5D2LE

Crystal structure of tcr c7 in complex with hcmv nlv epitope presented by hla-a2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
195
structure length
187
Chain Sequence
NVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCAFITGNQFYFGTGTSLTVIPNIQNPDPAVYQLRDSKKSVCLFTDFDSQTNVSQSSDVYITDKCVLDMRFKSNSAVAWSNKSDFACANAFNNSIIPEDTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Crystal structure of TCR C7 in complex with HCMV NLV epitope presented by HLA-A2
doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 26
structure length 187
sequence length 195
chains with identical sequence I, K, O
ec nomenclature
pdb deposition date 2015-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d2lE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d2lE02
5K9OA 1FNAA 4ISVB 3C8KA 4ODTH 4GG6F 2VLLA 3VXNA 5JMRA 3QJFB 4KK6C 2WV3A 1E4WH 4MJIB 4AT6B 1ZHLA 4XBPA 1BEYH 1E4KC 5DO2C 5LCVL 4QHLA 2JJUA 4PJ9B 2O5ZH 3KHQA 5IW6A 1QFHA 2G5BB 2VZUA 3D69B 1K2DB 4J3VA 1KENH 3LB6D 4M7JL 3T0DA 1EO8L 2EEDA 5CJ8A 4PD4J 4Y16D 5I6XB 1I3VA 2DS4A 4CDHA 5KTEH 1S5IH 4LCUB 2H3NA 3GJFB 4WY7H 5I1JH 3BPNC 4OKDA 5EBMA 3PWUA 2XTJE 2VR4A 4AQ1B 4YDKH 1U8KB 5FDWA 3I75A 1NLDL 4YXHL 2LVCA 2XQYG 3ARVA 5I73C 3TBYA 1TQBB 1V5JA 3V52H 1WT5C 4JO4H 4TQEL 2AK1H 3T4YA 1YECH 5EBLB 1FFRA 3E2HB 3B5HA 4GRWB 1Z9LA 1CLYL 1F2QA 1MY5A 3DX7B 1VGKB 3BDBA 1MFAH 4I9WE 3NPZB 1OF2A 4UTAL 4NNXA 4H0GA 3LQAC 3CZFB 3S35X 4MVBC 5EOTB 1BP3B 2OJZH 3VGAB 5GRVL 3E1F1 1AE6H 4HBCH 5GPRA 3V0WH 1BVKB 1BJ8A 3EYQD 1OY3B 4XP5H 5F3BA 5HGAA 3K4AA 3AAZB 1DN0A 1SVZA 1NANH 5DJAA 1EPFA 1L7IL 5DHYB 1X5IA 2FL5A 4ZFGH 3RGHA 1XAUA 3U4BH 4QXTA 3ARGC 3WE6A 4GKNB 2BVYA 1JWUB 2IAMD 4YNYA 1ZV5A 2Y5TB 4YGVB 5GGTA 1CF8L 1EHLL 2IANB 5D6CB 5K59E 5ENWA 3GB7A 4PG2C 4LARH 2BNRA 5MEOA 1BJ1H 4WO4B 3BDYL 2Y23A 4UV7H 3RU8H 3VFSA 1E4XH 1L0YA 4WGWB 3BISA 4XPTL 5CD3A 4AEEA 2X4OA 4NKDB 4OFVA 4P2RA 3RKDD 3OHXB 1GGCH 2IADB 1X7QA 5HGGS 1B0GB 4Y7MA 3FO0L 3HKFA 3IXTA 3VXMB 3FJTA 2P1YA 3MBXL 2W59A 4XMLH 4P4KB 5LXGH 5E2TL 4JO2H 2ESVB 2JJSC 5L6YL 1R5WB 1HHGB 2EIDA 5JNYB 2R69L 3RVVD 1E0OB 4KRPD 1KOAA 2I07A 4WW1B 4MQ7A 3VXOA 3T77B 4S1RH 4CADA 3Q3GB 2QSQA 1W8NA 3JWOH 1TQCC 5T1KD 4I3SL 1KCLA 2X42A 4NZTL 3MV7B 3T3PF 1I3GL 1EVTC 2NY7H 4GXVH 3QWOB 3U9PL 4QOKA 5ERWA 3PWPA 4JY5H 3WLBA 4FG6D 3BQUD 4Q2ZB 3O9WA 3T04D 5KZCB 5D1QA 3TVMB 5D2LB 4LKXA 2N4IA 1HXYA 4NBZB 4ZUUB 1F3DJ 1IFHL 3VXUD 4PR5B 3MNZB 2HFFA 1VB9A 3TA3D 4S11A 4DN3H 2BOBA 1NAML 3B2VL 1MCWM 3HRZA 1AY1L 3CC5B 3L1OL 4NHCL 5FB8A 3KPRB 1HEZB 1NMCC 2X4TB 5LQBL 3VFWA 3MUY1 1I3UA 5KSBA 3DMMB 1BIIA 1AKJA 3AXLA 5JPNA 5LKNA 4OM0L 1SJVA 3ARBA 3EZ8A 1X5GA 4N0UE 3FQWA 1IGCL 3QUXD 2BVOB 3GUTA 1A9BA 4POZC 3QAZB 3ZTNH 4M1GH 4DJMA 4ZYKB 1UA6L 4TOYH 3DUSB 4MD0A 4QRTB 3I6LD 4IOIB 2QQLH 2W60B 3B9KA 3BKCL 2WUBL 4NKMA 3PUCA 3W9DB 1N59A 1DVFC 2IALA 3BXNA 4XP6H 5I1AA 5CSBA 4X5WB 5JQ6H 3OAZK 1U3HD 3LN9A 2DM4A 2ZKHH 5HHNA 1ZSDB 3ULSA 1J1OH 1KB5H 3ZE1F 3BFOA 3BX7C 5L0QB 4ZUVA 2D3VA 1JPTL 3T0WA 3C2AL 3VWKC 3D0VA 2EYRB 5T5FH 3L3IB 3MRLA 2VB5A 1RI8A 4ZFOA 2APVA 4HK0A 4LDLB 5DJXA 5JXEA 2CKNA 4GQ9L 4JJ5A 3GSNB 3QUKB 4WUUB 4FNLL 1RIHL 1NBYB 43C9A 2EDFA 1TFHA 1MEXH 5FUOL 2V2XA 3ULUF 1FG2A 4ONOA 4JDTL 1KLUB 4G6AD 5BOPA 4AK1A 1A6TB 2FB4H 4KQ4L 1RZ7H 3MLYL 2VLRB 3MLRH 4HUMB 4QRQA 3NFNA 4HUVA 4GMSH 2MPAL 2WLYA 4N0YL 1RK0A 4OKVB 4R96A 5IF0B 4XNXL 3TN0D 5DRNB 3ZTJH 1J87A 3WKNA 2J8UA 4ALAL 4DAGL 1NEZA 3EDKA 4PJ7A 1MWAA 5DZLA 1JWMB 3MRFB 3QJHB 3C9NB 1J5OL 5KVFH 4HV8A 5SWZD 3BJ91 4FQLL 1IKFL 2QQNL 2D31A 3PWNB 1H5BA 4HCRL 5CBAA 4PREA 3KR3L 1YJDL 3QO0A 4EN3A 4YGAB 3MV01 3QI9B 5BV7H 1WISA 3PWLB 4CMHB 1HH9A 3VXUE 5IVZB 1HOCA 2Z31D 5FM5O 2JCCB 3MRCB 4GAYB 3SKUD 2ZNWA 3LQMA 1YEHL 1NFIB 3WUZA 1Q8MA 4LSTL 1HHHA 5B38A 1PKQE 3L7EA 5EC1B 5IV2B 1JF1B 3BKMH 3E6FB 1GJIA 5KAQG 3U0PA 1K3IA 3FAXA 3ZDYF 2OZ4A 1YDPB 4P4KD 3JUYA 1BAFH 1CBVL 2ESVD 2BMKA 3BEWA 4YUEH 5C3TA 1V7NH 1F4XL 1GHFH 3CJJA 4JGUA 2C7UB 4BK5A 3BP4A 1C08A 1CG9A 1EAPB 4QHKI 4D0BA 1RIUH 1YNKL 1AJ7H 2B0SH 2NY5C 2XICA 5GRVK 3P9LB 5BCAA 1A9EA 1EFXB 3OSKA 3SCMD 3HR6A 1UEMA 3PV6A 4FXKB 4NN7C 3O45A 1NBVH 3VRIA 4PJXF 2YD2A 1S7TA 3VFGH 2J5LB 4YPGB 5DLMH 2CKBB 5EZOH 4ZS6C 3TT3L 1MIML 4NDMA 5IKCB 2XQBL 2HKFH 3WMSA 2CDEB 4PJBF 4F7TA 4MAYC 3CU1A 3G04B 1E27B 2DWEB 1P6AB 3TVMD 3WFZA 4BA8A 2XG5A 1S3KL 5HY9B 5E6IB 4AEHH 4JM2A 3LKPB 3K4DA 3G5YA 4Z7WA 1FVDA 3HNVH 1CFSA 2H2SD 3O6FD 1VFAA 4HKBB 5IK3A 4ZPVB 4WENB 4DZ8B 5HHPA 1A1NA 1FZMB 3VXSB 3KPRD 4LCWB 4GRWE 3DMMD 3TJEH 1MJ7H 2IBGA 5MEQA 2OS7A 2NY0D 5EBWB 4FQ2L 1YEDB 5AAWA 1QFUH 3QXAB 4X4ZA 3EOYG 4ENED 3HPJB 3TH2T 3RWDA 3QXWA 1BM3H 1Z3GL 5ESVB 4LHQB 5DFVD 1VFUA 1CD9B 3C5JA 5CP7A 1F90L 4XPHH 1SY6L 5F9OH 4PRPB 1KCSH 3RX5A 3RA7L 3IU3B 4DK3A 4XNQA 1LILA 1MPAH 4NZJA 4R2GD 3ARBC 2A6KA 4XRCA 2KQNA 2YPLA 2PTTB 1Q9OA 2MFNA 1D5XB 3EBAA 4Z78B 1KJ2B 2V2TB 4FZ8H 4OZGA 1JPST 1QVOB 4DQOL 1X6LA 4LP5A 5SWZE 3ZYIA 4DVBB 4P5MB 4X80L 3V7AG 4HUNB 1DBJH 3D48R 3EYVA 1UXSB 2R2EA 5D70H 3MPCA 2NW3A 4J6RL 3BP7A 3I6KA 5B3JF 3EZJB 5FO7B 1T4KA 2PCPB 4L3CA 5IR1A 2W0KA 1G9NL 3LV3A 4X4XA 4FQXB 3GBMH 1CLZH 4KKLD 1T1ZB 2BERA 4OSUL 3MV8D 1II4E 2A6JB 3RZCB 1EJ6A 3DUUB 3VD7A 4I3GA 1WFTA 4GSDL 8FABA 2HT4D 5D2NB 4U1GB 1IGTB 4N1EA 5I75B 4N1HB 2IQ9H 3FTGA 5IM7A 1I4FA 3IVKA 3MV11 5C0ND 4HBQA 3VFVB 4LPTA 3TO4A 5IMLA 1MIEL 5C08B 4L1HA 3ARSA 4NWTH 2NXZB 4U1NA 4U1SB 3WS3A 2ESVE 2BDNH 3QPQC 3FQTB 2ZSWB 2Y6SD 1DUYB 2VLRD 4PJ5B 3CUPA 2V9QA 4NKIL 4K8RH 3HZKB 3QDGD 4AL8H 1ZS8B 4O51B 5IB3A 3PV7A 4U1HB 3KPOB 1U36A 4L4TA 4QEGA 5D72H 4X0KB 2R29H 4OUUA 5C9JA 5CEZL 2D4DA 5GGRB 2X2YA 3A6CH 4OGAD 1OD9A 1JZ3A 2DTML 3MACH 2APTA 1U8LA 4XWGH 1RV6X 3S35L 5BJTB 1AR1C 4F37K 4GKZA 3UDWA 1KIPA 4PJDA 5CJOH 4GRMB 3LPFA 4UNUA 3BH8B 4C4KT 5CZVL 1TJHH 3SE3C 2DKSA 5E7FA 1J8HB 5DD0L 1UYWL 4Z0XB 1I1CA 3PGDA 1MQ8A 4BH7A 1A14H 4OGYH 4WIQA 3MCG1 1XZ0A 2EDOA 4H26A 1MCEA 5I30L 4AY0A 5D2LE 4QTIH 1RK1A 3RL2B 3NOIA 1P4IH 2IG2L 2A0LD 4K7FA 3IF1B 4K3GA 5TDNB 5HYFA 2PUQT 3GI9H 4KV5F 1ZLUK 1OTTC 4NGHH 2BHYA 2DQTL 5FDYA 4XMKH 3O6LH 1BQLL 1AO7B 3I6GB 1H5BC 5HI4D 3KPRE 3AVEA 4KKBC 1ZHNB 3HI5H 2WWKT 4OZFG 4EN3C 4DW2H 1L7TH 3HC3L 3WFCL 3P9WB 5I15H 4HKXA 3S9DB 1K3ZA 2HTLC 4P57B 1JZ8A 5EU7C 3TNMB 3MRBB 1MLBA 2HN7A 4XHJD 1FDLL 4KHXH 2A1WL 2AJZA 3LS5H 3LPGA 1IM9A 3BP5A 1CDGA 1U95A 1Z5LB 1G7QA 4ZFZB 3SE8H 4FQPA 2WUCH 4BZ2L 3QPXH 4V2BA 3NN8B 4Y4KD 5SV4A 3OKKB 2W9DH 4RSVA 5DJ6B 3GZKA 4S1SH 4PV8B 2C3XA 3MXVH 4HS3A 4Q6YA 5IFHL 1P84J 3B6SA 3UTZB 4Z77B 4M1DH 3EDFA 5H37G 4CGTA 3NABL 1QUNA 2DQGH 2E3VA 3LN4A 2VDQL 1AIFB 5EUKA 1ES0B 5JDSA 2L0DA 2BVQA 3QEQD 3S3PA 3W39B 3VJ6B 3G5VA 5DQ9A 2EH8H 5T3XH 5IFAL 3ZE0E 1OWWA 2QL1A 1AP2A 2AXFB 4FP8L 3VXSD 2CDGB 4HDIA 4FABL 4WFED 3BI9X 3G6AB 3KLHD 2AXGA 2OJEB 1IGJB 1KIRB 3KDMA 4JRXA 1CQYA 3I85A 3ZKSD 4GBXA 4J12A 1KIUA 3SJVB 3TZVA 3SDXF 4JM2C 4MCYA 2X89A 4XP1L 1A6ZA 1AGEB 1MJ8H 5TDOB 3ZE2F 2D0GA 2ATPA 2XA8H 3QFJD 4PJFA 3GHEH 2VLRE 4HS6A 3VG0H 4PP1D 3QDGE 1AD9A 3KPSD 1ORQA 5F1OB 4HPYL 2FJGB 3RNQA 1WBZA 3VD4A 5TFSL 1Q0YH 3LHPL 4MXVE 3MUJA 5E08H 4PS4L 3UBXA 5D1ZB 3HMWL 2PNDA 5DK2A 5M7QA 1IC4H 2D0HA 2BSSB 4JFFB 3AUVA 3GSRB 4G8GB 4EI6B 1O0VA 4ZUTB 2RAMA 3OAZH 4XBGB 5J56B 5IOPB 1WCBA 5M94B 1KJ3L 4FQXD 1BD2A 5TF0A 1DE4B 1MCOL 3BD3A 3RZCD 2JCCE 2BJMH 2P47B 3RJQB 1GPOL 5F7KC 2Z93A 2D2OA 4PRIB 3RGVA 5ID0A 1NJ9B 3GIVA 4YHML 2R2HA 4XVJH 5F9WC 1S7WB 2F5AL 4FN0A 1W72H 3BKJH 2EXWD 4N0RA 3FT4B 2I60L 2IPKA 2H6PA 4MS8D 3U0TA 5K9JH 2NXZD 5A40E 1NCBL 2VDML 4UMGA 2ZCLH 5D6DA 4OCWH 3IKKA 4Y5XB 4IDJL 4HH9B 1MLCA 5FKAB 5DD5H 3IB4A 4I3RL 5DC9B 2OL3L 3V6FB 1FORL 1UB5A 2WWMC 4MMZC 4NO0A 2P5ED 1VADB 1IMHC 2HMID 4XNUL 3T65B 3ZKQD 4F3FB 4HZLB 5LCVH 3WEXA 1JYXA 1JIBA 1TJIH 3HAEG 1UCBH 2CRYA 1W0VA 2MSPA 1NKRA 5GS2H 4ESKA 2CUHA 4UDUA 3ES6B 5EFIA 5MENA 4POYA 4HUWB 3CMOH 2UUDK 4NWUL 3IDJA 1N0LA 3P0GB 4KKAD 4M8QB 4LPWA 5EN2B 3QEQE 1HI6A 4U7MA 1YYLH 2X4QB 2GT9A 1M6OB 4WTWA 1JJUA 3UDWC 2GJ6D 4NUJB 4P3WA 32C2A 4G8EB 3VXSE 3K80A 4KTDL 2DQIL 3VFTB 4WFEE 3DRQB 4FXGB 2DQCH 2VRAA 1T20A 4I1NB 4RGMB 4Z7UF 5F7LB 1PYWB 1HXMA 1KPRB 4APQB 2R1XB 1HQRB 4TSBH 5GHWL 1KUMA 1U8HB 2P43B 3TCLB 3JWDL 3KG5A 4Z8FH 1G7MA 1LO0H 4P9HH 5ELIA 3QFJE 3MLUL 5KW9L 3AREA 5E8NB 3KPSE 4TSCH 5HHOB 1JHKL 2V5RA 3BPLC 2BY2A 4PJEF 2Y5EA 3BRGC 5DUPH 2AEQL 2HJFB 1K8IB 3VMOA 4U1LB 5JXAH 4O9HH 2V6HA 1YJDC 4XNMB 3O4LB 3U7YL 1IGMH 1D5BB 3BSZH 1KB5A 4WEUD 5ECJE 1BZ9A 5D9SA 3LEVL 4EQ3A 3IDGB 2A6DA 1KELH 4DVRH 2EDWA 2NYYD 1MCFA 5DHVB 5FF6B 3CFEB 3BZ4B 3G5ZB 5CJQH 4M6OL 1PW3A 4LSPH 4YX2L 5LVEA 4GAGL 1B6DA 1CF8H 5HYSA 5IHUL 4LGRB 1B90A 4LSUH 5D2NE 1H0DA 4YDLC 1BVLB 3K2UH 3ILPA 5D7KD 1KFAH 2JTDA 4A2MA 3MREA 2NX5B 3W2DH 1W2KT 4S0TD 4N8CH 7FABH 2AEPH 4PJ8B 3F7YB 3MMEA 1QEWA 4XPTH 1UZ8A 4YHYB 3V2AR 2XFXB 1FNEA 1CXIA 5C07D 2DJUA 3FFDB 5F44A 3GJEB 1ZT4B 2KZWA 3CMGA 5LGHL 1QP1A 3MBXH 3O8XB 1LNUB 3ZLQC 5C8JB 4MQXC 2X4NA 5E7BA 1NC2B 1PX3A 1KPUA 4GBXC 1TNNA 4KRMB 2NPLX 2MTPA 4ZSOA 4ODXA 2P44B 3TBVB 4LHUB 1E4JA 1JPGB 2P5EE 2XTLA 3STBA 1HK6A 4PY7B 1C5BH 5C0RL 2X1QA 2H1PL 3N1FC 3UYOD 5L2KA 3QIWD 1J8HE 5ANMB 3K2MC 4OCMC 2DM3A 5E5UB 4U05A 2F8VA 3C09B 1S9VB 1A1MB 3I50H 4IRJC 5E56A 2QTEA 4NZTH 3EHBC 1I8KB 3WFHA 3PNWB 4OTXL 5GS1A 4RQQA 3IFOA 3FB6A 4XX1E 3HNTL 2GJ6E 4P3CH 3LKSA 5FUCE 4PRID 3PQYB 4OJFL 4I18B 4UQ3A 4AZ8A 4M5ZL 3HB3D 1F6AA 1IL1A 3J7HA 4JZNA 3RP1A 2J8HA 5I76B 3NGBC 4HLZG 3VXPB 4GW4B 4C54A 2DM7A 4PTUA 4G8FB 2HKHH 1P7KA 4MD4A 2BFVL 1NAMH 3B2VH 1XF2A 3UO1H 5EIIA 3L1OH 4P23B 2CRZA 3C60D 5E95B 3K7UA 1A7RL 1PG7H 3GSOB 5ACMA 4Q6IB 1A6PA 2AJUL 4OM0H 4W68A 3IDYB 5HVWA 3NZ8B 2AGJH 2DYPA 3S96B 4KAQH 2Z91A 5F6HJ 3VFMA 2VL5B 3WL9A 2DL9A 2J88L 4N8VA 3MCLL 1NEZG 1ETZB 3N1GC 3Q0HA 5D6DC 3UTTA 1JFQH 4FQIL 3CFBB 5CAYB 5HPOA 4PJCA 4UOW1 1U8NA 2XPGA 4XCFH 2X9WA 3VXRD 1A4JB 1NUDA 5D7SL 5CBEB 3SKNA 3GIZH 3T2NL 5EWIL 1ZLSL 4YZFE 5CEXB 4C56A 4R7DA 1MHCB 5KSUA 1IEBA 3FN0H 1DQML 4U1KB 3BUYA 5E9DB 2I24N 1NCWL 1FNSH 5DJYB 4WW2B 2ICWI 5EOCH 3DGGB 4LLWA 4M7ZC 1ZLUH 3CAFA 1INEH 4ZOEA 5D7KE 3FRUA 4KK8D 1D7FA 2ITCA 3C2AH 1OGTA 4RIRB 2IGFH 1DZBA 1CFQB 3BPOB 1A6UL 3PGCA 5D7JB 4DN4H 4ELMF 3C5ZB 1RJYA 1Y6KR 5CJXC 1EO5A 3SDCA 3QRGL 4PJHA 4DKEL 2AP2A 1ED3B 1I7RA 3ROLA 1CGSL 3L5WB 3JV4A 3SQOL 2IH3B 4YBLB 1IGFH 3LKQB 2R0WL 4FS0A 1LO2H 2H2PD 1A7BA 2C1PB 3O2DL 3EYOA 5FA4A 1YNLL 2GQHA 1IC7H 1QKZL 3O4LD 1G9MH 2OP4H 3SDYL 1OGAD 2FJHB 1Z9SA 4LRNL 4MAUH 4LL9A 2J3SA 4TVPD 2EDKA 3Q2CA 3PP4L 4DAGH 1CFNA 3ZT7A 5HGHA 1CXFA 5FK9A 1WSST 4U6YA 4LVEA 3OXSA 4ELKB 3CXHK 1UM6H 1RD6A 1MRFH 4MNHA 1OSZA 3T0EC 2C1OB 4FQLH 4I0PD 3FN9A 2QQNH 1RUQH 3DV4A 1NC4D 1AGCB 4HCRH 3AMKA 1S9KC 3FOMB 1PGRB 4HEME 2BP3A 4NQXB 4PRIE 4NZDA 1GAFH 3GMRA 2BCKB 3QDAA 4HJJH 3MR9A 2BNQA 2NZ9C 1U8MA 4RGNC 3FQNA 1YY8B 1AGBB 1BFVL 1OLZA 2NX5D 3OX8A 2GUOB 2RHEA 3BIBX 3C6SA 3KHOA 3VH8G 3FZUC 3MGTA 5GGSB 2Q3AA 1UXWB 4U0RC 1AGFA 5BO1L 3PABB 2BSED 2BSRB 5GGVL 4BFBD 1A3RH 2ITDB 5IMKA 4PRHD 3QH3A 3TYFB 3NFPB 2FIKA 2DI7A 3P0VL 3O8XD 4C83B 3CLEL 1CBVH 1NC2D 2OQJA 3H8NA 5C0CA 1G7JA 1F4XH 4HFUH 3WBDA 4P9ML 2P7TA 1XIWB 3EAKA 5DRZA 1X5XA 4PJGF 2Q8AL 4G80B 1QLFB 1YNKH 3RL1B 3HG1A 1EERB 1V05A 3OKLA 4W6XB 1VKXA 1JNNH 4M03A 3VXRE 2VLJD 2A74A 1JYWA 2HH0L 4ZUSA 5F3HA 4CVZA 4OZIA 3G6JE 2QEJA 4I77L 2ENSA 2JKXA 4TNVF 2AXJA 4QYOA 2Z0BA 3HZMB 3ARQA 5T1MB 1KJVB 1UJ3B 1U2CA 2DQJL 4L4VB 4X4YB 5BZDB 4ONHB 3HR5B 4F57H 4KRLB 5HYIA 4L4JA 5CINH 2OR8A 4JREB 3CVHH 3MRNA 3GI8L 5F96H 4M61B 1LP9E 5BVPL 4XBEL 3I9GL 5KS9A 1MCCA 3ALWA 1JV5B 5FO8A 3D3VD 3VFUA 3DX9A 2PO6D 3N9GL 3QUMH 5K9QG 4KDVA 4YWGL 4PRBB 4L29A 5HVHC 3D9AL 4W81A 1FPTH 4PJEA 5DRXA 1UENA 4HMDA 3JUZA 4ERSH 1SEQL 3B9EA 4YXLL 4FQQB 3VDCA 2ZG2A 2YA1A 5CHNB 2Q6WA 1ERNA 3EYFB 1CFTB 5C0EB 1Z3GH 3F7RA 4YEFA 5ILTH 5LWYL 5LGKA 3L7FA 3P40A 3BP6B 3NIDE 1F90H 4K7PY 5IESL 4DUXA 3O4LE 2YN5A 1OGAE 1B4JH 2QKIA 8CGTA 1FP5A 4TVPE 5B39B 1CDUA 4JG0H 2E9IA 4Z7QF 5GSVB 5INCA 5T5NG 2NTFA 1WAAF 2DRUA 3KPQA 1GGTA 4F37F 5I1HL 2B2XH 4ONFL 4LF3B 4LLYA 4UBDC 4OIIH 3VA2C 5C9KA 2HFGH 1MHEA 4DQOH 3C6LC 2UVFA 1R3HB 2DLFH 5J1AA 2EC8A 4KXZI 1MCPL 4R9HA 5BQ7B 5E9DD 2UUDH 5FYKU 4HQQL 3GMNA 4WHTA 1I8MA 2YK1H 4KROB 4HWZA 4OQTH 1ZEAH 3WS6C 5C70A 3GSNL 4OF6A 1YN7A 3PG2A 3TIEA 4CJ1A 3HC0A 1KCUL 5ETUB 2NX5E 3EO0A 3LVEA 3RUGF 3OR7B 1U8QB 1B3JA 1WEJL 1JYNA 2FHFA 4E5XA 1A5FL 4NQDA 2EIZB 1AQKL 1QPPA 5HDLA 2A83B 5SWSD 3WFEL 4RFOL 2UY7A 4PRHE 3VXQA 1X9QA 3ARDB 3WNPA 5J13C 1MIEH 3RWEB 5DC0A 2UV3A 4LCIL 4HT1H 1R3KA 3CFCL 4NUGL 2P48B 1TMCB 3QO1B 3KNBB 5CUSL 3IFLL 1ACYL 2X1OA 3O11A 4H5SA 1F11B 4Z76B 3VFRA 1KYOK 1R0AH 3KVQA 3OAYK 3OMZA 5ANME 3REWB 2VDRH 4LVHC 1OCWH 2DQDL 2DTMH 1IAOB 2FZ3A 3QCVH 1DLFL 4TTDC 3ARWA 3RWIB 2VLJE 3F6IA 3DO7A 1CGYA 1HIML 3T4AA 1ONQB 4N5ED 5JW4M 4MDJB 2APWA 2K3TA 2NY1D 4J3XA 5GQBA 5BS0A 3PL6D 3RTQC 2O5XH 1DBKH 4JKKA 2YD4A 4LPUA 1FRGH 1QD0A 3QUYD 3JWDC 1N5AB 2DIBA 4LNVA 4R97C 5IJKA 2F54A 4FOMA 3Q6FB 5DJZB 3GSXA 4X9GA 2GIYA 3D3VE 3DX8B 2IPUG 4YE4L 2MMXA 3BPNB 4LRIA 2CR6A 5C0GA 3WIHH 5I16B 4XCYA 3ULUD 4MD5A 4BSWA 4QXGL 1MUJB 5C0DA 1WWWX 1QSZA 1D9KD 3NPSC 3WFCH 2FATL 2ICEA 3LKOA 1H3VA 4JHWL 4NJAH 1D6VH 3MRPB 3CFKA 4NJ9L 2VDKL 5B8CB 4WFGD 1PX4A 2D7MA 1XIWD 3D2UD 4OB5H 1N3NA 1FDLH 3P4LA 4P5TA 2CKBL 4Y4FD 3LKNB 5J6GA 3BWAA 4K8RC 4C55A 2EDYA 4JFXA 3UYRL 1NPUA 5JOFA 4UIMB 4BZ2H 1A02N 4MGXA 5EORH 2AJSH 1J05B 2OMNA 1CD8A 3PGFH 3X13B 1P4BH 4LAQL 1FGNL 3IJHB 2I9TB 1T3FA 4JZOA 5IFHH 3RY5A 3KYOB 3H3PL 1JCKA 5I1GL 4WCYL 2DI8A 4HEPG 5DVLA 5E1AB 1VHPA 3B5GA 5E9DE 2DB8A 3NABH 1YEGL 3DUHA 4TUJA 2VDQH 4PP2B 3RDTC 4MXQC 1CL7I 4JO3L 5KSAB 4NQCD 4MXWL 1I1AA 3MRKB 3VCLA 3TJHC 4Y1AB 3OKDB 4NKOB 5HVFB 2WQ8A 3ARGB 5D5MF 4FP8H 5IBLC 1WCQA 4FABH 2M1KA 1RZJL 2H9GA 2H26B 4Y5YB 1JGDA 3NAAH 2CLVA 2JIXB 1BVZA 5SWSE 1QLEL 3QNXA 1UGNA 1ITCA 4OT1L 4HIJB 1NCCL 5DEGB 1NCDH 4XP1H 3W5NA 4QRSB 3DTXA 3TWCH 2XYCA 2I25N 1FL3B 5D7IA 3DECA 3O3EA 2LV4A 4F2MA 3O6KH 2YMXH 4ZOBA 1LEIA 2N7BA 1IEHA 3STLB 3UJJH 4XP4H 3LHPH 4KRNA 1HKLL 4YLQT 4ZAKC 1TTUA 4KJYB 1GOGA 3MTRA 2ZSVA 4WI6A 3L3OA 5FOJA 4HX1A 4PS4H 3HMWH 3DUSA 2GAZA 1VPOL 3V4VL 2NLJB 5FGSA 5DYOA 2A38A 1IM3B 3ORJA 2YHGA 2VH5H 4IOFD 4P46A 1IAII 4AG4L 1G7LB 4RAUB 3U46B 4KTYA 5DS8A 5KVEH 2HVJA 5FV1L 3S37X 2W9LA 3MROB 3HRPA 4M00A 4OD1L 2D0FA 3RY6A 5I1EL 3UC0L 1TQCB 3OB0K 4X98A 2VDPH 1KJ3H 4Q9RL 4WI9A 4F58L 3MJ6A 1M05A 3MJ8A 2OK0H 4O58H 3V0VA 4MDIB 4RMWA 1K4DB 4PJ9C 5HYEA 3MZGB 4M62L 1RZKH 4M4PA 3ULUE 1MRCL 1JMXA 3ARDD 3Q1SL 3VE0A 3P30L 2P24B 4A6YB 1I85C 3U6RB 3WJJA 1O7SA 1NCBH 2AJXL 4PJGA 1L9NA 5J89A 1GXEA 2F19L 4WFGE 1R5VA 4G9FB 3MLVH 4QNPF 2ZWLT 4RAHA 4Y4HB 2YEZA 4NSKB 2ED8A 1FYTD 4LPCA 1OTUD 1QFOA 3IETA 3HN3A 4HUUB 4I3RH 4OV6F 2F8XC 3THMH 5C0JB 1HILA 2HFEB 1XGRA 3BO8A 2GEEA 12E8L 5AUMB 5I9QB 5F7HA 3NFSL 1RU9H 4HGWB 1SJEA 3W0WA 1JN6B 2OL3H 1QA9A 4KDTA 1FORH 5EU3B 4UDTA 3FT3B 1FVEB 5EUOB 5E4IA 3E2HC 4UV4L 5HPMB 2YC1B 3DIFB 3KYMB 5FECA 1G6RL 4WWKB 4MX7B 4L4VE 3CLFH 1IC5L 1U8PA 5GRUL 5CGYC 5DO2D 1WLHA 1G7PA 3NCMA 5TF1H 5EO1A 4G6FB 4NO3A 2Q1EA 1U42A 1ZT1A 4NWUH 1QO3B 1XF3A 2YBRB 5HYSG 3OXRB 1CDHA 3VGAC 1JNJA 2X4PB 3UX9B 4NQCE 1DVFB 4CNIA 1KT2A 2BZDA 5JW5A 5K9OB 1NAMA 2G75A 2FHBA 4R90L 3EYUL 4M48L 4PJIF 3C8KB 3ZDYE 2VLLB 3VXNB 2VLKA 2J6EH 2VABA 5HHVL 4PGDA 4FFZL 1ZHLB 4O5LH 3U0WL 5T1LD 3IJSA 3NA9L 4XBPB 4QHLB 2IMNA 5IW6B 1EEZA 3MLZH 4UILL 4XAKD 1KULA 3Q5OA 4AEIH 3S97C 3HHRB 4Z5RA 4R6UA 2YD1A 1YA5A 4RDQG 3WDHA 3GO1H 4I0CC 3ZTJG 2H3NB 4LRIC 1SYVA 4HWNA 5EBMB 3PWUB 2ZUQB 5H35A 4WUKH 4NRZA 5FDWB 3I75B 1NFKA 3MJ9L 1LHZA 2P8LA 4S1QL 3TBYB 1EZVX 3IRZA 4MVBD 2LAGB 1TXKA 1BF8A 3NIGF 3T4YB 3U7YH 5DURB 2FGWH 4P5TC 2DN7A 4Z0BL 3SN6N 5J11C 1T6VN 1CZ8H 1RUPL 3LEVH 4YJZL 1D5MA 3HI6H 4Z95L 4JKLA 1A3LL 3X3GH 5FYKL 1OF2B 3OQ3B 4NNXB 2VQ1A 2VZTA 2D7OA 2BK8A 3D39A 5IHUH 1IARB 4EI5A 2AQ2A 2EH7L 4JE4B 4F7EA 3DYMA 4PY8J 3A6OA 3IDIA 5F3BB 1EK3A 1H8NA 3WO4B 1QYGH 3BZFA 5HGAB 2WP3T 2VUOA 1DN0B 4OF7A 5DJAB 3BRDA 1I1AC 2FL5B 5DEFA 5C1MB 4QXTB 2OXGA 3WE6B 5DT1H 4YNYB 2AQ1A 2IEPA 1FYTE 5DJ2A 4IHOA 1JNHA 3FKUS 3ARYA 2WANA 2Q8BL 2OBGA 2VDLH 1RHHA 5ENWB 3GB7B 5BRZD 1ZHKA 1MJUH 2BNRB 5MEOB 1OOAA 1YMMA 5I1IH 3VFSB 3CCHA 5CD3B 3GM8A 2X4OB 3QUZA 5JUEH 3MJ7A 4P2RB 3NVQA 3QIUA 4HCRA 2YD8A 3M17A 2R0ZH 1X7QB 4K7PH 1CI5A 4GUPA 5K59F 3IXTB 5FA3A 5DA0B 1Y6NR 2WLZA 4OD3H 3V0AC 3QAZC 5I18L 4JPKH 3CSBA 5ESQA 4MZ3A 4K9EH 1FZKA 2I07B 2XY1A 4MQ7B 3KYNA 2WMPA 1UB6A 4KWUA 4KZDL 4P46C 2A9MH 3VXOB 4CADB 5FHBL 4HF5L 1T1ZA 4TUKH 4OM1L 4DWHA 3RY6C 4OFPA 5CD5C 1KV3A 2R56L 4FFYL 4XAKE 4MA7L 5CGTA 5AWNL 1OHQA 3V7AE 4G9FD 4V1DA 4UI2A 1OAYH 3CFDA 5L0QC 3B9DA 5EU5A 4Q97A 4UTBH 3QQ3A 4DOHB 4QOKB 5ERWB 4XI5C 4CVXA 3GNMH 3PWPB 2NY2C 3WLBB 3O9WB 4ACPA 5D1QB 1OB1A 2M8XA 4FQJL 2ZCKL 4LKXB 1HXYB 2J88H 1A7NL 2R39A 4M6AA 3HNSH 4P99A 3WJJC 3OAYH 2HFFB 3BZEA 5I19H 4POZD 2R4SL 2BOBB 2DICA 5CILH 3HRZB 3R1GL 4IOSD 4JDZA 5FB8B 1QSVA 3VFWB 4QWWD 4G6FD 4E42A 1P7QD 2KDGA 1BIIB 1YEKH 5D7SH 1AKJB 3AXLB 4KV5E 5JPNB 5KSBB 3HUJA 3CVHA 5CIPH 3ARBB 3L3KA 2X4UA 4LSQH 3BN3B 2AV7A 4I2XA 1DVFD 1P6FA 4HIEA 4DGYH 4S0SD 3FQWB 1S5HA 3OV6A 1A7PL 3GMOA 4D9QD 2Q86A 4WNQA 3TLRA 3GUTB 1A9BB 4P2QA 4JFED 3QUMA 1KNOA 1N5YH 1NCWH 1QFWH 4XWOC 4RMVA 4YO0A 1UWGL 5F8RC 4MD0B 5D7LA 1YZZA 1X5HA 1IAMA 3QA3A 3B9KB 3WSQH 1TCMA 4NKMB 5I8OL 1A6UH 3VWKD 1KLGA 1FGVH 1N59B 2IALB 4Z7VE 3BXNB 3UTSA 3IXAA 3ZMRA 5I1AB 1SHMA 3QRGH 5IHLB 3VW3H 5HHNB 4QRPA 2XI9A 5CJBA 2XZAL 3ULSB 1SMAA 4O2CA 3QI9C 1LMKA 1CGSH 1M71A 1QFPA 1VERA 4XCNA 4XH2A 4ZUVB 3DGCR 4H8WH 2R0WH 4G5ZL 2XXCB 5BRZE 4OLZL 3S5LG 3O2DH 3ZHDA 1SQ2N 3D0VB 1N7ML 5I8EA 1OM3L 3SOBH 3RRQA 2BX5A 3MRLB 4ZFOB 3N85L 4NFBA 5DURD 1JBJA 5DGQA 1KPVA 4HK0B 1BZ7A 5DJXB 2I27N 5F1IA 1FJ1A 4JJ5B 4OQTA 1CXLA 5JOPD 5SV3A 43C9B 5KVGL 3ELAT 1WWBX 4QRRA 3HE6A 1EV2E 3O0RL 5BMFH 4NQVA 1IEAA 1FG2B 4JKPL 2AI0H 3H6JA 1SBSL 4XPGL 3BIKA 5FAAA 4QRQB 3NFNB 4Y8AA 4HUVB 1MQKL 3SDXE 1RK0B 1QBLL 4R96B 4XCEA 2VXTL 3ZE2E 4ETYA 3BKYH 3SKJH 3TEUA 4XVTH 2J8UB 3IDMA 1NEZB 3MLWL 5ISZA 4PJ7B 1MWAB 5DC4B 4OLVL 4M43H 1DCLA 3NIFF 1T80A 4NQED 4X7TA 4G9FE 4HJ0C 4HV8B 3T3ME 3W11C 4FHBD 4EI5C 1J0IA 1BGXL 3IDXL 2D31B 1H5BB 1NSNH 1I7UA 1I8IA 5CBAB 4PREB 25C8L 4OLXH 5E6IC 3TYGL 1UM5H 1CE6A 3QO0B 3CLEH 4EN3B 4OCLC 2GY5A 3WN5A 2WBJA 1DQQA 1EJOL 2BNRD 3QSKB 1G6VK 4FFVC 4WWID 3E6HA 1LK3L 1HH9B 1L0QA 1FBIL 2Q8AH 3BYYA 4JO1H 5EUOE 1HOCB 2H41A 1FCGA 4LOUC 4P2RD 1KCVL 1QSFD 4X6CA 4RWYL 1NL0L 43CAA 1G9MC 3MX0A 2VXQH 5INDA 1HHHB 2FCBA 5B38B 3GMMA 3L7EB 3QQ4A 1GZPA 3BUTA 5AZEL 5EU4A 4F9PA 5D1ZA 3U0PB 1HSBA 2BMKB 3BEWB 3CX5J 3OKNA 4B0MM 4D9QE 4ZS6D 2DQJH 4YAQA 4JFEE 1Z6JT 4N9GA 3BP4B 1C08B 3QIUC 1CG9B 1QSED 3EIFA 4D0BB 4MAYD 1FZOA 3WIHA 3REVA 2UZYB 3S37L 4G6JL 4JKMA 1M4KA 4LIQH 2VO5A 1A9EB 4XBEH 1OAXL 3I9GH 3PV6B 5CLWA 4UINH 3O45B 4NT6A 1FNFA 4NN5C 1I9IL 1MAML 2WQRA 3N9GH 3VRIB 3H9SA 2O26U 1MREH 1LE5A 1FZJA 1S7TB 2X4SA 2FDBP 3KS0H 5ICYA 4NDMB 4QOKD 4YXLH 1MCNA 1P7HL 4F7TB 3FO1A 3KXFD 1ZT7A 1NFDA 5BW7A 4WV1A 4E41D 3MV9D 3BEVA 2W38A 2CRIA 3U7WL 4P48A 4JM2B 3KJ6H 3QXDA 3G5YB 5DJ0A 4Z7WB 1FVDB 5LWYH 1CFSB 3R06A 4LCCA 3A67L 2DBLH 1NDMA 4UT7L 1EMTL 1WBXA 4U1GC 5IESH 1VFAB 2MKLC 4K55A 2CGRL 5IK3B 5I75C 3LSOA 5HHPB 2I9LA 1A1NB 1KCRL 4Z7NE 1XCTA 5MEQB 2Q76A 3ARBD 4TN9A 3SGEI 5I1HH 5JOPE 1UADC 3TH4T 4MNQA 4ZO7A 2BC4A 3MNWA 2ILLA 3B9AA 5I71B 3RWDB 3U4AA 5J6HA 4Z7UE 1JHLL 3C5JB 5CP7B 4HUKB 4PV9A 4DTGL 4GRWF 3AY4C 3MLTA 1DBMH 4XNQB 3PDOA 3QWQB 2A6KB 4XRCB 3UEZA 4WTZG 1OSPH 1WEJH 3SDDA 2YPLB 3AGVA 1Q9OB 3O81A 3Q48A 1A5FH 4X5XA 1JGUH 4K3JL 5AG8A 4NQEE 1AQKH 4ZTOL 3F7PC 4OZGB 2XWBA 1T66C 2CK0L 4TULL 3MSPA 2HRPL 3FONA 4Y0GA 5DTFA 3EYVB 2B7DT 2R2EB 2NW3B 3CFCH 3BP7B 4NUGH 3I6KB 5C0AA 4WVRA 3K3QA 2BNRE 3BN9C 5CUSH 1T4KB 5EU6A 3X14A 4L3CB 5IR1B 1VA9A 3FO2A 3LV3B 3QPQD 4TNWK 2W0PA 4X4XB 2BNUA 2DIAA 5GJSH 5LJYH 2CUMA 3NCYS 1UACH 4P2RE 4YXKL 2B1AH 1ADQH 1HCFX 1QSFE 5CSZA 4RRPA 5HGBA 2HLFC 8FABB 1UWEL 4JDVA 5D96B 2DQDH 4HS8L 2JB5L 2M26A 3FTGB 5IM7B 1I4FB 3IVKB 5D4QA 3TO4B 5IMLB 1A4KA 1NBZA 5E94A 1S7VA 5A16A 1AR1D 1JUFA 4U1NB 3WS3B 4XMPL 3H3KA 3LQZA 4XXDA 2AAVA 3CUPB 2VL4A 1Q1JH 4B5EA 1BF2A 4WI4A 3PHSA 5IB3B 1GGBH 1QSEE 4L4TB 3L95A 2YD5A 4WEMB 1FL6A 1DQDL 1H15A 3BDXA 4OUUB 4UT6H 5C9JB 4MWFA 2VZ1A 4Y2DD 1GC1H 1AFVL 3IU4L 4KUCF 1U8LB 1B9ZA 3HE6C 1U6AH 3EW3B 1OTTD 4GKZB 4YE4H 1CICA 2MQ0A 1KIPB 4EUPA 4MJ2A 1CGVA 4PJDB 5CZKA 3AU1A 2IWGA 4QXGH 2W1NA 1EEQA 4DOHE 4QOKE 2FATH 2EDDA 4EN3D 2E7LC 3KXFE 3PGDB 4OCNC 2PETA 4BH7B 4E41E 1XZ0B 4H26B 2VDKH 3MV9E 1JPSL 3C5SA 4OLYL 1RK1B 3FO9A 2ZOLA 2HTLD 3AC0A 2OL3A 4Y16A 3RAJH 4KDWA 4K7FB 5CP3H 2VE6A 2CKBH 4RGOL 4PB0H 3OAUH 1QNZH 2GKIA 4JN2A 1CYGA 2R9HC 3SGKC 1KEGH 3EFDL 2XWJA 1C5DA 2WIMA 3GKWL 3WN5C 1JNLH 1WUNT 1PKOA 1I9RH 4LAQH 5DUBA 4ODWA 5D2LF 4HKXB 5M95B 2VDNH 5TGBA 4ETQA 2Q7YA 3H3PH 1MLBB 2HN7B 2AJZB 2J6EA 5C71A 5EPMA 1IM9B 3BP5B 4I8DA 1FO0H 1U95B 2CD0A 1NGWA 3V4PL 1G7QB 4JO3H 4N0UA 3MXWL 4F9PC 3RQ3A 1AXSA 3UTOA 5D1ZC 1YEFL 2C3GA 1J1PL 3QNZA 5E8DH 5KANI 1RMFL 3IGAA 2I5YH 4HS3B 4LQFL 1EVUA 1S9WA 1QLEH 3B6SB 4XPAL 3ZSTA 5IQ9A 2O5YH 3FQXA 2A77L 15C8H 3LN4B 2XQYK 5MHSD 2DTSA 1BBDL 5EUKB 4HAGA 2YWYA 3QFDA 5JDSB 1GZQA 2BVQB 1RFDH 3IKCA 3G5VB 5DQ9B 4J3WA 3WXVL 3WKML 2IAMA 5DFTA 1GVIA 1AP2B 3CDGA 4HDIB 4M7KL 1X5FA 1WIOA 5EA0L 2AXGB 2VL5A 5KG9A 2LU4A 4NNPL 1C5CL 4KTEL 4DCQA 3KDMB 1FAIH 4JRXB 2DDQL 3ECBA 4RAVA 5MP6L 5BW7C 1XGYL 2IF7A 2IFGA 3CXHJ 4GBXB 1X5JA 4PRAA 3TZVB 1N6QL 4MCYB 4KH2A 1G84A 1YPZA 1A6ZB 3VFNA 1XGTA 4WI2A 4LCCC 2P45B 2ATPB 4WHCA 3K8LA 3X17A 4PJFB 5DDHA 4HS6B 3LDBC 1IBGL 1RUKL 1AD9B 2DD8L 1ORQB 3MUHL 2E7HA 4OD1H 3CXDH 4H20H 3RNQB 1WBZB 1TPXC 2J8UE 4ZD3L 3TV3L 4HUXA 2YPLD 4P59L 4CN1A 2WW8A 4X9FA 3CK0H 4M6NL 1F8TH 5GISH 3UBXB 5DK2B 1F4HA 1YEEL 5FCUL 5JR1L 4HIXH 3EUUA 1KBGL 5AEAA 5GJTH 2W0LA 5MERA 3MOQA 1X5LA 1WCBB 2JJWA 4H1LH 4ZPTA 5T1KA 2GSGA 5TE6L 1QLRA 2Z8SA 4MXVF 4ZTPH 1BD2B 3MOAL 1YYML 1EUTA 1O5DT 5EU7E 3D25A 2P42B 4XZUA 4D9LL 3L5WA 3VGBA 3ARFA 2YKLL 4RGMC 3K46A 1XCQA 5C0FA 2Z93B 3RGVB 5ID0B 3EJZC 3GEWB 3GIVB 1WICA 1DQLL 2R2HB 4L5FL 3BQUA 4LSRH 3EJYC 2R0KL 3P73A 4APQC 4NC1C 4DFHA 4FQCH 2ZJSL 3VXUA 2IPKB 3EGSA 2H6PB 3U0TB 2WWMD 2CO7B 1G6RH 4G7YH 4GMTL 4YHKH 2NR6C 3ARTA 2JCCF 3VGHA 1Y6MR 1P2CA 3JXAA 3FFCD 3IAQA 3GRWL 4DKFL 1MLCB 5HYQA 4L4TD 4M8VA 4F7CA 2NCMA 3TESA 3DURA 1ZLWK 1NGXA 2V7HA 2IFFL 4G6KL 3NCYP 4GFTB 1GGYA 2IC2A 3H9YA 4LEXL 4U49A 1EHXA 1UB5B 1ZA3A 4R90H 4NO0B 4M48H 4U0QB 4TSAH 3BPCA 2QSVA 3VRJA 1Z2KA 3ZDZE 5J06A 2C3VA 4KPHH 2DAVA 3WEXB 3UZVB 1RZKC 4M7ZB 4GW1A 3FB8A 1S7SA 1S7XA 1W0VB 1B2WL 4UDUB 3V95A 5EFIB 1BLNA 5MENB 1CFVH 5MHSE 2F8OA 2BVPA 2CRMA 3IDJB 3LQAL 2X4RA 4Z7WE 2OTUA 5CCKL 4ZFFA 3O6ML 5HBBA 1HI6B 3TF7C 1U3HA 2GT9B 1CICC 5I1CL 3PP3K 3PHQA 1EGJH 32C2B 1CTOA 3BW9A 1P69B 4CU8A 3WCYA 3MJ9H 5HD8C 4PJ8C 1EZVY 1T20B 1AI1L 2NW2A 1HZHL 2VXSH 3HMXH 4YHYC 1D6EA 2QHRH 4MYWB 1I9JL 3FMGH 1HXMB 5CIPA 3UXFA 4HPOH 3H42H 4Y16C 4Z0BH 1G7MB 2XN9D 5HHXL 1A21A 4RX4A 4PUBH 4Z95H 3AREB 4L8SA 1IGIL 4YDIL 1A3LH 1KTDA 4RFEA 3LS4L 3VD9A 4Q9QL 2YPLE 4J2XA 2NY3B 3EDEA 1TTGA 3RHWK 4JR9L 4GS7B 2ARJA 2DLHA 3JZ7A 1KB5B 2AEIT 3S4SA 1RQ5A 3L5XL 2UZIH 1BZ9B 4KXZH 5D9SB 3TN0A 2R8SL 5J3HC 3SDAA 2VDOH 2A6DB 4QKXB 4YH6A 5DVMA 3ZSSA 1Y18A 3WUWA 5IVOA 3O2DA 1OPGL 4WRLA 3PWVA 4U0RB 5JLZA 2XWTA 4N8PA 4Z7QE 5SWZA 2PW1A 4JFYA 1CDJA 5HYSB 3DSFH 3EYQC 1BOGA 2DKMA 1H0DB 1MHPL 3ILPB 4PBVC 4MQXD 4OLWL 3U2SA 3MREB 4GBXD 4P23C 3MMEB 1DSFL 1QEWB 4PLKC 5C09D 5ITBH 2Z31A 1UZ8B 3GBNL 1LEKA 1FNEB 1ORSA 3IDYC 1DL7L 4NQTA 4KQ3L 1MRDL 3DRTA 2AVGA 5DVNA 1YQ2A 3K8KA 1FVCA 3MRRA 3RUGE 1RURL 4L4TE 2X10A 4IRJD 2A2QT 3QWRD 2X4NB 4NFCA 5E8EA 1EXUA 1F2XK 1KPUB 4BSVA 4ZSOB 6FABL 3RNKA 3HFML 3QEGL 4ODXB 3HS0A 4NBYB 3WIIL 2X70A 4PJDE 3OG6B 4GG8A 5FHBH 5FGCB 3RWHA 3VGDA 5L2KB 2J8OA 4JRWA 4DKDC 2EYSA 4OCYL 4L8BA 3M8OH 4MB3A 1U8QA 4JANA 1M7IA 1JGEA 3SCMA 2AV1A 4WFHD 5B4MC 2G60H 5AWNH 3DETC 3N1PC 2VITA 5BV7B 3WFHB 5GS1B 5TQ2L 5C6TL 4RQQB 3IFOB 2EXYC 2Z9TA 3FB6B 3FHQA 5HVHB 2DLTA 4UOW0 4ODHH 1P5VA 3LKSB 4MA1C 5CKGA 5ALBH 4UQ3B 5E6ZA 2PW2A 4FQJH 2VKXA 1F6AB 1IL1B 3OJVC 4JZNB 5D7JC 4XC3H 1E28A 3VXTA 1IKNA 3C5ZC 5DD1L 4KJPD 3AMLA 2X09A 3RZWA 2X6MA 1V7ML 1X4XA 4PTUB 3O6FA 3ZT5A 1P7KB 2QR0A 4MD4B 5C6PB 5EIIB 1FLTX 3I3DA 1C12A 3VRLE 4X6DE 3ARFC 2XN9E 1VEPA 4BQCA 4JFPA 5I1DA 4ZNEE 4KZEL 2PR4L 4YBLC 1V3MA 2NNAA 5I8CA 1JF5A 1K6QH 4KVNH 2DYPB 3GK8L 1IZKA 3N50A 2Z91B 1LGVA 3VFMB 3WL9B 2FR4A 4OCSH 2LVEA 5F6IB 3IAGC 3ARUA 4N8VB 4LLAA 3LZFL 3MA9L 2AW2A 5DI8A 3UTTB 2JK5A 4F8TA 3CPLA 5JIKA 4PJCB 3EOTL 1U8NB 2XPGB 5F97E 5CMAA 1Q0XL 1KN4H 1U93A 4LVOC 3SKNB 3MLSL 5ADPL 3MLPA 5E2WL 3K74B 2R0LL 4MJ5A 4JRYD 1MAKA 4C56B 4XXCA 4BFEA 2V17L 1CL7H 4R7DB 1IEBB 1R5IA 2D7QA 2MQCA 5CEZD 3BUYB 4TVPH 3V5KA 3MRDA 3G6DL 4KJQD 2B4CH 4G9DA 4GH7B 4G5ZH 3DLQR 1G0YR 4LLWB 4JRXE 2QQQA 1YQVH 1LO4L 4JFDD 3F65A 3FRUB 2ITCB 4QTHA 1OGTB 3MNVA 4ZOCA 1JMZA 1RZIA 1VGEH 1WV7T 5JW3L 3G5XA 3PGCB 3MV8A 5C09E 4AMKL 4PYGA 4YZFF 5GRWA 3O2VH 3FL7A 3QDMA 3TBTA 1RJYB 1FFQA 4MSWA 3K4ZA 3SDCB 3EDJA 4PJFE 4J4PD 5HYJD 4PJHB 5IT2L 4LVHB 1RVFH 5JMOC 1C16A 2VXUH 1FFOA 2E6QA 1I7RB 4JHZA 4QCIA 3ROLB 3WD5L 3JV4B 3O0RH 2EEBA 3BGFB 4YHIA 1U58A 2C3WA 3T0ED 3I2CL 3EYOB 4KMLB 5FA4B 4XPGH 1JPFA 5K9QI 4X9HA 5GGQH 3QDGA 3IDNA 5IVXE 5GGTL 2VXTH 4EIGB 1KJMA 2NZ9D 4RGND 4NQUA 1CFNB 5HGHB 1A6VH 1IAIH 5FK9B 4JFOA 4OLVH 1T1XA 3FZUD 4KGLA 4R97B 4U6YB 4WFHE 3OXSB 4HW6A 1UJ3C 3T0XA 4YPJA 4OFDA 4MNHB 1JK8A 1IJ9A 1E6JL 1OSZB 4G6AC 1HKFA 3UJIL 3VDAA 1EFQA 3DV4B 4JREC 4RA0C 1ADQA 1KF9B 1FV1A 2NY5L 1MI5D 3GMRB 1NCAL 2ZUWA 3NPSB 3QIBA 3MR9B 3WHE0 1EJOH 2BNQB 1U8MB 1D5IH 3BT2H 3FQNB 4W4OA 4H8WC 2LQRA 3SDAC 1I1YA 3BGAA 3OX8B 1V3JA 3C6SB 3MGTB 3VWJA 4LK4A 4MA8H 1AGFB 1SJXA 1CTNA 4AENA 3RBGA 4YBQC 2V7NA 1KSRA 3DBXA 5ACLA 5HDQL 5IMKB 4GW5B 1XF4A 4ODSL 3QH3B 4OF5A 2FIKB 1F3JA 3WFDL 4I13B 3CH1A 2KPNA 2VN4A 5A1AA 5DMYA 1JWSA 1KC5L 2OQJB 5C0CB 1J18A 1UZ6E 1G7JB 4HK3J 4X99A 3NTCL 2Z31C 2P7TB 5DRZB 1YEIL 1FIGL 4I9WD 1U8IA 1FE8H 4QHNA 2YUZA 4KY1H 2FSEA 2EICA 3ZDXF 3HG1B 2EYTA 3TT1H 3OKLB 4OFIA 1VKXB 4NOBA 5IMOA 5F72S 1CLOL 1KEML 4K71C 1LD9A 1KN2L 4LSVH 2A74B 4ZUSB 4NNYA 5F3HB 1I9IH 1MAMH 4YHOL 4CVZB 4OZIB 4Y4KA 3R0NA 1TETL 1J0KA 5CP3A 1FH5H 4KROC 1JGLH 5AYUH 4QYOB 4ZODA 4PFEA 4YHZL 5IHZA 4F15B 2ICCA 5KVDL 3WIFA 4PGZA 1SYSA 4IRZH 3F7VA 4YHNA 2GK0A 3JVGC 4KMTL 3O2WL 1YEJH 3GFUA 5DK0A 1H3PL 4F7PA 3MRNB 2ZUVA 4L3AA 5KN5A 5ESAA 2DQEL 4JFDE 3QEQA 3A67H 3RX8A 3G6JF 5KS9B 3DVGA 1EMTH 2NY6B 3P77A 2SEBA 5FO8B 3VFUB 3RY4A 3DX9B 2AKRA 4E9LA 1KCRH 2R1YA 3RPIA 4L29B 5GS0H 5F89A 2PYEA 5A2IH 4PJEB 5DRXB 3QXTA 1FO0A 4AJ0A 1CU4L 1RUAL 4ZUWA 5I74C 2UWEA 5IB4A 4PJIE 2Q6WB 2DYPD 1PLGH 5TPWL 1RZFH 5E24E 4UBDD 1GGIH 1LP9F 5C7XH 2HT3C 4KGJA 1LO5A 1LQSR 3C6LD 3T0EE 5IFJA 1JHLH 3IFPA 1ZLWH 3L7FB 3AM8A 4PD4K 1INQA 3QFJA 5IW3A 3UTTD 3KPSA 2QKIB 3K8MA 4C4KO 4NC2B 4LU5H 4LLUA 5JIPA 4EUPG 3T1WA 2XIDA 3X12A 4RGNE 5I1KL 5INCB 2NTFB 2XNAA 4Y8DC 1DN2A 1LO3L 3KPQB 3UJTL 2IMMA 4GO6B 1RPQA 2ICWA 3PE9A 1MCSA 2XRAL 4K3JH 4LLYB 4ZTOH 1MHEB 2FBOJ 3MODH 4ZFOL 5J1AB 3NIDF 5JW4N 3QHZL 4HWBH 3GMNB 4WHTB 1I8MB 3WFBH 1BHGA 3MOBL 3D87B 1CXEA 4HWZB 1MI5E 3NIGE 1YN7B 3TIEB 3PP3H 3HC0B 4R2GC 2QQKH 2WWKO 4W70A 3EO0B 2VTFA 4KUZH 5CSGA 3BIAX 4HC1H 1ZAGA 3TP4A 1LDPL 1FHGA 2GYSA 4JQIL 4YXKH 4LHUG 4E5XB 4NQDB 4F9LA 1UWEH 3M1BA 3V4UH 4JFZH 4HS8H 1T7WA 4KKCC 3VXQB 5B8CC 4WI3A 4OBSA 4TTDD 4S10A 4JPWH 1YNTA 1R3KB 1MWAL 2CSPA 2Y36L 1S7UA 4J1UA 4QGTA 3X3FH 3O11B 5FUZH 5D71H 4H5SB 5CGMA 4MZ2A 5EZJA 3ULUH 3VFRB 4CW1A 3ZYOA 5L2KE 3RTQD 5JQHC 3NZHH 3D85D 1AFVH 2I26N 3IU4H 3S88H 2FZ3B 3HZYB 4H1LA 3DO7B 2ICWJ 3T4AB 4JN1L 3P9MA 3RVTC 3ZKNC 3W9EA 1EAJA 1Z9MA 3S6CA 5BS0B 1HCVA 5KSAC 1T2JA 1DLHA 2BNQD 1SVCP 4PGBA 2ZUTA 5E8PA 4EOWL 2V5YA 1F58H 2OZ4L 4NP4H 2YS4A 2F54B 4Y5YC 3GSXB 4TRPL 4XPBL 5IW1A 1G6RA 3F58L 2GJ6A 1FG9C 2EE3A 4K8RD 3EFDH 2HA1A 2B8OT 4U7KA 5C0GB 3DOSA 5DUMH 5IUSA 4XCYB 4MD5B 4BSWB 4HSQA 1R3IL 4BJLA 5C0DB 3QZWA 3QIBC 5A43C 5F9DC 2ICEB 3LKOB 3RPKA 2D7TL 4XC1H 5FYLL 2VN7A 5J1TC 1UH2A 2HG5A 4OAWA 1I75A 1T2QL 3CFKB 3VWJC 3S3JA 1N3NB 4PJAE 1BECA 2X9YA 4P5TB 1IE5A 5J6GB 4L9LA 3UTTE 3BWAB 5J11B 5GRJH 1HWGB 2N1KA 5HI4C 4JFXB 2W9EH 2DOCA 2QBWA 4YQXH 3RDTD 5JOFB 4HKZA 4EBQH 1MCWW 4MXQD 3FRPA 2JE8A 5JIHA 2KH2B 1ULVA 1DQJA 1GC1C 5KBNC 3L6FA 1ZK9A 2F58L 4LQFH 4O2EA 1T3FB 2ICES 4JZOB 3SBWA 3SQBA 4YFLF 4XPAH 4ZS7L 4JHAH 1AD0A 1EGJA 5JW4Q 2Y07L 4IMKC 4K3EL 3MJ9A 4TUJB 5T3ZL 4LEOA 3TBWA 4U31A 1FLRH 3TM6A 3H0TA 3HMXA 2XV6B 1EUUA 1I1AB 3K81A 3RFZC 3VCLB 3KPTA 5DMIH 5JORA 1VFBA 4RISH 2QJDA 3BAEH 2VOTA 1QHOA 4CMMA 3GHBH 5E2JA 1NCUA 4LLDA 2H9GB 4UB0H 1JGDB 1DBAL 1OAUL 4PJHE 2CLVB 4L3ED 4NNPH 1C5CH 2ZCHH 3QNXB 4WW2F 1XGYH 4ZAKD 5JA8B 2RBLA 4NCDA 5DR5H 3MRJA 2D7PA 3HC4H 4Y88A 4Y4HC 4HWEL 3ESUF 3DTXB 4LSSH 1KB9J 5D7IB 3OR6A 1N26A 3MZTA 3O3EB 5C07A 4F2MB 1IBGH 3T0VA 4OI8A 5I9QC 2P8PA 1JRHH 1MAJA 2AABL 1LEIB 5DJDA 3MLXL 4XCCL 3O3BA 5H2BA 3KLHC 3MRQA 1AXTL 3FB7A 5ICZA 4O4YL 4ZD3H 3PHOA 2YXFA 1NGPH 3QB7C 2ZSVB 3L3OB 4UQ2A 4HX1B 4WWKC 3RWCA 3DXAB 4MJID 5IMMA 5SWQA 2IBZY 2GAZB 3LRGA 4IS6A 5H94A 5J12B 5F6HI 1N0XL 4PJ9D 3AM8C 5JR1H 1VENA 5DYOB 4JAMA 3QIWA 4HZAA 4P46B 5DS8B 1C1EH 3OTTA 2HVJB 4NOFA 1ZANL 2MNUA 3OF6A 2D03H 5E2UH 2BNQE 4PLNC 4X98B 5TE6H 5F1KC 1F4YH 1YYMH 3VI4E 1QBAA 2EDQA 5BZWA 1M05B 2A9NL 3BH9A 3MJ8B 4ORZC 2DQHH 4D9LH 3V0VB 4NQDD 4U4BA 2Z8WC 4L5FH 2YD9A 4XNYH 1EHAA 3C2SA 2NY2B 3FOLA 1A6WH 2UYLA 3VE0B 1TJGL 5IEKA 4BFIA 4XVSH 1A1OA 1MELA 4KFZC 35C8L 3ZL4H 4PJGB 3ABZA 4GMTH 4NZRH 4WU5A 1R5VB 2ZUQC 2Y9RT 3C60A 5EO9A 2YEZB 3GRWH 5KVMC 4DKFH 4F9LC 4JB9H 1BBJA 1X3DA 5JHLL 2GFBA 3IETB 2IFFH 3NIFE 5DWUL 1HILB 1V3KA 2AJVH 1XGRB 2CJUL 5TQ0L 3OL2A 3BO8B 3EDDA 4K94H 5C3LD 1OARH 2GTWA 1SJEB 3W0WB 3S4SG 4RZCA 1QA9B 4F7MA 3RHWF 3GMLA 3QHFH 4UDTB 4M7LH 5FECB 4K23L 2HVKA 1HNGA 2OR9L 2ZNXA 1W8OA 4QXUH 4KHTH 5CJ5A 1U8PB 5H8DA 2HWZL 4QRUA 4EZMA 2Y06H 1G7PB 5EO1B 3VXRA 4NO3B 5C0BA 2ZUXA 1ZT1B 1XF3B 3G6JA 3LQAH 4GRLA 4TUOA 4WGVB 1MF2L 3VGGA 1CGUA 2QSCL 1FFPA 5KS9E 2OTPA 1G0DA 5I1CH 4FQ1L 4CNIB 2IAND 1KT2B 5JW5B 4LMQE 1NAMB 2G75B 3WO4C 4ODTL 2VLKB 2VABB 3UPRA 2WBWB 3EYSL 4PGDB 1L0XA 4WI8A 4L3EE 4OZHA 4WO4D 3IJSB 5B39G 1BEYL 3RJDA 3TPKA 5ALCH 1LP9A 2FBJH 3FT2A 1EEZB 2EEAA 2O5ZL 5GZOC 1OAZH 4R4ND 5C2UB 2FX8H 1KENL 4GKOA 4Z5RB 4U2YA 1NEUA 1MHHA 1LDSA 2P8MA 3WHXA 4P5TD 3U36A 1S5IL 4R3SA 1C8PA 3VXMD 4WY7L 3V8CA 4KUCD 5F1SA 5L2JA 1SYVB 1NDGA 1DBBH 2P5WA 5H35B 4NRZB 3GGWA 3RX7A 4M6MH 4YDKL 4FZEH 4Y19A 3LS4H 5FM5M 4HG4J 4GG6A 1N64H 3R4DA 2ED9A 2P8LB 2EE6A 4QLRA 4D2NA 2MWCA 3V52L 1SM3H 4MJIE 3SGEH 3IFNH 4ZMAT 2AK1L 4GT7A 1YECL 1OGAA 2MHAA 2WINA 1XH3A 4L9LC 2E27H 1LEGA 3CVIH 1D5MB 3H9HA 3MV7D 4CAGA 4HXBH 2HT2C 3I84A 3MFFA 2VQ1B 2ZPKL 3WYRA 3PXHA 3D39B 4I0PA 4OZFH 1N4XH 3RVXC 3P4NA 4EI5B 3NH7L 1NC4A 4KJWC 4QY8A 2OJZL 3ET9F 3SBWC 5KZCD 1AE6L 4HBCL 4NQDE 3V0WL 1TCRA 4F7EB 4LCYA 5F7DA 4ZO8A 5KAQF 4PGEA 3IDIB 5GRZA 5FGRA 4XP9H 3BZFB 4Q0XH 1T21A 3ULVC 4UIKH 3KYKH 1IQWL 1Z9OA 1FL5A 5B3NA 3M45A 5DEFB 5DJCA 4ZFGL 3JV0A 1OAQH 3U4BL 5I2IA 5DJ8A 3O9WC 3E3QC 3OKOA 5D1QC 4PRHA 1RAMA 5DJ2B 4MQTB 4Y5VA 3U83A 4BELD 4IHOB 1JNHB 2OTWA 3WV0A 1FAKT 1HYSC 4KK9C 1RHHB 1ZHKB 4PPTA 2BVUA 2ZG1A 1WZLA 4NRXA 6FABH 4LARL 5H37H 3HFMH 3D1MC 1YMMB 4UV7L 4DUWA 3CCHB 3RU8L 3QUZB 4G3YH 3MBEA 3MJ7B 1P1ZA 3QIUB 3OGOE 4P46D 4R0LA 2QADB 3SY0A 4OCYH 1GGCL 3M17B 2XACC 4GUPB 5BXFA 1MCIA 2VLJA 5CD5D 5FA3B 5EOQH 2FJFA 1R3LA 3E0GA 4TNVK 5FCSH 4UZGA 4NM4H 4NN5B 1L6XA 2F54E 5ESQB 5LXGL 4JO2L 1FZKB 5F7WC 2IANE 2ARWA 2VQTA 2MCPL 2VQUA 3V6OA 2W0FA 3B9KC 3KYNB 4M93C 4EVNA 1CK0H 1UB6B 4XI5D 3ZYZA 2NY2D 4S1RL 5FYJU 5F9JA 4P0DA 5IROA 1JI2A 3JWOL 3LCYA 3D3VA 4KVCL 4V1DB 5L7XH 2PO6A 4M3KB 3CFDB 2LFGA 4WUUD 3DJ9A 4BM7A 3DROA 5EU5B 2NY7L 4GXVL 3VXME 3QQ3B 4D0CA 4CVXB 4LMQI 3GK8H 4U6XA 1OB1B 3LEYH 3DVIA 4PTTA 2EDHA 3BZEB 4OLUH 4DN3L 5JXEC 4XWOD 5TE4H 3OZ9H 3EOTH 4F8QA 4JDZB 2GTZA 1MCDA 5FYJH 5F7EH 1QRNA 4E42B 1JGVL 1KXTB 2BRRL 4LDEB 1FSKC 4BZ1H 3HUJB 3MV7E 3CVHB 3UTQA 3L3KB 2X4UB 2AV7B 4I2XB 4HIEB 4U1MA 1H3GA 4MMXC 3FCTA 5HI3C 1S5HB 3GMOB 2Q86B 4WNQB 3O3UN 4P2QB 1EHNA 2F5BH 3QUMB 1KNOB 5SX5K 3T09A 2YUWA 3QI9D 3ZTNL 4G6MH 1PZ5B 4YO0B 2VIRB 3ESVF 2MJWA 5D7LB 3TNNA 1RZ8A 4ODVL 4U33A 3QA3B 5E2VH 4H0HB 2QQLL 5L8KB 5JW3H 4GRLC 4DGIH 1KLGB 1P5UA 4HWUA 4EKXA 3UTSB 3H3BC 3IXAB 4XPFH 5D7IE 5AZ2H 2Z92B 2ZKHL 4QRPB 5SWSA 4O2CB 1J1OL 3PF2A 4OCRH 1M71B 1P84K 4XCNB 4XH2B 2FX7H 5IG7A 1DFBH 3KJ4B 5E00A 1VACB 3I2CH 3HAEH 4K3HA 5I8EB 3BOVA 4Z7VF 2FX9L 5T5FL 1EFXD 3V5DA 1KPVB 4X4ME 1BZ7B 3AS1A 4HWBA 4I48A 1A0QH 1F3DH 5F1IB 1AH1A 1FJ1B 5FFLA 3N0PB 1V3LA 5CFHA 2V5TA 3GSUA 2X1PA 2XZCH 3L3HA 4QRRB 3HE6B 1MEXL 4GLRI 4HJ0D 3W11D 4NQVB 1DQTA 1IEAB 4HC1A 2HLAA 1MCJA 2Q7NA 2FB4L 3BIKB 5JIIA 1UWXK 3MLRL 3PL6A 5E6ID 1Q94A 2VR9A 2DQUL 3OKEA 4UOJA 1NUFA 2VLMD 4XCEB 2LTQC 3QUYA 1JZ4A 4FFVD 3WNOA 4ZDHA 3IDMB 2JLLA 5ISZB 4HKJA 4UU9A 4LCWD 3MFGB 4LOUD 3A6BH 3TBSA 4X7TB 1J1XH 5KVFL 3EFFA 4WUUE 2K7QA 4ODSH 1JE6A 1N8ZA 3CU7A 1I7UB 1I8IB 1CE6B 1D9KA 2VXVL 3RKPA 1ZXQA 3TH3T 3WN5B 2WBJB 1KC5H 4YIQA 1DQQB 1XGQA 3DI2B 5I66A 3E6HB 5BV7L 1J86A 3D2UA 1YEIH 1FIGH 4PRPD 3HPLA 5FO9A 3T3MF 4Y4FA 4X6CB 3QQNA 1P9MA 1P53A 43CAB 5INDB 1CLOH 1KEMH 3GMMB 3QQ4B 4Y5VC 1GZPB 5EU4B 1ND0A 5I71C 3BKML 1H9VA 1HSBB 1OTSD 5CEYA 4D3CH 1BAFL 4JG1L 1NMAH 5DD3L 3SO3C 1BREA 3OKNB 2IPUK 4YHZH 5EUOF 4YAQB 1GHFL 2ZOKA 4AIZA 3MBEC 4N9GB 2N7AA 5T1DH 3G9VA 4R0LC 1MCLA 4PB9L 1FZOB 3REVB 1RIUL 1IGYA 4NQCA 3RWJA 3IJYA 4LHJB 1JTPA 4NT6B 1ZVHA 3H9SB 1NBVL 3SKMA 1LE5B 3KPPA 1NGZA 1FZJB 2X4SB 2Z35A 5DLML 5ICYB 1QQDA 4P49A 5EB9A 2X7LA 3CDYA 3V6OC 5C08D 5K9KA 2HKFL 3QR2A 3FO1B 2RQ8A 1ZT7B 4HFWA 1NFDB 4I5BA 4WV1B 5TPWH 5FHAL 5SX4I 3BEVB 4PJ5D 4LBEA 4TPRH 1TVHA 3QXDB 5DJ0B 3R06B 3HNVL 4LCCB 1NDMB 1WBXB 4YHLL 5D96C 4JQXA 1UM4L 3LSOB 2I9LB 3LDBB 2IBBA 4OCXH 3CH8A 1MFDH 2WBKA 4PJXA 1AR2A 2DMCA 2W91A 4RWHA 3TO4C 4DK6A 5I1KH 3B5TA 2ZZUT 3Q6GL 1NGYA 4NFDA 1TPXB 1LO3H 1XCTB 1MJ7L 1OP5K 2Q76B 2R15A 4MNQB 1WZKA 5C86A 4PJBA 5GIRA 3M07A 2BC4B 1QFUL 1J8HD 3QDJA 3MNWB 4JLRA 3TGXA 5B21A 4P2QD 1T66D 3QHZH 1T83A 3H7BA 5TDPA 5J6HB 1BM3L 4HLZH 1GSMA 2CIIA 3H2WA 4M7JH 1EO8H 1RULL 3RWGA 2QV2A 4R7NA 4PV9B 5F9OL 4ORGA 5TH2A 4Z7NF 2VLME 3MLTB 5IQ7L 3BN9D 5HDBE 1BJ1J 1MPAL 2W65A 3PDOB 1AO7D 3T8XA 3QCTL 4LFHG 3SDDB 2APBA 3UTSD 5A3IC 4LCWE 3QZWG 1NLDH 4X5XB 2P4AB 4YXHH 4JGMA 2E6PA 2XWBB 4FZ8L 4QRPD 5F7UA 4QXWA 2HLFD 3UTPD 2XY2A 3FONB 5DTFB 4OIBA 5GS0C 2X1XR 1DBJL 4TQEH 1PBYA 3MGAA 5EZLA 5C0AB 1CVRA 2Y36H 3X14B 5EU6B 1CIUA 1A6AA 3FO2B 1CLYH 2D7NA 2BNUB 3BVNA 1IILE 1CLZL 4PRPE 2YSSA 3JSSA 4WJ5A 1FYTA 4UTAH 5J7CC 3H9ZA 5CSZB 5HGBB 2FD6L 4URTB 4JDVB 3CGTA 4H88L 2EKSA 4NYLA 2IQ9L 3EOBA 3LEXA 2BY3A 1A4KB 1NBZB 5E94B 1S7VB 1ZVYA 4O02L 5A16B 1X44A 1JUFB 4NWTL 4LKCA 3LQZB 2BDNL 4OGZA 4XVUC 4X7EC 3WNMA 4XXDB 1L9MA 5DVKA 5ID1A 1L7IH 4K8RL 4AL8L 1I7ZA 3B2UC 3L95B 1FL6B 2H32H 2FGZA 1QTYT 1S9XA 3DHJA 2OZ4H 5D72L 3W5MA 1H15B 1KIQA 2R29L 4MWFB 4WHYG 5IIEA 2EDJA 4XPBH 1EHLH 4J3TA 3MACL 4XWGL 2HAZA 2DQFA 1CICB 2R9HD 4EUPB 1XT5A 3AB0B 3DV6A 3GRWA 5CJOL 2PYFA 3AU1B 5FYKD 1TJHL 1R3IH 3BDYH 2NY1C 3CSGA 3SJVD 5T1LA 2O61A 5C08E 4OF0A 4PY8I 4TYUA 3U1SL 2D7TH 3PXJA 1A14L 4OGYL 1PY9A 5F7FA 1WT5A 3C5SB 1UH3A 4PJ5E 3FO9B 2ZOLB 4QTIL 5J0BA 2OL3B 3N06B 3FO0H 3LD8B 4Y16B 1BFOA 2VE6B 2ADIA 3GI9L 2YZ1A 4JN2B 4NGHL 3O6LL 1HDMA 5E2TH 5L6YH 4BSJA 2XWJB 1C5DB 3TZVC 2R69H 1D9KC 5D1ZD 1J9CT 4DW2L 1L7TL 4I2XE 5DUBB 1MCKA 2ATKA 4ODWB 2F58H 4JFFD 4Q58C 5I15L 4AYFA 4G8GD 1BJMA 1U8JA 4ZS7H 4GOSA 1XGUA 5TGBB 2Q7YB 4ETQB 4P2QE 4QO1A 1CCZA 4J8RA 3TO2A 4KHXL 4I3SH 4K3EH 5C6WH 1P9MC 2G9HA 4HMCA 5EPMB 4EDWL 1NGWB 1C7TA 1I3GH 4NO5A 5KSBF 4N0UB 1U8OA 1AXSB 2WUCL 4GAFB 3U9PH 3QPXL 3HE7A 3QNZB 1TENA 1AO7E 2R2BB 2Y4SA 3H9SD 1JZ5A 3UTSE 1HNFA 2W9DL 1FFNA 3IGAB 4S1SL 3D0LA 3MXVL 2HTKD 1S9WB 1IFHH 4QRPE 2H8PA 1KG0A 3UTPE 4M1DL 5HJ3A 3LRHA 5ABDE 5IQ9B 1RJLA 3FQXB 4PG2A 2XT1B 3O3DA 2DQGL 1AY1H 4NHCH 2PTUA 2JELL 4Z7VA 2EDRA 3QFDB 5LQBH 1GZQB 3B3IA 3IKCB 4JZJA 3RGVC 4PGCA 2EH8L 2IQAA 2IAMB 4U6TA 4ZQKA 3MLXH 3CDGB 4MHHG 3VFPA 1AXTH 1QG3A 1IGCH 5DZOA 5KG9B 3BESR 4DCQB 1WZMA 2CUIA 5BRZA 5D93B 1HHIA 3ECBB 3RIAF 4RAVB 4LLMA 4MNQD 1UA6H 2JJSA 4PRAB 4D94A 4OFYD 4QRRE 1YPZB 4AIOA 3VFNB 1XGTB 1X5AA 1MJ8L 1Q9LA 3BKCH 4OZFA 4QT5A 5FM4A 5DMKB 2WUBH 2XA8L 5DDHB 1XF5A 2ADJA 3LAFA 3GHEL 1ZVSA 3VG0L 3JWOC 3WDIA 1URLA 4O2FA 2X1WL 4YHPA 3OGCA 1DEEA 5SX5H 5ITFA 1Q0YL 5ISZE 1QR1A 4HUXB 1MFCL 1JPTH 5E08L 1M1SA 3EOAA 2E9WA 1I3RA 1T83C 1EEYA 1TVBA 4MA1B 2X41A 3EJZD 4UT9L 3SDXA 5FYKE 3EJYD 4APQD 5B38G 1M7XA 2VISA 4IJ3B 3SJVE 5C0AD 5MERB 1ZKAA 1F02I 1CDYA 4ZPTB 4X6EA 4U3CA 2YOCA 2WIIA 5EU6D 1K5NA 5T1KB 2GSGB 2J8UF 5JTWA 1QLRB 4PJ7F 4GQ9H 4Z7OF 1J12A 4IBLT 4FNLH 2NR6D 1RIHH 3D25B 5HHOD 4XZUB 3ARFB 4X6CE 1XCQB 5C0FB 3MQIA 5DWUH 5FUOH 4B41A 2E6JA 4X7DC 2CJUH 5TQ0H 4JDTH 3BQUB 3P73B 4XVJL 4KQ4H 3MLYH 3MUZ1 3ME0A 3VXUB 2MPAH 4N0YH 3EGSB 4G43A 1HWHB 1T7VA 4XNXH 5K9JL 4JFFE 2MCG1 4G8GE 3AREC 2OM5A 4ALAH 1TZIA 2D4FA 3DX6A 1P2CB 3LRSA 4OCWL 3G08A 3IRPX 1SJHA 5HYQB 1P7QA 4F7CB 1J5OH 5DD5L 3DURB 2E5EA 1NGXB 2V7HB 2NY3C 3DSNA 3CSPA 1MF2H 4LVOB 5IBUG 1IKFH 2WP3O 2APFA 1UWXH 4FQ1H 4GS7C 3KR3H 1YJDH 5F1NA 3HZVA 4EEEA 1CICD 1ZA3B 3H9SE 4LPXA 3UMTA 4JFEA 1T6WA 3BPCB 3VFOA 3VRJB 1TITA 2E7MA 3EYSH 1WFNA 1GRWA 4LPYA 2C3VB 1FN4A 5GS3A 5HD8D 4PJ8D 3ARRA 4GW1B 3FB8B 1S7SB 1TJIL 1S7XB 3OJDA 1UCBL 1NFDE 2YWZA 1BLNB 1YEHH 1DTUA 2Y25A 3VWKA 3MRHA 4LSTH 2BVPB 2WSKA 3CMOL 3ZDXE 2A6IA 5CKAA 1UC6A 2X4RB 3Q5YA 2OTUB 3BYTA 4ZFFB 4GW5A 1U3HB 3QNYA 2V5MA 4X9IA 1CDIA 1YYLL 1F13A 4HHAA 1LE9A 3PHQB 4WEBL 3ZDZF 2PN5A 3BW9B 1YY9C 5F88A 2DQCL 2NW2B 1T22A 4F33A 1NMBL 3KWWA 1D6EB 4LHUD 3S7GA 5CIPB 4K94C 4MNQE 3VU2A 4JM2F 4Z7WF 4TSBL 2BSTA 4Z8FL 3WHE1 1LO0L 4P9HL 1BMGA 5D1XA 1A7OL 4L8SB 3QQ9C 5J3HD 4TSCL 3U4EA 1KTDB 4RFEB 1MIMH 2ZPKH 5DUPL 3TT3H 2XQBH 3PQYD 1J7VR 1T1WA 3F62A 5JXAL 3NH7H 4O9HL 1ZHBA 4MNGA 4Z7UA 4JY4A 2ARJB 1S3KH 5I1LA 1IGML 3BSZL 5F71A 2OSLA 4HAFA 3S4SB 4RMTA 5BV7C 2C4FU 2EC9U 4NC1E 1IQWH 3TN0B 3QEUA 3SDAB 4P23D 5GS1C 5C0AE 1KELL 4PLKD 1Y18B 3WUWB 5EU6E 4DVRL 1P4LA 3HE7C 3PWVB 4H25A 4X8JA 5JLZB 2OXHA 4NQEA 3HAEA 5CJQL 1VEOA 2XWTB 4LSPL 5SWZB 2PW1B 4JFYB 5HHOE 4FQ2H 5L9DL 4OZGF 3W82A 1BOGB 4LSUL 3VD5A 4NRYA 1H3UA 3K2UL 4QGYA 1KFAL 2ENYA 3U2SB 1SY6H 1H3TA 3W2DL 4N8CL 4CBPA 7FABL 3RA7H 2AEPL 1FNGA 2Z31B 1LEKB 4YDVA 3PIQA 3UZQA 4JZJC 1DUZA 3UAJD 1OP5H 5KSVA 1ORSB 1QSFA 1ZGLA 3DRTB 1W0WA 1FVCB 7CGTA 2YA0A 1S7RA 3MRRB 5CWSA 4K71B 3DYOA 5B4MD 5E8OA 5F6IC 3DPBA 3DETD 4X80H 2JB6A 5E8EB 1EXUB 4BSVB 4MCZA 3RNKB 3R0MA 4HIIA 5GSRA 2MCPH 3HS0B 4J6RH 2EXYD 4ZO9A 2R1WA 2X70B 3A0OA 3MC0A 1SEBA 4GG8B 1QSEA 1C5BL 3RWHB 1G9NH 3MCKA 4MAYA 3WLWC 2EYSB 4OSUH 4XHQA 4HLJA 5D7JD 1XR9A 4L8BB 4JANB 1M7IB 5JOEA 3C5ZD 1JGEB 4YC2B 3SCMB 2AV1B 4LLVA 1IQDA 4GSDH 3I50L 4KVCH 2AXHA 2VITB 2GI7A 4YDJA 5EC2A 3ARFD 1K85A 4PJDF 1MFNA 5T5NF 2G2RA 4P3CL 5HHQA 3KXFA 4HIHA 4E41A 2PW2B 5I74B 3MV9A 5IJVA 3VXTB 4NKIH 1E28B 3RVWC 3UROR 3SDCC 1FQ9C 4K2UL 4Z18A 3O6FB 3QEHA 2QR0B 2HKHL 3JTSA 4XGZA 1C12B 3UO1L 3GJFK 5CEZH 2X40A 5FIEA 2ORBL 3HZYA 4JFPB 5I1DB 3GSQA 3S35H 1JGVH 2BRRH 1C7SA 1PG7L 1F4WL 3BGFC 1T5WA 3MRGA 1WIPA 2NNAB 4V2CB 1CR9L 4I4WA 5I8CB 2NY0B 5HDOA 4FTVA 5CZVH 1VSCA 2AGJL 5DD0H 1UYWH 2JF1A 3KLAA 1Q9KA 4KAQL 2J7LA 3PQYE 2FR4B 5JO5A 3L3JA 5EG6C 5I30H 3VRLF 4X6DF 5DI8B 1W72A 2JK5B 2IG2H 3CPLB 4P2OA 1JFQL 4CDGC 4ODVH 3BZDA 4QWWC 5CMAB 5ADOL 2R2CA 4XCFL 5FOBA 2DQTH 4P5KA 1U93B 1BQLH 4R2GB 4OGXL 3GIZL 2GITA 4MJ5B 4QHUA 2EDLA 1UH4A 5IB1A 1R5IB 3HC3H 3FN0L 3ILQC 3V5KB 3MRDB 4PGJA 5J8OA 1FNSL 4G9DB 5EOCL 1Q9WA 2BHZA 2CIKA 2GSIA 2PXYA 1INEL 3OPZL 4QTHB 3MNVB 2A1WH 2FO1A 1RZIB 2FX9H 2IGFL 2FWOA 3G5XB 1YPZE 1UQSA 3MV8B 3I02A 4DN4L 2F15A 3UBXG 3QDMB 4KK5C 3LH2L 3SHSA 3TBTB 4KMQA 4MSWB 4RX4D 1JHTA 2MQ3A 1S9YA 1C16B 1FFOB 4QCIB 4I0KA 3STZA 4P2YA 5IB2A 1IGFL 4L4VD 4YHIB 1U58B 2Z8RA 1LO2L 1CVSC 3F5WA 2WM0A 5E0QA 3MYZA 3SE3A 1JPFB 2CDFA 3BMVA 2DQUH 1IC7L 3QDGB 1HQ4A 1G9ML 2OP4L 3IDNB 2CQVA 4PJFF 4ELMA 5D1XC 4MAUL 5GGVY 1KJMB 5IFAH 1J0ZA 5HGDA 3SDAD 3LKRA 4Y2DA 2DWDA 4JFOB 1T1XB 4F15C 4JFHD 4FMKA 1UM6L 1JK8B 1MRFL 2FIRT 2AJYL 2QHLA 4LVNC 4YBQD 1RUQL 1NAKL 2ADFL 1AGDA 4P4RA 5HI5C 1FV1B 2VXVH 3OBAA 5IVXF 4YR6A 1GAFL 3QIBB 4PBXA 1T7YA 2NY6C 3QCUL 4HJJL 1KJ2L 1H8OA 1I1YB 3RBSA 2RIKA 3L3DA 4HPYH 3VWJB 2AJ3A 1PQZA 4M9PA 3T1FB 5TFSH 3VA6A 4A2LA 3KGRA 4AENB 2V7NB 4YFDB 1DANT 1A3RL 2BOCA 2NTSP 3DBXB 3TIDA 1XF4B 2ZUSA 3DXAA 4LASL 1F3JB 2H32A 1G7IA 3CH1B 2Z4QA 2FRGP 1XGPA 4JG1H 4GXUN 1JWSB 2XKNA 5DD3H 4UUJA 4KROD 4YEEA 4X99B 4HFUL 4XT1C 4IMLA 3VGEA 5AAMA 1N2RA 4LNRA 4PB9H 5ICXA 1U8IB 1PY4A 4QHNB 2FSEB 4NHUA 1MCOH 2EYTB 1PEWA 3I6LE 5IMOB 1JNNL 3FAWA 1LD9B 2L7UA 2EECA 2ERJC 1K9TA 1GPOH 4NNYB 3V7MA 4Y4KB 4YHMH 2BY1A 1UZ6F 4PRNA 2F5AH 3ZKMD 3K1DA 2I60H 5IHZB 3P4OA 3WIFB 2X9XA 1SYSB 4JCMA 2PKDA 4J23A 3F7VB 4YHNB 2GK0B 2VDMH 1VFMA 5FHAH 4F57L 3TPUA 5CINL 5DK0B 4F7PB 3CVHL 5KN5B 5ESAB 5F96L 5DGRA 4IDJH 2HT3D 3O3AA 3QEQB 4Q7DA 2B39A 3DVGB 3P77B 1A7QL 4YHLH 2SEBB 1UM4H 1XR8A 2AKRB 3QUML 2R1YB 3RPIB 3Q6GH