4KJYA

Complex of high-affinity sirp alpha variant fd6 with cd47
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
ELLFNKTKSVEFTFGNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukocyte surface antigen CD47
publication title Engineered SIRP alpha variants as immunotherapeutic adjuvants to anticancer antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 25
structure length 114
sequence length 114
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-05-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kjyA00
3E6FA 1T7WA 1OLLA 5J1TC 5A2LH 4MB5A 1S8DA 2IFFH 3P9WB 5I17A 4PJEB 4ODSL 4HFUH 3ZKSD 4H1LG 1P84J 1F4YH 3AUVA 3QEHA 5J4MA 3HG1D 4U49A 3MRLA 2AJYL 1HOCA 1YEFL 1MFNA 2GK2A 2YD7A 3GSUB 3TT1L 3QUYA 4V1DD 3C6SA 2P24B 4P4KC 4WV1A 1NSNH 4YHPB 4WI7A 4NZTL 2XG5A 1CFNA 1PFCA 2X4TA 4CVXB 1KCUL 4G42A 3MV8A 4AEHL 3MRMB 4EDWH 4JGUA 3RI5F 3HI5H 4QXUL 4FXGA 5HGGS 3OSKA 4TPRH 1U9KA 2C4FU 3BPLC 3MV7B 4OGZA 1CI5A 4JRYD 4LLYB 4OLWL 3UDWA 1PYWB 2NR6C 1RUPH 3P0YH 5CSGA 4S2SA 3D18A 3GMLB 1MEXL 3HA0A 4BQ9A 1K6QL 4FN0A 1JNNL 4ZTOL 1C12B 3KLAA 4JFPA 4UIMA 3ISWA 4GRLB 1A22B 4MWFB 4DVBA 4NM4H 5J6GA 5CP7A 3CFDB 1I7RB 5FYJL 3WEXB 2O5YH 3G5XB 1UWEH 4E9LA 1F3DH 1WBXB 4LFHG 2FLBT 3ULUE 5IMMA 3CZJA 4M8QB 3OWEA 1T03L 5HGDA 3MLSH 3P40A 1DLFH 3SKJL 3SKNB 5DHVA 4OTXH 2BSRA 2ZCLL 4HFWB 3RWCA 2IAMC 3VGFA 4JY4B 4QOKA 3IDMA 5C0GB 5E08H 3F12A 5HI5C 5K93A 2X4SA 5J8OA 4H1LA 4K2UL 4QY8B 4M7ZC 2IPTL 4YLQT 4J6RH 1D9KA 1W72L 3UC0H 4OJFL 4FTVE 2C7UA 3LRHA 4LU5L 4M1CD 4JPVH 4OBSA 1PEZA 3GGWA 5EO1B 3C60C 2HFFB 5E2TH 1MRFL 3U0TB 2I9TB 1CD8A 2P5WD 4EUPG 1RJCA 3WXVL 4F57L 3KXFD 1RQ5A 3O4LA 4BFEA 2P46B 4XVUD 4G8EB 4MD4A 4XCYB 1H15B 4BKLA 5TF0A 3DO7A 3U4EA 1PX4A 2HFTA 2DWEB 4GAJL 2BK8A 3LEYL 4K55A 5L2KD 4WWID 3O6MH 3IS1X 4D9QD 4HUVA 1SYSB 1UJTA 5I1LA 4RMRA 5HY9B 3CSYB 4OSUL 1QG3A 4P4KB 1C8PA 4OCRL 4MXWL 1T1YA 1YEHH 4JKWA 2QR0A 3V5HA 4DCQA 1S78C 1U8LB 5C8JB 1ZVHA 3ZT5A 3VI3E 2JLLA 2BJMH 4FG6D 3PWNA 2EYTB 3B9DA 5BZDB 3BPLB 3OR6B 1N7ML 4U1MB 1PDKA 4AEIL 3CUPB 3SDCC 5ELIA 5ESQA 2CLRB 1SVZA 4ZS7H 4DTGL 3O2VH 5C07B 3VFSB 4JO3H 3RJDA 4RA3A 4YUEH 4GRWF 1UFUA 1YJDC 2AK4A 4GFTB 4XNQB 3NIGE 4GAGH 3MR9A 5JOPE 3W81A 3BDYH 5FECA 5C6TH 4NP4L 4QF1A 1A3LL 4IIQA 2GTZB 4C4KT 3UP1A 5JW4N 4M7LL 2HT2D 3U2SA 2GAZB 4YNYB 1KEGH 4I3SH 1IGTB 2XNAB 4OLXL 4EUPA 3DUUA 3K8KA 4XPBL 3SKMB 1SJVA 2J88H 3V0VA 2FHCA 2IAMB 4JQVC 3VW3L 5KSBE 3ZTNL 8FABB 1MCPL 1H3UA 3QUYD 3HZKA 1ZA6B 2I60L 4M7ZB 3KYMB 2GKIA 1PKQE 4WJ5A 3VFNA 2WLYA 2P8PB 3LQZB 5DJXA 5DEFA 1A7PL 3B83A 3MV8D 5D2NC 2CLZB 1A6AA 2P5EB 2DL9A 4AJ0A 4UB0L 1A02N 1J9CT 3C60B 1QEWA 3MRFA 3KHOA 1ZLSL 4KMTL 1UVQA 4OF7A 4M5ZL 4NZRL 2EE6A 3J8F7 1LE9A 4OZGA 1QNZL 3ARPA 1JNHA 3EAKA 2DQGL 1PEWA 5D9SB 4WEBL 1IC5H 4HULB 1T20B 2VDOH 4KTYA 1TVDA 5DMKA 3GSQA 1KTRL 4MB3A 3U7AA 5DC4B 1FG2B 3IFNL 5BVJB 3OKEB 4Z7QE 3Q48A 1IZJA 1INDL 2XTJE 3HNVL 4FXKB 3BJ91 3TYFB 3IB4A 5TPWH 1AI1L 5J1SC 3IU3B 1I8LC 5I0DA 4L29B 1G9MH 3P0VH 4QOKD 2P24A 1OAKL 1KXQE 2CGRL 3BUTA 3DXAE 5BXFB 5CJ5A 4R8WH 3ILQD 4MDJB 3ZTJH 4PRBB 4BH7B 3SDCB 2ZUUA 3MRMA 1D9KD 4YHML 2X4QA 2DQJH 4AEFA 4MVBD 5D71L 2Z93A 5TDPA 2NXZC 5DYOB 1FYHB 3O81A 4JDTH 3PIQB 1MJUL 3QXWA 1VGEH 1BQHG 1HINL 4LCCA 3BZEB 4LLYA 3HC0B 2X1PA 1BZQK 3NCBB 5EUOE 4LCUA 3Q6FB 3O4LD 3GMLA 1UCBH 5ABDE 1C12A 1IAIM 3FN0L 2X70A 4QCIB 4OFYA 4YWGL 1Q94A 4FA8A 3ME0A 2EYRB 2AK1H 1WZ1L 4UQ2A 5HGAA 4GRLA 5F71A 3TPUB 3P4MB 4MWFA 4GMTH 4OLYL 3ZKNC 1I7RA 3LY6A 4U31A 3QG7L 3G5XA 1H3XA 4M62H 3CFCH 1BFOB 5F6IC 1P6FA 4M8QA 1FAKT 3FL7A 2Q6WA 4GQ9L 1OLZA 4G9DA 1YY9D 1SJHA 3GBLA 4HFWA 5D2NB 1RUKL 3LRSB 5C0GA 5T3XL 1YEEH 4OGAD 1MIEH 3VXNA 4L3AA 3T0BA 2CIKB 2FEEL 4QY8A 4LFHD 3D3VE 2FEDD 5JHDE 1JIBA 2PW2B 3DECA 1YEKH 3JTTB 3PABA 3U7YL 1I1YB 1BGXL 1QLFA 4X9HA 3QXVA 1I9RH 5DQDH 4J4PC 2HFFA 2A6IB 2OR8A 3QISA 5C0AB 1WSST 4PG9B 1OP9A 2AK4D 2ZWLT 5J11C 3V8OA 1UENA 3GMRB 3U9UB 3NCFB 4G8EA 1OOAA 3TZVA 2W0KA 1DFBL 1BQHA 1H15A 3BIKB 4M43H 4ERSH 4MNQE 4LVOC 1E6JH 5BRZB 1MJJB 1BIHA 5KSUB 3BZFA 3W0WA 5KZCD 4U1KA 4ZXBA 1J1OH 5HY9A 3CSYA 5DR5H 3STLB 1XF3B 4HCRL 5I30H 3QZWB 1A1NB 1E6OL 2OJZH 4BFIA 4XC1L 2ZZUT 1A6UL 1U8LA 2XA8H 4LOUC 5GS3A 3WLWC 1WK0A 2XZCH 3VXQB 2EH7H 3BPNC 2NXZB 2KUTA 2AVGA 2EYTA 5IB2A 5BZDA 5J06A 1F45A 3OR6A 2FHFA 2Y23A 4U1MA 4FQ2H 2BNRE 2CH8A 2ZOKB 3PE9A 2QJDA 3ZE0F 1P84K 3U4BL 3RWEA 3VFMB 3VFSA 1K4CB 1EMTH 1OW0C 1JGUL 2BZDA 2QV2A 5CEZL 2YXMA 2BFVL 1NJ9B 5IBTH 1WC7B 3WJLC 3LRGA 3VFWB 3RKDC 1PLGL 3VXTB 2X9YA 4JFYB 5C0CA 5JXEC 3HRPA 4R0LC 2NCMA 5IROA 1YEGL 1V3JA 4YNYA 5DLML 1OWWA 3NVQA 5F6IB 4PJBB 1IGTA 2VKXA 5DRNA 5CD3A 3REWB 5FO9B 4MSWB 3OZ9H 4YBHA 8FABA 3K1KC 3GHEL 5CBEB 3WFCL 2OL3A 1CVSC 3KYMA 3SEPA 2Y1VA 1T2QH 2P8PA 5GGVH 1CE6A 1VPOH 2GFBB 2VUYA 3LQZA 4QT5B 1JYWA 4TUOB 2DD8H 1RZ7L 1VACB 2P5EA 4O58L 3BSZH 3SDYH 4K3JL 5F7EL 3IU4L 3V6OC 3C60A 4Y5YC 2F58H 3MOBH 4EKXA 1MJ8H 5J11B 2HRPH 1TJHL 1IMHC 4KI5E 3VFGH 2XWJB 4KTDH 4O5LH 4P2OC 4NCC1 3EJYD 4FQLH 4HX1B 1T0PB 5D9SA 2QSVA 4LVOB 3EYFB 3U79A 4OFYD 4UI2A 5IVXE 3V6ZB 2O5ZH 1JHKL 2DDQH 1VA9A 2H41A 3FONB 4HIEB 5IFAH 4M02A 2AXFA 2CR3A 4FRWA 1QLEL 1KGCE 3QUMH 1PQZB 3HTLX 3QO1A 1JCKA 4ZQKB 4MS8D 4PY7B 5AAMA 1Y6MR 2D0GA 3U9PH 1P7KA 5DD0L 3NBNA 3BPNB 3G5ZB 4K94L 1S5IL 4WEUD 4IRSC 2VXQL 1I85A 3OXSB 1F58L 5HHMD 4XX1E 2D7QA 4XPFL 3HAEH 3S35X 3TWCH 4BH7A 4PRBA 1R5WB 2YHGA 1EFQA 5JR1H 3QT2A 3ZYZA 5DVMA 4Q6IC 3KAAA 4HH9B 4PJIE 5DYOA 1YEJH 3PIQA 3VXOB 1MFDH 5FKPB 5JDJA 1OHQA 3GO1L 3C2SA 3BZEA 5GS2H 2OXGA 1L6ZA 3N06B 1F5WA 2WW8A 3BAEH 4Z8FL 1Z0NA 2A77H 1NFDB 25C8L 3OJ2C 3DARA 3Q6FA 3SCMC 4R0LB 3JSSA 3TZVD 4QCIA 3L5IA 3EO0A 3TV3L 1KIQB 1T5XB 3QZWG 2EYRA 4LIQE 2BSED 4MZ2A 3AXLB 1CLOH 3FAXA 1RK0A 3W0WD 1RUML 1CR9H 2AJSH 1DQLH 1IKFH 4ZXBD 2GI7A 1AXSB 3R06A 3ARFA 2K7QA 4OCYH 4M6MH 5E5MB 1X5GA 4QNPE 2R1YB 35C8L 3DVNB 4HHAB 4DFIA 3SDXF 5FKAA 4LLUA 3RVVC 5D2NA 3B9KC 5DJ2A 3LRSA 3NA9H 4AMKL 5IQ7L 3HE7C 4ZO6A 5SV3A 3TIEB 2ARJB 2CIKA 1SEQH 2M26A 3FCTB 4TVPD 4JKLA 4Y5YB 5GGUB 4NT6B 3JTTA 3BQUC 5EH1A 3IVKA 1I1YA 4ZFOL 3LVEA 4BK5A 1NBVL 1MLBB 1OAQL 2CRYA 2NR6D 2Z8VC 3GKWL 4Y5VC 3VD3A 4P2OB 4Q7DA 2AEQH 4F37K 1C5CH 3JUYA 2E6JA 2A6IA 5GJSH 2R56L 1WWWX 3O4OC 4OF8A 4ALAH 2UZYB 4LAQL 3VFOB 4ELME 5I8OL 3DYMA 3AVEA 1YN7A 3GMRA 4OD1L 2C1OA 1ADQA 4BSJA 1TZGL 1XGPA 3BIKA 4HGWB 2VZTA 5C0CD 4YC2C 5BRZA 1UCTA 1H0DA 3ZDYF 1HILB 3V5KA 5GRJL 5E8OB 4HF5L 3V2AR 1I8LA 3QDGE 4KKAC 4X6DE 4IRSB 4YO0B 8CGTA 1XF3A 5IG7B 3T1WA 3QZWA 1A1NA 3OX8A 5FYKE 1MRCL 3G9VA 4JDVB 5CKGA 3UTTE 1F90L 5J89A 4Z0BH 2NY5H 2FJHB 3MXWH 1S7UB 4Q6IB 4ZUUA 5JIKA 2Y5EA 1HI6B 4NQDB 1N6UA 4RQQB 3SDAC 4QKXB 3IFLL 2KPNA 2UV3A 3O0RL 4ZS6D 5TGBA 4YHNB 2ZCHH 3SCMB 1C08B 1LEIA 3ULVL 3L5JA 2NY6D 1K4CA 5LAXB 2FH6A 4RWYL 3SE8L 4OQTH 5D7IB 5I8KH 3RDTA 3LKQB 3QIWA 5GJTH 2X5PA 4X9GA 4JHAL 1NJ9A 1U58A 3RY5A 5AG9A 1WC7A 1UYWL 3VFWA 1MQKL 4PJCE 3VXTA 5F7WC 1G1CA 5TH2A 3TNMB 5BZWA 4NKQB 1CZ8H 1J18A 4DQOH 1D5IH 5M7QA 4F7EA 2P8LB 4WI2A 3VXRB 1DQQB 1QBLH 1NAML 5DUMH 5DMJB 1FGVL 5EBGA 3B9KB 4JN1L 3HE7B 3QEQE 4MSWA 1ZGLM 5SV4A 1X6LA 4CMHC 5I1IL 2WUBH 2X44D 4ODVH 4YDVA 3BQUB 1Q0XL 3F62A 4ZOBA 3T0DA 2GFBA 4N5ED 4P3CL 4QT5A 4XMLH 1ITCA 1JI1A 1VACA 4YFLI 4Y5VB 2GY5A 5I8CB 1KELL 5HSFA 3JWOC 4UINH 3MQIA 4PGEB 5JPNA 1A7OH 1YEIL 3KPLB 1RZKH 3O4OB 1LNUB 4L4VB 2BNQE 5E9DE 4K8RL 2YWYA 1V3LA 2ARJQ 1AGCB 3Q0HA 4YC2B 2V2XB 4HX1A 1GC1L 5EU7E 3WS3B 2Y06H 3GUTA 2DLGA 4U7MA 3QQ4B 1ZA3B 3NABL 2ADIB 2HFEB 3WNPA 3FONA 4HIEA 2ZP0T 3JV4B 4UILL 4LPYA 2YMXL 5BO1L 3X3GH 1KUMA 4XP9L 2FLRT 1PG7W 4AZ8A 3MV9B 3RGHA 4LRIC 2WIMA 4CN4A 3OPZH 1IKNA 3ARFD 2A6KA 2V17L 5KVGH 1FCCA 5GGQH 1L0XA 1RU9H 2PCPB 4FQQB 3GSNA 3G5ZA 3QQ3A 1U8NA 1ZWIA 4HWBA 4JY5H 4YAQB 4HW6A 1I7TB 1UEYA 5CILL 3TH4T 3KS0J 3SDAB 1XMWA 1R5WA 2QL1A 2BSSB 5IVZB 2O5XL 4HWZA 4FMFA 3PWPA 1TZIB 3T2NH 1KJ2H 4HH9A 3DSFL 1KSRA 4OLVL 3T0EA 4P99A 5FKPA 4QYOA 1JZ2A 3TVMD 3O6LL 3QCUH 4PJXB 2V2TB 2NY4C 1AD0B 1OARL 5KOMC 3WJLA 1NFDA 2EDBA 1D5XB 1QBBA 1CTNA 1GSMA 4DVRH 1MIML 5JXEA 3GSVA 1HKLH 4X80H 2UWEB 1MFEL 1CFQB 2LE9A 4NJAL 5IB4B 1CDBA 1RJZB 3KPOB 5FF6B 3MRIB 4LLQB 1S9XB 3ARUA 3AXLA 3H42L 43CAA 3B5GA 2Y36L 4OM0L 4JKPH 2E27H 4PV9B 4KRNA 3OB8A 3S35H 2WINB 5D7LB 4PJFE 2R1XB 5L7XL 1AXSA 4CMHB 4YDLC 3T3PE 5B3JF 4LNRA 5E5MA 2R1YA 3DVNA 4HHAA 4X5LA 2NYYD 4I5BB 4K3EL 3C8DA 3GHBH 3B5HA 4J8RB 4LCIL 5I2IB 1JWMB 1ACZA 1Z3GH 3BZ4A 5I16B 5HHVL 2EZ0D 3SN6N 5JO5A 3SKOB 2NXZD 2PR4H 1B0WA 2YUZA 5E95B 1WF5A 4AM0B 4XI5D 5GGUA 4NT6A 3BEWB 3H9HB 4LHUB 4G5ZL 1ZEAL 1ZOXA 5KTEL 2B1HH 3ULUL 2ZG2A 4D9LL 5B4MC 5GRZA 4J3OC 4PJ7F 3REVB 2C9AA 1U3HA 4XAKE 4HPOH 3RDTD 3QIWD 3UEZA 32C2B 5E8PA 5F9AC 3EBAA 1BX2B 4IOSD 1RZFL 5A2IH 4PY8I 2D9QB 5ILTL 2UVFA 3IRZA 4ODTH 1VSCA 4L1HA 1BP3B 3VD5A 3C5JA 4XAWH 4S10A 3O2DA 4NO3B 1TMCB 2B4CH 2IPUG 5JW3H 2DQHL 1KFAH 3L6FA 4LP4A 2Q7YB 1SBBA 4Q74A 5DA0B 4XNUH 3TESA 1HH6A 1IGYA 4IM8A 1T1WA 5IG7A 5H2BB 1CDJA 3CFIC 2VXSH 4PLNC 2EEDA 5F88B 1A9BB 1B90A 4F15C 2FJHA 3B2VL 3MFFB 5GRYA 4XVTH 3OKMA 2Y6SC 4JREC 3S34H 4HJJH 4NQDA 3GB7A 3VGAC 4X7TB 4RQQA 1JPST 3ZKXC 1FO0L 4R2GC 4PJAE 1DQDL 2NY4B 4KV5F 1A6VH 5HI4D 3MUJA 2WBKA 3QQNA 4IOFC 4H1LH 1G0YR 5D7IA 3LKQA 1XCTB 3GBNH 3HZYB 3HI1B 3HRZB 3N85H 3TEUA 4PB0L 4F37F 1I4FB 3TNMA 4OQ1A 5TDNA 2P7TB 1F4XH 5IB3A 3BH8B 3C08H 2VIRB 3WS6A 1MAML 1YQVH 5GSRB 4YDLB 1KIUA 2HMIC 1MH5A 4OI9A 1DQQA 2OLDA 3A6CL 5CLTA 2JJTC 1EH9A 1PSKH 1T66C 3MJ9L 5C9KA 4UTAL 3FJTA 4LOUD 3HE7A 4U4BA 3CC5B 1FZJA 2ZUSA 1EXUA 1IARB 1YMHB 4DZ8B 2YD2A 1DBKH 3B9VA 1XAUA 3BVNA 3BQUA 5FGCE 4MHHG 4W81A 4K23H 3T0AA 4HIJA 3ALWA 1P7QA 1QQDB 1SY6L 4Y5VA 4W6WB 3PWPD 2Y5TB 3SO5A 4JO1H 2VXUL 4PGEA 3T0ED 4TUJA 4IRZH 1KENH 2MPAH 3KPLA 2DQFB 1ZHNB 2VLRE 4Y19E 1LNUA 2ENYA 4YPJA 4YFEA 1DBJL 4I8DA 2CDEB 4H0HB 3O11B 2IGFL 5DUBA 1AGCA 4OZIB 3RKDD 5TE6H 3GBML 5FYKU 3UCRA 5JXED 5ENWA 1JMXA 1MPAH 4ZUSB 4BFGA 4GUPB 5HYQB 3WS3A 4DK6A 1A5FL 3UMTA 2W91A 5HDBF 1GAFL 5ALBL 1X5FA 5CINL 3QQ4A 4Z7OF 1CDIA 2ADIA 3MNVB 1CF8H 2W0FB 4P5KB 4X5WB 1QRNA 3DRQB 3JV4A 2Q76A 3CNKA 2X1OA 3MV9A 4WI4A 2YD8A 4S1QH 1VFAA 1DJSA 12E8H 1XGTB 1DUZB 4PREB 3QHZH 5GISH 3HC4H 4ZNEA 4F15B 1IAMA 2PCPA 1LEKB 2PTVA 4FQQA 2H2SC 4UTBH 4HC1A 4JREB 3O6KL 2R8SL 3VGAB 2F54B 4HBCL 3SDAA 3ZKXB 4EUPH 4R2GB 1OAYL 4JZJC 4QTHA 1YYLH 1TZIA 4NUJA 4JG1L 4N0UB 3WO3B 1CGYA 1MSPA 1U8OB 1GYAA 1R3HA 1U3HD 1Y0LB 5E2UH 3HN3A 2ZCKH 2V2TA 1AD0A 3D0LB 2X4RB 3SGJC 3UBXB 5IV2B 1RK1A 3LMJL 1CFQA 2EIBA 2IBZY 5FF6A 3MRIA 5LGHL 2E7HA 1CFTA 2AJXH 1S9XA 2AGJH 1J8HB 2EXYC 5TF1H 2VDLL 2W07A 3HI6L 5IHZB 2YK1H 4P2QB 4PFEA 3EYVB 4WY7L 2D03H 1KACB 3C09C 4OFKA 2WINA 3GJFK 4LVNC 4UDUB 4BJLA 2IQ9L 2GQHA 2FX9H 2VLKE 4M6OH 5F1NB 4GKSB 5HHXL 4Z6AT 2XT1B 2G2RA 3KLSA 1MFBL 3DURA 3MCKB 4NQDD 4UAOC 3BEWA 3H9HA 5GS0C 4JHWL 3GI9H 5MHSD 4NO0B 1FORL 1A14H 4CVWA 2VLJA 2FATL 1MRDL 5C0JB 1J0ZA 2A9ML 3LN4B 3PUCA 1J1XL 4K3DL 4FOMA 1DDHB 4RAHA 4JFOB 4OUUB 1OT2A 1RZJL 1BVZA 4XPGH 5DMYA 3CGTA 4X6BB 2YPKB 3RTQC 1ZSDB 1AQDB 5DMIH 5AYUL 5I15L 3WCYA 4NRZA 5JUEL 1NUFA 2XG4A 3T65A 4PRDB 4IJ3C 3GDBA 2VR5A 2H32H 3ZSTA 4XP6H 5DEGB 1OD9A 3H0TB 4TTGA 5IB1B 5SWZE 3AREC 4LQFH 5JQ6H 4ZODA 5HVHC 2PTTA 1YNKL 4M5YH 3CZFB 4XMKL 3U6RB 3HE7D 3FQNA 3N0PB 3WSQL 5H2BA 4QTIH 4OKVB 3P77B 1A1MB 2YZ8A 3LQAL 4JZJB 2DN7A 3BQUD 5F88A 4CU7A 5FK9B 3PWJB 1P7QD 3INUL 3ES6B 3QEGL 1QKZH 4XVJH 4B41A 1UZ8B 2QSCH 3LKOB 4X7TA 5KVEH 2NY2D 5D7JC 5CCKL 1LO0L 1TQCC 5ISZA 4V2BA 5HYSB 4G6FB 2EDOA 1M1SA 4HXAL 3DHJA 4HS6A 4KRPC 3EOBB 4K7PL 1XF2B 5CGMA 4XCNB 3LS5L 4OCWH 3UTQB 1RHFA 2DJSA 3OKNB 3UYOD 2HJKB 3LH2L 3HZVA 1IQWH 3KWWB 3FO9B 1R6VA 5JOEA 3C09B 3BH8A 1QRND 4MAYA 4LVNB 3FOMB 3C87A 2P43B 1V7MH 3NIDF 3MV9D 1HHIB 1BQLL 1AGBB 2YA0A 3OAYK 4MJIA 5JPMB 1K3IA 2MKWA 2OMNA 4OI8A 2XN9E 3UX9B 5JORB 4OZHB 3CC5A 5AUMB 4DZ8A 1MNUH 3S7GA 1H3PL 4NJ9L 4D3CL 2J8UF 4UAOB 5I9QC 3QNYB 3SDAD 3S98A 5C2BL 1YYMH 1EA9C 1QPPA 2XRAH 5KJRH 1XGRB 4O51A 4NN5C 3BP4A 1U36A 4PRHE 1DQJA 2E9WA 2HTLD 4X4MA 1IGFH 4NBZB 3L7FA 3RTQB 5FFLA 3O11A 4JAMB 2GK0B 3EYQC 4IRJC 3IDXH 4TVPH 4FQIH 5HD8C 1FL6B 3IXTA 3PL6C 4HMCA 3WDJA 3NACH 3K0WA 4GUPA 4IJ3B 1U41A 3FTGB 4MJ5A 3ETBF 5F7MC 2XY2A 3AREB 3MNVA 1INEL 1BHGA 2W0FA 4JPKH 4X5WA 5HVHB 3BE1H 3NTCL 1U42A 3LEVL 4M6NH 4FZEH 2RB8A 5D72L 2R39A 4HWEH 3O9WA 4TULL 1GGCL 1KN4L 4JPIB 5EORL 1DUZA 4PREA 4U6VH 1T80A 5ALCH 1H5BC 4UUJB 4PJ5A 4UQ3B 4XMPL 4LASL 3KYAA 4YIQA 2F54A 5D7JB 4WTZA 1MCRA 2QQQA 1TQCB 4K3GA 3GSXA 4WUUA 3VFVB 2VDQH 3RA7L 3HCVB 3MJ7B 4F9PA 1J88A 1WEJH 4KRPB 2PUQT 4UNVA 5CD5D 2YXFA 3DX9B 2VLJD 1MFAL 2VZSA 5EZLA 2OL3H 3I85A 5D1XC 1U8OA 4OD2A 2R0ZL 1Y0LA 2R0WH 1LK2B 3HR6A 3ELAT 1DEEB 3M8OL 2K1MA 2X4RA 2VWEC 2Z91A 5HYJE 5IV2A 1AQKL 1F6AB 4C56E 4PP1C 5JA9A 2RGSA 3MRBA 2JB6A 4M1DL 3VXMB 5EIQA 3ARRA 1G1YA 4PGBB 4X7EC 1KT2B 3HG1E 2BNUB 4KK9C 3L3KB 1JHLL 3HR5A 4XNXH 4P2QA 2JJTA 1M7DB 1OSZA 1MCEA 3WKML 1CU4H 5GHWL 4QXTB 4V1DE 1EDQA 3MLPA 3F6IA 4X4XA 4ZO9A 3T4AB 1KIRB 1F11B 2VQTA 1TJGL 1TVBB 5I9QB 2PO6C 3DYOA 5HYSG 4OGXH 2Z4QA 1HZHH 3CXHK 2ATKB 5TE7H 4KPHL 4NN5B 5KW9L 1RIUL 5ESVB 4LIQL 3MCKA 4G7YL 1A4KB 2CXKA 5EBWA 3QP3A 5C86A 4P5MB 1G7JB 3IJHA 3UZEA 5KAQF 5EULV 3UPRA 1U8IB 3RJQB 5ISZD 2NY4D 2ZKHL 5DWUL 3DX7B 5IEKB 4BK4A 4HWNA 4IRJB 1Q9KB 3G9AB 3DO3A 3PL6B 5MEQA 4OB5L 4OZFG 1BFVH 1MF2L 2X1XR 4JFOA 1JN6B 3EOTL 1CD0A 2VTFA 1ZSDA 1AQDA 2HKHH 4R4FH 1W72B 1NMAH 3BEVB 2OP4H 1NUGA 1MHCA 5E8NA 2DQCH 4EVNB 5BVPL 4MAYD 4YBQC 2IBGA 4ZUTA 2JIXB 1GOGA 3H0TA 3P73A 4S1DD 3UTZB 2DIJA 4MJID 1H5BB 3UJTL 4LEXH 5T1LB 1DLHA 1N4XL 5EBMB 3CZFA 5DFWH 3OKOA 5EIIA 1E4XL 3MCLL 4OKVA 4J12A 1A1MA 4LSPL 3WXVH 1MCCA 5A3ID 3PWJA 1NGQH 4TSCL 3R1GL 4ZPVB 4BQ6A 4HS8L 4WNQB 3LKOA 1F6FB 3HNSH 5D1XB 2DI8A 4BELD 4GKOA 5EBLB 1UXSA 3JWDC 5HYSA 4HXBL 5F3HB 1JGVL 5IK3A 4TQEH 1XF2A 5FYKL 1MI5B 4FQCL 1LO3L 1WJ3A 4ZO7A 4F8QA 3CSGA 2H9GB 5L2KE 2VDNH 5BW7A 2CQVA 4EBQH 3UTQA 1MAKA 4D9QE 1EHAA 3OKNA 3PJSA 2X4OB 3SKUD 3IAQA 2OYPA 4LPXA 1XF4A 2IFFL 3FO9A 1L6XA 3H7BB 4PJHE 2YPVH 1BD2B 4OZFA 3D6GA 4HFUL 4P48A 1F4YL 3FRUB 2OS7A 3ARDA 1HHIA 4NKMA 3O9WD 5JPMA 2PO6B 4D8PB 4JJ5B 3AMLA 2ED7A 1ADQH 1DN0A 1OF2B 4PJ5D 5AUMA 5B39B 2R23B 2BY1A 4QLRA 2Y6SD 5C09A 2F54D 4I48B 4EDWL 4G8IB 4WI6A 3MLXH 3HI5L 1U3YA 3KHQA 4OM1H 4WHCA 4WUUD 4WFGD 4ODUB 3ZDZE 1MUJB 4PPTA 3QIBC 4MQXC 4M7LH 4TPRL 4ZSOA 3BPCA 4X8JA 4E41E 4M7LT 1OP5K 1Y6NR 2G60H 2WUCH 3TNNB 1QVOA 5D93C 1R3KB 3AS3A 4LGPB 1RUPL 3P0YL 3RTQA 2HJFB 3FB8B 4JAMA 1A2YB 3N1QC 5EZOH 3GI8H 1MCPH 1QSEA 3BRFA 1FL6A 1FIGH 4H20H 4H5SB 3IF1B 5ICXB 2ZUVA 4XP5H 3FTGA 2H2PC 2J8HA 2Q20A 4NM4L 5F96H 3RNQA 3NN8B 1UWEL 4NQVB 3NFSL 4P2QD 4PBVC 2DJ4A 3AU1B 3LKSA 3RGVC 3QFDB 1RURH 5IHUL 2C4XA 3MLSL 4P46C 3QDHA 4JPIA 1DLFL 2DI7A 4OTXL 1S7QB 4LHQB 3N1GC 1JGEA 3MV8E 1IL1B 4UQ3A 4XGZB 2BHZA 1MCWW 1I7UB 2IBBA 5E08L 1PW3A 1HSAB 4KDWA 4RGND 2DQGH 4JFDB 1WTGT 3AY4C 1CD1B 2KQMA 2EDYA 5DDHB 4U1HA 3CFKA 4J6RL 1N3NB 2V7HA 3UC0L 3GK8H 2IALB 3VFVA 4F58H 1JVKA 3GSWB 5EUOF 5HDQH 3O3BB 4EN3A 4UT6H 1C16B 1D7FA 4JPVL 3MRRA 4LBEB 1UT9A 5E2TL 2I25N 2GHWB 5C2UB 2ATPB 4PJDB 2IADB 4G80B 1I8KB 1R3JB 2GTWA 1AI1H 2EO9A 1FFRA 1DEEA 4U05A 2GCYA 3T77A 3WJJC 1DE4B 4MHHI 1NC4B 2VH5H 2YUWA 4EDXB 5E8DH 4PGBA 2E3VA 4LPWA 3BW9B 3DMMC 1KT2A 2BNUA 3O6ML 3L3KA 1EO8L 1QBAA 4UNTA 4YZFF 2AXGA 2IBZX 3VRLE 4MA1C 5EFIB 3UTPD 4QOKE 5I1EH 3PXJA 2H2SD 5A16B 4GBXC 3VMNA 1YEHL 1KIRA 5I1KH 3WUZA 1A6PA 2GJJA 3K80A 5IP4A 3F5WA 3G6JB 4CN1A 2AI0H 2BJML 3WNNA 2MQ3A 4UV7L 4TRPH 1I1FA 1JZ7A 4GMSH 3EO9H 4X4ZA 3QIBB 3VFTA 1HXMA 1N0LA 4BM7A 5MEPB 3BH9B 4N0FA 1A4KA 1TETL 1WZ1H 1G7JA 4N0YH 5D93B 4I77H 4JN2B 2V7NB 1U8IA 3F7VA 1VEOA 3HE6C 2DRUA 4ZS7L 2F19H 3VWKC 3O4LE 3O2VL 5AZEH 3TJHD 2IQAB 3GSNH 4JO3L 5IEKA 3DX7A 1EEYB 4YUEL 4IRJA 4HWBH 2FYYB 3PL6A 2FJFB 4E42A 3C5SB 3MREB 3VXUA 4GAGL 4P2RE 4DN3H 3EYSH 4Y1AE 1KC5H 1KTLA 1JN6A 4RMUA 4I4WB 3BDYL 5MENE 5C6TL 4FFZH 3RZCC 2EXYD 4ODBD 3FO1A 2FR4B 4Q9RL 2ESVB 4EVNA 1NGZB 1LHZA 3RGVB 3EZ8A 1CN4A 2CRZA 1P7HL 1KEGL 4I3SL 1FL5B 4P46B 4PJGE 1NL0H 1UKSA 1UB5A 2AEWA 3BP7B 3UTZA 3ARDD 1X5XA 2J88L 2NTFB 3GNMH 2Z92A 5EOCH 5T1LA 3LKRB 5DJCB 3QDJA 4JFFA 5EBMA 4O2CB 1RPQA 5T1DH 1SMOA 5GGTA 1JYNA 3ARTA 3BPOC 2YUXA 3QFJB 3W5MA 5LGJB 1MVUB 3SDXA 4WEMB 5C09D 2RIKA 4Z78B 5ID1B 3MRQB 4UT9H 5GS0D 4CGTA 3WE6B 4GG6B 4ZPVA 4F80A 5JA8B 5KS9F 2VYRE 3D85B 1PY9A 3PQYA 5D1XA 2Q7NA 3HUJF 3TN0C 4WW1B 3W9DB 4O2FB 3DUHA 3MNZB 5CHNA 2ICEA 1U8KB 1JV5B 5DQ9A 3RTQD 1G7LB 4JCLA 4PJ7B 4X99B 1QO3B 2P8MA 3RWDB 4HAGA 1IC5L 1KIPB 4MJ6A 4P57B 1QSED 3DMMB 3G5VB 2H3NB 2VDOL 5BS0B 1CGWA 4M48H 4Z77A 3JV6B 1A21A 4NRXB 2X4OA 4R7NB 3BUYB 2PETA 4MA1B 3TIDB 1FN4B 4LARH 2HG5B 2VZOA 4GBXB 3C8KA 5SX5H 4Z7NF 2FL5B 4WW2F 3ZL4H 1AE6H 3LN5B 5TPWL 2DQTH 4D8PA 1G7PB 3V79C 5L2JB 3I02A 1G9ML 3P0VL 2ICWB 2DM7A 3OKLA 4A2LA 2W9LA 3O2DH 4R8WL 2AV7B 4KDVA 5DD3H 2GY7B 4I48A 3RWJB 3RPIB 1S9VB 4TNWK 2QHRH 3ARQA 4Z7UB 5JW4R 3HE6B 2DQJL 3VWKB 4JDTL 3GMQB 1HQRB 1VGEL 1KF9B 4U1JA 2BSTB 4LDLB 4JFEB 3RVXC 4EN3D 4EOWH 4ETYA 2PW1B 2H45A 1YMMB 3WFDH 2GUOB 3WN5C 1AGEA 3FB8A 3RZCB 5CIPA 3SE3C 1UCBL 5ITFB 4W6YB 4K71C 3WFCH 3DLQR 5EO0B 3OJDB 2AK1L 3PP3K 4GMTL 1FNFA 2MSPA 5F1IB 1AY1H 3NH7L 3JZ7A 3RVUD 3NCEB 3DROB 4NC2B 3D87B 3GSRB 4M62L 2ZJSL 3CFCL 1YPZB 3QQ9C 1H3TA 3BPOB 1M7XA 4I0PC 5D8JL 3FO0H 1IE5A 5K33A 1S7QA 4CDGC 1YEEL 3CJJA 4XGZA 5E6IC 1K4DB 5BV7C 4RMTA 4NQEE 3PGDB 1NPUA 5E00B 5EOQH 4JFDA 3O6FA 4K3HA 2CUMA 1YEKL 5DDHA 5EG6C 4HZLB 3TN0B 1JHKH 4RFEB 4KKCD 3W9EA 2IALA 3QCTH 3GSWA 1K9TA 1NCWH 2YD4A 3O3BA 5D5MF 3PWLB 4DWHA 1NQBA 1I9RL 5DQDL 3WHE0 4LBEA 4LPTA 1BVLB 4IRJD 2OTUB 2JCCF 4PJDA 3PL6D 5HPOA 2IADA 1GPOH 1I8KA 1ZT1A 3VXUD 2B2XH 5DO2C 2W65B 3ROOB 2YD5A 3NFNA 2FECI 1BF8A 1NC4A 4JM2C 4M43L 1S5IH 4ERSL 4EDXA 3WYRA 4N8VB 3AGVA 3VRIB 1WISA 4KQ3H 1E6JL 3EDEA 1U8MB 4XPFH 4BFBD 3WL9A 2QTEA 1BZ7A 1HQ4A 3LS4H 5FUCC 1AKJA 4GKZA 1EX0A 3P4NA 5KSAC 1J1OL 4HKJB 5IMOB 5DR5L 5I18H 3S3JA 3EDKA 3QDJD 4JFFD 5I30L 3QA3B 2NLJB 5HHME 2DQEH 2OJZL 5ANMB 5IQ9B 4HT1H 4MQTB 5ETUA 3S37X 2XA8L 3KDMB 2XZCL 1JTTA 1A6TA 1VADB 5I1CH 2QQNH 1KLGA 3QIBA 1HYSD 4FQ2L 3BH9A 4BQ8A 2BY0A 3RIAK 3H2WA 3PQYD 5D1XD 1DQMH 2CUIA 4JN2A 3WN5B 4HK3J 4JZNB 5HGBB 1EVUA 4UDTB 1RUMH 4HC1H 4M4RA 4MJ4A 1EEYA 1X5ZA 3G04B 4K71B 2FJFA 2JE8A 3MREA 2APFA 3LAFA 3TBVA 5IBTL 5IF0B 4I4WA 3W0WE 1TTGA 4JR9H 2BVPB 2FR4A 1NGZA 1WFTA 4MD5B 5E7BA 4NSKA 3RU8H 1KTDB 1Q72H 5DS8A 1ZXQA 4O4YH 1FL5A 4I0PB 4P46A 1NEUA 1NUDA 5HPMA 4XHQA 4JDZB 2NTFA 3JWNC 4G6JH 5F7DA 4K8RC 3P9MA 3LKRA 5E6IB 5BV7B 3OZ9L 4O2CA 4KK6C 2FDBP 3V9FA 1KG0A 4TVPE 4BQBA 4MNGA 1GC1C 4RBPH 5LGJA 1U92A 3IFOB 4FFVD 5GGVL 3RPKA 1EBAA 1VPOL 5I8OH 4M7JH 2LVCA 3MRQA 1N5AB 4LLMA 5ID1A 3BSZL 1RZGB 3SDYL 3WE6A 1DBBH 4OFIA 2AQ1A 4H0GA 1TZGH 3RVWC 3JBG7 2XPGB 4WIQA 3RUGB 4PJEF 5DK0A 1MHEA 1ERNA 2W9DH 5I1GH 2J5LC 3MOBL 3W9DA 1MJ8L 1ORQA 2HRPL 4K7FB 3MNZA 3VFGL 2YUVA 2HLAB 4KTDL 4HF5H 4O5LL 4PJCF 1U8KA 3WJJA 4PJ7A 5C0CE 4JM2B 4FQLL 5IFHH 4P57A 1P6AB 3C9NB 2O5ZL 3KPMB 4KC3B 1JPFB 2DDQL 4L8SA 3OHXA 1OTUD 1RZIB 2YR3A 3QHTC 4NGHH 5KSAB 4RMWA 3V0WH 1CDCA 3K2MC 3QUKA 1FN4A 3DPBA 1IILE 3KJ6H 2ARWA 4JCMA 3QUML 5FCSH 2HG5A 3EIFA 1M71B 2FL5A 3LN5A 3U9PL 5DD6B 3JUZA 2FBOJ 2DQIH 1JK8B 2E7LC 1OP3K 2UYLA 1XIWC 3QPXH 3SE8H 3TWCL 4JFDD 3O6FD 4AIOA 1ITBB 1S9VA 5JR1L 1NAMB 3HE6A 1FDLH 2XWBB 5D2LB 1AR2A 5F72S 3VWKA 1ZLWH 3EJZC 1YEJL 1HQRA 1MFDL 4JFEA 2P4AB 1CT8B 4N8VG 1WT5C 4G6AD 2PW1A 3MLTB 2ZUTA 1JF1A 4KUCF 2DLFL 5B38B 2GSGA 4UV4H 5GGRY 4EQ2A 4KJQD 3T4YA 1N5YL 1NDGB 4KKLD 2Y25A 2X10A 3P9LA 1R3LA 1TZHB 1NC4D 1JE6A 3QO0B 4IMLB 4G7VH 1CLOL 3BKYH 4P3CH 4W4NA 2BY2A 5E6YA 5IB5B 1P5UA 1CR9L 1AKJD 4CRPA 2AJSL 1I75A 1R24A 1IKFL 3GSRA 1KELH 5DJ6B 5CSBA 5IJVB 3ULUC 4KGJA 5F89B 1NFIB 4OCYL 4M6ML 1KEMH 5DC9B 3EZJB 1JPGA 3W39A 5T1MB 4CU6A 3NA9L 2V5YA 2QBWA 2PYEA 3A6BH 5MERB 4G8GB 2H8PB 3BJLA 1SEQL 1AP2B 3QIBD 5J56B 4MQXD 2QKIB 2J5LB 1DN2A 4X83A 3KPSD 4RFEA 4AY0A 4RZCB 4F7TA 2AEQL 2EKSA 1AO7A 1C5CL 3MMEA 4Z7VB 1JNJA 2GJZB 5EN2B 3QJHA 3KYOB 4TNWF 5GJSL 3IRPX 3QWOB 5JW4Q 4ALAL 1EGJA 3ZKMD 3DHMA 1V7NH 2H2PD 2X09A 1J11A 2W65A 5ADOH 1T7XA 1J0HA 4Q6YA 4NRYB 2X4PB 4N8VA 3C2AH 1I3GH 2XTLA 3H9YA 1U8MA 4Q9CA 2V9TA 3GMPB 3JVGC 5HJ3A 4Z76A 1AGDB 4P46D 4PLOB 4LSQH 1L4IA 4XT1C 2ITDA 3R4DA 4C59B 1UM4H 4HKJA 4GRWH 5IMOA 5E94B 1XIWB 3B8SA 3SGKC 1OWRM 2NLJA 3CFEA 3X12A 4Z0BL 4P4RB 4L4JA 5IT2H 3PNWA 2DIBA 4LEOB 3FQXB 4QHLA 3L1OH 2W38A 3L3HB 1ZT4A 2HTKD 4UBDD 2X2YA 4QHUA 4WENB 2R2HA 3H42H 3WN5A 3X13A 3MBEC 1AR1D 5F8QC 2ZCHL 4JZNA 1R3IH 5HGBA 4UDTA 2NY0D 3SE3A 2D0FA 5LBSH 4OQTL 3TBSA 3G04A 5I8KL 5GJTL 3WHXA 2IH1B 2C3VA 4HLJA 5D70H 4IS6A 4Z7WE 1MCOH 3FB5A 5EC1A 1CZ8L 4ONHB 4DQOL 1D5IL 2BVEA 3CMGA 2CD0A 1VESA 3S37H 2WQRA 5CBAB 2GSIB 1QBLL 4MA3B 2D3VA 5DUML 3IGAB 5K9OA 5GIRA 4JDZA 4CAGA 4HMDA 3DIFB 4AIZB 2BMKA 5E6IA 1LDPH 2J12B 5DJAA 7FABH 4JB9H 4D0BA 2WUBL 4PYHA 4JVUA 2FO1A 5DMGC 3IFOA 1H8OA 3MTRA 4XMLL 4PJAF 1N5AA 4FTVB 2VB5A 4FHBD 3HE6D 1ACYH 3VWKD 4UINL 1KPRB 1A7OL 3CMOH 3QSKB 1RZKL 4JFED 3T0VA 1CK0H 3MGOA 2X7LB 4NWUL 4ELKB 5I1AA 5C0BE 3H3BC 1HHGB 4JM2A 1OPGH 1FNGB 4GT7A 4N8CH 3CDGA 2Y06L 4TSBH 1YA5A 3C9NA 3KPMA 5IUSA 3EOYG 3TFKD 4PRIA 5ACMA 1FO0B 1RZIA 5C6PB 43C9B 1Q8MA 1HKFA 5F9WB 3X3GL 4PRNB 3MJGX 4JPWH 1F2QA 2XTJC 3AS1A 3OPZL 4MAUH 3RAJH 5KVGL 1NGWB 4A2MA 2H26A 4O2EB 1UWXH 2XKUA 4JFHD 3TO2A 1JK8A 5DSCA 3NCYS 5K59F 3FAWA 3DVGB 4JY5L 1PD6A 2PYED 4M61A 1OGAE 4XWOD 4GKNB 5LCVH 1FSKB 3MBEB 4YGVB 3T2NL 2XWBA 5EU4B 1KJ2L 3IFPA 2RCSH 4U2YA 3VDCA 1O0VA 4KHXH 2I24N 3MC0A 1AO7D 5KANG 3QCUL 4HBQA 5GRVK 3MOAH 3RY4A 3CDFA 2VAAB 5L9DH 3A6CH 1U95B 5K9JH 4DVRL 2ZSWB 1HKLL 1NDGA 1SYVB 4RX4A 2A9NH 3LEXA 2X1WL 3VDBA 1BOYA 1IQDB 3L3IB 3AFLA 4JKPL 3RP1A 2E27L 4KWUA 5IW6B 2EDXA 5KSBB 3X17A 3BX7C 4MDIA 4GSDH 1DL7H 1FC2D 3QNZB 2A83B 3F7PC 1PKQB 4APQA 1XGUB 5C3TA 5LXGL 2HA1A 3BP5B 3GHBL 1RZJC 1II4E 1Z3GL 1JTPA 1NCDL 4PIRF 2R15A 4F3FB 3PWPE 4HUXB 3FFDB 4G8GA 2PR4L 2H8PA 4LVEA 4OZFH 3T0EE 2J8UA 2A1WH 5DK3A 2QKIA 5E1HB 1QACA 1T6WA 3D39A 3WMSA 5FM5O 5HBBA 2J2ZA 1B2WH 5IVNA 5GGSY 4YHKH 4KY1H 4RZCA 2B1HL 4KROB 4H26B 4GRMA 1HHKB 1RSFA 2CKBA 5L8LB 2YZ1A 5BJTB 1CVRA 1B0RA 4HPOL 4ZTPL 5GS0H 1TTUA 2I27N 1O7SA 4ODTL 1GHFH 3LQAC 4XAWL 5CJBA 4NRYA 2X4PA 1JGDB 5FOBB 4IEFB 2XTJB 1MCHA 3GMPA 2B4CL 5JW3L 1E28B 2C1PB 1AGDA 1WVZA 1KFAL 2DLIA 4YXKH 2QEJA 5INDB 4U1NB 1SM3H 4XNUL 5E6ID 4JQXC 3IDJA 3DXAB 5IKCB 1YC8A 5KAQG 2VXSL 3MJ8B 4P4RA 3D25B 3T1FA 4M6AA 4XVTL 3S34L 3U48A 4HJJL 4PTUB 2AJUH 3L3HA 4WFHD 4FQ1H 4PJBF 5FYJU 5DJYA 5T33H 5JZ7D 4S0SD 4IMKA 5EUOB 5C3LD 1A6VL 1VFBB 3MRPB 4LKCB 3NCMA 1ZT7A 4LLVB 3BDXA 3CXDH 4NUGH 2HAZA 3GBNL 4PGCB 5IBLD 4QXWA 4G6KH 3N85L 3KYNB 5CEYA 5H94A 1UACH 3PDDA 1OTSC 5B3NA 1MJ7H 1T83A 4PRID 1F4XL 3C08L 3ZDXF 1YQVL 5DD5H 1A4JB 2GSIA 4OLEA 4WU5A 1PSKL 1BJ1J 1T4KB 3IDGA 3DIFA 1QHPA 1MRDH 3JTSB 4OD3H 1EERB 4OKDA 3CVHB 3S8WA 3GM0A 1NBQA 3RWIA 1DBKL 5HHOE 5GZOD 3D3VB 1BLNB 2VABB 5JHDB 3M45A 3DWTA 2ZUWA 4M93C 2G75A 4K23L 3OB0K 3WLBB 1E4WH 1ZANH 5E0QA 5AYUH 3KLHD 5E7FA 4GW4B 3C5ZA 1G9NC 4JO1L 4Y4HA 3DVIA 5DVKA 4IRZL 2MPAL 2X4NB 5JHLH 3NZHH 3IDIB 4KI5C 2X7LA 1HK6A 1TLKA 5TE6L 3RWFB 4XMKH 3RI5K 2G9HB 3TBWA 1MPAL 4MNQB 4RX4D 1YNTB 5M95B 4ODXB 3OGCB 1CF8L 4R3SB 3RIFF 1JPTL 1L7TH 5ACZA 4DKAA 1P53A 1ND0B 5J3HC 1FFPB 2CK2A 3L3DB 1GCFA 1L0QA 3SGKA 1P69B 4KK6D 4S1QL 1CLZH 12E8L 1LO0H 3ZZ1A 1H8SA 5GISL 3QHZL 4APQD 3CH1B 3HC4L 1U8PB 5B8CC 2Z31C 4R26H 5CZVH 3TT3H 5BMFH 4ZUWB 4KRMB 4FFYH 1NFDF 4NHUA 5I6XC 1F02I 1QTYT 1T22B 1P9MC 4UTBL 1X5AA 4BH8B 5A2KH 3DVGA 2AQ3A 4G8GD 4NQCE 1VGKB 2BNRB 2VN7A 1G7IB 4XVSL 1IRAY 3KGRA 3GJFA 4IDJH 3D39D 1YYLL 2N56A 4YGVA 5EU4A 5D7SH 5GGTH 2VC2H 5C0IA 4KK8C 5GZNC 5GS1A 2YD3A 3F65A 3MRJB 5E2UL 2ZCKL 3WFZA 1NLBH 5FGBA 4HGKC 1SYVA 3T04D 5C9JB 1QRNE 1LO5A 2J6EA 3KR3H 5DRZB 5HDOA 3LKNB 4HG4J 2AJXL 4JO2H 1JTOA 2AGJL 5IEHB 1IQDA 3L3IA 3VFRA 2YK1L 4ZNEE 3VXPB 5MEOA 2D03L 4FQXD 1TQBC 4WWKC 1D6VH 1S7SB 4PLKD 2A83A 1PKQA 1XGUA 4M93B 2FX9L 5HYFA 3SQOH 3NIFE 5E24E 3PHOB 4C54A 5D6DC 5IM7B 1QFHA 3T3MF 1BWWA 5EZJB 4F3FA 3WUWB 5FV1L 2WWMD 5CZXD 2ZSVA 4GJTB 1ZGLB 3OBAA 2OR9H 2E9IA 4Y4FC 2EIZB 4HDIB 1KB9J 4L8DB 4L5FL 1A14L 3MRKB 4RRPG 4H26A 3G08B 1TCMA 1HHKA 1RJYB 3LEVH 5TE4L 3QJFB 5IVXB 1S9YA 4XPGL 5F3BB 4JZOB 4ODWA 3S88H 1EAJA 5DMIL 5F7FA 1EEZA 5CFHA 1T89A 3MODH 5FOBA 5FUOH 3TO4C 3STBA 3QXAB 1E28A 2C1PA 3NPZB 4LQFL 5JQ6L 5B8CB 2Z31B 3LPFA 5CIPH 4P3WA 1A6ZA 5I6XB 2CK0H 4M5YL 2OZ4A 4GG8A 4A6YA 1D5BB 4QTIL 5D1ZC 5IKCA 2NY7H 1T5WA 3O3AB 1EHLH 4W4OC 2Y07H 1W8NA 3U1SH 4F7MB 3EHBD 3D25A 1Y6KR 1AFVH 4PJIB 1QKZL 3L5WA 1NDMB 2VLJE 3L3JB 2QSCL 2PNDA 3C5ZD 4HK0A 3GRWA 5KVEL 4Y4HD 3FFCE 2VDML 2P44B 1NCCL 5EB9A 3MZTA 5EUOA 2EKJA 1VFBA 1LVEA 1N2RA 1EHNA 4KJPC 1CFSA 4LLVA 3THML 4OCWL 5L6YL 3ULVE 4PGCA 1ULVA 3MRCA 5F7UA 3ARBC 4CW1A 5DRXA 3V7AG 4POYA 3GSOA 4RRPA 4CVUA 1TQBB 1Y18B 2PXYC 1V7ML 1JNLL 4WWKB 3OJMB 5C70A 1A4JA 3QULB 3MRNB 4NYLB 1X5KA 1FVDB 1I9IH 4XCFH 1T4KA 1IAOB 5LWYH 3LV3B 4YHIA 4HKXB 3CVHA 2R2BB 3TP4A 3HZMB 1MNUL 2MCG1 2VABA 3QDMD 1MF2H 4Y4FB 1BBJB 2NZIA 3WIHA 5ISZE 4M4PA 2AKRB 1YYML 2EH8H 3WLBA 5BCAA 2XRAL 4GW4A 2B1AH 1CGUA 1A3RH 1IGMH 3DV6A 5BVPH 3ZHLA 1JUFB 3S5LG 5D1QC 5EOTB 4D94A 1IGFL 1IAKA 4ELMB 1K8IA 2APWA 4Z0XB 2RFXB 4HUWB 1UA6H 4L3CB 3MROB 3BOVA 3IDXL 4TVPL 5AZ2H 2HT4D 1EAPB 4FQIL 4G8FA 4MNQA 3NACL 4PJHF 5EU7C 2KKQA 4ODXA 3TO4B 2QADC 3H3PH 3O8XA 4U33A 1DVFC 5DJZB 1R5VB 4CADA 4BSWA 3VGHA 4JPKL 4MJIE 2FIKB 4YQXH 3BE1L 4M6NL 1ND0A 3QDGB 3L5HA 4FZEL 5TJWK 4X6DB 4WHTB 3L3DA 3QAZC 1IM9B 4ZPTB 4HWEL 3DI2B 1WCQA 4MJ2A 4LSSH 1AGFB 4OCNC 3UTTB 3CH1A 4U6VL 4PJXF 1U8PA 3C6LC 4S1SH 5FGSA 1T22A 5DI8B 3ZLQC 4YXHH 7CGTA 1FFOB 2DKMA 2UWEF 5DJDB 3B3IA 2IMMA 2YBRB 4PUBL 3O3DA 1CL7I 4L9LC 5I66A 5FO7B 1MREH 4XTRC 3D0VB 3DGCR 5CSZB 2VDQL 4YH6A 4PJ9B 4Z5RA 4QGYA 1AXIB 1WEJL 2FX8L 1QSFA 5KS9A 3MGAA 4GRWE 3HKFA 3OAUH 2OL3L 2WBWB 3HUJA 3SQBA 3ARBB 4NPYA 2R0WL 3T2QA 4PJCB 2QSQA 3ROLA 5SX4I 5C0RH 5C9JA 2PXYB 1LDSA 1LE5A 1VKXB 3S5LA 5JIIA 3F6LA 2LAGB 1UQSB 4LLWB 2D0HA 3HFMH 3LKNA 1KCVH 4L8BB 4XX1G 5ESAA 2XTJD 4PS4H 1IJ9A 3V0AC 4XNXL 3I6KB 1E4KA 1EBPA 4UZGA 1CU4L 2NXYD 3V4UH 4PJ5E 3QEQB 2AJ3B 1W0WA 4E0RB 4WW2A 1UADC 4C58B 3OXRA 1N6QH 4NOFA 3E8UH 1KJVB 5IM7A 4OGXL 4WUUE 5JOFA 1HZHL 1LK3H 4YHLH 5EZJA 5GGRB 5TE7L 5FDYA 3WIFB 4YE4H 2XY1A 3HPJB 3RZWA 5D1QB 3V52H 3QXDB 2A74A 1QFWL 4HDIA 2BNQB 4NBYB 1N0XH 5E9DB 4L8DA 1W0YT 2DQUH 2MFNA 4FQJH 1RHHB 3MRKA 5C08E 1BOGA 3NFSH 3MA7B 3G08A 4GH7B 1RJYA 2R2EA 1D5MA 1NGXA 4RMQA 5IHUH 5F1KC 5IOPB 5I73C 4CMMB 5JW4M 3L9RA 1BFVL 1X5LA 2QADB 2JK5B 4RNRB 1J0YA 3SE4C 1DVFB 1WCBA 2ADGA 4QRSA 5SWSD 1M4KA 5FXCH 5GRUH 5F3BA 4JZOA 2HKHL 4R4FL 1SJEB 4MLSA 3BHBA 5I1DB 2PF6A 1NMAL 2OP4L 2Z35A 2DQCL 3DRTA 3T09A 3QAZB 2APVA 3QXAA 2XQBH 1Z6JT 3L3OB 4Q0XH 1JHTA 2Z31A 4FZ8H 5KANI 3C6LB 4LEXL 1XCQB 2NNAA 3B4NA 1P9MA 1F00I 3GMNA 4RGNE 1KCKA 2PYFB 2EYSB 1D5BA 1Q1JH 3IKCB 4L9LB 3O3AA 1H3WM 2DI9A 3ZHDA 3R0NA 3FQRA 4NQSA 1NGQL 4PJIA 1MCFA 2HH0H 4RIRB 4X6FB 5H37G 3S9DB 2R1WA 3HNSL 4E5XB 4CBPA 4OV5B 1EO8H 4ODHL 5CEXB 3BFOA 5D5MA 4J1UA 1MVFA 3WIIH 1T21B 2IANA 1EJ6A 1T1ZB 4TQEL 1G9MC 2JCCA 2M1KA 3I2CH 4QRPE 4LDEB 3W11D 2VDNL 4EBQL 4MNQD 2HFGH 1KB5A 1FJ1A 3ARXA 3O8XD 4RAUB 4PJGF 2XKSA 3KPRA 1YC7A 5BOZG 3UTPE 2VDKH 4UV7H 2HVJB 1Y18A 1ZV5A 3QRGH 4NKIH 2YPVL 4PJFB 2ICWJ 5INCB 1EJOH 4WWKA 5F1OB 3S36H 2E7BA 1YEDB 3N1MC 3QULA 3RX5A 1TETH 3MRNA 1EGJH 1FE8H 2CO7B 1XR9A 3SY0B 5D6DA 3NZ8B 2A0LC 4LKXB 1UGNA 3LV3A 1ADQL 1KPVB 4QRTB 4D2NA 4OZIF 4OCLC 2R2BA 4OZ4A 1IEAB 2ORBH 5IHLB 1LP9E 2I07B 1FYTA 5FA3B 4HMEA 1K2DB 3BD4A 4HLZG 1IFHH 4NCC2 3MLXL 1A47A 4OM1L 4HG4K 2OJEB 4X9BA 5J6HB 1ETZA 1OCWH 4Q9RH 2YC1A 3CCHB 1QSFD 5DGQA 3FQWA 1Z5LB 5I73B 2G60L 2WUCL 4ORGB 4WU7A 5EOTA 6CGTA 2DOCA 1UZ6F 3PHQB 2YPLE 5C0FB 5EZOL 3UZQA 2RFXA 4HUWA 3SGDI 4JLRB 3GI8L 3MROA 5LJYH 5IJKC 4MX7B 4H20L 1FIGL 5KN5B 4XP5L 3ZYOA 3KPPB 1DUYB 1R5VA 3U46B 5F96L 5DVOA 3TCXA 2FIKA 2YN3A 4IDLA 2CLVB 1KB9K 3BI9X 3MV11 2BP3A 1RURL 3SJVE 4ZPTA 5MI0C 5D1ZA 5F7NC 4U6HB 3CU7A 4JRXA 3UYPA 4W4OA 5C09E 3AC0A 1B4RA 3DSNA 1RZ8B 4X5XB 5IIEB 3DOSA 3VGEA 4Y2DC 1FFOA 5H35B 5J0BA 3ARZA 5DJDA 4ZSOE 5FO7A 3GMMB 4KTEH 5HXMA 4I2XE 4PJAB 2YRZA 3GK8L 5CSZA 5FAAA 4F58L 5HDQL 4UT6L 2K3TA 2DM2A 2CRMA 4PJEA 1QUNA 1QSEE 4YDKH 3EKCA 5CGYC 4CN6A 3ARBA 4DFHA 4N90E 2D4FA 4PJCA 3GSUA 2GIYA 2VH5L 5D96C 2PXYA 5E8DL 5C0EB 1LEGB 2AAVA 3SO3C 4YHPA 1IGIH 2P47B 4HS3B 3HLAB 1M7IB 1UQSA 4LLWA 1F4WH 4CVXA 1KGCD 3PP4L 1NKRA 3D69B 5EU3B 3IXAB 1ZK9A 2Z31D 1JP5A 3MV01 5I1EL 2AJ3A 4HPYH 4YDIH 3SDDC 3MV7A 4XXDB 4E0RA 4NC1E 1IGJB 5I1KL 2IG2H 5FGCB 5L88H 1PYWA 4JY6B 1G0XA 2AI0L 4WFEE 1OAXH 4TRPL 4GMSL 3EO9L 4LPUA 3MLWL 4M3KB 2XWTB 5D1QA 2VLRB 4N0YL 4Y19B 3QXDA 3V4VH 5GZND 4I77L 1JGLH 2J4WH 3UAJC 5E9DA 3CFDA 3SE9H 3KJ4C 1CL7H 5IWLC 3NH7H 3PWUB 3RRQA 2F19L 3WEXA 1VEPA 2R9HC 5AZEL 3GSNL 3RL2B 3P4OB 3MA7A 4GW1B 2ZJSH 5CWSB 4N0RA 2IAND 1WBXA 4J3SA 4HWBL 4ZNCD 1X7QB 4CMMA 4DN3L 3EYSL 1KC5L 5D8JH 3TBTB 1DVFA 3SKNA 2FZ3B 3PHSA 4LK4A 4R4ND 2OK0H 4X7FC 4FFZL 1SJEA 4ZFGH 5FM4A 5I1DA 4JY4A 2HLFD 3KPRD 2DMCA 4Y7MA 4IOIB 5MI0B 5SX4H 4WWKD 4LMQI 3I3DA 2E7MA 3VI4F 1NL0L 3Q1SL 5A43C 2J3SA 3BWAB 4EZMA 3L3OA 3GNML 1RVFH 4XP1H 5EOCL 4LSTH 1OT1A 4QHKJ 4Y2DB 3OG4B 5T1DL 4C55A 5EO1A 2PYFA 3TH2T 2EYSA 3DJ9A 2EDLA 4L9LA 1I3VA 1VHPA 3U0TA 1FYTD 2I9TA 1UM6H 4XXCC 4UT9L 1CLYH 3CAFA 4XCYA 1FBIH 4RIRA 2L7UA 5E2VL 5JW5B 2ILLA 1FC1A 2MQ0A 2DWEA 4E5XA 1CFBA 1UM5H 3RWGB 3VXUE 5D6CB 1NBZB 1SYSA 2W9EH 2XFXB 5K9KB 4FMKA 4OCXH 3O2WL 5D96B 4OZHF 4P4KA 3SO3B 4BZ1H 5MP6L 5E8EB 4M48L 5FV2A 3H6JA 5C8JA 5EUKB 3CLEH 2OM5A 4HJ0C 2CKBH 3QDJE 4JFFE 5INCA 4LARL 2ZPKH 3VWJC 3SDDB 2E7CA 2BVTA 3ZL4L 1FZOB 1AE6L 1N8ZB 2DQTL 3CUPA 5D1ZD 1CDHA 3SDXE 1LO4L 1G84A 4JRXD 4DAGL 4OF3A 2VLKB 4PLJC 2CLRA 1OM3H 3NZ8A 4FFWC 4AIXA 5C07A 4R9HA 1C7SA 5E70A 1NLDH 5T1KB 2UZXB 3O2DL 4L4TE 3ALXA 5CUSH 4XNQA 1G7MB 5DD3L 3PQYE 1NUNB 3KG5A 2QHRL 1JI2A 4FQPA 2A38A 3KJ4B 1KJMB 4URTB 2GTZA 3MO1B 5J6HA 2IMNA 4EOWL 2GAZA 1FAIH 1Z5LA 2XNAA 3BZDA 1SBSH 4ORGA 3QUZC 3SE4A 2WLZA 1S9WB 3SKMA 4PRAB 5EU5B 3WFDL 3I84A 3ARBD 5BQ7B 2IAMA 5C0FA 4MLIA 1FLRH 1TPXC 1QP1A 4PG2C 1W8OA 4JLRA 5I76B 1W2KT 1ZA6A 2PXYD 4WTXA 1I8MB 2HT3C 1FNHA 4LRNH 3NOIA 3KPPA 4TNVK 1DUYA 3OAZK 3ZDYE 3FB6B 3UJJH 5SWZB 3U46A 2ERJC 1AY1L 3NFPB 3HNTH 2CLZA 3WKNA 5E4EC 1FZMB 2BOBB 1RIVL 2SEBB 3FO0L 3MV7D 2R69H 3FN3A 1FHGA 4XBGB 1U8JB 3GJEB 4NNPH 3BGFC 3RQ3A 4X5XA 2FJGB 1AJ7H 1I1AC 5H35A 5EOQL 1YN6B 4KZDH 2GJ6E 2VMFA 4KDTC 3QUMB 4DEPC 3I3EA 4RAVB 1T20A 1AHWC 3GMMA 3HS0B 3FOLB 5D1QD 4PJAA 2BVOB 4JGJA 3LB6C 2VAJA 2VQUA 4NQUA 1OAUH 4GRLD 3AAZB 3QCTL 1NCWL 1FG2A 5E9DD 4PBXA 5BVJA 1LD9B 3OKEA 4HJGB 3MZGB 5DT1H 1NMBH 2JJSC 4FXKA 5I1HH 1GPOL 3TYFA 4RMSA 4KUCD 3HAEB 1Q9LB 2B2XL 2AJZB 4PB9L 4X7SH 1DVFD 2MCPH 4Y16C 3IU3A 1HSBB 4QHMB 2NY5C 4L29A 5FA4B 3CVIH 2R4SH 1J12A 4X6CE 4HS3A 4KQ3L 3VWJB 5BXFA 2B0SH 5E56A 3SGDH 4NQXB 2Q3AA 4MDJA 5EU3A 3SDCA 3LS4L 3IXAA 4XBPB 5KVMC 1U91B 1T3FB 1KLUB 2XN9B 4LLDB 5I18L 1AXTH 5HDLA 4XXDA 3FN9A 2DQEL 2CDFB 4HT1L 3O41B 3HC0A 2DLFH 4JY6A 5DK2B 3TCLB 4PGJA 1N5YH 5A2FA 5I1CL 1T2JA 1CICB 2OI9C 2QQNL 2Y7QB 1E27B 1JRHI 3EFDL 4PRHB 4WTWA 3QUZB 2Z8SA 4Y5XC 3TPUA 3P4MA 1DQML 1ONQB 3LSOB 1AD9B 2XIDA 4JQVA 4KMLB 4D9RD 4HC1L 1TPXB 4GW1A 5CWSA 3U36B 1BFOA 1OGTB 5IJKA 5CJXC 2BC4B 4XP4H 1X7QA 2DTSA 4P4KD 5LGKA 1PKOA 2G5RA 2FZ3A 2WM0A 3GJFH 1BM3H 2ERJB 2XKNB 3VFUB 4ZD3H 4JR9L 2E6PA 1M6OB 3QUXB 3STZB 3UZVB 5E4EB 1AIFB 1CQKA 2VDRL 1J1PH 3RU8L 1Q72L 1GGTA 4O4YL 2PW2A 3FMGH 5GSVB 1BQUA 3VFPB 3BWAA 4G6JL 3BGFB 1KXTB 4Y2DA 1I1AB 1G7QB 2J6EH 5C07D 2DWDB 3B9EA 5C0AA 3ULSB 3FO2B 4PG9A 4DEPB 1AHWB 3M1BB 2ITCB 3KPSE 4GW5B 4M7JL 5SWQB 2BXYA 3CSBA 4M1CC 3U9UA 3CDCA 4NZJA 4RFNC 1DBBL 3EUUA 4WFFE 2UZIH 5JW5A 4WI5A 4P9HH 4LCYB 5ECJE 2W9DL 5I1GL 4LPCA 1MJJA 2VN4A 3BDBA 1YUHB 4WVRA 1ZLUK 5KSUA 2CIIB 3S3SA 4GAYB 4DGYH 5D6CA 1NBZA 3FT2B 4Y16B 3OR7B 5E03A 4YXLH 2XFXA 4D0CB 5HYJB 1GZQB 4C56B 2IAMD 4Z7WF 5KVFH 1J0KA 3L5XH 5KSVB 3STLA 1IGCL 1QLRB 5IFHL 3UTSE 5HI5D 3RBGA 3CPLB 4YDJB 3HG1B 4RFOH 3I6GB 4U3CA 1Z9MA 5HHPB 4NGHL 3V0WL 1Q9OB 2B7DT 4JANB 3VXQA 2R29H 2P5ED 3KJ6L 4V1DB 4ZFZB 3X3FH 1J0JA 1HHHB 5B3JE 5LKNA 3C60D 1U93B 2C3XA 1HH9B 4MNGE 1QA9B 2Z8WC 2ZOKA 3QDAA 3N9GH 2DQIL 4FG6C 4X9FA 3MLZH 3VFMA 3Q6GH 3QPXL 2OI9B 2NY1C 5IESH 2LABA 1T04B 1G7MA 4BSVB 1IEHA 4NQTA 4Y5XB 2MHAB 3FT4B 3WFEH 1JWUB 3RNKB 2XZZA 3E1F1 1FDLL 2FO4B 4KUZH 1C5BH 4JFYA 1REIA 4KJYB 1XR8B 2OZ4H 4OCMC 3MO1A 4X6EB 1FNLA 5EC2B 3WNKA 2VITB 3H9SE 4A6YH 1JYVA 4PJBA 4X98B 2DLEA 1KJ3H 3EDDA 3KPNB 2GITB 4UV4L 1S78D 3REWA 1T0NB 5FO9A 5CBEA 2HT2C 3OAYH 4O02H 3MUGB 4I0KA 3WO4C 4G7VL 3FB6A 3BKJH 4RWHA 3BKYL 5SWZA 1P1ZB 2O61B 4U1LB 4TUOA 3SDCD 4KKNA 4XCCH 1SEBB 1WICA 3QUYC 4J4PA 4PR5B 1FZMA 4WV1C 2BOBA 1KEML 2SEBA 5CJOL 2BRRH 3K8LA 4FABH 4PJDF 4M03A 1CXIA 3EW3B 4XXCA 4AG4H 2XWJA 4I1NB 4I3RH 4NWUH 4RFNB 4MNHB 3A6BL 2A6JB 4HIIB 2YEZB 3EYFA 3MNWB 2W0PA 3UTOA 3ZE2F 3QYCA 2WP3O 3V6ZA 2MWCA 3FOLA 5CZKA 2BVOA 3BP6B 2B4CC 3LKPB 3UDWC 3AAZA 4KV5E 4TSAH 3CVHH 1CGTA 1PQZA 1ZHLB 5HHNB 5DZLA 3WFHB 5L2KB 4ZQKA 3IAGC 2YSSB 4NNYB 4PY7A 1IEBB 3OMZA 3HPLB 1Q9LA 1M05B 1V7NL 1CGVA 3WIHH 2AJZA 4M8VA 3U0WH 3VXSE 3G6JF 4U7KA 1HSBA 4QHMA 5ADOL 3QNXB 1KJ2B 2F53E 4BUHA 4PJHB 4TVSa 3C2AL 3OXSA 5IVOA 3IJYB 3QEUB 1I3GL 2N7BA 1CQYA 4NQXA 3KVQA 5IMLB 4LSQL 1U91A 4B50A 1PZUB 3G5YB 4JFHE 1T3FA 1UM4L 1F8TH 4I9WD 2H6PB 2ADJB 4OT1H 3VXOA 4TNVF 2CSPA 2NW3B 2PYEE 1OW0A 2NY1B 4Y2DD 1ZVSB 2CDFA 3ARSA 3ILQC 4YJZL 2Z8RA 5C0AD 2CJUH 2D31B 5DK2A 3R0MA 4MVBC 1LWRA 4R0LA 1MHPL 5IT2L 5JDSB 4KU1A 2K7PA 3L1OL 1KIQA 5F6HJ 1T5XA 4PRHA 4E41B 1ZS8B 4ZOAA 1IC7H 4I3GA 4XRCB 3E6FB 3QUZA 5BRZD 5CGYD 4YHZH 1ONQA 1R5IB 2FX7H 1R3IL 1AD9A 2AABH 4J3VA 1QZ1A 1DANT 1IC4H 4PG2A 1S8DB 2ED9A 5LBSL 4NIKB 2BC4A 3D2UB 4Y89A 3WO4B 5LXGH 3N50A 3QEHB 4Z7OE 5F9DC 5D70L 1MCOL 3MRLB 1EZVY 1HOCB 1NCDH 5J9PB 3STZA 3WD5H 4K9EH 1L9MA 4GG6F 3TIEA 3QUYB 2EDQA 2ARJA 4U1SB 3V6OA 3S37L 4WV1B 2FECL 3FCTA 4Y5YA 6FABH 1CFNB 1Z9LA 2OQJB 1NCBH 4ENEC 1GGUA 1YY9C 4G42B 2BVQB 3VFPA 3MV8B 4U6XB 2EDKA 4YK4C 1MLBA 1G6RB 4R7DB 1LDPL 4OGAC 4P2OA 1I1AA 4L3EE 5F21B 7FABL 1G7QA 3UROR 4R97C 4JB9L 2DWDA 1ZVYA 3B9AA 3ULSA 3FO2A 4ZTPH 1HXYB 2H1PH 1AHWA 4N1EA 2ITCA 3VFOA 5A2JH 1HCVA 3LIZH 3I6LD 3ZT6A 4PRPE 3UAJD 3ZKND 4S2SB 1ACYL 3ECBB 4HGWA 4Y0GA 3SPVB 1PG7H 2XI9A 3P4LA 4L1DA 3CMOL 4NZDA 4JFPB 1YUHA 4HGMA 1CK0L 4UIMB 1HILA 1JRHH 4GAYA 4LCWE 3VA6A 3FT2A 4Y16A 4DVBB 3MLRH 5E8OA 5J6GB 5CP7B 5HYJA 1GZQA 3HMWH 4C56A 5CMAB 1FH5H 1G9NH 1OPGL 4IRSA 4IIQC 1U0QA 4LSRH 1I1CA 1QLRA 3P11H 4GXVH 4YO0A 4N8CL 5IMMB 4TSBL 4JDVA 1A1OB 5F9OH 1JZ8A 5HHPA 3EGSB 4POUB 5SWZD 5DD1H 1Q0YH 1S7UA 4Z7UF 4Q6IA 1WBZB 4QOKB 4NWTH 1HI6A 4OCSH 3K4AA 1NGPH 3F12B 1HHHA 2VKWA 4JPWL 3WDIA 2X4SB 4J4PD 4KVNH 4H1LB 2JB5H 4OQTA 4MAUL 1U93A 3RAJL 1HH9A 3F58H 1QA9A 5FHAH 5DHVH 4NZUH 2VLME 4YHNA 4F7PB 3SCMA 1C08A 2C7UB 1EFXB 4F8TA 5LAXA 3VRJB 3K8MA 4XWGH 1RAMA 5I8EB 5LCVL 3FT4A 4BUGA 4HUKB 2N7AA 4AK1A 2FO4A 1CXEA 3IDUA 3O4LB 2RCSL 4KHXL 4BKLB 2P8LA 3OF6A 1YPZF 1GVIA 3VXRA 3U4EB 4X98A 3MOAL 3KPNA 4P2RB 4Y1AB 1WAAE 5L9DL 1IC1A 1MWAB 5K9JL 5MENB 4OFVA 4PRIE 3B9KA 1T0NA 5I1LB 3WLWD 2A9NL 3P2TA 3DUSB 3MUGA 4WO4C 4PJGB 2R0LH 4JQIL 2O61A 3MLUH 3V5HB 2BHYA 4U1LA 3BRDA 4YK4B 4I18C 5I8CA 1SEBA 4UOJA 2N1KA 4PLJD 4Z18A 4GSDL 1DL7L 4FFWD 1CE1H 4R97B 1GL4B 1I9JH 3EFFB 5L0QC 2XACC 4KAQH 3RX8A 4L4VA 1KB5H 3WFBL 2YS4A 3I75B 2Q8AH 4JKKA 1OP5H 2V2XA 4QO1A 4HIIA 2A1WL 3MNWA 3AMKA 4LCCC 1JF6A 4PRHD 5D4QA 1ZA3A 2HFEA 3LKPA 1B2WL 3MR9B 3QUZD 4YHKL 5J13C 4KY1L 1JPTH 2QQKH 5T3ZD 4X0KB 1ZLVK 3EJYC 1XGQB 4IIQB 4MXVE 5DJ0B 3WFHA 1KYOJ 2HT3D 5GS0L 3HPLA 4LHUG 4EUPB 3DUUB 1Z9SA 1GHFL 5KZCB 3ZKQD 3V0VB 4GOSA 2V5TA 5H8DA 4PJHA 4LGRB 1VFUA 1QFWI 4YAQA 3QEUA 1I7TA 2LAAA 3G6DH 4MS8C 4WJ5B 4XVSH 4GO6B 2VZUA 1FVCB 2BSSA 5IVZA 4YXKL 4KZEH 3G5YA 4RGOL 5DEFB 1SM3L 5H37H 3EJJX 4P2OD 2NW3A 1C1EH 1S7TB 2LTQC 2J8UE 1QEWB 4PJXA 3B6SB 3D39E 2D31A 1F3JB 4HQQH 1D5XA 2F5BH 5FOJA 2UWEA 1LE9B 1INQB 4N1HB 1JNHB 5IB4A 5IMKB 2AJUL 1RJZA 3KPOA 5LQBH 4E41A 4LLQA 4FQ1L 2Q8BH 3K46A 4XRCA 4KRLB 5T33L 5TQ2H 1DSFH 2A73B 1R5IA 1YECH 5DMKB 1FCGA 4PV9A 3GSQB 5FYLD 4Y16D 1UKQA 2IFGA 5D7LA 3TZVC 5HYJD 2R1XA 4C56D 1P4BH 4OGYH 2DICA 3CXDL 4NUGL 4IRSD 4WO4B 3D2UA 4G6KL 2R4RH 1UACL 4I5BA 4J8RA 3ZE1F 5I2IA 1JWMA 1MJ7L 2ZNWA 5J9PA 5I16A 4I18B 3ESVF 4ZXBC 3SKOA 2E8ZA 1PVHA 4U1SA 2JKXA 5DD5L 1NKOA 3B5TA 4FXLA 3RUGF 4UOW0 4AM0A 5L0QB 2MOVA 2OQJA 4HLZH 1U6AL 4LHUA 4PD4J 2BVQA 4YPGB 4U6XA 4L5FH 1G6RA 5FUZH 4R7DA 4OD3L 4ORZC 2X4QB 4NQEB 5TDPB 2Z93B 3SCMD 4Q9QH 4JM2F 3REVA 3DV4B 3ARYA 4NO2B 2MJWA 5E4IA 3ZO0A 5TE4H 1HXYA 3FT3B 4LCCB 32C2A 2H32B 3W2DH 1BX2A 3ARGC 1E4WL 1ZANL 3NCCB 5J13B 1F3RB 4FS0A 3WHE1 4LCUB 3ECBA 3LHPH 3SPVA 2VRAA 4NO3A 4LRIA 2X70B 3EDJA 3ULVF 3VXRD 3OF6D 1Q94B 5JHLL 3NZHL 1WV7T 4UQ2B 5HGAB 2Q7YA 2L4OA 3RVVD 5CMAA 4H8WC 3B9KD 5IROC 4R90H 2IC2A 1K3ZA 1SHMA 1A1OA 4NO5B 2Q6WB 1A9BA 2MQCA 1L7TL 3EGSA 4G9DB 1SJHB 5D2LF 1WBZA 3MFFA 2NX5E 2AEPH 2N4IA 4XH2B 3VXNB 3U4AA 2LTQB 5HHMB 3VJ6B 1CLZL 2VDMH 1NCCH 3PABB 3TT3L 4R26L 5BMFL 2I5YH 5CZVL 4L4VD 4F7PA 4FFYL 1QLFB 1WIPA 1T7VA 4QEGA 1EFXA 4DUXA 3VRJA 3NAAH 5L6YH 3THMH 1XCTA 1L9NA 3HZYA 3HI1A 5I8EA 3HRZA 4G9FE 4IDJL 1DBAH 4ZS6C 1IBGH 3F7RA 1I4FA 2P7TA 2NY6C 5D7SL 3TZVB 5GGTL 2VIRA 1WWBX 1BQHB 1BQSA 2VC2L 1JNLH 3OG6B 3BGMB 5GSRA 2CXGA 4KKAD 4YHOH 4QXGH 3LN9A 4WTZG 4P2RA 3OQ3B 4Y1AA 1P2CB 3BZFB 1NLBL 1MWAA 2D7PA 5MENA 3CFJB 3W0WB 1A7RH 1OSPL 4HSQA 2J1KA 4U1KB 4ZXBB 1YMHA 4S1RH 3KR3L 3DUSA 4JO2L 5IHBA 1A8JH 4PJGA 4BFIB 4XBEL 1QQDA 5FHBH 3UBXG 5J1AB 3IS0X 1J5OH 2Y5TA 2NPLX 1D6VL 3QDME 1I85C 1F3DJ 4Z7VF 5IB2B 3EFFA 2DQFA 1ZHNA 2NY1D 2R0KH 2FRGP 3SQOL 4N5EC 4M1GH 3ARGB 2CDEA 1FPTH 3I75A 3KYKH 4OZIA 2KDGA 3QIUC 1NAKH 1EEUA 1S7XB 3RWEB 3FHAA 4ZUSA 5HYQA 4WGWB 5EU6E 2OR9L 2UUDK 2ZUYA 5JIHA 4E41D 2APXA 1YZZA 4P5KA 4X0KA 3DRQA 1WITA 1XGQA 5F7YC 5C0CB 3PP3H 3PGFH 1A6WH 4NFCA 4F33B 5D7LD 5DJ0A 1XGTA 3D2UD 5DRNB 3S88L 1ED3B 3MJ6A 4QRRE 1LEKA 5CD3B 2PN5A 4Q97A 2E6QA 2DTMH 3MODL 5FUOL 2EC9T 4PUBH 3RVTC 2OL3B 3ARFC 5IBUB 4LSUH 5I75C 1FVCA 2C5DC 3TJEH 3QXUA 4LHUD 1CE6B 3MUHL 4RISH 2CK0L 2EO1A 2FX8H 1MOEA 4N0UA 3JV5A 1OQXA 4GLRI 1S7TA 4X7DC 4XPHL 1QPXA 2NY7L 4OIAA 1EHLL 3OKKB 3B6SA 2EE3A 2Y07L 3D0LA 3U1SL 1F3JA 1KN2H 3UBXA 1AFVL 4LGSB 3K2UH 3K4DA 4MCZB 4N9GB 1INQA 4PTTB 2NY6B 2YD1A 2DMBA 5IMKA 4KHTH 3MCG1 3TVMC 3ULUF 2Q3ZA 3KLDA 1J8HA 3TA3C 2P42B 1TDQA 2A73A 3NCJH 2Y9RT 3A67H 5IHZA 5LG1A 3EYVA 1DR9A 4LMQE 1LILA 2AXFB 4UDUA 1BBDL 1FG9C 4WO4A 3QO1B 1T0MB 2XZQL 1A3QA 3RWHB 2AW2A 1WUNT 2I26N 3MUY1 1K5NB 3JWDL 5F1NA 4GKSA 5JXAH 1P7KB 1PY4A 4I18A 2F8XC 1V05A 1EZVX 1WTLA 4JRYE 1D5ZB 1I9IL 1QFWH 2NYYC 3CLFH 4YPGA 3OTTA 4XCFL 4NO0A 5LWYL 5AWNH 2EZ0C 4DGVL 3QIUB 5C0JA 4NQEA 1JF5A 2WSKA 3LN4A 5L8JB 1EFXD 3DV4A 1DDHA 4NO2A 4XI5C 4OUUA 3FT3A 2H32A 3TF7C 2FNBA 2OX5A 2YPKA 2EH8L 3D9AH 4X6BA 4MGXA 2B1AL 1IGML 1A3RL 1YJDH 4PRDA 4JM4H 3QCVH 2WV3A 3EO0B 4KVCH 5DEGA 3RDTC 3QIWC 1UB6B 5SWSE 5EWIH 5IB1A 2X42A 4P2RD 3ZYIA 1WGOA 2FB4H 3FQTB 4Y1AD 1QBMH 4PGDB 5MEND 3VI3F 1UA6L 1U2HA 1RK0B 5AZ2L 2NY3C 3U6RA 1WQVT 2BDNH 5HGHB 3H3PL 3IETB 3P77A 3R06B 3VG0H 2AXHA 3ARFB 4NO5A 1MCSA 4YZFE 3BN9C 5I75B 4JZJA 4OLZH 1H3VA 5FK9A 4YQXL 5FKAB 4ENED 4LLUB 3BYTA 2ADFL 3ES6A 5DJ2B 3VD7A 5EPMB 1HCFX 4ONOA 1UZ8A 5DQJB 4XH2A 5B4MD 2ICES 3VJ6A 1LP9F 4LSSL 5ID0B 2P5WE 4ODHH 1MY5A 2RJMA 3NIGF 3IVKB 3KXFE 4B5EA 4S1SL 4DGIH 3SGJA 1KYOK 5DRWB 3EOBA 4YXHL 2X4UB 5I19H 4XCNA 2FH8A 4QGTA 3TVMB 4XNYH 1MREL 4HIXH 3TPKA 2HJKA 1BJMA 3TA3B 3FB7B 1S3KL 4ISVB 4EEEA 3KWWA 1YN7B 5HI4C 1RMFH 2C1OB 5KSBF 3OAUL 3FOMA 1XGPB 4U2ZA 3BGMA 1ZAGA 1AGBA 1H0DB 1P2CA 5IBUG 1NH6A 3RKPA 3CFJA 3V5KB 4Z7WB 5JORA 5C0RL 4OZHA 1GXEA 4EXKA 4GS7C 9CGTA 5F7HA 5I71C 2XYCA 1CIDA 2KH2B 2P48B 3FQUB 3HFML 3S97C 4WUKH 2EC8A 1KCVL 1TVHB 3OX8B 1OP3H 3QI9C 4PS4L 3CK0H 3QNYA 1F2XK 1IKNC 3DVFA 4O9HH 4R2GD 2YD9A 4WDIB 5E1AB 3V7AE 5J1AA 3V4UL 2WIIB 1XGRA 4BZYA 4ZUUB 1NANI 4IOFD 5E5RB 1N6QL 3E8UL 4NC0B 1H3GA 3ZT7A 3ARGA 1LK3L 1N26A 2AQ2A 4YHLL 2GK0A 5TGBB 1S7XA 4YE4L 1QSFE 5KS9E 3HC3H 1LEIB 2FSEB 3T0EC 3AS2A 4Z7QF 3V52L 3HUJE 4U0QB 3RDTB 3QIWB 2HJLB 3K81A 2DKSA 2HMID 3VGBA 1N0XL 3AREA 2DQUL 4FQJL 1J8HD 1U58B 2F5AH 5DZNA 5C0BB 2VL5B 4PD4K 5TH2B 1T66D 4TUKH 5BZWB 4DOHE 4LHJB 2NY3B 3LD8C 4M9OA 1HIMH 3HMXA 4F33A 1KNOB 4U3XA 4F7EB 4WO4D 2GT9B 5GRUL 1Z2KA 1ED3A 1X9QA 4UUJA 4G6ML 3TC9A 3B8YA 4QRQB 1U3ZA 4JKMA 3U83A 5D7JA 5E2WH 4Z7NE 15C8H 1RFDH 2XQBL 4YDVB 4NBXB 4Q0XL 4FQHB 4FZ8L 3HCVA 4UNUA 3MJ7A 4NO0D 1V3KA 1X5JA 4RGMC 3DX9A 1S5HB 4R96B 4NQED 1Q1JL 2EDWA 5ITBL 1RI8A 5JPNB 1OGAB 3OKKA 1LK2A 5J7CC 4KKBC 1J05B 1F6AA 4JE4B 2HH0L 4MCZA 2VZ3A 4N9GA 3VXMA 4PTTA 3WNLA 2Q87A 3FKUS 3PV7A 1U3HC 3PP4H 2D2OA 4R4BB 1CBVH 4K07A 3GUTB 1HN1A 3KPQB 1J7VR 1M7DA 1NC2B 1LO2H 3WIIL 3X14B 2RAMA 2FD6H 4QXTA 1S7WB 4JFXB 4GS7B 1UH2A 5I71B