGA 3E2HB 4Q97A 5CEZE 5J6HA 5GS3A 3CFEA 3QT2A 5ID0A 4I2XE 1IGTA 3T1FB 3L3IB 1CG9B 3EFDL 3IU3A 4M5ZH 3RUGB 1W8OA 4PJ9D 2ZOLA 1A4KA 3D3VA 3MRNB 3BKCL 4GKSB 1SEBB 2NY6B 4Q6IA 2CLZA 1NFDA 2OBGA 3X11A 3UJJH 2NX5E 4FOMA 2VDRH 2O5ZH 2OK0H 2IANA 3DUSB 3IJSB 1H9VA 4L4VB 4JANB 2WUCL 3MO1B 4PY7B 1UFUA 4JAMA 4LL9A 1HILA 1MFAL 1TCMA 5IESH 3O3AA 4KUCD 4NQDE 5E56A 5B39G 3MRNA 1FL5B 2P5WB 4OKVA 2EDBA 1SM3H 4XPFH 4EQ2A 4PR5A 1U42A 3MUJA 2A74A 4O2CB 1C16A 2DLGA 3QIWB 3B8YA 1F3RB 1N2RA 4JG1H 1JNHA 4OFPA 1UZ6F 1IQDB 5CD5C 1OQXA 3EOBB 2OR9L 2X5PA 3IGAB 4HWBL 1AJ7L 1RK0A 1RJCA 4RGOH 4WI5A 5DHVB 5F7NC 3VXUD 1NEUA 1NBZA 5DRWA 2G2RA 5IMLB 1PDKA 2WBJA 1R5VA 4GW1A 4XC3H 1JHKL 2XICA 1KLUB 4P2QB 4M9PA 4L4TA 1XR8A 1EUUA 4EIZC 3C87A 4PBVC 4XVSH 4Y1AE 1MFBL 3ES6A 1OAZL 4OIIH 4BFBD 3V4PH 3TH2T 4CUCA 1NGPL 4LLQB 3MLSH 1F45A 5GJTH 5KVEH 5F7MC 1R3IL 3C2AH 4YBLC 1A2YB 3RP1A 4FMKA 1XF3A 2CDFA 5I2IB 1OTTD 1CLYL 3PP3K 2ICWA 3DTXB 4GBXB 5DVOA 5JW5A 4EQ3A 2FJGA 3GJFB 2NW2B 1WCBB 2H6PA 3DNKA 2E7LC 1JPSL 2Y7QA 3CMOL 2IBGA 2CO6B 1SYVB 1UWGH 1TCRB 5L7XH 3VRLE 2YPLA 3NFNB 1YMHB 4JQIL 5FGCB 1QSEA 4F7MA 2BSSB 3VWKB 2WMPA 3FRUB 3F5WA 3MGTB 1XAUA 3SGDI 3RL1B 5I8EB 4YHIB 4NO2A 3ZT7A 4ZO9A 1KPUB 4OLXH 3PL6B 3WS6C 1CLYH 4XH2A 1I3RA 3TO2B 4LLMA 1FGVL 3GSRA 2IFFH 1VFOA 1NGYB 5EZIL 1AO7B 4HPOH 4N9OB 4M8QA 3BMVA 3QEHB 3MLZH 3QEGH 3SPVB 2B1HH 2JLLA 4RNRA 4N1CA 5JA8B 3FFCA 3CXDH 4OQ1A 3VXOA 3WO3B 5FYLD 5JPMB 5J13B 1S7UA 2ARJQ 5SV4A 3JSSA 1KOAA 4EVNB 1QFWI 2CDGB 1EBPA 2AXFA 3MTRA 4AH2B 2HWZL 4MAYD 2LVEA 3JVGC 2AP2A 4FN0A 3VXUB 5HGHA 2X4TB 3WIIH 4OI7A 3C8DA 4JRYA 2O5YL 3PWVB 5KVDH 2L4OA 3CDGA 3GMOA 2HRPL 1SYVA 2H2SC 4PRHD 3H9HB 1UGNA 3MQIA 4MHHG 1BP3B 3S96A 4E41A 1CTNA 3LKSA 1AXTL 5IEHA 2Q76B 4G7VL 5IHUL 1EEZB 1KT2A 1W72H 5DJDA 1FYHB 4PJ5A 3L7FA 3MO1A 4YFLI 1JN6A 2FATL 4J8RA 1CGSL 4FTVE 3OKEB 3O45B 4OZHA 4JO4H 1EAJA 3S36X 5FM5M 2BOCB 4PPTA 2WK2A 3V7AG 2ENYA 1O7VA 4JR9L 2VMFA 3ZKXC 1QBMH 2BSRB 5ACMA 4P3CL 1XR8B 4L8SA 4K3EL 3UBXA 3MNZB 4KK6D 4UDUB 2O5ZL 2ARJA 3E1F1 4QYOB 2COQA 4HGWA 3TYFA 7FABH 1CXFA 5C0CA 2L7JA 1OARH 3G04B 1OAQH 1BM3L 2Z93B 1KGCD 3HNTL 3QCUH 4QRUB 3ZE2E 5JMOC 2VZTA 2NY1D 5EOTB 3ARBB 3VDCA 4MQXD 2QKIB 3ZKXB 3KVQA 1T1XB 3IGAA 4R90L 1AI1H 4YHOL 3P9LB 2NXZC 2AK1L 3MRDB 3RA7H 4OZHF 2FD6L 4X6DF 4JFDA 3HMXH 5IK3B 5DK0A 4G7YH 1IFHL 1OHQA 1S7XB 1SJEB 3S3SA 1ORSA 1W0VB 5JNYB 1TVBB 3MRLA 5CILH 1QLEL 4RAUB 1KENH 2DL2A 4PV9B 4Y4KA 5CWSA 1KB5A 3ROLA 2ADFL 3QQ9C 3VFSB 2FX8H 1AQKL 1KSRA 1RK1A 1SJVA 4X5LA 4YGAB 4MA1C 2MOVA 3L6FA 4LSRH 3EKCA 1Z0MA 2JB6B 2Q7YA 4XTRD 3VI3F 4PREA 3BJ91 4PRBB 3QRFM 2R1WB 5HHNB 1QPPA 2A83A 3VMNA 3FCTA 4QRTB 2VLKD 3UTQB 4V1DD 5EC2B 4POYA 3PDDA 2DAVA 1DN0B 4MMZC 2XTLA 1IKFH 2ZOLB 3KWWA 1T89C 2Z91A 4XVJH 3O2DH 5E95B 3U83A 4H8WC 3RA7L 3NGBB 1I7UA 2BY1A 4KTEH 4C58B 1WBXA 3FT4B 5CBAA 4JY6B 3VRLF 3PGDA 1CGUA 1M71B 4CADB 1NAKL 3LEYH 2G9HA 1IT9L 2PW2A 4WY7L 4FFVD 4WNQB 2R69L 3W2DL 4OUOA 4DFHA 1AH1A 2ADIB 5MENA 1NFIB 5EU7C 5BRZA 4UDTB 2BRRL 4P3CH 3OJVC 4NQDD 3ZE0E 4M48L 4NM4L 3R1GH 3SDXF 4MNHA 1QYGL 3MROA 5FUZL 3RY4A 5I1JH 3QUYA 5D7LD 1U93B 3FB7B 4IRJB 1XGUA 4PRDB 2VUOA 4U1SB 4D9LH 4QXUH 2D4DA 3MA9H 2Q8AH 3T77A 2NQCA 2DI9A 4MA8L 1W72L 1GHFH 4KGJA 4P2OC 2OTUA 4C4KO 3UDWA 4PJ7B 4NYLA 5D7JC 5I30H 4IHOB 4O51B 3FONB 2ZUSA 4HC1L 2DQTH 2GITA 1OAXL 4QRRA 4R3SB 4F33B 5IEKB 4OKDA 1U8MA 3Q6FA 2A77H 4LOUC 2B4CL 2HKFL 2YD1A 4WI4A 4G43B 4CRPA 1RJLA 3HI5L 4WDIA 2IAMD 1SMAA 1HI6A 4OJFH 4NO0A 3ZYOA 1YN7A 1ZHKA 1EFXD 4LVNB 4X83A 1KTLB 3O6KH 3ZTJH 4ZPTA 2V9TA 4X7SH 3EFFA 5HHVH 1A7PH 5JQ6H 4QOKA 5HI5D 1J0JA 4L9LB 1QSEE 1BVZA 1MJUH 4JKPL 2XZQH 4TSAL 1MREL 3B6SA 3CK0H 3DGGA 2UV3A 3PDOA 4JPIA 4LPYA 4PTTB 2HT2C 3KPOA 2MCG1 2F9BT 3G5XB 5L6YH 1I9JH 2Y06L 2OP4L 4NRYB 2A9NH 2MQ3A 4Z76B 1I1FA 2JB6A 2Q7YB 5I17B 3DX9A 4U6HB 1T66D 4M6MH 4PB0H 3ESVF 5IB3B 2DTSA 5DUPL 5BQ7B 4ZFOL 1A1NB 1UJ3B 4HQQL 1Q9OB 1WT5A 3S98A 2RFXB 4OFYD 4P9MH 5TDPB 1KIPA 2HT3C 3N50A 3FFCD 4OV6F 3U0TA 1ND0A 2E7LA 4JHZA 2VXVH 4GKNA 2V17H 1CN4A 4JFPB 2GAZB 1NUFA 4MQ7B 5TE7H 3RGVD 4BQ9A 3AGVA 3CSBA 5JNYA 3DBXB 5IP4A 2PO6B 4FTVD 4XI5C 5MI0C 4RGMB 2UZYB 2DQJH 5F89B 4JPWL 1ZVSA 4BFIB 3RJQB 3C2AL 2YZ8A 2KUTA 4JANA 5J1TC 1X5ZA 1P1ZA 4R26L 2R4RH 2HJKB 3D39B 1H8SA 2P8LA 2XFXB 3WNNA 1VGKA 4HHAA 5GPRA 3NCJH 1LNUB 4RWHA 3HMWH 4X9FA 3QJFB 1NFIA 5DUMH 3IU3B 3NA9L 3OF6D 3RUGA 5FO7B 4EI5B 3BZDA 1CLOH 5LQBH 3FQWA 1ZWIA 4DUVA 4WFEE 4Z77A 4OZFG 1LK2A 2DLFL 1UWEH 3QPXH 4KPHH 1R5IB 1TVDA 43CAA 4WRLA 2R2EB 5I15L 2V2TA 1A14H 2UYLA 3NIGF 4HGMA 5HSFA 2DQFA 1NAMA 1R3HB 4RIRB 3U1SH 3QQ9D 4LLVA 2VXUL 3RWGB 2VN7A 4MJIA 3D9AL 4HJ0D 2EDDA 4HGKC 3TC9A 2BDNH 3RUGE 4UT7H 1MFDH 1KXTB 3VFRA 5C70A 1A6ZA 2IEPA 3T2NH 1E6OH 1OVZA 2BVYA 1PAMA 3V5DA 3E6HB 1I75A 4PJGE 1IL1A 1W72A 4HEPG 3L95A 4KJQC 2DIBA 4UMGA 1FO0B 1NEZA 2CO7B 3ARDB 3SKNB 2ZWLT 1E6JH 2Q6WB 2EE3A 1B9ZA 3O41A 3P0VL 3WFDH 4AMKH 3BYYA 4ZXBD 1KG0A 3MFGB 3BHBB 3O3BA 4APQC 3CZFA 3P3YA 4XPGH 1ERNA 4U1IA 1K8IB 5B3JF 4Q7DA 2W07A 3UYOD 5DJ0A 3I84A 2GK2A 1A6VL 3QDGA 4YDVA 4ZYKB 2EO1A 2YZ1A 3CFJB 3RZCB 1CXLA 3GK8L 4O2FA 2EH7H 3VXPB 4NCC2 5EU3B 5K9OA 2N56A 1BECA 4M7LT 2LAGB 4XPTH 5C0DB 1WUNT 1G7MA 5DUBA 3U7WH 3PWPD 1IGIL 3WD5L 5F7HA 3LDBB 4CW1A 5LJYH 3HE6A 2P8LB 2AK4E 3HMXA 1TETH 4G9FB 5FDWB 1DBKH 2X7LB 4H1LG 1ZLVH 3UMTA 3MRKA 2CK2A 5AAWA 1JNJA 4ZS6D 2DBLL 4FXGB 4IIQB 1I9RL 3SGEH 4KMTH 4Z7VE 5AG8A 3C6LD 3QCTL 4QWWC 3IXAB 1EGJL 4FQXC 1D3CA 3OQ3B 4TSBL 1RFDL 3EZ8A 4MQ7A 1V5JA 2OL3B 4U6VH 1CQYA 2VLKB 3ULVF 1JHLH 4YDIH 3IF1B 3IDYB 1KJ3H 5JXEA 2AK4A 4CN6A 4LHUD 5K33A 1MCWW 3QPQC 4GAJH 1ZV5A 4HIHA 2AQ1A 4M3KB 1QRNA 3MLTB 3AU1A 4HJGA 3F58L 3HC3H 1I1FB 1M7XA 4PLOB 2NZ9C 1T20A 1YEKH 1BEYL 4Z7QE 4QHLA 3I02B 2OQJB 3ILPA 2FNBA 1LDPH 4CMHB 1HKLL 3N0PB 5F1OB 3VD3A 3OL2A 3NIFE 4CVZB 4N5ED 2VTFA 5HGAB 3I2CH 1HOCA 3GMPA 4O9HH 4OZGE 1DLHA 1D6EA 1TTFA 4LSPH 3K1KC 4D0BA 3FOMA 5DFVD 4LDEB 4RAHA 3EYVA 2EIZA 5TF0A 5IMLA 1X7QB 2IPKA 2ZG2A 4GSDL 3MCLL 1U8JB 4TRPL 1J1XH 3WL9A 3K2MC 3VXMD 1FGNL 2RCSL 1MCRA 4PGCA 4B53A 3O9WA 1VGEL 1PD6A 1CDGA 3G9AB 3KPRA 1EEQA 2UZXB 4RFOH 4NUJB 3O3EA 4O5LL 1D6EB 5L9DH 2UY7A 1C5CL 5FUZH 3VRJB 3MV8B 1XR9A 4MZ2A 4MLIA 5BXFA 4ZFZA 2CPCA 35C8L 2GITB 1WTGT 2OXHA 1JGUH 1FGNH 5CJ8A 3HI1A 2WZPD 1BVKA 2GFBB 3QXUA 5C0FA 5E94B 5K59E 1ZHLB 2MTPA 3MCLH 2FJHB 5FK9A 1NL0H 5C6PB 2B0SH 1XZ0B 4TNWF 3O81A 4CJ0A 4F9LC 4W6WB 1P7QD 4NN6C 5GJSL 3P2TA 1UM6H 5F9WB 3BESR 4KRNA 5CD3A 3O3DA 2Y72A 1E28B 3I85A 4GLRI 4AEIL 3H2WA 4GOSA 4XVJL 1E4XI 5C8JB 1CFNA 1J1PL 2GCYA 5KSVA 5CUSH 3HC3L 4AEEA 3DV6B 4QRSB 2EE2A 2ZSWA 2GI7A 5L0QC 1RZKC 4KMLB 5DZNA 3FO0H 3JWDH 1KNOB 4JDVB 3B3IB 5DMGC 1BOGA 1T20B 1OSPH 1UKTA 1M71A 2G5BA 3LQZB 4X9GA 1MNUH 4OGXL 5HI4C 4M1GL 5GSVA 1S5IL 3FQUB 4NC1E 5EFIA 4F15B 4L8DB 1F4YL 1JWSB 1FFOA 2HKHH 2QSQA 2NXZB 3DVNB 1RIUL 3GSWB 5EBWA 2ZUYA 1I1YA 3VE0B 4HUVA 1PYWB 1KLGA 2QHLA 3KNBB 3X13A 4PRPD 1DN0A 2VLLA 1Q1JH 1TETL 1AXSA 2DDQL 3QEQB 4LVNC 1TXKA 5GS1B 5FGBA 3T2QA 4NIKB 4V2CB 4Y2OA 3RWHA 4NKMB 3F8UB 3NH7L 3FN3A 4HFWA 1EHAA 3MRBB 4R8WL 4M1CD 5F7EH 2VN4A 5TQ2L 2PTTB 4XT1C 4X7CC 2F54E 1RZJH 4PJ7F 1LO2H 4HUKB 5ALCH 1T21A 2XA8L 3OKOA 2JB5L 4LHUG 5D2LB 4IRSC 1ZGLA 3OBAA 4YWGL 3G6AA 3OXSA 5H94A 3WFDL 4AMKL 4JPKL 3VDAA 2YA2A 3L5IA 5H2BB 2WAHA 3BX7C 3VXRE 2CSPA 2OXGA 4JAMB 1E4XH 2VZVA 3PWLA 4DUXA 3EAKA 1U95B 3TZVB 1I8LC 4WGWB 5HYJB 1Z9LA 4HF5L 4WHCA 3F65A 2V2TB 1BIIB 1MQKH 1JUFB 3MLRH 3IFNL 3TGXA 2OYPA 5DLML 3ZDXF 2V7NB 3L3DB 2CGRH 2BVPB 2MJWA 2BDNL 4WIQA 5JW4Q 3VGEA 2R1XB 4PGEB 1DN2A 4OLZH 4I3GA 4R2GC 4GMSL 3NACH 4Y1AD 2RQ8A 1EZVY 2ZSWB 5E2VL 1S9YA 1PVHA 3OKKA 4ENEC 3QEQA 1OF2A 1RQ5A 3RIFF 5CLWA 3FN9A 1AC6A 1YEIH 1Q94A 4LLAA 4XP6L 2J6EH 1YYMH 12E8H 5JIPA 15C8H 2A0LD 3M8OH 1L7TH 1CD1B 1RHHB 3KPSE 5JW4M 3TBWB 2CR6A 5LQBL 4TN9A 4NCDA 2BVUA 5EIVA 2ICES 3FT3A 3TNMB 1ORQA 4NC1C 1CK0L 2OR8A 3GB7A 4BQ6A 3NCJL 4N0CD 4S1DC 5I9QC 4NQVA 2YRZA 3H9HA 3L3GB 5BS0B 3KYNB 1T22B 4TUJA 3K2UH 4HPOL 3GMOB 3K74B 2XN9D 2ARWA 4ELMB 5DYOA 5D9SA 3PIQA 5E2TH 3EOTH 1YECL 3D0VB 2NLJA 4DKEH 5GGVY 5C0EA 5SWZB 2H9GA 1MRFH 3U36B 3JV4A 1M7IA 1RJLB 4WDIB 4R4NC 3TCXA 1GPOL 3VD9A 1FZJB 3EO0A 5I16A 3P0GB 1K6QL 4YHPB 3ZLQC 2C7UA 1DZBA 3BT2H 3KPNB 4OB5L 4WEBL 1NAMB 1NCWH 5D4QA 5EIQA 3DURB 4LFHD 3G5YB 1JFQH 3FONA 4WI9A 3P9MA 3NAAL 4LBEA 2I5YL 5AUMA 1GGBH 3NCFB 2F8VA 4ZFZB 3SO3C 3U7AA 5ISZD 4M7LL 5CKAA 2XQYG 3KLHD 1BD2B 2O61B 1QR4A 1WQVT 3U7YL 1MREH 5JOPD 4NBXB 3BPOB 5KVEL 4FXLA 3QDMA 1JGLL 4JN2A 3SDYH 1HHKB 4ODSH 3FO1A 4MJ4A 3SY0B 5HTSA 1CGVA 4OLYH 5DC9B 3GFUA 3SE4A 3PGCA 2XI9A 4B0MM 1IAMA 3DX8B 5D7IE 4KI5E 3EO9L 1FNHA 3CSYA 3ARBD 3IDNA 5JORA 3BE1L 1UJ3C 2VDOL 1KN2H 4LKXA 3MRPA 3GSNA 3GSUB 5C08D 4PJHE 1B2WL 2NY7H 5BV7L 1QRND 1FZJA 4TYUA 5F6IB 3O41B 5EPMB 3H0TA 1NGWA 4BA8A 5JXED 1FO0L 4X4YB 5F3BA 4M1DH 3OAUL 1G9NL 4MJ5A 3MOAL 2X42A 5CZKA 5C0JA 4LIQL 4MXQC 5A43C 3VH8G 1BBDH 3EYUH 2EC9U 4YDLC 5F8QC 1MHPL 4M6OH 3G6AB 3OXSB 5H94B 4YHKH 4I18C 5DS8A 2AI0H 5J06A 3OKMB 2DLIA 4K23L 4CL7A 3RWCA 4GG8A 3C8HA 5EZLA 1S7WB 3EDJA 1I8LA 2BVOB 1J0KA 2JIXB 3LCYA 1X6NA 5I1JL 1MWAB 4ZD3L 5BW7A 5GGVH 4LLVB 1P7QA 1G0XA 5EC1A 1N4XH 2J8OA 3GJEA 3E2HC 4Y8DC 5DO2D 3REVB 1QACA 1T1ZB 4Z7UE 1UVQB 4MD5A 1HH6A 2VDNH 1U8IA 2P48B 1TQBC 3C08L 3OR7A 3K8MA 4ODWB 4H0GA 1DUYA 5GGRY 5FEBA 4GRWE 4XPAL 4D9QD 2FH8A 4ODUB 3EFDH 4M5ZL 4KVNH 3LIZH 1A7RL 4F57L 2P42B 1TDQA 3WKMH 3B2VL 5CIPA 4QHUA 3IU4L 4FQJL 1T2XA 5HHPA 3L5HA 2O5XH 4JQXC 4KZDH 1FYTD 4A2MA 4H88L 3H0TB 1OY3B 4JG0H 3BXNB 2APWA 3TO4D 4X6CB 1KIQA 5I75B 3ARTA 2PXYC 3LRGA 3KG5A 4KRPD 4QY8A 5LCVH 5H37G 1T2QL 1PEZA 2V2XB 3DETC 5F1IB 2X4QA 1U91A 4WEUD 5DK2B 1ACYH 1LEKA 2OTWB 5HVGB 4HUWB 4UOJA 5IBTL 1AQKH 5FO7A 1H3PH 2DYPA 2ADFH 3RVTC 3O4OC 4PREB 2UWEF 4TTDC 1V05A 1G9ML 4QRUA 4O02H 2IPUG 1YC8A 2DMKA 1R5WA 4XHJC 2YD7A 5I71C 4Z0BL 5D7SH 3G6JA 4D94A 2DQFB 5HGDB 3IJHB 1HHHA 1JHTB 3VFVA 2J3SA 5DA0B 1G6RL 4HT1L 1OPGL 3T4AB 1I1AC 2E3VA 4KU1A 3QFJB 2W65B 4OBSA 3N9GH 5CGTA 3VFGH 5HPMA 3SE3A 2KQNA 4K8RL 1LP9F 4E5XA 1JK8B 4MX7A 4UT9H 1V8HA 5DXWA 4P23A 3ZYZA 1EFXB 3DVIA 3WFHB 1BQHB 1J0IA 3QA3A 4LLWA 4X6DE 1XF2A 1NLBH 5SX4H 3UBXI 4YHMH 2Q8BL 4J2XA 1WICA 2PN5A 4XB8A 3QJHA 3VXME 4H1LH 5I17A 5F3BB 5CJQH 4JFDD 4JO1H 4KKCC 4X4ME 1QUNA 1XGQB 2XRAH 3OSKA 3DWTA 1UCBL 3BVNB 3LZFL 4QCIA 3UAJC 1AQDA 4KRPC 4HIIA 3M45A 1RVFH 1A0QL 5INCB 1I9IH 1L4IA 4K2UH 5FYLL 4M00A 3ULVE 1S5HA 4ZAKA 4BH8B 1ZT7B 1ORSB 4UI2A 3DOSA 4PJ7A 1FVEA 3OKEA 3RZCD 1RURH 3RL1A 3MLXL 4XP1H 1AKJA 2FIRT 4UUJB 4UNUA 3P30H 4J3VA 1VFBA 2DL9A 1GOHA 2YN5A 4KRPB 2IGFL 1K4CB 3OJMB 4NHCH 1JMZA 4XP4H 2OJZL 5E8DH 5D6DA 3RVWD 4CNIB 3UJIL 4LCWB 3DROB 3UJIH 3TO2A 4XWGH 2DQUH 3CLFL 4OBRA 3HE6D 3B9KC 3HFMH 1U92A 2BSRA 3IKKA 3OKDB 3PABB 4K71B 3SOBL 3MLZL 3ZDXE 1YDPA 1F97A 1MAML 2CDGA 4DZ8A 3F5WB 5EUOE 4G3YL 4XP1L 1ZLSH 4JZJA 4L4JA 1TTUA 4AL8H 1FZKB 3QXDB 1VB9A 2P8PB 4F9PC 3P9MB 3IVKB 3BYTA 3AAZB 4HWZA 5IMKA 5IT2L 4K3DL 3HZVB 3HE7B 5EWIH 1WCBA 2H6PB 4W81A 2D7OA 2EDWA 1CE1H 3RRQA 2J8UE 1ED3A 4OCSH 1O0VA 3PWVA 4ZNEE 5IHZB 4YGVA 1IGJB 1M7IB 2GY5A 4KK5D 3PQYE 4JO1L 3A67H 3K8KA 4R0LB 4XNUH 1JPSH 4YXHH 5CJQL 4OD2B 4FP8H 4JQVC 2LU3A 1CVRA 4M93C 3PWNB 3TP4A 1YEEL 3ZKNC 5L2KA 5LGJA 3SN6N 3SKNA 3O9WB 4AEHH 2IQ9H 3QWQB 2NTFA 4PGCB 4V1DA 2CDEA 4D0DA 1NANH 3SJVE 3KWWB 4OQTH 1FNGB 1IC7L 2BMKA 2EEAA 3WFCH 4NWTL 4PV8A 5DGQA 3ZE1E 1I3GH 1RY7B 3NGBC 3IDUA 2VLLB 3V4PL 2BFVH 3EW3B 3UZQA 4RCAA 3OGCB 4HUMB 1E4WL 4NSKA 3WLWD 4MGXA 2XG5A 3IT8D 4RIRA 4DKFL 2VDMH 5IFAL 5CMAB 5EU7E 4AG4H 3FQNA 3I50H 2NY5L 3G04A 3DGCR 3PV6B 1XGPA 2MFNA 3ZL4H 1A3LL 1FFNA 3KXFA 5MEQB 5T1DL 3TYGH 1NMCC 4HWBH 3LKQB 5E03A 5C0BA 5E2UH 1C5BL 2R2HB 4HDIB 1QSZA 1WBZB 3RX8A 1T83C 1HIMH 5H2BA 1NBZB 5DRWB 3DUUB 3QUZC 4DQOH 1TVHA 3T0EC 3UP1A 3OB0H 5JPNA 1R3KA 1UACL 3V0WH 2ICCA 5HYJA 1TZGL 2Z92B 2F19L 5DR5L 4GRWH 1BLNB 4HWEH 3ARBA 3F7QA 4IRSA 1N2RB 1BQLH 2J88H 4QXWA 1XGTA 3Q3GA 1FV1A 2BC4A 1T7YA 1RUAH 3WKML 4XVTL 5K59F 1VFUA 1LHZA 4G9DA 4L1DA 4MNQD 5C0CE 1T21B 3U0TB 4L8SB 5JHLL 1OTSD 2IPUK 3VD4A 3CIQA 1FL5A 5EU3A 3PV6A 4OCYH 4BSVB 2CR3A 4OD1H 4HK3N 1PY4A 2WBJB 1D5IL 4TNVK 2P5ED 3D85D 2CK0H 4AIOA 5FYKD 4IRSB 1IRAY 4YXKH 1MVUB 3DYOA 3RWDB 3GBLA 4Z7WB 5IM7B 4X4XA 2DKSA 3JTTA 5EBMB 1A22B 2HVJA 4QT5B 1G7JA 2NZ9D 5ID1B 3B5GA 3DGGB 5EOQH 3ZKMC 1PW3A 5KJRH 1I7RA 1A9EA 2R2HA 4HDIA 1GSMA 2Z9TA 2VAJA 1SMOA 4MMXC 1OSZB 4EI5A 2DIAA 1C16B 3BPOC 3NABH 3DJ9A 1BBDL 4ZFOB 5D72H 2FBOJ 1IILE 4YNYB 1JWUB 1BZ9B 4MNGA 5HVWA 4Y16B 2IH3B 2IMNA 3N1GC 4KUZH 2IADB 5DRXA 3GM0A 1DUZB 4HMDA 3OR6B 1ZSDA 4ERSH 4KK9C 4R96B 5DJ6B 5D96B 1FORH 2PR4H 1CD0A 3ZL4L 1JYNA 3NOIA 1XZ0A 1LEIA 5BV7B 4LP4A 4X9BA 2N4IA 2NY5H 5KSVB 1UM4L 4L4TE 3ARFC 2AAVA 2MWCA 5HYQA 5I1DA 4CKVX 4JHBA 4EUPG