4YEEA

Beta2 carbohydrate binding module (cbm) of amp-activated protein kinase (ampk) in complex with glucosyl-beta-cyclodextrin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
82
structure length
82
Chain Sequence
QARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-AMP-activated protein kinase subunit beta-2
publication title Determinants of oligosaccharide specificity of the carbohydrate-binding modules of AMP-activated protein kinase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Sugar binding protein
total genus 13
structure length 82
sequence length 82
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R
ec nomenclature
pdb deposition date 2015-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yeeA00
4HC1H 1B90A 2VL5B 3K80A 3QQ3B 4F9LC 2WP3T 3SDCD 3V8OA 1MHEA 2HN7A 4NQUA 1PKOA 4RFOH 3GSNH 3WIHL 4J1UB 4LAJH 3QDGB 3P3YA 1G7QB 1UYWH 2AABH 1CR9H 5ESVA 1ZV5A 3MBXL 1JHKH 4XRCA 3BGFC 1N6QH 4AEIL 5DJ6A 3RJDA 4UIKL 3QI9A 3MJ8B 5DQDH 3IDXL 5IIEA 2ZSVA 2XXCB 4H0GA 4DZ8A 4U6YB 3BGMB 4UB0H 3CFKA 2IPTH 3LH2L 5J11C 3WFDL 3S34H 3FQRB 3N85L 4LLYB 3QDJA 5B39A 4LCWD 5AZ2L 1A22B 1A7PH 2C1OB 3A6BH 5KTEH 4X4ME 2FH6A 2WUCH 5HHME 4LOUC 1HKFA 1K4DA 3I6GB 1QR4A 3IFOB 4JANA 4ODUB 4YJZL 5D7LB 2GK0B 1R3KB 4OJFL 2Q3ZA 3SDAA 2V2XB 5IHLB 4K3EH 3SDDD 3WXVH 4HZLB 2HT2C 4Y5VB 3W0WE 3OX8A 4MNGE 2YKLL 2C4FT 3ORJA 5ISZD 1A3QA 2YPVL 2W1NA 4PJ9D 2DM2A 1L7IH 5TE4H 2EO1A 2X2YA 1CICA 2AEQH 2DMBA 4NKDB 2C3XA 3VWJD 2R69L 4ACPA 1P5UA 2FR4B 4NKOA 1ZLVH 1FVCA 4B7IA 1AIFB 1P9MA 4ZAKA 4HV8A 4H5SB 1SJVA 5GGQL 2GCYA 3MLRL 5E94A 5MI0C 4H26A 2WIMA 4S1QL 5ICZB 4CAGA 1K8IB 5EU4B 4NHUB 3P4LA 1NUDA 1ZA6A 3EYQD 4RFNC 2MWCA 4R8WH 3TO4B 5K9OA 4O51A 3VRJA 1J05B 4WUUD 1XGPB 3AY4A 1LD9B 2HWZL 4QRUA 1OSZB 5EZOL 3IXTA 3MV7B 5C0BD 1F6AA 4RSVA 2XTJB 3QISA 2FBJH 4G80B 1DUYA 4CW1A 2J6EL 3ABZA 1YDPA 3ARED 4QOKD 3UTZA 5CJXC 5C08D 4NO2A 3Q1SL 1AD0B 3IU4L 2FX8H 1MNUH 3V4VH 3S37H 5JORA 5GSRB 1GRWA 4EI5B 1VPOH 5IFAH 5JIKA 5IB3B 5HDBE 3BZEA 3QQ4B 2K3TA 3A0OA 2GY7B 1MCFA 2C3HA 2PUQT 3N1PC 1JWMB 4ODWA 3VFOB 1IAMA 5DMKB 1OAZH 3MLVL 3RVTD 1A7QH 4Y89A 4ZQKB 1CLYL 4NWUH 5D7IB 1A9EA 3VWKA 3SGDI 2V2WB 5CINH 4LLDB 3RGVC 4BFIA 2VYRE 2EDNA 3MZTA 4M9OA 2VDOL 1JK8B 4P5TB 3MRMA 1I9EA 5DMGC 5K9JH 2EEAA 3QRFM 3MGAA 1WQVT 3U30B 1VGKA 4FQLH 4Q6IB 1YNKH 3FOLB 3MUJA 3HRPA 4IHOA 2EDWA 5DI8B 4PV9A 5MENA 4LPTA 4M48L 3IJYB 3P0YH 3VXSB 1IVLA 4UILH 5FKPA 4KROD 4X6DE 5TDNB 4ZS6C 1IMHC 1JZ6A 1LE9A 5ICXB 4P46C 4NDMA 2PTVA 2H1PL 4L4VA 1TQBC 3W11D 4NOFA 5CLTA 4F9PC 2EYTB 2VDPH 4OZHB 1QSFD 2LU3A 4ENEC 1EUTA 4LSQL 2A1WH 4AEHL 1CBVL 5T1KB 1MFCH 4N0YH 1FYTE 5CJQL 3O0RL 2J4WH 4CN6A 4TOYH 3OG6B 2WBKA 4X98B 2DJUA 1ADQA 1EO8H 2LV4A 1JPTH 3NA9H 3ARFD 3BKML 4Y1AD 4HX1A 2EDOA 4M6ML 1UXSA 3MUGA 4R4FH 2CH8A 1WTGT 3D85A 1CL7I 3C08H 3H7BB 4WUKH 5D7IF 1BREA 4JY6A 2XWTA 3H0TA 4PJ5E 5HVHC 1OW0A 3KYKL 5DR5L 1FGNL 2PXYC 3MFFB 5HPMA 1MJJA 3O6LH 1DQLH 3EYOA 3MCKA 3RWCB 1S9WA 2BSRB 1TQCB 2EH7L 1KCUL 3KWWA 1JYXA 4L3EB 1IGML 2KUTA 5HYQB 4JR9H 2XZAL 2ATKB 4AIXA 4UQ3A 4NHCH 1LO0H 3GMRA 5DYOB 3OZ9H 5HI5D 2ITCA 3T0VA 1QSED 1UZ8B 3MRHA 2IH1A 4JFOB 5HHQB 5GHWH 1MFBH 2P24A 5T1DL 3SDXE 3RJQB 1A7BA 2Q86B 4JLRB 1JPSH 2NYYC 1O7VA 3C2AH 4YX2L 1I9JH 1I9IH 1WIPA 4OZHF 3MOAH 4UV4L 4OGAC 3CVIL 4K3JH 5IW6A 5DD6A 4MA7L 3FQRA 1RU9H 1YYML 5F7UA 4GMTL 3KLHD 3FN3A 4LLYA 5BW7C 5IR1A 2EDKA 4XCCH 3E6HB 5KOMC 1EEZB 1I7TB 2HFTA 4F15C 2FSEA 4NT6B 3I6GA 1AD9B 4PP2B 3CFEB 5D2NA 1RJZB 3IFOA 1BP3B 4KVNL 2AJ3B 4ODUA 2R1WA 3L3KA 3FO1B 4HS8H 1P4BH 3VG9C 1HILB 2Z93B 4Y5VA 1KACB 5IESL 4TUOB 2BNQB 1X6LA 4J3WA 1HE7A 4YHZH 1QR1A 1IGFL 2JJWA 5EU7E 3FN0H 3H7LA 3ILQD 3WIHA 4NKDA 2FR4A 5DEFB 1N5YL 4YR6A 3SDCC 1CFVL 3BQUB 2B2XH 3IGAB 4OF8A 4NO5A 3BD3A 4ODXA 1IKNA 4M5YL 3MV9B 3TZVD 4XT1C 3AM8A 3FT3B 5ICZA 1K8IA 3VGGA 4YDKL 5DUPH 2D9QB 4C57C 4EN3D 4HWEH 5JIHA 2P46B 3TO4A 3FQUA 1FGVH 2OJZL 5CCKH 1HHIA 4PBWD 1FZKA 1WAAF 3NA4A 2I9LB 4C56B 1Y6KR 1OSZA 1IBGL 3MV7A 1VESA 2DIBA 3I50L 5IB1B 1I1CA 4BZ1H 2WK2A 3VXUE 2AJYH 2YUVA 1G9MC 1R0AL 5LCVL 3O2VL 4NZTL 3UTSA 2DDQL 4WTZA 1AD0A 4BSVB 3TT3L 4GSDL 4I18B 4YDJB 4A2MA 1U6AH 4EI5A 2EECA 2D3VA 4GQPH 3UYOD 4O2FB 4Z18A 3RWEB 1NKOA 2AK1H 3VU2A 5DMKA 3VFOA 4IRZL 3VWJC 4ZQKA 4EDWL 3S96B 2Y06L 5IMMA 4JO1H 5HYFA 4XZUB 3AS2A 1JTOA 3K2UL 3T0WA 4OZ4B 2I9TB 1Y6NR 5F1SA 3VFTB 3EYQC 1GPOL 4XVSL 4Y2DD 3CK0H 3WIHH 1U3ZA 5DI8A 5IMOA 2DN7A 3QFJE 4LQ1A 2J6EA 4J4PD 1XIWB 1MCRA 4UDUB 3WNPA 4I13B 3PG2A 3V52L 4UIKH 2BHUA 2A6JA 4HCRL 4YXKL 3IDXH 1MI5B 3JV5A 1YMME 5F9WB 1YMHB 3PGFH 2XWJB 3PP4L 1D6VL 2VISA 4LSPL 3EYUL 3LH2H 2BVQA 3OQ3B 3I6KB 3KLDA 4KHXL 4X7CC 5D1ZA 3WFDH 3KJ4C 3N85H 5F7HA 4KK5D 2YEZB 1C1EL 5E2UL 3SE3C 2E7HA 2EYTA 4OZHA 5AZ2H 4LF3A 5I73B 3QNZB 4OAWB 1RY7B 4XP5L 1MUJB 4Z7OE 4L8CB 4RGMB 5D71L 5C0NC 4JAMA 3B6SA 1NCUA 2YA0A 4FQQB 4OJFH 4W70A 5T1KA 1Q72L 4NUJB 3SOBL 3RWJA 4Y4KB 3CGTA 3LMJL 4LIQE 4LNRA 5DF0A 4X98A 4PRID 1U91B 2BY1A 1F6FB 4LHUD 4MJID 1FFRA 2C3VA 2YPVH 2VDQL 4PB0L 1T2XA 5F7WC 2ZZUT 4YFEA 2VABA 4NZDA 2WNGA 5FEBA 2DYPD 4HGKC 4K9EC 2R69H 5GGQH 4P2RB 3KG5A 4S1QH 2H2SC 3NIGF 2BSRA 5HGBB 2PW1B 3VFSB 4L3EA 5HYQA 4ISVB 2ATKA 4X9FA 3JV4B 1FFNB 2DQJL 5F6HI 1OM3L 5SWQB 5KSVA 3L7FA 5GZOC 2CK2A 2HWZH 4JFOA 5EZOH 1I8MB 1EMTL 4UDTA 3WE6B 3WJJA 2Q86A 1KTDB 7CGTA 3P11L 2ARJB 2J6EH 5CJBA 3U6RB 1K8DA 5GGRY 3Q1SH 5AG8A 1CFSB 2WWKO 2W65B 3IU4H 4OFIA 1EHXA 4K3GA 5DVMA 3EJZC 2XN9E 1UH3A 4GRWF 3RTQC 2DQDL 5DVNA 3E6HA 1A5FL 4P2OA 2X4NB 5GS1B 1RUPL 3BP6B 1EEZA 1I7TA 3QHZL 3L3JB 4CMMB 4NT6A 1AE6L 2QR0A 3S35X 4AENB 3ULUL 4M1DL 4P9HC 2V5YA 5TF0A 3SQBA 3FO1A 4LPUA 3PL6C 5A16A 1GH7A 3OR7B 5IMKB 1Q9KB 2V2TA 4G8EB 4JM2B 3MLVH 1EV2E 2Z93A 1CLYH 3ARBD 4KQ3L 2LTQC 3KYNB 4JRYD 3T3PE 3VFRB 4FTVE 1U2CA 1T20B 2R1YA 3BRDA 5CMAB 8FABA 2VDOH 4YBQD 1AGFB 4PLOB 5I1DB 5ILTL 2Z91A 4QY8B 3NACL 1NC2B 4RWYL 3BQUA 3IGAA 2NY1D 5B4MD 5HI5C 3ULVD 4QRRD 3PNWA 4ZOBA 1F3JA 1G7JB 1NGWB 1Y0LB 4M48H 3FT3A 6CGTA 1A0QL 3O3AB 4LGRB 4XPTH 5CJ5A 3OKMB 4JFDE 2F74B 4ZG1A 5BRZB 1AKJD 4P5MB 1CXIA 3F6LA 1J8HB 2H1PH 3WIFB 5JHDB 4C56A 4P4KA 5CUSL 3PV6B 2JB6B 4IRJC 3QNXA 4K23H 3UTTA 1E4JA 5KVGL 4KI5D 4LSQH 3E6FB 3FB5B 2Z4QB 4JY5L 4AEHH 2R2CA 1QA9B 3H8NA 4V1DD 3EOTL 2VLRD 4YFLI 2A2QT 5H37G 4R7DA 5CJQH 3O0RH 4RMWA 1M05B 1KXVC 3DMMC 5DRZB 4RWHA 2R8SL 4YDJA 1DQTA 2NY4D 1P84J 1JL8A 3BKMH 3CH1B 5I1LB 4J3OC 3FB7B 1KT2B 1VACA 4JM2F 4YO0B 4O2FA 4LNVA 2X9WA 3RWEA 4FXKB 2P5EA 3KYKH 5DR5H 3ILQC 1FGNH 4HJGB 3GMOB 1FV1A 1U3HC 3PDOB 5J12C 4NCC1 3S96A 4IM8A 1FC1A 5CIPB 4XZUA 4OFYD 3QO0A 5DK0B 3GMNA 2EH7H 1KCUH 1A1NA 2ZNWA 5GS0D 5ID1A 4OZ4A 2I9TA 1IGMH 1OAUL 2Y6SC 5DJ2B 3QHTC 4BA8A 2XZAH 4GRLD 5C86A 3QDME 4EN3C 1BLNB 1U8QB 5BO1L 1S7VB 2PYFB 3EFDL 4APQD 4NYLA 4MMXC 4YWGL 5GZNC 4QHMB 5T1DH 4UDUA 3TBWB 4HPYL 1AGDB 1LDPH 3CAFA 1BZ7A 2B1HL 4BH8A 4YX2H 1YMHA 4R0LC 2XWJA 1TZGL 3OV6A 1DVFA 4UV4H 3ULUF 3C87A 3CVIH 3I6KA 3UZVB 2DQIL 4NRYB 3WS6C 2BNRE 1L0YA 4MA7H 1YYMH 3IETA 4KTYA 4JREB 4OB5L 3C6SB 1GGIL 2B0SL 1IGTB 1HHJA 5E4EC 1XF2A 4C4KO 4MB4A 3KS0J 3IFNL 1U8PB 3B9KB 1ZLWH 1CDJA 3MBEC 5IEHB 3U46B 5I6XC 3QAZB 5IQ7L 1CGWA 3GMQA 2CJUL 2E7BA 2AERT 3EBAA 4Y4KA 5GRXG 2ICWB 5EC1A 5F88B 3CFCL 1U91A 4ZTPL 3CH8A 1NUFA 2I5YL 5DEGA 3FOMA 1BFOB 1I1AB 3KPRE 2ADIA 4TPRH 3T0EE 1XH3B 3PWNA 3T4YB 2FL5A 4I3RL 4N90D 2DTML 2CSPA 3DXAB 3EOAB 2R15A 4DZBB 5CD3A 2EICA 1N5YH 1CFVH 5KS9E 1A4KB 5K59E 2F53D 2HA1A 4M5YH 1P5VA 4G7VL 2MTPA 4HCRA 5HGBA 4J4PC 4YDKH 2V5SA 2PW1A 2CKBL 3FCTB 5L2KB 4W68A 4ISVA 3LKSB 3NFNB 2HLAB 1FFNA 5D1XC 4N0FA 2Y5EA 3KPOB 4KDWA 4MZ2A 3KPSA 2ICWI 3QJHB 3VFVA 4M93B 3T4AB 4CNIB 2P8PB 5E00A 4QXWA 5IJKA 1IBGH 1JF6A 4Q58C 3KPNB 2P8LA 4U7SA 3I50H 4KK5C 5TH2B 2UWEB 4ESKA 2P8MA 2JCCE 2ARJA 5FCUH 2R4SL 3U6RA 1R0AH 5LCVH 2AQ2A 3O2VH 4NZTH 2DDQH 4WNQB 1CFSA 2W65A 3K8LA 1KTLA 3ARUA 3TT3H 3BZFA 3BD4A 3SQOL 1CG9A 3UZEA 2X4NA 4GRMB 3BP6A 2VSDA 4XPFL 5C9KA 3L3JA 3VA6A 4CMMA 1KGCE 4HMEA 4L8SB 2IG2L 1CDBA 4GRWH 3OR7A 5IMKA 3RX7A 1KIRB 1Q9KA 4IRZH 4G8EA 4JM2A 5DJAB 4EDWH 1E28A 5I9QC 1H3VA 2Y06H 2E8ZA 1NMCB 3EYVB 4P3CL 3VFRA 2CKBB 2NY2C 1RURL 1T20A 3B2VL 3K2UH 4FFYL 3NCYP 3S35L 4GW4B 2DB8A 1KCSL 3RX5A 3ZHKA 1AGFA 5I1DA 1GPOH 4QY8A 3P40A 2Q8BL 4RRPA 2NW2B 2QQLL 2VZVA 2UV3A 1G7JA 5J13B 1I7UA 3KLSA 4EEEA 5GIRA 4HWBL 3C5JB 3V52H 3O3AA 4HCRH 1DFBH 4G9FD 4JRXB 3OKMA 3INUL 3PP4H 1D6VH 5IB4B 2UWEF 3V4UL 4L29A 4LSPH 3EYUH 4KHXH 1OLZA 1IC5H 3QO1B 4ORGA 3QIBC 4WW1A 4NQDE 2BFVL 3QIUD 3WIFA 5IJVB 5JHDA 3LN5B 1UB6A 1YPZB 1OGAA 2ED9A 1C1EH 2JB6A 2A9NL 4L4TB 2XNAB 4D0DB 5E70A 4XP5H 5FGCB 1O0VA 4XVTL 1I4FA 3E6FA 3FB5A 1UJ3B 5D71H 3FRUB 3RBGA 4PJGA 3Q6FA 2FATL 3SOBH 5DRZA 1M05A 3LMJH 4MNQB 4N0RA 3WMSA 1IQDB 1RUAL 2IBZX 5DJDB 4R7NB 3ARBC 1MJ7L 3D39E 5I1LA 3FB7A 1KT2A 3DX7A 3ZE2E 3T0XA 2VZUA 5B22A 2VDQH 4PB0H 1B0GB 3ELAT 3MLYL 3N1FC 3HI5L 4FXKA 5DJYB 3MRGB 4HXBH 2BNUA 1NLDL 4HJGA 4EDXB 1A9BB 4RFEB 5D6DA 2E6JA 3EYFA 4OQTL 4EQ3A 4XH2A 5CIPA 2NY1C 5B3JF 5B4MC 3ULVC 5DJXA 3GO1L 3KLAB 3Q5TA 2E9BA 2CDEB 4CDHA 5DJ2A 1ZHNA 2DQJH 1OM3H 2F19L 1S7VA 2PYFA 4YHNB 4JGJA 4H88L 1OAXL 3DUSA 3V6OE 1KB9K 1EMTH 1DTUA 4LLVA 1JZ7A 5FHBL 2EDXA 3TBWA 4GG6E 1AGDA 2A74B 5BQ7A 1U8LA 1YPZF 2FHBA 4KI5C 3UTQA 2RCSL 3F6IA 4IRSD 4HH9B 5D93B 1VERA 2DQDH 1A5FH 4LSUL 3SKNB 2VXQH 1IGTA 1RUPH 3QHZH 2FJHA 1Q0XL 3SGKC 1HYRC 1AE6H 3GMLB 3ULUH 1MQKL 1U8PA 4M1DH 4XHJD 1OAQL 4KZEL 5IEHA 4N5ED 3U46A 1DBML 5IM7B 2EEDA 3RNQB 4DKFH 1OSPL 2ICWA 4KQ3H 5F88A 3IJSA 4URTB 2DQTH 4KKBD 1MCBA 3FT4A 2NTFB 5F1NA 2R2BA 1BFOA 5I74B 1I1AA 5FF6B 4E5XB 3M17B 4PJXE 2W59A 2V5TA 1MAJA 5GS0C 3DXAA 4L9LB 4NQCE 3SDAD 3EOAA 5L2JB 4G6FB 4HJ0D 5ILTH 4GBXD 4DZBA 1HHKB 3NACH 4ZO6A 2LAAA 4RWYH 4XX1E 4APQC 7FABL 3S8WA 2OTPA 2X4TB 4JCMA 5CIPH 4IIQA 5L2KA 3GSRB 1A0QH 4N1HB 4O5LL 5ITFA 4NBZB 5HYJD 3NFNA 4P3DB 2O5YH 4N8CL 1T22B 2EE2A 3KPOA 1RZIA 3QJHA 4ZAKD 3T0BA 4CNIA 1GGBH 5FA3A 5H2BB 3KGRA 3MACL 1KPVB 5DD1L 3E2HC 4LSRH 1YEHL 2CLVB 5KVGH 1GZQB 4LVNB 3K4AA 5DS8B 2J8UB 4JY5H 1GOGA 4WNQA 5BVJB 3NCFB 3EOTH 1P6FA 4OZGB 5F96L 2Y25A 2P4AB 4GRMA 1GCFA 4Z9KB 1NPUA 5DUMH 4ZDHB 4IMLA 4LCWE 4OM1L 4UU9A 1UZ6F 4DJMA 5TGBA 1LEGB 5EUOB 2EIZA 5DJAA 3L9RB 4U1HA 4XPAH 2GTZB 3SE8L 3EYVA 1M7IB 2FECL 2CKBA 4MLIA 2HKHL 3MQIA 4OIBA 3VRLE 3DYPA 3NAAL 4GW4A 4U1KB 4YE4L 1OAUH 2VXUL 5LGHH 3SE9L 1BVKB 1NCBL 3T3MF 4NSKB 3NGBB 2X5PA 5BO1H 2CLRB 2YSSA 3EFDH 3GBLA 2FYYB 4YWGH 3VWKD 5C07B 1GXEA 5FYKL 5FM5M 1PEWA 3IS1X 1I85A 4HPYH 3C5JA 4HWZA 4MA1B 2NY7L 1PKQE 2YD2A 1WWWX 2ORBL 1P7HL 4JHAH 3REWB 1TZGH 5IB4A 4F7TA 4RA3A 5FV2A 3TVMA 2AXFA 1QO3B 3BZDA 2DQIH 1JIBA 1YPZA 1HHHB 4XNUL 2CRIA 4NKMB 4OB5H 5ABDE 4U1GB 1GGIH 3QCTL 3O3UN 4MMZC 4L4TA 2OI9C 5H37H 4D0DA 4OZGF 2E6PA 3MXWL 4Q6YA 2Q7YB 4BSWB 4L1DA 4KWUA 1AO7E 1HXMA 1W72A 3FRUA 4L4VD 1TLKA 1LK3H 3QFDB 4DEPB 1DN2A 2XPGA 3LPFA 5IQ7H 4Q2ZB 2CJUH 4WGWB 4QOKE 4MNQA 5C08E 3QEQD 3CFCH 4R7NA 4B41A 5IUSA 2I5YH 5EB9A 3X13B 5EUOF 1BM3H 4PD4J 5CEYA 1OAYL 3CVHL 4I3RH 4XHQA 2DTMH 5DJYA 3JWOL 3OWEA 1YEGL 3WN5A 4O00A 3K46A 5LG1A 5KSBE 2NR6D 2VC2L 1A9BA 3H3KA 4RFEA 4R2GB 1CFBA 1MCWW 4HWBA 5BS0B 1I3UA 4G7VH 2HVJB 4G8FB 3D85D 2P47B 2CDEA 5IKCB 4BK5A 2CKBH 3O2DL 4HIEB 4YHNA 2FECI 5JW3L 4PRDA 3U9PL 1FFPA 1TVBB 3IFLL 1GAFL 4PJDE 3DRTA 4GS7C 3JUYA 3S6CA 2D2OA 2R4SH 1AGCA 1D5BB 3MGTA 4U6XB 3VA2C 1JF5A 2XY2A 3QDGD 5E2WL 3BOVA 1EXUB 3T2NL 3GMPB 4NC1C 2GSGB 1IEBB 3SQOH 3V6BR 3SKNA 1WT5A 2IPKB 4PR5A 3U7WL 4ERSH 1BECA 3IF1B 2IG2H 4HUVB 5IM7A 3Q5OA 1W72H 3D69A 4OQTA 5DO2C 2UYLB 2JK5B 1IM3B 4P3CH 3ZE0F 2NTFA 2RJMA 3CFJB 5KW9H 1QRKA 1RURH 3TIDB 3B2VH 5FF6A 4WVRA 2IC2A 4FFYH 5D7LD 3S35H 4U4BA 1KCSH 2AEIT 2Q76A 2KKQA 4L9LA 5KG9B 4PPTA 5J6GB 4RQQB 5J1SC 2VDLH 4R3SA 3B8SA 1XF1A 4JZJA 2QQLH 4TTDD 5C0JB 2X4TA 1WBYB 4QCIA 4LLMA 1SBSL 4RISL 3ZHLA 3KPQB 3L5HA 4HK3N 4BELD 4HWBH 5HVGB 3IDNB 1MCLA 1H3TA 3H9SB 4P3DA 3QUZB 5H35B 4JY4B 1XF3A 3INUH 5IBLD 1CK0L 2QEJA 3JSSA 3V4UH 3V7AG 4N9GA 4IRSC 3T2PA 2BFVH 3FJTA 4HKZA 4YHYC 1AHWB 1XGTA 5J1AA 4XXCA 3FO9B 1HNFA 3QEHB 4KY1L 2A9NH 4DWHA 1KPVA 2VR9A 4DGYL 3RI5F 5FK9B 4XAWH 1GZQA 2NX5B 2OLDA 2ZWLT 3EO1A 3OKOA 2ZSWB 1MY7A 2F54E 1BD2A 1JI1A 4N5EC 5EU5A 4OZGA 2FATH 1RZ7L 4X4ZA 3FHQA 4Y5XB 1CD9B 2XTJD 5C8JA 1RUAH 2Y23A 1MJ7H 4IMKC 4FG6D 1KV3A 4WU5B 5JMOC 5F93C 2VN4A 2VIRB 3T0AA 4Z7VF 5DVKA 1CDGA 2J5LC 3MLYH 4S1DC 1ZTXL 2X1PA 5EUOA 1FE8L 2PYEB 4YGVB 4GBXC 3L9RA 4XCEB 5ALBL 1MRFL 4C55A 2GTZA 4OQTH 5IB2A 1NMAL 5I1AB 1INDL 5CKAA 3GO1H 5HHOB 2V7HB 3DROB 1D5IL 3QZWG 3FFCA 4U1KA 2EKJA 3VXMA 1BVKA 1BFVL 4X9BA 4NSKA 3OB0K 2F19H 2CLRA 1BIIA 2FYYA 2Y7QB 4H88H 4JKPH 2PO6B 1OAXH 2NLJA 4YC2B 5C0CB 5FHBH 1Z9OA 1I8KB 4TRPL 2YD1A 4P5TD 3DRQB 4WFHE 4QRTB 3KAAA 4DUWA 2BVOB 3OXRA 2RCSH 1QO3A 3QFJA 3NN8A 1CIDA 2VL4A 3VXSD 2FRGP 4DW2L 1NGZA 1WZ1H 1IQWL 4GKZB 4LSUH 4IDJH 5C0GB 1T4KA 1Q0XH 4JG1L 3TCLB 3DJ9A 4LGSB 4KZEH 1V3JA 1S7SB 5AUMB 1DBMH 4JPVL 2Q8AL 1QFWM 1A1OB 4YHOL 3D3VA 5T1MB 3UEZA 3OKEA 4Q2ZA 3EJYD 4DVBB 1OSPH 1X7QB 5C0AB 1U3YA 4LPCA 4PJBE 3VFGL 1EEQA 3MCLL 4YUEL 3X13A 3BGFB 1LNUB 2R9HD 3UYPA 1BJ8A 4L8DA 4PTUB 5T1KD 2EDQA 3RIFK 1HH6A 2ZNXA 1MRCL 1ONQA 5DGQA 3JV0A 1MHPL 5L8KB 3MRQB 4MDIB 3VXPB 5HBBA 1URLA 5BS0A 4QT5B 4G8FA 4F37F 5IKCA 5DZLA 4HIEA 3RFZC 4HKJB 4N8CH 3X12A 3WHXB 2EDTA 1ZKAA 3ARWA 1FCGA 2F5BL 4OSUL 3RVVD 2J12B 2FJGB 3TM6A 1S3KL 2H2PD 3RY5A 4CADB 1N64L 3MACH 4MJ5B 4L3ED 2R39A 4OIIL 2E5EA 4GAGL 4U6XA 2E6QA 3WL9A 5I1IH 3MO1B 4G7YL 3RQ3A 1A3RL 3JTTB 5F96H 1AXSA 3LKPA 2GSGA 2ZCHH 4OUUB 3HNVL 4Z8FH 5MI0B 5D6CA 3V9FA 4JVWA 1BQUA 4LL9A 4ZOCA 3WJLA 4TNWK 3NIFF 2Z31C 2X4QA 4M6AA 1IILE 4OM1H 4B0MM 3QZWB 3FTGB 2OTWB 3H6JA 3WEXB 4Z7VA 3B9EA 4EI6B 4PJIE 5HJ3B 1GOFA 2WINB 2UYLA 3QIWA 4PTTA 4L5FH 5I76B 4X9IA 1BJ1H 3O2DA 3TIDA 2HKHH 1D5ZA 2JB5L 5IVXE 3NAAH 4YE4H 4FFWC 3DO7B 2QHRL 2VXUH 2M8XA 3SE9H 4PRIE 3ZKXC 1NCBH 4M03A 5KG9A 5J6GA 4RQQA 4MJIE 4KUCF 1YQVH 4EIZC 3C5ZC 1PVHA 3U1SL 4RCAA 3AROA 5C0JA 2ICEA 2BNQD 3RWDB 1WBYA 3KPQA 3HMXA 1KJVB 2NY7H 3IDNA 3H9SA 5DXWA 4NM4L 3O3DB 1QYGL 1L4IA 5IW1B 3WDIA 5L6YL 1KLFA 3MV9D 1QVOA 1FORH 4IS6B 1UM4L 3FO9A 3ZTJG 3QEHA 4KPHL 3QCTH 4NNXA 2IFFL 2VZTA 3MXWH 1P7KB 2WQ8A 4ZXBA 1NCNA 3IRZA 3QH3B 4C56D 2IADB 1CDCA 1CU4L 4Y5XA 1JZ2A 4HJJL 4S1RL 4MWFB 3DYOA 1K5NB 2VIRA 1VADA 5C3TA 1OAYH 5A43C 4JDTL 2GJ6A 5C0IB 2YWYA 4J23A 1GSMA 4X4XB 1YEGH 1E6OL 3HTLX 4U1LB 3PWUB 1JTPA 4P46B 4XCEA 5HI4C 2VC2H 1J88A 1BZQK 2VQUA 1R3IL 4R4ND 1TQBB 4TTDC 4X6BB 5I1AA 4K3DL 3IT8D 3LRGA 4TUKL 1G7IA 4F33B 2LFGA 3O2DH 1VCAA 3HFML 5DRXA 2I24N 4Y4FC 2EIEA 2RIKA 1OT2A 4LLAA 5DRNA 2PO6A 2ARWA 2ICES 3U9PH 3LN4B 1H3PL 3V0AC 3M8OL 4U3XA 2X4RA 1ACYL 5E9DB 3IFLH 4OFKA 1GAFH 3D0VB 3HI1A 3DHMA 2ARJQ 3K81A 3UXFA 3F7VB 2AXGB 4Y19E 5TPWH 5BZDB 4QRTA 4YXLL 4P4RB 4QRRE 1F45A 4C54A 4N0CC 1JGLH 3PDGA 4I48B 5DK2B 4BM7A 5HVHB 2G75B 2JF1A 4LEOB 3G6JB 4U1SB 3T2NH 2FX9L 4GXVL 1XIWD 1G6RB 1S7QB 1EVUA 2ID5A 4BFGA 5F89B 2XTJC 2WP3O 5GGVL 5C0GA 1MI5D 3U7WH 3QG6B 4E0RB 4J3UA 1MHHB 4XC1H 1S7SA 1ZE3C 2BNRA 3BEWB 5GRVK 4F9LA 3MRJB 1UKTA 3ETBF 4HIHB 4XNMB 5EU6B 1X7QA 5D96C 5F1IA 1QFHA 4YK4B 2R0WH 5I66A 1S8DB 2IJ0C 1OP5H 2VWEE 3MRFB 4PJCF 4PTUA 1MOEA 2ENSA 2AJZB 2O93L 4P2YA 3NVQA 4LLQB 4FZ8L 4Y4KD 3TN0C 3S5LA 3MRQA 5CBAA 3UX9B 3QUKB 4YDVB 4P23C 1CLCA 4PJHB 3OF6D 1X5YA 1SBSH 4RISH 3VMPA 4QT5A 2DLGA 4KMLB 4FABL 4GLRI 4U1NB 4F15B 2H6PB 4P5TC 2AJXL 1CK0H 2IMNA 2D4DA 3WHXA 1G9ML 3MCG1 5CZVL 4Q6IC 5ALCH 1ZVHA 3MV8A 4P2RD 3VG9B 2FJGA 1NBZA 3VI4E 3V79C 4P9MH 3BI9X 3QUXD 4JFFB 2SEBB 4CADA 1G7PA 4MJ5A 4X6CB 3C09C 4J3SA 4UBDC 1Q9WA 1S9YA 4DGYH 4HAFA 3G6JF 2D7OA 1SM3H 1RIHL 3TBSB 4RMRA 2X4OB 5FIEA 1FZOB 3J7HA 4G6AD 1NFDE 3JTTA 3CXHJ 1RZ7H 3SDCB 3TPKA 4OUUA 3PWPA 4V2CB 3PHOB 3SY0B 3GIVA 1J1OL 2ZUVA 3B9DA 1A6VH 2BC4B 2OP4L 3GBNH 3BKCH 4HIIB 5DA0B 1ZTXH 3LAFA 3QZWA 1FE8H 3WEXA 4EI6A 4LASL 5HJ3A 4PLNC 5ALBH 1MRFH 1K6QL 1CZ8L 2WINA 3G08B 1P84K 3F8UB 1NMAH 1INDH 4OZIB 4OCSL 3V5HB 3D87B 5I8CB 1JNNH 4MNHA 4NIKB 1NGXA 3VH8G 1D5IH 3PWJA 1RIVL 4FZEL 3DO7A 3SJVE 1INEL 2P5WE 1BFVH 4PJHF 5CJXA 2CRMA 5DGRA 5K9QI 1CGUA 4JM2D 1T83C 4W4NA 5ITBL 1XR9B 2W0FB 2VMFA 5E5UB 4HFWB 5J06A 3RWDA 4ELME 5A3IC 3RVVC 1UQSB 1OD9A 5TQ2L 2H2PC 1TNMA 1TQCC 3OKNB 4TRPH 5EIIB 2F53E 4Y4HC 4HKBB 2GT9B 4X6CF 5E03A 1NC2D 2P1YA 3O3DA 5CHNA 5E8EB 4D8PB 3BUYB 5IW1A 3O6KH 4PLKD 1ZS8A 3P73A 3ARQA 4FFZL 4HMCA 1IQWH 5DD3L 3JUZA 3BYTA 1OT1A 1ZLSL 2OZ4A 4WWKC 1QACA 1TTGA 4PIRF 3BZ4B 4XNYH 3RX8A 3ZYJA 4JG1H 5BRZD 3RGVA 5F9OL 3RBSA 4JKMA 1J8HD 3QH3A 2Q8AH 3I6LD 1CVSC 3GSVA 2IADA 4YHOH 5E24E 4KMTL 1MWAL 2ICCA 3ULUD 5C0DA 4Y0GA 1BOGB 2NZ9D 5JQHC 3BT2L 3VFGH 4MWFA 5D1QB 4ZSOA 3QCUL 3MCLH 1K5NA 3PP3K 5E99L 5D2LF 4Q97A 1ND0B 3CUPA 5C0IA 1DLHA 2R2EA 4KXZI 4OZIF 3OKDB 3DVGA 1MRCH 1S7XB 4U1LA 1MHPH 4P46A 4PJCA 3G5VA 3RVWC 3KJ4B 4X6BA 4BSJA 1JCKA 1NDGB 1JGEB 4KJQC 1OTUD 4LRIC 5FGRA 4PY7A 3CD4A 2O5ZL 4RGNC 5E1HB 2OQJB 5TE7L 5BZWB 2F5BH 2VLKE 3WKNA 1X5KA 1IC4L 1JRHL 3VXRA 5DHVA 4LCIL 1S3KH 5KSUB 4ZFZB 1N64H 1MCOL 1QKZL 4KC3B 4ZOEA 1HSAA 1QPPA 4DFIA 1U92B 2B8OT 4OIIH 4WTWA 4P4RA 4GAGH 2OK0L 1LHZA 3L3IB 1QFPA 5DK2A 5BV7C 4G7YH 4XP1L 5HHMB 3L3HB 1MWAB 1A3RH 1U8KB 4U1SA 4ZYKB 5L9DL 1IJ9A 2PXYA 4G9FE 1G6RA 2BSTA 3RUGB 1W0WB 3OAYH 1UADC 3HNVH 3QQ9D 1A6AB 3TYGL 3ZKSD 3QG6A 4K94C 4L1HA 4E0RA 5AZEL 4XP4L 1HCVA 3VH8B 1G7LB 4HIHA 2DQCH 1T2JA 4BJLA 4XNMA 4M02A 5H8DA 5HHVL 2MJWA 3EDDA 4R4NC 3B9KD 4RAHA 2IANB 4KRNA 3SKMB 2JB5H 5DJZA 2QHRH 2AJZA 3VI3F 3ZKND 1FFOB 2DWEB 2HTKD 2J2ZA 5FO8B 5JLZA 3PGDB 3U1SH 1XGRB 2XIDA 2EC9T 5GRJL 5DQJB 2AXHA 1I1AD 4F58L 5BW7A 2YPLB 1JNHA 3RTQB 2BOBA 2NNAB 4W6YB 1A14L 5I1EH 1IE5A 4U1NA 3DXAD 1K85A 2H6PA 3BPNC 3MNZA 1KIUA 1LO2L 4WFFD 1TXKA 4XMPL 3UMTA 3WKML 4NM4H 1QYGH 1MHCB 3PL6B 1IL1B 3TYFB 5D5MB 4FNLL 5L6YH 4PRNB 5JOPD 1UM4H 2LTQB 2SEBA 3E3QC 43C9B 1XIWC 1S7TB 2IFFH 4MA3B 4F7PB 3JWNC 4G6ML 1INQB 1OQXA 3RUGF 4Z76A 2X4OA 1ZVSA 3DGCR 1MCKA 5ENWB 3F7QA 1FZOA 4PJ8B 2XZCL 1NCTA 3SDCA 2R0KL 4ZPTA 4NN5B 2AEWA 4HJJH 5I15L 2UZIL 4S1RH 1QSEB 1G6RH 2JJTC 3MTRA 4QWWC 1IFHL 4M00A 4MXVF 5FM5O 4JDTH 4YZFE 4O2EB 5L88L 2YBRB 1Q0YL 2BHZA 4HIIA 2JJSC 4GLRH 1E6OH 5FGBC 3GSWA 4NQXB 2EDJA 5D2LA 4ZUTB 3CX2A 1R3IH 3G08A 4BFEA 2CXKA 3HI6L 4PGZA 5T5FL 4TUKH 3QWOA 4IRJB 1OGTB 3QDJE 3BFOA 3HC0A 3VXOB 1D9KC 3I02B 3HFMH 3OJ2C 1JPGB 3IJHA 2W0FA 4JFYB 4PV8B 1H3PH 3M8OH 3DMMB 2VDNL 1UQSA 4RGOL 1DEEB 3O45B 3QUXC 2R2HB 3OKNA 5MEOA 5D5MF 3V5DA 3GZKA 5EIIA 3SO5A 4AT6B 4LQFL 5ISZA 2GT9A 1NBQA 4M4RA 4OV6F 1ERNA 4FQXC 4PJAB 5GRYA 3ZTJH 4D8PA 3PV7A 1RZFL 2BRQA 2X42A 2FX9H 4GXVH 3VWJA 1U3HB 5J12B 1WK0A 4OM0L 3HRZB 5GGVH 5HDBF 4LMQI 4JRXD 5CEZL 3BZ4A 3LSOB 4CMHB 4K55A 2ZG3A 3S9DB 5HGAB 1XGUB 3F5WB 5KZCB 1T7WA 4GW1B 4PJ7B 1P4IL 4WUUA 2CMRL 5LAXB 1II4E 2PTTB 5AAWA 4C83B 4L4TD 3VDAA 4PJ5B 1OF2B 4KMQA 3IVKB 1IKFL 3LZFL 5JPMB 1EEYB 5FUCE 5C0BA 3DECA 1ND0A 3LKRA 3TBYA 5IFJB 3O81A 5FO9A 2OJEA 1I8LC 4R0LB 3OKDA 1H15B 4QOKA 1S7XA 2YC1A 2ZG1A 1JMZA 4ZPVB 1FFQA 1IGIL 2CIIA 1F4XL 4KKAD 5JZ7D 3SE3A 3STZB 3QHFL 2CO7B 1VFAB 2F8VA 5E4EB 3VFMB 1F58L 1NDGA 3CX5J 1JGEA 1PGRB 3BUTA 2AJXH 2J8OA 2WQRA 2R23A 3BE1L 1G9MH 3MBEB 5D7KE 1A47A 3U9UB 3G9VA 5I6XB 5BZWA 2Y1VA 2W9EH 1JGDB 3WS3B 3TV3L 4PLKC 1JP5A 5KSUA 4JDZA 4PJAF 4EZMA 3NIDE 1PX4A 1EBPA 4LHJB 5HI3D 4G6JL 1MFDL 3R8BB 1X4YA 3L3IA 3WNKA 2EXWD 3L3OB 1F5WA 1MWAA 1U8KA 4ZYKA 4KXZH 2XA3A 4F57L 1KLUB 4TSCL 3ZTNH 1Q9OA 3RUGA 3EHBD 2VXSL 2JELL 1J0IA 3GJFB 3P4MB 1A6AA 1GYAA 1C16A 2NZ9C 3QBTB 1J1OH 5B8CC 2B5IB 4N68A 4PJ7F 3PGCB 4Q0XL 2OP4H 5ACMA 5D1XB 5J0BA 4OLZH 4U3HA 3KXFD 4LASH 5EO0B 5CBEB 1K6QH 1CZ8H 4G8IA 3GNML 4L4VE 4OCSH 4NCDA 2M26A 4HUKB 4KTEL 5LBSL 2IANA 3SKMA 2GK2A 1RIVH 4FZEH 1C12A 1QSFA 1YJDC 4BQCA 1INEH 5AAMA 3QEQE 3VD9A 5F7EL 3FZUD 2YUWA 5FO8A 2DQUL 3PGDA 1DUZA 1P7QD 5ITBH 2BY3A 2IEPA 1XGRA 2PN5A 2YPLA 3QEUB 3G6AB 5SX4H 5DUBB 5JW4Q 1HH9B 1KFAL 4DK6A 3MREB 3P30L 4Y1AA 4G6FD 4NJ9H 2EYRB 3HMWL 4IOIA 4JO3L 4MVBC 3BHBA 3RWHB 1WZLA 5CD5D 5DWUL 5CKGA 5HYSA 3MRRB 1IL1A 1G9NC 5D5MA 3GM0A 3OJVC 1N5AA 3ARPA 5FFLA 4FFZH 2XY1A 1TMCB 5I9QB 1OL0A 5DD3H 1S7TA 2KQMA 1ZLSH 3GHBL 2NY2B 1EAJA 2DBLL 3HR5B 4WV1C 3L5XL 5F9OH 4AIOA 1TJHH 2GHWB 4HBCL 3LEYL 3L3GB 2WMPA 1EHAA 4KMTH 1CDYA 4K9EH 1MWAH 4JREC 1P1ZB 4NNPL 1QSEA 3BT2H 2IALB 3QDGE 3QCUH 1VB9A 5E99H 2EDDA 2X05A 3ULVL 4O2EA 4Z5RB 2YBRA 1K2DB 3U2SB 1NCCL 1JPST 3ES6A 3HB3C 4HGMA 4UT9L 4DKEH 4LHQB 2CUMA 4O4YL 4NQXA 3C6LD 5DRWA 2HTKC 2NY0C 3GGWB 4HEME 5T1LB 3QIBB 2D7MA 5IVZA 3FQNA 2C9AA 3IFPB 4MCZB 4W4OC 4PD4K 1T80A 1ZT1B 4IRJA 1MREL 3VXOA 1J87A 3WUZA 1Q1JL 2DL2A 2YRLA 3UTPD 2O5ZH 3D5OF 4JPWH 5D2NE 4X8JA 2BVPB 1IC4H 5JO5B 2YR3A 5EPMA 3DMMA 4LCIH 2YXMA 1DEEA 1MCOH 3ARBB 3B3IA 2R2HA 1QKZH 3L5IA 3QXUA 1XCQB 1HI6B 3VFUA 5DFVD 1T6VN 3V6ZB 4AT6A 2OK0H 4PYGA 4PJAA 2Y36L 4XP1H 3MUHL 1N2RB 5C07D 3O41A 1IAKB 5KVMC 4M93C 1E4WL 4ZD3L 1U3HA 2Q6WB 1UC6A 3NH7H 2NY1B 3TYGH 1R24A 2C3WA 4WFGD 5EZIL 3CMOH 2Z92B 4HUXB 3NCEB 5AZEH 5HGAA 4JHBA 4XP4H 4EN3A 3F5WA 3P9MB 3FAXA 3QWRD 4GW1A 4PJ7A 4W6XB 1AKJB 2XKUA 2VKWA 5LAXA 2PTTA 5HHVH 1G7MA 1T7ZA 1ETZB 1OF2A 3UBXI 3IVKA 3QYCA 1KCRL 1EEYA 5JPMA 3MV7E 4PLJD 5JHLH 3BP7A 2EKSA 3U7AA 5IFJA 4LSSL 4L8SC 4R0LA 2CO6B 3RRQA 4RBPK 3IAQA 1R5WA 3UPRB 4OLWL 4ZPVA 1O5DT 3WS6A 3PP3H 5F9JA 2VLRB 3KS0H 5GRJH 4X6EA 1UXWB 1DCLA 4F58H 1PSKL 2BERA 4D9LL 1QFOA 1VFAA 2GTWB 1QOKA 4OLXL 1FL5B 1WFNA 5EFIB 3G5ZB 1MCPL 3CZFB 1G7HB 1LO2H 3WKMH 1RJLA 4XMPH 5FYKD 4Z78B 3MBEA 3ARDC 4R2GD 5JNYA 3L1OL 1JGDA 3BWUC 4FNLH 3KHOA 3WS3A 4E42B 1KELH 4RA0C 1K3IA 3GSUB 4WU7B 5J13C 2AJVL 3TC9A 4OD3L 3WD5L 3C5SB 3QXVA 4Z7OF 5BMFL 4Y8AA 4RZCB 4XTRC 1NDMB 2LQRA 1OB1B 5D70H 2RHEA 3ULVF 2N7AA 1CGVA 3DO3A 1HSBB 3SO3C 2GI7A 3IXAB 5I15H 5HHNB 2H9GB 1DZBA 2QSQA 3P4MA 4L9DA 1VSCA 4MD5A 2F8OA 3RVUC 1IFHH 5TF1L 4J4PA 3PGCA 4EKXA 1HDMA 1N26A 3RHWK 3TA3C 1PLGH 1UJ3C 4OLVH 5L88H 1HHGA 4PGDB 2CR3A 5E4IA 5D1XA 1K4CB 1HINL 2ESVD 2O5XL 3WNLA 4JKKA 5TJWK 5EO0A 4M6OL 5DZNA 5CBEA 4BZ2L 1JGUL 1A6TB 4OI7A 3RWFA 4KI5F 5T5FH 4KKAC 5SWZD 5JZ7C 3E2HB 1HYSD 4OZHE 1OQOA 3CSPA 4XC3L 1PEZA 2R56L 1BX2B 4IJ3C 1BGXL 4OUOA 3QEUA 2YZ1A 4RGOH 4XVJL 4UNVA 1XZ0B 5TQ0L 2ITDB 1HH9A 4Z7UB 5IG7B 1J10A 3MREA 1VEPA 5EWIL 4LHUA 5BOZG 2EYRA 2KBGA 4JFQB 4LQFH 1CVRA 4HFUL 4O9HL 4KVCL 2XTLA 3CFBB 1RZFH 4JN2B 2EXWC 1H0DB 4L8BA 4AEFA 2DYPA 2VXVL 1WWBX 4JRWA 3QP3A 3LD8C 4OM0H 2YD7A 3EHBC 1ZLVK 3EGSB 3QUZD 5CEZH 4U1JA 2EO9A 4OF5A 1ZHLB 3HR5A 3MRLB 4OFVA 4LDEB 2HG5A 4L3EE 2EDEA 5D93C 4Q9CA 3FQTA 1E27B 3L3GA 4MCYB 3SGEI 5IB5A 1ED3B 1P4IH 2CMRH 1FLTX 1TIUA 1CS6A 1CD0A 1P1ZA 3ZL4L 1KIPB 1IKFH 1HZHL 3LZFH 1E4XL 2NX5D 4MQSB 3M1BB 4NRZB 3GJFH 2KZ1B 4Y88A 4Z5RA 1K2DA 1ZHKB 3LS4L 5C6TH 2CDGB 1TCRB 1F8TL 1FRGL 3FZUC 4KI1A 3GGWA 5T1LA 3QIBA 1IGIH 3IFPA 2CPCA 1J11A 4MCZA 3QHFH 4CVZA 1ZT1A 2H8PB 3OR6B 2OI9B 3U4BL 1F58H 3EOBB 3AY4C 4JO4L 1JZ8A 4XP6L 5DTFB 2PYED 3BE1H 3ZYZA 4O02L 4Z7UF 5F7KC 4FXGB 3WLWC 1JJUA 2BVPA 3CSYB 5JO5A 3TV3H 3ECBA 1U9KA 5HHOD 5TDPB 1FNGB 1H8NA 1S9VB 3ARBA 4JRYA 3UBXA 1S5HB 4ZMAT 2NXZC 1MFDH 4G6JH 3V6ZA 2I60L 2BNQE 2ZPKL 5SWSB 5TE6H 4YPJA 5EBWB 2PO6D 5FOJA 3CFDB 1QNZL 5C0CD 1W0VA 4F57H 5L8JB 4TSCH 2Q6WA 2FIRT 2VXSH 2JELH 1R3LB 4U2YA 3U83A 4XGZB 4HIJB 2FIKA 5SV3A 3MV9E 2DLIA 1ORSA 3QUYC 4JE4B 4Q0XH 1SVZA 2FO1A 2BMKA 3CDCA 1U0QA 3P9MA 3T0EB 1AKJA 1A2YB 3C6LC 3ZSTA 2E7LA 1ETZA 3GNMH 1XEDA 4C56E 4KJYA 1KUMA 4KTEH 5LBSH 4GS7B 2WIIB 4PB9L 3RAJL 3DX8B 1U8JB 4YNYB 5F7EH 3STBA 3UTTE 2WBWB 5ELIA 2DQUH 3D9AH 1OTTD 3I75A 5C0AD 4I0PB 3EFFB 2FEEI 3W9EB 5D9SB 4KAQL 1LQSR 4BFBD 4V1DA 2VLRA 1Z0NA 1S9XA 5JA8B 4LARL 1FNEB 2GTWA 1RFDL 1KFAH 3P30H 1FL5A 3SGKA 1QRNB 5EFIA 5GISL 5I2IB 3HMWH 1G7HA 4JO3H 3IDIB 4Z78A 2B4CC 2JCCB 5DWUH 4IOSD 1H5BC 2IH3A 4P57A 1L9MA 3GSUA 2WLZA 2ZOKA 4WU7A 2P5EE 4KUCD 5DK3A 1AC0A 2AKRB 3T08A 3ET9F 3GHBH 1YEDB 3QA3B 2DBLH 2CIKB 2OXHA 5EBMA 1NDMA 3L5XH 2UUDK 2BDNL 4U6TA 3UO1L 1OB1A 4F7CB 4GRLA 2B7DT 3LEYH 4M62L 1HSBA 4APQA 2QQQA 3MR9A 3IXAA 1A02N 3NIGE 2AW2A 4NNPH 5HHNA 2Y5TA 4U1GC 4K7PX 3WBDA 2RQ8A 2EE6A 1JF1A 1I3RB 3DETC 3QDHA 4NBXB 4YDIL 3MRBB 3MGOB 3ULVH 1FL3B 5C9JB 1GGTA 3G5YA 5KSAB 3DVNA 1NCCH 4JO2H 1X5ZA 4UT9H 2X70B 3MFGB 1K4CA 4O4YH 4DEPC 2MNUA 2CK0L 4D9RE 3O6FD 2H26B 5K33A 1A6TA 4YHYB 3HZMA 4OCXH 1SJXA 2YZ8A 1MREH 3ZZ1A 1Q1JH 3DV6B 3TNNB 1EZVX 1WFTA 3Q5YA 3TIEB 5T3ZD 1HKLL 1LMKA 4GRWE 1BX2A 4WI8A 4U1IA 3LQZB 1MJ8L 4K7FB 3MRIB 1UENA 5CJ8A 4PG2C 4Z7UA 4NQDB 1U93B 5GRWA 4RDQG 1F42A 1I75A 4JFQA 5EBGA 3RWGB 4I5BB 5E6IB 1P6AB 2J5LB 4EUPA 2EIBA 2Y36H 3KYMB 3CFBA 1YN6A 1E4WH 3TBTA 5J6HB 2DQEL 2DICA 3SCMB 3TO2A 1N4XL 5D2NC 5F1KC 4XP9H 2ZUQC 3O3BA 1YUHB 3EGSA 1SJHB 5BXFB 5IT2L 1MVUA 5EZIH 1ZHLA 3MRLA 1A64A 3D39B 2YRPA 2Z8SA 2QKIA 1VKXB 3GIZL 5GS0H 4MCYA 4H0IA 4X6FA 3RP1A 3R4DA 4PG9A 3X11B 5D7SL 4I2XA 3IDYB 2HJLB 5C2UB 1F2QA 4NRZA 3MRKA 4HDIA 5BJTB 1J0HA 3JWOC 1FO0L 1C7SA 4LSSH 5KN5B 1ZHKA 1HYSC 3K8KA 1TCRA 3MXVL 4ODTL 5C1MB 5F8QC 4YHMH 1C5DB 2FHFA 3R8QA 4E41D 4XPBL 2VZ1A 3WUWG 2DLTA 4D9LH 1KG0B 3WDJA 2XFXB 5E2TL 2H8PA 1JHTB 4PUBL 3VE0B 3EOBA 4OLXH 4NZUL 5C6WH 3ZDYF 1S7WA 5HDLA 4G9DB 4P46D 4GG6B 3LKOB 2X44D 4FXGA 4KJPC 3CFIC 3L1OH 4N9OB 2D4FA 1EIBA 1JNJA 1DANT 3ARGD 1VFBB 3RIAK 5DJ8A 4H0HB 2C1PB 4O2CA 4Z7QF 5TDPA 2AJVH 4ENED 1S9VA 3SGEH 4H1LG 4KU1A 4OD3H 1RK1A 2NCMA 2ZJSL 2WM0A 4I77L 5EBWA 1MCQA 4UV7H 5E5MB 1NEUA 5I71C 4X7SL 1Y18B 3CFDA 5E9DD 3PHQA 4ZNEA 3BN9C 2AP2A 4N0UB 1FAIL 1R3LA 5GRZA 4HIJA 3VJ6B 1FO0B 2NY3C 1VHPA 5TF1H 2DIAA 3G5XB 5EIQA 4X99B 5E2JA 4WY7H 2XXMB 3FONB 1LO5B 2YXFA 1HINH 2C5DC 3CXHK 5DHYB 1KC5H 3NPSC 4YHKL 3I3DA 2BVYA 4M6OH 1ZOXA 4BZ2H 5BRZE 1JGUH 1BAFL 4UUJA 5JHDE 4OF0A 2VLLB 1OGAE 3S36X 3FAWA 3NABL 3DX8A 1E4KC 5J9PA 1GGUA 4XC3H 1U8JA 1MCCA 3W2DL 1WBZA 5EU6D 3L5WB 4BH7B 4WRLA 4LLWB 3SKOB 3EFFA 3WNMA 2R56H 4PJGE 3THML 5F7DB 1BGXH 1JZ3A 4GG6F 1PD6A 4XVJH 1FNEA 4KGJA 3GK8L 4Z7WB 2NYYD 5TQ0H 3NFPB 1X5AA 5ACZB 1HEZB 4KRMB 2DI7A 1L9NA 2ZP0T 4R90H 2AEPL 1YQ2A 3LOWA 5EWIH 3HCVB 5D1ZC 5E8DL 5I2IA 2Z31B 4OGAD 5IOPB 3IDIA 4HFUH 4KVCH 1AGEB 4O9HH 1NUGA 1I1YB 5JOEA 3ZYIA 2GUOB 2VXVH 2DRUA 1S78C 4XCFH 4X7TB 2P7TB 1A6ZB 2G2RB 2VITB 4ZUWB 1M71A 4MJ4A 2P44B 1B88A 1T89C 2XQYK 3F7PC 1MFEH 2NPLX 4N8VG 4X5XB 5FYKU 4D3CL 3ZKXB 1IGJA 4F7CA 4M1CC 1L7TL 3HUJB 3C5ZB 4JFFD 3EOYG 2V9TA 4WENB 1CLOL 1LP9B 3ZL4H 1UEMA 4ZUSB 1ZGLB 1EEUA 2I07A 1E4XH 3FB6B 4TUJA 4HAGA 3ME0A 1I3RA 3QNYB 4FMKA 3MGOA 1T0NB 3LS4H 2XQYG 2PR4L 2X70A 5MHSD 2FH8A 4OLYL 5GGSB 1F8TH 1FRGH 4PRAB 4BQBA 4IRSA 1OTTC 1W8OA 3KPPA 1DQJB 4K7PL 5IHBA 5E56A 3B8YA 2BK8A 1I7ZA 2X1QA 2V7NB 3HC3L 3U4BH 1WZMA 3GMMA 2DMCA 4JO4H 1PQZA 4XP6H 3DV6A 3TNNA 1BZ9B 4M7JL 3H9HA 4H1LB 1EJ6A 3TIEA 4Z7WF 4O02H 3WJJC 4FS0A 2FDBP 2V9RA 3ALPA 3LQZA 3ZLQC 4K7FA 1AJ7L 3H9YA 1ZT7B 1JZ4A 4ZOAA 2X89A 1G84A 4IMKA 3S7GA 5FYLL 4M1GL 3DTXB 3GSXB 3GUTA 1BHGA 2I60H 2ZPKH 4I5BA 1G6VK 5JIIA 2JJVA 4HSQA 3U0PB 3MJ6A 4Q74A 4K3HA 1QNZH 2XKNB 3DXAE 5J6HA 4GBXA 1AO7B 3O2WL 2E9WA 1CD1A 1FQ9C 1IARB 1NJ9A 1PFCA 5LJYH 1NAKL 3O3EA 4HHAA 5D8JL 1YUHA 4F7MB 3HUJF 5BXFA 5KOVC 3WNNA 2B1AL 4BUHA 3SKJH 5JOPE 1LP9F 3CDFA 1HOCB 4MX7B 5L2KE 5EC2B 3LIZL 1M4KA 4WI2A 1VKXA 5HYJA 4Y4FB 4OQ1A 1YC7A 1RHFA 4YBLC 1I3GL 4JG0L 4EBQL 4TNVK 3HPJB 3O6FC 4OCLC 5KSBB 2NXYD 4PB9H 3VMNA 3I3EA 5EN2B 3RAJH 3W9DB 4LSTL 1R5VB 1CXLA 1KSRA 1FZJB 3BESR 3S88L 1MLCB 1IGYA 4BQ8A 3I2CL 1FL6A 5D1QD 1B4RA 2CRZA 2QHLA 1KG0A 2XFXA 4LARH 2R1XA 5FA4B 1RFDH 3C8KA 2OTUA 3OKLB 2CGRL 5C0EA 4L3CB 3DIFB 5GISH 1VENA 4G9DA 4UZGA 1RK0A 3LKOA 3RWIB 5HDQL 3MRNB 5AD0B 4N8VB 4V2BA 3V0VB 3RIAF 1IM9B 3CMGA 5D96B 3DLQR 2W0PA 4WO4C 1KXQE 4M8QB 3LRSA 1FNHA 1T7YA 1AQKL 3HPLB 4ZUVB 5C0ND 1NFKA 4NJAL 4JM4L 2BDNH 5E5MA 3UO1H 1Y18A 4HS3B 2FLRT 4XBPB 1NCAL 2V17L 3TN0B 4M62H 4JKWA 3C8DA 3Q2CA 5IW3A 5CP3A 4N0UA 4P23B 4MQ7A 3KPMB 3EO0B 1NGQL 3VJ6A 4WW2B 3G5XA 4NZJA 3DOSA 2DLHA 3K74B 3PWVA 4AH2A 32C2B 4X99A 1UKSA 3KYOB 3P9WB 5HHMD 3UC0L 2HMIC 1LO5A 2EIDA 5FAAA 2CK0H 4WHTB 5FO7B 4QYOB 5DHYA 3MNVA 3ZYOA 5JW5A 1AXTL 5FM8A 2H2SD 3WFHA 3L6FB 1YPZE 2WWMD 5E8PB 3W0WD 3C09B 2GSIB 4BKLA 5GPRA 5IHUL 5CEXB 4L4TE 1VEOA 3B4NA 2H45A 2ERJC 5GZOD 5FGCE 3NZ8B 1HKLH 4LLWA 3T77B 1X5HA 1ZLWK 5KBNC 4GOSA 1A21A 1MJ8H 1T66C 2IAND 4P99A 2H32B 3ARGC 4EXPX 2HYMA 4Z7WA 4MNQE 3S36L 5ACZA 1WICA 1SEQH 3JTSA 3QEQA 2EDFA 4MXWL 5MP6L 3MRCA 5EZJB 2Z31A 1NFIB 3FFDA 1ZSDB 1I1YA 3EJZD 3BXNB 1A7RL 2DQEH 2YPLD 5D72L 3RTQD 4XB7A 2HRPL 2P7TA 5F70A 1A6ZA 3HZVA 1N4XH 3CSBA 4FQPA 2VITA 4ZUWA 1I9RL 4X0KB 5DMIL 1IRAY 3MYJB 5IT2H 4HS6B 3QXDB 4R26L 3WDHA 1RQ5A 4MD0B 5HGHB 3PL6D 2FD6L 2P49B 5FKAA 3GIZH 4P3WA 5A2IH 2BJML 3HUJA 1F11B 4WW2F 3C5ZA 3OJDA 4HBQA 5D7SH 1KN2L 1LP9A 2WBJB 5DMYA 1ZGLA 3RVXC 5CP3H 2H3NB 2JKXA 3FB6A 3P4NB 2UUDH 3QNYA 3R06B 5DURB 2DM7A 1MCNA 3TPUB 3WUWA 1FO0H 5DSCB 2VL5A 3QQ3A 4PJ8D 4Y4HB 1ES0B 4PRAA 3MXVH 4ODTH 4J1UA 3QDGA 4YK4C 4MD4B 1T1ZB 1G7QA 4XPBH 1UG9A 2JIXB 5E2TH 1UVQB 4PUBH 4Y5YB 1B6UA 4R96B 4WWKB 3MJ8A 1BZ9A 4H1LA 4U6YA 3HHRB 1P4LB 3BGMA 3VD3A 1RD6A 3K4DA 5BV7L 1UWXH 5FUOH 1ZT7A 4IRJD 1T5XB 3ZE1F 4JFHD 2C1OA 4PJFB 2VERN 4LCCB 3VMOA 4HW6A 4I0KA 2UY7A 2F5AL 3HC4L 1DBBH 2ZJSH 4K94L 1MJUL 5D7LA 2X4PB 2GK0A 1R3KA 2AAVA 4X7SH 3DMMD 2V2XA 3ROOB 4F8QA 4HZLA 5FYJE 3MSPA 3PABB 1FAIH 2XRAL 4B5EA 5HHXL 1V3KA 4F7MA 1U95B 3T3ME 1OARL 4PJBB 1ORQB 1HOCA 4MX7A 5EC2A 4LAQL 4NM8L 4XWOD 1ZANL 4RGNB 2HJFB 1U3HD 3OGCB 3EW3B 3BAEH 2AJUL 4YHKH 5EOCJ 4TNVF 1AIFA 3HPJA 4H5SA 5F6HJ 5T33L 1J8KA 2FEDD 2VH5L 1IAIL 2Y6SD 5EU4A 4NHUA 5DJ0B 1BFSA 3NABH 3BH9B 5CLWA 5KZCD 3PWLB 3W2DH 1J05A 3DWTA 3MLUL 3ESVF 1CGTA 1XGPA 4QNPF 4XCYB 5BV7B 3VGHA 5GZND 4Y16C 1LD9A 4PJ5D 4OKDA 3U7YL 3THMH 3OTTA 1BD2E 3RDTB 4OZGE 3H42L 2EZ0C 3GK8H 4G80A 4HF5L 2ZOLB 3QT2A 1FJ1B 2AEPH 3DIFA 4KHTL 5E8DH 4RNRB 1TCMA 4JPKL 3RWIA 2YK1L 3WYRA 3MRNA 5AD0A 4MDJB 4PJFF 4H1LH 5F44A 5EUOE 4HKXB 5CZXD 3UTPE 5K9KB 1U8NB 5GSRA 2YHGA 4M8QA 5IB3A 4GH7B 3KYAA 5CSZB 5I8OL 1DE4B 3MBED 3QQ4A 5ETUB 2ADFL 4D3CH 1VFOA 3TJHD 1GGCL 3FFCE 3VXME 4NPYB 3EO9L 1JWMA 2OXGA 1L7TH 3TN0A 1DEDA 1N6UA 1OY3B 5CEZD 1CLOH 5D7IA 3KPLB 1HXYB 1UT9A 4CU6A 1L0QA 3EO0A 5F7MC 1LEKB 1FG2B 4HUNB 2CLZB 1Z3GL 2J88L 2V2WA 4PJIB 3BDXA 4OF7A 4LLDA 3VXTB 2NXYC 3KYOA 2FGZA 1JK8A 2FWOB 4P5TA 3BPNB 2PR4H 1RJYB 4OLYH 3IU3B 4Q6IA 3FOLA 4XWGL 3BP4B 4K7PH 3T8XB 5B3NA 4AQ1B 5D1QC 3MBXH 3IJYA 3VXSA 2AI0L 2GSIA 2N1KA 3CSGA 5FUZL 3HC3H 2VDKL 5EA0L 4AEIH 4WHCA 5D1XD 1FDLL 1A6UL 4NFDA 5TDNA 3T77A 5ICXA 2APTA 4NBYB 5IV2B 4KUZL 2VKXA 1IAII 3BO8B 3O6ML 2XV6B 1PYWB 5GJTL 1J1XL 1AJ7H 2H32A 3D3VE 4YHIB 5TDOB 5C92A 4MS8C 5FYLH 4M1GH 3DX9B 4HH8A 3UTOA 3TT1L 1NFIA 3I85A 1ZSDA 3HNSL 3BXNA 3VCLB 2DLFL 1MAKA 3ZE0E 3O2WH 4M61B 1VDGA 4TQEL 1HCFX 1NAKH 2YKLH 4X0KA 5D8JH 3MYJA 1FN4B 5F97E 5BS0E 5CAYB 4JFEB 2B1AH 3VXUD 1D9KB 5HGHA 1C8PA 1DBKL 1LGVA 3H7BA 1QSVA 3LIZH 5FDYA 4EOWL 1T83A 1F11A 4PJIF 1I3GH 4EBQH 3WNOA 3MFFA 3G04B 5CSBA 2NY2D 4OCYL 1QLFB 5E8NB 1AH1A 3MLRH 3JZ7A 3RWCA 3P4NA 3QUXB 2AK4B 1TTFA 2WWMC 2WW8A 2GAZB 3TPUA 4LSTH 3LEXB 4Y4HA 3LQAL 4FQXB 1MF2L 4MLSA 5DYOA 3I2CH 1C5CL 1RPQA 1UZ8A 4HD9A 2IGFL 4HG4J 5HHQA 2A6KB 5JW4N 4MD4A 4PRHB 1U8MB 2JIXA 4JZNB 4JLRA 2WUBL 4R96A 4WWKA 1WAAA 2CGRH 1HQ4B 5JW4R 4NQEB 1FAKT 1RZJC 4P49A 1P4LA 1J0JA 4Y19B 5T1LD 3QIBD 2Y9RT 5HDQH 3HE6B 1U8IB 2IPUG 1PAMA 4K2UL 4XMKL 1JMXA 5I1HL 4Z7VE 1R3JB 1T5XA 4TN9A 1WC7B 1RZ8B 4PJFA 2H32H 2BRRL 1AQKH 4CJ1A 3DHJA 1AD9A 4PP2A 3CFEA 1RJZA 3QWQB 2AJ3A 4JM4H 4NJAH 5HTSA 4PREB 4YXHL 1NCAH 2V17H 1YN7B 4MA8L 3ROOA 3BX7C 3MJ9L 1CFQB 1HILA 5IMLB 1BFTA 3H3PL 5ESAB 4DQOL 4TUOA 2BNQA 1NGQH 2ZUYA 3LHPL 1D6EB 2VJXA 4R4BB 43CAB 1WLHA 3P4OB 3UC0H 3WO3B 3CCHB 1YJDL 3H9SE 3OGCA 4PJ8C 5HDOA 5DEFA 2DQFB 2IBZY 3LKQB 1AXTH 4NN5C 5J8OA 5KANG 3MV9A 4XBEL 3U79A 3ARRA 2WSKA 5DJ0A 3MA7B 5IHUH 3BH9A 1IAOB 1JN6B 3CPLB 1AR1C 2W60B 4B7LA 2NX5E 1CDHA 2XACC 1NSNL 2I9LA 2XWBB 4XPHL 1G9NL 5D7JB 4UINL 1PG7X 3U4AA 2ADJB 2IAMB 5IB1A 5L0QB 2ZOLA 3S36H 4PP1C 5CGTA 5B8CB 5MP6H 5A2FA 3WCYA 1QLEL 2XQBL 4RNRA 1CBVH 2GJ6E 3W39B 4K71B 2FJFB 4BSVA 4P2QB 5D72H 2HRPH 4I18A 2V9QA 4DCQB 5K9KA 1I9RH 1MCSA 2FO4B 3BP5B 1NFDB 3E8UL 3VXQB 1AC6A 2E7CA 4M6MH 4OGXL 1QFUL 1LWRA 2DIJA 5IBUG 4R26H 2FD6H 3BIKB 5GJSL 3P2TA 5EZLB 2BJMH 4XWOC 3QEGL 1KN2H 1EUUA 4I4WB 5J4MA 1HXYA 2XN9D 3KPLA 4OCWL 1DR9A 2CLZA 2FEDC 3BSZL 4CMHC 3VXTA 3KNBB 1CLZL 1RJYA 1MFAL 3VFTA 3CXDL 2LAGB 5I19L 2Y72A 2P5WB 4WFEE 1REIA 1XIWA 4JJ5B 1ITBB 1MCEA 4FTVD 3UAJD 4ELMB 3MX0A 1MI5A 4WV1B 3STLB 4FQHB 2Q87A 5ESQB 3VI4F 3BO8A 5BV7H 2YEZA 4GMTH 4YHIA 2X1XR 5I8KL 2E3VA 2JJTA 5CZXC 3QNZA 4OAWA 4HLZG 2DF3A 3HG1B 5INDB 3ZDZE 1MUJA 2F5AH 3HC4H 4L8CA 2DQHL 1I7RB 4K94H 4KVNH 1MJUH 4UQ2B 2EDYA 1NBYB 2JJSA 1NFDF 4FQQA 5FGBA 3TJHC 4NUJA 2NY0B 1MLBB 4LRNL 2ADGB 1Q8MA 4Q9QL 1J86A 5IESH 2GJZB 2XRAH 5HHXH 3AAZB 1U2HA 1FN4A 3OF6A 4J3TA 1IGFH 4OI9A 4RFOL 1D9KA 3GSNL 3JWDC 4LAQH 4NM8H 1UYWL 1ZANH 3O4LB 2AJUH 2QL1A 1FNSL 1GHFL 1AY1L 1QLFA 5T33H 5E8NA 4TVPE 4P2RA 3MV8E 1IAIH 2EYSB 3QUXA 2AK4A 2B5IC 3KR3L 5EUKB 4N5UA 4JFZL 3VFSA 2GAZA 5I0ZA 3LEXA 4AYFA 4P2CG 1RULL 5IBTL 4G8GB 1ITCA 3JV4A 5SWQA 4FQXA 2OJZH 4QTHB 3MLUH 5D4QA 3U7YH 5KTEL 3J8F7 4RIRB 1KJMB 5EU7C 4S11A 1I8MA 4PRHA 1EAPB 1RUML 4PBXA 2J3SA 3WE6A 3BWAB 4JZNA 3H42H 2VLKB 5KANI 4HF5H 1KTDA 3PWPE 1HQ4A 2IFGA 4KHTH 4NQEA 3JV6B 4JPKH 3FMGL 2YK1H 1XR8B 5IBUB 1U8IA 1QHPA 3PXHA 3D18B 4GSDH 1TVHB 1WC7A 1RZ8A 5GS1A 2DM4A 1BBJB 3GSNB 5I8OH 2AEQL 4AENA 3EKCA 2BZDA 3LVEA 1MCDA 1AGBB 1I8LA 1GGCH 1WUNT 3EO9H 4PREA 4F2MB 1U8HB 3AFLA 5KVEL 5IMLA 3KYNA 5ESAA 4ZODA 4R8WL 1X6NA 5SWSD 1D6EA 1Z3GH 2J88H 4R4BA 5CMAA 3GJEB 3WV0A 1Z2KA 4XVSH 1TZIB 3ARDB 3A67L 2DQFA 2MOVA 3LKQA 1NC2A 4XWGH 3RPIB 1WFOA 1H3GA 1NGWA 2HH0L 3AB0C 1Y0LA 4YGAB 2AI0H 1UEYA 3NCJL 5FUZH 1N6VA 5EH1A 3HE7C 3KPRD 1FDLH 4M9PA 4YXKH 1JN6A 5IF0B 1A6UH 3T0ED 2F74A 2AJSL 1NGYB 4M7LL 5BRZA 4P5MA 3NFSL 1J8HA 1VPOL 4FQIL 3O6MH 3ZSSA 2XWBA 4YEFA 4PGEB 3SO3B 5GJTH 3V8CA 5E2UH 1J1XH 1E0OB 2ADJA 3PV6A 1WBXB 2MFNA 1YEIL 4ZSOE 3TT1H 3TA3B 1OAZL 3GI8L 4I0PD 2Z4QA 2W0LA 2HFGL 3HNSH 1QA9A 4NWUL 3W39A 2YOCA 1Q72H 2BY0A 4WDIB 4P2QA 2QLVB 1JWSB 4TQEH 3RL1B 1PG7L 1T3FB 2RAMA 4PJCE 4XNZC 2FO4A 3VXQA 3CH1A 1QRND 3FRPG 4K07A 3NTCL 5K9JL 3MLWL 1MHEB 4YO0A 3DSFL 4WI4A 1DBKH 3WLBB 5DO2D 3QRGL 1F90L 4EOWH 4XRCB 3QJFB 3GMOA 3PDOA 4IJ3B 5DEZA 5ANMB 2I27N 4XXDB 3QI9B 5I8EB 5IIEB 2ZSVB 4DZ8B 3VXRE 5DK0A 2OX5A 1EBAA 3OXSB 3B2UD 1SHMA 3IKCB 2XOTA 1KGCD 5A40E 1BLNA 1U8QA 1X9QA 3QDJB 2VDPL 4PRPB 1C5CH 3W82A 4JFXB 1TVDA 1K4DB 4QHMA 2PETA 4CUCA 4NFCA 3CDGB 3LD8B 2WUBH 2FGWL 3P11H 5KSAD 1JE6A 2KDGA 4GFTB 1MFCL 3EUUA 4N0YL 3BPLB 4WIQA 4WV1A 4FQHA 3STLA 3N9GL 1F13A 4KDTA 4XVUD 3OX8B 4NRYA 5BVPL 4XMKH 4K2UH 4CN4A 2F15A 3DUUB 3C6SA 3QXTA 3KXFB 3E0GA 3C08L 5IFHL 2BRRH 3HG1A 5INDA 1IEHA 5HHPB 3B9KA 4NKOB 4UQ2A 6FABL 4WI9A 4ODSL 1YEJL 5EO9B 5GGUB 4H26B 4MA8H 2HTLC 3MJ9H 1MLBA 1TTUA 2X89D 1P7QB 4NQDD 3H3PH 1BBDL 2GJZA 4LDLB 1ZA6B 4JR9L 4DQOH 3CU1A 4W4OA 3LHPH 3AAZA 4LK4A 3VRJB 4OCMC 4CVXB 4PJHE 5E6ID 2YRZA 1LO0L 4KJWC 1XH3A 3T4YA 4JVPA 4S1DD 5DC0A 4LVOB 1DQML 1FPTL 1J1PL 5B38G 3NPZB 4QRUB 4GT7A 3K7UA 1YJDH 4JDVB 4WJ5B 3O4LA 2YD8A 3SCMD 1WWCA 4M6NL 1TDQA 1FVDB 1DUYB 4CW1B 3BIAX 1A4KA 2KZWA 4HK0B 3SDYL 2VB5A 3UTZB 4XBEH 1EDQA 3VFPB 1U3JA 3K4ZA 4JFFE 3D39D 1SBBA 3FCTA 2NXZB 1CI5A 3LKSA 2COQA 4K3JL 2HLAA 4G8GA 3UAJC 4QTHA 3C60C 1CFTB 2GJJA 5JORB 1NSNH 3T4AA 2B4CL 4RIRA 2P8PA 4OFPA 1EAPA 4WCYL 5CUSH 1G9NH 4I1NB 4UINH 1MRDL 5MHSE 4ONFL 3KPNA 5TH2A 2UWEA 4FQ2L 3RI5K 3PQYB 5I1CL 4ODWB 5ERWB 1QLEH 2XQBH 3QUYB 2MQ0A 3ARVA 1XR8A 5A2LH 4PGBB 4KK8D 1ADQL 3C6LB 5GGVY 2R8SH 4BFIB 3S3SA 5D2LE 4F80A 3RKDD 4X8XA 2MCPL 1X3DA 1BBJA 3E8UH 4OGXH 1A1MB 1QFUH 4OZIE 1UACL 1UH4A 1VGKB 1AGBA 5FGSA 4IHOB 4L8SA 5MENB 4HQQL 1HIML 5GJSH 3TGXA 4MZ3A 1U8HA 1KIRA 2XKSA 4HUUB 3FO2B 3QEGH 4KQ4L 3SHSA 4GKOA 3ZT6A 5FKPB 4KK9C 1FP5A 4OCWH 3TESA 4JGMA 3BSZH 3GJEA 5M95B 3D0LB 4JKLA 2GY5A 1CLZH 1MH5B 1MFAH 4CJ0A 3CXDH 1WISA 1TZIA 3ARDA 3OB8A 4JQVC 5ISZE 5I19H 1X5IA 2NW2A 2VZSA 1H5BB 4UOW0 4HUWB 4LEXL 1YA5A 1BQHG 4X9HA 3RL2B 1Z5LB 3ZDXF 5IF0A 2B1HH 4JRXA 2JJUA 1NGYA 4KFZC 4NQCD 3QO1A 5IJVA 4WTZG 3LN5A 1UXSB 4QTIL 4PGEA 1X44A 2J8UF 5ADOL 5I8KH 2B0SH 1WBXA 4WUUE 5FHAL 1CD8A 3DUHA 4JY6B 2XNAA 2XWTB 3AS3A 3H0TB 4WEUD 2APWA 2Z8VC 2Q7NA 3IFNH 3TA3A 1UJ3A 5C0BE 4OD2B 1MJJB 1OP5K 1SVCP 2EE9A 2VUOA 4WDIA 1S9WB 3RU8L 5B38B 4LRNH 4H20L 2LE9A 4Q9QH 1IQDA 1T3FA 5DJDA 2EDHA 4ZTPH 4UQ3B 2Z31D 3VI3E 3GMRB 3RY4A 3CK0L 2ITCB 1B0GA 3MRHB 4FQ1L 4PBVC 2IH1B 3MRGA 3WLBA 2P24B 1LDSA 3QJFA 1FNSH 2CXGA 4EDXA 1R6VA 1GHFH 1AY1H 5ANMA 1Z0MA 4XXDA 1JUFB 5I8EA 4JHWL 3PGFL 3RZCC 3BMVA 4FFWD 3KLAA 3KR3H 4F37K 1EHLL 4U0RC 2Y4SA 4JFZH 4AM0B 3OXSA 4DOHE 3IKCA 3SE4C 1RULH 4UT6L 5DD6B 5IBTH 5IW6B 1EFXD 1EJOL 1UFUA 3C5ZD 2R4RL 3T0EC 5IR1B 3FN9A 3SBWC 4PRPA 3DPBA 4QRQB 2OSLB 3MPCA 4JFXA 5IWLC 1RUMH 2FSEB 4Z0XB 3K0WA 5D2NB 3CDGA 1A7NL 4Q7DA 2ZUQB 3RUGE 1YY9D 2R1WB 1FBIL 2A74A 3DBXB 3L3KB 4OGYL 2NY6B 3X14B 3LV3B 1IC1A 3FMGH 2HT4D 5AYQA 3DGGB 4HH9A 4I0PC 4HLZH 4FQJL 2MKLC 1QR1B 3DUUA 5GS3A 2ESVB 2X09A 3DURB 3KXFA 4MXVE 4YDLC 4GW5B 4XPFH 3CVHB 4MXQC 5JXEC 2DS4A 3GMLA 1WF5A 5HHPA 5SWZB 1FNLA 4YR6B 2IANE 3CIQA 3BIBX 5EO9A 5E0QA 1QSFE 4NO5B 5GGUA 4ODXB 4LPWA 4NNYB 3RNQA 1F4WL 5KVEH 1CT8B 1KF9B 3P77B 1P7QA 3AS1A 3VDCA 2DI8A 3ESUF 1QEWB 3FQUB 4CVXA 4E5XA 3VD4A 3M17A 2YPLE 3C9NB 1HHIB 1BQHB 1FZKB 3B2UC 1CFNB 5L2JA 4Y1AE 4JDVA 4WJ5A 2EXYC 1AO7D 2A6IB 5HI4D 1HHKA 5J89A 3A67H 3B9AA 4OKVB 2Q8BH 4NC0B 1FVDA 1FZMB 2WANA 4HK0A 1YYLL 3V6FB 5D5ME 2LVEA 2F8XC 3O9WD 5JW4M 2HH0H 3UTSB 3VFPA 4B53A 3GHEL 3KVQA 3NCJH 3GSRA 3LPGA 1CL7L 5KSAC 4Y4FD 2Z0BA 2Z8RA 2AJSH 4M7LH 1OOAA 1T22A 3NFSH 4XMLL 3BRFA 1CFTA 5I71B 3HN3A 4XVUC 4FQIH 2XG5A 4L4JA 5DFTA 3HR6A 4QKXB 5H2BA 3IRPX 1YEIH 3TNMB 3UYRL 2NY3B 1QSEE 2CLVA 3PQYA 1FHGA 4N0CD 1T1XB 5ERWA 4XVTH 5DS8A 3QUYA 2J8UA 1FH5L 3GI8H 3FRPA 5I18L 2HFGH 4OCNC 5BVJA 5IMMB 3QPQC 4RX4D 5FYLD 2YPKB 3M45A 3NPSB 4PGBA 3C6LA 5HD8D 4NCC2 1EERB 1QBBA 1PG7H 1NAML 3NTCH 1A1MA 2DTSA 3MLWH 4ZDHA 5LGKA 3DSFH 5E6IC 5IMOB 3HI5H 4JFHE 1OTSC 4LMQE 3QRGH 5HGDB 4DGVL 1F90H 1LEGA 4HUUA 1IM9D 3FO2A 1NLDH 3SCMC 3TLRA 2DQGL 4D0BB 4XPTL 1M7IA 2A6JB 1CCZA 2VISB 2VO5A 2KH2B 4XAKD 2BVQB 3D0LA 4TSBL 4XI5D 2M1KA 5D1ZB 1MH5A 3TN0D 1PY9A 1JTTA 1ZAGA 3P9LB 2YS4A 4XNXL 3BJLA 4LKCB 4LF3B 1H5BA 4P23D 4PJAE 5HXMA 4HUWA 5C07A 4K23L 4UT7L 2GW5A 1TFHA 3RL2A 4IDLA 3IDYC 1N7ML 1Z5LA 2FGWH 4JAMB 2FLBT 3B6SB 4UTBL 2FBOJ 3OAYK 4PGCB 3KDMB 1AQDB 3REWA 3N9GH 3FKUS 1NKRA 3RWJB 2ED8A 4LNRB 4KV5F 2WZPD 3A6CL 2IF7A 4M4PA 2VDML 5BVPH 2C3VB 1PZ5B 1NAMB 1HHHA 4NKMA 1CE6B 3HAEG 3QWRA 4UBDD 4DAGL 4PJ7E 4KK8C 5IFHH 2VABB 4M7ZC 3LDBC 3OKKB 5I17B 3RKDC 3V6OC 1KB5L 1MQKH 2D7TL 2Q7YA 1WITA 4BSWA 6FABH 1OAQH 2HKFL 4ODSH 4OD2A 1YEJH 3O4OB 5DVOA 2P43B 3QFDA 4U31A 5EOQL 5B38A 3A6OA 1BBDH 4G43B 2IBGA 3WFZA 4Y8DC 4LDOB 3QXAB 5KSVB 4MQXD 3L7FB 1F3DH 5E08L 1DQMH 1FPTH 1J1PH 4POYA 4J7RA 4UDTB 2A0LC 3WHE0 4CKVX 4M6NH 1PBYA 4OGZA 2F54D 5F7NC 1LDPL 7FABH 3GI9L 1EFQA 2P48B 3SDYH 1K8DB 1JUFA 5T3ZL 2HVJA 2M2DA 4PG2A 4AM0A 4X80L 5CEZE 4O5LH 2OR8A 3CLFL 5GS2D 4P2OB 3VFWB 4QRQA 2OSLA 2WBJD 5A3ID 2B4CH 2RR3A 1OVZA 3KHQA 1TVBA 4WCYH 4CBPA 5C2BL 2QR0B 4Z0XA 1MRDH 3RNKB 4ONFH 4HWNA 2W07A 5DURD 1KB5B 4FQ2H 5DD1H 3DBXA 1KULA 1U42A 1YEHH 3EDEA 4Y4HD 4HUMB 3LV3A 5A16B 3X14A 5FECB 5I1CH 5T3XL 1D5BA 1ZK9A 2V2TB 1NL0L 2FNBA 3DGGA 4KRPC 3D2UB 1MPAL 2C26A 1EXUA 4LP5A 4Y7MA 4YBLB 3GMPA 2R1YB 2JIXD 1ADQH 4TPRL 2ESVA 1IEBA 3DURA 3LN9A 4Z77B 4WWKD 8FABB 1QBML 3O6FB 4GW5A 2MCPH 3CVHA 4NN6B 2IPKA 2Z91B 4QHKJ 1UACH 5SWZA 1OWWA 1KYOJ 2BX5A 4EQ2A 4WFHD 2DJ4A 3IF1A 4HUVA 4HQQH 1HIMH 3PNWB 5HPOA 1F3JB 4NNYA 1BWWA 1TETL 4KQ4H 1CT8A 3P77A 3SE8H 2JK5A 1IM3A 3CFJA 4M43L 1QEWA 5LGJB 3C9NA 1BQHA 1L0XA 4QRPB 5C09B 1CFNA 4P4KB 1NCDL 2A6IA 1G1YA 4KRLB 1QBAA 3RVWD 4OKVA 3QCVL 4UNTA 2FCBA 1FZMA 2NQCA 3QNXB 4LEXH 5FCUL 3V6FA 3UTTB 5FYKH 4BZYA 1RJCA 3K1DA 1CXFA 4WO4B 3RKPA 3ZT5A 5HGGS 4KJQD 4LVEA 3HAEB 4R7DB 2ORBH 1YY9C 4RGND 3QUZA 5H35A 3IYLW 4JY4A 2GFBB 3SDDC 3REVB 1U41A 2HT4C 1VACB 1AHWA 4QTIH 4XNUH 4E9LA 1XT5A 4JN1L 5ADOH 2MCG1 5FHAH 4PJ9C 1UWGL 3TNMA 4Z7NF 5FK9A 1HWHB 2P5EB 1NMBL 1T1XA 2NX5A 5EOCL 1FV1B 2ZSWA 2V5MA 3OAZK 3RDTD 2YPKA 3QO0B 3RU8H 3GMNB 4H20H 1A1NB 1SQ2N 5ID1B 3T09A 2B20A 1EPFA 4DUVA 2K1MA 4GKNB 4WU5A 4E41B 2BHYA 1IC7L 3CVHH 4NYLB 2D9CA 1E4KA 4FQ1H 1U8OB 4OCRL 3JWOH 2ERJB 1T0MB 1QTYT 5HGDA 2VUYA 3W5NA 3QB7C 2VNCA 2PYEA 4YGVA 4M3JA 4D0BA 2YWZA 4K8RL 1BZ7B 5IVOA 1DFBL 4FFVD 4RRPG 3ARGB 4BH8B 4JHWH 3N0PB 3AREC 1DVFB 5HHOA 2V7HA 3DROA 3O9WC 1EHLH 2VXTL 1IC5L 4PJEB 4JRYE 1T1YB 4UT6H 5CILL 1JYVA 1EJOH 3P9LA 3IETB 2R4RH 4LKCA 2BOCB 2Y7QA 1BJMA 5JW3H 5DD0L 1HHJB 1MIML 4S10A 2MQ3A 1XF2B 5C0CA 1A7NH 4GRWB 1I8KA 3SGDH 1FBIH 4OGYH 3DRQA 5GXBB 1UJTA 3NCBB 4KKLD 4PGCA 3KDMA 3ULVE 1AQDA 1T89A 3GMQB 1BQSA 1T04B 2BVOA 5EC1B 3RVTC 1XGQB 1IGCL 5E2WH 1GVIA 5DEGB 3ZKQD 4HG4K 3FOMB 4FQJH 5I1GL 4H8WC 1PZ5A 1NAMA 2ADIB 2AV7B 1QPXA 1CE6A 3PWNB 2FL5B 1FG9C 4GKZA 4DVRL 3PJSB 5HD8C 2LU4A 3OKKA 1DLFL 5I17A 1RZKL 4HXBL 5CD3B 3P0VL 3TCLA 5IQ9B 5AUMA 1B3JA 1A1OA 4U33A 5T1MA 1F4WH 1QLRB 4DVBA 4KI5E 1AFVL 2L4OA 2OCFD 5C0AA 3FQXB 1V3LA