2EH7H

Crystal structure of humanized kr127 fab
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
218
structure length
218
Chain Sequence
QVQLVQSGAEVVKPGASVKVSCKASGYAFSSSWMNWVRQAPGQGLEWIGRIYPGDGDTNYAQKFQGKATLTADKSTSTAYMELSSLRSEDTAVYFCAREYDEAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Broadly neutralizing anti-hepatitis B virus antibody reveals a complementarity determining region H3 lid-opening mechanism
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords HUMANIZED KR127 FAB, LIGHT CHAIN
total genus 44
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2007-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2eh7H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2eh7H01
1A6ZB 1I3RA 3BKCH 1DBJH 3S34L 4HV8A 1WLHA 1IC7H 4KJWC 3VD7A 1UM6H 4P4KB 5DURB 4R0LA 1QBML 2NLJA 3T2QA 1TVBB 2AKRB 1UVQA 4XMPH 1RUKL 3QG7L 4LAQL 4X8JB 1IC5L 4J23A 2NW2A 4FXGA 1ZEAL 3QUMA 4KGJA 1AI1H 5EU5B 4GG8A 4PGDA 1FDLL 4AJ0A 1DQML 2YUXA 2NY0C 4LVHB 3BE1L 4X6DA 2HJLB 4G7YL 4PJ8D 3MJGX 5CBAA 3UBXI 1YQVH 1QLFB 3V6FA 2R56L 9CGTA 5LKNA 3V6ZA 5E00A 1MCKA 1WBZB 1YECL 2FATL 1H8OA 3D69A 3DX8A 1VSCA 4U1LA 3OKDB 1WEJH 2PXYC 3V0WL 3IDMA 5AWNL 3VRJA 5HBBA 2ZNXA 3RWEB 3CK0H 1F4WL 4D2NA 4IOFC 5SX4I 1G9EA 5FM8A 1U8LA 4O2FA 5TGBA 1A9BB 1HHHB 2F58H 4PJDA 4Z0XB 3WUZA 1JZ4A 2CO7B 1MJ8L 1SJVA 3SPVA 1T7YA 4KK9C 3WIHL 4X7TA 4NO0D 5DC9B 1BBJB 4OCXL 3PWLA 3MRJA 1DUZA 3SCMC 1TCMA 3U0WH 4JO3H 3T04D 1MFDL 1OAXH 5EWIH 4WHTB 1I7UB 2EYRA 3NMEA 4K94L 4R4NC 1NGWA 3EOAB 3UTTE 3FFDB 2YZ1A 2WM0A 2D7OA 1T0MA 4KUCD 4E0RB 5FO8A 4NUGH 1TFHA 4PJBF 5CINH 2CRYA 3HB3C 5CZXD 3L7EA 3KWWB 1IGIH 1PGRB 1JHKH 1VGEH 3MUGB 4O2EA 1SBSH 3O6LH 5IMMA 4LNRA 4TOYL 4LHUB 3GSXA 2YK1L 4NJ9H 1MCRA 2ICEA 4HUVB 4NUJA 1U8PA 4OV6F 3ZKNC 1P7QD 5GSRA 4PJFB 3M17A 4L29B 5IT2L 1BM3L 2XTJC 4EN3C 1ND0B 3OKEB 3GI9H 2UWEF 4I9WD 4MDIB 4F9LA 4KUZL 4LCIH 3STZB 4GRLA 3V7AG 5I1GL 5EUOF 2X1PA 3GJEB 3RGVB 2H6PA 1RZFL 3QXUA 2DI8A 1YPZE 3WFHA 4U1HB 1C8PA 4BZ1H 1X7QB 5DDHB 5LCVL 5J7CC 3HUJA 1KB5H 1MCWM 5D7JA 2NY6C 3H9SA 4HS8H 4LSQH 1QEWB 4ZS7L 4XVSH 3TJHC 5K9KA 3I50H 3BZDA 4Y2DC 5I1CL 5DVOA 3G6JE 3HHRB 4FZ8H 4YR6A 5DRNA 4LVOB 1GZQA 4IOIB 3MRFB 4MA7H 2AABH 1KC5L 1UG9A 1S9VA 3LKOA 1B0GB 1T4KA 3CH1B 3X3GL 4PJ8B 3WIFB 2WWKT 3DYPA 4LK4A 1B0GA 1GAFH 1KG0A 3SBWA 3DUSA 25C8L 5CD3B 3MRNA 3TVMC 2D03L 2YD8A 2N56A 4U6XA 4Y5VB 4X98A 1A3LL 5ID0B 5D6CB 5IHZA 3IETB 5CIPB 1JPST 2C3WA 4P2QE 1S7TB 2D9QB 2X4NB 2NXZB 2J6EH 3I85A 2AJZA 5T5FH 1MSPA 1FN4B 3GI8H 4DQOH 1KCRH 2X42A 4JFHE 1K3IA 2JJUA 4OLXL 2UVEA 5CEYB 2O5YH 4TPRH 4N0UB 4ONFL 4NN6C 5I74C 3L3OB 1LP9E 1MCIA 1S7UB 5DYOB 1CGVA 4HUKB 3V6BR 3RWEA 4QRRD 4D9QD 3MRHB 4H1LG 1NCBH 2YUZA 1W0VB 2EKSB 2ESVB 3ZLQC 3LKNA 4K2UH 3MFFA 1NGQL 2DOCA 1FE8L 4L5FH 5DWUH 2FD6H 4NQCE 2J8HA 3EFFA 1P7HL 2Q1EA 4H0HB 4R0LB 2NY2C 3BN3B 4Y19D 4HQQL 3MYZA 5IFAH 2WBJA 2IGFH 1PG7H 1FFRA 3QA3A 4QOKB 1ZLUH 4RZCA 1G84A 4E0RA 3U0WL 4XCCH 3QFDA 3BWAA 4LCWD 5HJ3A 1IM3A 3MRIA 1YC8A 2Z4QA 3CX5K 4OTXL 2DQDH 2JKXA 4DFHA 1YY8B 1S9YA 4PP1D 5HGBB 3Q6GL 1HHJB 3QIBB 3IDUA 4QRQB 2P7TB 1FG2A 3QJHB 5KVDH 4JKLA 2DI9A 4HFUL 3VXQB 4HIHB 1U91A 3P9LA 4P5TC 2CRIA 2OR7A 5C0GA 5EUOB 3P4LA 3STBA 3R8BB 4PJCB 3NOIA 3VRJB 3IFPA 5IT2H 4DAGH 5IMKB 5SWSA 3MCLH 4PJHE 2L4OA 5E6ZA 5JUEH 3CUPA 3CC5A 4PJDE 2AQ3A 5KN5A 5L88H 5A16A 3QDGA 3L3IB 4KDTA 3ZE2E 5FYLE 1A6UH 1W2KT 4OJFH 1IKFL 1QG3A 5IB2A 1EEZB 3UTZA 5JXEC 2X2YA 4F57H 3SE8H 3IFOB 4C56A 4S2SB 4G8IB 1KB9J 1U41A 4LLDA 4MA1C 5K59E 1L6ZA 1GOHA 3U9UA 4S10A 5F88B 1BX2A 4HBCL 1K5NA 4EDXA 4JO4H 5BW7C 4LSQL 1EVUA 2MCG1 1UM4H 4CVWA 4IM8A 3ROOA 3X11B 3LKQB 5E5MB 1DQDL 2JIXD 5IFJB 3HI5H 4FS0A 3LQMA 4PYGA 4A6YL 3ABZA 1R3LB 4FQCH 4JB9H 3DETD 1YEIH 3CH1A 2CKBB 4RMWA 4DN3H 1EUUA 2NY0B 2EDHA 4FRWA 1WZ1L 3B9KA 4QRTB 5KW9L 4I18A 1I7RA 2K7QA 3V0VA 3HFML 5ID1B 1OCWH 2V9TA 5B39B 1KIRA 3SE4A 4PGZA 1NCWL 5LWYH 2R1YA 4GBXC 5IR1B 1A0QH 1CFTA 5DRWB 4PRAB 3IVKA 3FHQA 1NMAH 1JL8A 5GPRA 2XZAL 5JOFA 3T8XB 2XTLA 1SMOA 2JF1A 4NYLA 2IANA 4BZ2L 3QDHA 2R4RL 2YHGA 3HPJB 2Z91A 4OI9A 5IWLC 4XPHH 4GAYA 3PDOA 2IANB 1YN7B 2XA8H 4R9HA 3MV9A 4ZUSA 1LO3H 1T0PB 2HT4C 1D5BA 1RJZB 1D5XB 1Z9SA 5T1DL 2BVYA 3EOTH 1SJHB 1LQSR 3BOVA 5F1NA 3VI3E 1UJTA 4FQLH 1NUGA 4M48H 5DXWA 2J5LC 2BOBA 3MRDB 1QYGH 4H20H 3MRCB 5EORH 3RWHB 4ODWA 7FABH 1FO0H 3N1QC 1S3KL 4WO4A 3TPUA 4NQEE 1JK8A 3UP1A 1L7IH 4YPGA 4UNUA 1PLGL 1NBYB 5I17B 3HZYB 1VADB 5CBEB 4YIQB 1A7RH 3BGFC 4GRLD 1BBJA 4JFED 4CVXB 1DSFL 3QQNA 1EMTH 4FQQB 4MD4A 3HZYA 3O3UN 5FB8A 1M05B 5I71B 1YEGH 1TVHA 3HRZA 2BC4A 3MV8D 3GMPB 1UM5H 1T5XA 3OAUL 2P4AB 1RIHH 5ENWB 3T4AB 1JHLL 1NBQA 4IMKC 1MQKL 4G9FE 3SDAD 3U9PH 4UV7H 4QRUA 2AJXL 1NGPL 1AKJD 3TNNA 1RZ7L 4POYA 4W4OC 4I0PC 4TULH 1WBZA 3RU8H 4N9GB 1RJLB 2I9TB 4HUWB 4Z7NF 1CU4H 2ICWI 3O9WA 1INEL 3P9MB 3BZ4B 5L88L 5FYKU 1NCTA 3UAJC 1JZ8A 1UQSA 2EE3A 3IDGA 2NW3A 4DVRL 5C08A 1NAMH 2VLJE 4G8GD 4NO3A 1IAIM 4OGAC 5CWSA 4DW2L 3HUJF 1UENA 4K9EC 5HHNB 4NO0A 4RAUB 3DMMC 5HPMA 5EIIB 5HYSB 1MWAL 1I8MB 1UM4L 2ZWLT 2UUDH 4U6HA 5GRVK 1VFBB 1XR9A 3ZO0A 1CICB 3BUYB 1AFVL 1DBJL 5JW5B 2G60L 4HH9B 2VZVA 3WEXA 1F3DH 4KHXL 3C60B 3H3PH 3U36B 2W65A 4AMKH 1I3VA 4F7MB 3RWFB 4J3OC 4WY7L 4GKSB 4M6NH 3NGBB 3X13B 1BLNA 3T09A 3FQRA 3QEGH 3UO1L 4XCNB 3PWLB 2I24N 4EJ1C 2KKQA 3FL7A 3PGDB 4MXQC 5BZDA 1CE6B 2Q6WA 1Y18B 5CJQH 5JO5A 4MNGE 4LMQI 5IMLA 5IQ9A 4EDWH 1I9JH 2CKNA 3C8KB 3UPCA 4Z7UB 2R2BB 4P9HL 4XPBH 4GBXA 2BVPB 1YQVL 4HKBA 4X7EC 3TBSA 4Y4KC 4P3CL 3RL2A 5MP6H 5E2VL 1F4YH 1S7XA 1UH2A 1NC2B 1N6VA 4C56E 4JRXA 4LDOB 3TO2A 4Z7UF 1KENH 3I9GH 2HFTA 3X17A 1K5NB 2EE6A 4PY7A 4UQ3B 1O7SA 1K9TA 5FM5O 5I9QC 4F7CA 4WUUE 4JGMA 3DIFA 4Y19B 4YH6A 1IBGH 3DNKA 1JNNH 1FFPA 4QT5B 1H9VA 5FYLH 3QUYD 1U8KB 3QAZB 4JQIL 3JWOC 1NFDE 2NX5E 3NIDF 1KLGA 5D2LE 4HKXB 1NBVL 3FQWB 4MQ7B 1OVZA 4P3DB 4ZTPL 5TH2A 3LRSB 4FQLL 4JO1L 2WUCL 4PJFF 4Y5YC 2EKSA 3DHJA 5D1ZA 1CDGA 5DSCB 5LJYH 1RUAH 3BZFB 2GITA 4WFED 4ENED 4JPWH 4QHUB 1U93B 3VXSD 4MJIA 3VMNA 4U7SA 1G0DA 4F2MA 4KV5F 2NXZD 1P53A 2XZZA 1AGEB 1ZHNB 1QSFA 3TFKC 1YMHA 3T1FA 1QBLH 4MD0B 2X6MA 1EZVY 1F6FB 1IGIL 3HC0B 3GSWB 4R96A 4QWWD 2AK1H 1NPUA 4OD3L 2H32A 1NDGB 5EZOL 1CF8H 3OJVC 3GKZA 3W5NA 1UYWL 2X4NA 2A9ML 4LMQE 4ZFFB 2EXYC 1A4KB 2PKDA 3C09C 4J1UB 4XP6L 1RSFA 4LNRB 5HYJB 1UA6L 4F7PA 1V3JA 4FQ1L 4K94H 4MXWL 3NFSL 3K8LA 3UBXA 4HWEH 1B0RA 2EIEA 4S0SD 5EU4B 3AY4C 1XAUA 4NSKA 1T83A 4XXCC 2XIDA 1N0XH 4Y4HC 4QKXB 5C0BB 1VGEL 3GJFB 4LDEB 2HA1A 2JJVA 3MV8E 4O9HH 5T33H 3JWDH 5EU6D 4JM2C 1MRFH 4JDVB 4JAMA 1OTTC 4XZUA 4MQSB 1KPUA 2MMXA 4P3DA 1BM3H 5D1XC 5EU3A 3ULUF 4OLUL 1J0ZA 3HZKB 4PLNC 1G6RL 1X4YA 4U4BA 4N0CC 3IXTB 1IGCL 1JF5A 1HXMA 4JO2H 2W60B 2H3NA 3QI9C 2DQIH 3LHPL 3FO0L 4MZ3A 2ESVE 1UWEL 4OAWB 3SE4C 3O9WD 4HK3N 4U6TA 4K9EH 4PB0H 5HD8C 3FRUB 2R2HB 3GJFH 4WI9A 1Y18A 1G0YR 5EH1A 5JO5B 2Y06H 5ESVB 4PTTA 3LEXB 3PP4L 1XR8A 1X5ZA 3GFUA 3WUWA 5E8DH 1AE6L 2FBOJ 1NC2A 4F58H 3RPIB 2VAAB 3GUTA 4L9LB 4AYFA 3FQTA 3MR9B 5FM5M 4BSWA 3QXAB 3O2VL 4L4VE 5IW3A 3TC9A 5C7XH 4IRJB 4TPRL 1NGZA 3K0WA 5D96C 5MP6L 2YPKB 1AGBA 4JFEA 4AQ1B 3HG1B 5J89A 4NRXB 2IADA 3EJYD 4NKOA 4BK4A 4ZMAT 3MRRA 1IFHH 4IS6A 1ZSDA 1JBJA 3SJVE 4G8EB 5MEND 3SKOA 2DL9A 4PV9B 5T3ZL 3VE0A 4X99B 4NN7B 4WO4D 5HYFA 2A2QT 1K3ZA 4JVWA 5BRZB 1VACA 1BIIA 3OKKA 1DLHA 3U6RA 1X4XA 3OBAA 5INDB 4JQVC 3Q6FA 2VLRB 4D9LL 5LGHL 2OTWB 4HMEA 5D7LB 2NR6C 4I8DA 4DKFL 3V2AR 1N5AA 2P47B 3VGBA 2BVEA 3SCMD 2VLJD 2VN7A 1TZHA 4KHTH 1SJEA 2AW2A 4DZBB 5JA9A 2IFGA 3GRWH 5D2LB 4PS4L 4FXGB 4MAYA 3DMMB 5ADPH 4PRDB 3LEVH 4LSUH 1BJ1J 2M2DA 4NZRL 1I8KB 1G6VK 2F5AH 4XC1L 3BFOA 4BKLA 2RFXA 2B39A 2A9MH 5IV2A 2GAZA 2VH5H 3OAYK 3OPZH 5E0QA 5GS1A 2R29L 4YPGB 3WFCL 4JY5H 5LG1A 2A6IB 3UC0L 3HE7B 3CJJA 5HPOA 2Y23A 3EYUH 3G5ZA 5F72S 1GGIL 2A74B 5HHVH 1P7KB 4CVXA 1CDJA 1GGCH 1IAIH 4UV4L 5D2NB 5E9DD 1VB9A 3FFCA 2UUDK 2BVQB 1NDMA 1RUPL 3WHE1 1CICD 3SEPA 3BYYA 4F57L 3D3VB 3SE8L 1LEKA 5DZNA 3BYTA 3C6SA 3B3IB 2HFEA 5C3LD 1F3JA 5IVNA 3BO8B 4AG4L 5D96B 2GJZA 5DMKB 4M1DL 5MEQA 3QPXH 1CFQA 3GSUA 4NKDB 2NY6D 2X4SA 2B0SL 4YFLF 3QIWC 1GGUA 3KHQA 3VH8A 3MCLL 1PX3A 3I3DA 1QSFB 5L7XH 3AAZA 2BFVH 2R0LL 2D7TL 2FO4B 5DVMA 1UACL 3KHOA 1RJZA 5D7KE 1T80A 5DT1H 4AT6B 2A0LD 1KTLB 3MV9D 3CLEH 5C08B 3ZKMD 3LS4H 3U4EB 1TQBC 4P2RE 1FL3B 1YY9D 3NPZB 5E6ID 4YPJA 5CCKL 1F3DJ 3FB7A 5JIHA 3F58H 3P4MB 4NKIH 2E9IA 3QRGL 5MHSE 3MLZL 5EO9A 4XP1H 1I7RB 1QSVA 2CH8A 4J3WA 1RZKC 5GSRB 5H8DA 3OL2A 3ULVF 3L3JA 4EOWH 2VDQH 1UT9A 1AE6H 1U42A 1LO2L 1J7VR 3GMNA 5E5RB 4I9WE 4KI1A 3WDHA 3E2HB 5ESAA 4KK6C 3VW3H 1WAAF 5C0AB 5GGUB 4TSAH 3Q48A 1IGML 1UXWA 4GAGL 3C6LA 2PR4L 4ONGL 1VDGA 1SYVA 1J9CT 4IEFB 1OSPH 1F2XK 5DQ9A 1AC0A 3MLSH 3VRLE 1QR1B 1V7NL 1NL0H 4PJEB 3KAAA 4XP9H 2DQGH 1D5ZB 2VKWA 4Y16A 2VJXA 2BERA 4YHYC 2NMSA 1TDQA 5GGVY 1CGYA 2WBJD 4CJ0A 1DVFC 1R5IB 1P4IL 5C70A 4I5BA 3ARFA 4H88H 1VEMA 5DS8A 2RAMA 3LD8B 5ISZD 1ES0A 3VXUB 2G5RA 3OKDA 1I8KA 3MUZ1 1FL5A 4QTHA 4U1NA 3K2MC 4I0CC 1N2RA 5DJ0A 4YDLB 4LLWA 4M8QA 2CK0H 1MUJA 3NCCB 2PW2A 3VXMD 4Q6IA 1BEYL 5SWSD 1NGXA 1UWGH 4QYOA 2NY1B 4MJ5B 1X5IA 1QYGL 1JPFB 4IIQC 1RIUL 1A22B 1T1YA 3JTSB 4NDMA 2GFBB 2V5SA 1S3KH 4XWGH 3ZE1F 4PJXA 3T0EE 2WP3T 2BY2A 1QHPA 2AEIT 2FJHB 3KPQA 3T77A 3RIAF 3JBG7 5FYJE 3OPZL 3SJVA 2Q20A 3VE0B 4JVPA 5EO0B 3WHXA 1AD9A 4X6FB 5GGUA 1RD6A 5JNYB 2NY0D 4F7TA 4XMKH 4X7DC 5DGRA 3QQ4A 4UV4H 4TYUA 5ITFA 2AQ1A 4MXVE 3SKJL 1E6JL 4X5XB 2L0DA 3CZFA 4PJBB 5BXFA 3TT1L 5DEFB 4NQCA 5FAAA 4P57A 5D1QA 4X0KA 2AEQH 1XGUB 1A1MA 3SKUD 4PBXA 5I8KH 3HZVB 3MGTB 2DBLL 4GG6A 3IFNL 3WXVH 2OTPA 3BDYL 3V6OA 3QB7C 5DSCA 1INEH 4WCYH 4XB8A 4Z9KB 2PUQT 3KNBB 4GRMA 4U6HB 1I1FB 3QP3A 4K8RH 4N8VG 2CLRB 2EC9T 2V2TB 1NAML 3RX5A 4XP5L 4MCZA 3CH8A 3EO0B 1G9MC 4XNYL 3H3BC 3B9DA 1ZT4A 3BH8A 2P5WA 4UMGA 3PWUA 5A1AA 5KSAB 4G6KL 3B8YA 3RZCD 2G75A 2XI9A 2WUBL 1BVZA 2DLTA 1AO7D 1FIGL 1I75A 3BH8B 5EIVA 5GS2H 3VXRD 2WIIA 3U7WL 1WT5C 4PJHA 2O5ZL 2M8XA 3NN8B 5ANME 3TZVB 3MLRL 4MHHI 2FZ3B 3ETBF 1J1OH 2CSPA 5D6CA 1SY6L 2B4CL 5DK2A 5F7UA 1SYVB 5F9AC 3BT2L 2PNDA 3GKWL 3PQYE 2F74B 3WNLA 4XPBL 2QL1A 4MNQD 3ZL4H 5D9SB 3OKNB 2ARWA 4NPYB 5KSVA 2GY7B 3P3YA 3D69B 1KJ2A 3FT4A 1TQBB 2ESVD 1EGJH 4M43H 5GRZA 3BUYA 3NZHH 5F89B 4BK5A 3G08B 4ELMB 5FO7A 1LE5B 5E8NA 3TIDA 3W39B 4ZOAA 4JRYE 2Z8SA 4M7LT 5TQ0L 2ZCLH 2AK1L 4PJGE 1NGYB 4WHCA 1BEYH 4Z8FH 1E0OB 1ORSB 4CW1A 2FL5A 1BZ9A 4UOW0 3OR7B 4HWBA 1WIPA 2NY5H 2AGJL 2YD6A 1MHEA 3KYMA 5DD3H 2BDNH 3BKMH 5E8OB 4N0RA 4UZGA 4X4ZA 2FX8L 4XMPL 4IRZL 4LL9A 4MJ6B 3WYRA 1V3KA 4NQCB 4WV1B 3V5KA 2AS5M 4HIHA 1QLRA 2OXHA 1ZHKB 3QJHA 3GO1L 4PLOB 5D2NA 3UTSE 1AXSA 2P5WD 3O3BA 4FQ1H 1P7KA 4W4NA 1MI5E 2AK4D 2GSIB 5EUOE 4XNUH 4PRNA 3T4YA 3DRQB 1I85A 3IFNH 1FHGA 1RURH 1U8HB 1MRCH 1RZJH 2FECI 1CD8A 5J12B 1S5IH 4NQEA 3W9DA 4DOHE 3EGSB 4MS8C 4YJZL 1RK1B 4X9HA 4FQXC 3V0WH 2GFBA 2DQUH 1JGEA 1F42A 3H9SB 4KQ4L 4LHUG 5F70A 4XPFL 2XG4A 3QO1A 4G43B 5HGHB 1ZT4B 2NTFA 4GRWF 5F1SA 5C0DB 5IFHH 5ABDE 1RZIB 2ZCHL 1TJGL 3DX6A 4V1DB 3LS5L 1SM3L 4PLJC 1F4XL 2MCPH 2VIRB 3FZUC 4LHUD 1JWSA 1LO4H 4ZUTB 4DZBA 4JFQA 4NNPH 4F8QA 3W9EA 4OT1L 5C7XL 2DICA 2C4XA 3D0VA 1CGSL 1QO3A 3Q1SL 2P7TA 5AG8A 5I1HH 3P9MA 1PYWA 4XRCB 4OKDA 3HPLA 1A1MB 2YPKA 2NYYD 3PXJA 2CMRH 3BP5A 5CAYB 2GT9B 4MDJA 1RV6X 2ZCKH 4S1RH 1B6UA 2WWMD 3P4OA 2NXYB 5B38A 4XNZC 3C5SB 5F44A 5IJVB 3ZDZF 3V0VB 4MGXA 4LLUB 1X4ZA 4ERSH 2WSKA 2V9RA 1FNEB 3NFNA 3PWPD 5BOPA 4YFEA 3VFGH 5D1ZD 3MXWL 4YDIH 2VUYA 2YN3A 2X4SB 3L6FB 3HG1E 5IK3A 1NLDH 2IPUK 1U2CA 3GBNH 1T2XA 4UU9A 5FHBL 2OK0L 1YECH 2FH8A 5J6GA 1WIOA 5EZJA 2B2XL 2YXFA 1LEKB 4K7FB 4K55A 4HPYH 3J8F7 5GZOD 3BESR 3S4SB 2ARJA 4IIQB 4JHAH 3QWRA 3X13A 3VDAA 1GH7A 2EO9A 3UROR 2VDNL 3TFKD 1AQKL 1H3XA 5J11C 5E6IC 3MXVH 4JJ5A 2GJ6E 3OXSB 4JFYB 2WIMA 4LLMB 5EZIH 2R8SL 4HAFA 1QUNA 4TTDC 4PD4J 1CS6A 4XPAH 1HDMA 2XFXA 5DJCB 1U6AH 1OPGH 2DIBA 3V4PL 3NTCH 1F8TL 5ANMB 3B5GA 3PL6D 5FUCE 4X6CB 5F7WC 4M93C 4HMDA 4FFWD 2Z93B 2ZZUT 4PG2C 5DURD 1G7MB 4HX1B 5I1JL 1FVCA 1JGDA 5KSAC 1QRNE 2IG2H 3W2DL 3RTQD 4C83B 1I8LC 1CGXA 2VDPH 3KR3L 3DVNB 2GIYA 1FLRH 3CVHL 2Y5EA 4M7ZB 4PV9A 4XH2A 4LSTL 3QHFH 2GK0B 1Y0LA 1FO0A 3VD3A 4JFOA 1T5XB 3TJEL 4UNTA 1FORH 5L7XL 2ZNWA 4XGZA 3BP6B 3HMXH 2AXGB 2IALA 3LOWA 3D2UD 1IC4H 3EJZD 3QUZC 4FQ2H 3CVHA 4WUUB 2D0HA 3HE6D 5E4EC 1EK3A 5FHAL 1EEUA 1D5MA 2DQEH 4KJPC 4JPIB 2EIDA 1F11A 2DD8L 3S6CA 3DGGB 3DVFA 5DUMH 3T65A 3P0YL 1R3LA 4G6FD 1BQLL 5DUPH 5KSUB 3DO3A 4PP1C 5EOCJ 1Q9WA 3WIIL 3W11D 4R7DB 3VGFA 1MQ8A 4PG9A 1CZ8L 1SVZA 4X6CA 2EE9A 3LS5H 4KMTH 1RMFH 1U2HA 4F3FA 3TESA 3WE6A 2AABL 2AXJA 5TPWL 5B4MC 3HZMB 1OY3B 5L2JB 3OWEA 4U1MA 4UDUB 1I4FB 5J11B 2J88L 5IWLA 2BNQE 4KKBC 1OWRM 4Q2ZA 4O02L 4WI5A 4NZTL 1MWAB 1AXTH 3ECBA 3OKEA 3BKYL 4PRPD 5I1HL 4Q2ZB 2GJ6B 3BJLA 3BDBA 1MIMH 2VXTH 5EN2A 3TYFA 1JWMA 4PRNB 3TNNB 3F12A 2VZ1A 3BI9X 3KPMA 4U1GB 1W72B 1A02N 2QQNL 2VLKA 4YHPA 5C9JB 3E3QE 4WO4C 4WW2B 5DHVB 1NCCL 4PJGB 5GGQH 3IDIA 4YHNB 1OM3L 2EDDA 5FK9A 1KSRA 2PYED 2IF7A 4OGAD 4GO6B 3EAKA 3MBXL 1BQSA 4ODTH 4XVTL 5C1MB 4HK0B 5D4QA 1RK0A 2PR4H 4M7KH 5I16B 3DSFH 4Y1AB 4RGMC 2WBKA 3QDMB 1LO0L 1JYNA 4PTTB 3U4AA 4Z7QF 3W0WA 2DYPA 2B1AH 4Y16C 2AV7A 2R0ZH 3P11L 3GMOB 1S8DA 4Z7QE 4AEHL 3HPLB 1BLNB 3KGRA 4RQQB 4R90L 3HI5L 4OSUL 3RWFA 1E4WH 4LQ1A 4XP4L 5FYJH 5DMIH 1IKNA 4QHUA 1YEKH 3TIDB 2XRAL 4QXTB 5BV7B 2Z9TA 5EA0L 1AP2B 3MV7E 1OAUL 2PO6D 1QACA 3QDJA 2CK0L 3EJJX 5T1LB 2JELH 4F2MB 1PEWA 1WBYB 1UVQB 2FB4L 3PGCA 3EO9H 1MVUB 3D0LA 4LOUC 3FT2A 3WDJA 4MAYC 1C5DA 4W6WB 4XWGL 3TVMB 5EU5A 3WS3A 2P8PB 3LZFH 3RWCA 2HAZA 3OQ3B 3C5ZA 1DBML 4N9GA 3CVHH 5CEXA 1YNKH 5GGRA 1JYWA 1G9NL 1B3JA 4KDWA 1OLLA 1T1XB 3K3QA 4PGJA 5BV7H 2DMCA 3LD8C 4HUUB 1MJJA 2AXGA 2V5YA 1KN4H 1MFAL 1FNSH 4LCWE 2G2RA 2C5DC 4GKZA 2B1HL 3P40A 4PJEF 4M61A 4OUUA 2QR0B 2E7HA 1S9XB 3I75A 1IC4L 4FQXA 1F2QA 4NIKB 4P5KA 4TUJB 1H15A 3UJIH 1EVTC 3RIFK 1YYMH 3MMEB 4PJ7F 2O5XL 2F53B 3O2WH 3VXUE 4P5KB 2IWGA 1G7HA 1FCGA 2VZOA 4JM2A 4WFGE 4BQ6A 3UZVB 5D7KD 1A7OL 2JTDA 2IEPA 2I25N 3QEQE 3TPUB 2ADGB 4OLEA 4G6KH 5D93C 2ADIB 3FTGB 3HC4L 3LKPB 5H37H 4MJIB 4MCZB 3WS6A 4JB9L 4K3DL 2BNRE 2H32B 5IVOA 2HH0H 2XXMB 4OD1H 4FFVD 3TPKA 3HC0A 3O6KL 3GSQA 5MENE 2GSGA 1G6RB 4JR9L 3V6FB 5KVMC 3G5XB 4M7ZC 1JV5B 1OF2B 3U0TA 1OGTB 3MRPB 2DBJA 3LH2H 3WNPA 3RX7A 4YXLH 3SOBL 1RVFH 5IF0A 5EB9A 1H3VA 3W9EB 4LVNC 3EW3B 3L3DB 1INQA 3GHBH 2EIZA 4CNIB 5IB5B 4J4PC 3PF2A 3QNXB 1ND0A 4RMUA 1NEZB 2R69L 2YPLD 1CFVH 3A6CL 1UQSB 5D9SA 5CGMA 3Q5YA 3SDXB 4G80A 4NPYA 2CLZA 1F4AA 2Z0BA 5CHNB 1I9RL 4BSVB 1ITCA 4HUXB 3DBXA 4FQXD 4X6CE 3CFBA 1S8DB 3OSKA 4KRLB 2IAMD 3ILPB 4NN7C 3VFTA 5MEPA 5TQ0H 3CFDB 4DW2H 5JIIA 2HMIC 1J86A 4UOW1 3TYGH 3FFDA 3H42H 4XXDB 1T6VN 1OGAD 3GMQA 3CZJA 3ALPA 4KH2A 4M8VA 5HHXL 4YR6B 2R0ZL 3P11H 4DWHA 3FOMA 3PP3H 5C0RL 3EHBC 3QIWA 4QRPD 4P2OC 2X40A 1CXEA 2R0KL 4GJTB 3E0GA 5DK3A 2NY5L 3NZHL 3H9HA 2D31A 3D85A 5AAMA 4OKVA 5ETUB 5D7LE 1EHLH 3AS3A 3LQZA 1E4XI 1FVDA 1OARL 4L3CA 4M7JH 4JFDA 2QQKL 4JZJA 3FQNB 3EYSH 3DV6A 1QHOA 4YNYA 5ISZE 4QXGL 4KQ3L 3T3PE 1AIFA 3WLWC 3RWCB 5FKPB 5J4MA 3PIQA 1VPOL 1E4KA 3QNZB 5IBUG 1MLBB 3O0RH 4R97B 3VG0L 5E00B 3AM8A 3BRDA 3FB8B 5E4IA 1F58H 4CMMA 1Q94B 4FZEH 2VL4A 1J05A 2AP2A 1G9NH 4AIOA 5IKCA 5D1QB 2PCPB 4YDKH 1FH5H 4YUEH 4LPVA 2ARJB 4IIQA 3MUHL 4EQ3A 4WEUD 3ARED 1C08B 1FCCA 2ADJB 2ZCHH 4U1GC 4UIKH 3SKNB 1U8IB 4ODHL 4OZFA 4YIQA 1T2QL 1IM9A 1DBBL 2M1KA 2XOTA 3N9GL 2X1OA 4CBPA 3KPLB 3E6FA 3RFZC 4HWBL 2W0FB 1P6AB 4XBEH 4JN2A 3P30H 1AD9B 3BWAB 4LEXL 1K4DB 1QFWM 3CSGA 4OQTH 3IS1X 3MV7D 3F7QA 5DJ8B 3U4EA 3ZTJG 1W72H 1U3HD 2HH0L 4XPTH 3TO4A 4JY6A 4ZUTA 5FM4A 3KYMB 5T5NF 4K3HA 5HY9A 2BVTA 4Y7MA 5I1CH 4J3VA 1F90L 1ZA3B 5FCSH 2BVOA 4YX2L 2W9LA 4WV1C 1S78C 4AH2B 4ELKA 1FV1A 5ACZA 4OGYH 3F7RA 4ZFGL 1N4XL 5GHWL 1OQOA 4HKJA 3D39A 3VWJC 1KJ2L 1ZSDB 1KLUA 5CSBA 3MUJA 4U1SA 4TVPH 2IADB 2YBRB 1CR9H 4Z7OE 2CDEA 1N0XL 2C3VB 4YDLC 3QDGB 4XNQB 4Y4FD 3U48A 2OI9B 1I9RH 2X9YA 4HJJL 2Y07H 3BIAX 5FYKD 1UXWB 3HC3L 3SDYL 5FFLA 3D2UA 3HI6L 1QPXA 3MRMB 5DJYB 1YEJH 2P5WE 3B2VH 4XAKD 2HKHH 3GM8A 5D7SH 1A1OB 5F71A 3OKLB 5E2TH 1HZHL 2I5YL 4PJ8A 4MAYB 1LDPL 3LHPH 4NGHH 2LABA 4Q0XH 2Y9RT 4BFEA 5EO9B 4ZFOL 3ULVC 4MMXC 1YPZB 2CR6A 5F7EL 1HSBA 3MJ8B 1GIGH 4K23H 3ULVD 1I9IH 4LVOC 4HFWB 4MNGB 3QUXD 4C83A 3P4NB 2DWDA 5ILTL 4LSPL 3A6BL 2VSDA 3BXNA 1ITBB 1MCCA 1WIUA 1AH1A 4X5LA 2DAVA 3KPRD 3U0PA 4OUOA 4OIAA 4P4KC 3MRLB 3KYOB 5C0JA 4TUKL 4MS8D 2NX5D 5TDPA 2CIIA 5BS0D 1CT8A 1A3RL 3WDIA 2ZUUA 3L3IA 3UPRB 1CFQB 3MLXH 2OQJA 2P8LA 4WI3A 4JQXA 2F8VA 5FF6B 4EN3B 2YSSB 3OZ9L 3ZMRA 5JHDA 1DFBL 3VXME 4Z7NE 2ICWB 2IFFL 1U3ZA 3CMOL 4G7VL 2KH2B 3MRQB 1INDL 2R9HD 3OXSA 4JFYA 5HGHA 4KJYA 1FVEB 5ADOL 1CXHA 2NR6D 2JJWA 2V7NA 4V2CB 1DLFH 5BVJB 1A9BA 1HHHA 3L9RB 4KKAD 4PJDB 1M7DA 1VGKB 1BIHA 3B9EA 3RVWC 5J8OA 4IBLT 3PWPA 1QRNB 3WSQL 2DMBA 2KZ1B 4TUJA 2ITCB 1XF3B 3HE7A 4HS3B 5FHAH 5CD5C 1S9YB 5HGBA 3K81A 1NSNH 1ACZA 1IE5A 3L95A 3QHZL 1M1SA 2NY3C 4MJ6A 1K4CA 1BQLH 1WQVT 4QXUH 1JGDB 2ICWJ 3L3HA 3WIIH 1HQ4B 3HAEG 3KS0H 1I1RA 5GQBA 2C4FT 4JJHA 5E70A 4LBEA 2BNQB 5CZVH 4EBQH 1H3UA 2NZ9C 4PJAA 1MREH 1JNJA 3S5LA 3ARFC 4JDVA 1Z6JT 2VE6B 4U1IB 3WFCH 5GGQL 3WFHB 4EUPG 5DF0A 1ZA6B 3U4BL 4U1JA 3R06A 1N6UA 3PGCB 1HIMH 5JR1L 3VGEA 1YEFH 1Z2KA 2GYSA 1NC4D 5DJDA 5C0BE 1OTSC 1ZOXA 1MIML 1T6WA 2VXTL 1JZ5A 3I2CH 3R1GL 4YHMH 4OFPA 3MGTA 4OFYD 3QFJB 3F65A 2UYLB 1RUMH 3OHXA 1HKLL 3A67H 4RFEB 4HUNB 5FGRA 2VLLA 1WWBX 4DEPB 2YOCA 2Y07L 4N1CA 1CTOA 4QXWA 12E8L 5DD6A 4XC3L 2R1WB 1VGKA 4RIRA 2E9JA 4K8RC 4WU5B 3QAZC 3ULVL 2IPKB 5DO2D 3SQOL 3VI4F 3MACH 4RIRB 5D7SL 4FFYL 1GGBL 2NY4D 4EXKA 1E4JA 3GMLA 4OLVL 3ZTNH 5C8JB 1LO3L 4LCCA 1HNGA 1LDSA 1DDHB 1JN6B 5DRZA 4G9FD 1XF2B 5T1DH 1GOFA 5DRNB 3C60A 3U36A 1Q9OA 4KKLD 5DEGB 1N0LA 1CG9A 5LQBH 5ESAB 4NDMB 4C55A 2GCYA 1LK2B 5KS9E 4JM4H 2ENSA 2PYEE 3VJ6A 2X7LA 1A3QA 3QCTH 1DL7H 3VWJB 4XP1L 1UZ6F 1BGXL 3TIEB 5B3JF 4MB3A 1AR1D 2VDML 4LSPH 2AV1A 4OZFG 4XNQA 3GI8L 1PLGH 1I1AD 2FZ3A 1RHFA 5F3BB 2Q3ZA 1T22B 1B4JL 1MJUH 2V5TA 1A7RL 3SDCC 2FEEL 3RIAK 4TQEL 4HIJB 1BREA 1U3YA 1MHEB 3EYVA 3O2DH 3IT8D 2VDLH 5F7YC 4TUKH 32C2B 1QLFA 3QCUH 3ARBD 3K46A 4Y16B 2H26A 5JZ7D 5B21A 2NY7L 2GUOA 4I48B 1KELH 3RUGB 2YPVH 2QSCL 2EDWA 4AG4H 3FO2A 2F8OA 3BVNB 1IAKB 5HI3D 1DFBH 2XFXB 1FP5A 3CNKA 2APBA 3S96A 4LSVH 3PDGA 4DKAA 4N5UA 2ILLA 5A2LH 2R0LH 2YUWA 4ELMA 2DS4A 1ED3B 4G6JL 4RQQA 1XF5B 4PRID 4LARL 5JDJA 5IV2B 3AS1A 2XKSA 4XCCL 4E41B 4JFFE 4PJ5B 1MFNA 4KZEL 3RWGA 1OLZA 4R96B 3GSNH 5IW1B 4KK5D 4PREB 4POZC 3RRQA 2COQA 4ODVL 1YEEH 2V5RA 1PG7X 1KIPA 2NY1C 5AZ2L 3GNMH 2ATPA 2IH3A 4FXKA 4PJBA 3SBWC 3VXRA 3ARXA 4J1UA 4OLZL 4H8WC 4JPVL 5FYJU 4EBQL 5KANG 3BGFB 3OMZA 3QEGL 3UO1H 1WCBA 2K3TA 5BV7C 5INCA 4YHPB 4Y88A 3DLQR 1CLCA 4XNZB 2E27H 5DQDL 3UTOA 2V2WB 1A7NL 3I6KA 3ESUF 4APQC 4OQ1A 5F88A 3ELAT 4PJIA 1L0QA 4CDHA 2YC1A 5KVGL 3KJ6L 2P44B 1CLOH 1IL1B 3MUY1 4PRBB 4H1LH 1O5DT 1JUFB 4PGCB 4QRSB 2CLRA 1A6TB 2P5EB 1SJXA 3CPLA 4R7NA 1UEYA 2CUMA 1C16B 1U8HA 2NNAA 5IHLB 1Q1JL 3T0AA 4HBCH 4M5ZL 1U36A 3BRGC 4JRWA 5ITBH 1IEAB 3G6DH 4ORGA 2C3GA 4HV8B 2FX9H 3NIGE 1FGNL 4M62L 3LN9A 4JCMA 3LIZL 3MCKB 3QIWB 1TVBA 3RWJB 4DKDC 2D0FA 3MV01 4Z7UA 5IESL 4P5TB 3BN9D 2FX7L 3O6FA 4NBZB 1WZKA 4U6YB 2XNAB 1CICC 4Q9CA 4P2QB 3QT2A 3WO4C 2ZPKL 5KG9B 3RPIA 1DANU 2FWOA 4XT1C 2HT2D 3DECA 4G6AC 4K3JH 5DD1H 4JG1L 4JDZA 4O00A 3D39B 3VDCA 3GSRA 3GHEH 4OGXH 3SDCD 5BO1L 4BH7B 1U92B 1T1ZB 5GIRB 5IEHB 3NACH 5MERB 3RDTB 1LP9B 4CVUA 1KTDA 2A83B 3LEYL 2DLFL 5GSVA 4BFIB 2QKIB 2DDQL 4XPHL 1OAZL 2EE2A 4MQTB 2NY2B 4ZDHA 4HZLA 5I1LB 3GKWH 2ORBH 5IG7B 4LHJB 3ULSB 3IDJA 3PDOB 1F13A 2DM3A 1KELL 1DLHB 3U6RB 4XCEA 1YC7A 3CGTA 4P23D 3LMJH 5HSFA 1UKQA 1TZGL 1MUJB 2EDRA 4JAMB 4KPHH 5ALCH 3CXDL 3WKML 2CXKA 1YMME 3CLFL 1IM9B 3B9VA 1GHFH 2W91A 1SEBA 2VZ3A 4R2GC 4YO0B 2IQ9L 4OZIA 3CVHB 1IEBA 4PFEA 1II4E 5CEZE 1JF1A 3RZCC 1EPFA 4UILH 1G7LA 3MRBB 3QWQB 3H0TA 3DX7B 5IW1A 2R1XB 5CIPA 1ZTXL 5FV2A 3CDYA 2H2PC 1HI6B 5I1EH 5ESVA 1QKZH 5T3XH 4Q6YA 2MJWA 5FA3B 4YFDB 1OSZA 5F1OB 3FRUA 2ITCA 5DA4A 3T2PA 5AD0B 3ZKQD 1XR8B 1T21A 1U8OB 1OSZB 5DK0B 1LEIB 1MF2L 3UXFA 3DVGB 1EJOL 1JHLH 3WXWL 3KJ4B 4PJXF 1TTUA 4KTDH 2WBWB 5I2IA 1BVKA 1T2JA 3RAJL 4J3XA 4FQJH 2PF6A 4YDVB 1UZ8B 1K8DB 4TSCH 1EHAA 3RGHA 2CDGB 2F19L 1HKFA 4XCEB 3FAXA 3NAAL 5IW6B 1VKXB 1AHWB 3U2SA 4G7YH 5GHWH 4LRIC 5DDHA 1S9WA 1MAKA 5F97E 5L2KD 5KZCB 1TETL 4MWFB 4WFFE 4JREB 4Y5YA 3BPNB 1BD2B 4JFFA 3GJFK 4Y2DD 4EI5A 5HYJE 1NLBH 4JG0H 3PV6B 4M5ZH 4HIIB 3O4OB 1IC5H 4NO3B 1RZFH 3MREA 5ICZB 4P5MA 4N0CD 4PJEA 3C5ZD 2W0FA 1UXSB 5SX4H 5IBLD 2FRGP 4WWKB 1IM3B 4V1DA 3ZSSA 3PXHA 4QRQA 4LFHD 5L2KE 1YY8A 3FFCD 4ZAKC 2FR4A 5F6HI 1MHHA 3GMOA 2BVPA 1IGFL 5SX5H 2DYPB 1FBIL 2NXYC 4I18B 4JDZB 3JV4A 5D7IE 4KK8D 1R0AH 4P9MH 4J6RL 4WW1B 1KIRB 1QOKA 1OB1B 4YGVA 3ROLB 4Y5VC 3S36H 3OGCB 2FEEI 3DJ9A 3QI9B 5FECB 1YA5A 1VFAA 3U46A 3FB8A 5AG9A 4KI5C 1I9IL 1WBYA 2DYPD 4LLQA 1S7UA 1OAYL 4XVUC 4CADB 4G8IA 1PG7W 4KVCL 2ZUVA 5D5MA 2VLKB 1KJVB 2Z8WC 2CIIB 1T89A 3IDJB 1OAZH 2ZSWA 4R4FL 4U1IA 3HKFA 5D7IF 4HKXA 2ED7A 4KY1L 3IDXL 1C5DB 1EXUA 1MI5B 1YEHH 2CQVA 3IYLW 3L5XH 2MNUA 2RIKA 3H7BA 4KRPB 3OJ2C 32C2A 3KLHD 4J7RA 3S35H 1BHGA 4JFZL 2PTVA 3N1FC 4NKDA 4P2OB 4F15B 1RZJL 3QZWB 2AV7B 1Y6NR 4HWZA 1OHQA 1OWWA 4L3CB 2Y7QB 3AXLB 4O51B 1MCPH 2IPTH 2W9DH 1H15B 3SDDB 4XVJH 2DIAA 3CMGA 1GGTA 3MTRA 2APTA 4Y4KD 2XTJB 1INDH 3AU1B 3JTTB 1X6LA 3IJSA 1KIUA 5CBEA 5FDWA 4WEBL 1SMAA 5EZOH 5I17A 5EZLB 5KSBA 3T3ME 5F96L 3UYRL 1Q8MA 2A9NL 4XP6H 1BZ7A 4NZUL 5CEZH 2XPGB 5EC1A 3SDDC 3DXAD 3WFEH 3GSVB 2HLFC 4G42B 4F37F 4PGBA 4HS8L 4C57C 3ZDYE 1QTYT 3MNVB 3F12B 1Z3GL 3GSVA 4ZUUA 3KYOA 6CGTA 3BMVA 1HHKB 5KVDL 4HFUH 1BP3B 3A67L 2XY1A 5ITFB 4ZYKB 4DKEL 4F33A 2E7CA 2XACC 4AM0A 4L8CA 4X7SL 4QCIA 1MRFL 1PEZA 4RISL 4Z0BL 5ICZA 4L3AA 3VFUB 3OHXB 3NGBC 1U95A 4HIIA 1CDIA 4YDJA 4N0UE 1QSFE 4LLAA 5EBLB 3HCVB 5D1QC 1JTOA 4HKZB 1DUYA 3L3KA 1A6UL 3DGGA 4NO5A 4ZPTB 5F8RC 1OSPL 3UTTA 3W0WB 1XIWA 2XKNB 1HINH 3O4LE 4UAOC 4UDUA 3VXPB 5GGTL 4O2CA 1PZUB 5T5FL 5JQ6H 2Y25A 2EYSA 5DS8B 1UWEH 3FCTA 2EDLA 3AS0A 5C09E 1AD0A 1B0WA 1N2RB 4MYWB 3GBML 5E2UH 2EDOA 4R6UA 4HQQH 3MGOA 1FL5B 3JV6A 5L9DL 4ZFOA 1DQDH 1MFCH 5DQJB 1I1YA 3HRZB 2WW8A 3RVTC 1ODAA 3EYOB 1NBYA 5F9OH 4E9LA 4GRLC 2BJML 1PVHA 1ZK9A 4N0FA 1P4LA 1WFTA 4PJFE 3F62A 4N68A 3IDIB 5F9DC 1DQTA 4ONOA 3S36L 2PW1A 3AUVA 3MA7A 4PR5A 5JIPA 1M6OA 5JW4Q 1R5VB 4B5EA 1R5WB 4WIQA 4GBXB 4MB5A 4HJ0C 5FA4A 1AO7E 2X4RB 3HRPA 3KPSD 1JZ3A 3V6ZB 1BGXH 4QRSA 1J1XH 3QIWD 4QRPA 4RMQA 4S1SL 1U8QB 5GGSA 4HJGA 1FPTL 4GKZB 5C0CD 1C16A 2NNAB 5IVXA 2UWEA 4CMMB 4V1DE 1GGYA 3KXFA 5LGJA 4C4KT 1MFBL 2GEEA 2BXZA 2VR9A 2RR3A 1UCBH 1MRDL 4WJ5B 2A1WH 4MD5A 1JGVH 2F54D 3O3DA 5TQ2H 4G9DA 4C56D 3OR6B 2HKFL 1C1EH 3S3SA 1PSKH 4C54A 4HIXL 2ADFL 4KMQA 1BFOA 2P5ED 1CFTB 3LRSA 1QSEE 2YRPA 1FZKB 4KDTC 4UTBH 5T1LA 4MA1B 1VEOA 4YE4H 1EEQA 1EERB 3MBED 1GZPA 4RGMB 2AEPH 4DGVL 4BFGA 1NGWB 1FNHA 4UUJB 5J3HC 4YEEA 4X6DE 3T0BA 2XWJB 4XX1E 2X4TA 3RNKB 5E1AB 1EV2E 2A9NH 4LIQL 4XH2B 4MLIA 3EIFA 1KUMA 1MAMH 1OAUH 2PTUA 3QEUB 3SGDH 3EZ8A 4PV8A 4X4MA 3BKCL 5IKCB 3G9VA 2Z92A 1P9MA 1ONQA 1ZHKA 1CE1H 2YRZA 1Q9KA 3U7WH 2P48B 4JFXA 3VA6A 5SWQB 1DVFA 1KPRA 4PJ9C 4EVNA 3IRZA 1QFUL 3P73A 1UEMA 3MBEB 1O7VA 4LPXA 1FNGA 5KN5B 4ODSH 1KGCE 2APVA 2LAGB 3SGKC 3WJLC 3K4ZA 2RB8A 5EFIB 3B83A 1GPOH 1SEQL 3FOLB 1BFOB 2OTUB 1QBBA 1K6QH 1RY7B 1I7TB 3WE6B 2W60A 2YMXL 2OI9C 4Y4FC 5DD5H 4G6MH 4JEGB 5E8PA 5FCUL 1HQ4A 4W68A 1HH6A 1MWAA 3ULUC 2QHLA 4ZNEE 3WJJA 2EDKA 2IQAB 3H9HB 2BNUB 4OZHB 3B2UD 2Q8BL 3DUSB 4TSBH 5DUBA 5AAWA 1EBAA 4RNRB 4EUPH 1AFVH 4K7PX 5IGXH 4OSUH 5IBTL 5DZOA 1JPTL 4BFBD 3KPSB 4KHXH 4ZYKA 3NBNA 5C3TA 2MQ0A 2XZCH 5DD0H 2LU3A 5FA4B 5C0BA 1LP9F 1RU9L 1R5VA 1YPZA 1A47A 3GSRB 3BPLC 4HPOH 4HT1L 2FB4H 1CXLA 4GXVL 1KCVH 1YEGL 5E8OA 1P69B 5CHNA 4IRJA 2AK4E 3QNXA 4WFFD 1UC6A 5B3JE 1LE9A 3FB6A 3R4DA 1P84J 5I1DA 1PKQA 1RZ7H 1CGWA 2ESVA 4PUBL 1EO8L 5BV7L 5EBMA 3VFMA 3D3VE 2CDEB 4APQB 5D7JB 2NY4B 1U8LB 4O2FB 2QSTA 3M07A 2H9GA 4K3GA 4TNWK 2YK1H 3ME0A 4NJ9L 4PBVC 4LHQB 2X70B 3EYFA 1A1NA 2ORBL 4PRHD 3ARBA 1MIEL 3IJHA 1FL6A 2WANA 1ZTXH 2PYEA 2H2SD 4OV5A 1RZIA 1HDMB 5DJCA 4YE4L 3LDBB 2NTFB 3C08L 3RU8L 2EYTB 2E6PA 3CSPA 3CSYB 3TO4B 3VRLF 3QXDB 2DM7A 3HAEH 3I6LE 3D18B 4HMCA 1ZGLB 3L7EB 1YPZF 5E5UB 5EIQA 1MFEL 1ZA3A 1XGRB 1MH5B 4EUPA 1CDBA 3TBYB 5IFHL 1CI5A 4KTEH 4XNMB 1AGFB 2DRUA 1OARH 3UTQB 3LPFA 5J9PA 3ILQC 1BWMA 2QQKH 2EDEA 5EU4A 2UWEE 4P2YA 4FTVA 1DVFB 1KPRB 4PRPE 5F93C 2Q86A 4OLWH 3ARGD 4ZS6C 1E6JH 2XPGA 4DEPC 3O11A 4Z7WB 2GT9A 4MDJB 3G6AA 5FYKH 3CDFA 2HG5B 2IBGA 5BCAA 1WFOA 5CSZA 1BFTA 5I75C 4BQ9A 2YBRA 5AYQA 4OZFB 4Y4KB 3ULUH 2AEQL 5CJBA 2OXGA 3GZKA 4PJHF 5GJSH 3ZT7A 3EO1B 2P8LB 2ZCKL 1TZHB 4YDKL 4Y19E 3M1BB 4Q9RL 4NHCL 2R9HC 4L4TB 5D1XB 4ALAH 5K9JL 4P2OD 4N1EA 3VFGL 3L5HA 4JZNA 4H1LB 3QUML 4RMSA 4L4TA 1NAMB 4TVSa 2R2EB 4HG4J 1REIA 3FB5A 2HRPL 1CN4A 2EDXA 1OF2A 2OP4L 4IMKA 3U0TB 2BNRD 3NH7H 4TTDD 3GK8L 3GSXB 1CCZA 2WNGA 3RL1A 3SJVD 2MSPA 4J6RH 1FE8H 1NBZA 2OL3H 3KPSE 2VDOH 2BMKA 4JGUA 5CZXC 1KCKA 4QOKE 2P42B 1HXYB 35C8L 3PUCA 4WW1A 3RKPA 1LEGA 5ELIA 1NAKH 3CFEA 5FKAA 4OB5L 5DRXA 5JOPD 1N5YH 1T5WB 1KPUB 5IMKA 3MBEA 3P73B 4YLQT 2D0GA 3IFPB 3IDYC 1XH3A 3OGCA 4ZTPH 5HHPA 1BZ7B 4KQ3H 2GTZA 4MNHB 3EYOA 4NQSA 4HKBB 4IMLB 1D6EB 5E99H 3TBSB 5J6HB 3ARVA 1EFXA 3MOQA 4HZAA 4QHLB 1OTTD 5JW4N 5I15L 1NMBH 1JZ2A 2GKIA 3U1SH 1LWRA 3MA7B 4PR5B 5D93B 3MRFA 1VFMA 4HLJA 4J3UA 2GK0A 4D9QE 4WW2F 3KXFD 4WTXA 3OAZH 4L3EB 2X4PB 5FDYA 2HN7B 5SWZD 5FF6A 2MKLC 4Z7WE 3CVIL 4WWKD 1CBVL 3VXTA 3TM6A 2ICWA 1IFHL 1XIWB 5JXED 3ARDB 3QWRD 5T1KB 4HWUA 2IPKA 5HHOE 1KN2H 3H3KA 5C07D 3IF1B 2IBBA 1BD2D 3KPRE 1KCSL 1ZKAA 1S7SA 2QHRL 4JCLA 3IXAB 4ODHH 2BOCB 3RVVC 4ORZC 3T2NL 1IARB 3RA7H 3LPGA 4LASL 2FIRT 5ICYB 1UB5B 5L2KB 1Q9WB 4D9RE 5ANMA 5GS0H 4GUPB 1HYSC 4Z8FL 4QF1B 4RGOH 3S9DB 2WINA 2I5YH 4A6YB 4HEPG 3IAGC 4K9EL 4TUOA 4PB0L 4NJAH 1DE4B 2VZTA 2APWA 2ENYA 1ADQA 3C6LB 4H26A 1J0HA 3H2WA 2CGRH 4FTVB 3LKPA 1VENA 1WF5A 4QGYA 3TA3D 4NQXB 4YX2H 5KJRH 1KBGH 5J56B 2ICCA 3RPKA 1LILA 3N1PC 3MUGA 2HMID 2XXCB 3PJSB 3Q5TA 3QQ4B 3UPAA 4O02H 2CR3A 2OSLA 3G5YA 1UM6L 3MV7B 2DJ4A 1M6OB 3QA3B 5J1AB 4XTRC 2ADJA 2MQ3A 4RMTA 4XAWL 4ZFZB 5CJOH 4L4TD 3O3BB 3JV5A 2ARJQ 4GQPH 1Q72H 4PJGA 4YHNA 3NZ8A 3MRBA 2MHAB 1G7QA 5T3ZH 3IGAA 4M6ML 1NEUA 1KB5L 4P5MB 4KJYB 3CXHK 2VDKL 1TIUA 1TJHH 1F97A 1X7QA 5E2UL 2R4RH 3RL1B 3V7AE 3C2AL 3QWOB 2Y1VA 3JUYA 4Q9QL 4OCLC 1K85A 1QPPA 3DI3B 1X5AA 2HFFA 4LKXB 2BRRL 5EG6C 5KVEH 1FAKT 3MOBH 2BMKB 4PJCA 4P59L 4LKXA 4OCWL 4HGMA 3CD4A 4OCRH 3HR5B 4QXTA 5JHLH 3I6GB 5JMOC 1NAKL 4LQFL 1JGUL 3VFOA 2VR5A 5F7EH 3LDBC 3CC5B 5HDQH 4NCDA 7FABL 4QXUL 4LPUA 3WIHH 3TO4D 3TNMB 2XQBH 5CLTA 1U3HA 3QUKA 5DQ9B 5LAXB 3L6FA 2VLJA 2LU4A 4X0KB 4WI6A 5A2KH 3BKJH 4GAYB 3K8MA 1CFNA 3HNVH 2UVFA 4P57B 3HPJA 1FZOB 2FWOB 3Q3GA 3PHQA 4GRWB 3LKRB 1DSFH 4TVPD 3TJHD 4WU5A 3HLAB 1RFDL 1EO7A 2LVEA 4HIEB 1UM5L 4HF5L 1SBSL 3O6LL 4HIXH 3REVB 4TOYH 1JI1A 3QQ3A 1AY1H 3UTSD 3LSOA 1P4BL 5DLMH 3ULSA 1NANH 4L3EE 5DWUL 2LQRA 4YHKH 8CGTA 3UC0H 3BRFA 2QADD 5CJXC 2VSCA 5L6YH 1Q38A 2ERJC 2PCPA 1UB5A 4R4BB 4LLWB 4M8QB 5EFIA 4NN5B 2VXSL 4GAFB 4QNPE 4WDIA 2DWEB 4MA3A 5C2BH 1RUPH 2EZ0D 3O41A 3K8KA 3NPSC 4HC1L 1YZZA 3QJFA 5LXGH 4DVBB 1FJ1A 1HSAB 5CCKH 5AYUH 5IHZB 4PGDB 1FVDB 3BH9A 1FRGL 1HHIA 1XF1A 4JZJB 4PV8B 4H0IA 3QULB 2YS4A 4LSDA 1HN1A 1BFVL 4OLYH 1CE1L 4ZO9A 2YA2A 1U8MA 1RJCA 1NFDA 4MB4A 3SY0A 1Q9KB 1MCOH 4UT7H 2EH7H 4ZODA 1WCBB 4JR9H 4X8XA 2EH8H 3BSZL 2DM2A 4NSKB 4I0PD 2Q7YB 3UYPA 1D5MB 1WJ3A 4GAGH 4OF5A 4NP4L 1WZLA 1MCJA 5J1TC 4WTZG 5CP7A 1E4KC 3QCUL 4OCNC 3DBXB 3WJLA 4MXVF 1KB5B 2CLZB 3SKNA 2XKNA 3NFPB 3CFDA 7CGTA 1AQDA 2DBLH 1CFVL 4LVEA 5B38G 4X6FA 3SO3B 4NM4L 5MI0B 4NWUL 2QJDA 2OMBA 4TNVK 3AMLA 1ZHNA 4PJ7E 1G1YA 1GPOL 1AJ7H 4W4OA 4H1LA 1CGTA 3VGAC 1YNTB 1GCFA 5I1KL 3ARBB 2FGWL 3AY4A 5KVFL 4KMTL 4I13B 4M7LL 2LAAA 4DN3L 1FL3A 2XZCL 2YMXH 3C5ZC 5DD0L 4D8PA 4JQIH 2BNUA 1PQZB 4OZHA 4NCC1 3G5XA 3C60C 4Q97A 1ZT1B 4X4YB 1G9MH 3QXVA 4QHKI 1A2YA 4KK6D 4R3SB 4QY8B 4R4ND 1PG7L 5IOPB 4WWID 4ZUWB 4PG2A 3TCLA 1JMXA 3RGVC 3IAQA 4MMZC 4JFXB 2H32H 2X1XR 5SWQA 3J7HA 2VLMD 5C6TH 4N0UA 2CJUL 3PHOB 4OCYL 2BSED 2BHUA 2OR8A 1CF8L 3ZT5A 1UWGL 3O4LA 4OZIF 4KVNL 4WW2A 3QFJE 3LRGA 4NQSB 1TVDA 4PB9H 2XA8L 4LKCB 4U2ZA 4BUGA 3CX5J 3GMQB 2MPAH 5J6GB 1F58L 5E5MA 3VA2C 4IOIA 3MNZB 5F3HA 4CUCA 1BBDL 5I8KL 1T3FA 15C8H 3O6FB 4YHKL 3ZTJH 2YEZB 2V17H 4OBSA 1HH6B 1T4KB 4JRXD 3VI3F 1PX4A 1YMHB 4YC2B 4YUEL 1JF1B 2YPLE 2BXYA 1IEBB 1TNNA 1AGDA 4GBXD 3QFJD 4OD2B 3V4VL 5C2BL 2OZ4L 2JCCE 2HFGH 2AV1B 4OLUH 3OR7A 1Z9LA 4JFEE 5TE6H 3SE9H 3DV6B 3D0LB 1U3HC 1MJ8H 4QY8A 4AEFA 2ZCLL 4A2LA 3TBWA 4BSJA 2FX7H 2ID5A 3QIUC 5JTWA 4RFOL 4OF7A 2YN5A 1NFIA 5EOTA 5EU6E 1OGAE 4NQDB 1NBZB 4PRPB 3QIUD 4A6YH 4HZLB 4S1QH 2V7HA 3QIBC 1IJ9A 3V0AC 1IGYB 2Y36H 3PGFL 1Y6MR 2Z92B 2XT1B 3KXFE 5FECA 4POUB 2O5ZH 3RQ3A 4K07A 4OF3A 5I76B 3T0DA 1Z9MA 1H5BA 1HQRA 1IRAY 1DCLA 1BIIB 3OKKB 4UU9B 3PP4H 2C1OA 1FYTE 2DLEA 2EKJA 5L0QB 2W0KA 4FQHA 1KPVA 3W0WD 2V9QA 4WTWA 5KTEL 1S9KC 1Y0LB 4MSWB 4I1NB 4NM8L 1JF6A 1XCTA 4R26H 4DN4L 1FNEA 3O2VH 3NABL 3EGSA 5JHDB 1N7MH 5HI5D 4KROC 1A0QL 4ODUB 4R2GB 3GI9L 1YDPA 4B7IA 5DJXB 2JK5A 1T0MB 3DURA 1EH9A 3U7YL 1YNLL 1I85C 2E6QA 1A7OH 4ONHB 4PJXE 5E8EA 3QDJE 5HHMD 1AKJA 4EEEA 1FYTD 4DZ8A 4MJ2A 1QRNA 2JLLA 5EIIA 2EC9U 4MAUL 4RFEA 3THMH 5DFVC 3CFKB 3CK0L 1DQMH 5J1SC 5BS0B 5I1KH 4XBPA 4Y4HA 3QXDA 4NQUA 4Q74A 3ZE2F 4OM0H 1ERNA 3LEXA 1G7MA 1V3LA 4KXZI 4OBRA 2XWTA 3DO7A 1FSKC 5CEYA 3QEQD 4MX7A 4AL8L 1HOCA 4KRNA 2VERN 4X6EA 5HGAA 1T7WA 4NZJA 1JYVA 2IC2A 4O4YL 1QZ1A 3S37X 3FN3A 2YC1B 3RGVA 2VDOL 5C0EA 5K33A 4YGVB 3ROLA 4OT1H 5HI3C 3X3GH 4J12A 5E4EB 3T3MF 2LVCA 5A3IC 1P5VA 2BDNL 2JB5L 2I9TA 1WICA 3NACL 2Z91B 4K23L 1F3JB 2F5AL 1KGCD 3DYMA 4XC1H 5BRZA 3BAEL 1IAMA 2DLFH 4LSSL 3T0WA 4M5YH 4S1RL 3G04A 5I0ZA 3HE6A 3A0OA 2H9GB 2WQ8A 3LKOB 4N8CL 4OFIA 1GZQB 4GRWH 4EN3A 4MLSA 1WBXB 2RCSL 5TE7L 4KRPD 2O5YL 2VLRE 1GGCL 4HIEA 3T65B 3OB8A 5ICXB 4LASH 3MRQA 3HLAA 4L3ED 5CINL 2I27N 2ICES 4AQOA 3MRCA 3I02A 1I8IA 5IROA 1CL7H 4OIIL 2VLKD 2F53E 1DDHA 1JN6A 4WUKH 3BP5B 1FC2D 4DOHB 4HHAB 5HD8D 3GMLB 5CS7A 3SDDA 2AI0H 2JJSC 4AEIH 1RIVL 4KKLC 1J0IA 1NFIB 2JB6A 2W9EL 2GITB 3JTTA 2Z93A 1KCSH 4H25A 1CDUA 5EZIL 1NGYA 1ZA6A 3HMWH 3BWUC 5KBNC 4ZAKB 3GSNB 2R8SH 4Z6AT 4OD3H 2BSTB 2MCPL 1QKZL 3NA4A 1UYWH 5JOFB 4WI4A 3LS4L 3QUYC 1U8JA 5JIKA 2FCBA 1AGCA 3QFJA 1GC1C 1T7VA 2WLZA 3BH9B 4FOMA 3AFLA 1RHHA 3VG0H 3WXWH 1A7PL 3FO1A 3LY6A 2FEDD 4XWOC 5H35A 1XGQA 4ETQB 5D5MB 3QPQD 4FQJL 4NCC2 4ELMF 2BCKB 3B6SB 3F7YB 3I50L 3NCFB 2EO1A 3W0WE 4BZYA 3TLRA 2VABA 4V1DD 5CJQL 4F33B 2UZYB 4D0DB 3VGAB 3IJYB 3NAAH 8FABB 3MLUH 4MJ4A 3RNQB 3U30B 5JXAL 3IGAB 1DN0A 3MC0A 2QR0A 2KQNA 5E8EB 5I30L 2Q7YA 1V7ML 3E6FB 3U4BH 5KZCD 1L0XA 3L5XL 1CWVA 3HZVA 3IJSB 1QNZL 1P6FA 4ZSOA 1XF3A 4HS3A 2RFXB 2DQIL 3MROB 3BGAA 4HK3J 1ZXQA 5EU6A 5BS0E 5C8JA 2J6EL 1FLTX 3CPLB 2CRZA 2BSRA 4F7MA 3DUUB 3ESVF 1J8HB 1PW3A 3ARGB 4BM7A 4PJXB 4OLXH 5EULV 5K93A 3C2AH 3BPLB 4MNQE 5FUZL 5E1AA 4L8DB 3RP1A 4G5ZH 2XQBL 1KOAA 5IB4A 3ARTA 4JKKA 1OPGL 4F9PA 2XN9A 3LN4A 1CZ8H 4KJWD 2B2XH 1N6QH 3PL6A 3GBLA 3I3BA 5ECJE 3GEWB 2I9LB 5CILH 5JW3H 3LN4B 1XZ0B 3VCLB 1FG9C 4JPWL 4AH2A 1WZ1H 4NZUH 1S7RB 1UCTA 5H2BB 4ZXBB 1AQKH 3ZKSD 3MLVH 1EAJA 2FIKA 2C4FU 4Y5YB 3ZHLA 4HUWA 5TF1L 1CXKA 1WAAA 5EPMB 2NW3B 5HVHC 5C07A 2ZUTA 1JRHH 4YFLI 3FMGL 5JHDD 3VH8G 4PJ8C 3LCYA 1JZ6A 2QQLH 3EJZC 4NRXA 3NTCL 3ARFB 1J0JA 1X9QA 3WMSA 3MJ9H 4PJGF 1TXKA 3QBTB 4M6AA 4IRSC 5DR5H 2YWYA 5A43C 4Z7VB 1S7QA 1F5WA 2E9WA 1IEAA 1YY9C 3WFDH 4MD4B 4NOFA 4LF3B 4LGRB 3P77A 4P3WA 4PY8I 2FSEB 4Y5XA 4G8GE 3WD5H 1OT1A 1AY1L 3MCKA 5HYEA 1FFQA 1ULVA 2XG5A 5JOEA 3TEUA 3ZE1E 3RDTD 1PKOA 4AEIL 1I1YB 3VFPB 5IF0B 4ZNCD 3MLTB 3SDCB 4KAQH 2P1YA 4E41E 1LHZA 1OAKL 1E27A 1FO0L 3PQYD 2HP4A 5IB5A 1VFOA 4PJCF 5H35B 4J8RA 3TWCH 1WVZA 4OJFL 1INQB 1PZ5B 2VH5L 1BOYA 4HC1H 4YXKH 5BOZG 3B9KC 1R3JB 4JN1L 4GS7B 4L8BB 3VXRB 2LV4A 4RGNE 3O6FD 2P8MA 1EMTL 3CAFA 4X4XA 5GJTL 4JQXC 2EDNA 2HTLC 3L3DA 3MA9H 4NOBA 1AR2A 2YD3A 3FB6B 1NMAL 4JRYA 2F53A 4Y4FA 2FNBA 4JFHD 2UZIH 4LSRH 4UQ2A 4RISH 4Z0BH 2VWEC 1NCCH 3BGMB 3GIZH 5F9JA 4I3RL 2E5EA 4PRHE 1AXTL 1SY6H 2QV2A 4FQHB 1C08A 5EBGA 1VFUA 2BFVL 3BGMA 3C5JA 3WO3B 5D1ZC 1OCWL 1XCTB 1UACH 2EYRB 1P7QA 1KEGL 4GW1A 4AIZA 4KK5C 2ZJSH 2FJHA 3KPQB 1G0XA 2DJSA 1HNFA 4S0TD 3BZEA 2O5XH 2DQHL 2DQFB 2E9BA 3ROOB 3X11A 2KUTA 3GBMH 4P5TA 2IQAA 2A38A 4H20L 3RVUC 3G6DL 5EOTB 2Z31C 1EGJL 1MJJB 1QFWH 4TRPL 2ZOLA 5I1IH 4CAGA 3FAWA 4LCUA 5SV4A 1R3JA 4NBXB 2AJVH 2WZPD 4B41A 5DMIL 4XVTH 1XZ0A 1J1PH 4KC3B 4M6OL 2YKLH 3VCLA 4L9LC 5B39G 1IMHC 4PTUA 3FT3B 5EPMA 3O6KH 4LLYA 3MLYL 5DRXB 5HHNA 3FT3A 2PO6B 4XMLH 1J18A 5B8CA 2FBJH 4M48L 4YDVA 5A2IH 2J5LB 2CLVB 3VFNA 2X10A 4GSDL 3QNZA 1F00I 3BO8A 1I7ZA 3RBSA 4P9HH 5JDSB 4RRPA 3VG9B 4ZSOE 4XP4H 5FYJL 2WBJC 3PWPE 1YNKL 2ZOKA 1ZVSB 2AJ3A 3VFWB 1FPTH 3KLAB 3E8UH 1HK6A 4LKCA 2PXYA 3EO1A 4N0YH 5GRVL 3G08A 5SWZE 5DJZA 3QDMD 3D9AL 5F7MC 3EO9L 5TQ2L 4KKBD 5IQ9B 1B6DA 1I3UA 2Z35B 3GO1H 5DHYA 3RWIB 2EZ0C 2DTMH 3LN5B 1SEBB 4UB0H 2XNAA 1CK0H 1HWHB 4FMFA 3D39E 5DVNA 2B0SH 2FLBT 4JFDD 5GRWA 4WVRA 2ZUYA 3T0ED 2QTEA 5HGGS 5DMJB 4WU7A 5D71H 3E6HA 4BH8B 2IQ9H 4HBQA 4M93B 4GT7A 5J0BA 4KQ4H 1AP2A 2DIJA 1UZ6E 4QHMB 3N1GC 1WWCA 1TJGH 3N85H 5GSVB 4BFIA 3QXTA 5I18H 1KB9K 4JFPB 4J2XA 3WNKA 3BD3A 5GRXG 4O5LL 4YQXH 1RVFL 1R3IL 2FJFB 5GJTH 4HXAL 3UTSB 4K7PH 3MREB 1NUFA 4S1QL 5IW6A 2NCMA 1F4YL 4PRIE 3ARFD 4ZTOH 4M6NL 3ZKMC 4G6FB 1QSED 1AXIB 5JLZB 2VC2L 2ED8A 3D25A 1S9WB 3MRJB 5EOCH 2ZKHH 3PV7A 4MAUH 4PD4K 3THML 4WHTA 4I77H 1RAMA 3QRFM 2AXFA 4X80L 3D2UB 1H3TA 2VAAA 1ED3A 3UEZA 1NLDL 1X44A 2YD2A 2DQHH 3UTQA 5J9PB 3EZJB 2F8XC 1D6VL 1MHPH 1JK8B 4FQIL 1WT5A 2R69H 1N64H 3GSOA 3N0PB 4LPYA 2XWBB 3ECBB 3KYKL 3QCVL 3FO0H 3ZYZA 1DQJA 1MPAL 1RI8A 3NCJH 1KF9B 5C0IA 2AEWA 4MQXC 3BISA 1I4FA 1JWMB 4JRYB 4OLZH 1WTGT 3M45A 1XGQB 4ETQA 4JFOB 5E95B 5BJTA 3GSNA 1BF2A 5E1HB 2UZXB 3P4NA 2Y06L 2VTFA 1BJ1H 1MJ7H 3JWOH 2XTJD 5DQDH 3PL6B 3MV11 1UA6H 4M00A 4L8CB 4NT6A 3F7VA 1KXQE 3L3GA 3OXRB 2RCSH 5GZOC 5H94A 5GGSY 4LU5L 1YN6B 4CU7A 3CXHJ 3AAZB 4PJ7A 1TJIL 3DX6B 2P24B 5E24E 3TV3L 5C0CA 3DYOA 3VXOB 5B22A 1CR9L 4O9HL 1TPXC 1U8KA 1WFUA 3ARDA 2J8OA 3F5WA 1WWAX 3RWIA 4PBWD 4X5WB 1I8IB 1Z0MA 3QO0A 5DI8B 3VXRE 3V6OC 3L3HB 1XFPA 5KG9A 4FTVD 5HDLA 3QUMH 4LEOB 1K4CB 1CK0L 1DBBH 5DJ6B 4OCXH 2J8UA 1CG9B 4FFWC 3PGDA 5SWSE 4TVPE 4Z77A 1TCRA 2FSEA 4Y5XB 1X5XA 1BJ8A 3CFCH 4KKNA 3I6GA 2GAZB 3VMPA 4XVUD 3T0EA 1BJMA 1FSKB 5T3ZE 1MFEH 3O41B 1IT9H 3T2OA 3MRGA 1RHHB 4OB5H 4UINL 4NZRH 2K7PA 3V5DA 5IJKA 4XNYH 1BAFL 5E6IA 5GGRB 4MAYD 3MRLA 5SX5K 1XGPB 5JPMB 2XWJA 1NKRA 4WWKC 1ZLSH 4CDGC 3N9GH 4U6VL 1Q0YL 1XIWD 1ZV5A 3UTTD 4P46A 1S7RA 3UTTB 1JFQL 4DK6A 3D1MC 3BP4B 2EIBA 2ZUQC 1K2DB 1WZMA 1W72L 3QQ3B 5M7QA 5I15H 3RI5K 1CLYH 4ENEC 4TVPL 4YAQB 2EDTA 5TDOB 1F11B 1TZGH 4TN9A 1KJ3L 1KYOK 2VISB 4M03A 3H9SD 2GSIA 1A3RH 5IVXF 3W39A 1T1WB 5F7LB 4IRJC 5EU7C 4MA8L 4HWNA 4ZFGH 2BSRB 3MLWH 1MEXL 5IHBA 5CP7B 4OIBA 2R56H 4UTAL 3QO1B 4G43A 4P46C 2J1KA 1YEDA 1T03L 4NQXA 5C0IB 1RJYB 4CU6A 5C0BD 4WHYH 3FQRB 3UJTL 3WHXB 4PJ5A 4HGKC 2X4TB 1DBKL 4MQXD 1DE4A 4NQTA 3ARYA 1HINL 1X5YA 1ZE3C 4RGOL 3TBTA 1KIQB 4M02A 1W8OA 1FYTA 4JFQB 5LGKA 4K94C 4XGZB 1U3HB 3QUKB 4WNQB 1NH6A 2Q87A 5HHMB 3V52H 1OGTA 4JPKH 4U2YA 3FMGH 3X3FH 3GUTB 1NFDB 4JDTL 5FOJA 1A64A 1KTRL 3F7VB 3L3GB 1TLKA 4FG6C 4GQ9L 4BQCA 4EDXB 4MA7L 4WHYG 4GXUM 4G9DB 4E42B 1HILA 2P24A 4R2GD 2BOBB 3MRDA 3KYAA 1IM9D 1FAIL 1A14H 3RUGF 2D03H 3ORJA 4PJ9A 4XI5C 5FHBH 1JUFA 2B8OT 2DQJH 3VXPA 3EDEA 4XI5D 4LCYA 5SV3A 3WKNA 1KB5A 4JRYD 3S7GA 3IS0X 4X6BA 5MENA 2N4IA 2XWBA 2EECA 2R29H 3FQXA 3DO7B 3QPXL 5EOQL 4ISVA 5C0GB 3Q0HA 2EEAA 3EYUL 5TJWK 3KS0J 2E7BA 3MNZA 1CE6A 2C3HA 4R4BA 5DJ6A 1TJHL 5F3HB 2Q6WB 3U83A 5D72L 4NFCA 2GCYB 5DR5L 3ULVH 5M95B 3P0GB 4JHZA 1KIQA 3VRIA 1S9VB 1X3DA 1H3PH 3ES6B 4OF6A 1P5UA 3WSQH 3EUUA 3VWJA 3CLEL 5GS2D 2Z8RA 3UJIL 2Q8AL 4BZ1L 4DGIL 1NC2D 1F8TH 4PJHB 1T7ZA 4OCWH 3AMKA 2P8PA 3H8NA 4L5FL 4Q6IC 2IJ0C 4R3SA 2XY2A 3MJ6A 3CMOH 3EDFA 3L7FB 3Q6GH 5ACMA 2AEPL 4KXZH 2H6PB 4P48A 1XEDA 1OTUC 2HTKD 3B4NA 5GGVH 5IROC 3ZKXC 4LLUA 1AO7B 4ODXB 5KJRL 1X5LA 4PP2B 4CMHC 1BZQK 5CZVL 3BD5A 4O58H 5HVWA 2VISA 3HNVL 3STZA 4KKAC 4I3RH 3WLBA 4YAQA 1HE7A 3BVNA 1QLEH 1VACB 2HT4D 5L2KA 4P23C 1LE5A 2IAMA 4ONGH 5JDSA 5BVPL 5I19L 1EIBA 4FXLA 3PE9A 3WCYA 3V79C 4HF5H 4X6CF 1RZGB 4ZD3H 4L8SB 3LN5A 4G8GB 1A7BA 2FHBA 2F15A 5HI4C 4NNXB 2IPTL 1M05A 4RMVA 2HVKB 4XVJL 5HVFB 3TH4T 2JCCB 4JFDB 3R8QA 4RSVA 5DJZB 3ARQA 1ADQH 5I8CA 3DURB 5GZNC 4RBPK 4BH8A 3P9WB 3RY4A 5KVEL 2AXFB 1T1XA 4P59H 3WIFA 3NIGF 1IKFH 5DEFA 3TN0D 3DSNA 2E6JA 2WIIB 5FDWB 1IVLA 1JMZA 2BK8A 3MLYH 3SDAB 3QISA 4KZEH 5FCUH 5CP3A 3SE3C 4U3HA 1BQHB 4M9OA 3KYNA 3WN5B 4JM4L 1BQHG 1TITA 1Z3GH 1KXVC 2EDYA 2XKUA 2YR3A 4IRSA 3VXNB 3DX9A 4MJID 3GRWA 3O8XA 1QLRB 3MACL 1D3CA 2XICA 3CU7A 2N1KA 5DC0A 1GJIA 3TYFB 1LEGB 4GQ9H 4GKOA 2VLME 3S3PA 4HW6A 1I1FA 3QUXC 5EBLA 4RAUA 5HPMB 3IXTA 1H3WM 3VXMB 4S1DD 3VFWA 2HJFA 3F7PC 3FONB 1X5JA 5EU3B 1RFDH 4I0PB 43CAB 2HJFB 3FONA 1VPOH 4IOFD 3BPOB 4F7EB 3M1BA 4QO1A 5I73C 4AT6A 5F7KC 2YPVL 2QLVB 5KSUA 5FGSA 5JW4R 1IQWL 1XGTB 3UMTA 3FRPG 1JNLH 1UKTA 2WMPA 4DAGL 4QRUB 3TN0B 2XZAH 4P4KA 3QIBA 2VZUA 1FH5L 1B9ZA 2CRMA 3EJYC 4NM4H 3VDBA 3OF6A 2JE8A 4R90H 3DXAA 5FGBC 3EYQD 4L4JA 1CLZL 1E27B 1T21B 3REWA 1FQ9C 4NQVB 1L7IL 4RAVA 3MV8A 4NO2A 2F58L 4PLJD 2C26A 1T04A 5IESH 5CZKA 2J3SA 5J13B 1KT2B 3HNTH 3OJMB 3G5ZB 1RZKL 3CFBB 4YEFA 4QHKJ 3ZKND 5D71L 2C3VA 3H9SE 3QSKB 1I7ZB 4C56B 4MNHA 3QQ9D 1PAMA 3LKNB 3UDWA 3AB0B 1QVOB 3X12A 1J1XL 1ZAGA 3IDMB 3WS3B 2VC2H 4GFTB 2H3NB 5DO2C 4GKSA 3HS0A 3GSNL 5E6IB 4WEMB 5JPMA 1D5XA 3C2SA 3BQUA 1YEEL 4G8GA 5C08D 1ZHLA 2JIXB 4YO0A 1AHWA 3U2SB 1RZGA 1WCQA 3KJ6H 2PYEB 1B2WH 5H37G 4KDVA 5F8QC 3QH3B 1MNUL 1JPGB 4LLMA 2BZDA 1IZJA 5JOPE 3U9PL 4DZ8B 4CGTA 1MY7A 3GMMB 4OI8A 5FUCC 3IB4A 2A73B 1H8SA 3MLRH 3AROA 4Y5VA 5D2NC 3K74B 3VD5A 5B8CC 1HI6A 3CLFH 1G7QB 1GHFL 1FDLH 4F9LC 4GRMB 1AJ7L 4P2RA 5IB3A 2QKIA 4XNXL 2GJ6D 1AO7A 4ODXA 3DSFL 1BOGB 1EO5A 3HI6H 3L5JA 4HSQA 2OZ4H 1RJYA 5TE4L 1FZJB 1MCBA 1MHHB 1ACYL 4Q58C 3DVNA 5TE6L 3DV4B 2Q86B 3K7UA 1E6OL 4N90E 3RNKA 4G42A 4H26B 5ENWA 3I6LD 2J7LA 4N5ED 3C6SB 3DRTA 3O11B 4U0RC 2J4WL 3BIKA 2HVJB 3KYKH 4NGHL 5TGBB 1NDMB 2MWCA 3CZFB 4LU5H 4UAOB 1FGNH 3BZFA 4KKCD 1QRND 1YUHA 3VFOB 1KJMB 5C6TL 5EC2A 1JIBA 1MCSA 4IHOB 1GC1L 3FOLA 3K1DA 2FIKB 3AS2A 3DMMD 2EIZB 4CNIA 2HVKA 3Q5OA 4L1HA 4ZXBA 2JELL 3K2UL 3TH2T 1XGYH 1NAMA 4HJ0D 2BHYA 4PB9L 4GUPA 5E99L 4OAWA 2XTJE 1L0YA 4I5BB 3IAPA 4YZFE 1V3MA 3LZFL 3V8OA 3MXWH 3S5LG 1N7ML 2AQ2A 4YHYB 4YK4C 2AJXH 3LMJL 2OTUA 4XNUL 5HXMA 1N59A 2NY5C 3TYGL 4R7DA 1MRCL 5BZWB 1QSZA 2D2OA 3KYNB 4KFZC 4U1NB 1DN2A 3CVIH 1MFAH 2J8UB 1FNSL 1KCUL 1CU4L 3DUUA 3M8OH 4GMTL 5GISL 4LEOA 2VL5B 4EI6A 2DDQH 2YA0A 1J8HD 3WFZA 5IB4B 1Z5LA 2UY6A 3BW9A 4ZUVB 3EKCA 3HG1D 2L7JA 3MRRB 5I6XC 3QUXB 1OD9A 3RTQA 5IFAL 4JVUA 4K71B 4N0FB 1MWAH 5F1KC 1UH3A 2R4SL 5TF0A 4JGJA 2Y4SA 3KPPA 4KPHL 5ALCL 1D6EA 5J6HA 4G8EA 4I2XE 2EDQA 1A9EA 3FO1B 2HWZH 1R6VA 5EUKA 1BPVA 3BEWA 5C07B 3OXRA 4HEME 1CFNB 3HAEB 5GRJL 3ZE0E 4UILL 5T1KD 5TDPB 4HWEL 2X4QA 3SKMB 3KLHC 4X7CC 1P9MC 4HUXA 2B4CC 2IH1B 3KXFB 3BAEH 1MCHA 4KVCH 1HHGA 2F19H 4PJIF 4KK9D 3JWDL 4ERSL 3OKMB 1HCVA 3MLWL 3O3DB 4OD2A 1NCUA 2B5IB 3QDGD 1HHGB 2BOCA 3O6MH 3GHBL 4YHZL 4WU7B 3FQWA 4HX1A 4MQ7A 3QXWA 2GK2A 1B90A 1FN4A 1KJ3H 4XBGB 2WINB 3RWDA 4I3GA 2NXYD 1HKLH 1EEYB 2X4UB 4AK1A 4NC1E 1N26A 5IQ7L 1EHNA 3ZDZE 2RGSA 5T33L 2CIKB 2A77L 5J3HD 2ATPB 2VO5A 2IANE 2BVQA 4HULB 3C8HA 4YDIL 2YD9A 3P0YH 2W9EH 4UQ3A 4Q9QH 1I7UA 2VN4A 1NDGA 2BNRB 3L5WB 2UV3A 3JXAA 1F90H 1FBIH 4JG0L 1W0WA 2OR9H 1NCBL 3TBYA 1WWWX 2N7BA 1NQBA 5AD0A 3U82B 4ESKA 1RUAL 3CU1A 3DGCR 4F7PB 3BD4A 3N06B 1N4XH 4JZJC 3BHBB 4NHUB 3S34H 1A14L 4B0MM 4Z7OF 4HUUA 1IAOA 3UBXB 2H26B 3MXVL 5IEKA 3DX8B 4GW5A 1I1CA 1KJ2H 2DMKA 1YYLL 5LBSH 4Z78A 3N1MC 1QSEA 3RKDC 3DMMA 5M94B 1BX2B 1DL7L 3MJ9A 4RWYH 4AY0A 3VXSB 2VQ1A 5LWYL 1ROWA 5GRUL 3RVXD 1AI1L 4DGYL 5GGTA 2EEDA 4D9RD 2D7PA 4HKZA 4BKLB 2EYSB 2VXVH 4HJJH 3IDXH 4JZOB 3WEXB 3L1OL 2R23A 2YD1A 5DVLA 5K9JH 4F3FB 1HXMB 4OF8A 1H3GA 3PHSA 3GGWA 5HGDB 43C9B 2WWKO 1A5FL 1CQYA 5E9DA 4JFZH 2DQTH 3QEQB 2GY5A 1EFQA 3VFSB 4Y89A 1LK2A 4R97C 4IDJH 2VDRH 5T1MB 4X4ME 3QUYB 5HGAB 1DBAH 5IBUB 4FTVE 2DQFA 3VFSA 1JWSB 2WK2A 4R4FH 3GRWL 2IH3B 5DHYB 4LSTH 4LVNB 5L8JB 1JGLL 4KY1H 2EC8A 3VU2A 5ADPL 4U1JB 3TJEH 4O2EB 1FYTB 2D9CA 4UIKL 4I0KA 1QA9A 1G6RH 3M17B 4L29A 1MCEA 3O45A 4HDIB 4JFDE 4HG4K 3ZSTA 4G6JH 2BSSA 1ZLVK 3TZVA 5IHUH 3NA9L 5C08E 4FQ2L 3BEWB 2OL3A 2FJGA 5IJVA 4HH8A 4OQTL 1QSEB 2X4OA 3WN5A 3P4OB 4XCYA 5EWIL 2X09A 2ZG1A 1CD0A 5C0CE 2Q7NA 3VFNB 1NCDL 4NQDA 4P23B 1EFXB 5L8KB 5GS0C 2AJ3B 5DHXB 1KLGB 3F8UB 3RUGA 1JHKL 5D7JD 5GGVL 3OAUH 3IDNA 4UI2A 1RPQA 5I0DA 3EDDA 2NY2D 4QTHB 4OFVA 5KS9B 4X7TB 5GRYA 4UT7L 5E56A 4JE4B 3T3PF 5C92A 3CDGA 1H5BB 1M71B 2J8UE 4NQDD 2R2HA 2FL5B 3IJHB 4NC1C 3IKKA 1CD1A 1JPSH 3S97C 1SJEB 1UWXH 4JJ5B 3D39D