5D2LE

Crystal structure of tcr c7 in complex with hcmv nlv epitope presented by hla-a2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
195
structure length
187
Chain Sequence
NVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCAFITGNQFYFGTGTSLTVIPNIQNPDPAVYQLRDSKKSVCLFTDFDSQTNVSQSSDVYITDKCVLDMRFKSNSAVAWSNKSDFACANAFNNSIIPEDTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Crystal structure of TCR C7 in complex with HCMV NLV epitope presented by HLA-A2
doi rcsb
source organism Homo sapiens
total genus 26
structure length 187
sequence length 195
chains with identical sequence I, K, O
ec nomenclature
pdb deposition date 2015-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d2lE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d2lE02
3MV8E 3A67H 3WYRA 1CLCA 4DEPB 1NBQA 1JNLL 4BZ2H 1AE6L 3TO4C 4HS6B 5FCSH 3QDMA 4GJTB 4Y5VA 4GBXA 1B4RA 3RHWK 3TT3L 1QQDB 2J12B 4YXKH 3VI3F 2DLTA 4R4ND 3RDTB 3MODL 5FAAA 3B3IB 5FEBA 3H6JA 1MCBA 5A2KH 4GW1B 5LWYL 3IFNL 1CR9H 1VACB 4I48A 2FLRT 1OGTB 1R6VA 3OBAA 3RGVA 4D0DB 4M4RA 3PL6B 1TIUA 3ZMRA 3GSQB 1HHJA 4HBQA 4MLIA 1DANU 1KNOA 1IGTB 1NANI 4NKOB 1GAFH 3BISA 1YA5A 1VFBA 4P9HC 4PG9A 1FL6A 1S9WB 1WSST 2LAAA 1IGJA 2HJLA 3TBVA 2ZCLL 1QZ1A 5DJZA 1OF2B 3FO1B 3VMNA 5KJRH 5EOQL 5D70H 1S9VB 4HZAA 1UT9A 1K2DB 1VEPA 2VDQL 3BD3A 4PGDB 4DJMA 4MQXC 4MZ3A 2DAVA 3TA3A 1F4WH 1YPZF 5GRYA 3OJVC 4NRYB 4XCEA 5JXEA 1CGSL 4YBLC 5CP7A 3TO4D 3VFWA 1F8TH 2HTKD 1AFVL 2E7LC 1QTYT 5I1CH 5J11C 3AY4A 1M7IB 2ENYA 1BBJA 4OM1H 1X9QA 3DYOA 4OUOA 5IFAL 2VWEC 2QSCH 1Q0XL 1KCRH 1H5BC 4G6KH 1Q0YL 3HLAA 1CD1B 3SO5A 2VDPH 2FRGP 3CLFL 5IMMA 5DFTA 3ZTJG 1KIUA 5DJDA 4P2OA 5FHAL 3QH3A 3X14A 4JM2C 5AYUL 5GXBB 4TTGA 1NFKA 1KPUB 1DVFB 1DUYB 2GSIA 3MJ7B 2AV7B 5IHUH 1BF2A 3UDWC 3CCHB 2IH1A 2M26A 4YO0B 1ZA3B 4X7CC 3P0GB 4LGPB 4GMTH 4I5BB 4CMMB 5T1DL 3V4VL 1BFTA 1YPZA 5TF0A 5C70A 3EZ8A 5MEPA 1M71B 1NUNB 4NCC2 5I17A 2I9LA 1XF5B 1H0DB 5FUZH 4MQXD 4YGVA 2AJYH 2OQJA 1DFBH 2VDML 4NSKA 4NO3A 1IM3B 4NZTH 1SYVB 1RULL 1NBYA 3AREA 1X3DA 4JN1H 4JRXE 4HDIB 5GS2D 1HDMA 1JUFA 3T2QA 3S7GA 3T4YA 4ZQKB 3PJSA 2LVCA 5I2IA 4POZC 5KSBE 4LCUB 5HYJE 3WS3A 3OL2A 1OTUD 1A9EA 3D39E 4YZFE 4J8RA 1J1OL 3LH2H 1RK0A 2GHWB 3O3BA 4JM2D 1T3FA 2A6IA 4UOW0 5DURB 1KG0A 1K5NA 1SEQH 3S34L 3CSPA 5KSAA 5CCKL 1AKJB 5DI8A 2UUDH 3K7UA 3K8MA 4J6RH 4FP8H 1V05A 2O5XH 3P73A 4NO5B 4O4YH 3FTGA 5FHBL 3SKNB 2XWTA 2C7UA 3HG1B 3L7FB 4P2QD 1FHGA 3U4EB 5HHNA 3BQUB 4NQSB 3EYFB 1YN6B 1WV7T 4OF8A 5EPMB 4YDJB 4RMTA 2AEPL 3H9SE 3GSWA 3EYUL 3GMQB 4JPWH 2M2DA 2A6KB 1MQKH 4M7KH 3O11A 3V5HB 3DARA 3VXSB 2UWEF 2Y72A 3N50A 2MCPH 1MNUH 4NT6B 4S2SB 4LSRL 1ZAGA 3GJFA 5IVXA 3DX7A 3GSNL 3EYOB 3GIZH 4XNQA 5KS9F 3B6SA 4NKDA 4NO2B 4X9FA 4POZD 1QFUL 4X5LA 4TOYH 1AO7A 3B9EA 3RJQB 2C3XA 1J8HA 4XWGL 3RWIA 4MNQE 2G2RB 3L5WA 3AAZA 1P7QB 3VGHA 5JIIA 3AS1A 5DJXB 3KLHD 2EYSB 2BDNH 1HSBA 5B22A 2AXHA 3FMGL 4NDMA 1T20A 3PWLA 4QTIH 5GGRB 5DFWH 3SGEH 1RIHL 2E3VA 1TZHA 5J6GB 2NY1B 4QXGH 3KYKL 5C0IB 3O3AB 4OD3L 5JOPD 4P2RD 5BMFL 3KJ6L 1JNNL 2PKDA 4PJHF 5TE6L 3VXUA 5J1AA 3GB7A 1EFXA 4PS4L 3SGKC 4P9ML 1KENH 3UBXG 3EZJB 2Y07L 2DQCL 3TIEA 3QUYB 5CD3A 2DQEH 2D7OA 4L9DA 2DS4A 2UWEA 3LZFH 1U6AL 1FFPB 1KCSL 2FO1A 3Q6GL 4YAQB 5J56B 3GRWL 2P5EB 1GC1H 4IOIB 3GSXA 3CZFA 1OAQL 3CX5J 4MD4A 5EU5B 3JTSB 3KDMA 4YHOL 4JPIA 3LPFA 2A6DB 1B6DA 3QHFH 4Z7NE 5J0BA 5D9SA 1CGWA 4Z8FL 1U0QA 2EH8H 4RAVA 2H2SC 2XI9A 3QULB 4ODTH 5JR1H 4KVCH 5BZWA 1TZGH 3LQAH 2CH8A 3B9VA 2O5ZH 4DTGH 5JMOC 1JPTH 4JVUA 1QBBA 4XWOC 4EN3B 3QA3A 1F97A 4PV8B 3BZ4A 2IBGA 5J13B 1JTTA 3QIUD 2VXVL 4FQJL 5FM5O 4JFQA 4OB5L 1MCDA 3BE1L 2B7DT 3UTZA 1CXIA 4DZBA 4HCRL 3S36X 2VLKE 5GRUH 3ZYJA 2J5LC 1UJ3A 5FGSA 4K7PX 3DX8A 4B7IA 3P4OA 4CADA 1XR9A 3P0YL 4L1DA 3TJEL 1DANT 4NCC1 1CGXA 1T0MA 2P7TA 4LEXH 2VXUH 2XXCB 3I3DA 3WJLC 4LSQH 1A3RL 1HI6B 4OLUL 5FKPB 2C4XA 3UTTD 3E8UL 4X6EB 2H2SD 4ZUUB 4RFOH 3W0WE 2VC2H 1TXKA 2DWEA 3MC0A 4OCWH 1IC4L 3FN3A 2BVEA 3OKDA 1RMFL 2ED7A 1A6PA 5CLWA 1NGXA 2EDWA 3KS0J 2DICA 1XGRA 2CUMA 3MJGX 4M7JH 4YDLC 2VITB 2BNQB 3PG2A 3PWJA 4TUJA 1JFQH 4XWOD 4L4JA 3JVGA 4F7CA 3ILQD 4CVXA 2Y7QA 3WHXA 5BQ7B 2EIZA 3IFPB 5IMOB 1UEMA 1XR8B 2F54D 1RZJH 4EUPG 4UDUA 3ELAT 5I1KL 4ZUTA 4PGBB 5E2VL 1L6XA 3CFIC 3OJDB 1WK0A 1DQJB 1GHFH 4PGEA 4QOKB 5E1HB 3T3PF 2V2TA 3ARDC 3OG4B 5IBTH 1U58A 3PQYE 3BP5A 3O45B 4MXVF 4GRLC 4M5ZH 3T2NL 5HHOB 3NFSL 3UC0H 2X4OB 3FAWA 2FCBA 3TBYA 4K3EH 1GIGH 4D9LH 1LO2H 4UT6L 5FKAB 4IRJB 5AYQA 2VDNH 5DTFB 3QI9C 4ZS7L 5EU7C 4OLYH 1IGYA 3W5NA 1W8OA 1A7RL 4HWNA 2ZOLA 1EJOH 1QSFB 5EBMB 2WUBL 4LCCA 1J05B 1ZT7B 4O5LL 4YK4B 5HI3C 1S7VA 4X6CF 5IMKB 1T83A 2V2XB 3G04B 1N6QH 2YWZA 3VFNA 3ARFB 1U36A 2Y23A 4EUPB 1CLZL 4WDIB 25C8L 2XN9E 4GXUN 4TNWF 3PWVA 2UY7A 3DX6B 3G5YB 1XFPA 3S9DB 2DYPA 4L4VA 4L8CA 2H26B 2NMSA 2FJFA 4K8RH 4HGWB 3ARDD 3ULSA 2YRZA 3CXDH 3SQBA 3ISWA 4GRLD 5DLML 2WP3T 4ODVH 2HKHL 4XP6L 5BOZG 3QPQC 4PJAE 5F7UA 3V8CA 2CGRH 4IDLA 1S7UB 5CUSH 1BJ1J 2Y36H 5CJBA 4JFXA 3QI9D 3WNKA 1SM3H 2WINB 2VABA 5CMAA 4CGTA 1BLNB 5E2TL 4RRPA 4K71C 1NFDF 4QY8B 2E8ZA 5I15L 2BNUB 1JGVL 2Z91B 4LVNC 4WHCA 3P9LA 3QDME 1W72B 4OGXL 2AK4E 5I18H 3KPSE 3NMEA 3S3PA 4XXDA 3CUPA 1BQHA 2UYLA 1XCQA 5FA4B 2F53A 3V6OA 1E4KC 1NAKH 4YHKH 1GYAA 3KNBA 3LSOB 2AEIT 3MV7A 4ODXB 1RZIA 1J7VR 2D0GA 1T1WB 2V17H 4JN2A 1S7QB 2CO7B 4XBEH 3REVA 3W5MA 2JIXB 3BYTA 3MUGA 2YMXL 1NCTA 4N0UA 5GJTH 4LRIA 1C5CL 3DYPA 3IKKA 5C0EB 1NFDA 5KVFL 1WEJL 4L8DA 3MSPA 5LCVH 5I0ZA 4NQEA 3BJLA 2AQ3A 3BGFB 1T03H 2ILLA 5I8EA 5JPNB 4XHJC 1MRFH 4HHAB 4UB0L 1MRDH 5EZJB 4WTZA 4NM4L 5IGXH 3RNKB 2NX5B 3UJJH 4N90E 4LLUA 5ICXA 2IQ9H 4GLRI 3HZMA 1GJIA 4Z7UA 2EDYA 4UI2A 1IL1A 4TSCL 4KGLA 3V0WH 1U8HA 4HC1H 4DGIH 3LN9A 3MOBH 4G8EB 2AEWA 2IFFH 5BVPH 5KSUB 4H26B 4HUXB 4XP1L 4M6OH 2MTPA 5I8CB 1UXWB 3NAAH 4Q6YA 4QRRB 4M7ZC 1HEZA 4XGZB 1LE5B 4ZYKA 1NMAL 3PF2A 1WFUA 3HN3A 4HUUB 3ARRA 1U8OA 4X6FA 2PR4L 4OSUH 3GKWL 4V1DB 1F45A 1R3JA 2JK5B 1KXQE 3BKML 3CX2A 1P4BL 1CZ8L 3V4UL 5JW4M 3TT1L 3T0EB 4O9HH 1MHEA 2DQUL 3ARTA 4HMEA 4CNIB 5IJVA 3U2SB 1JZ8A 4L5FL 4Y4KB 3KPRB 5L8JB 3PP3K 1MVUA 1FZMB 3WD5H 2OK0H 3TO4A 3C2SA 2DB8A 4PLOB 2J6EH 3O2VH 5T5NG 5T1MB 5SWQA 4HUVB 3I02A 3UROR 1DBJH 1FZOB 3LCYA 4DVBA 1ZHKB 4FQCH 1YN7A 4NO0D 2VDRL 3NFNA 2YPLA 4NNYA 1NGWB 3VD5A 1ADQL 3QXTA 3ROLA 3MGTA 4IRZH 5ACZB 4Y5YC 2LE9A 3UYOD 3NCFB 3VXRD 3MCKB 2QADD 4QRQA 3QIBD 5DJ8A 1KF9B 4QGYA 5L7XH 4NC1C 1N2RB 2Y06L 2J8UB 3MRFA 1B0RB 3DGGB 2A1WL 3CU7A 4XAWL 1TQCC 3LHPL 1H8SA 2OTPA 2HRLA 2MQCA 4JM2F 3RI5F 5ID0A 2YRPA 1TFHA 3DVNA 4Y4FB 3DV4B 2P42B 3QPXL 5B8CB 2AKRB 5SV4A 3BHBA 4JHAH 3VXPA 5DJYA 4Z6AT 3GMRB 1CVSC 5FUOL 3DXAB 1T0PB 4WCYH 2B0SL 3MJ8B 5KAQG 2AI0L 1ZANL 4I2XB 4PFEA 5EIIB 5HYEA 4L8BA 2O26U 3MBEB 2E7LA 4AEIL 4OLXL 3SKJL 2W92A 2QHRH 2NY2C 3BP4A 1IGFH 2R56H 5HGBA 2JCCB 4F9PC 5IVXE 4GAJH 1H5BA 4EDXA 3NPZB 2NY0C 4MJ5A 1J8HE 4N8VA 4DKEH 4JFYB 2LAGB 2BVYA 1D6EB 4PJ5D 5D7KE 3JV5A 4JM2A 3IJSA 4K9EL 4X6BA 4HJ0C 3VRIB 3GO1L 4HKXA 4UQ2A 2I5YL 3ARBB 4HD9A 4NJAL 4XP9L 1X7QA 3UDWA 3CLEL 1CBVH 1OP3H 3ARGD 1J1PL 3VXUE 2QHLA 3QCVH 5GGRY 4Q9RL 3NFPA 4LEOB 1NC4B 4OLEA 1KCUH 5F7FA 4U6VL 4R7NA 4P2QA 2FHFA 2NNAA 1OTTC 1JV5B 1S5HB 1CTNA 1EHAA 4GG8A 5HI5D 1MJ7L 5DJCB 1F4YH 4G5ZH 5HYQB 4ISVA 1A02N 2CLZA 4MMZC 5DGQA 1JPST 3KYAA 3C08H 3RUGB 5H37G 3GMLB 3GUTB 3MRLB 1S7SA 5EOCJ 4WW2B 5DSCA 4HX1A 2BNRB 1S78C 5CJ8A 3TPUA 2NY3C 1KEML 1AD9A 5MENA 4ZXBC 1RIVH 5GJSH 4X8JB 2MSPA 4G43B 2NY0D 5HGGS 1WBZB 1CL7I 4NBZB 1G7HB 3MUJA 3PGCB 3RKPA 3QISA 3VFRA 1ES0B 3QEGH 2H3NA 4UTAH 5A2LH 3HNTL 2DRUA 4XMLH 1X5HA 1NCAL 3L1OL 3ZLQC 3O3DB 4P2RA 1MI5B 2QV2A 3DRQB 3IU4L 1KIPB 4GXVL 3FB5A 4IIQB 4NQCB 5D1ZD 1G9MH 1BZ7A 1RZGA 2UUDK 1E4XH 2W91A 4PJGE 4XNUH 4M6ML 1OTTD 3HZKB 2EO1A 1P7KB 1NEZA 3F58L 4G8GB 3ZSSA 3QCUH 5BVJA 1X5FA 5FYJL 5TE7H 3C87A 1FO0L 1N7ML 4HUWA 1AY1L 2XKUA 4MA1C 1FE8H 5DRZA 5LJYH 5DFVC 1NC2D 4WU5B 2ADJB 4PGZA 3THMH 1FFOA 1RHHB 5E5MA 2VKXA 1Y18B 3T8XB 5TPWL 2NY3D 3LQZB 4NWTL 2I60H 1HQ4A 4ZXBD 5E70A 2MCG1 4DK6A 5GRVK 3INUL 3NPSC 3PABA 4PGCA 1DQDL 2CK0H 5C71A 2RB8A 1I3RA 5DVNA 2F9BT 1Q72H 3BKCL 5JOFA 4PB0H 4LIQH 2ITDA 1LP9A 1UZ8B 4PRHB 1IC5H 1RQ5A 2BSTB 3TF7C 4WFEE 5EDXA 1I7RA 3DUUB 3QDGE 5ILTL 3H7BB 3W82A 4OZFG 2AV1A 1XGYL 2Q76A 5B3NA 4HIHA 2ZOKA 3EYSL 3HE6C 4U0RC 5EOCL 1J1XL 4PG2C 3HS0B 3SGKA 5DK2B 1DR9A 3I6KB 1UB6A 1VESA 2FGZA 3NZ8B 5MERA 3BN9D 3ARZA 4P5TC 5C0BA 1E27A 4O2EA 2ZUUA 4HW6A 3IGAB 2EO9A 5HYSG 1T1YB 4KQ3L 2GCYA 2LVEA 4H1LA 4Y4HC 1F11A 4Z7WF 4YHZH 5CSBA 3CFDB 1A4KA 2AQ1A 4JZNA 2H32A 4Z7VF 4NFBA 4GW5A 3TIDB 5ABDE 5D5MB 3CVHA 2OJZH 5IT2H 5J7CC 5HDOA 4JHZA 5MI0C 2Q6WB 4HF5L 3UTTA 1JPSL 4ALAH 4YFLF 4M3KB 2BSSA 4PRAB 5F3BA 4YC2C 2VH5L 2MOVA 4IHOA 3N06B 4HFUH 1KACB 4P59L 3D69B 1OCWL 1RURL 3ZO0A 5ICYB 4S0SD 3RKDC 4LKCA 1KJMA 4GAGL 5I1IH 3MRNB 1KCKA 3PP4H 3A0OA 4LBEA 3LN4B 3RWFB 3AC0A 4WY7H 4M43H 4QXUH 1A6UH 5C9KA 4M1DH 3GJFH 5E2UH 2VXQL 1CDUA 1ZMYA 5DEGA 2VDOL 4RFEA 5IEKA 2V5RA 1UM6L 2VLRB 3QT2A 5DQ9B 3MV9D 4Z7WA 4PD4J 1H15A 2DLFL 2F54A 3T3PE 5MHSE 4PRID 3MXWH 4Y4HD 1CE6B 4Q6IC 2EEBA 2H9GB 2ESVD 5C1MB 3DVFA 5DDHA 4L4VE 1VDGA 4I3SH 1OSZB 3DBXB 1QLFB 5EUOB 1LD9B 1CFTB 3WJLA 5L8LB 1HHGA 3RL1A 4ZO6A 4JFPB 1F2XK 3F7VA 1P1ZA 1VSCA 4LAQL 4OD1H 4P2YA 3ECBB 5E8PA 3KLAA 1EHNA 2R0LL 3WO3B 3UZVB 2A2QT 1I75A 3KPNB 4FFZL 5I1AA 3TESA 1FL5A 1WBYB 3JUYA 3ES6A 5D2LF 1R3HB 3KYNB 1HHKA 3K74B 5FA3B 4MA8L 2CJUH 5K33A 1DBAH 2F53E 3V6OE 3BPLC 2AVGA 3V0VA 5CBEA 1CFSA 1CG9B 3TH2T 4Z7QE 2AERT 3MV7E 4AM0A 5C0CD 1PYWB 5ID1A 3QQ4B 4P57B 2H6PB 2VAAB 3GSVA 3UJTL 3G5VB 1EEYB 4OF0A 3CC5B 3H9HA 4M48L 5JHDB 4LLMA 4LHUD 5I1LB 5K9QI 4K55A 5IW6A 4MJIB 1GPOL 5E8NB 3KPTA 3FCTA 3ARDA 2ZCKL 1WTGT 4MA7H 2P43B 1YJDH 3H42H 2YA2A 4N0UE 3HR5A 5F71A 5DVMA 1PY9A 2OR8A 4GRLA 2BSRB 1CF8H 3RP1A 4IOFC 2YPVH 5BS0D 1NFDE 4H20H 3TBTB 4YNYB 3QI9A 4NQEE 3KPPA 3ZKXC 1WZMA 2QQLL 2CO6B 5TH2A 2IF7A 1SVZA 3FT2A 1S5IH 1YYLH 3K8LA 2B5IC 1A6VH 5EIVA 4H8WL 4RA0C 4WJ5A 4S1SL 4ZO8A 1CLYL 1MEXH 2OSLB 5CJOH 1IT9H 2CXGA 3SGDH 5IOPB 1FNAA 4U3HA 3L9RA 4Z7UE 4YEFA 5GRZA 1C16A 4X80H 4ZUWB 5I9QB 3GNML 5IESH 1FAKT 5IQ9B 4FQ2L 4ZDHA 5AAWA 1FDLH 2DTMH 2IMNA 1UM4H 4K9EC 2VDKH 4UQ3B 4PV9A 3MFFB 4KJPD 4NNXB 4NYLB 5SWSB 4JY6A 4ELKA 4X4ZA 4AT6B 1CIUA 4UUJB 4OIIL 4R6UA 4QHLB 2X1WL 3B8SA 1BOYA 1GZQB 1XGPB 3T77A 5HHMB 4PR5A 4WO4D 1C12B 2A74A 2LU7A 3H9YA 1WCBB 4IOFD 1CLOL 3L3DB 2WWMD 4YR6A 3IU3A 4WI5A 4AENA 4OGYH 4NP4H 2P5WD 4WUKL 2ATPA 2VYRE 4HK3J 4U1LB 2APFA 5F7MC 3LQMA 4PBXA 3W9DA 5JW3H 4GKNB 1AP2A 3EGSA 2Q8AL 1RUKH 2YBRA 3CDGB 4XTRC 3VFSA 1VA9A 3QJFA 1GOHA 1A2YB 2X4SA 3CH1B 3PXJA 1BD2B 4BKLB 2E6JA 4GG6E 5D72L 1XCTB 1E4KA 3A6BL 4JCMA 1WF5A 4ZTPL 5ENWB 2V5MA 4OBRA 4WTXA 4JG0H 4Y2DD 1G1CA 3WFEL 2FBJH 3CMGA 3SO3B 4GH7B 2BFVH 3IF1A 2D7TL 5DK0B 4W6WB 2ZUSA 1IKFH 4XPAL 1T2XA 4Y5XA 1QNZH 1ZLSL 5IFHL 1UH4A 1A6ZA 4HULB 2HG5A 4ZAKB 4NFCA 4RQQA 4O02L 1MJUL 2ORBL 3TH3T 3U9PH 1ACYH 1HQRA 1ITBB 1INEL 3VXOA 3UPRB 2YSSB 1NKOA 4LU5L 4AL8L 5EFIB 3CFCL 3MJ6A 4MNHB 1Z9LA 3HAEA 1KCVH 3HC0B 3KXFE 4PJ7F 1YZZA 4TVSa 1ZE3C 4P4RB 4P23B 3BIKA 5HJ3A 1VADB 4L29A 4ZOAA 5SWZB 4JDVB 4XNYL 1N4XH 1FZKB 2AJZB 1QRND 3GSNA 3E0GA 3C5JA 1B2WH 5EC1B 4CMHC 3W2DL 4U2YA 4NO0A 3TYGL 1SJHB 5ICZB 1A47A 2C4FU 3TNNB 4LSDA 4JR9H 1WC7A 4ZPTB 3VXRA 4KTEL 3IAGC 4RWYL 3QIBA 5L2JB 2ICWJ 3EJZC 2YS4A 3SE8L 4YHIB 1NLDH 1TDQA 3H2WA 1U91A 2QR0B 5F7EH 1G1YA 4LHJB 3MREA 1PAMA 3FO2B 2NY4B 4NC2B 4TULH 2NW3B 4NM8H 4WU7A 1FFNA 1OAYH 3TLRA 4N8CH 1C8PA 4PJ7A 2DQHL 4RGNB 4QO1A 5KW9L 3HZVB 5DD1L 1I1AC 1SBSL 3E6HB 5FYJD 4JY4A 5GRJH 4ETYA 1G7PA 3REWA 3CFJA 3S8WA 5IBUB 2BY0A 3MA7A 4X7SL 5ESVA 3FT4B 3GRWA 4MMXC 1VGEL 2Y9RT 3RIFF 1A3LL 3LRSB 3L3IA 2Z92B 1KT2B 3RIAK 3V7MA 5I30L 3T2OA 1OAKL 2R2BB 5TF1L 4Y5YA 5DJ6A 4ZD3H 3T0AA 3A67L 3G6DL 2IH3B 5IB2A 2X44D 1YEKH 2FL5A 2VLJD 3EJZD 4MD0B 4PJ5A 1I8KB 1MWAL 4TSBL 4URTB 4KKLC 4PTUA 5F3HA 3C2AH 3FQNA 5FECB 1LQSR 1IAOA 3O6LH 2CIKA 5J8OA 4FMKA 1H3GA 1OP9A 1HYRC 4P2RE 5JOPE 1A7OH 3TCLA 5J12C 5C6TL 1UWGL 1CU4H 2F58H 1KEGH 1SJVA 1CR9L 3VXMD 2GY7B 2OLDA 1IQDA 1I1AD 3QEQD 5HTSA 2AEQL 2DJUA 5GIRB 1Q1JH 1N8ZA 3S4SG 4JQIH 2NTFA 5E6IC 5E08L 2DLEA 3MV11 3S35L 2WIMA 3NN8B 2DWDA 5CIPA 3X11A 2GFBB 4EI6B 2A83A 5E9DB 4WHTB 3MRJB 5A2FA 5I6XB 1UZ6F 3BGAA 3MRIA 5ESQB 3TBSB 3GJEB 3D25A 2DIAA 3V6FB 3SJVD 3O6KH 2JB5H 5KJRL 1FVCA 1YEEH 1OARL 4G9FD 3O0RH 3MACH 4L4TD 4MA3A 4XNMB 5FYLE 3LMJH 4K23H 1OB1B 2AJSH 1F8TL 1XIWB 2A38A 2VE6A 1LP9E 3F7PC 4KK5C 4ONOA 4TUKL 5I16A 5HHPA 1UADC 1KB9J 1ZWIA 4LSUH 3R8QA 5FB8B 4U2ZA 4OM1L 1KGCE 5DRWB 3MYJA 4Z0BL 5L2KE 3X12A 5JA8B 2IQAA 2QSCL 1KBGH 1KCRL 1DQQB 4G6KL 4J4PD 1UJTA 4Y7MA 3F65A 5F7YC 3LKSB 4Z0XB 2Z35B 4W6YB 1G0XA 2VDPL 4HK0B 4ODBD 4QHUA 1OP3K 1QEWA 2DF3A 1BFVL 1WZKA 4JRXB 3NZHL 5JA9A 3C60C 1DP0A 5INCA 4WI2A 1R3LA 2IPTH 3NIDE 1PKOA 5DMIH 1YDPA 2E9BA 3WL9B 2DQTH 3EFDH 4ZXBA 2YD7A 1UM5L 4P9HH 4JO1H 2W65A 3VDBA 4JKLA 1FLTX 2GJJA 3O9WC 1ONQB 3UTTE 4MD5A 3DHJA 2CDGA 4GS7B 4JN1L 4H8WC 5I74C 3VCLB 2UZYB 5D93C 2X5PA 1JE6A 3IETA 1RJZA 1ZVSB 2Y5TB 1TQBC 5F88B 3GHBL 4C58B 1G7QB 2MKWA 2NTSP 1BWMA 3Q48A 2ADGB 2ZP0T 5BJTB 3EAKA 4UOJA 2FWOB 5JIPA 1ZLWH 1KFAL 4ETQA 2WBJC 3LH2L 1TCMA 1NMBL 1BZ9A 3C60D 5EO0B 1JWMB 4WUUB 2F54E 1AGEA 2KQMA 3MRMB 4GRWF 1IKNC 4J6RL 5EO9B 2O5XL 3GGWB 4DN4H 1V3KA 5E5RB 1KIQA 4O4YL 5F7WC 3VG9C 2FSEA 2ZUVA 4BH7A 1C7TA 3CSYB 3VD4A 2PF6A 3ZYZA 3DOSA 1DDHA 5DJAA 5IP4A 3SE4C 2R1YB 4P3DB 2W9EL 3B2VH 1R5WB 2HMIC 4UOW1 3EDEA 4RA3A 1IEAA 3MLXL 4HH9B 4WNQA 3O9WD 4ZUSA 4JPWL 5D71L 2NLJA 4NUJA 1OPGL 1T21B 1P6FA 1MNUL 3O2WH 4R4BA 3VWKB 3WIFB 1IEBA 3HE6A 1SY6L 4D0CB 5K59F 3GIZL 4PG2A 3TV3L 4MVBC 3MMEB 2HRPH 1MLBA 2GJ6D 4X7FC 4TOYL 3TJHC 3MNZA 1NGZA 3BGMB 4EI5C 4GKSA 5CHNA 2KL6A 5DJ2A 2ZSVA 1CK0H 3V9FA 1GGIL 4P5TA 2BDNL 3DMMB 2FX9L 1T1XA 4F57H 3O6FB 3B5TA 4FQQA 4OQTL 4QTIL 3L3KA 4PRIA 4Y4HA 4UIKL 2VO5A 2HN7A 2A9MH 4QXGL 5TGBA 3HI6H 2JJTC 3HA0A 1EHLH 2ESVA 3HUJF 5K9KB 1B4JH 1OAXH 1YQ2A 4JO2L 1LE9B 3QWQB 1W0VB 3O4OC 3ET9F 4O51B 3WNNA 3MV01 4NN5B 3DWTA 1TCRA 2DQEL 5DVKA 1VFAA 3U4AA 1MLCB 4MDJB 3LZFL 1BGXH 5FDYA 4NZJA 4P49A 5EZIH 1XGUB 5L9DL 2AS5M 3JWDC 4J3WA 4Y16C 3TWCL 4NRXA 3EUUA 5EBWA 1G0YR 2XTJC 4HKZB 4PRDA 4XB8A 3PUCA 2Z8WC 4D9QD 2OTUB 4HLZH 4MVBD 1E6JH 5DQJB 4PJCE 5ANME 1FNEB 3LY6A 3QAZC 1NCCH 4EI5D 5GGSB 4ZFGL 1U3HC 3JWNC 2FX7L 3QHFL 1IE5A 3UBXA 2ZKHH 2EH8L 1BX2A 3QUMB 2NY6D 4L1HA 2VLKB 4C83B 3X3FH 2GUOA 5EU3B 5CGYC 5C0CA 1T1ZB 5DD0H 5JR1L 1EUTA 3MBXH 4Q6IA 3GJFK 2Z93A 2NZIA 5I75B 3GBML 4LHUA 4MYWB 3R1GL 3VWJC 3PIQA 4I0PC 4G8FA 1JPTL 3NIFE 3S5LG 1M6OA 3O4LD 4PJ8C 3DX9A 2C1PB 1MFEH 2WIIA 3AXLB 4BZ1H 5D7LB 4BFEA 1G7JA 1Q9LB 4NUGH 5BS0A 2J4WH 2JJUA 4RMSA 4I18C 3OKYA 4Y16D 3EYQC 3WKMH 4HS8H 2YUWA 3QUKB 4FN0A 3S98A 2CUIA 3CSGA 4O2CA 2P8MB 1OLZA 4H1LH 3C6LC 4QHNA 4LEXL 2VXUL 3OX8B 1FG2A 4ZTOL 3L5XL 3U30B 1GZPB 4E5XB 2CMRL 5T5FL 4KY1H 4LSQL 3GMNA 1CT8B 1U3HD 1SQ2N 1CIDA 1ADQA 2E9IA 3QWOB 5AWNH 3WDJA 5C0DA 2H32H 2X4RB 2DIJA 3ROOA 1AQDB 3I50H 5GGUB 3CVHH 4OCWL 5CGYD 1RK1A 1XF4A 2X42A 5JORA 2FO4A 1WZ1H 3O3UN 1DQMH 1K9TA 2XQYK 2OI9C 3VWJD 4M7JL 2HJFA 4I0PD 5GZOC 3PQYB 3EDJA 4PLKC 2R39A 4IMLA 4RNRA 2EDQA 4PJ8D 1FNLA 3I6GA 3BDYH 1DLFH 1WQVT 3HKFA 5CFHA 4A2MA 3LKQB 5E0QA 4POYA 4X6DF 3KPOB 1M1SA 5IIEA 1AHWA 2P5WA 1RZJL 3EYQD 1OQOA 1SEBB 3F6LA 3V79C 1CFVH 3SDCC 4YHYC 5T1KB 4X5XA 1F6FB 1VKXA 4N9GA 5DJ0B 4PRBB 4LCWD 5FM8A 3UPCA 1T66C 1K4DB 4EXKA 4OIBA 3QRFM 4HIEA 3OGCA 1Q9KB 4P2CG 1JI1A 5FV1L 4M5ZL 1Q9OB 4ODHL 4DKAA 5CZVL 4JPVL 2HFEA 2YWYA 1J5OH 1L7IH 3TZVC 1YEDA 1J10A 4K3EL 3P77A 4PRNB 4R0LC 1LO2L 3BP7A 5HGDB 5GGQL 4FQHA 4Y2DA 5J6HA 3VXRE 1INQB 5H2BA 4KKCC 4QCIB 1LHZA 1QRKA 3DIFA 3RZCB 4OCMC 3IXTB 5GZOD 1U8JB 2UZIL 4PLKD 3V5DB 3LRHA 3UO1L 1AE6H 3I6LE 4M9OA 4P5KB 1UXSA 3C09C 3TT3H 4MQTB 4H25A 2EE9A 1CICD 3L3JA 2FECI 5LWYH 3IFNH 4JGJA 2FHCA 4XC3L 2AABH 4JQVC 3VH8A 4G80A 3SDCD 1CFNA 5FYKU 2NXZC 4FXGA 1UWEH 4Y5VB 1L0YA 3ZT7A 3CSBA 4NQUA 5C0GA 1QRNA 1N3NB 2FATH 3ZDYF 3V95A 4LP5A 3MUHL 3TZVD 4FOMA 1J86A 3MOAL 3Q5OA 2AXJA 2CGRL 4I48B 3LKRB 5CUSL 2YC1A 3NIGE 2Y36L 4FQLL 4KTDL 3RGVB 5FDWA 1H3TA 2WNGA 4KV5F 3G5ZA 2BMKA 1HHJB 5EOQH 2H45A 1YC8A 3SGEI 1X4YA 1DLHA 1KNOB 3E3QC 4FQIL 2YKLH 4ORGA 1YY8A 3SDAC 4YHLH 4R97C 2ATKB 3RWHA 5I18L 1CGSH 1VFBB 5T3ZD 1AFVH 4PG9B 4BJLA 1SBBA 1FL6B 2XZQH 1NAML 2HJLB 3TBVB 1U8LB 2C1OA 2W0FB 4PJEA 1NAKL 4NN6B 4QTHA 5KBNC 5IFAH 1QSED 4RFNB 1K3ZA 1Q0XH 4QRPB 3G9VA 1FLRL 1OGAD 2ZNWA 4HJGA 4XCEB 2R2EB 4PBVC 5IVNA 1FO0A 3CLFH 1YC7A 2NXZD 2V17L 3IFLL 5D7IA 5FGBC 5FO8A 2C3WA 2X1XR 5AYUH 1ZHNA 3S97C 1S9XB 3BD5A 5JW4R 4WWKC 5H8DA 3OV6A 3ZHKA 3HLAB 3C5ZC 3P4LA 4MCZA 1NMCB 5T1DH 5DJDB 1T03L 3QH3B 1GGBL 1NQBA 3CDCA 1MRFL 4ONHA 2D7QA 2GSIB 5GGVH 3SDAD 1SHMA 1MRDL 5IGXL 4J3TA 1MCNA 1KXTB 2VDMH 4HMCA 3WUWG 4FXKA 3CMOH 1YPZB 3V0WL 3P3YA 3DV6A 4DGIL 4YQXH 2Y6SC 2IFFL 5MEPB 3WIIH 3BZEA 1WIPA 4M6OL 1NCNA 4ONGL 5I17B 3IVKB 2I9LB 5I19H 3VXMA 5GQBA 4Y8AA 3QEQA 1EEZB 1I1AA 4YGVB 3MLSL 3P9MB 2J8UF 1YEHL 2IANB 3ZYIA 4NSKB 1BVKB 5DHYA 4NO3B 2OYPA 1KV3A 2K7PA 1JWUA 3AREB 2VL4A 1HDMB 3O8XB 3VFTA 4EIZC 4OSUL 1JUFB 5F96L 1DE4A 4TNWK 4QKXB 3S34H 5JW4Q 2X70B 3RWJB 3T4YB 4WWKD 1O7VA 5F9JA 3PJSB 5E4EB 5I2IB 1I8MA 3C5ZD 3WS3B 1S7RA 1RJLB 4KROB 3SJVA 3WFDL 1A9EB 4HFWA 1R24A 4M61A 4G9FA 5T5NF 4L4TA 3EFFA 1RK0B 3O3BB 1WBXB 2A6IB 4MWFA 2W0PA 1T4KA 1F3JA 1K5NB 3BVNA 1A1NA 5AAMA 5KSAB 4PY8J 2AEPH 4LVHC 5C0BB 5DI8B 3HAEH 2R8SL 3EYUH 3O2VL 3K80A 3CPLB 4OZGA 1DVFC 5GHWL 35C8H 3FTGB 1IZJA 2W0KA 3QCTH 4KZEL 2XWTB 2Y6SD 2E5EA 4FQCL 2C7UB 5SX4H 3QFDA 4J4PA 4LSRH 4OZIE 2HH0L 5HHNB 2P45B 3GSNH 2RGSA 1EMTL 2Q7YA 2Q3ZA 4CU8A 2IADA 1OD7A 5JO5A 3IS0X 3BAEL 4OCXL 3MV8D 3OKOB 1JGUH 5KANG 3PWPB 3O41B 3EO1B 4OT1L 3FHAA 2DBJA 1FNFA 5ERWB 5HBBA 4HH8A 4Y1AA 3DX7B 2XFXB 3MZGB 1JYWA 1RIHH 4XNQB 3B6SB 4NKDB 2JJVA 1RPQA 3MLTA 3KYKH 4F2MA 2X9XA 5KAQF 4DWHA 1MQ8A 1JNNH 3KJ6H 4N0CC 1AO7B 4P46B 3MLZH 5DUML 3RWIB 4FABH 4GUPA 2YD4A 3K46A 3AAZB 2M1KA 4P9MH 3QIWC 4MNGA 4WCYL 4LFHG 3LKNA 1XH3A 5DD5L 1RFDH 3WHE0 4BSWA 4J1UA 5IHZA 1MRCH 4NDMB 1T20B 3PWLB 1ZHBA 4CRPA 2NPLX 1U6AH 3ZDZE 1CDBA 1C1EL 1VFOA 1RZKC 4Z78B 3MZTA 1DVFD 1KCSH 4HIIB 4E0RB 2BRQA 3GMMA 3Q6GH 2R56L 3GRWH 2DQGL 5EUKA 1OAQH 4KJWC 3KYMB 5CD3B 3RVXD 2JJSC 4JRYE 2UWEB 1UQSA 3U6RB 4DKEL 4XP4H 4GRWE 2LQRA 5KTEL 4BFIB 4FG6C 5KS9B 3MV9E 4Z8FH 3C60A 3RNQA 4X4YA 3GSXB 3CZFB 4JHWH 4F15C 5JQHC 4PRIE 4MD4B 5K9JL 1CBVL 2H1PL 4LF3A 2ESVE 3QCVL 4LK4A 4JPIB 4PY7B 5D2NE 4N0CD 5D1XC 6CGTA 1OTSC 1ZSDA 1KCUL 3ZE1F 3HMXL 3MRKA 2CKBB 3BOVA 3ULVD 3QIWD 2OL3L 4PJHB 5CAYB 5DEFA 1TTGA 3O9WA 1RZJC 4AEEA 1F4YL 2VXVH 1YECL 4Q58C 4FQJH 3BH8A 3MUY1 4OB5H 3BE1H 5DURD 2D4FA 5FGCB 1AKJD 4I3GA 5B3JF 5I71B 1F02I 5CIPH 1S9KC 2B4CC 4R90L 4XH2A 1A3QA 1RIVL 3SDXE 2GJ6A 5GJSL 3P0YH 3TJEH 1CTOA 4JFQB 3HG1D 4OKVA 1A7BA 3S36H 1S7TA 3UTZB 1QLRB 1A3RH 4YUEH 4K7PH 1BWWA 2AXFA 4OLUH 5GGSY 3QEGL 4TQEL 4TSAL 3E8UH 1UJ3B 2XG4A 2K3TA 4CADB 2B39A 3DX8B 1IKNA 2E27H 3MLVL 1I7TA 1IC4H 4MHHG 1XR9B 1I8IA 4HWUA 1RMFH 1ZLWK 5KSVA 1KJ2A 1T0MB 2IG2L 2F74A 5DHXB 2XNAA 1FIGL 3MR9A 2E6QA 3EO0B 2VAJA 4PRPB 4KH2A 3SE4A 3QUXB 4XNUL 4J3VA 1A7NH 3QZWG 3QO1A 4XCNA 4C56A 5JPMA 1GGCH 2G9HA 3QCUL 3D39D 5CKGA 5F97E 5DR5L 3OKDB 5BS0E 1N64H 3QRGL 1KELL 1NGXB 1QSVA 1JGDB 1XGRB 1ZS8A 5CJQL 4M03A 3EOTH 3OWEA 5I1KH 4TUJB 4JLRB 3L5IA 2NY1D 5B38A 4YH6A 2WLYA 4F7CB 1EAPB 4CVXB 3DO7A 2Y7QB 3WHXB 3IJYA 4F7EA 5AZ2L 4EI5A 2YA1A 3MA9H 4N1EA 3E6FA 5D6CA 3NFSH 3QUYD 3F7YA 4UDUB 2X4UB 4PB0L 3RX5A 3H9SD 4CKVX 1IC5L 4W68A 1TETH 3PWUA 3UTQA 4M93C 4ZS7H 2JJTA 4LKXA 4PGEB 1A7RH 4JO4H 3ZTJH 1BIIA 5E7BA 5FIEA 1U58B 1PW3A 4J3UA 2FH8A 1J18A 1Q9WA 3O4LA 1H3XA 4JPKL 2WUBH 2VUOA 4K3GA 3TBYB 3GSUB 2EICA 3MRQA 5LAXA 2WMPA 3VGEA 4O5LH 1U93B 3MNWA 2CK2A 2P5WE 5EBGA 4Y16A 2ZOLB 4M02A 1UACL 1VEMA 4HS3A 25C8H 5IK3B 5IG7A 1IAKB 1WIOA 3G08A 4YHZL 3OXSA 5F72S 3GSOA 3T04D 5IJKA 1JYVA 4LLQB 1GL4B 1JGEA 1BQHG 3P4NB 1S7VB 2Z8RA 3KS0H 5F8RC 5FO9A 5IT2L 1QO3A 1U3HA 2WQ8A 3AB0C 3STZB 5IW3A 4L3CB 3TFKD 5HY9A 4JVPA 4PP1C 4XP6H 4ALAL 2BSED 3LKPB 4XZUB 3C5SB 1YUHA 2DYPB 4L8CB 2DLIA 2OXHA 3JV6A 3ULSB 3VWJA 5GZNC 4I0PA 5BRZD 4R4FH 4Y8DC 2DQDH 7FABL 3QXUA 1N6VA 5I15H 4XI5D 3DPBA 4PJ8A 1QFWL 1JGVH 2FJGA 4WY7L 1L7TL 4M43L 3SDDC 1A6UL 4OGXH 1HSAB 4GKZA 2ERJC 2XKNB 5JMRA 2EYRA 4JFXB 3MPCA 4RGMC 2QKIA 1MIEH 4KK9C 3IDIA 5FOBB 5IMLA 2VABB 1GOFA 4I18A 5HYIA 4GRWH 4UNUA 3MXWL 2CXKA 3BJ91 3IDYB 4X6CB 1AXTH 3GHEH 1KXVC 4ZFZA 4WTZG 1A6TA 3P9LB 2FEDC 1K85A 4XXDB 3CUPB 5D1QB 2FGWH 4UZGA 2UYLB 4PJBE 3C6LA 5E00B 4DGYH 3QQNA 2F53B 5KVMC 1T89C 1NGQL 4DOHB 3KNBB 3IS1X 5HDQH 4Q9CA 4DVRH 4PP1D 3MV7B 4LQ1A 1RZIB 3BUYA 3EYVA 5F1IB 4LVEA 5I66B 5IB4A 1HKLH 3MNVA 5DUPL 2YUZA 5KVFH 4D0BB 1MWAA 1EXUA 5FO7A 5GZND 4E42B 3LKOA 4WEBL 5TFSH 1KTDB 3M1BA 4NM4H 4QOKD 3LDBC 4TRPL 5LGHL 3SDDD 5CSGA 3B5GA 1DBAL 2J8OA 1NFDB 5ADPH 4XP5L 4PJEE 1IARB 2M8XA 4L8DB 4TSCH 1OQXA 3PHQA 3OKNA 4X4XA 4KK9D 3JWOL 1QSZA 4Y89A 5D4QA 4LSTL 4AIZA 4XP1H 1CICA 2EDFA 4LLVB 1D5ZB 5FYJE 1MFNA 2ICWA 3SDCA 4K3JH 1BJ1H 3RA7L 1VB9A 2YRLA 3VA2C 3L95A 1RY7B 4LLUB 1FYTD 3IKCA 5D7IE 1NMAH 5ICXB 3HFML 1QSFD 1IRAY 4NHCH 3LEVH 2PR4H 2X09A 1U8HB 2F5AL 3GIVA 1YNTA 3TZVA 4KV5E 1WUNT 2VZVA 4R0LA 3BKMH 1P4BH 1X5XA 4LPXA 3U9UB 4H20L 4ZYKB 5E6ZA 3SQOH 3RVUC 2E7HA 2E9WA 3ARFD 5EG6C 2DQUH 4TUOB 1U8OB 1XF3B 2MNUA 4X6FB 2VLJE 2F8OA 1LDSA 4XPHH 4L5FH 2A0LC 4M1CC 1JPFA 1J87A 1IT9L 3VXNA 4X80L 1OWRM 5F1NB 1E4XI 1MHEB 1RV6X 5IESL 2RQ8A 1QSEA 1X44A 5IJVB 4PJIF 3DROA 1GH7A 1FDLL 1FV1A 1OGAA 3MOQA 4FFYL 2DTML 1ADQH 4RGOH 5IVZA 5EOTA 1UM4L 4JQVA 3TO4B 2PXYB 4ZPVA 4LMQE 4CVUA 2HT2C 1IZKA 1DBML 4UAOC 5SWQB 1T04A 4KJQC 3B83A 5T3XD 3B43A 3WMSA 1KB5A 2Y06H 3ZKMD 4NNYB 2EC9U 5EZLA 2YPLB 3S3SA 4PJFE 1ZEAH 4GBXC 1KN4H 2A1WH 4NKMA 4XAWH 3VFVA 3MGTB 4KI5D 3BZFA 2JELL 1Y6KR 3SJVE 3RVUD 4N8VG 2AK1L 4G9FE 4W6XB 4JFHD 5JW3L 1ZTXL 5LGJA 5FUOH 3SDAA 1PX4A 2B0SH 2AI0H 2A0LD 4M1CD 3BX7C 2P8PA 4ZSOB 3V2AR 1FG9C 3VFUA 5SX5K 4OZGE 2A6JB 3CXHJ 5ID0B 4NGHL 4PP2A 4AEIH 2JIXD 4OLXH 3SKJH 1P4LA 1J8KA 4V2CB 3BHBB 4CJ0A 3VXPB 3FQWA 1HWHB 1L6ZA 2P46B 4A6YA 4JG0L 2W0LA 4Z18A 1R5IA 4QXWA 4XCFL 1S9YA 2BFVL 4YBLB 3TEUA 4L8BB 5FGBA 3TA3C 1B6UA 5J11B 2HT2D 4OCNC 3MCG1 2NYYC 4KJQD 1FNSL 2J2ZA 1E4JA 3BP4B 4PJXF 4K9EH 2XZAL 3QNZB 5HGBB 2NX5D 3GO1H 4HS6A 2AK4D 3KPSD 4XP9H 3WLBB 2AXGB 5FM5M 4CBPA 3AY4C 3U9PL 1AGDA 4WWKA 3CLEH 3C5ZA 4EDXB 2PCPA 1QLEL 4MJ5B 4PTTB 4Q9RH 4N8VB 3B3IA 1H3UA 1KJ3L 4GW1A 2Q20A 1KCVL 1JN6A 3NTCL 4QRRD 3K4AA 4JM2B 1VACA 3IJSB 2IMMA 2HLFC 2XYCA 3IDXH 4HKXB 4N5EC 5HXMA 4ZG1A 1MFBH 1FVDA 2YN5A 4P2OC 5EO1B 1MJ7H 3ZSTA 1BOGA 3MLYL 3GSQA 3BPOC 1SY6A 1RAMA 2F5BL 4R7NB 4P2QB 3QXDB 1S9WA 1KEMH 3T0ED 4GG8B 2V6HA 4PJXA 3P30H 3FO1A 4ISVB 3BPNC 3MV8A 2ICES 1X5JA 3CD4A 4OQTA 2CLZB 3ZKNC 1BM3L 1K2DA 5BXFA 2NYYD 4HLZG 3KPRD 4P99A 1S7SB 4HWBA 5DSCB 3WN5C 3R06B 4M8QB 3WSQL 3TPUB 3L1OH 1AD9B 5MENB 1G6RL 4TULL 1OAYL 4N8CL 3IU4H 3LRGA 1V3MA 5GRWA 3S37X 1JZ4A 3CK0H 1CD1A 4HSQA 1LNUA 2IALB 4LARH 4OI7A 2H3NB 2HLFD 2EIEA 1P2CA 3MGOA 1FZJB 4N5ED 3RWDA 3F58H 5FYJH 2GAZA 4OKDA 3GM0A 1FO0H 1DVFA 1N7MH 1AY1H 2AV7A 3ARBC 3CCHA 1BZ7B 4CMMA 2XG5A 2GJ6E 4Y4FD 1NEZB 4ZD3L 5C0AB 5BVJB 5E7FA 1TPXC 1M71A 1FCGA 3LEXA 1KYOJ 3INUH 1XF5A 3DXAD 1DQDH 5DRZB 2PTTA 1WFNA 2V5YA 4UNTA 3BKCH 3AS2A 1MIMH 2VLME 1E28A 1IM3A 3MBED 1SYVA 1FFOB 1NCDL 3FKUS 5D8JH 2FHBA 5F44A 4X0KA 3S88L 5ALCH 1CU4L 2F58L 1WAAA 2Q1EA 5EOCH 3PABB 4QNPE 1J1XH 3VDAA 3GK8L 1Q1JL 3QIWA 1I3RB 4JQIL 3QO0B 3QDJD 4LCUA 3HE7C 2ITDB 4XMPH 3FZUC 5AD0B 2EDBA 3ARSA 4B0MM 5KSBF 1C08B 1J12A 4B7LA 2AV1B 2XICA 1YQVL 4KDVA 4KRPC 2Q76B 3N1MC 3CJJA 3ARBD 4YZFF 4OLZH 1AKJA 1MCEA 2Q87A 1JZ2A 3HC4H 1UB6B 3VFMA 1TMCB 2JB5L 5MERB 4MXQC 2H8PA 2DL2A 3H7LA 3O0RL 4PREB 1R5VB 3HG1A 3L7FA 1OOAA 4LVOC 1QBLL 4O2EB 3U4EA 1N5AA 5K9OB 1TNMA 3S4SA 1JPGA 1Z6JT 2YEZB 5DWUL 5EPMA 2AJSL 2GCYB 4H1LB 1JPSH 1VERA 3GMQA 1U3ZA 2A6KA 4HGMA 1MHCA 1CE1H 2BK8A 2VH5H 2D31A 2VDLH 2H32B 4P59H 1OCWH 4GW5B 4M6NL 1KBGL 4NT6A 3CU1A 4S2SA 3DUHA 2YXFA 3O4LE 4GAGH 2BNRD 3D85D 3EYOA 4NO2A 5EZOL 3DRTA 3JWOC 4I4WA 3IDGB 1PLGL 3HE7D 2BSSB 3FJTA 2SEBA 3D39A 2VXQH 5DC9B 3FZUD 2VDOH 1TENA 4IHOB 1UM6H 4L3EB 3DHMA 2E7BA 3K1DA 5AG9A 2IPTL 4KRPD 3LEYL 3MRGB 2VZ3A 4LKCB 2DLFH 1X5GA 4G7YL 5GGRA 5C0IA 3BPCB 3FOLA 1MI5D 3K0WA 4MXQD 4U1HA 1BEYH 5DEGB 5DA4A 4P9HL 4RFEB 4FZ8L 5IEKB 3JTTA 1J0HA 1J0KA 2MKLC 5DS8A 4Z7WB 3FO9A 1H15B 4XC1L 4G6JH 1X6LA 4Z7VB 2J5LB 3H9SA 5C09D 3FRUB 3S96A 3N1PC 5DDHB 1FFPA 3LN5A 1FFRA 5M95B 2C5DC 2R0LH 3H8NA 3RVTC 3T1WA 4FFZH 5BW7C 4OF7A 1HHGB 1CGYA 3RL1B 2BY3A 3F7VB 1P1ZB 4YE4H 1HNFA 2BVQA 3N1FC 5E8PB 1LK3L 4MA8H 3D1MC 4U6HB 3KLAB 3U1SH 5C7XL 2Z31B 4LFHD 3CX5K 4YDLB 4PRHD 4DUXA 4Z7NF 3ES6B 5M94B 4OCYL 4LCWE 4ELME 3RZWA 1HHKB 5E6YA 4JANA 3LVEA 2HFFB 4NHUA 2CLVB 2XZCH 2ZCKH 5L8KB 1I3UA 2UVEA 3JVGC 2FJHA 3V0VB 5CBEB 1CFSB 4PV8A 2Z0BA 1YNKL 5JIKA 5BO1L 1H8NA 4F8TA 3AS0A 3GSVB 2V5SA 3H9HB 4LLMB 2EDXA 5IW6B 1DEEA 3RGHA 4YIQA 2QQLH 3FCTB 3QQ3A 4AEFA 3ARDB 5GGTL 1MCWW 4OGZA 4KXZI 5BRZA 2L7UA 3RVTD 5IW1A 1P7HL 5I73C 2HRPL 4S1SH 1CLYH 4GRLB 1NAMA 4IRSC 4U1GC 2R0KL 1PKQE 1JF1B 1I9JH 3LOWA 3E1F1 3QI9B 3KPPB 3FN9A 5D2LB 4F57L 1BQLL 4ZUUA 4WJ5B 3B9KB 5CZXC 1EHLL 4WFED 2HWZH 4FS0A 2R0ZL 3U7AA 4BSVA 2PUQT 3L9RB 4LCCC 4OIIH 3L3OA 2AJ3B 1ZK9A 5D96C 4DUWA 1KJ2H 3L3HA 5I1HH 4YWGL 4ZDHB 1BGXL 2VQ1B 4F58L 5EZIL 2GSGA 3ORJA 4AYFA 3QUZB 3IFPA 2VLRD 1XF2A 4PV9B 4WUKH 5I1DB 3U7WH 3VGFA 1VFUA 2KUTA 5CLTA 1XR8A 1F58L 3DTXA 4PGBA 2KQNA 4X98B 3T77B 4IRSD 2A74B 1F13A 4QOKA 5T3ZE 3SDDA 1NCCL 4YR6B 4AIOA 2D7NA 2ATPB 2L0DA 1AC6A 4KKAC 2X4OA 3V52L 1QSEE 5D72H 3V7AE 3HAEG 4ZTPH 3X3FL 2RFXA 1OGAE 4K71B 3W9DB 3RPIB 5BCAA 1JP5A 1AP2B 2EEDA 3BKYH 4UT9H 2AJUL 5CZXD 5DTFA 3WFEH 4LVNB 5FYLL 2YBRB 3VFSB 3TM6A 1FYTA 2D7TH 1I85C 3QJFB 1QSFA 2X4SB 2O61B 5F21B 1K4CA 1J88A 4HJJL 1TJIL 1ZLSH 1T89A 1U92B 3G6JF 1J05A 3MRPA 3SKMB 4YPGB 1ZT7A 4LLYA 2IFGA 3VXTB 3ZTNL 4O02H 3ZL4L 1MJUH 3B4NA 4NUGL 5IMKA 2V2XA 5E94B 5JDSB 3IF1B 2HVJA 3PV7A 4JFDB 4JZJC 4AL8H 3ARFA 1JHKL 4Z77A 2DQJH 3FHQA 4LP4A 4RMWA 4LSVL 3E3QE 2WZPD 3JWDH 5JHDD 4LL9A 3G5YA 4MJID 2NXYC 2VZ1A 4HGWA 4KY1L 4I0CC 1HQRB 4XNYH 5B39G 3S5LA 2EXYC 2DQIL 4KKAD 4ZS6C 3W2DH 3GBNL 3I50L 3CVHL 4XAKD 3TYGH 2FX8L 3V6ZA 1S7UA 1WZ1L 1DQML 4NQDE 2GK0A 2WINA 3OHXB 4S1RL 5HJ3B 3G6JA 4KTEH 4L29B 2W38A 4PJAF 5C07B 3ZZ1A 4OFVA 3GSNB 5JIHA 3KPQB 2BNUA 4HV8B 1MJJB 2Z91A 3WXVL 3BDYL 4NO0B 5E99L 1NDGB 1W72A 1MFDL 1MUJA 4NBXB 3HMWL 4M7ZB 5FA4A 2FLBT 1A0QL 3STLA 4R4NC 5FCUL 4C57C 3WE6A 3V5KB 2DQHH 3HB3C 3ZT5A 1CFVL 1SBSH 3D0LB 3M17B 1MELA 3G6AA 2AGJH 2I9TA 1T1WA 1ZT4B 1UCTA 4X7SH 5TE4L 3DURA 2NXYD 4M4PA 2NW2A 1PDKA 1VGEH 1J5OL 1FFNB 1YNLL 3D87B 2OX5A 4PJ7B 1A3LH 1LWRA 1OWWA 2BC4B 3J7HA 5HHMD 4ZS6D 4G3YL 5E8EB 4JY4B 5I30H 1OAKH 3REWB 3CFJB 3MA7B 5ESVB 1AXIB 3RWEB 4FHBD 4LCYB 3G6DH 4EOWL 5JPNA 1HE7A 3LS4L 3T65A 1FAIH 1MWAH 2Q8BL 4N0YL 4PJDF 4TSBH 1H3VA 3W39A 5J9PA 2F8XC 2HTKC 2NX5A 2J88H 2AK4A 3KPSA 4LGRB 3HMXA 3ZDXE 4HWZA 1I7UA 2V2WB 4GXUM 3M07A 1Z9SA 2OL3A 4NJ9L 4G8IA 3LB6D 5C6TH 1UWGH 4H26A 5IB2B 1NH6A 4DK3A 3HB3D 4PJ5B 4QRRA 2R1WA 2AABL 2AEQH 1MCOL 3P40A 5ESAB 5ITBL 1UWEL 4PTUB 5F3HB 3W9EA 3FQNB 2FYYB 2CIKB 1RUAL 5E08H 1TQCB 2QQNL 1QKZH 3S35H 5GS1C 3TCLB 3U48A 3QFJD 2FATL 1A7QL 1JRHL 4ZAKD 2JK5A 1VGKA 1N8ZB 2NTFB 3PNWA 3T0EA 5IEHA 4FFVC 4PJDA 1HOCB 1OARH 2YKLL 4WGVB 3U2SA 5CIPB 3X11B 4YHLL 1LO0L 5KZCD 3KPRA 3OJMB 5AEAA 3WFZA 2A83B 2NY2B 2ITCB 4P23D 4TUKH 3MRIB 4WTWA 1CD0A 3T3ME 1AXSA 2XZQL 3FFDA 4W81A 4Z0BH 2NY0B 5T3ZH 1WAAE 1ZHKA 2N4IA 5HVGB 4MA3B 4IOSD 1PGRB 3ULVE 3ME0A 1YY9C 3UTPD 4KHTH 4YFEA 4GW4B 4WFHD 5I16B 1OTUC 5EWIL 5HHPB 3I9GL 1TZIB 5E5UB 1BFVH 3NZHH 3MYJB 3X12B 5HDBE 4KJYA 1UGNA 1EVUA 2O5YL 3Q3GA 1B0RA 1A1OA 2CD0A 1RHFA 1SYSB 3DI3B 2NY4D 4WHYH 1KB5H 4U1MA 4JREB 4QHUB 3RL2A 4FFVD 2AKRA 1YYML 4AQOA 1K8DA 3HG1E 1UM5H 5J1SC 3KXFD 4LAJH 5J1TC 5GGVL 5KOVC 3DXAA 5INCB 4EIGB 3SPVB 5L0QC 4LRNH 2EDNA 5EIIA 5CJXC 1YDPB 3WN5A 5FFLA 3MBEA 4JFOA 1RUPH 3CMOL 4EXPX 3VFGH 1OP5H 3CFKA 1B90A 4YQXL 2CUHA 3WIIL 4E9LA 3KPLB 2D0HA 4B50A 2JCCA 5I6XC 3GHBH 4HPYH 3LV3B 2ZG2A 2W65B 5I19L 3QDJA 1YY9D 5A43C 4MD5B 4U1KA 2CDGB 5DF0A 4RMVA 5IVXF 3TC9A 3UYPA 4A6YH 4NZRL 4JFYA 4HZLA 1KFAH 2P8LA 3IETB 3KLHC 1DN0A 1NMBH 2X4QA 3VRIA 32C2A 3PV6B 5GS0D 3ARBA 1BFOB 3WUWA 2I25N 4KQ4L 2XWBB 4P4KB 5FK9A 1ZA6B 3P2TA 4XHQA 3BT2H 3K8KA 1P6AB 2G60L 4TVPE 1TVBA 1IM9A 4ETQB 1TLKA 4QRUB 2W9EH 4LPCA 5F6HI 4AG4L 5T1LD 1JV5A 1AGEB 4G9DB 3MLXH 3MROA 4R3SA 5LBSL 5C0FB 5D71H 2FSEB 3QB7C 3RUGA 35C8L 3QCTL 1OPGH 3GMLA 4GLRH 1T7ZA 3MRLA 2XY2A 2P5EE 3UJIL 5E9DD 5EU6B 1HH6B 4UTBL 1SY6H 2BNRA 4XPTL 1K6QL 3TV3H 3D85A 2A73A 1IEAB 4WNQB 4ZUSB 1QOKA 3HE7A 4X8JA 1ZVYA 1S3KL 1JGUL 1WBZA 3WJJC 2FNBA 2NLJB 1G7HA 3PGCA 4NUJB 1GGIH 3LS5L 5E8OB 5IM7A 2FX9H 4OQTH 1IEBB 5HGAB 3HE6B 2VXTH 2AQ2A 4UIKH 3LD8C 1JL8A 4HWBH 1T22B 4MJ6B 3MNZB 3RX8A 4GKSB 3MLZL 4JO2H 5CEYB 4GRWB 4FABL 5DJ2B 4UU9A 4P5TB 4YFLI 3FAXA 3SEPA 1RFDL 3KG5A 1MRCL 2CDFB 3QIUC 3FB6B 3L3KB 1P7KA 4Y4HB 4F7PB 1E4WL 1AIFB 2HN7B 5C09A 5TGBB 4GQ9L 5F6IC 4Q2ZA 2E7CA 4PJGF 5L9DH 4LHUG 3D3VB 4GMSL 5AG8A 5JXAL 3TWCH 1WWBX 3RTQC 3NCJH 5BRZE 1QA9A 4WU5A 4BQ6A 3D0VB 4S11A 1TCRB 1RHHA 1Y18A 5MI0B 3T8XA 2IPUK 4EJ1C 4RIRA 3BIAX 4XP4L 1ZT1A 2BP3A 4GO6B 3PDDA 4ZFGH 2FX7H 3MUZ1 4YC2B 2X4PB 4NRXB 1C5BH 3PGFL 5FYLD 1I1CA 5EBWB 4JHWL 4PRDB 1UZ8A 4PRHA 2BSTA 3U0PB 2UV3A 3GBMH 1F6AA 5C08B 1KGCD 5L2KD 3D6GA 3EKCA 3QBTB 3R1GH 5F7LB 2BNQE 1EH9A 2XRAL 1QD0A 3UBXB 3RFZC 3ILQC 3I6KA 3DGCR 4S1QL 4PJGA 3HUJB 5LQBH 3UZEA 3BMVA 2GUOB 5C0CB 3NZ8A 4OCRH 1MAML 1NLBH 2Z93B 3FQRB 2OM5A 3DMMC 4XVJL 5J4MA 3IGAA 1L0XA 3PIQB 4WUUD 1T1YA 5DRNB 1J0JA 4G8FB 3RTQD 5F7HA 3D18B 5BW7A 4S10A 1RZKH 4AH2B 2HP4A 3VGAC 4ODSH 4QOKE 2FBOJ 1G7JB 4ZTOH 3L5XH 3S36L 3TIDA 2CMRH 5T5FH 3HZYB 4QRTB 4YUEL 5HHOE 4K7PL 3K2MC 2X7LB 5KVDL 2MQ0A 4ZO9A 2E27L 5DZLA 5FYJU 4NQXB 3QDGA 4GAYA 1DL7L 1FYTE 1FG2B 3NABH 1QSFE 3VWKD 3F5WA 1AQKH 3GMNB 2R0WH 4KMQA 1ZLVH 4JGUA 3BPLB 5C0DB 1A7NL 4YHNB 4WI9A 3ROOB 3LN4A 5ETUA 1GGCL 3F7QA 4TPRL 2GQHA 1F3DJ 1XF4B 3X13A 4M1GL 1MHHB 1V5JA 5JORB 1N64L 2VLRA 2XWJB 5DQ9A 3HNSL 5FYKL 3DMMD 3VW3L 3O6FD 2HJFB 4DFHA 1E0OB 3EOTL 2VIRA 2EDRA 4RNRB 1CE6A 3FRPA 1IAIM 2RIKA 3GM8A 2WANA 4CVZA 2H9GA 2N7BA 4IRSA 3DBXA 1QLFA 2ICEA 2QLVB 5EUOA 5IB5A 1LD9A 5IIEB 1CFTA 4ONFH 3MA9L 3HNVL 2P5WB 2B4CH 4ODHH 5CZVH 4JPVH 2ZG3A 4MX7A 3ZKXB 3QZWA 2OJEA 1CL7H 5IKCA 4KMTL 5GGQH 2B5IB 2D9CA 4PPTA 5DZNA 1TETL 3VH8G 5BV7L 5C3LD 5JQ6L 1VKXB 4N9GB 3OKEB 4JO4L 3G6JE 1YEJL 1JNJA 4BQ8A 4HIEB 4QXTA 1MCSA 2UZIH 5T3XE 2HFEB 1WBYA 4GRMA 4H5SA 5EBLB 1YEDB 3UO1H 3P77B 3WNLA 3BP7B 3HCVB 3KYNA 5IV2A 2EDDA 4HPOH 2IWGA 2I26N 4OF6A 2H2PC 4FQHB 1PQZA 4MCYB 4KI5E 4UIMA 5DMGC 5H2BB 4DQOL 3DIFB 2ZPKL 1UH3A 4U1JB 2Y25A 2V7HB 4JFHE 4M8VA 5EIQA 1DBBL 4XC3H 1CDHA 1HHIA 2VAAA 4P57A 2F8VA 4X6DB 1EEYA 1JZ5A 1N59A 5JHDA 2CR6A 5I1LA 2R2HB 2WWKT 1OAZH 4KK6C 3L7EB 4MJIA 4Z7QF 1MCLA 3ABZA 4QF1A 4IDJL 3F7RA 1UXSB 5SX4I 1MPAH 4J2XA 1N6UA 4LSPH 1RVFH 5C2BH 3OZ9L 5J3HC 5LKNA 1RU9L 3MOAH 4M5YL 5D7LD 1JVKA 4G80B 3HC3L 1CFNB 4FQLH 4KTDH 4BH8A 2HTLD 3NCEB 4YJZL 1CDGA 3IRZA 1Y0LB 1I85A 4R4FL 2DQDL 5C0GB 4J12A 1TJHL 3OKLA 2ENSA 1QRNB 4FQIH 2BVPA 2GT9B 5DHVB 1MOEA 1G6RA 1T5XB 2B20A 2NX5E 2ID5A 1EHXA 1ETZA 5IOPA 5CSZA 2H2PD 2YC1B 5DMKA 5FDWB 1NAMH 5GS3A 2NQCA 1MIEL 4Y19B 1OSPL 5DMGD 4ZUWA 3G5ZB 2BMKB 5I1JL 4JZJA 3N1GC 5C6WH 3ESVF 4Z7UF 5IQ9A 1FLRH 1YY8B 4QRRE 1AXTL 2OR9L 3GHEL 3QXAA 2WAHA 4QYOB 3GBLA 3JV4A 3RZCC 4KK6D 2FGWL 3IFLH 2ARWA 1A9BB 1CXKA 4UUJA 4DGYL 4Y5XC 2C1OB 1OW0A 1NL0H 2VLLB 4V1DE 1G9NH 4QHKI 1XGPA 5HDQL 1KULA 1TJGH 4DVRL 5J3HD 2YK1L 3ARWA 9CGTA 1MY7A 4HJGB 4F80A 2K9UA 3L3DA 1CCZA 3QG7H 1B88A 1HKLL 1FO0B 1D5XA 3T0EE 2YD1A 4XXCC 1JZ6A 4NN7C 4PJDE 5LVEA 5F7DA 1UENA 3HTLX 4U1LA 1GGBH 1XF1A 5HI4C 1D9KC 1ZHNB 5TFSL 4GKNA 3KPRE 4PLJD 4CMHB 3TO2B 2X10A 1P5UA 4KAQL 2RJMA 1JGLL 5ADPL 4TNVF 3U4BL 1DSFL 1PBYA 5TDOB 1UVQA 4UDTA 4BKLA 4LPVA 2I07B 1WTLA 4MB4A 1GVIA 4ONGH 4U7SA 1MCQA 4HGKC 2IPUG 3GMOA 3MXVL 2QSQA 3TVMB 4K3JL 3MLSH 4GG6F 1YEHH 2QADC 1V7MH 3RBGA 3MYZA 3RZCD 3QIBC 1UG9A 2E8YA 4FXKB 4NHCL 3LEVL 1E6OL 3QFJA 1FRGL 3BZEB 5F96H 1BBDH 3EHBC 5CILL 3VXMB 3QEQB 1KPRA 3ULUL 4UV4H 2X6MA 2ZNXA 3SQOL 1HZHL 3WFDH 3WDIA 2ZSWB 3K3QA 4QRSB 4MNHA 3NBNA 4I77H 3C8DA 3HC0A 5HI4D 4XPHL 3VFTB 3DXAE 1D9KD 4FNLH 1DE4B 3VJ6A 4P23A 2R8SH 5F9JB 1SJEB 2XKSA 4JDVA 4HWEH 1JK8A 2AJZA 4R2GC 5DT1L 1S7RB 1YMHB 3SJVB 5GHWH 4HFWB 5EC1A 4GG6A 1R24B 4KZEH 2HT3C 4G9FB 4M61B 2JCCE 3U0WL 4L4TB 3EFFB 1SJHA 4DCQB 4MWFB 2HH0H 3BEWB 4RGOL 3BVNB 1EMTH 3TNNA 3QDJE 1NMCC 3IRPX 2VZTA 3MRBA 2GKIA 4DKDC 1EA9C 3ZE0E 3BAEH 4OCXH 4G42A 4AMKL 3KHOA 1CQYA 5IR1A 2EDLA 5HVHB 5GS1A 5EC2A 1I7ZA 2GTWA 1QVOA 4OT1H 5J12B 1EAJA 3I6LD 1ZEAL 1U8MB 3QFDB 1KN4L 2QR0A 5HHVH 4EVNB 3EHBD 4FTVD 3AMLA 3ARGC 2Q7YB 2IADB 1JCKA 3MRHA 2NW3A 5JO5B 1W72H 5E6IB 4LASL 1CDYA 5DUMH 4JFFB 4H88L 4QRPD 3HZVA 5IQ7L 5F8QC 1U8KA 1DQTA 3KXFA 3Q6FB 1F00I 2EH7H 1BQSA 5DD5H 2ZCHH 3PGDA 2Q7NA 1UKSA 1ORSA 5HI5C 4Y1AB 4NOFA 1T5WA 3WO4C 4C54A 3FT4A 3H3PL 3OKKA 5C9JB 1C1EH 1X5IA 1KIRA 4MS8D 3RUGE 3MQIA 4R2GD 3TN0C 3WFHB 3LRSA 4GUPB 2HT3D 3FOMA 4MNGB 5ADOH 2BNRE 5E4EC 4F7TA 2DQGH 1NFIA 2QQKH 3LKNB 4BSWB 5IHZB 2OTWB 5GPRA 4KROC 4E41B 5I1GH 3ZE2E 3VD3A 5E1AB 3VI4E 3L3GB 2IH3A 4C55A 5KTEH 3GMMB 1D6VH 5F89A 1NDMB 5FECA 4J3SA 3EOAB 2ZUYA 5K9JH 2H1PH 3GSRA 1T7VA 2VB5A 1MI5E 1INDH 2DBLH 4LLWA 3BP6B 4NQCE 2X89D 1OT2A 4K3DH 3HMXH 1DCLA 4EBQH 1W2KT 5D1ZC 5GIRA 2NCMA 2OL3H 1HIMH 3WXWH 2XPGA 2IAND 3IDXL 5T1LA 1MFBL 4R9HA 5C09E 1YECH 3IXAA 4HXAL 5CJXA 5GGTA 1AH1A 3O8XD 2PYEB 2VL5B 2GFBA 4Z7OF 4L9LC 5DD6A 3TN0D 4EI6A 3U7YL 4LNRB 5E9DA 5ESQA 3F6IA 1QPPA 2DMKA 1KOAA 4R90H 5DEFB 4P46C 4NPYB 4KROD 1KLGA 3P30L 1OP5K 2DKUA 5BV7C 5I74B 1ND0B 3BXNB 5HHXH 1ZGLM 4OD2A 1B0GA 4XNMA 4TQEH 5F7NC 3HR6A 4TSAH 5HPOA 3SOBH 4ZODA 4PRHE 5B38G 3MLVH 3BRDA 4LHQB 5FB8A 3U36A 3WFBH 2IPKA 2GJ6B 4JEGB 4BA8A 5DRWA 5E2WH 1LP9F 2IG2H 1KCLA 2WW8A 3P0VH 4OKVB 1DQQA 2VZSA 1S7TB 1FIGH 2WBJB 3CK0L 2Z35A 4Y2OA 2AXFB 3FONA 4LARL 2BOCA 2HT4C 1KB9K 3G5XB 5FYKD 4DN3L 4XNZC 1FNGA 3BN9C 5ALBL 1AGCA 2EECA 1WT5A 4OGAD 5DR5H 3PWPD 4P48A 4XMKL 2HVKB 5IFJB 3QRGH 1KELH 3VG9B 1IVLA 2F74B 5CJQH 2JTDA 3MR9B 2DMBA 1A14L 4K94L 5KG9A 2R69H 4X8XA 4HKJB 3QO1B 3CFEA 4XCNB 4C56B 3BSZL 3NIDF 2G9HB 4AQ1B 1RUQL 4P46D 3MRCA 1LVEA 4M9PA 5AZ2H 5D5ME 1YMMB 5DMYA 1RSFA 3WJJA 3UBXI 1ZS8B 2C9AA 2D7MA 1MIML 1MF2L 3ARXA 2RCSH 1FP5A 8FABA 3PHOB 3DO7B 1VPOL 3VCLA 5D8JL 2X4NA 3IJYB 5ALCL 5I8KL 2Y5TA 5L2KA 3ALXA 3MX0A 4U6YB 4EI5B 3VFPA 3OPZH 3WV0A 3B9DA 2ZUXA 4JPKH 4HIJA 5BJTA 1NCWL 3MLRL 2HT4D 4XMPL 2FWOA 4L8SB 3QIUA 2CKNA 1A1MA 4JAMB 3UTQB 2HAZA 4LKXB 2VLRE 1KJVA 3CDYA 2ED9A 1BIIB 4J3OC 4WUUA 3FT3A 3MRMA 3O4OB 2AP2A 1UACH 4OLZL 3RTQA 3KLDA 4N8PA 3HC4L 4U1SA 3Q0HA 1X5ZA 4ZFOL 4K7FA 2VNCA 3MRQB 2BY2A 2QSTA 5LAXB 5D2NC 1I1RA 5EUOE 3MNWB 2RHEA 5GSVA 4FQPA 4DFIA 3VA6A 4P3DA 1I1YA 4Y16B 1HINL 2P47B 4X4MA 4HH9A 1X5LA 5IG7B 2XTJB 3RU8H 4XBGB 2L4OA 4MJ2A 1AI1L 1YEIL 2CPCA 3GSOB 1CE1L 1HYSC 4WRLA 1JBJA 1JGEB 2VDLL 4OZFB 2CLRA 2VN4A 3QAZB 1CQKA 1IGML 5FO9B 2NY5L 3VWKA 3WIFA 3QEUA 7FABH 2VZOA 1IBGH 3MMEA 1JIBA 5HY9B 4JGMA 1QFWH 4GFTB 5D7JC 1L7TH 4HEPG 4JRYD 2JB6A 1YUHB 1BMGA 4XVSH 1A5FL 4QGTA 3DMMA 2DMCA 3JV6B 5HYSB 4KHXH 3C8KA 3O6FA 1KC5H 4I0PB 1NPUA 4TYUA 4PJ8B 4D94A 3IDNA 3RBSA 3MJ9A 5TDNA 2FJGB 5JHDE 2V7NA 1TVDA 3DUSA 4MJIE 2X9YA 3ALPA 3IT8D 1IILE 1BEYL 1W0VA 4O51A 4YDIL 3JBG7 3ULUC 2EYRB 1KTLA 4PRPD 3IDIB 3QUXD 4JG1L 5IMLB 4G6JL 1NGQH 4I18B 5ELIA 1MLCA 3A6OA 3M8OL 4MDJA 4XAKE 5F9WC 4MB5A 1M05B 4HG4J 1PG7X 4ZFZB 1XGUA 1A6TB 1LO4H 1WZLA 5DUPH 2EKSB 4KZDL 1HYSD 4KKBC 3QDAA 1U8PB 1GGYA 3C6LB 2EDKA 3UXFA 5C8JB 4U1NB 3B2UC 4R7DA 4UNVA 2D7PA 4WEBH 4FRWA 2WM0A 3WEXA 1PG7L 4NQTA 4YX2H 5D7JD 1HH9B 5DQJA 4YE4L 4TRPH 1V7NL 1FNEA 3BUYB 5FV2A 3EYVB 5LGHH 5F6HJ 4UT7L 4XP5H 3BN3B 1KLUB 4QLRA 3U1SL 4PJCF 1MWAB 1EXUB 3JWOH 1ZLVK 5FO7B 3QUMA 4YPJA 4C83A 2OI9B 4LSTH 3LKOB 4QHMA 1T1ZA 2X1QA 1QBMH 3CFBA 3RA7H 1MSPA 4KJPC 3HPJB 3HFMH 4HKBA 2OMNA 2XZCL 3ULUD 1RJYA 3MFGB 4X4XB 1T7YA 5E8DL 4WV1C 1S8DA 4WO4C 3AXLA 5HHME 4AIZB 1MHPL 2F5AH 3V7AG 3O3EB 1AR1C 2WWMC 3NIFF 4XPBL 5D7LA 1U95A 1XGTA 4YHYB 2WSKA 1AHWC 3I2CH 2BCKA 3L95B 1REIA 1IEHA 4KKBD 3OF6D 4MAYC 1NUGA 1WFTA 3B2UD 4LQFH 4WHYG 4WI7A 1JMXA 1YNTB 4OI8A 4N5UA 4PJCA 4R0LB 2A77H 5ANMA 3TPKA 2CRYA 1I9JL 3VFOB 1U2HA 1WISA 1GZPA 3NACL 3QWOA 4ZOBA 3T4AB 2OCFD 1V3LA 4HT1L 2X4RA 2BRRH 1AQDA 3FFCD 4Y2DC 4FFYH 3UTSB 1AGFB 2HWZL 1JPFB 2LFGA 1C5DA 3VXNB 5ISZD 3EDDA 4EQ3A 4BELD 1DBMH 3C09B 3SKOB 3IAQA 3QFJE 1KJ2L 3SGJC 1V8HA 2GW5A 4NZDA 1TITA 4ZOEA 4XPFH 5I1HL 3SCMC 3DROB 1OGAB 1AR1D 5EOTB 3KPOA 1Y6MR 2JELH 4ZPVB 2NXZB 3U7WL 2EYTA 2AK1H 3B5HA 3N85L 2ADIA 1T04B 4P5MA 4MAYD 1ZTXH 3C6SA 5DJ0A 3E2HC 2YD5A 1K4DA 5D1QD 3VFVB 1BZQK 5SWZE 1N5YH 3BZFB 3QJHA 2GJZB 4NGHH 3EJYC 2IEPA 3FB7A 1Q9OA 2G5BB 3UMTA 1DEDA 4ODUA 2PNDA 3VE0B 5DUBB 4HUNB 1QP1A 5LGJB 3SDAB 4GQPH 3BKYL 4UT9L 4PJ9C 2DIBA 3UTPE 6FABL 1UYWH 4R97B 4XCFH 1GCFA 4WFHE 1INQA 4PIRF 3RZCA 3VFUB 1T7WA 4LMQI 4PJIB 5TQ0L 3IXTA 3I75A 1U3JA 1XZ0A 1FJ1A 3FQUA 3OAUH 1FNSH 4IM8A 3CH8A 3KPMB 4D8PA 2XZAH 2KH2B 3B8YA 3SCMD 4RMUA 4XRCB 3U83A 4C4KT 1S9YB 4F7MB 1QLEH 4RGNE 4XXCA 1KJ3H 2DQJL 2XT1B 2VISB 3NTCH 3JWDL 1D9KA 4XBPA 12E8H 2PXYC 3U0TA 1AGDB 4IEFB 4WWKB 3MLYH 4K94C 3AM8C 3C5ZB 1H9VA 4JDZA 4CW1B 2PCPB 3EJYD 1H3PL 1N3NA 4OZ4A 2F5BH 2FZ3A 1MFCL 3HPLA 1JN6B 2VR9A 4PGJA 3LKRA 4PJ9D 4ZNEA 4RDQG 1FVDB 3EBAA 3RY6C 2R2CA 1BOGB 1JHTA 4OLWL 1BM3H 3NIGF 1C7SA 1X5KA 2C3VB 1I4FB 2ATKA 4KVNL 2UVFA 4FTVA 3WSQH 2R23B 5H35B 2D03H 3ARVA 1U8LA 2W0FA 1G6RH 5B39A 3NCYS 4PJXB 4N1HB 1EV2E 3MV8B 4X7DC 5DO2C 4QRPA 5E95B 5BXFB 2HLAB 1HN1A 3IFOB 4XVTL 2R2EA 5C0NC 2AGJL 4IS6A 4F3FA 2OP4L 2PXYD 1A7PL 4JFZL 5L6YH 2Q3AA 4OZHF 3X3GH 3DSNA 2FIKA 1MCPH 1WJ3A 3S37H 4DW2H 1SMOA 4Q97A 4YHMH 2YPLD 1S9XA 2EE2A 5E9DE 5C6PB 1M7DA 1LNUB 1P2CB 3MGOB 2P24A 3RWDB 5EN2A 1OD9A 3P4MB 4LVHB 5JLZA 3N9GH 3UCRA 2GAZB 4OM0H 1FAIL 8CGTA 1TTFA 4A2LA 4NKIL 1CFBA 4ZOCA 2J88L 5CP3A 2NY5C 2DOCA 3CVIL 1JMZA 1NCDH 4APQC 3ARGA 2R29H 4ZFFA 3S88H 1AJ7L 1DJSA 3AFLA 4J4PC 3L5HA 3SDYH 3LEXB 2X89A 4H0GA 5DO2D 2ARJA 3IVKA 4OZHA 5MEQB 4CDGC 1EEZA 3GK8H 5B21A 2PTTB 3P9MA 3ARUA 5C0ND 4AJ0A 2IANA 1BVKA 4Z7OE 1MJ8H 1G7IA 1E28B 4EEEA 1CGTA 1QKZL 1FSKC 3O8XA 4G6AC 3DYMA 2AJVL 2E9JA 4X0KB 1YQVH 3TN0A 4JO3L 2X70A 2EDTA 3RWJA 1NGYA 1MCKA 3QIWB 2VSDA 4ZMAT 1FL3A 1RJLA 1ULVA 1QHPA 4JFED 2YD2A 4Q0XH 2VXSL 1QBLH 2PYFB 1WBXA 3TCXA 1PZ5B 1I3GH 4ACPA 5HSFA 5DWUH 2N56A 3CPLA 4QHKJ 3VFMB 1UH2A 4FQ1L 4N68A 4APQD 1CXLA 5KN5A 2H8PB 5T3ZL 4M6NH 4QWWC 4N0FB 3KJ4B 1RZ8A 1N5AB 2XA8L 5D1ZA 1LEGB 1JPGB 4KHTL 3S4SB 5EZOH 4MDIB 3DVIA 4DGVL 1EJ6A 1PLGH 4OZIF 4F15B 3OKOA 1MHCB 4AY0A 3PWPA 2D31B 3O41A 4G6AD 3EO1A 5LG1A 4WUUE 3F12B 3LEYH 5D1XB 4L9LA 5ERWA 1W0WA 3U46A 3QEHB 4G7YH 1NC2A 1IAMA 2XFXA 3K4DA 3QDHA 3DVGA 1FNHA 1KB5L 3G9AB 2XQBH 3TNMA 3DRTB 5KSBB 5MEND 4I4WB 5HYJB 4LGSB 5IUSA 1TVHA 4P46A 2SEBB 3D39B 5HVWA 1OAUH 1RZ7H 2P49B 4MQ7A 4FZ8H 4FXLA 4X4ME 4LRNL 4XC1H 3FQTB 4YHPA 1RUPL 3OR6B 4KUCD 3FOLB 3VFGL 4Z78A 1WWAX 4HIIA 2CDEA 2PO6C 5INDA 1HKFA 4WFFE 4E0RA 2APWA 2DD8L 4U1HB 4BFGA 1PX3A 4QWWD 4HPYL 3ZDZF 5EB9A 3JTTB 4OZIA 5GS2H 5A2JH 3IB4A 2X1OA 5DS8B 2VSCA 2X1PA 3FO9B 5TDPB 3KYMA 5JW5B 3IAPA 2ARJQ 3H9SB 4HMDA 5C0AD 4A6YL 3U6RA 1DZBA 3S96B 1I9RL 3PXHA 1LK3H 4BFIA 3LN5B 5KS9A 3K1KC 5C7XH 3EW3B 1SVCP 4PLNC 2W9LA 1AGBA 2R4SH 4JZOA 3T1FB 3VDCA 3M45A 4OCYH 4ODWA 4XCYB 3BT2L 4PY7A 4F33A 5GS0H 2O93L 2BVQB 4UV7H 4MNQB 2CKBA 2BVOB 2BHZA 4O2FB 5CEZD 3IJHB 3P11L 4IMKC 4XX1G 1Z0NA 4PJHA 2OZ4A 3STBA 4WI4A 1YNKH 1M7XA 5BO1H 5CJ5A 1ZKAA 1HXMB 5IHBA 1BHGA 1GGUA 2LTQC 4UBDC 4OCSH 4WW1A 4JANB 4M7LH 4RISL 2PO6D 4CUCA 1PY4A 4NHUB 5GGTH 2FJHB 3L6FA 5CINL 1LO5B 4X9IA 2R0KH 4JRYA 3QP3A 1A4JA 3H3KA 5HGHA 1QLRA 4M93B 1DEEB 2QBWA 1DBKL 2NY6C 4HAGA 3MV9A 4YIQB 3MRRA 3SDXF 3QQ3B 1BQLH 5IW1B 5BRZB 2VLMD 2VXTL 2BOBB 1NAMB 4U33A 4HWBL 3GEWB 2R0ZH 5D2NA 3HRZA 5C92A 4WI8A 1FGVH 3EO0A 2GTZB 4PRPA 3QUXA 5DD3L 1AD0A 1D5MB 5L88L 4YWGH 5D7LE 3ULUF 4KK8C 4F58H 4BYHA 1DUZB 2Z31C 4IJ3C 4L3ED 1PD6A 4UBDD 4BSVB 1JGDA 3NCJL 1F58H 4J3XA 3D5OF 4ORZC 3L3OB 4UILL 4JLRA 3AB0B 5IJKC 1EAPA 1ODAA 2APBA 2HJKA 3BH9A 3L3HB 1SJXA 5D7JA 4LLDB 3SDXA 1Y6NR 2JE8A 1NUDA 2GSGB 1IGIH 1U3YA 5SV3A 1XF2B 1FBIL 4YXLL 1C5BL 3V52H 4HQQL 2X4UA 3VD9A 5F9AC 3DTXB 2BX5A 4FQXB 2ICWI 2AJUH 4RWHA 1M4KA 5FYLH 3SDDB 2DTSA 4NCDA 1P84K 1UCBL 2ERJB 1H8OA 4RGMB 4HJJH 1FVEA 4OQ1A 1A6AA 5DRXA 1TJIH 5CWSB 3SY0B 3GSUA 3WIHL 5LQBL 2RFXB 2JJWA 4OCRL 1NLBL 3W0WB 3ZTNH 3ZL4H 4DUVA 3H0TA 3ULVL 4KK8D 1U93A 4X9HA 5K9QG 4O58L 1CXEA 1K8IA 2Z31D 2MPAL 2IAMC 2X05A 1FYTB 4GKOA 3MO1A 3OF6A 3SE9H 1JHKH 2APTA 3B9KC 1K4CB 5IK3A 1IAKA 1RZKL 4LSVH 3VMPA 4ODSL 3MRPB 3SE3C 4LLYB 4LLQA 1CDCA 4EKXA 3P4NA 4YEEA 4JJ5A 2V9QA 5IB3B 2HVJB 3STZA 2CRMA 4L3CA 3T0VA 2FR4A 3BZDA 2DQIH 4RSVA 4Z77B 3V0AC 3GBNH 2B1AH 1JWSA 3FFCA 1IQWL 2FX8H 3QUZC 2R1XA 4P0DA 3LKPA 4XZUA 3C5SA 1UC6A 1BECA 4KC3B