2EH7H

Crystal structure of humanized kr127 fab
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
218
structure length
218
Chain Sequence
QVQLVQSGAEVVKPGASVKVSCKASGYAFSSSWMNWVRQAPGQGLEWIGRIYPGDGDTNYAQKFQGKATLTADKSTSTAYMELSSLRSEDTAVYFCAREYDEAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HUMANIZED KR127 FAB, LIGHT CHAIN
publication title Broadly neutralizing anti-hepatitis B virus antibody reveals a complementarity determining region H3 lid-opening mechanism
pubmed doi rcsb
source organism Mus musculus
total genus 44
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2007-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2eh7H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2eh7H01
3C8KA 5HVGB 5CINH 1WTGT 4KTEL 5DJYA 2EXWC 4UU9B 3VWJA 5ESAB 3MV7E 1F45A 2O5YL 3MCKB 2DLHA 2FEDC 3DMMD 3MQIA 4WGVB 1BWMA 1UENA 1OLZA 1U8QB 2EKSB 3HG1B 4FTVE 2ZUQC 1NGPL 1S9XA 2OCFD 3T65A 3C2AH 4HX1B 1TPXC 4K94L 4K7FA 3U4BL 3WFCL 1DUZA 5ADPL 2Y4SA 4UUJA 3QI9A 3T3PE 3LY6A 3IAGC 3GJFH 3QEUB 3GSNL 3ILQC 2HTLC 4X4ME 4M7JH 3HAEH 4XMLH 3T0DA 3AAZB 3QCTH 2VXQH 1ZLWH 1OW0C 1Z3GH 4NZTL 4Y5XA 5ID0A 3DOSA 1FFNB 4AK1A 2NZIA 1XEDA 1AE6L 4HWBA 5BXFB 3UTPD 5A2JH 3W9DA 1L9MA 2A6JB 3DUSB 3B9KD 1C8PA 3DETD 3RWJA 2R0KL 3NZ8A 2X70B 3BD4A 2FWOA 4IMLA 5T3ZH 3CDYA 1TNNA 3IB4A 4PJDA 1MJUH 3RKDC 1RZJC 3VD5A 1NCCH 3JTSB 4YQXH 2NY2B 4AYFA 3O11A 1A5FH 4O00A 3VRIB 4JM2A 4TSBL 3BIAX 1CTOA 2AV7B 1IVLA 4WIQA 2APVA 3O6LL 5T5NF 5SWZD 2YWYA 3QDJB 1KJ2B 4LLVA 4OM0H 3OB0H 3QCVL 4URTB 4XMPL 1W0VB 3BXNB 3JUZA 5FUOL 1C12A 2Q20A 1L9NA 4RGOL 1AGFA 4QRRE 4M61A 1WAAE 4OFPA 4QWWD 3LKOA 4LLMB 5F7MC 1T7ZA 5JPMB 4OF7A 4HMDA 1U95B 2E27H 3M17A 2NNAA 4LARL 4HJ0D 4GBXA 3OAZH 4OGXL 1JYVA 1KJ2H 2HTKC 3KLAA 1YEJH 3OTTA 1YQVL 3A6CH 3CSPA 3PGCA 1P4LB 5F1IB 2R0ZL 5E8PA 2CLRA 3WIIH 1KPRB 4P23D 3ZE0E 4RX4D 4G9FB 3M8OH 3OXRB 5D70L 2R9HC 3ARSA 2DBLH 3C60D 3B4NA 3BE1L 4PJ8A 3AB0B 1G9NC 1JPST 3QISA 4KTDL 2B2XH 4LLQB 1M71A 4L8SA 2ADJB 3MROB 2F74A 3QUZB 4IBLT 5J4MA 4QRUA 4HXAL 5BO1H 4V2BA 5B3JE 5IT2L 1ND0B 4QRSA 1CTNA 3QUMB 5I30L 3BT2L 5GZOC 1ZANL 2DAVA 1RUKL 5EWIH 5DGQA 1JHTA 4JM4H 3P9MB 1D9KB 2X4UA 1CN4A 4GAGH 1NJ9A 1E4XL 5JO5A 4PJEE 1QRNE 4G6JH 1TZIB 3QUMH 2XOTA 3BZEB 3DWTA 1DTUA 2VL5B 3EJZD 5EU7E 3PDOA 4XMKL 1LP9B 5JLZB 2VLJA 3B9VA 3CFEA 4X7EC 4MDJB 4KMTL 4P5KA 5F6HI 1XGRB 1RUAH 5FOJA 1CG9A 4F57H 1I8KB 2D03L 4DK6A 5D7SL 1FFPA 5DK2B 4R7NB 2ADGA 2ZP0T 4NRZB 1LNUA 5KTEH 3BWUC 5TGBA 3HFML 3UYRH 4HK3N 4ELMF 5DD0H 5DJXA 1QFWL 4NZRH 1JZ5A 5KSVA 3VXRE 3CDGA 1KLUA 3NPZB 1I8MB 4GO6B 1MNUL 5IB3B 1L7IH 4NYLA 2ZCLL 1A8JH 4Y5VB 2DLIA 4Y8DC 5DJ8B 1ZT1A 5KVFH 3D69B 3MJGX 2G2RB 3TJHC 3N9GH 2IBGA 4HUUB 5C0JB 1IKFL 5JMRA 1P4BL 4M03A 3AC0A 4HS3A 4QRPD 2F19H 3MOAH 1DLFL 3QNYA 3CH8A 2CKBH 5IOPA 2AXGB 3L95A 4J6RL 3FO9A 4OUUA 43C9A 4OT1L 3JV4A 5HY9A 3RY6A 1R6VA 2MCPH 3WNPA 3QEQB 4P57B 5EOQH 5CZVH 1K8DA 3DX7A 5TFSH 5KSUA 4L4TB 5DMGC 4XNZB 4NP4H 4G9DA 1JK8A 4EN3B 4MD5A 1TLKA 2V9RA 4OZFB 4P2OA 1CGTA 2EIZB 4WJ5B 1I7RB 1H5BC 4KAQL 4K8RL 5FHBH 4QTHA 1RVFL 3HI1B 4K7PL 5D2NB 3BGFC 4OD1L 1E4KA 3QUXB 4YDJA 5SWQB 2JB5H 4X8JA 4EVNA 2OTWA 3RY4A 3SJVB 5E70A 1A6WL 3QULB 1NLDL 1CIUA 5TE7H 3UTTA 5I9QB 2YHGA 3I9GH 5E99H 2CRIA 1WV7T 1MHCB 3FO2A 2H2SD 3BJLA 5FYKD 5JHDA 3LQZA 3ROOA 3VXMD 2GTWB 4Z7VB 4LHUB 3BQUB 1PYWB 2NY4C 2CGRL 3MRHB 4MDIB 3ARFD 4PJIE 3VFRB 1JTPA 1JZ3A 4UT6H 5H94B 2IBBA 2EDQA 2R2BA 3E3QC 4X5XB 3CFCL 3T0VA 3U36B 4UOW0 5LJYH 5JQHC 3T0EE 4ONFH 3P4OB 4Z7QE 2ENSA 5IBUG 1A9BB 1JUFA 4LDOB 2PF6A 3U9UA 1UZ8B 2IANB 3V0VB 2C5DC 5L9DH 4QEGA 3SO3B 3TH3T 3QPQD 1FYHB 5DC4B 1QLFB 1S7XB 1Z9LA 2D7MA 3SE4A 3BVNB 3E6FB 5KZCD 4GKNA 5DJ2A 2Q3ZA 4ZUWA 1OGAB 1MFCH 4XCNA 1HYRC 3T8XA 3D85B 5KVDL 5J9PA 3C8HA 4LLAA 3PHQA 3O45B 4AG4L 1D5MA 1NCDL 2WLYA 3KPMA 4NWTH 4FZ8H 1Q0XL 4QXGH 3A67H 5DZNA 3H2WA 3MTRA 1R3IH 2VLKB 5F9JA 2GK0B 3G5XB 4IRJD 5F6IC 4JHZA 5EO1B 1LO2L 4P2YA 5ICYB 4K55A 2IAMA 3RVVD 4S1SL 4TULH 1Z6JT 2AJXL 3V5DA 1T2QL 1NFDB 4FHBD 4Z7WA 5JW3L 3H9SB 4GW5A 1N8ZA 3UX9B 5C3TA 2ARWA 3SGEI 2BERA 4DAGL 1DP0A 3P3YA 4HK0A 4KRPD 4M6MH 1GSMA 4R6UA 3TT3H 5C2BH 3QA3A 2G5RA 4XGZA 1DVFD 1DE4A 1NFKA 1KN2L 4XP5L 3QDMB 5L7XL 1ZVHA 4PY8I 3HZMA 5TE6H 4OFYA 4OCYH 5F44A 2G60H 3R4DA 1F4YH 5HHPA 3QG7H 5L0QB 4EZMA 4ZFOA 4Z7NE 5EU5B 2VH5L 5DURB 5FO7A 3KJ4B 3S96A 1KCVH 4XVSL 1YEFH 2EXYC 3B8SA 4Y88A 3HMXH 1I7TB 2CXGA 4WFEE 1O7SA 4ODWA 1JWSB 2YD6A 1N0LA 4WWID 1WCQA 3EYQC 1BEYH 4P2QE 4C56D 1EFXD 1F2XK 3WHE0 3IFPA 1AGBA 3CX5K 3L5IA 5I8CA 3STZA 1NBYA 2P5EE 4G6KH 3ALPA 4ZPVB 1CFTB 1X5AA 1NUFA 2UWEB 5I6XC 3W0WA 1XR9A 5LQBL 3HRZA 2QTEA 4N1HB 5CHNB 4M9PA 2X1XR 1XCQB 2NY1C 3EUUA 3JV6A 2DJSA 5I8OH 1MREH 4WHDA 2VL4A 1TJIH 1TVDA 1URLA 4X8XA 3RVTC 1NGWA 1BAFH 1KCSH 1INDH 4KVNH 2AXFA 4HPYH 4GG6E 5T1KB 1Z2KA 1I9RH 4NUJA 3HHRB 4JQXC 5E08L 3BUTA 1MCNA 2Z4QB 5F89A 4PUBH 2KBGA 1KBGH 3O4LA 3BN9D 5KW9H 3MNZA 4YGAB 3TVMC 2NY5L 4JZOB 3GBMH 3ZKXB 4UILL 4ZMAT 4PV9A 3NFNA 1EA9C 4MAUH 5DQ9B 4KJWC 1KN4H 4PRHA 5KVGL 3ZLQC 5BW7C 2DQCH 5FCSH 5IVZB 4HC1A 3D39B 3NH7H 3ARDB 4HEPG 3KPSE 1JF1B 1VGEL 1GOHA 3MLZL 2CIKB 2IADA 1YJDC 2VOTA 4XC3H 4BQ9A 1AGCA 5GSRA 2DYPB 3DXAE 1FAIL 4L5FL 3PWUB 3D25A 3PV6A 2A9NH 1XGTA 5IMMA 3LB6C 3R0NA 4WEBH 2Q6WB 1GGIH 3PE9A 1S7WB 5HYJB 1Y0LB 4UTBH 3QFDA 4RFEB 1DBBL 1BVZA 1QFWI 4LCYB 4DGYL 4ZFOL 1I1RA 5JHLH 1AGDB 3TPKA 4OV5B 2VZSA 1UB6A 5DJZB 1TIUA 1BZQK 5D7JD 3O3DA 5TQ2H 1BBJA 5C08B 1T4KA 5EBLA 2YKLH 4P5TD 1FN4A 2EYSB 1TETL 3ARUA 3ARBB 3DROB 5SWSE 2EECA 3EYFB 1XF2B 3FQUB 5GIRA 5J6HB 4LNRA 4WTZA 1RMFH 3RGVA 2LE9A 4E0RB 4UV4H 1JGLL 3DJ9A 2QSVA 3MV7D 4XP4L 5DD3L 1ZGLB 4JHAH 4FNLH 5IBLD 1ZK9A 2VQ1B 1KIQA 5EOTA 2Z31D 5DJYB 4MHHI 1J0YA 4FTVD 3NOIA 2P8MA 5FOBB 1IC5L 4WCYH 2JB6A 3BGMB 2D0HA 1A9EB 4WI2A 1T3FA 3N50A 2R0WH 3WO3B 3QFJE 1CD9B 1S9XB 2EDOA 1ZT4A 3T65B 4PJBA 4I3RH 4J2XA 4PJ5A 3OB0K 4K7FB 2VSCA 4PJAE 1DUZB 1YZZA 1UQSA 5E7BA 1BVLB 1EZVY 2MTPA 3L5JA 3QI9B 4UUJB 5F96H 4DWHA 2A6KA 5GRYA 1F13A 2CRMA 3N0PB 5F97E 2CKNA 4PJCE 3QIUC 5I16A 3LKPA 4Y4HA 1I9IH 5EUOE 3OAZK 3OAUL 5DFVD 2YD2A 3LS5L 4XNQA 4LQ1A 5ID0B 4PRIA 4NIKB 1N6QH 1YEGH 1X5GA 4K07A 2HAZA 3EJJX 4WV1C 1NC2D 4GRWF 3W9DB 1JNNL 2FRGP 3CFIC 5D1ZB 3VFMA 3RWJB 3NZ8B 4IMLB 4Z0XA 5GS1C 4K3DH 2F15A 4PJDB 1PZUB 1NAKL 1N4XL 5FV1L 5EDXA 1P84J 1FAKT 4HWBH 4IOIB 3GKZA 4JM2B 4OLUL 4X6BB 3VWKA 1DQQA 4XP9L 1KB5B 4QRRD 4ETQA 1FNAA 4JO4H 2FX7L 5HHQB 3EYOA 5E9DA 2P47B 4JY5H 1ADQH 2VWEC 4JLRB 4EDWH 5EG6C 1BLNB 2DRUA 5EU6E 1EBPA 3HI6L 1L0YA 1QNZL 5E2UL 1IM9A 3MRNA 4AM0B 1KB5H 3HE6C 5SV4A 1LDSA 2A1WL 1IJ9A 4KKNA 4XI5D 4N0FB 1ZHLA 2DL2A 3KLAB 5LBSL 4UOJA 5K33A 3NCYS 4XPFH 2BNRE 3DURB 3T2OA 2R0LL 3SGDI 3TV3H 4LSRH 3PGCB 5E8PB 2CLRB 4LQFL 2XTJE 5F3BB 3JXAA 1IZJA 1JZ7A 2FD6H 4NZUL 4DN4L 3D87B 3G6AB 3KLHD 4YDKL 5D7IE 3GSQA 2XPGB 5ISZA 4JVPA 2EIBA 4RMWA 1M71B 1WLHA 3FB7B 3NFSH 2P46B 1HCFX 1EJ6A 3HRPA 2F74B 2JJSA 4OLZH 1MAMH 4QRUB 3HPLA 5I74C 2UZIL 3B3IA 4QRSB 1ORQA 3ZDXF 4YHNA 5F7DA 4M7LH 3IJHA 5F88B 4Z0BH 3LZFH 3NGBC 2ZUWA 4S11A 4N8CL 5C9JB 2NY7H 3ARWA 4Y16C 1QRND 5IR1A 3S4SA 5D4QA 1U3HC 2XKNB 4XTRC 3H42H 2X6MA 4U1MB 5JO5B 3SDAD 3FN0L 3FN3A 1OP3H 5CLWA 4GAYB 4OCSH 1T2JA 3SGJC 3PDOB 3OPZL 2MQCA 2FJGA 4HH8A 2HT3D 1JRHH 2WM0A 4H25A 4P5KB 4KRNA 3UTZB 4AZ8A 3HNVH 1YYLL 5IQ7L 3DMMC 4HJGA 3MV01 2XG5A 5DD5L 4P9MH 3I50L 2B20A 1FFPB 1U8KA 1JF5A 3SDDA 1SJVA 3QP3A 4RBPH 2ADGB 1X5HA 4NRXA 4O4YL 5CILH 3MOQA 1QPPA 2KH2B 3VXRD 5TGBB 1E4WL 3MJ6A 2XRAL 3LH2L 4JFYB 5FYJH 1I7UB 2IH3A 5I1KL 2R23B 5F3HB 1W72A 5KSVB 3NAAH 3CDGB 4Q0XH 2BOBA 4NYLB 5D2LE 2UWEF 4HAGA 1I9JL 3RWHB 4F7MA 3TJEL 4NQXA 2MPAH 5DVLA 2A0LD 4HBQA 5FUCE 1AY1L 4HS3B 4PJGA 3QNYB 1IRAY 2Y36H 1B0GB 3L95B 4E41A 4OUUB 43C9B 4KHTH 3JV4B 1CFVH 5HY9B 2AJUL 4FABL 2IH1A 4NKDB 3OAYH 1AGEA 3X11A 1K8DB 3DX7B 5JXED 4POZD 4HH9A 4WWKA 4NHUA 3B9KC 3DETC 1HXMB 4MD5B 4IRSA 1MJJB 2CUHA 2X09A 4F37F 3BGAA 3GM8A 4XNUH 2QV2A 3KPTA 5DVOA 2W65A 4YDJB 3EO9H 5GSVA 2N56A 3UJIH 1S9KC 1A14H 4Y4FD 5CZXD 1IC7H 3UTTB 3CDFA 3WEXA 3AU1B 2CSPA 2OBGA 3GMLA 3ROOB 2HKHL 4PD4J 3QSKB 1JHKH 4BK5A 3FB8A 4BFIA 4QWWC 1RURL 5C0CA 5J12C 1MIEH 5I0DA 4JHBA 4U31A 1YNLL 4HJ0C 5SV3A 2YR3A 4F80A 3GUTA 1OAZH 3GIZH 4ODVH 3P9LA 4LIQH 3OMZA 5I19H 1T5XA 4HKJA 3FT4B 3VFOB 4PGEA 4PJFE 5F8QC 4P23C 3KPLB 4X6CF 5J6GB 1JFQH 4EBQL 3C60C 3DX9A 1UM5L 5IHBA 3QXUA 2QKIA 4P4RA 4GKNB 3RP1A 4ZUWB 5C86A 2CIIA 5F71A 4A2MA 1S5IH 2VDQL 4XCNB 3E6HA 3BDYH 5J9PB 2GKIA 4JZJC 5AWNL 3HG1D 3PHQB 4DCQB 3F7QA 3O8XB 1XFPA 4S0SD 1CS6A 1OOAA 3Q1SL 1D5MB 1I4FB 4F7TA 2VDKH 5EZIH 2SEBA 5FXCH 2C3VB 1FVEA 2YA1A 3LMJL 5F9JB 4XT1C 5F7EH 3SQOH 2A2QT 1RZKC 3WIHH 3N85L 4HIEA 3QWRA 3NA9L 2CRZA 5EBWB 1PQZB 2QQLH 4HDIA 3V5DB 5JOEA 2BJMH 4GW5B 1N8ZB 3ZSSA 5CKAA 1WGOA 4JR9H 4HK0B 2AJ3B 3EJZC 1UC6A 4OCNC 4EOWH 2UV3A 5FGRA 4F7PA 3CIQA 3PGDB 1HKFA 4JN2A 3CVHA 4XGZB 5GS2D 1DE4B 4I2XE 3X17A 4ONGL 4QGTA 4UT9H 4NUGL 3MZGB 4CU8A 3HZMB 4O02L 5AZ2H 2OL3L 3IDMA 3NIDF 2W92A 5HHPB 5L88L 3NVQA 1DQLH 2L7UA 1ITCA 4WFED 4KGJA 3N1GC 3GMPA 1RPQA 3S96B 1VKXA 4YR6A 1HHKA 4K3EH 5ECJE 2VDNH 4P2QD 2P5WA 4N8VA 3BMVA 1ZAGA 2HN7A 2BXYA 1II4E 4GW4A 5EC2B 2P5ED 3CSYA 3KYKH 1NCWH 1V8HA 5H35B 5D71H 1AHWC 4GW1A 2BVOB 1AGBB 3IFPB 2PYEB 1NBYB 1YDPA 4PJDF 5IIEA 3V0WH 2CH8A 1T1ZA 2HT2D 4D9LH 3PXJA 2F58L 1DBMH 3W0WB 5C71A 4Y2DD 3HRZB 1U8HA 4ZUSB 4JM2F 2ERJC 5IROC 5DJAB 2WINA 1J8HA 4YX2L 4WUUE 1FGNL 1MRDL 3JV6B 1MQKL 3MLPA 1RULH 2V9QA 1FIGL 4XPTL 1NGWB 2YRLA 1C08A 1JHLH 1X5YA 4X9FA 3RFZC 5CBAA 1L7TH 2AW2A 2PO6D 3P30L 4K71C 5E2WH 2AXFB 3TC9A 2R2EA 4NUJB 3CZJA 2VLME 5E8DL 2VITB 2H2SC 3U83A 1EGJH 1OPGH 5I15L 1ODAA 3O4LB 4RWYH 4KJYA 4QXTA 3MNZB 2K1MA 1I3GL 4OZHB 4HS8H 3ARFC 4PV9B 1CI5A 5GISL 3NFNB 1FZMB 3KPSD 4ZXBD 4PRHB 1JI1A 3VXOB 5E2JA 5GGTL 5LKNA 3PHSA 1UM6H 3DXAD 5DEZA 5EBMB 3S5LA 3D3VB 5T33H 3U48A 2OSLA 1AGCB 3V8CA 1E6OL 5GSRB 1P7KA 1F3DH 4QXUL 4KK6D 2WQRA 4D2NA 4JDTH 3D25B 3PV6B 2F8OA 3QPQC 2AJZA 1XGTB 3CVHL 4HMCA 5IMMB 4KKCD 4ZUUA 4IRZL 3BRGC 1MY7A 4HC1H 1UM4L 1WITA 3QFDB 5ILTL 5K9JH 1MAJA 3ULUL 1NMBH 4H8WC 1K85A 4XCCH 4C59B 1TCRA 1H5BA 4DOHB 1WWAX 2XA8H 1YPZA 1UB6B 2Z8SA 4L3AA 5GS3A 2RJMA 4ELKA 2IMMA 2MQ3A 3O3DB 5SWSD 5TQ0L 5EBLB 1JPGA 3WLBA 2C4FU 2FX9L 5FECA 4AENA 4PRPE 3EFFA 3V6FA 5BVJA 1ZA3A 4HLZH 4I18B 4LL9A 4QT5A 1E28A 4MLIA 5GIRB 4P5MB 1LK2A 4RCAA 3C6SA 4IRJC 2Q8BH 3QQ3A 5IW3A 3WXVH 3EDEA 3UPAA 1CGSL 4HBCL 3RGVB 4U4BA 3RVVC 2IPUG 4ZAKD 4L4VE 7FABL 5EOTB 5CJBA 1TZGL 4U6VL 2V2XA 4JO2L 5FDYA 1I1YA 4KU1A 4KRPC 3ZDZF 5CJOH 5MENE 2AERT 1MCQA 2DKSA 1ZHKB 2ZOKA 3QFJD 5GGSY 3C6LD 5BZWA 1DVFC 2XACC 2JB6B 4MCYA 5I1HL 5D7LE 1T3FB 2Y6SD 1C1EL 2YWZA 3BH9A 1OM3H 2I9LA 3W82A 3UTSE 1ZT4B 4L8BA 4PJBB 3QDHA 4FQJH 4PP1D 1UQSB 3K4AA 1I75A 3QUXD 4JANB 2YSSA 2A6KB 1M1SA 1TENA 1HKLH 1TQCC 4FZEH 3LKPB 5KANI 4Y4HB 2AEPH 2AABL 1PKQA 5DJ0A 5D72H 4ETYA 4XNQB 4J3SA 1IL1A 3ECBA 2FHCA 3VMOA 4KXZI 1WIUA 3KAAA 4BK4A 2V5RA 2YD9A 2CLVA 4G6FD 2OZ4L 4WNQB 2X44D 1WBXA 3MLRL 4JFDA 3VFMB 3K0WA 4CDHA 1MLCA 4HQQH 1RFDH 4Z0XB 1MFBH 4F7CB 1EEUA 4OFIA 3V7MA 3STLB 2AK4E 4EKXA 3TYFA 3QHZL 4WU5A 1A6PA 1T1WB 1IQWH 3MSPA 1A7QH 4RMRA 4WHYH 1EPFA 1CZ8H 1NQBA 3VWKB 1DQQB 4HF5L 1TTUA 1B2WH 3MYZA 5JQ6H 3V5HB 5EU6D 3H9HB 3RU8H 2ZCKL 1J5OL 5F93C 1CE1L 3EYOB 5E9DB 2RAMA 5J1SC 4QHKJ 5I18H 2X1OA 3GSOA 4X4ZA 3BN9C 1G7PB 1YMMA 3P73A 5GRUL 1IM9B 1KV3A 1P2CA 3MRNB 1J11A 2VXUL 1OP3K 4YXKH 2LAAA 1SM3L 4OCRL 3DARA 5D1QB 1TMCB 3PABA 3OXSA 2QADB 2F53B 3PUCA 2XTJD 2J8HA 1AI1L 2DS4A 3HAEG 4R8WH 1G9MH 1X5LA 4FXKA 4YPGA 1A0QH 2VXTL 5L6YL 4Z95H 3LN9A 3TYGL 1FRGH 4W68A 4RBPK 5ISZB 5GGSB 2EE6A 1EO8L 4U6XA 5JW4M 2IEPA 2R69H 4JPKL 3KR3L 3BEWB 2EDRA 1FZJA 3WN5C 4ZUVB 2B8OT 3E8UH 2WUCL 1CF8H 2J88L 4IDJH 1ZMYA 3U7YH 3TO4B 3QDMD 5IEKA 3HPLB 3E2HB 5C0BA 3HE7B 3P77B 5D7JC 4O2FA 2WZPD 1ORQB 4M62L 2E8ZA 5F7DB 4YHNB 2JJTC 4P5TC 4Z7WF 3IJHB 2NW2A 2OR8A 4Z5RB 1WVZA 3MV11 5DURD 5CP3A 3R8BB 1M7XA 4FP8H 4NNPL 2B1HL 3S4SB 4K23H 4JQXA 3OAYK 3DX6A 1AKJA 3NTCH 4JB9L 4ZFGL 3Q6GH 5CGYD 3CSBA 5CJQL 1K8IA 1NBQA 4JKPL 1YEDB 2DKMA 4YWGH 3TVMA 4NOFA 4X6DA 1X5JA 1AR2A 2Z31C 4JKKA 4KK8D 5JNYA 2GEEA 4MA3A 3WD5H 3WYRA 2NW3A 4DUWA 5BW7A 1Q0YL 4H25B 1T89C 5BRZE 5DZLA 4HJGB 3UROR 4R2GB 1FL5B 4XHJD 1DQDL 1BBDH 3I2CH 3SDDB 3VXNB 3TFKC 1FFQA 3PWPA 4NRXB 1V7NH 4C4KO 3IXTB 3L3HB 2E6QA 3CCHA 1CCZA 3WFDL 1W72B 3CJJA 4GOSA 1WC7A 4BZYA 1CR9L 5D6CA 3MA9L 5EZLA 4F7MB 15C8L 1HILA 2QQQA 4NQXB 4YHLH 1ES0A 2B5IC 5EA0H 5EU4A 3K46A 3ZYIA 4LSQL 5DFVC 2VTFA 4ZDHB 4Q9QH 3B9DA 4Z7OF 4Z6AT 4ZSOA 3MRRB 2XN9A 3CU1A 4WFFE 1X5ZA 1W72H 3MLUL 4JO1H 3VRJA 3X11B 4O58L 3V6ZA 5E6IB 1IKNC 3IDXL 4HH9B 2HRLA 3O2VL 4NHUB 4BSVA 5HVHB 1TQBB 4R4BA 3L5WB 4ZYKA 4IRSB 2RBLA 1LEIA 1QACA 4CN4A 1T5WA 3MLWL 2FIRT 1QFHA 2XQYG 1P6FA 2VR4A 1IC4H 3MRLB 4H88L 1MAKA 1CXFA 1DQML 1CGVA 3FAWA 1SEQH 4MXWL 2H26A 5DD1L 3BPCB 4JFEE 2ICCA 3WEXB 1G7QA 4MVBD 5HYJD 3CXDL 3OZ9H 3GBLA 5HGBB 5BS0A 3H7LA 4BFIB 4GRLA 4XX1E 3KJ6L 5B8CA 2P49B 4DGIH 5C08D 1K4CA 5C0CB 3UJTL 1CLZL 4GSDH 4XCYA 1JBJA 4KUCD 4OKVA 1J0ZA 3AS3A 3QIUA 2H41A 4XI5C 3GUTB 4UIMA 1JPTL 2YUWA 1VFMA 1T5XB 4TUKL 1WEJH 3QNZA 3SO5A 4D3CL 3MRIB 2EIEA 1KC5L 1KCKA 1LK3L 4L8CA 4PTUA 3P0YL 1HSAB 4X7CC 2FGWL 3FT3A 4Z77A 3KLHC 3DX9B 2DJUA 3K2MC 3EDJA 4N1EA 2CIIB 3E6HB 5E5MA 1U36A 3RIAK 3BP5A 4HT1H 1E6JH 1ERNA 3F12B 1A3LH 3VGEA 2QHRH 2FECI 4YFDB 3VE0A 4X7TA 4JDVA 3L9RA 2SEBB 3IFLL 5FKPB 1MLBA 2GSGB 5ITFB 3QWQB 3ULVL 2KZWA 1FLRH 4FQ2L 4DGVH 4HIEB 1S9WA 3H3PL 4OLYH 4MNGB 4M1CD 5EU7C 1F00I 1A1OB 3OKMB 3LEVH 1B6UA 4MNQE 3SDAC 2WWKO 1N0XH 2EEAA 4JO3H 2JIXA 3FQWA 4J3VA 4PB0H 5B22A 3BKCL 2V2WB 3MACH 1DBKH 1N3NA 5HPOA 3GMMA 4W4NA 1R3KA 4PRDB 4PJBF 3HE6A 4F7PB 4M5ZH 2HT3C 4JN2B 2PYFA 2X4PA 1RUQL 5ANMB 4Z7UB 3UTQA 3C5ZA 4YXLH 1BQHG 3N1PC 5ITBL 3U82B 3GI8H 3IETB 1SYVA 1QSVA 4XNXH 3GMPB 1ONQB 4R26L 4YR6B 4X5LA 1BJMA 1QLRB 2CR3A 2P5WB 1AC0A 1UACH 2BNUB 1QP1A 2HN7B 3QHFH 4GW4B 1RUPH 2BP3A 3VXUA 1X5FA 3CSYB 3JTTB 4X7SH 1GRWA 4MQ7A 1JCKA 1EAJA 3ES6A 3ZSTA 2A0LC 2ICWJ 2YS4A 4GW1B 4E9LA 5MP6H 1YDPB 3MO1A 3QPXH 5FO9B 2AJVL 4BUHA 1HIMH 1G9NH 2EIDA 1T1ZB 1G1CA 2FEEI 2P8PA 5I1GL 2FDBP 2AI0L 5DFTA 4YEEA 3VXSA 4Y16A 1OB1A 2ITCA 4POZC 1GGCL 5JXEC 1PG7H 1U8HB 4WUUD 3S98A 4XAWL 4F9LC 4JDZA 3OB8A 3WJLC 3MRFA 5L2KA 1T80A 3SE8H 3SGJA 1Q72L 4MQXD 2A6IA 1RZ7H 3HC3H 2VLMD 3FB5A 1C08B 3JV5A 4N68A 1DCLA 5FHAL 2APWA 4Y4FC 5CZXC 5C09B 2Q7YB 3U4EA 3HMWH 1KLGA 3DMMA 1B4JH 4AEHH 1A6TA 1OARH 4L3EB 1RIUL 2R2EB 3KYNA 4NQVA 2UVFA 1CK0L 4PG9A 4EDXA 1IT9H 3O2WH 4LSSL 3WKNA 4XBEH 1F11A 4HKZA 4I1NB 5DMYA 4QXTB 2IMNA 1IM3A 1WBZB 5IB1A 4W6WB 1QFUL 4M7ZB 4R3SA 4HUVA 3ROLB 4P46D 4OBRA 3HN3A 2ESVB 2DMCA 5DHXB 4XBPA 3X3GH 2OSLB 1G6RA 5ENWA 3GJEA 4D9QE 1MFDL 4NFCA 1YY9D 3W2DH 1XF5A 4N0CD 1GZQB 3TIEA 4IJ3C 3S88H 4D0DB 2X05A 1PY9A 5BV7L 2AJZB 25C8L 5DRZB 1F4AA 2Y5TA 3K8KA 4K2UL 1RJYA 3HA0A 4YHZH 4FRWA 3PWNA 5JW5A 12E8L 3B9KA 1A7OL 2V2TA 3QG6A 4POUB 4ALAH 4N8PA 2R4RL 4KTEH 1TCRB 1H5BB 4PRPD 3MRMB 1RHHA 1I1AD 2ADIA 2DI7A 3BGFB 3BPOC 5FM5O 1JPGB 3WLBB 2ZPKH 3LDBC 3QXDA 4KY1L 3TF7C 4PGCA 4ZOAA 3V6FB 3WSQL 4NRYB 1ZA3B 3PV7A 1NGPH 5HJ3B 2O5XL 4MA7L 3QQ3B 5SWZA 3IJYA 4M6NL 4K94H 1U92A 3U4BH 5ADPH 5MEND 4UQ2B 4ZOCA 5IB2A 1BIIA 2DL9A 1KELL 4Z78A 4EXPX 2NY4B 4CVXA 1MWAA 5C0GA 3IKKA 4MA8H 5ETUB 3OJDB 5D7LD 3GI9L 3CFJA 4JFXA 3NCJL 2ZOKB 1U6AL 1BX2B 4RDQG 1VB9A 4NQSB 5BZWB 3LN4A 3UTSD 2PW1A 4NO2B 4KUZH 3EBAA 4HPOH 1HHHB 3IKCB 2CDEA 2NMSA 5LAXA 3BH9B 2PXYD 3J7HA 1O7VA 1LEKA 5B21A 1MRFL 2DWDA 4L8BB 3DRTB 4P23A 4RX4A 4XVTL 2VN7A 4M3KB 1NCAH 2NX5A 2BSTA 3CXHJ 3N1MC 3ZKND 3JV0A 3JWDC 1EO7A 1IGIH 2R0KH 3C60A 4PJGF 5BVPH 4JFFB 5HHOE 3ETBF 3JWOL 3V7AE 1B6DA 1R5VA 4YUEL 5HYQB 5E00B 4FOMA 4W6YB 4PBVC 2BRQA 3BISA 5T1LD 1HEZB 3B2VL 3DUHA 3KYOA 3R8QA 2PUQT 4PTTB 1IL1B 2BVYA 3FO0L 3MRPA 3ECBB 4LAJH 4WI7A 4ZNCD 3Q3GA 3ARRA 1MOEA 3I6LE 2HT2C 3B8YA 5FIEA 4XPBL 4XMPH 5FUOH 4XZUB 1DBJH 4TTGA 2AK4D 1H0DB 4I8DA 4JFDB 3EZ8A 4RGOH 4Y2DC 1G6RL 1MLCB 3WKML 3LOWA 3FO1B 2C3GA 5EO9A 1XGQA 3GK8H 4KK5D 3NCMA 3JWNC 3PWVA 4KPHH 2BSSA 4OGXH 4WU5B 3OKOA 6FABH 3GRWA 2E9IA 1U3YA 1PZ5B 3L1OL 2PO6C 5C0DA 1WJ3A 5CAYB 5FV2A 4KZDH 1D7FA 4PREA 3AB0C 1A7RH 1U8PA 2Z91A 1CXLA 3G6JE 3NZHH 4P4KD 4U05A 5KS9E 3GSOB 3MUZ1 4U1SA 3P73B 2A77L 4W6XB 5DQJA 5DMIL 3KS0H 4GRWE 5DVMA 4ZXBC 1WUNT 5T5FL 1A6ZB 4OZIE 4PJXA 3UYOD 4GS7C 3F58L 3OXSB 3HR6A 4R9HA 4UV7L 4CADA 1AHWA 1T1YA 1ZT7B 3O6KH 1UA6L 1ZANH 4TOYL 2DI8A 4FXKB 3RJQB 3RWGA 1RUKH 2X5PA 2VE6B 1E27A 2LABA 4KK6C 1LHZA 1NCBL 4LU5H 1RJCA 1HDMA 5C0IA 5HHMB 2L0DA 3B43A 4RA0C 4ZNEA 5I6XB 5E5UB 4KKCC 4U6XB 2HH0H 3MV8E 4K3HA 4Z76A 1FZJB 4L8DA 5IROA 3RIFK 4XVJH 3DV6A 3OGCA 2E6JA 1KFAL 3IDJA 4XMKH 3V4VH 2RB8A 1IQDA 4KMTH 5GGQL 5GRJL 3CUPB 3GSUA 2FX8L 1EXUA 4KI1A 5D7SH 3GO1H 1JWUA 3IS1X 5E2VL 2BVEA 4X5WB 3ZTJG 5ADOH 1MCHA 2DQDL 3C5SA 3ZL4L 1KPUA 3DX6B 5CSGA 5GJTL 2XZCL 4HWEL 4ZAKC 1QA9A 1X6NA 1YN7B 2OS7A 3VXMA 1LO4L 5IBTL 1K8IB 3ULUF 3SDXE 4X6DB 4RFOL 5BRZD 1HN1A 1MNUH 3ARFA 4P9HC 2ZCLH 1X44A 3VI3F 5JNYB 5CP3H 3MRBA 4MA3B 2W0PA 1KULA 2NW3B 3LRHA 2YPKB 1P4BH 1L6XA 3C6LC 5KSBB 1DLFH 4ODHH 2LU3A 2VRAA 1T83C 4J6RH 2IFFL 4XNZC 3BKYH 2Y6SC 3ZDXE 4UTAL 4F9PC 4DKEL 1VEOA 2YMXH 1Q9KA 3AXLB 3BKMH 3THML 3GRWL 1YEHL 1S9YA 1YNKL 3CCHB 4PP1C 3QUXC 4TNVF 3MR9B 1A3RL 2EDHA 5EULV 4X83A 1T0PB 3K80A 4TPRL 5D6CB 1YJDH 3RQ3A 2R8SL 5EZLB 2BVQA 3UO1H 4KVCL 4WFFD 2COQA 4WW2F 2Z93A 4X80H 4OCXH 1NLDH 1RJLA 5C0AB 5JOPE 4HGWA 2PTVA 2XN9B 1IFHL 1Z0MA 4AIZA 2CD0A 1CXKA 4LNVA 1CD8A 3O9WA 3V6ZB 4U49A 4IRJA 5FM8A 4F2MB 4BSVB 4R4BB 4NNYA 1YY8A 4I0KA 4TSAH 2I60L 2PETA 1KJVA 2RCSL 3BMWA 1T5WB 5TPWL 3PIQA 4OAWA 1SJHA 4JFED 1QSFA 4HS6A 4N5UA 4WI4A 3HTLX 3SGKA 1BGXL 1H3GA 4LSPL 3TP4A 5CEXA 4HIJA 5AG8A 3C5JB 4FXGA 2VN4A 2G75B 2H26B 4HG4K 1DVFA 4J7RA 5DK0A 3HLAA 5I8KH 4MJIE 3QR2A 1G7QB 5HHNB 1P5VA 3KYAA 1TNMA 5DTFA 2XIDA 1BZ9A 4JG0L 4NQDA 5EIIB 5BS0B 4HV8B 3J8F7 1LD9A 1NDMB 4RGMC 2Q87A 1RAMA 4HZAA 1MPAL 1IGYA 1NBZA 1K4CB 3U46A 3W39A 3HCVA 3U30C 2QL1A 4XCYB 3V6OE 4OKVB 3EYUH 4E5XB 1JGEB 2HYMA 4RQQA 1F90L 4I13B 4AG4H 1NCDH 3UZQA 1QLEL 4C56A 2BCKA 2XTJC 5F7NC 4MQSB 1A4JB 3QNZB 5CSBA 3HNSH 4WRLA 1C16B 1YPZF 3CU7A 4JHWL 4BSJA 5DUMH 5DI8A 2BFVH 4WV1B 1EJOL 3FT3B 1AFVL 1AQKL 2AJXH 2NY3D 1T2QH 3L5XL 2RQ8A 1MIML 3IYLW 3P0VL 1F02I 5GS1B 4DAGH 5E5MB 1FNEA 1IMHC 2DQGL 1GC1L 4CUCA 1W8NA 5B4MD 4PV8A 3TBTA 3L9RB 4WY7H 5L0QC 1CGUA 3KYMA 2JJUA 4NO3A 3CFBA 4O5LL 1EERB 3REWA 5L7XH 1CU4H 3W9EA 3K2UL 3MJ7A 5MI0C 3KJ4C 3NCYP 1U42A 1TFHA 4UDTA 1HWHB 2YD4A 4MNQD 1J88A 2MHAA 2KL6A 1S9WB 4JPIA 1VACA 2WUBH 1GGBH 5CGYC 1GYAA 4XVSH 5L8LB 4X6CE 1EHLH 2JIXB 3I75B 4ODUB 5DHYB 1N3NB 1FE8L 3GMMB 1DZBA 1NGZA 4KK8C 4W4OC 4U1JA 4ZS7L 3HE6B 1D5ZA 3RI5K 3WFHA 3LRSB 1CDJA 1INEL 2PYFB 1MCIA 4PB9L 3UTQB 2F54B 4XC1H 4XHJC 4HXBL 4ZO8A 3UAJD 2XYCA 4XPAL 1PFCA 4LLYA 4LSVL 5BOPA 1SYVB 2IBZX 1P7QD 3HUJB 2E7BA 4HKXA 5E8EA 1I1CA 1XAUA 4LSUH 3VXUB 3MLVH 2D4FA 4MQ7B 2VUOA 3LN5A 3RUGA 2VDPL 5I74B 3KPQA 4AH2B 3O6FD 5D7JA 4ZS6D 3F62A 1J0HA 3GHEL 2JJTA 4P5TA 3CLEL 2D7OA 2H3NA 3GHBL 5IBUB 1NGYA 3NGBB 5CD5D 1MCBA 4I3SH 4EI6B 5E4EB 4EIGB 4LCWA 4RGNE 4MAYD 1P9MC 3VXSB 5HPMB 1OB1B 1U3HB 1KOAA 3FRPG 5HD8D 4ZTPL 4NDMB 5D1QD 1X5KA 3KPRA 5L2KB 1PG7W 4BSWA 2XKUA 4LKXA 3DIFB 1IAKA 1K5NA 5F7WC 5KVGH 5JDSA 4I48B 4PRAB 2X9WA 5JIHA 2A6IB 4RRPG 4FTVA 1SEBB 1T89A 1FL6A 2NY0D 2XA3A 3U4EB 4TSCH 1KLGB 2O26U 3EO1A 1FYTE 4JFZH 4MVBC 1ZA6A 4TQEH 3IDIA 3G6DH 4PG9B 4EDXB 4ODSL 3K7UA 4OZGA 3QEGH 3O3EA 4N9GA 1BMGA 2XZZA 1F11B 2FCBA 1CFSA 4HKZB 3RWIB 3TO4D 1UKSA 2YPLB 3D9AH 1DBBH 1I3RA 3LHPH 4DGYH 4X4MA 1MVUA 5IB1B 4R3SB 1MF2H 3GMNA 5C07E 4HUVB 4KJPD 2Q76B 4D9QD 3SN6N 3IXAB 5BZDA 1KJMA 4CN6A 5C6TL 3FHQA 1F42A 1QQDA 3HKFA 1TETH 3GJEB 4LPYA 1A02N 2PCPA 3FFDA 3DGCR 2FB4L 1T21A 2B4CC 3VA6A 3BKJH 2X4RA 1XF3A 1OSPL 2C1PB 2X7LB 4HIHB 5DVKA 1IKNA 1NC2A 1RJYB 3JVGC 4YH6A 1JGLH 1CXHA 1CGXA 3QCUH 3B9KB 4ODTL 2GFBA 5EN2A 4C55A 3EYSH 4M93C 3H0TB 3GSVA 2QEJA 1D5IL 3CVIL 1RHHB 5H37H 4D8PA 2OJZH 2ADIB 4H1LA 2B0SH 4U1GC 2DQJL 1RY7B 1MVFA 4PGCB 4UNTA 2WQ8A 4S1RH 1YEIH 5FCUH 4X6DF 3ILPA 4QRRA 3IJSB 4BELD 5J13C 3ARTA 3TWCH 1R3LB 1CDIA 5SWZB 5TF1L 2DM2A 3X14A 1NANH 1WAAA 3IJYB 1LWRA 1QTYT 2ICEA 4CW1A 1U92B 5DUBB 4LEOB 4M1CC 4RZCA 4WHCA 1BIIB 4F58L 3MNWA 4CAGA 5FF6B 4CVXB 1MWAB 5C0GB 2I9TB 5J12B 3CFJB 1A21A 1KLFA 1VFOA 4WW1A 3LQMA 2R29L 2J8UA 1U58A 3MCG1 2PW1B 1GZPA 4LPTA 4XBGA 4NSKA 5J89A 5HYFA 2Y5EA 1N5AA 5LAXB 4JRYE 5IV2A 1H8OA 1QKZL 2MMXA 3BX7C 3NCFB 4HFUL 1LEKB 1MWAH 4P23B 1JGUH 4KDVA 1JNNH 3P11L 2DQFB 4GFTB 4P48A 2HLFD 2X9YA 5JUEL 2VLJE 1LO3H 5KAQG 1N4XH 1CQKA 4LP5A 4MJ5A 2P4AB 1RK0B 3HZYB 3VFSA 1R0AL 1FFOA 4JZJB 2DIBA 3QJFB 3WIFA 4PLJD 1BQLL 1BJ1H 3MLSL 4FQHA 4A6YA 5DK3A 1H9VA 5DRNB 3QB7C 3MRPB 5IQ9A 4H0HB 3Q3GB 4G7VH 3CLFL 3LKSA 4TVPL 3KPNB 3TZVD 2FX7H 3NA4A 1OAUL 3U7WH 1VFBA 4XX1G 4HLZG 4PJEA 1QRNA 4YEFA 5LXGL 3KLSA 1KNOA 1W0WA 3BESR 5FB8A 5E8NB 3SKUD 3MFFA 2X4SB 5I17A 3V5KA 2DLFH 3KG5A 3SDAA 3IS0X 3PWVB 2GTZA 4MQXC 3O41A 3DSNA 3GMOA 3OKOB 2CO7B 1RZKH 3ZT5A 2VXSL 4UDUA 3MREA 5C0DB 2R0LH 5EUKA 4PPTA 4PREB 4V1DB 4UT7L 2Z91B 4G80A 4M1GL 1X5XA 3VXRA 2BVPB 2GJ6E 4MX7A 4JPVL 1V3JA 4U1SB 2EE2A 1FNLA 3AS2A 4JJ5A 5D5MF 4OF3A 4OFDA 2CDFA 3S37H 3EOAA 4HUNB 4HULB 2UZIH 4BKLA 3L7FB 3VD9A 4P46C 3QQNA 5LGHL 5IKCA 1XMWA 1DBAH 2GJZA 4OD3H 5E7FA 1AHWB 1T1YB 4QRPB 3T1FB 1N64H 5BMFL 6CGTA 3BPNC 1IAOA 1YY9C 5JHDE 3MV8D 4N0CC 1EMTL 1R24B 3RGHA 1UWGH 2EE9A 4R96B 5DDHA 3G08B 4U1HA 1UZ6E 4Y89A 4R90H 2W0KA 4HIIA 4WGWB 2D7TH 3BIBX 5JXEA 3TBSB 3EOTH 2P24A 4Z76B 2ERJB 1UJTA 3ELAT 4F9LA 5IFAL 2CDGA 4NC1E 3WJLA 3OGCB 4PR5A 2H1PL 5BCAA 3OPZH 1ZSDB 1IQDB 1I1AC 2E7LC 3S36X 1YYLH 2ZWLT 5IQ7H 2Q7NA 1EXUB 4PLOB 4WHYG 4Y4FA 1JWUB 4NO0B 3REVB 3VXQA 2A38A 5FUZH 3FRUA 4O4YH 5DS8A 3S35H 3C5SB 1KPUB 3MC0A 1KXQE 3BP4B 4M43H 3OKKA 4XP6H 3U6RB 5KN5A 2XRAH 2HWZL 3HPJB 2PTTA 3VXMB 4MGXA 5DMJB 5C92A 1S9VA 1GHFH 4NM4L 4QTIL 3ARFB 1U9KA 1FPTL 1I9JH 5MHSE 1Q9WB 4UIKL 1DQJA 5C6PB 5FAAA 4WI9A 1KCUH 4GUPA 5I8EA 5FYKH 4OQTH 5IW6B 1MHHA 2ZCHL 4ESKA 2PXYC 5B3NA 4YGVA 1EVUA 4Z7WE 1Q9KB 1FL3B 4H26A 5HYSG 1SBSL 4ERSH 1S9YB 3ZKNC 4JPWL 3NACL 1RZFH 4CKVX 5KZCB 2OR9H 2J7LA 2VO5A 1MHEB 2LU7A 2HMID 4TRPL 3MCKA 5CS7A 3GJFA 5JOPD 1CLOL 4DKDC 4L3ED 3HG1A 4LPVA 5HVWA 5I1JH 4PGDA 3O3UN 1RJLB 3BSZL 3HAEA 4HGWB 2GITA 1OQXA 1MCOL 2P43B 4IRJB 4H8WH 3WFBL 4XNYL 5F7FA 2AK1L 4OFVA 4NQCB 4FXLA 3O4OC 4U3HA 4NNYB 2VSDA 1BM3H 1KJVB 1L4IA 4I9WE 4NKOA 3AM8C 4OAWB 1SJHB 4KK5C 3MX0A 1CVRA 3AAZA 1YNLH 2G5BA 3B5HA 4KRPB 3PGFL 4MJID 3KHOA 2YD8A 2C9AA 4FXGB 1FFNA 3MRDB 1J1PL 2YXFA 5J1TC 1UJ3B 1KT2A 3HLAB 2AV1A 3FJTA 5KSAB 1NCTA 5E0QA 5BXFA 2DQIL 2XQBH 2P8LA 3SKJL 3WJJC 5DTFB 5J8OA 5ESQA 2X70A 3UTOA 3RL2A 1V7ML 4OI8A 4Z7OE 1UM5H 1HH6B 4UNVA 1LD9B 1PEZA 3Q6FB 1BZ7B 4KHXH 2FHFA 5LG1A 1IGYB 1NBZB 3U46B 3W39B 3QH3B 4P2QA 1OAQH 1QBAA 4GRMA 3VFGH 4RQQB 4FFYH 1QBLL 4MJ4A 5FA3B 1NUNB 5T1DH 1QYGL 2P5EA 1LO5A 3Q1SH 3LQAC 3QYCA 4R4FH 3P4MA 4C56B 1EFXB 2BCKB 4FQXD 3IRZA 2DD8H 5SX5K 3BXNA 1I8IB 3AGVA 3LMJH 1GL4B 5FM4A 4LAQH 2O5ZL 4N90E 5CINL 3N85H 1BHGA 5DI8B 3QJHA 3VH8G 3NA9H 4BH8A 2OK0H 4N9OB 1IEBB 1ZLUH 2YC1A 5K59E 2MKWA 4OCMC 4BM7A 5DR5H 2AQ2A 2AJSH 5HDOA 3TBTB 3C2AL 1P4LA 1BD2E 3KYMB 1N6VA 3CFBB 4NO3B 4NUGH 3REWB 1I85C 1YEEH 2PO6A 3LAFA 4I0CC 1IZKA 1VEMA 3OR6B 1A6UH 4LDEB 2X4OA 3LEYH 5D8JH 4TN9A 4JPIB 1VACB 4Q97A 4LLQA 2W0FB 1AD0A 2FYYB 3MROA 4XMLL 3QCTL 1P6AB 1T0MA 1UEMA 2VXQL 3BD5A 1Z3GL 2NTFA 3ME0A 4OTXH 2MNUA 4JFHE 1FNGB 3KPSA 3QUMA 4U1JB 4NCC1 3NABH 1J1OH 3WFHB 4OLEA 4KKBD 3DXAA 1BF8A 5FYLE 2HA1A 2EDNA 4DKFH 3P9MA 4ZO9A 5EOCJ 5T3ZL 4LLYB 1MJUL 3SKMA 4ZO7A 1NCCL 3VI4F 4YHKH 2OXGA 4YQXL 3BZEA 3IRPX 1A5FL 1LP9A 4HK3J 5JW4Q 1JZ4A 1FORH 3WN5B 3W81A 4MDJA 4Q6YA 4Y19E 4OM0L 1ACYH 3AFLA 3SKNB 5D7JB 1J18A 5SWSA 4R7NA 3ZE2E 4RGND 3L3KA 3P30H 4P5TB 1OWWA 2YRZA 4S1QH 4NRZA 1WFNA 4PJ5E 1Q9LB 1R5WA 4P2CG 3GZKA 2CKBA 4X99A 3UCRA 1T66D 2E9BA 2XNAB 5GS0L 1DQTA 2E27L 2VERN 1M05A 2G9HB 5I15H 1KJ2L 4L1HA 1GAFH 3VMNA 2APBA 4ZAKA 1YEJL 1CFNB 1I3GH 3MV7B 2C4FT 3A6CL 5EOCL 5HGGS 5C0JA 3INUL 1IAKB 4X6FB 2Z31B 5JDSB 3WIIL 4AEEA 4PRIE 4U6TA 3ARGD 4HWNA 4PGBA 3M8OL 4FTVB 1FYTD 3BPLB 2DBLL 1ORSB 5HHXL 1QOKA 4YDIL 4ZFFB 3V79C 3QEQA 1D6VL 1T83A 4QXUH 4U3XA 4XWGL 1ZA6B 4EIZC 5EB9A 4F9PA 4PJXF 2K3TA 3O3EB 1WICA 5BO1L 4IRZH 5C07D 3R1GL 4V2CB 1SJEB 3M45A 1UM4H 2GT9A 3HI1A 4PJCA 3SDYH 4P3DA 5CIPA 3SKOB 3QUXA 1MVUB 4NZDA 4B7LA 5EUOA 4N0YH 5CJ5A 5EWIL 5BZDB 2X1QA 2VLRE 1KJMB 3Q5TA 4I18C 3RVUD 3QUYD 1U93A 1G7HA 2B5IB 4GKZA 2FX9H 4JM4L 2LU4A 1MHCA 3PL6D 2FJFA 4G6JL 2WSKA 3LSOA 4Z7VA 4LHUA 1T21B 2X4RB 1PYWA 3MRHA 3NIFF 1CGSH 4HBCH 3VFRA 1NC2B 2J8OA 5H94A 1KG0A 2NY3C 43CAA 2GFBB 7FABH 1RUAL 5EN2B 4F57L 2GSIB 3U79A 4U6VH 1F4XH 3U36A 4CVWA 2ZJSH 4K8RD 1A9BA 1ZGLM 5KTEL 1UZ8A 3UYRL 5I1HH 5DD0L 4NZRL 1QLFA 3ILPB 5IF0A 1F8TH 4QRRB 1C5DA 5JMOC 5EU6A 3BVNA 1JF6A 3FL7A 5CUSL 1S3KH 5HGDA 5KVFL 1OGAA 4RZCB 3N9GL 3D85A 2R1YA 4M6OL 3MOAL 1NL0L 4KZEL 4G7YH 3VGHA 1G9EA 4YHOH 5EFIA 4AIOA 2MCPL 2W0LA 4JRYD 5EOQL 1EEQA 2AABH 1XIWD 5CZVL 3ZTNH 3G5XA 1U58B 4FFZH 2YD1A 4NP4L 3LKRA 4AL8H 3RZWA 1GZPB 4XBGB 4NSKB 4FQLH 2W9DH 3UAJC 3DVNA 5D7IA 5GGUA 5CGMA 1NFDA 2OZ4H 5FHBL 5K9QG 2VLJD 3H9SA 1P84K 1D5BB 2VDLH 1PD6A 2JB5L 2VDRH 4TNWF 2W9LA 3U0TA 1VPOL 5TE7L 3HMXA 3I9GL 1FFOB 1QBML 3PXHA 3QDMA 3WIFB 2ID5A 1FH5H 1GH7A 3O6FC 4FQHB 4ZS6C 4A6YB 1MCJA 1Z9OA 3GKWH 3QRGH 5IQ9B 2IGFH 2HFEA 1RU9H 4HF5H 4MSWA 1KCRL 3LKSB 5F6HJ 5CD5C 2J2ZA 1J5OH 2CXKA 1CE1H 4UT6L 4M7KH 1TDQA 3RWCB 4BH7B 4MAYC 3N1FC 4FQIH 1QRNB 4PJEB 2O61B 1I7TA 5FB8B 5HD8C 5I17B 5D1QC 5GRUH 3V5KB 4A6YH 3SDAB 5CMAA 2VXUH 3MUHL 2GTZB 2DBJA 2DM3A 4PJGE 2R56H 3GMOB 5E5RB 3AMKA 5L9DL 4I4WA 4W4OA 2HFGH 4I0PB 4E41E 4QOKE 4ZPVA 1AI1H 1FBIH 3DV4B 2NY0C 1CD1A 3MREB 4P2OD 5EUKB 3H3BC 1OP9A 2GJ6D 5ESVB 2Z8RA 1T03H 1HZHH 2WW8A 5GXBB 2VZ1A 4DZBB 3VDBA 5CHNA 3VXRB 2Y07H 1XCQA 4KI5D 8FABB 4LCIH 3TO4C 4NWTL 4N0UE 1OY3B 2WUCH 3A67L 3EOAB 5EU3B 1R3IL 3WE6A 4LPWA 4BKLB 4DVRH 4AY0A 5JHDD 1OGTA 2GJZB 2V17L 5DRXB 1GCFA 4TULL 3DGGA 2DTMH 1XGYH 3IGAB 1IAOB 2Z4QA 4J4PD 1RUML 4NNPH 5DDHB 5IHUH 5CKGA 4M6ML 1MCRA 4JZOA 4D9RE 1P9MA 1XGUB 4JB9H 3IAQA 3TT3L 5I76A 4OCWL 5C2BL 4YHYC 4LK4A 2P24B 4F8QA 4Q9RL 5IVZA 2HT4D 3ARDA 4OCYL 2G60L 1F4YL 4XP1H 3QG7L 1NGXA 1Q0YH 4LVNC 2X89A 3OWEA 1OCWH 4JCMA 2I27N 4OLVH 3CK0H 5CBEA 3RZCD 3PWUA 3QDAA 3I3DA 5I1CL 1KCVL 4Y4FB 3GIVA 4P3CH 3VXQB 3VRLF 1YEFL 3FRUB 5HYJA 4WVRA 1Y0LA 3KHQA 4OQ1A 3BFOA 4RFEA 3OKKB 4PJIB 3G5YB 5KN5B 1SYSA 2PTTB 5MHSD 4K3GA 1S9VB 5A2FA 3PHOB 1BFVL 3EYVA 5C08A 1I1FB 1PW3A 1Z5LA 1OT1A 3T0EB 3RRQA 1XZ0B 15C8H 2UZXB 2EYSA 4WHTA 3ARBA 4TNWK 1KJ3L 3EYFA 1DEEA 4LSQH 3FQUA 4GUPB 2FATH 5E6IC 1MHHB 5F72S 4HKBA 3F6LA 4YGVB 2NCMA 3RUGF 4IJ3B 3ZYZA 3IDXH 4KH2A 1XF4A 5I8OL 3QQ4A 4X6EA 2VQ1A 5E95B 1MREL 2OMBA 1CL7H 5HBBA 3JVGA 2HLFC 1BAFL 1KCSL 2YA0A 1INDL 4KVNL 4KQ3H 5FOBA 4HPYL 3GJFB 4WEMB 1I9RL 3BGMA 3K1KC 5CD3A 1A9EA 4P3WA 3ULUE 4PLJC 1CDYA 3BPOB 4MXWH 5DD1H 4RAVA 4PD4K 4PGDB 3LDBB 3VI3E 4PUBL 2EDXA 3HAEB 2DMBA 4CJ1A 4LHJB 5KW9L 2GITB 3RDTD 3TZVC 3GBML 1UWXH 2GUOA 2YPLD 5M7QA 3CXDH 4PY8J 4MAUL 4I9WD 1BVLA 1KN4L 1NMAH 1QZ1A 2DQCL 1KPVB 4YBHA 1MEXH 3MRJB 3EOBB 3NH7L 2X1WL 2P7TB 4KDTC 4OLWH 4NKOB 3MGAA 1RIHL 4XC3L 4F15C 1ZLUK 4CRPA 5D1XD 2G5BB 3QBTB 4MMXC 4OZGF 3T3PF 4U6HA 2A9NL 1KSRA 1NAMB 5J56B 1KT2B 1CXIA 2AV1B 4F33B 1GGIL 1WIPA 2V5SA 4UTBL 4BFGA 2MJWA 4QYOA 5DHVB 5T1MB 5D1ZA 2P8LB 1LK3H 3P0YH 5ESQB 3RL2B 2QSCL 5DO2D 5TQ2L 3BJ91 1ADQA 1J8HE 3LS4L 2YKLL 2VNCA 2HJFB 2C4XA 1NAMH 5GS2H 4P2QB 5IP4A 3T77B 1X7QB 4GRMB 4MHHG 4IOIA 2HVJA 5DHVH 4R97C 4X6BA 2ITDA 2P5EB 1LO5B 1KB5A 2DQTH 3P4MB 1KEGH 3MJ9L 5H2BA 4N90D 1RMFL 5HHQA 2ZUUA 3IFLH 2ATPA 4UV4L 5AZEH 4K3JH 4JLRA 4Y5YC 3JWDH 2H9GA 4JHAL 4FNLL 1BLNA 3S3SA 1PJ9A 1RZGB 3QJHB 1NUDA 4BH8B 4M1DH 4D94A 3TBYB 3O3AA 1BVKA 4Y2DB 4LDLB 3LCYA 4AM0A 4LOUD 2KKQA 4WUUA 2YC1B 4WFHE 3BKCH 1BD2D 4N0FA 3MRQB 4WUKL 2R0WL 3DURA 1OAKH 3QWOA 2D4DA 1VGKB 4GG6B 4ZFZB 2WIIA 5F3BA 4RISL 2IALA 2NR6D 2PO6B 5F96L 3G6AA 1REIA 2XPGA 4CMMB 3U2SA 2X4OB 2EC9U 5ITBH 2MOVA 3CC5B 4YDVA 3VA2C 5GGVL 2HJKA 4YK4B 1AD0B 2WK2A 3FB7A 4JFHD 5GPRA 2J8UF 1DDHB 1YPZE 1T0MB 1EHAA 2NTFB 1N6QL 1YEGL 3KPSB 4ZXBB 5T3XL 5F88A 1IGMH 5JXAH 4GS7B 35C8L 4IDLA 4P46A 5C9JA 3DXAB 4U33A 4NT6B 1KEMH 1QHPA 1UCTA 2XKNA 5B3JF 3SKMB 4U1MA 5DJ6A 4KV5E 4YE4H 4F7EA 1EV2E 4LCCC 4GAYA 4U7SA 1BP3B 4Y19D 5IVOA 2V5YA 2BY0A 4HWBL 2HFFB 1HQ4B 4NN6C 3E3QE 5DXWA 2AEWA 1U8IA 4NKMA 5EH1A 3UTZA 1AQDB 1Q72H 2HMIC 4JO4L 3WUWG 2R1XA 4PJ5D 4V1DD 4PJEF 2Z92B 4JY5L 4MXQD 2V9TA 5SWSB 1F58H 5DT1H 3QNXB 4EDWL 1NDGA 1S7QB 3L3KB 5DD6A 2E7LA 5IG7A 4GQ9L 3G5ZA 1R5WB 1RIUH 2CKBB 4X99B 3TGXA 5FO8A 4P59H 2XTLA 2DLTA 4APQD 4NBZB 5IK3B 4JFYA 3I3BA 1I7UA 2R23A 4LSSH 5F3HA 1S8DB 1M05B 4JRXE 2VZUA 4M7ZC 1IGFL 1HYSD 3F7YB 4HUXB 4ZAKB 4NHCL 4PRID 3WNMA 3BDXA 3RWHA 5DA4A 2R39A 4XPFL 5KOMC 3TV3L 4LSRL 1PKQE 1OF2B 3QXAA 4PGBB 1B0GA 1FCGA 5D7LA 1K4DB 3ORJA 5FYJU 4U2YA 3QFJB 1QVOB 3DI3B 4NKDA 1S7SB 2HFTA 1BJ8A 3C6LB 4AQ1B 3UTSA 3MGTB 4G3YH 4BQBA 4PJAB 3NFSL 1CD0A 3JSSA 5DVNA 1HXMA 4OLZL 25C8H 4RMVA 1MJJA 1MAML 4P9HH 4BQ6A 4K94C 3V6OC 5CGTA 5IVXE 2GT9B 2V5MA 2VLRD 4PJCB 1A7OH 3IU4L 4M7LL 4P3DB 4WTXA 5CIPB 2BMKA 5CCKH 4Z0BL 1BOGA 5EUOB 1NKRA 1JPSH 1YYMH 2NY7L 1R3HA 4Q9CA 4NO0D 1U93B 1G7HB 4GKZB 3F5WB 3AU1A 3H42L 1UCBH 4X98B 1ZTXH 4FQXC 3RWEB 2W91A 3WSQH 1G1YA 1IAIH 1ZS8B 2FJFB 3LSOB 5CIPH 1BQHB 4G6FB 2QQKH 1YMME 2AK4A 2FBOJ 1KG0B 1XH3B 2CQVA 5GGRA 43CAB 4PIRF 3CZFB 1F6LL 1D6EA 5DEGA 1KTLA 4ODBD 4XXDA 3AM8A 4P9ML 5J11C 5CILL 1RSFA 3FT4A 3VFOA 1J10A 3I6KB 1CDHA 3EOYG 3KPLA 5FYJL 5J6GA 5F1SA 5IF0B 4JQIL 4GKOA 1C5DB 3NAAL 4QXWA 2C3XA 5EU6B 1JN6B 4Q0XL 4Y1AE 2YK1L 4KKLD 3O0RH 5HGDB 3WJJA 2VJXA 5IJKC 3FRPA 3WIHA 2MPAL 2R1YB 4RGMB 1CLYH 4AT6A 2ATKB 5DJDA 1EVTC 4YUEH 5C0BE 4DCQA 3O8XA 1FNSH 1MY5A 2Y36L 1OQOA 3U30B 1I4FA 4KHTL 5EFIB 1CFVL 2XZQH 4KMQA 2BNRB 2DKUA 4JY6B 2C3VA 4CMHC 4RRPA 2EEDA 4KKBC 1I9EA 3LKRB 2XTJB 5TDOA 3RPIB 3WLWD 3JBG7 2VB5A 4NQCD 1I3UA 1MFEH 5EBWA 1PQZA 3DVNB 5D7IB 3DSFH 2LTQC 5GGUB 4XNUL 4TUOB 4JZNA 1NPUA 2CMRH 1DSFH 1G0DA 3EO9L 2AJ3A 1A14L 4XPHH 3PGDA 3U0TB 3G04A 1IC7L 1HHJB 3HB3D 2ARJQ 1JYXA 1NLBH 5KSAD 5H37G 4XPGL 2ZNWA 2HFEB 1JHKL 3PWPE 4RGNC 5TDPA 2M2DA 4MSWB 3DVFA 1I85A 2J6EA 5MI0B 2IPUK 2VMFA 4JEGB 1KB9K 1T66C 3RBGA 5M95B 1MIEL 3U1SL 5FFLA 3Q0HA 3ZYOA 2ZG2A 3ULVE 5EC2A 1OAZL 4ODVL 2ZG3A 3MLYH 1SBBA 4E41D 5CMAB 4YO0B 2IPTH 4QOKD 5H35A 3FMGH 1ZXQA 4FMKA 5BRZA 5JOFA 2BVOA 2PYEA 4I4WB 3Q2CA 3ARGC 4WWKD 3MOBH 4ZSOE 1CD1B 3EHBD 8CGTA 1MHPH 4TOYH 3P40A 1ZVSA 4CGTA 3OQ3B 1S5IL 3FOMA 4ZUSA 2EH8H 3BDYL 2NYYD 5EC1A 3T4AB 5DJAA 2K7PA 5IB4A 5D2LB 3Q5OA 1SY6A 1EGJA 3SOBH 1XCTA 3WE6B 2V6HA 2XFXA 3I3EA 5F7EL 3SQOL 1FGVL 3MODH 3WIHL 1OGTB 3QUYC 4NQTA 3A6BH 3DGGB 2FX8H 5J0BA 1FIEA 2VITA 4D9RD 2YOCA 2BJML 1U8JB 3PL6C 5E2VH 3U0WH 3UJJH 5GHWH 4JR9L 4L4JA 2BVTA 4PBXA 1EUTA 3P9WB 4OZHA 2NTSP 5BJTB 2EDEA 5I76B 4EOWL 1FZMA 1TZHB 4MXVF 3VXOA 1L6ZA 4UT9L 4RFOH 2X40A 4QHLA 4K8RC 5EBMA 4YBLC 3D3VA 3GSWA 4JFEA 3CDCA 1NGXB 4JGMA 1H3TA 4KDWA 5D5ME 5CBEB 3C2SA 5EO0A 4DKAA 3GIVB 3VW3H 4K3EL 1CDCA 2VDNL 1KENH 4JE4B 4G6AC 5DWUH 4O9HH 5CFHA 1UWXK 1YEHH 1SYSB 1YNKH 4NBXB 3T09A 1QSEE 4KJQD 1NCWL 4YNYB 5D71L 3GJFK 4NZJA 3FOLB 5I75B 3EYVB 3L3DA 1M7DA 1Z5LB 2KQNA 3OF6D 1NC4D 1JWMB 1MJ8H 1C5CL 2R8SH 1HI6A 5IFHH 2JELH 4KVCH 4D9LL 2JK5B 4WHTB 1DBML 3KWWB 1YEKH 1ZLWK 2YBRB 4I18A 4PJFB 1XIWC 5CEYA 1DEEB 4P5MA 3S36L 5E24E 5I66A 1LP9F 1FG2B 2VWEE 4HKBB 1ZLSH 4JAMA 1P69B 4PJ7E 5MEQA 1F3DJ 4Z8FH 3TLRA 1XF4B 4OIBA 3QQ4B 4X6EB 2PR4H 1RULL 1NSNL 1QFPA 3FQXB 1JHLL 2I60H 2IWGA 5TPWH 3ULUD 5AYQA 1ZHKA 2ORBH 2AKRA 4XVUD 4M93B 3DRQB 5CD3B 3GFUA 3L5HA 5IGXL 4U1GB 4RAVB 1B90A 2B4CH 1OPGL 4I77H 2Q3AA 4RWYL 4XCFH 1IBGH 1OD7A 4HS8L 2GUOB 4HW6A 5J13B 3DHMA 1MCEA 3BIKA 4JANA 4ZPTA 1U8NA 5DYOB 1UVQB 4KWUA 1JRHI 4J1UB 4MD0B 4I2XB 4L9LC 4PJ9D 2ZSVB 4MZ3A 4GH7B 1F90H 4CVUA 1WCBB 5GRVK 1S7UA 1HQRA 1S7RA 1QLEH 4U6HB 3QXTA 32C2B 3DUUB 5AYUH 4PJCF 3MXWL 4HC1L 4P2OC 4WNQA 4OGYH 4QYOB 2A83B 3ARZA 2VDOH 1NMBL 5EUOF 3KPPB 2CLZA 4GAFB 2XA8L 4M8QA 4F7CA 3STLA 1P7QA 4KI5C 2OR7A 3D1MC 3P0VH 5FGBC 5TF0A 1CIDA 1TTFA 1T1WA 3R06B 5LGKA 2BNQE 3VDAA 4Z7VF 2F8VA 2HVJB 1EAPA 2YN3A 2ITDB 1ZHBA 3ZTJH 2Q8BL 2HVKA 4NOBA 3V5HA 5H2BB 3H9HA 3O6FA 2ATPB 2F8XC 2BY3A 4OGAC 4MJ2A 7CGTA 1WZLA 2H9GB 2WP3T 2AJYL 4J4PC 1QO3B 4HIXH 5C70A 4HGKC 2UZYB 5CP7B 4WFHD 1G7PA 4W70A 3O3AB 5HYSA 2XQYK 1BVKB 4GMTL 4X4YB 4NFDA 1F6FB 5FYLL 3A6OA 2WBWB 4WUUB 4HCRH 3IT8D 1BWWA 1G7IA 3PJSB 5D1QA 1JYNA 2HT4C 1C5BH 1MJ7L 2F53A 3BHBB 1OM3L 5E6ZA 3S3PA 2IF7A 3QWOB 1FZOB 3SE4C 3RZCC 2WIIB 1GIGH 2IALB 2IG2H 4RMSA 5DJCA 4HXBH 1OTSD 4XPAH 3K8LA 4QO1A 5GGSA 3U2SB 3UTPE 3S9DB 4Y7MA 4YDVB 1HKLL 3BEWA 2HJKB 4ZUVA 4IMKC 4XHQA 4ENED 2OP4H 4NJ9L 5FGCE 2AEPL 3MA7B 3HNTL 3PDDA 3TO4A 5D72L 3WNOA 3HE7A 3P77A 2NY5C 3H8NA 3MJ8B 3NIGE 2FZ3B 1NFDF 4LPCA 2VDPH 4Z5RA 3F8UB 4P46B 3OX8A 3VD4A 5E4EC 5GGRY 3G9AB 3GNMH 4PJHE 2PN5A 3BPNB 4MD4A 1EEYA 3S37X 3B5GA 1MCWM 5DJ6B 4JKLA 4UINH 4F7EB 2ADFH 3VG0H 1YEDA 3RAJH 3LPWA 1PSKL 1A7QL 4S0TD 4I0PD 4J3OC 5I2IB 1CZ8L 2FHBA 4UAOC 3BZFB 1U8IB 3HR5B 4NKMB 5JQ6L 4HWZB 3RU8L 1L0QA 4PRPB 2R1XB 2MCG1 3O2DA 1FL5A 4RA3A 1WT5C 3T2QA 4OJFL 1I1AB 3VXNA 1NDGB 5DD6B 2BDNH 1NEUA 5IG7B 4R7DA 3G5ZB 4JRXD 3WBDA 4H5SB 1WQVT 3RDTC 5FO8B 2NX5E 3FONA 3IXTA 3BUYA 3L3HA 4L4VB 4YXKL 3VH8A 5FKAB 3C08H 3SE3C 5MENB 4OFKA 3VI4E 3TNMA 2BHYA 4R8WL 1G9ML 4DJMA 5LCVL 5D1XC 2YPVH 1A0QL 4PRNB 3QXAB 4ZDHA 5D7LB 4Z95L 4Q58C 1FRGL 3T3ME 3MRRA 3UTSB 2V5TA 5IJVA 3RX5A 1JZ6A 5E6IA 3EJYD 4JG1H 2EKJA 1OAXH 3X3FH 2FB4H 2PXYB 3ARQA 1CF8L 3L5WA 3SCMD 4IDJL 3U7YL 2XZAL 1OSPH 3CGTA 4NKQB 5DO2C 4RDQF 4LASH 3D0VB 3MRLA 4ODTH 4LPXA 1NFIA 2GY5A 2BMKB 1BOGB 1MFAH 3SEPA 3CVIH 1OSZB 3BPCA 4FP8L 1R3HB 5T1LB 3U0PB 3VFNB 3NTCL 4FQPA 1OD9A 2IPKA 4BQCA 2EXYD 5HGBA 2PNDA 4YWGL 1NKOA 3TZVA 5TF1H 2CK0L 4LF3A 1DN0B 3QIBB 4NKIL 3WD5L 4MB4A 2AK4B 5GGRB 3T0ED 4F58H 4LOUC 3O4OB 4PJXE 1D6EB 2HJLB 4MZ2A 5DEGB 1KTLB 3SQBA 4XXDB 4U6YA 1BBDL 3FCTA 3GBNH 3I2CL 5AAMA 5KBNC 3DO7A 1OW0A 1PLGH 1V7NL 2K9UA 4Y1AD 2E6PA 3CFKB 3MRIA 3L3IA 4G43B 3OGOE 1JI2A 1IILE 3G6JA 1A6VH 1HSAA 2NR6C 5LWYH 3DVGB 4ZNEE 1QKZH 2LV4A 4H20H 3DBXB 1KIRB 4K9EL 5KS9A 1RZ8A 4KUCF 2VR5A 3QO0B 4P4KB 4XXCC 3VFTB 1FDLL 5DF0A 4AT6B 1FO0B 5EA0L 5DJDB 3F12A 3FAXA 4Y2OA 5JPNA 4OZIA 3MV9E 4C54A 4Q9QL 3NIFE 1MH5B 4GAJH 1EHNA 4RMUA 3KXFE 4LRNH 1W72L 1R0AH 5FKPA 4JO1L 2GSGA 5ITFA 1AKJD 1VSCA 5TDOB 1GXEA 5AAWA 1ZGLP 3QAZC 4Y5YA 1MCFA 1FO0H 4MNGA 2A9ML 1A1OA 2FGZA 3MV8A 3OKMA 1T20B 4MB5A 4JZNB 2DDQH 4JN1L 2F5BL 5DLMH 1OHQA 3V8OA 2V2WA 3C87A 3IF1B 1SEQL 1NBVL 3LQAH 3LIZH 1MRCL 4PRDA 1A7PH 3BOVA 3G04B 5KVEH 2AEQH 3PWPD 2LVEA 5ANMA 1BOYA 1JP5A 4Z7UA 2D0GA 3EIFA 2EYRA 4MXQC 5HI3D 5B39G 1GPOL 3GSRA 4HG4J 5TDPB 5F1NA 4ZOBA 3IETA 2GW5A 2BC4A 4YZFF 3RKPA 4DGIL 4JVWA 3ULVD 4WDIB 1ONQA 1CE6B 4QRQB 1HXYA 4APQC 1UXWA 1CDUA 1N26A 4GSDL 1QLRA 2BNUA 3CFDB 3SDXA 4DVBA 1HYSC 1XR8A 4M4RA 3JTTA 2YEZB 2OX5A 3H3KA 2YD5A 2I5YH 3BEVA 3PQYE 5ALCL 5BRZB 5JOFB 2OM5A 1AD9B 2J6EH 5FO9A 2ARJB 1RQ5A 4ORZC 3KDMA 3V95A 4L1DA 3AVEA 5AEAA 1ZVSB 1HINL 2FL5B 2D7NA 4WTWA 2Q86B 3FOMB 5EC1B 3TBVB 3X12A 1A3LL 2QHRL 5IB4B 3L3OA 4LSTL 4LCCA 3V9FA 1QSFE 3RPKA 5C7XL 1JL8A 1XCTB 5IFAH 1A1NB 1A22B 2BY2A 4QHMA 2XFXB 1MELA 2B1AH 1EIBA 2Q7YA 3MXVH 5C09A 5E56A 4MCZB 1HWGB 4NCDA 4DGVL 3TT1L 4NJAH 4OLYL 5HVFB 4GRLD 1RZJL 4L3EA 4ODXB 4B53A 3QXVA 4NFBA 3BAEH 3LEVL 1SY6H 4QHNB 1HHIB 4NQDE 1N0XL 3I6GB 3VJ6A 4JO3L 1G6VK 5DQDL 3MACL 1WWWX 1DBKL 1N5YH 2J3SA 1JPFA 1WBZA 4M5ZL 4LLUA 1A64A 3UC0H 3I02A 4QTIH 3ROLA 4QHLB 2ESVA 3UMTA 3MBED 4HUKB 2JCCE 3GSWB 4JFEB 1IEAA 4AEFA 5E8OA 2R1WB 1GZQA 5EO0B 4MJ6A 4D0DA 5ACLA 4N5ED 5DRZA 1QSED 1UACL 3ZHDA 2JJSC 2YUXA 3QHFL 1GOGA 5JORA 4KK9D 4KKLC 1KACB 3B83A 2X4QA 3QRFM 5IB5B 3PNWB 3IFNH 5ALBH 3MRMA 5TE4H 4M8VA 5MP6L 4ZTOH 1P5UA 3PP4H 3U9PH 2OJEA 3L3DB 3QPXL 1M7DB 4B41A 1JMZA 1G9NL 1HI6B 5HHVL 1AR1D 1ED3B 3NCEB 3TA3D 1G7LA 4OB5H 1AXIB 3GSNA 3WXWH 4NRYA 4EUPG 5CEYB 5HJ3A 5I66B 3WLWC 4FQXA 3H9YA 2VQTA 2BY1A 3FT2B 1RZIB 3MLTA 1LGVA 3OKYA 4JAMB 2E9WA 4UQ2A 5MEQB 3QT2A 2AK1H 2Z8WC 3RTQD 2APTA 3VGDA 1P4IH 3VRLE 4JREC 1RZ7L 3HC3L 5ETUA 2NY3B 3OJDA 3C5ZD 3HMWL 1BX2A 1UJ3C 2AKRB 1B4JL 4NQSA 1T1XB 3HB3C 3MMEA 1OARL 3PGFH 4OSUH 2C3WA 5JDJA 4GQPH 5KSAC 2UY6A 4NO2A 3ARPA 3TN0D 1IT9L 1HHHA 3IKCA 3VD7A 1DFBH 2R2HA 4XBEL 1AJ7H 3MUGA 5EZOL 2EDFA 3DRTA 2DQIH 2DQHH 4UZGA 3SKJH 4MNQB 4JFFA 3BIKB 4ZPTB 1PAMA 5HYQA 1V5JA 3D0LA 5E00A 4JKWA 5IJKA 1U8NB 2FECL 1HEZA 1JNJA 3RUGE 2J1KA 5JA9A 4GKSA 1BQUA 3W2DL 4PTTA 4DW2H 1QYGH 5C0RH 1S7UB 1HQRB 1S7RB 4WWKC 3S88L 4LPUA 2IFGA 5L8KB 3T0WA 4YHZL 3EHBC 4LCWE 4XZUA 3QEHB 1H0DA 4ALAL 1K6QL 2CLZB 3FO1A 2NYYC 4M8QB 1LE9A 3KPRE 4RAUA 1IC1A 2BNQD 1P7QB 2YD3A 3BDBA 1OVZA 4CU7A 5AUMA 2ZPKL 3EFDH 2RFXB 1A7NL 4E42B 4DK3A 2HP4A 3PWJB 1EAPB 1PZ5A 4ONHB 1ZHBB 3EW3B 4MMZC 2HVKB 2WNGA 2J12B 1SQ2N 4G8GE 1J12A 3O6FB 3HI5L 3WCYA 1KYOJ 5CEZL 3IDGB 4OZGE 5DUPH 1EK3A 4OM1L 2CJUH 4MA8L 2NXYB 3DLQR 4P2RE 4MAYB 2VAJA 5HYSB 4M48H 2APFA 4TVPE 2AGJH 1G0YR 2BNRD 4NQEE 1A6ZA 4D0BB 1G7IB 4IS6B 4BFBD 1KF9B 1NCNA 4KUZL 2X2YA 4HPOL 2EDYA 4BZ1L 3E1F1 1N7ML 1ZT7A 2FEEL 4UQ3B 1AO7E 3ARGA 2VE6A 1FYTA 1NCAL 5CSZA 4OZ4A 1IGIL 2NY0B 3MRGB 5DJCB 5BVPL 2WBJD 1PVHA 4RWHA 3S34H 4WO4B 1LDPH 4R0LC 2VISB 1J9CT 4YHML 1E0OB 3HZVA 4J3UA 3S8WA 2OTUB 1TVBA 4KJQC 5C07A 3ZDYF 1CLCA 3WDIA 1VCAA 3CUPA 2W9EL 1F4WH 3KS0J 1MCPH 4WENB 2VKWA 3QDGE 4AMKL 3OX8B 1DBJL 5I1IH 3QUYA 4X5WA 2QQNL 1MCKA 2HKFL 4DEPC 3D18A 3GMRA 4MD4B 1ZLVH 1EEYB 1ROWA 3QO1B 3PL6A 2AS5M 3NN8B 3GK8L 1J0KA 1YN7A 3RIAF 1GOFA 5GS0H 4KPHL 5IBLC 4FS0A 2IQ9L 2D31A 4DN3H 6FABL 4YHYB 4KTYA 3V4PL 5EOCH 2I07A 3ULUC 3BPLC 2C3HA 3INUH 4UB0H 2YPKA 4KZDL 4XVUC 1U0QA 5KSBA 2J8UE 1A7RL 5IVNA 4LVNB 2NX5D 4FQ1H 3NZHL 5HHXH 4YDIH 4NWUH 4R7DB 2ZNXA 4QNPF 1D6VH 1K9TA 3AXLA 5I1LB 4CNIA 4XWGH 1FC1A 3FONB 3BUYB 4F3FA 4H0IA 3VH8B 3MR9A 4M5YH 3R1GH 3O2DH 3VGBA 4X4XA 1UYWH 3BN3B 1MI5E 3W11D 3TNMB 3O6KL 2LFGA 5ICZA 2MQ0A 1KIPA 3OG4B 3S7GA 4PJ9C 3U4AA 4LRIC 5C0AA 2LQRA 3MYJA 4LU5L 4U0QB 4WW2C 1K2DA 4JRYA 1XIWA 4OI9A 5ACZA 2HH0L 5IJVB 2M1KA 4F2MA 4LLWB 1RK1A 1HHGA 4XVJL 5HHOB 4X7DC 1EFQA 5I1EH 4U1IB 1U2CA 3SE9H 1F97A 3V4VL 3QUKB 2GK2A 1DANU 1HK6A 3CD4A 4GXVL 1NFIB 4ELME 4X7FC 3C5JA 3GO1L 2G75A 1JNLL 5ADOL 4OZHF 3HC4H 5HHNA 3S97C 2H32B 2E7CA 2IPKB 5E2TH 5MEPB 3OSKA 2MFNA 3FQRA 5KAQF 5EIIA 4HV8A 3T4YA 3TZVB 1NDMA 4LF3B 4XB8A 2Y7QA 5CUSH 3CMOL 3WHXA 5F7LB 4O2CB 3GMQB 4M6OH 1AH1A 2W60A 2XY1A 5DSCA 4E5XA 4ODHL 1JGEA 1NL0H 4KZEH 2H32H 1HSBB 2VIRB 5E94A 4U6YB 3FCTB 4F15B 4S2SB 3BKYL 1RIVL 3DO7B 4L9LA 3WUWA 4YLQT 1A4JA 2YMXL 4PRBB 4LVHC 3BKML 3L3IB 1C16A 1NEZB 3QIWB 3G6JB 4WV1A 5A2KH 3F7RA 1OTSC 5K9OA 1UXSB 5KS9B 2GJ6A 3N06B 1RZ8B 3MV9D 1YJDL 3UO1L 3FFCE 5GS1A 2IQAA 4GRWB 4ENEC 3KXFD 1H3XA 2VXVL 4X80L 4ZD3H 5F7HA 5JPNB 4OZIB 4OCXL 3LPGA 5FGBA 5AD0B 4JFPB 1VPOH 2BXZA 3OJVC 3EKCA 4OZFH 1QBMH 1IGCH 2VUYA 4R97B 1P1ZA 1X3DA 5K9QI 3BP7A 4LKCA 5E1AA 4HLJA 1R3JB 4LGPB 1KCRH 4GRWH 4WI6A 4TSAL 4WU7B 2VABA 4Y5YB 3NPSC 3MV8B 4J4PA 5IFJA 4YXHH 5EORH 1Q9OA 3I75A 4ODUA 5DHYA 4FQQA 4JCLA 3UYPA 1TVHA 2ZZUT 4I0PC 2EYTB 5I8KL 2JF1A 3LRSA 4ZG1A 1PEWA 3VCLA 2F54A 2ZKHH 2EYRB 4TUJB 3BP6B 1UH2A 4HEME 4PG2C 3GSRB 1GGTA 5F1NB 3MBXH 3C09B 4XB7A 3RZCA 3ZKSD 1YA5A 4X0KA 1N2RB 4KQ4H 2BC4B 3HUJA 1OAYL 2L7JA 1HXYB 3T2PA 1SHMA 1UKQA 1UXWB 4JGJA 1FC2D 3EYUL 1J87A 1H15B 3PQYD 3SDXB 4DVBB 1AP2B 1XR8B 4IMKA 2D3VA 2VC2H 3T2NH 3BEVB 3HG1E 4AH2A 1DL7H 3HNSL 3BI9X 3O9WD 1BECA 2GI7A 4L3CB 4QY8B 5DUML 1ZVYA 2BFVL 2V17H 3KDMB 2FBJL 4EI6A 4GMSL 4DTGH 3VGGA 2PKDA 2FNBA 1J1XH 5HPMA 1O0VA 3EJYC 1U3HA 2EH7H 5D7KE 3MNVA 1RUMH 1YC8A 1QSFD 4YJZL 5EIVA 1XF1A 4QCIA 1YECH 4UBDD 4NDMA 3SCMC 1F4HA 1U91B 4ZQKA 4I5BB 3X12B 2ZOLA 3L3OB 4OCWH 2XWTB 2XWBA 2XWJB 4LCCB 3DIFA 4HHAB 3K3QA 4UI2A 5T3ZE 5EIQA 2EZ0D 4WY7L 4Q9RH 4I48A 4PRAA 2E8YA 1G0XA 1QEWA 1CU4L 4MWFB 4NN6B 4QHMB 1SEBA 3IVKB 5A2IH 3V52H 5C9KA 1Y18B 4PS4H 3UBXG 3HC0A 4NQDD 1WISA 2F5AH 1WT5A 1S7VB 3V2AR 2WUBL 1GGBL 5I1CH 3VJ6B 1EHLL 4M9OA 3GB7A 2C1OA 1TJHH 4LHQB 2X4NB 4M02A 3RDTA 4KROD 3RWIA 2DQUH 1HH9A 3UZVB 2YPLA 2X1PA 1KIUA 4YIQB 1TXKA 1JMXA 3RL1A 1JPFB 2ZUSA 4LLUB 5F9OL 1JGVH 3T0EC 4XCEB 2N7AA 3I02B 1FP5A 2Q76A 3SE3A 1BFVH 2J5LC 5C0ND 3IXAA 4JY4A 4U1NB 2BOCA 3B9AA 1U3ZA 4XC1L 2M8XA 1MCCA 1MSPA 3V4UH 4U1KB 3QDJE 4HGMA 5D1XA 1KJ3H 1IEAB 3LVEA 4IIQC 4MJIB 3FQTA 5E8OB 1WZKA 3WFEH 4MJ6B 1V3KA 2E7MA 1AXTH 1YN6A 4W81A 3O6MH 2C1PA 2X7LA 1AXSB 4HIHA 5GGVY 3LEXB 5JORB 4LSUL 5HDQH 4J8RA 2H6PB 2RGSA 3MLVL 1CBVL 1EBAA 2X4QB 1T04B 3H0TA 3L7EB 2K7QA 3HS0A 3OHXB 1YMHA 2O5YH 2OJEB 4MXVE 5FM5M 4I3SL 1G7LB 3GSNB 4G9FE 5GJSL 1VFAB 1A1MA 4LEXL 5TDNA 3RJDA 4L4VD 3IJSA 1R3LA 4FQXB 2VDML 3RIFF 1E4XI 5DUBA 3MLTB 4LEOA 3WFCH 3ZT6A 4IOFD 2AXJA 1VA9A 5FF6A 3GSNH 2I9TA 4OIIL 4PGJA 1RIHH 4TSCL 4JFOA 3MMEB 5J11B 1BD2A 4NZTH 4JFZL 4TQEL 3G6DL 1VEPA 5HI3C 2D9CA 3GEWB 3QEGL 4FQCL 2R2HB 1FZKA 3MUGB 3O3BA