4KJYA

Complex of high-affinity sirp alpha variant fd6 with cd47
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
ELLFNKTKSVEFTFGNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Leukocyte surface antigen CD47
publication title Engineered SIRP alpha variants as immunotherapeutic adjuvants to anticancer antibodies.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 114
sequence length 114
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-05-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kjyA00
2CIKA 3DMMC 5GS0L 4Z7NF 2E5EA 4OLVH 1ZOXA 2BSTA 2WZPD 1A0QL 5JIIA 1HNFA 4H20L 4K7PY 1E4WL 4HUMB 5CCKL 5CEXB 4I0KA 2VLJB 5HGBA 1D5ZB 1FNEA 1KCSH 2OK0L 1TVDA 1A7NH 5E5RB 4FZEL 1VGKA 5HHNB 1M05A 3QJFB 3CZFA 3MFFB 2H3NB 4MAYC 4JQIL 2XZAL 1I7TB 1WWWX 1RU9L 3L5WA 4RA3A 2C1OA 2I9LA 1A3RH 2ARJA 1NEZG 3DGGB 1P7KB 5HHQB 4GMSL 4MAYA 1CGWA 3D3VB 4BZ2L 5A2JH 2WV3A 3PGFL 3GMOA 5I1AA 3PHQA 3SOBL 4YHNB 2FBOJ 2Z31D 4WVRA 3ZYIA 2XG5A 3GSVA 5LQBH 5C07B 1JVKA 2X4QB 2J8UE 4P57A 1IQDA 2B20A 2VLRD 3N9GL 4P2OB 3FB8B 3FONA 1Q0YL 5L2JA 1RUML 4PY7B 4M9OA 1P4BL 4JJHA 3A6CH 1X4XA 1BJ8A 3IXTA 4JHAL 3VFTB 4W6XB 3KDMA 3OPZL 3MRFB 5HDBF 1EHAA 4UDUA 5SWSB 1WZKA 3VRJB 1LE5A 1NEUA 1KIQB 4QRUB 4UV4H 5H2BA 3QWOB 3O4LA 3KAAA 2VXSL 4JQXC 8FABB 1QA9B 1VEPA 5E6IC 1MEXH 3FOMA 1JJUA 3P9WB 1KIUA 1JPST 4WUUB 3QXUA 2ZUXA 1FH5L 1I7RA 1MFAH 3GSOA 4F80A 4JQXA 4NSKA 2JJSC 4O9HL 4X99A 4MLSA 1G9MC 2IAND 4GAGH 3V7AE 3U7WH 2MPAH 3VCLA 4KROD 3T0XA 4KJPD 3QUYD 4AEFA 2DM7A 3D18B 4HDIA 1X5YA 3ARDB 4EDXB 5FECB 3R1GL 3VXRB 3MRPA 2JJSA 5IVNA 4NO0D 3CX2A 5F93C 3C6SB 5FM5O 3KPRD 1B0RB 2GJJA 2NY3B 4RFOL 3L5XH 3LN5A 1G7LB 3K8MA 4JFDA 3FKUS 1HHGB 3DO3A 4QRTB 2BHZA 1UWEH 4KK6D 4LNRA 4LP4A 3GRWA 4YDJA 5DMIL 1BD2B 2FHCA 1ORSA 4RQQB 1QTYT 3QBTB 5J6GA 1WWBX 3H3PL 2NX5B 2CRZA 4PTUB 1A2YB 4HUUA 4YBHA 3RTQB 3GSWB 4JKMA 2ZG2A 1KOAA 1NCCL 1GSMA 1BQHG 4HBQA 5DJAA 3VXSD 2VDMH 4MHHG 3GMRA 1ZHBA 5FKAA 3FN3A 4HFUL 1C5BL 1KCRH 5GGSY 5K33A 2Q86A 3KXFB 1S7RA 3BUYB 4ORGA 4OFYD 4OZ4A 3MJ9A 4JFZL 5C0DB 4LKCA 3TBSB 5EC2A 3PXHA 3WYRA 5D5ME 1PYWA 4XP1H 5E2JA 5BXFB 1QO3A 3TYFB 3V6OE 5ERWA 3MRGA 3GKWL 4H8WH 1DUZA 4S1RL 5ALCL 4RDQF 1DQML 1DR9A 3UROR 4TUJB 4LCYA 4XVTL 4HQQH 1KPUB 2I60L 2XN9E 4PLNC 4GW1A 2W60A 1K2DA 2FR4A 1SBSH 3CJJA 4JN1H 2EICA 2AJUL 4CW1B 4JRYB 4EN3D 1EVUA 3V7AG 2J5LB 2D9QB 3NCEB 1M71B 1WFUA 5MERA 3MRNB 4LCIH 2UYLB 2ZCKH 1P5UA 3ZZ1A 2ADFH 1TITA 1J1OL 1SEBA 3VXNB 4TN9A 1A6WL 1Z9SA 5H35B 1C08A 1KC5H 4O02H 3AREB 5C0BE 1GGUA 5FYLD 5GS1C 1JGEB 5DFVD 5IBUB 1YEJH 3RIAK 1NEZA 4OZIA 2H6PB 4PRHD 1A4JB 3SO5A 3BW9B 5HHXL 1Q9WA 5GS1A 5GGVH 2HJKA 4FQHB 5GS0D 4PTTB 5CIPB 3HAEA 4P9MH 1J1XL 5EOCH 1OAZH 1J0YA 1OGAA 1P9MC 3GMLB 4DQOH 3DHMA 5DMGC 4FQCH 1E28B 2NY5C 1SYVA 5JHDD 1R24B 4HUNB 5INCB 1AO7E 3E8UH 3MLSH 3QEUA 4KQ4L 1IAIL 2A9ML 5C6WH 1HZHL 5B4MD 2JB6A 1KV3A 3BDBA 4KRPB 2RJMA 3QDGD 2Q3AA 4D94A 1QLFA 4GW4A 5HYJB 1D3CA 1NQBA 5HYIA 1QG3A 1W0YT 1UT9A 5FUZL 4F2MB 2Y5EA 3VRIB 3RX8A 2BFVH 3KPSB 4IS6B 5FFLA 5C0CE 3SEPA 2AQ3A 4OIIL 4XPHH 2NXYC 4LIQH 5D1ZB 2E7BA 2WWMD 1ZVSB 4Q58C 3RVVD 1DQTA 2FJFB 3UTTD 3QIUD 4OIBA 1O7VA 1T6VN 3MV11 4AL8H 3Q6GL 4PUBH 3U36A 1K8IB 3K7UA 2W9DL 4OLWH 5JHLL 4E42B 4H0IA 3INUH 4LLYA 2VISA 3LB6D 1C5CH 1C12B 2HJLA 1CBVH 5DT1L 5DO2D 2BVTA 5F1OB 3HA0A 1X5XA 3MLVL 5FYKU 4ZO9A 2M2DA 1YC8A 1YMME 3P0YL 4LHUB 4MDJA 4ZFFA 4CDGC 2EXYC 4PP2A 1JL8A 4CMMB 3WIIL 3TJEH 3FB7B 1C7TA 1AY1H 1EO7A 1U93B 1WT5A 3GHBL 4IRSB 5B38B 1LDPL 1N59B 4KWUA 2A6IB 1J11A 2CK0H 4ZS7L 1CGSL 4NQXA 1BMGA 3FQRA 5D7LB 3VDCA 4M5YL 3TFKC 2HT2D 2V2TB 1RJLB 1GXEA 1DBKH 2NY1D 4XMKH 5I9QC 1P5VA 3VGGA 3ARRA 2BRQA 2J8UA 3RVXD 1ZEAL 3UEZA 1BQHA 5EUKB 1A4KA 5F6HI 1P4IL 4G7VH 1YNTB 1WBXA 4Y1AE 15C8L 2AJXL 3P4MB 1NBVH 5AWNL 1FDLH 4R2GD 3HNTL 2MCG1 3ARFB 5JXED 2Z92A 5I30H 4CGTA 1WJ3A 1JF5A 4LPCA 5EN2A 3MRHB 4NFDA 3PWLA 4WEBL 3KPLA 3PWJA 3S37H 5KJRL 3UPRA 4L8CB 2BNUB 1CIDA 1V3KA 3ZE2E 4JO4L 3NCJH 3PP4H 4MQ7A 4XWOD 4AK1A 4EZMA 1BFTA 2ITDB 3ULVD 1D5XB 2MFNA 2RFXA 3RVWC 1VB9A 2Z93A 5DC9B 1L9NA 4NFCA 3WKML 5IOPA 2NY7H 1KLGB 5D1QB 3CDGA 1U41A 5F1SA 3RWFA 2DTML 2YZ1A 2C3HA 1ADQH 4MD4B 2CKBA 4KZEH 3R0MA 1IJ9A 3WO4B 5IIEB 4UZGA 1D6EA 4NO5B 4P0DA 4XBGB 5EC1B 3I75A 4LAQH 1TLKA 4K8RC 2NTFA 3G6AA 1P4LA 1U9KA 5BRZE 4ZPVB 3VE0A 1U3HB 1VDGA 4J3TA 32C2A 2UV3A 3LY6A 1G7MB 1KB5H 2DI9A 3RWDA 4BFIA 1DSFL 3PP3K 1WK0A 2R1YA 1MQKH 5E08H 5LCVH 3OR6A 3D69B 1QNZL 4RAVB 1EHXA 2DWEB 1U0QA 4HBCL 4S1DC 3EYQC 1XH3A 4XP5L 4R3SB 2IEPA 1MJ8H 4B7IA 4ZUTB 2XWBB 5ESQA 5KVMC 3HRZA 1E6JL 4MXWH 4NN7C 3VFRA 4BSVA 1J87A 2J88L 2DDQL 4XAWH 4OCLC 4H1LH 4MA7L 1C1EL 2BC4A 2QV2A 3PJSB 4R26L 3MRBA 4PRAB 3SJVD 3V6OC 3K3QA 4NWTL 1FVEA 3G9AB 3FQTB 1UJTA 1IC5L 3H7BA 4GMTL 3SE8H 2L0DA 3QQ3B 3IGAA 4XPTL 2HP4A 3BN9C 3G5ZB 5F71A 4V1DE 5D5MA 4KTEH 4PJ8C 3UO1L 1F6AB 5DD3L 2VMFA 4HWBH 5JR1H 3SO3C 3UTSB 3GSNL 4MDIB 3HPLA 4G9DB 4YPJA 4NM8L 3VWKD 1AD0B 1UG9A 1NSNL 3LKRA 3GB7A 4PJ8A 3MV9A 4JFED 3WXWL 5ITBL 4U3XA 3H42H 3WKNA 3KPPB 2AEPL 1BIIB 4YE4L 4IRZL 2Q20A 4FTVE 1XR8A 4TPRL 3CH1A 5TH2A 3GI8L 4MZ3A 4LLDA 3QFDB 3LN4A 4LLUB 5HHMB 4JZNB 4LP5A 1B0GA 1RZKH 1XF3A 4YDIL 5EU4A 1LD9A 5C08A 5IGXH 5IQ9B 3QFJA 2DJ4A 4X9GA 2B2XH 4RFEB 5TDPA 2JJWA 4RBPK 1RZJH 1A1NB 4KZDH 4DK6A 3VU2A 1RUAH 4KXZI 1KCSL 1Y0LA 4LLVB 1NANH 2X44D 1TCRB 4XMPH 5F88A 1RZ8B 3FZUD 4NQVA 4X5XB 5D6CB 2X89D 2NR6C 3PDGA 3I3DA 2XY1A 3WNPA 1QEWB 4JDVA 1W72A 3AXLA 5IB3A 1A3RL 4PJXF 2J3SA 3QXWA 3EYSH 3F7YB 4OGYH 4K3DH 4WY7H 1U8KB 1AO7A 4U0QB 4NKMB 4P3WA 4DUVA 3QHTC 1U8MB 1JRHH 4CUCA 4Q0XH 3Q1SH 1G7HB 1VPOH 3MR9B 4JGUA 2CXKA 5IW1B 2F53B 1A7QL 2JCCE 2NPLX 1B4JL 3A6CL 4LCCC 5C0CA 4OJFL 3WUWG 5ESVB 1V8HA 3EOTL 2QADB 2P47B 4UTAH 3MFGB 5AYUH 4WHCA 1FG2B 4WDIB 2H9GB 2OSLA 3FB6A 3PDOB 3GJEB 2PNDA 3OZ9L 1XCTB 1QD0A 1OP9A 5GGRY 3MCLH 3WBDA 4LCCA 1L6XA 1QACA 2ZP0T 4BKLB 3EYUL 3QPXL 4M7ZC 4YR6B 4GG6F 2ICWJ 4LEOB 4OLXH 4XNMB 3WMSA 3TBTB 1FYTD 1G6VK 4JFOB 3KPQA 4HIXL 1JWSA 1J0HA 2OJEA 3SKMB 1QFWH 4OLYH 3ILPA 2EDWA 4R90L 5I1EL 5GGVY 1JYXA 1MFAL 4K23H 5FA4A 3KLHD 2YPLE 5DMYA 3GBNH 3E6FA 4QOKE 1QSFB 4JFPA 5M7QA 3ARWA 3L95A 4NT6B 2YXMA 4GG6B 4FN0A 1DVFB 3VXQA 5EU3A 4YZFF 3C9NA 1KCLA 4PGDA 1WC7A 2P24B 4MWFB 4NC1E 2VLKB 1UYWH 4I77H 1BVKA 3K1DA 4G8GB 5DMKB 5C0IB 4EI5B 2JB5H 3LKQB 5KSVB 3PWPD 1XIWC 4MSWB 3OKOB 2BHUA 4Z7UE 2Y7QB 4Q7DA 5GJTL 4KKCD 1O5DT 4MQXD 3STZB 3FRUB 2WWKO 3MROA 1I9EA 3ZTJG 1DQQA 2LU3A 3WHXA 2HKFL 4HSQA 4FQQB 3KPNB 3DXAA 2E9BA 1XIWA 4HZLB 1FE8L 2FSEA 4WHTB 4QRRE 4Y5XA 3QUKB 5E1AA 1H3WM 1I85C 3QNYA 4X9FA 1BZ7A 4MD5B 2ZPKH 4M1GH 4ONFL 3UP1A 5DJYA 3F58H 3BOVA 4GBXC 4HD9A 4X5LA 4DGVL 5J13B 2VAAA 1DQJA 2D7TL 2EDQA 1MI5B 2A77H 3PQYE 1F6LL 5DJXB 3C5ZD 2GJZA 2NY4C 3X3GH 5ETUB 4GAJH 3U46A 5GGSB 3SCMB 2DYPD 3FQWB 5KVDL 4GBXA 4MYWB 3RPIB 5AD0B 1H3GA 4X7TB 3DX8A 1KFAH 4QKXB 2Z8SA 1U6AH 5BRZA 1S5HA 5DI8A 5EIVA 2C4FT 2VZTA 4JN1L 2A83A 4PRPB 2FJHB 2F5AL 1CLZH 3WIHL 1Y18B 4LF3B 1VFUA 2XA8H 4ZFZB 2ZCKL 5L88L 2ADFL 4NO2B 4YLQT 5D2NE 1G9MH 4QT5B 3L3JB 5FYJE 1PKQA 4U2ZA 3T0VA 3U4EB 1MVFA 3SE3C 5HPMB 2VQTA 3VGBA 3O81A 4U6XB 1NGWA 3QDMB 1OM3H 2BSSB 5EBMA 4KHTH 5INDB 1YEJL 1INEH 3CFBB 3HMWH 2VUOA 3O2VH 1N6QH 5IP4A 3OKKA 3B9DA 5FF6B 4PJFE 7FABH 3MLXL 4M00A 4GS7B 3T09A 3SE3A 5TPWH 1J0ZA 3ARBD 1WUNT 4JY5H 1NC2B 1DE4B 3LSOB 3B9EA 1OARH 3ECBA 5DEFB 5JORA 1JNJA 1QOKA 2YRLA 2PYED 5HYQA 1NDMA 4YPGA 5JTWA 2K7QA 3P4LA 1H15A 5CJOH 4D8PA 4X98A 5DHYA 5I6XC 3T4AA 3E8UL 2E7HA 1J12A 4LVHB 3WUWA 3U9PL 1OSZB 5DZOA 4TUOA 5D93C 1R5IB 4TSBH 4U1NB 4QRPE 3F7QA 5IEKB 3CVHH 3MJ9H 5TJWK 3DVGB 4X7FC 1CWVA 4LPUA 4PPTA 3JWDC 3WFZA 3NFPA 3QT2A 2NXZC 1TJGH 3O41A 3PGCA 3LQZA 2CUIA 4ZO6A 2BFVL 2YUVA 5DURD 5TE4H 5CILH 5IJVA 3I02B 3EOAA 3Q3GA 4PS4H 4XPHL 5JW5B 1NGZB 2BSRB 4X7EC 1SY6L 3QG7H 3WE6A 3H8NA 4JFQA 5E03A 1CT8A 4AY0A 5JO5B 4UDTB 2M26A 3CFIC 5F7KC 1QFUL 5BS0B 2RBLA 3ULUH 3PL6B 4AT6A 2JKXA 5CGMA 4KI5F 4OLWL 4DZBB 4OFPA 3INUL 1ZLWH 1HHJB 1C5CL 2FO4B 4Y4HD 4QTHB 5AZEL 1A9BB 3STLB 1LO4H 3T3MF 3MSPA 1I7UA 2HN7A 5MENB 2EZ0C 4TNVF 1Y6KR 3FQUB 3QUXB 5CWSA 2PTVA 2NQCA 5CZVH 3NACH 5ID1A 1T5WB 3EHBD 1UVQA 3V6FB 4BELD 4CKVX 3L5IA 1S7QA 5MEQB 3HZKB 3SGEH 4TTGA 4ZOAA 2Y9RT 5KANI 3O3EB 3OHXA 2OL3B 4M62H 4M5ZL 2DLEA 2XKNA 3BMWA 3TA3D 4QF1B 2MNUA 4L4VD 4EUPB 2RIKA 4XAKD 1U58B 3H9SE 1CTOA 4U6TA 4Y5YC 5DQDL 5DK0B 4BJLA 2JCCA 5FO9B 3L7FB 4ZD3L 1MCQA 1PZ5A 1ZT1B 5E9DD 4CJ0A 5JDSB 1N8ZA 2NY5H 1HIMH 4PB9H 3T0EE 3MRLA 5I30L 2CDFB 5CJQH 3RAJL 5L9DH 3UZVB 4GRMB 3MNZA 1GPOL 5TDOB 1S7XB 5KSUA 1CVRA 4Y2DA 4NRZA 4NNXB 1GZQA 5KSAD 5I73B 2EDFA 3QEQD 1MHHB 3NIGF 3PP4L 4IIQC 1XF5B 1JHTA 3GDBA 1S9KC 3DX6A 4WW2C 1JZ3A 3N85L 4GAYB 3D0LB 4ZXBD 2VDOL 4NBXB 2OMBA 1GZPB 5A2LH 1ADQL 1A1MB 3DX7B 4N0UB 4IIQA 4NC1C 4ZQKB 3TJHC 3C6LC 3QI9C 4R97B 1AP2B 4QOKA 1U3ZA 5DZNA 5ADPH 3P11H 3P9MB 3MXWH 4Z95H 3QCUH 5E4IA 4XPBH 5F7DA 4LCWA 2G60H 3IDYB 3BXNB 3C6LA 5T3XE 5IV2A 4RNRA 1UZ8B 4HIIB 4W4NA 4QTIH 5DJ8A 2Y1VA 3D2UB 1T4KB 4GOSA 4XTRC 2GTWB 3L9RA 3KR3H 4KRNA 3K8KA 2CDGB 2H26B 3VXUE 3ELAT 5IKCA 1G6RL 4R8WH 3QXDA 3KYAA 3QULA 1JFQL 2EE3A 5ISZB 3QUMA 4LSDA 2O26U 2VQ1A 5HGHA 5FGRA 5CJ5A 1KJ3L 3AUVA 4YHOL 5ICZB 3CCHA 1RULH 4F33A 1JPGA 2YA0A 1ZXQA 3ZSTA 4I9WE 4MXWL 4DOHB 4FQJL 1FNGB 1UXSA 4Z5RB 5ICYB 2NW2B 3SKOA 3UZEA 5EA0L 1K4DA 5F3HA 3HR5A 2R1XA 2SEBB 3D87B 4PRBB 1QYGL 1RZIB 4JFFB 4I4WB 3DUHA 1J1PH 4YIQB 4U1HB 1VKXB 1HWHB 2IQAB 3QHFL 5ITFB 4S1QL 5I19L 3HE7B 2X1XR 4HJGA 4E41B 2R9HD 4YHIA 5D1XA 5GSRB 4APQD 1UH4A 4HH9A 3EW3B 5HD8C 1UWGL 2APWA 4MJ2A 4CNIB 1DQDL 1KJ2B 3MUGB 2YBRB 3MLRH 1DBAH 4PRIB 5IB5A 5AEAA 1OY3B 5IFJA 4X6DE 4L1DA 3LRSA 1AD9B 4KKBC 2BOBB 3F5WA 5E4EC 5LAXA 3H9YA 4YHZL 3FMGH 5JDJA 3OKDA 1NJ9A 5F8QC 5IB4A 4M3KB 1YNLH 2OQJA 5DFWH 1QVOA 4HKXB 4K8RH 4G80A 5JW4N 4N8CH 4NKOA 4RGND 1I1YA 3MGOA 4IOIB 1CXKA 4D3CH 4LPWA 1RUAL 4L29B 2XTJB 4NUJB 2FECL 4YUEH 3U79A 2FEDD 3CSGA 1CL7H 3RGVB 3NTCL 5JOFB 2ZCLL 5C70A 3KS0H 1FLRH 3DBXA 4YAQB 1A9EB 5CP7A 1HHIA 4D0BA 4F15C 5DMJB 1NC4D 2OJZH 5CFHA 3OXRA 1GRWA 1IQWH 5FGBC 2Q7YB 3B9KB 3OJDA 4YHKH 1I1RA 4I0PC 5SWZB 5A2KH 4OGYL 3WFEL 3HE6B 1PSKL 3W81A 1J9CT 4K3DL 4WY7L 1LK3H 4AENA 4I2XA 3FFCB 4FFVD 3GSRB 1A3LH 4UTBL 1MSPA 1IM9D 3BH8A 5ANMB 5FGBA 4QRPA 2RAMA 3CFCL 2VLJE 1HEZA 3F65A 1K4CB 3MOAL 4JFYB 4P4KD 1BWMA 5I1HL 2X4UA 4GUPB 5DD6B 3V9FA 3CFDA 3DVNB 4O2CB 2EDJA 3CSPA 3BIAX 4GRLB 3V4PL 4L4TB 3H0TA 1Z2KA 4Z7NE 4MXVF 3S88H 1K5NA 1QSVA 3GK8H 1M6OA 2WBJC 1NCNA 4P3CL 5E95B 5FDWA 1C16B 3BZEB 3D3VE 4XRCB 2EDHA 2HKHH 4MJ6A 2IAMD 5FKPB 3WD5L 3S96A 4OZFH 5CD3A 5C07E 2WBJA 3ROLB 4DZ8B 4U3HA 5K9QI 5F6IB 1YYML 4HMEA 2N7BA 5SX5H 4MVBD 4H5SA 1QFWL 4OLYL 5DTFA 1RIHL 1JRHI 4U0RC 3C87A 5IBLC 2VE6B 4BA8A 3P77A 3GBNL 1FCCA 3WHE0 4X7DC 3IVKA 2I07A 3ZYOA 3LZFH 1FJ1B 5SWSE 4D9QE 1IEBA 1WFTA 4WV1C 2ZSWB 4P4RB 3DHJA 3R06A 4ZFOA 3MV7B 1K3IA 3GJFB 3UTPE 2EDNA 3FCTB 3DV6A 1FSKB 1ZT4A 3AAZA 4ZYKB 4WUUE 4MJIA 5HDBE 3H9SA 2B7DT 1AGBA 4G9FD 4W81A 3MNWA 4GKZA 4EIGB 4Y4FB 4DN4L 5ENWB 4HS8L 4NQED 1KACB 4HS3A 1DUYB 4TUKL 3VXRE 4MS8D 4FQ2H 2V7HA 1FNSH 2CGRH 2C3VB 3EDDA 3DETD 2ZPKL 3W82A 4PGCB 2H1PL 3BDYL 1TMCB 3LN9A 1BD2E 3KWWA 3X3GL 4GAJL 2VZ1A 4FFYH 1MH5A 4CN4A 5IB2A 4KVNH 4CAGA 4M6NL 4JG1H 2AJYL 2HLAA 2NX5E 1I8IA 1AKJA 2CRIA 3QA3A 4UV7H 3QJHA 1AQDB 4LSSL 4JPVH 3GBML 3QRGH 5GHWH 5HGAB 1NL0L 1JPSH 3F62A 1NDGA 1D9KC 3SDXF 1CLZL 2CK2A 5GSVB 2R0ZL 3KXFE 3UYRH 3DOSA 1F3RB 1GGTA 4ZAKC 4ODVL 1G9ML 2QSTA 5FGSA 3TZVD 3QUZD 3OGCB 5I8OL 4HV8B 1UM6L 1CD1B 1MLBB 1JHLH 3BT2H 2QKIB 5D7JA 1RZGA 3GRWL 3NN8A 4PLKD 5IG7A 3HMWL 3O2VL 1N6QL 5DRNA 4ZAKA 7FABL 3KPOB 5CJXC 3SDXB 4LLWB 2PTTA 1I4FA 3OKEB 3C08L 5CLTA 1MHEA 2B5IC 1ZS8A 3EYVB 4P3DB 3T1FB 4JZJB 3RKDC 1MRFL 2O61B 5E8NB 3IJHB 2ADJB 4JRYE 1VESA 4JY6A 3T4YA 4FS0A 2ZKHL 4M8QB 3WFCL 1G7JB 5LGKA 2FYYB 3O6FB 4XGZA 4Z78B 5CJXA 3K2MC 5CUSH 3IFNH 3TO2B 5CJOL 1FHGA 1OGTA 2YD6A 2X05A 4Y16C 4I18C 3TN0C 1BX2A 2PO6C 4WFGE 3IDNB 4LSRL 4N0FB 3UXFA 4LDOB 1HCFX 1UACH 2VKWA 5IT2H 5C9JB 2PYFB 4P23D 4TSBL 5CLWA 1LE9B 5B21A 3MJ9L 4Q9BA 4JO1H 4PG2C 5J3HC 1CS6A 4UIKL 1IZKA 4Y16A 1EHLH 4I18A 5DC0A 3I6KA 2PO6A 4GFTB 3M07A 2OTWB 4U7SA 2ZOKB 4QXGH 1CK0H 1SJHB 3AS3A 5IHZB 5CILL 4U1IB 3VGHA 1AIFB 4XP6H 4PG2A 5CGYC 4U4BA 2X4NA 2B1HH 1X7QB 1IC4H 4HX1A 1KB5B 2Z31B 4M1CC 5KSBA 5JA9A 2Y23A 1CFTB 3B8YA 5EZLA 4JANA 4PJ9A 5IMOB 2VLRB 2VC2L 3MOQA 1I75A 1IKFH 1A6TB 5C0RH 5HYJE 3BJ91 1TTFA 1XZ0B 2DQHH 1EFXD 4UOJA 4WWKA 1UA6H 2ADIB 2DLFL 2PCPA 3QPQC 1JWMA 2AKRB 1LO4L 1TETH 2M8XA 1MNUH 2DTSA 3KYOA 1YNKL 1XCQB 3KPSE 2QSCH 1ZSDA 1WSST 4X4ME 1J8HD 1SJVA 3U9UB 2IQ9H 4QHKI 3D39D 4UIMB 3R0NA 4EQ3A 3OX8B 2Y06H 5EO1B 5MP6L 4K7PX 4KTDH 1T2JA 1S7SB 2PKDA 5IMMA 1A21A 2R1WB 4GT7A 1S5IL 1LDSA 1W0VB 2VSDA 5D96B 4AYFA 1AFVH 2XY2A 3A6BH 4KDWA 5DK2A 3RIAF 2W9EL 5TE7H 2VLJA 4AEHH 3TP4A 2P4AB 4XNUL 2IANB 3M17A 4RDQG 4PREB 1CDHA 5HHNA 3MFFA 5CSZA 1QSEA 4I1NB 1U8PA 2NY5L 5IBUG 4KHXL 1BQSA 4NO0B 1A6VL 5L9DL 4Y5VB 3DGGA 2WQRA 3BE1L 1P7KA 2VDNH 1HILB 4MAYD 1J7VR 4P2OC 3D3VA 3V0AC 2CR6A 4EJ1C 3HS0B 5D7LE 1V7NL 1F42A 4MJ5B 4YHNA 2ADGB 3V4VH 2BVPB 5C07A 4HKJB 4PV9A 1CQKA 3SGEI 4P2OA 3FB8A 1PG7W 1K6QH 1N0LA 1D5IH 4Z0XB 4PY7A 4XH2B 3QNXA 2R29H 2PXYA 2AEWA 4P5KA 5JOEA 2X4PB 3L3KA 5AZ2L 3VFTA 5DQ9A 2V7NA 5EZJA 4BYHA 4ZTOH 3FJTA 1MHCA 3Q5TA 3T65B 5EIIB 3WDJA 1ZT7B 1RD6A 1J88A 5ADPL 5SWSA 3VFVB 3VRJA 4Z95L 3V0WH 1KIQA 1FL3B 4XPBL 2FLBT 3O4LD 3MGAA 2CIIA 2G60L 3OKMB 1QA9A 3TNNB 3ZDXF 1LEIB 2R0LL 2F74B 3OL2A 5SX4H 4FNLL 2FJGA 4QTIL 2CJUH 3QCVL 1FFNB 3IDXH 2VR9A 2BMKB 2EDBA 3ARDC 3KR3L 5ECJE 3LS5H 2Q8AL 1FN4B 1T20A 1W0WB 3FQNB 1OTTC 2P1YA 1CCZA 3W39B 4CADB 1A1OA 4MAUH 3JWOC 4TQEH 4HCRA 2Q8BL 1RULL 1E6OH 2XT1B 1JTTA 4EDXA 5FECA 1WTGT 4O2FB 2P8PA 4AIZA 4EN3B 3C6SA 4LHUG 3H9HB 1U8NA 3LAFA 2AABL 5L7XL 4JFDD 4ODXB 4E5XA 2ESVA 3I6GB 1F3JB 1UB5B 3RUGF 3OXSB 1ETZB 1UJ3B 4PGEB 2GAZA 4YHMH 2ZUVA 4RMSA 3TIEB 1J1PL 1BD2A 5TE6H 3P0VL 3RA7H 3W9EA 2FIKA 3K2UH 2DM4A 1RURH 3RDTB 3HI1B 4ZOCA 4HULB 4YX2H 4PB0H 2NX5A 3NCFB 4PLJD 2X41A 4LSVL 3VH8B 5JLZA 5L8LB 5I8CA 2G5BA 3CC5B 4HGWB 3WS6C 2O5YL 3RUGB 3VW3H 3HI6H 5EOQH 1IILE 1KJMB 2VDQL 2CKBL 4JKPH 3BZFB 3MLRL 4NNYB 2YPKB 1E4KC 1DBAL 3ARUA 5JHDB 3VXTB 5KN5A 3FT2A 3KXFA 1U8QB 1Q0XH 1H3TA 3FMGL 1LILA 4NHUB 5FHAL 1IC7H 1VADB 3NOIA 3QDGB 3IETB 1E4KA 2WBWB 1Q9KA 1CDJA 5DQJB 3MACL 3MBEA 2C3WA 1BWWA 3QXAB 3TNMB 3UTSE 4L8DB 4BSWB 5C2UB 2J5LC 1R0AH 1T04A 1CDGA 5E94A 2W0FB 1G84A 1KPUA 4YUEL 4D2NA 3NA4A 4X80H 2Y6SC 1EIBA 5FA3B 1FLRL 4CW1A 4GG8B 4JRYA 2Y36L 3QIUB 3UTTB 3MC0A 4M7LL 1YEEH 2UWEF 3O0RH 4FXLA 4KAQH 4P5MB 4J1UA 3P4OA 3T2NH 1HDMA 4JDZB 2V9TA 1CFSB 4YHKL 5JQHC 5H35A 3IF1A 4U1KB 4LLMB 5HHME 5BMFL 1R3IH 2CSPA 3MLTA 2KPNA 2ZJSL 3NPSB 1YMHA 4DUWA 2XPGB 2K3TA 3LVEA 3P40A 4PJAA 2DI8A 1QLEL 2UWEB 4POUB 4AEEA 1JNNL 1HYRC 3MRRB 3VWJD 2XWTB 4FQHA 4U1JB 5CIPA 5E00B 1BF2A 4O51B 1V3LA 4JJ5B 4OLUH 3X14B 1OGAD 4KRPC 1CL7I 4ODBD 5SWQB 1KYOK 3S88L 4MXQD 1CGXA 1A6PA 3MZGB 4MNHB 1S7TA 4IMKC 1R24A 4PP1C 4OTXL 4Y8DC 3MODL 3IJYB 2EIZB 2DAVA 2NY1B 4LOUD 4P2CG 5I1GL 1DBJH 5DMGD 3EJZD 5IVXF 5D1ZC 1QR4A 1EDQA 2AJVH 5B39B 4IMKA 3ULVF 4Z6AT 4JRXD 5FYJH 2F53E 4M9PA 4F2MA 4WUKH 4JO2H 3U6RB 3VRIA 3G6DH 4D0DB 4IS6A 1NBQA 2FEEI 3CH8A 5D1ZA 1EMTL 1ZVSA 1XF1A 2FJFA 3LZFL 4R7DA 3B2VH 2QTEA 5IVXB 2BDNH 5I8EA 4ZG1A 1UM5H 5ACZA 4PBWD 4NQSB 2VLLB 2J12B 3G08B 1AGCB 1K8IA 4DFIA 2NXYD 3PG2A 5E2WL 4LQFH 4E42A 4LRNL 5A43C 1INQA 1W72L 1DN2A 1I8MA 5FYKE 4IRSC 4HK3N 4HS6B 3RZCB 3V6ZB 3CU7A 3SQOH 3TM6A 1NGYB 5BVPH 2QHLA 4EQ2A 4BH7B 3FB7A 1QSFE 4IRSA 4GG6E 5I1DA 1N59A 3BEWA 2A6IA 5KG9B 4EDWH 1MPAH 1T89C 4FQ2L 3FFDB 5DUPH 4UAOC 1FNSL 2VLKE 5D7LA 4HJJH 4QRQA 3C2AL 4NCDA 2K7PA 4N1EA 3MPCA 1RJLA 3FT4B 4G8GE 3RPKA 3QO1B 3ARFC 1O7SA 2LVEA 4RAUB 4X8JB 4Z7VF 1U8HB 1T89A 4GKNA 5EUKA 1OP3H 3CFEB 4K7FB 2DQFB 3TFKD 1OD9A 4YZFE 5FCUL 4GAFB 5HYSG 4FFYL 4ELMA 3ARFA 3ZHLA 3HTLX 4YNYB 2BVEA 5ID0B 1MQ8A 4UQ2B 4UV7L 2IH3B 3DRTA 2EE6A 1JNHA 3SJVB 3BGAA 2CDEB 4Z7VB 2JIXB 1ED3A 1NMBH 2NZIA 1M1SA 5D1QC 3BMVA 4JPVL 3QRGL 1KPVB 2HAZA 2ITDA 1X6LA 4UMGA 5EPMA 4CVZB 1MI5E 2XACC 5D1QA 4B53A 1EEQA 3LQAH 4UT6H 3BVNB 5I75B 1EJOH 1KGCE 1MCPL 1AI1H 5J1SC 1KT2A 3WO3B 2I26N 3AS2A 4MD4A 3VWKB 1U3HC 3ESVF 1MCWW 1T1YB 5F9OL 2HT3C 3VDBA 2MQ3A 3X12B 1JHLL 2PN5A 3BT2L 4Q9RL 4NO5A 4JFEB 4XBGA 5EC1A 1R5VB 4DKAA 4IHOB 4ZDHA 4HWEH 2ATPB 1GIGH 1EAJA 4WI4A 1U3HA 1LO5B 1D5MB 4PRPE 3VFUA 1PQZA 1EEZA 3ARPA 1F4YH 5EUOA 3NCYS 3K4ZA 2P5WA 5CUSL 1KCUH 3G5YB 4NGHL 1GL4B 1T7ZA 3M8OH 3RRQA 1PLGL 3G5XA 3QDME 4R3SA 4X9HA 2ZG1A 4LMQE 3SKJL 1NAMA 1UACL 4ZUTA 5HDLA 3TESA 1FZKA 4M7JH 4MCYB 3SN6N 5E6YA 1A7RH 4JO1L 1WFNA 2WP3O 4XCNB 2YC1A 2YD4A 4K2UH 5EBLB 1EAPA 2HVKB 5IM7B 3EYQD 1NBZB 3V6BR 2G2RA 2N7AA 3PJSA 4JE4B 4AMKH 2Q7NA 1TZHB 4FQXB 2YPVH 4PRAA 3TPUB 4KDTC 4DWHA 1FVDB 5DJZB 1BP3B 1I8LC 2KUTA 2ZZUT 4FRWA 4NZTL 4XP6L 1TQCB 5F96H 3EJJX 1EV2E 4NN6B 4K94L 3IDMB 1IM3A 4XI5D 2WQ8A 1IC4L 5T3XH 2V9QA 2VXVL 4OCRH 1NFDF 2F54A 1S9VB 4RFNB 3O3DB 1PGRB 3BN9D 1Z3GH 2VNCA 4JPWL 3S7GA 1AD0A 1IKFL 3BWAB 2DQGH 2DQHL 1FV1B 4D9RE 5BV7H 4PJ8D 2FX9H 4HMDA 1UWXK 3MV9D 1WLHA 1YA5A 3OBAA 1MNUL 1T1WB 5DD1H 3KPPA 1YY8B 4U31A 5I1JL 5EOTA 2IQ9L 4L3CB 1A6AA 1NFDB 4KDVA 2AK4A 4XVUC 2KKQA 2XIDA 4LSUH 5D7KE 3MREB 5JPMB 3KG5A 2XFXB 3L3GA 4KTDL 5I1KH 5E99H 4LLUA 4RIRB 1P7HL 4MCZA 5BS0E 5ACLA 5C08D 1HQRB 1XGUB 2DIAA 3QFJD 5IQ9A 1KTDB 1FYTB 1AFVL 5BZWA 1XGYH 3LQMA 3D48R 1S7VA 4K9EC 5C0AA 4LLVA 3GIVA 4A6YH 1TCRA 2X9XA 1I3GL 2ICEA 1XF4A 5MENE 2Q6WB 3GSUB 5C2BL 4XCEB 4KI5E 1XFPA 3BEVB 4UU9A 4HK0B 4P5TB 1JUFB 2IG2L 1T21B 4PJIF 3VI4F 4Z7QF 4XC1H 1OWWA 1U8KA 3OKLB 3DO7B 4CN1A 4M6AA 2F58H 2NR6D 5HYSA 3BH9B 1OVZA 3NA9H 1MOEA 3T3ME 5DC4B 5F1NB 3PWPB 1T7XA 3GGWB 3JWDL 3LPFA 5HVWA 2QADC 3MRMB 1WISA 3MR9A 4YQXH 3ZE0F 1GGBH 1IL1A 3CLEL 1FFQA 1D5IL 4PJXA 2D0FA 3FO1A 3MTRA 4PG9B 1DN0B 3LDBB 2NY2D 4PJIB 5TGBA 4W68A 5DVNA 5T33H 5J1AB 4DKDC 4POZC 4FG6C 5DR5H 1ZA6B 4ZTOL 4XPFH 3OAZK 4Y2OA 2EDKA 1FG2A 1Q94B 4LCUA 2XQYK 4CDHA 2H9GA 4YFLI 4YHPA 4QCIB 1MCLA 3GJEA 3DSFL 3V0WL 3D9AH 1F90H 1FZJA 3BWUC 4KPHH 4N0CC 3UTZB 2GKIA 3MJ7B 3K4AA 1K8DB 3THML 2D4DA 2MSPA 2DJUA 2W59A 4LEOA 3IDUA 4XNMA 1H3VA 1PEWA 12E8H 4ODUB 43C9B 3U0TB 2F8OA 1CFVL 1IKNA 3SKMA 1KLUA 3LS5L 1G0XA 3UCRA 5FB8B 1VACA 1F4WL 1CXFA 3PNWB 3HB3C 3IU3B 4N0UE 2VIRA 3BPCB 4MAUL 1QBMH 3ZO0A 1L4IA 4BQBA 2NY6D 1QSFA 1E6OL 2XTLA 4NT6A 4UNTA 5IUSA 4NP4H 2FGWH 3NIGE 4HWZB 4EI5C 3P73B 2OR9L 1FVCB 1NGXA 2P24A 4MWFA 3RBGA 1N7ML 4G8GA 2FIRT 1R3JA 2DQIH 1LEKA 3W9DA 5C0IA 4EI5A 4PJCF 3N50A 3RWGB 1MFCL 2VL5A 4MSWA 3FT3B 4ONOA 3RP1A 1U8JA 1AJ7L 5TE6L 1MLCA 4XZUA 2GTZB 3RA7L 1JPTH 5ISZE 2LTQB 4HIEB 4Z7OF 3FRUA 2ARWA 1XMWA 1AHWA 3AVEA 3MCKB 2EIBA 4JZOB 5KTEL 2ED9A 3DXAD 3GNML 4HZLA 5E8EA 4WHTA 4DOHE 3VW3L 2V5TA 3HI6L 4I13B 5EOQL 3QUKA 2F5BL 4EUPG 3LPGA 4M61A 4PJCB 3QYCA 4G6AD 4POYA 1CICA 1OAXL 2PYEB 3SCMC 3AS0A 4RX4A 1JWUB 2J6EH 5I76B 4N0RA 3JV5A 4JFFE 3E6HA 3GI9L 1E27B 3MJ8A 2W92A 1MI5A 3HZYB 4NKDB 3RNQB 1T0MB 3PXJA 2FLRT 3RNKB 1Q0XL 5DJXA 2FWOA 1FGVH 2W38A 2A6JB 1KG0B 4OF3A 5ETUA 2BNRB 4UBDD 2CO6B 5E1HB 1RK0B 3NABH 5GGSA 1MY7A 4RMRA 3SCMA 4GBXD 1X3DA 5K59F 3JTSB 4HLZG 5CP3A 4E41E 1R0AL 2NY4D 3MRJA 4OD3L 5DDHB 2DL2A 1LK2A 4XHJC 5BRZD 3QUML 3EUUA 4DCQB 3SY0A 3WNMA 4HCRH 1EPFA 4PRPA 2FJHA 5CSBA 4PRIE 4XC3H 3HNSH 1RAMA 4OZHF 2ED7A 2CLRA 4OV6F 2EYTA 1Y18A 4ZFZA 4PJHF 3L3JA 1IEAB 4G8IA 2O5XH 3VRLF 2VYRE 3JTTB 3PE9A 4U6XA 1R3IL 2BSSA 1VSCA 1S78C 2VABB 1OP5H 4X7CC 4RMQA 3LRGA 3UAJC 5FF6A 2XTJE 4CBPA 3VG0H 3KJ4C 4OZHB 4NKIL 4PJHB 4GXVH 1DE4A 3VFGH 4UNVA 4LSTL 4LVHC 3GMPA 4OLUL 3CPLB 4G43B 4E0RA 5GISH 1EGJH 4BZ1L 1CGYA 5SWZE 4LPYA 3TT3L 3UJJL 5GQBA 3QSKB 1DEDA 3FFCE 3IAPA 3FO2A 3Q6FA 2QQNL 3TA3B 1CE1L 5ANME 4L4VB 2R8SL 5IEKA 1U3JA 2VITA 4UOW1 1B0WA 5FYJL 4GSDH 3S98A 5E9DB 4JO2L 2BJMH 3G6DL 4HUWA 3H6JA 3J7HA 2GJ6A 4L4TE 3PL6C 4JFHD 1V3JA 2XQBH 5JW5A 4CU7A 3KPTA 4R7NA 2A9NH 1I9JL 2NXZD 3RL2B 5KSAB 3B2VL 4H26B 1YN7A 2BDNL 3QEQB 1ZLVK 5HHOB 1MVUB 5DJCB 4WENB 3KLAB 5BS0A 2YOCA 3MRCB 3X13A 1YEDA 4ZXBB 2O5ZL 3VJ6B 4I3RL 5GGTA 3QUXC 4OZGF 4FQIH 5CMAB 4KI5C 4MXVE 1MCJA 4QTHA 3WFBH 3IFOB 3PWUB 2DKSA 2CRYA 3DLQR 2DWDA 3SQOL 4ONGH 4KKNA 3ULSB 4JVPA 1VFBB 1Z5LA 5BVPL 3UJIH 4P48A 1EO8H 5CINH 4M6OL 4PFEA 3CUPB 4U1LB 3BIKA 5E8PA 5J56B 3UBXI 3I9GH 2DRUA 1GGCL 1PG7H 4X6CA 1T5WA 1CGUA 2ID5A 3VMPA 3CFJB 3H9ZA 4OZGB 4EDWL 5CIPH 5MEQA 3BZ4B 3HZKA 2F8VA 1IAOB 3MV7E 3SDAB 3CMOL 4PJBA 5F3BB 3GSXA 1IARB 4OT1L 1YPZA 3CLFH 4KKAD 4LLAA 4L5FL 4XBPA 3PF2A 4QF1A 3U30B 1MCOH 4EUPA 3L7FA 3NFSH 4XWGL 1JYWA 5I73C 5JDSA 4TSCL 3T0BA 4G6FB 1A7OL 1AE6H 4W6YB 3HLAB 1DBMH 1KN4H 3OAUH 1YECL 1U92A 4ODSL 1JGDB 3L3OB 4Y2DD 3OQ3B 3V0VA 4NNXA 5D7IA 3QEHA 4P46A 2BRRL 1D5BA 1XF5A 4ELKA 4R97C 5DRXA 3MV8A 4PLOB 4Q9QL 3JUYA 4GAYA 2A0LD 3D0LA 4MMZC 3X11B 1FAIH 1K3ZA 2CUMA 5HVGB 4ZFOL 1HHHB 5ADOH 1RI8A 1LNUB 1A1MA 3DX7A 4N0UA 4ZQKA 3SDDC 1P2CB 1AP2A 2GSIB 2UZIH 4QOKD 3PHOB 4APQB 1JV5B 1FORL 2RGSA 4BQ8A 4LCWD 4HXBH 4HWEL 1LHZA 1GIGL 3WNOA 4Z8FH 3SDDA 4TVPE 3C6LD 4OGZA 4HIIA 4ONHA 3D2UA 3EJYC 2GTWA 4TRPH 4RGOL 3ZYJA 4CU6A 2CDGA 4X5WB 4YEEA 1JTPA 3D85A 2H26A 2UUDH 2ENSA 2X4TB 3WS3B 4X4YB 2YEZB 3NZ8B 3M8OL 5C0FB 1N0XL 2WLZA 4XTRD 1UCBH 1DDHB 5F97E 1OW0C 2CRMA 1OAKH 1NCTA 4FXKA 3BD4A 3SDXE 3LKNA 1CIUA 1WTLA 3HCVB 4MNGB 5ICYA 1NC4B 4R4BB 2DD8L 3DYOA 2YPVL 2SEBA 2J4WH 3L6FA 5C92A 1RZIA 4JM4H 4K3EH 4OCXH 4I4WA 3OB0H 5FHBH 3KYMB 4MX7A 5F96L 1YEHL 1S3KL 1SHMA 1IM9B 3B3IB 2V2XB 4OCRL 1DLHA 2ZSVA 1MREH 1PVHA 3BGFB 3BP5B 5ITFA 5CJ8A 4JAMB 2EO1A 5KANG 4N5ED 4WNQB 4P4KB 4MGXA 4QGYA 3LEVL 3REVA 4C57C 1Z3GL 5JXAL 2DQGL 5D1XD 5IVZB 1JPFB 2VZSA 3FB5B 5GSRA 4XBEH 3C8HA 4KJQD 2HWZL 2APTA 4OUUB 4CNIA 5F70A 3NIFF 4JKWA 2YBRA 2YA2A 4XXDB 1UXWA 4HPOH 3TWCH 5GZNC 5T5FH 5GRUH 1AD9A 3IFLH 4K3GA 2NY0C 2B4CC 2Q3ZA 2IAMB 2W0KA 5HD8D 4BH8B 5K9JL 2DBJA 4OGXL 3FTGA 5FYJD 5I1KL 5E99L 2HFEB 3NCYP 3RGVC 4PD4J 4HH8A 1CFQB 3T08A 4YK4B 5EU6A 2X7LB 2VLRE 3EAKA 4HKXA 4KKBD 3RY5A 1XGYL 5H94B 3CDFA 1ZKAA 4L29A 1MAML 3B9KC 3P2TA 4OD1H 2XICA 4LEXH 4YXKH 3RGVA 3HE6C 5JOFA 1KIPA 1RQ5A 4FP8H 4XPGL 1A9EA 4XCYB 4KMTL 5HYFA 2C1PB 4U3CA 3HC4H 3B9KA 5SWZA 2R2HB 3HE6A 1XF2B 4JCLA 3EYFB 1A7BA 4H8WC 5DGQA 3G6JF 5JW3L 2GK0A 4OCWL 4M7KH 4GRLC 4JM2F 2VDRH 1H8OA 5ANMA 2BY1A 1ONQB 5GZOC 5HHPB 2XXCB 1NUFA 1K4CA 4JFYA 2G9HA 3MGTB 3HKFA 3HI5H 4LSPH 4G9FB 2IANE 4GUPA 5IF0A 5DHVB 1U95B 3VFSB 1KELL 3IXAB 2APBA 4KI1A 4IOFC 2W65B 4NQEB 1MUJB 3G6JB 3DX9B 2DQCH 4N8VB 1G6RB 1LO0H 4JM2B 3HFMH 5F6IC 4JPIA 3LV3A 3MA9H 3QIBC 4XRCA 4G42B 4RISL 1XGTB 35C8H 5HI4C 3S3SA 3U1SL 5DVOA 2YMXH 3OKNB 1RUKH 2WW8A 3MUJA 1RY7B 2WBJD 5GGRA 5GRZA 3ROLA 4DZ8A 2AJZA 2FZ3B 1EEYB 4XNZB 3QIBA 1X5ZA 2YSSB 5DD0L 3EFDH 4AEIH 4TTDC 3VFWB 4QNPF 4OV5A 2H2PC 1Z6JT 43CAA 2ERJB 1QSZA 3BRDA 1ODAA 1FAKT 4HUXB 1FSKC 1I3UA 4S1SH 3FAXA 4K7PH 1FJ1A 1IAKB 2FGWL 2QBWA 2DBLL 5E6ZA 5HGDA 1I9IH 5CEZL 2AJSL 1SJEB 2ZSWA 2APFA 3VFNA 3CDYA 3HZVB 4GKSB 4X6FB 3GJFA 2DIBA 1V5JA 2R4SH 4MA3B 1X5IA 5I1IH 5A16A 4MJID 2DQIL 1LWRA 3TZVB 3QUZB 3MA7B 3P4NB 3H9SD 1L7IH 1KLFA 4LGRB 1JPTL 2AI0L 2FHFA 4G6MH 2C4XA 4LPTA 5FM8A 2CO7B 3UBXB 2DQEL 4OIAA 4P2QA 5GS3A 5ENWA 3ZDXE 1L7TH 4DKEH 2XKSA 1DUYA 1CLOH 2HH0H 4IRJB 3CMGA 3B9VA 3RJDA 3SHSA 5JW4Q 5ACMA 4XP4L 1DANU 2QHRH 4PJ5B 3O6KH 3V79C 4NZDA 3B5TA 4URTB 5I66A 5D6DC 1SEQH 3MLPA 3T1WA 5ABDE 4YHLH 5FYLE 4WFHE 5FUCC 3MYJB 3WN5B 3BO8B 5C0EB 5FM4A 4PD4K 5I1LA 1T0PB 3UJTL 2H32B 1AKJD 4V2CB 5FYKH 2YUZA 1FFRA 2AV7A 3RUGE 4H88H 5IB1A 5DJDB 1B90A 4ZSOA 5IESH 3BESR 3QEGL 5HGAA 4HCRL 2VR5A 5IHUL 4U1MB 2C9AA 4PJDA 2CUHA 1KPRA 1F3DJ 4ODWB 5JHDE 1ORQB 1VEOA 3HNSL 1U91A 2G5RA 5GSVA 2KQNA 5F9JB 5DSCB 3N1FC 4MB5A 1NKOA 3JWOL 3QDGE 3MUZ1 3AMLA 1BEYH 4HV8A 2D03H 5DJ0B 1EFXB 4JZJC 1J0JA 1CXLA 4QXUH 4WI5A 5D7JD 4LKXB 3LHPH 5BOZG 4R6UA 4ZAKD 1IT9L 3KJ6H 3RWCB 3O6FC 3DIFB 3KPOA 5K9QG 1J8HB 3AC0A 3OKEA 1JYVA 2WIIA 3Q5OA 4P3DA 5KVFL 4JZJA 2AGJH 3UDWA 2CD0A 2O61A 5E8NA 5AG8A 4NO3B 3UTTE 5FDYA 1XGPB 2Z91B 1NCAH 1P84J 2CMRH 2ZOLB 5D72H 3BHBB 4M8QA 2N1KA 3T0AA 1CI5A 1G7JA 2FYYA 3O6FA 3KHOA 5GISL 1NMAH 4YXHH 4Z78A 4O4YL 4LSQL 4Q6IB 2IADB 4GW5A 2G75A 1CLYL 1ACZA 3LIZH 2V9RA 1K9TA 3RKDD 5E70A 1FZOA 4JVUA 3DURA 2OP4L 4N0FA 1KB9K 5F7YC 5FUOH 4GO6B 5C9JA 1HOCA 3L5HA 1LE9A 4NM4H 1DBBL 4OM0L 1M05B 5BQ7B 5CAYB 1N64H 2UWEE 1CGTA 4Y16D 2FH8A 4FQ1L 4UINH 2PO6D 5EZOL 2OTWA 3RVUC 4NOBA 2Z31C 5HSFA 2ARJB 2B0SL 2DQUH 4XVJH 5TQ0H 4N8PA 5IHZA 5LBSL 5CP3H 2XQBL 4R4FL 5J3HD 4ZUSB 4K3JH 5EDXA 3VH8G 3VFMB 3GMOB 3BYYA 4J23A 1KB5A 2FATL 3BIBX 2Z31A 3O9WA 4N9OB 3GM8A 5JZ7C 3SE4C 5AUMB 4PJ9D 1MJUL 4P57B 5IMOA 4UB0L 5CGYD 2VLRA 3L1OH 3FONB 5K9KB 1A6TA 3UTQA 1GH7A 1XZ0A 1RVFH 2R2CA 4WWKD 3BGMB 2QSQA 2I9TB 3WFBL 3IXTB 2LQRA 3LH2H 3BDXA 3PWVA 3RWHB 3SE4A 5I1CH 3FQXA 1XCQA 5CBEA 5BW7C 4UDUB 2ZCHL 5D96C 3UJIL 1TJIH 4UIMA 1F8TH 5H2BB 5EO1A 3O4LB 3QPQD 3EGSA 4H1LA 1A14H 3GMQA 3BD3A 5DK3A 5IVXE 2XWJB 1S7SA 1I3VA 1BIHA 5BW7A 3FOMB 3ULVE 2BK8A 4U6VH 1W0VA 1OLLA 1I9RH 4KJPC 4O2EB 4F57L 1IGJB 3OSKA 2HG5B 3BN3B 3RGHA 3GSOB 2VLJD 4TOYL 4NSKB 4KQ3L 2E27H 2EXWD 4X99B 4HWBA 5J4MA 1MCOL 4Y5VC 5EWIH 4PREA 5CEZD 5C6PB 3NFSL 4RMVA 4YBQC 4F7EB 1QSED 2Q87A 5KVGL 3MRPB 5BV7B 1DL7L 3M1BA 4GKOA 1AE6L 4HT1H 3TCLB 5DWUL 5HI3D 1HILA 1RZKC 4JFDB 4KMLB 1OAUH 3EO1A 3S3PA 4ZNEA 2VDLH 2ADGA 4LNRB 3O4OB 3GM0A 2BVPA 3Q5YA 4X7SH 4HKJA 1A64A 1OAQH 1WZLA 1ORSB 3KYKH 3IU4H 4P2OD 3D0VB 5J6GB 5TFSH 2R0WL 4BM7A 4Z0XA 5D8JL 1SMOA 1IVLA 3U0PA 1KBGH 2PXYD 2ITCB 1KJVA 4JPKH 4ZTPH 4KK8D 2JJTC 3HG1A 3MRIA 3T65A 4X6DF 1LO2H 5DRZB 1IBGH 1ZT7A 5DJAB 5SWSD 2CQVA 3NCBB 3O6LL 2EDRA 5B39G 3SJVE 2C7UB 4Z7VE 4O00A 2IGFH 1OF2B 2JJTA 3OKMA 3VDAA 4Z8FL 4PY8J 1S7RB 1TTGA 2F74A 4ORGB 4OFYA 4LKCB 1HSBA 1NAKH 5EC2B 1P84K 2DOCA 1FFNA 5FIEA 1PYWB 3C5JA 3QZWB 2BMKA 3MUHL 4HC1H 4BK4A 1QO3B 1CD8A 3P9LB 1V05A 5ERWB 3BZDA 3MRGB 2VH5L 1W0WA 2WLYA 5LGJA 1LEGA 1DUZB 4PYHA 1CU4L 2OL3H 3FQNA 2B8OT 3W39A 1JI1A 3QNZB 3MBXH 4EN3C 5DLML 2R69H 1JGVH 3MO1B 5CEYB 4NQDB 5IHBA 1IGYB 2D0HA 4G8FB 4JFEE 4JHWH 3S97C 2W60B 1K2DB 5GIRA 4F7CA 1SYSB 1UJ3C 3CSYA 2FR4B 5D7SH 1OTTD 4O2FA 4OZIF 4H0HB 5GS2D 3B43A 5DFVC 3H9HA 8CGTA 3LMJL 4EOWL 3K74B 3X3FH 2ESVD 4ODXA 5C3TA 3RDTC 3HNVL 3I6GA 1UB5A 1SEBB 1IGTA 3OXSA 3ZDYF 2J4WL 1B2WH 1MCIA 4KKLC 2GT9A 4K3EL 5F7FA 3TIEA 1J05B 4DFHA 2HTKC 4M43H 3QO0A 4NZJA 3RDTA 4OZIB 2BX5A 4AIXA 4HLZH 3HC0A 1LMKA 3D5OF 2NX5D 5ILTH 4EBQL 5E2VL 5C09A 4ZUVB 3VH8A 4K55A 2HJKB 3JZ7A 3VWJB 1LO3H 1A5FL 5CZXD 4NC2B 3HAEB 1YYLH 3DMMA 4NJAH 1RZFL 5JW4M 4Z0BH 3TF7C 1H3XA 3MLZH 1W8NA 4ISVB 1CFNA 3KXFD 5T5FL 3QEUB 1G9NH 3LEYL 2JB6B 1V7MH 5IEHA 2EH7L 3QIWB 3I85A 4IMLB 3U4BH 2WWMC 3MBED 3QXAA 4F7MA 4JRXB 5F7EL 2YWZA 1MFDL 3QIUC 5E2UH 5J6HA 3WJJC 2W0FA 3SDYH 5E8DH 1MFBH 4YXKL 5C86A 1FNHA 3MLWL 5GRJL 5HJ3B 4M8VA 5FA3A 3EKCA 5IR1A 2YKLH 1NAML 4JRYD 2WUCH 4P9HL 3EFFA 4WEUD 5F7UA 1NFDE 2V2WA 3WJJA 3EZ8A 1YC7A 3NAAL 3NPSC 3SE9H 5LG1A 2GITA 3HC4L 4XNYH 3ROOA 2IPTH 1G7QA 2Y6SD 3NGBB 4U1KA 4HXAH 1HQ4A 3NIDF 1CD0A 1S9WA 4LLYB 2HJLB 1FYTE 2RCSL 3O2WH 3T2QA 4KJYA 4DN3L 2PW2A 2VDRL 1HXYA 1R3HA 2P44B 3MRKB 3NZHL 4PP2B 2X1QA 4LSPL 4PGBA 1RFDH 1T0NA 2HT2C 1JTOA 2MWCA 1BBJB 2GI7A 2NY1C 1NLDL 4JJ5A 2N4IA 2LFGA 5E6IA 1CGVA 5TQ2H 4NQXB 3GEWB 3HFML 1KJ2H 3IJYA 2EIZA 1ZWIA 3JBG7 3DSNA 1Q9LA 3TBYA 5GGQH 5D71L 1BQHB 3PWPE 1FPTH 4HKZA 4DGYH 1A4KB 3W0WD 2YD3A 3HPJB 3UC0H 3P3YA 2HRPL 4PP1D 1WBXB 3WSQL 1BFVH 4WWID 3V8OA 3EFDL 4KVCH 4ACPA 2VZUA 2Z92B 4OKDA 1QRNA 4PJIE 4RWYH 3VI4E 3ULVC 4Z7QE 3RWIA 5E2TH 5EN2B 5D1ZD 2B4CH 3PWLB 3KPLB 3PWJB 4Z76B 4JGJA 4S1SL 3UPRB 3VFPB 1D6VH 4AG4L 4JVWA 4K7PL 2Z8RA 1I9IL 2DQDH 2GSGA 3ES6A 3RZCC 4X0KA 1J8KA 3ZE0E 1AR1D 2Z93B 4JRWA 1OAYL 1UC6A 1NCWL 2DMCA 3S35H 4K9EL 3CDGB 4LFHD 5I1IL 5C3LD 1ZGLA 1LQSR 2FB4L 1YEKH 3BAEH 3HC3H 2CKBB 4NHCH 3RZCA 4ODHL 4HPYH 1L7IL 1NGYA 3CVHA 5L2KB 1NLBH 4YDLB 5LWYH 1A47A 4G6ML 5IFAL 3H2WA 4L3AA 1N6UA 1Q9OA 2NTFB 1T2QL 5HDQH 3G6AB 1OPGH 1BVLA 2D31A 3VE0B 2JK5A 5KW9H 1ZTXL 1HINH 2HH0L 32C2B 3ULUC 3RWDB 1FL5A 3FFDA 3VGFA 2HFGL 5D7LD 2I24N 2BSED 2L4OA 5I18L 4J7RA 3O6KL 5F1IA 1RHHA 4L8BB 4OLZH 4RAUA 1B6UA 1HI6A 4U2YA 1IEHA 1U8HA 4RZCA 3ARXA 4YHLL 1XH3B 4BUHA 3PV7A 5T3ZL 3CFEA 4K7FA 2DQFA 1HKFA 5ESQB 1MWAH 3HRZB 4HIJB 5JNYB 3ARFD 2X5PA 3ARYA 3IFPA 3VXMB 3VFRB 4BSVB 4YWGL 3BKYL 5FYKL 3KHQA 4NRYA 5AG9A 1N6VA 2HYMA 1PY4A 4LASH 1X9QA 1UM4H 2BC4B 2EC8A 1Z0MA 2HT4D 3O6MH 1WEJH 1MF2L 2MCPH 5F8RC 1CN4A 2JIXA 3OR7B 4PJCE 5I75C 3H7BB 1BZ9B 4Y88A 2PYEE 3IGAB 4JO3H 3DARA 1HXMB 1TQBB 3VWKC 4Z7OE 4QYOA 2UY6A 3FN0L 4U1SB 4TSAH 4TNWK 5D1QD 5DJ6A 3BVNA 2BNRE 1UH2A 3GJFH 3HPLB 4DVBA 1GGIH 2ZUQB 3VWKA 1BEYL 5EBWB 3EO9L 4QXUL 4UOW0 3GB7B 2EKSA 4ZUUA 3MV9B 3LHPL 1IE5A 1EBAA 4HWNA 1P9MA 1CE6A 2EC9U 2ATPA 4WHYG 3PV6B 5LXGL 1U3HD 4LLQA 3GHEL 3QDJA 4OI9A 4ERSH 2AGJL 5TH2B 4LDEB 4LLDB 4XVSL 3C2SA 3F6LA 4YBLB 4M1DH 4YXHL 1NMAL 1XF3B 5K59E 2P5WD 5C08B 3DTXB 3QFJB 2VWEE 3FZUC 5BZDB 3KNBB 5C7XH 5TDPB 1FIEA 4ZS6D 5A40E 4QY8A 4JLRB 5DYOB 5TF1H 3WUZA 5FUOL 1WAAF 1B4RA 4FQXC 1Y0LB 1KTKE 1ZHLB 4KK5D 1G0DA 1YEGH 4NQVB 3I50L 1G7PA 1TQCC 4XCNA 1CDIA 2AVGA 4OZHE 1JNLL 1DEEB 1NCBL 1WCBB 3B2UC 4NN6C 4NQCD 5EBLA 4DJMA 4I0CC 4UINL 5EU7E 4PJHE 4JDVB 1MJ7H 4N90E 4OZFG 1W72B 3AXLB 4FQXA 3TPUA 4YGVA 1FVDA 4O5LH 4F58L 4RFNC 3VRLE 4J6RH 2OYPA 3GBLA 4XXCC 2Z4QB 4X6EA 3IDMA 3QHZH 4TVPH 3DECA 3S34H 4MA8L 2D3VA 3B5GA 4I5BB 1WICA 2F54D 2CPCA 1S9VA 1KULA 3O3DA 4FABL 4L4VE 5I8KL 3BWAA 3L7EB 3V52H 5IROC 1RVFL 1RZ7H 1AXTH 4WCYL 4YXLH 2NY2B 1BGXL 1S7WA 4KU1A 5E9DE 1IGIH 2F19H 5I1CL 1T1WA 1YY8A 2OSLB 1WGOA 2AK4D 1IFHH 5IROA 2AJ3A 5J11C 5JPMA 2XFXA 3QEQE 1BM3H 5HHMD 3MLUH 5HHOE 1BAFH 1HQRA 4UI2A 1XGUA 1G7IA 5BO1L 1T66C 1KTDA 4LVOB 1I9RL 4JB9L 1JWSB 4TULL 4NUGH 4MNQB 4XCCL 3ILPB 4OBRA 5E0QA 2AK1H 3SGKC 4PJGF 5C0AD 3F8UB 5EWIL 1FFPB 4P5TC 1UCTA 5EH1A 5DS8B 4WTWA 2NY6B 4JFPB 3L95B 4WO4B 1Y6NR 2Q6WA 1MHPH 5H37H 3DYMA 1ITCA 3H3KA 5KBNC 3VXQB 5EU3B 1T5XA 1F13A 3C9NB 3SGKA 1WBYA 3BEVA 1EEUA 4PGDB 1WC7B 4LMQI 1BVKB 2GFBB 4P5TA 1JUFA 3WFDH 4OZGE 4KKCC 3OKLA 3DO7A 4MQXC 2DLTA 1J0KA 4HFWB 1OQXA 3BH9A 4PJGB 1U8OA 2F15A 3P30H 3LDBC 3GGWA 3ARQA 1OAQL 2VKXA 2BVOB 1E4XH 4C58B 3MROB 1DQQB 2V5RA 3E0GA 1H9VA 5IW6A 2A1WH 4PJIA 4JPKL 3DXAB 2OTPA 5MHSD 2FSEB 5J1AA 2QQKH 5GGTL 3WLBB 2QADD 4Y5XB 3VD4A 1ZA6A 5C71A 4RGMC 3V4UH 1IBGL 1BZ7B 3VA2C 1EX0A 3ZKSD 4F37K 1ZANH 5DJYB 5T3ZD 3MJ7A 4U6HA 1K8DA 3X17A 1DQJB 2YD2A 4POZD 4FG6D 3WXVL 3ESUF 5DD5H 2E6QA 1MIEL 4ODUA 3U0TA 3U46B 5FYKD 4N0CD 4FOMA 4GBXB 1LVEA 1ZLSH 4WW1B 3PNWA 2EH8L 4DUXA 5FXCH 4OCMC 4OQTA 3BPCA 5F6HJ 1ZLUK 2NY4B 1ND0A 1QSFD 2X6MA 3V6OA 1ZVHA 1X4ZA 4JHWL 4OB5L 1S5HB 5DI8B 2VXTH 5DUML 4C54A 4X4ZA 5GRVL 2E7MA 2B1AH 3HB3D 3V5DA 5JQ6H 4D9LH 3I2CH 2XN9A 2LTQC 3X3FL 4G8GD 3TO4C 5IBTL 3OAYK 3ARGB 1PKQB 4EI5D 4ZFGH 3RL1B 3RWGA 2UY7A 4PBXA 2V17H 4OSUL 1NGWB 4OZFA 3N0PB 2GTZA 4HIEA 3TO4A 1I1AC 2DMKA 5C0BA 5ILTL 3B4NA 2ORBH 4OLVL 1GGYA 1P7QB 3PABA 2GUOB 1LO3L 2FHBA 4LU5H 1RUPH 4MNGE 5JORB 2K9UA 1CICD 1I1AA 5HYQB 1NDMB 2KBGA 1A7NL 4YPGB 6FABH 2XZQH 4Z0BL 4RX4D 4F8TA 3TCXA 3TT1H 3RU8H 1MI5D 4NKDA 3RNQA 1QR1A 4ZPTB 3WUWB 2NLJA 2HMID 4OFVA 1YDPA 1RIUH 5KS9F 1V7ML 2A6JA 2BNRA 3RKPA 2P5ED 3S4SG 1RK0A 3H7LA 1HNGA 1SMAA 3SCMD 3DVIA 4LBEB 3O8XB 2IALA 5CBAA 4U7KA 4Z77B 3CXDH 4KY1H 1HH6A 4NZUH 4OI8A 4EXPX 1GOGA 4WFFE 5E2UL 3LQZB 1UKQA 1TVBB 5LQBL 3CFKA 5IJVB 2WBKA 3EOAB 5E8DL 4I48B 4PRPD 2P42B 4NWUH 2YKLL 4BFEA 5I0ZA 5KS9B 3D25A 1CT8B 2HLFC 2NXZB 4MD0A 4PGZA 4HG4J 2P7TA 3ARVA 4XNYL 3IKCA 5J89A 4I3GA 1IEAA 1UZ6F 3TYGH 2OZ4H 3JTTA 5K9OB 1BBDH 4UV4L 4Y7MA 3NIFE 4IDJH 5FYLH 2HN7B 1BOGB 1CF8H 2X40A 1MEXL 4Y19D 4PJHA 1S78D 2OXGA 1YMMA 4QXWA 5ID1B 2C5DC 2R8SH 3QH3B 3UAJD 1UVQB 1I1FB 2BVYA 5AYQA 1S7QB 4GAGL 3S6CA 5JUEH 3U7WL 2MPAL 4H20H 1E4WH 5C6TH 5CCKH 2PETA 2AP2A 3ZE1F 1IGMH 1F5WA 3RWJB 2BCKB 2XKNB 5HVHC 4FZEH 1BFSA 4QEGA 3L5XL 1RJZB 1T1ZA 4JQIH 2XZAH 3UC0L 2ZWLT 3AU1B 4G9FE 1BFVL 1S9XA 5KSAC 4KVCL 4M02A 1UWEL 4MB4A 3MRLB 5MEPA 2GJ6D 1ZHKB 4NQEE 4RWYL 5IMLA 3MOBH 3G6JE 5I17B 3F12B 2EE2A 4Y1AA 2PW1A 5F7MC 5E24E 2NCMA 3PGFH 4Y2DB 4NRZB 3SOBH 1QFPA 5KSAA 1MCHA 1OT1A 5HHOA 2DQJH 5BS0D 3KLAA 4NCC1 1BHGA 1FYHB 2VDPH 3PDDA 1FLTX 3N9GH 2VDML 1RUMH 5CMAA 1R5WA 3IFOA 3MNVB 3UTOA 1KCRL 4IIQB 3OPZH 4F7TB 4NHCL 1T3FA 5KZCB 4KH2A 1UB6B 1NBYA 1VFBA 3T8XA 2OLDA 1NLBL 5IK3B 1I85A 3SDAC 3CUPA 4XP1L 5T1KD 3PP3H 4LCWB 5FK9A 3NFNA 5HDQL 1OPGL 2VXSH 3ALWA 4YHYB 4H8WL 5IV2B 3L3DA 1HWGB 3CFJA 5I2IA 3U30C 1MFNA 4I8DA 4OZGA 4CVWA 5IMKA 3I6LE 2EECA 3VG9B 1IAOA 3LEXB 4HQQL 4HF5H 1N5AB 3SDAA 3W11C 4LVEA 4C4KO 5F3BA 4QNPE 4OKVA 1M7DB 1SBSL 3QULB 1RPQA 4O9HH 1MY5A 3QUMB 4M03A 2VQ1B 5HGHB 5D9SA 4HHAA 1UENA 3CCHB 4LCIL 1B88A 1JPGB 4F33B 5JIKA 1ZK9A 4JHBA 4V2BA 3R1GH 3MRDB 1A3QA 1KC5L 3BP7A 4O02L 1XEDA 3HLAA 5H8DA 1UXSB 2P45B 3ZKMD 4RFOH 3JV0A 1CXEA 3ZTNH 3S4SA 3O6ML 5F3HB 3HR5B 2R1XB 4WGWB 3VXPA 4JKKA 4RSVA 1PKOA 3GMMA 3LOWA 5FO7A 2A73B 1WIPA 4PJ5E 4P46D 1KXTB 5DMIH 5GGVL 5T1MB 4HG4K 3MV8D 3MJGX 4APQC 5K93A 4BQ6A 4N8VG 1PJ9A 4J4PC 1KUMA 4OBSA 4P9ML 3ULVH 5DEGB 2E6PA 3H3PH 5EOCL 1OAZL 4DQOL 3KYNA 1HHHA 4FQCL 5HY9B 5A3ID 1A02N 1N26A 1LNUA 4V1DA 4OD2B 4Z9KB 1P2CA 2X4SA 4YHIB 1JHKH 2GSIA 5D1XB 3MLSL 4J4PA 3WLWC 3A0OA 5F7LB 5TF0A 5IB5B 2MKWA 4LVNB 5IFJB 3SDDD 1OCWH 2HFTA 5HXMA 3VXOA 3F5WB 4XT1C 3SQBA 1XGRB 4JFZH 5LAXB 3QG6A 1WFOA 3D2UD 1NJ9B 4RBPH 3BKMH 2BVQB 4X5WA 3D85D 4FTVA 4LIQL 4QHNA 2Z35A 4BFBD 1DQMH 1QVOB 4ZO7A 4X4YA 4PBVC 4G80B 1DANT 4XVTH 1I1YB 4CVUA 3NZ8A 4AL8L 3EJYD 2DS4A 4PUBL 2I60H 1DDHA 1UFUA 2UVEA 4ODTH 1MIMH 2AJUH 4NIKB 1BF8A 1J8HE 3DBXB 5CP7B 4TNVK 1HHIB 4FFVC 4MNGA 3V5HA 3OXRB 1CBVL 1KNOA 1UEMA 1J1OH 3BGFC 3OJDB 3ZYZA 4C83B 5GRVK 1A6WH 4G6KH 3OG4B 4O5LL 4JQVC 1HKLH 5J8OA 3UBXG 2BXYA 3KYMA 4AENB 4I2XB 3TJEL 4KK9C 3HHRB 3KLDA 4OAWA 3EO0A 2BOCB 1AY1L 2XG4A 3K1KC 3QHZL 4TVPL 4HUVA 2CR3A 3S34L 1HEZB 4RRPG 4KRLB 2COQA 2CK0L 4JQVA 4WNQA 3C09C 4RA0C 2X4UB 5T1LA 4UUJA 3CFDB 3C5SB 4W70A 1JZ4A 1DBKL 5L8KB 4XMKL 4YXLL 3H0TB 2BY2A 1J1XH 1IGIL 5A1AA 1EUUA 1K5NB 1M6OB 3KPMB 1IRAY 4G7VL 1XGQA 4YK4C 5FDWB 1IFHL 4LQ1A 2GQHA 3TVMC 1NBVL 4KQ4H 1IAIH 1FDLL 4B50A 1FNLA 4BH8A 3S96B 1BAFL 1W8OA 2WBJB 4Y5YA 5DVKA 5GZND 5EU6D 3S37L 4HMCA 2X4RB 5FUZH 4Z7WF 5LVEA 3TVMA 2NY0D 5DTFB 1E0OB 4CL7A 3NCJL 5E8OB 1JK8A 4OIIH 3RGVD 1YQ2A 1RIVH 2NY7L 2NNAA 5I71B 2V5SA 3VGEA 4ESKA 1IEBB 2YPLA 3CDCA 4U6YA 2C1PA 3Q6GH 4KFZC 2CLVB 3KLSA 3IDGA 3O4LE 3B9KD 2W9DH 3R06B 3F6IA 5SWZD 4KZEL 2R2HA 4HJ0D 3HE6D 3LKPB 4Z7WB 2VLMD 1XF2A 4WW2A 3WFDL 1RJCA 4ETQB 1N4XH 2ED8A 3DV6B 3EYFA 1ZT4B 4PRDA 4J2XA 3AAZB 5KOMC 3SDCB 4LAQL 4MJIB 2YUXA 2DB8A 3MLVH 5EOCJ 3QI9A 1KB5L 4JM2C 3WIIH 4G9FA 3MNWB 1U95A 1T22A 1MQKL 5E08L 1TNMA 5LCVL 3IXAA 2W65A 4HS3B 5GZOD 1LDPH 1I3RA 4Z7UA 4HKBB 2QQKL 4ZS7H 3DX9A 1JZ6A 2V7HB 4N8VA 2KZ1B 4JM2A 1CDBA 3V4UL 1FG9C 2W07A 2H2SD 1MJ8L 4M5YH 2D7NA 3O45A 4JFDE 4G42A 4IOFD 3WL9A 3TBWA 5E5MA 3AB0B 4ZUWA 3WDHA 4QRRA 3BPOB 5F89A 1RUQH 2BY3A 2ERJC 4XAWL 3LD8B 1P4IH 5C0JB 3DV4B 3QIBD 15C8H 3WDIA 1MH5B 5IB2B 3MMEA 4YJZL 3VFWA 4QGTA 3SE8L 2HLAB 2Y4SA 5I16A 1I8IB 1VENA 1TZIA 3IDJB 5EO9A 3PQYA 4R96B 3QA3B 3C60D 3DUSB 4KTEL 4WEBH 5EFIA 2NW3A 1E4XI 5IJKC 5KJRH 4HWBL 5JR1L 4JO4H 2VXTL 1SJEA 2H2PD 1PX3A 4D9LL 4GKSA 1NGQH 5D2NC 4MA3A 5IJKA 3FAWA 4PLKC 1VHPA 1P6FA 3H42L 1FBIH 3MA7A 3OJMB 4UQ3A 4IRJC 2V6HA 3BQUD 2JLLA 5D7JB 1RZGB 5D2NA 5IG7B 4NQDE 5DRNB 3E2HB 2WM0A 3QAZB 4P2QD 3UBXA 3JV4B 1I4FB 1RZKL 1HHKB 5IGXL 1MHEB 5D4QA 1ZS8B 2B2XL 4IRJA 1WV7T 3L3HB 4LU5L 1RUPL 4KZDL 1RZJL 4JY6B 1DSFH 1AGDB 1JMZA 4RRPA 4PJFA 3WN5C 1HH9A 4A2LA 1QQDB 4XCFH 4PJ5A 1WQVT 4XGZB 1QNZH 4F8QA 4AZ8A 3ZT6A 3C8KA 4FFWC 3DUUA 4XMPL 5B3NA 3OGOE 1BX2B 2GHWB 1WF5A 3RU8L 2DL9A 4XP5H 1OTUC 1SVZA 3WN5A 1RIUL 3BO8A 2HFFA 3FRPG 1PG7X 4OZIE 1H8NA 3EYSL 1E6JH 2FCBA 5JMRA 5KSBF 3CXDL 4KY1L 4Y16B 2FX8H 2DDQH 3QQ4A 4I18B 4WHYH 1S7UA 4MA7H 3I6KB 1C1EH 1RJYA 4R26H 3ZDYE 1JRHL 5F7WC 2XZCH 4Q0XL 4I0PA 5CKAA 3Q1SL 1IC5H 4OQTH 5DJDA 4TVPD 1VPOL 2IC2A 1TJHH 2ZUYA 4U1MA 1HCVA 4NWUL 4OQ1A 5B22A 4B0MM 2X4NB 4ODWA 4HX1B 1ORQA 3UO1H 2LU7A 5DD3H 5KSBB 2D7OA 4R4ND 5EZLB 4JANB 2OI9B 2A6KA 3ALPA 4PJ9B 4UTAL 2ZUTA 5AYUL 4NM8H 3U2SA 4EEEA 1NSNH 2AXFB 4WWKB 3MCLL 4JRXE 2PCPB 2X2YA 4N9GA 1JWMB 3DWTA 5ITBH 1FFOB 2VZOA 4LKXA 3RWCA 1MWAB 3Q0HA 3DIFA 3QZWG 4C56B 1TVHB 4OLXL 4Q6IC 4YE4H 2BNQB 3JWNC 4JREB 1URLA 5EG6C 4NYLB 3GI8H 4NO3A 5FO8A 2Z91A 3FO9B 4K23L 2ZOLA 3BHBA 5IMMB 2YZ8A 3O6FD 2HTLC 3LQAC 4YDIH 5IHLB 4Q6IA 5JUEL 2YN5A 2IADA 4ENEC 1M7XA 1TCMA 4PV8A 5DK2B 3UPCA 5B3JF 5C0NC 5C6TL 3STBA 1IGML 1I1CA 4L3EB 4BQ9A 2PTUA 2E6JA 3M17B 1UYWL 4I77L 4M93B 5CSZB 5BQ7A 5CHNA 2HRLA 2E9WA 5JPNA 1QSEB 4X6BB 3T0EC 1KTLB 3UX9B 1U8PB 2JB5L 4WV1A 1EHNA 3GMNA 2ENYA 3SGDI 3DRQB 3MOBL 3NIDE 2AS5M 4ZUSA 4X9IA 3VFMA 4KUCD 3T0EA 3RVUD 2Q1EA 3O9WD 1S8DA 2X4OA 3TV3H 2DQJL 3HAEG 2Z9TA 2VDPL 1EERB 2VB5A 4PV9B 5AUMA 2VJXA 4KGLA 5K9KA 1A7QH 3QNXB 1B4JH 2CXGA 3BGMA 4M1GL 2PXYB 2I9TA 4OJFH 4P5KB 5F9WB 3F58L 3L3KB 5JZ7D 5DQ9B 2V7NB 4UILH 3EOTH 1A6ZA 1U8IA 2R0KH 5EZJB 3RWHA 1OT2A 1MHCB 2A77L 3UYPA 3OZ9H 4ZO8A 1BJMA 1N2RB 3EYUH 2CIIB 4S0SD 3QPXH 2XWJA 4M6MH 1FL6B 2FJGB 3NVQA 2X09A 2X1OA 1INDH 1ZVYA 4HF5L 1ITBB 4O2EA 4HIXH 1IGJA 1KFAL 1QUNA 2MHAA 5J06A 3VFOB 4ZMAT 4MA1C 1U6AL 1SBBA 4R90H 2HG5A 5I1EH 1T20B 5BV7C 1JZ8A 4KGJA 4J8RB 5J12B 2MKLC 1A1OB 5FCSH 2XRAH 2HVJA 2LU4A 5L2KE 2XA8L 3VXUA 5DF0A 4F7EA 1PFCA 3WIFB 5T1DH 2BXZA 3TEUA 4YDVA 4F7PA 1Z9OA 3O4OC 5GJSH 1T1XA 2P8PB 2XNAA 1UKTA 4AIZB 4YDKH 3TCLA 3ZKNC 1D9KA 4OFIA 2OMNA 1U8NB 1OM3L 4KHTL 3ZTNL 2EDYA 1INEL 3FRPA 1GVIA 4E5XB 2ESVB 3OMZA 4YBQD 1BQUA 1KEMH 1H5BB 3VGAC 4PLJC 4JN2A 2GAZB 1F11B 5TPWL 1J10A 4JY5L 3W9EB 2FIKB 3Q48A 5GJTH 3D0VA 5DJ2B 1OARL 4P2RD 1HN1A 2YXFA 4RWHA 3ULVL 2HKFH 2ITCA 5JLZB 3WHE1 3F7VA 2H45A 3G9VA 3HG1D 1CR9H 1BECA 2CLZB 1FE8H 2G5BB 5I8CB 5EU5B 4QWWC 1NFIA 1JHKL 3VXME 4A6YA 5DRZA 3QDHA 4ONFH 2C7UA 3CVHL 4Y4KC 3W5MA 3AS1A 2NZ9D 1OF2A 4TVSa 4DGVH 5KN5B 1OCWL 3FT2B 2D7TH 3TN0A 1TJGL 2RHEA 4GLRH 3BKML 5DEZA 3QZWA 4WI2A 5TE4L 3P9LA 4PS4L 1Q9KB 4X6DA 4Y4KA 3JV6B 1P1ZA 3MBEB 5KVDH 3V8CA 4ZOEA 3QG7L 3SGJC 3QNZA 3TIDB 3MO1A 5CEYA 1T04B 4NQDA 5E94B 1IGYA 3MV9E 3ULUL 4G8FA 4ODTL 1SYSA 1MIML 3A67H 4PJAF 3SGJA 2F5AH 3WIHH 2IPKA 4J1UB 5L88H 3P4OB 5E5UB 1HDMB 2V5YA 5GGUB 4LPVA 3EYOB 4J3XA 4G6KL 3IF1B 3V5KB 2R4RH 2Q76B 1HKLL 1EH9A 4WFHD 1Y6MR 4IJ3B 3PWNB 5C08E 3VWJC 3QFJE 1J05A 3MLTB 5CZVL 3NACL 3OG6B 1YMHB 2EO9A 4RMTA 3ILQD 2R56H 3RDTD 1OOAA 2WNGA 4PJAB 2WINB 4HGMA 3MLXH 4JCMA 5C09D 4KKLD 4MXQC 4ZUVA 3DYPA 3VWJA 2Z0BA 1TDQA 4M62L 2HTKD 5CEXA 1X6NA 1D5ZA 4LOUC 3DMMD 3CVIH 4W6WB 3EJZC 3QIWC 2ZUSA 4KROB 3QJFA 2E3VA 2FD6H 2H3NA 1S7TB 3QUYB 3CX5J 1I7TA 2D7PA 1O0VA 4ISVA 2KQMA 1WAAE 5DA0B 4TNWF 2AW2A 5EZIH 1NPUA 3U9PH 2EC9T 1HIML 4PB9L 2RQ8A 5CJQL 3BUTA 1JGUH 3QIWA 3KPRB 4IMLA 4WI9A 5HHQA 3W0WB 1WITA 1YY9C 3UPAA 2YWYA 3JUZA 1DFBH 1F02I 1MCBA 4RMUA 4JRXA 1R3KB 5F9AC 4AM0B 2VZ3A 1WIUA 4F3FB 2X4QA 3NGBC 2XQYG 1T03H 5HJ3A 1SY6H 1RIVL 2YK1H 1T7YA 4R7DB 1CLCA 1EK3A 3MUY1 5I8EB 4PYGA 5ACZB 1MCSA 1QFUH 1H3UA 1FO0B 2YD9A 3MRFA 1INQB 3QCTH 2K1MA 3RVTC 3VXSB 1N4XL 2J6EA 3P11L 3MXWL 3QCUL 1IAII 4MJ4A 4QRUA 4DEPB 5AZEH 1WT5C 1I8MB 3QWOA 3T77B 4MNQE 8FABA 1FZMB 2UZXB 3MRKA 3QISA 4WUUA 2R2BB 1BBJA 4R8WL 3ZHKA 2QSVA 5FV2A 5I1DB 3BEWB 1MCCA 5E6ID 3RHWK 2DN7A 4ELMF 2NY3C 4QHKJ 4QRQB 1QZ1A 5FOJA 3D18A 3ARDA 4M5ZH 4PJGE 3VXRA 1IGCH 4WU5B 4FQLH 4YO0B 1RUQL 4GKNB 1B0RA 5DQDH 4UAOB 2D7QA 3HPJA 1G7LA 5KVEH 1A6UH 4ZD3H 3ZKXB 3NBNA 1HHGA 4QRTA 4ELMB 5IW3A 3QQNA 3RTQC 1QRND 3RAJH 3DXAE 5B38G 3WNLA 1GPOH 3KVQA 3K46A 4RQQA 3DRTB 1JNHB 1TXKA 1RHFA 1KCKA 3PHSA 1ED3B 4Z76A 3T0DA 4PRHB 3VFPA 4PGJA 4PTUA 3ZMRA 1A2YA 1M4KA 3RTQA 3GSWA 5BJTB 4WRLA 1BVZA 2GK2A 1EGJA 3N85H 1NGQL 5EPMB 4YDLC 4KC3B 4H0GA 2VDOH 1KT2B 1FBIL 3RZCD 3TPKA 5EUOF 3WS6A 3BUYA 3IKKA 2FDBP 4XMLH 5L2KA 5C0DA 3TBSA 2P48B 3IT8D 5BXFA 1G1YA 1YNLL 3BP4B 4ZDHB 3TYFA 3GKZA 1RK1B 4O58H 5DHVH 2VN4A 5EO0B 2OX5A 4TUJA 4K8RL 1YJDC 3VFUB 4N8CL 3QQ9C 1H0DB 4D3CL 1PQZB 1EEZB 4HUKB 2XI9A 1OTSC 2VAJA 4XCFL 5EUOB 3SBWC 1FP5A 1CL7L 1G6RH 2AAVA 2P5WB 3TH2T 3DROB 4L8BA 3ORJA 3CX5K 3AREC 1JFQH 1PKQE 3ULUD 2IBZY 1KJ3H 1KEGH 2OJZL 1M71A 4YHOH 3G5XB 1IQWL 4AJ0A 3MRNA 5A2IH 2UYLA 1NAMB 4GQ9H 1FZKB 3SBWA 4HIJA 3VXNA 5JNYA 5GPRA 4FQJH 2WMPA 3SKNB 1CDYA 2EYRB 1VEMA 3AREA 1NUNB 1PX4A 1LK3L 1JGEA 2W91A 2YC1B 4OLEA 1TQBC 5ELIA 1EAPB 3VXMA 2FX8L 4NQCB 1A3LL 2G2RB 4XI5C 5EA0H 4L9DA 4QHUB 2X42A 4F37F 1QPXA 2JIXD 2H6PA 2XZCL 3OR7A 3RBSA 1QYGH 2FEEL 3BP6B 4OQTL 1A4JA 1BZ9A 3BW9A 1HXMA 1TJHL 2ZUQC 1QLRB 2HJFB 4MQTB 1IM3B 4HW6A 5BVJB 4PTTA 6CGTA 5MEOB 4U1SA 1X5LA 5M94B 3QHFH 2F54B 4S1QH 1GJIA 3GMLA 5I19H 2ICWI 1E28A 2ILLA 5KOVC 3GK8L 5L0QB 5EBWA 3FOLB 5INCA 2HKHL 3N1QC 1UWGH 3LPWA 1DQDH 4H25B 5F7HA 5I74B 3EBAA 4NQTA 4WFED 4YBLC 2WK2A 2J2ZA 4KMQA 2YN3A 1HK6A 5EOTB