4KJYA

Complex of high-affinity sirp alpha variant fd6 with cd47
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
ELLFNKTKSVEFTFGNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineered SIRP alpha variants as immunotherapeutic adjuvants to anticancer antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Leukocyte surface antigen CD47
total genus 25
structure length 114
sequence length 114
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-05-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kjyA00
5GISH 5EUOE 3WIFB 1T03L 1KACB 3KYNA 5ERWA 4R26L 3KJ6L 1KJ3H 4NZJA 3V6ZB 3ZT7A 2KZ1B 4U3CA 5J06A 5J11C 1QLEL 3VI4F 3RVTC 3QCUH 4Q7DA 3DETC 4MZ2A 4HFWA 5E4EC 2ZZUT 1MWAH 2R4SL 4N0CC 4PY8I 3DBXA 5JORA 4LFHD 3EYFB 2UUDK 1U36A 3ULVD 5J1TC 1G7IA 2X4OB 3MMEB 4HMCA 3CUPB 2BVOB 4GRWF 5B4MD 1WZMA 1NGPH 3IB4A 1YJDC 2C3WA 3VDCA 3MRQA 1WIOA 1I1AA 2X70A 2I9LB 3WS3A 2PYEE 4HUUB 4P4RB 1SMOA 2NXYC 4XNQA 3G04A 2ESVD 3L5IA 5INDA 2VXSL 2Q86A 4MD4A 2X42A 5FYKL 1EJ6A 1Q9OA 4PJAF 4YJZL 2HLFC 1NCBL 4HIEA 3MRNA 4X99B 1C5CL 5I19L 3O6FC 3VFWA 1VFMA 3AM8A 2OK0L 5F1OB 4C56D 3FO1A 1IT9L 3MJ7A 6FABH 3KPMB 3QJFB 1NCAH 2E27L 2IPUK 4PRDA 3DI3B 1EZVX 1I3UA 3S96A 3VI4E 5CAYB 2R56L 1KLGA 5EBLA 4JM2C 2YK1L 1A5FH 5FKPB 1Q8MA 5DMGC 2D7QA 4M7ZB 3QQ9C 3H8NA 1QQDA 3KXFD 2AEWA 3HE7A 4PS4L 4Z7VA 3T4AA 5KOMC 4Y4KA 5JZ7C 2OP4L 1FVEB 3AU1A 3DLQR 3GKWL 1O7VA 1GH7A 5K9JL 1KJ2L 1D9KD 5JTWA 4EDWL 3OGOE 3KYOA 1CXKA 3RPKA 5C0JB 1TZIA 1LGVA 5EBMB 4ZAKC 1VFAB 4OLVH 3X3GL 2DD8L 1NAMA 4OD3H 1SVZA 4LDLB 1N7MH 1KEGH 1A9EA 2HRLA 3WUWA 3QUMA 5EO9A 1RUPL 3IU4L 4OZHE 3WSQH 3WSQL 2WBJA 4HSQA 2HRPL 3MA7A 4JCMA 4M7JL 3ABZA 1ZK9A 5SX4H 2AEQH 1IRAY 2IQ9H 1YECL 1YNKL 1U9KA 4S2SB 1X4ZA 5DJ2B 4LGPB 4Y4HB 5FYLE 2D31A 5GGSY 1VADB 4ONFL 4Q6IC 3FB8B 4F7EA 4ZTPH 4NJAL 1DE4B 3TGXA 4DGYH 4Q58C 5FOBA 2CDGB 3PIQB 2P5EA 4FQPA 3QIUD 3C8HA 4DKEL 2Y23A 5IBTH 4PGEA 4M00A 4XTRD 1MFCL 4D3CL 4RA3A 2AXFB 4RBPK 4GRWB 1IGML 1OSZA 4OLYH 1Z6JT 3MV9D 2R56H 2HH0L 2QADD 5E6IA 1SJEA 4S1QL 3BKJL 4NSKB 3KS0H 1YECH 1QFWI 2AV7A 2XXCB 1X5FA 5CGTA 3KPLB 3ZT5A 3K2UL 3WD5H 3V0WH 1A3RH 1KF9B 2AK4B 3NZ8A 1NCCL 1XGTB 2BY0A 1V3LA 3SQOL 2NY1B 1QLRB 5HYSA 5I71B 2ZUWA 1N7ML 4YPGA 5MEND 2D31B 3MRLA 3PWLA 4NT6A 3GKZA 5CZXD 1ZTXL 4IOFC 4Q9RL 4PJEF 4C55A 4LSVL 3QDGB 1KLGB 4M61B 3OZ9L 4P23B 4WY7H 3REWB 2ARJQ 5DVNA 4LSRH 3FONA 5JNYA 4MDIB 5H94A 5D93C 1OQXA 3QUML 4KK5C 4UINH 1JWSB 1A1OB 5TQ2L 3THML 3K8LA 1LEKB 4M62L 3FTGA 2AXGB 1N0XL 5TFSL 2NY2D 1NBVL 5LXGH 3WHXB 1K4CA 4NO0A 1S7QA 1RU9H 1J10A 3BKMH 4Y2DB 5IB3A 1ZLVK 1XGRA 2QR0A 3GJFA 5C0AE 2KH2B 2X4SA 1XCQA 4PJHB 4PB9H 4HIHA 2B5IC 3DXAD 5DVKA 2C4XA 4OF6A 1FG2B 3BH9A 3PV6B 1K5NA 2VH5H 3C60C 2ZWLT 4KRLB 4ZFZA 4P4KD 3RWFB 4X8XA 2XPGB 1CF8H 1KELL 2NPLX 2VLLB 4CU7A 2CMRL 2DI7A 3LN9A 3G5ZB 1LE9B 5I73C 2D9CA 1VFUA 1K6QL 5HYJE 3FQTA 1MCOH 5DO2C 3SKOB 4DKFH 4HEME 1U58A 1CFNB 2HKFH 4WGWB 1IE5A 2JJWA 1X5HA 43CAA 1OGTA 4NRZB 2LV4A 1MWAL 2R4SH 4NZTH 5D7LE 4ZXBB 1NMCC 1RJLB 3RY5A 2XQYK 5GGVH 3U4BL 4D9RD 2EDRA 3DTXA 2NYYD 1ZLUH 1Y6NR 2BHZA 3C5ZC 4KHTH 3QG7H 2I26N 3RZWA 4KVNH 1EIBA 1DUYB 4BQ9A 4LLDB 3GMNB 3BEVA 3BZDA 3EDDA 1I8IB 2HWZL 1JJUA 5EIQA 3HNSH 1J0YA 1RJYB 4U1SA 1CDCA 2YUXA 3S98A 2ZSVB 2FIRT 3GI8H 4D9QE 1R3HB 5BXFB 5F1KC 3UAJD 2A74B 1T89A 3WL9A 1HHIA 5E1AA 3W0WB 2EE9A 2EICA 2FL5B 3SOBL 5JW3H 2HFGH 4RGMB 3BQUA 3GBMH 1A1MB 2BERA 4RDQF 5JXED 1F45A 2Y36H 2F53E 4AJ0A 5D2LB 3C2SA 3WNPA 1U93A 5JW5A 1YEEH 1K4DA 3WNLA 2XQBH 2D0HA 1I1AD 3BDBA 4X6BB 1WBZB 5BZWB 3TN0A 4LGSB 3BP5B 3ULUC 2ZCHH 3TCXA 4PJ9C 3ZHLA 5FEBA 3I9GH 2LVCA 3QG6B 5BJTB 1U3YA 3HZMB 5DJDA 4B7LA 4OGYH 1B2WH 3NGBC 4NKIH 2NY0C 1HYSC 4Y19D 5EUKA 4ZDHB 4OGAD 1YYLL 1BEYL 1FDLH 3V6FB 3ZKXB 4GW4B 2J7LA 4PJHF 1BFOB 2V5RA 3MLWH 5KOVC 1OM3L 2VTFA 2AXFA 4LSSH 3TVMC 1IGIH 5ITBL 1T1ZB 1LQSR 1JZ3A 2FB4L 4YHYB 3OTTA 4NQDA 4FFYL 5D4QA 3C6LB 3EOAA 1JNLL 2JJSA 1I7UB 3C5JA 4OF8A 5L0QC 4GKNB 4G3YL 3LS5H 4OTXH 4PYGA 3QDME 3T0EA 3P0YL 3WIIL 4H88H 1VPOH 1A47A 3CDGB 2P46B 1QYGL 5I1LA 1T1WA 2VXTL 3UTTB 4RSVA 4CVZA 2D4FA 3CK0L 5F7HA 3L5WA 1FE8H 3PNWA 3AVEA 4N68A 3UTSD 2WAHA 2NR6C 2LTQB 3SOBH 1GGIH 5JW3L 3MV11 2GJ6E 1F3RB 1FH5L 5L7XL 4EI5D 3ZZ1A 4HGKC 2R2BB 2NY6B 3VXRB 5C0EB 1BOGA 3VWKD 4NQCA 2A38A 4ZOBA 4YO0B 3TNMB 4L8CB 4LLUB 5C0JA 4KFZC 1AO7E 4QRRE 1RURH 1UA6H 3WNMA 1WCBB 2XXMB 1ZHLB 2O5XL 3EDEA 1RHHB 1DLFH 4OKVB 1J0JA 3MGOA 2B4CL 3TIDB 2CIKA 1RIHL 1X5XA 4U6XA 3ISWA 4YEEA 2WP3O 2NY5L 4G42A 1I3VA 1YPZF 1UM4L 4KUZH 2YK1H 5AZ2L 3S4SB 5F3BA 3DECA 5DUBA 3P77B 4JEGB 3T2NL 3SO5A 4ODHL 2D9QB 3TZVD 4AEIH 1E27A 5C1MB 5I1DA 4J3VA 4E41E 3NZHL 5B21A 2EE2A 2AXHA 1UADC 1YEJH 3D39A 2NY4B 4X4XB 3PQYE 3VE0A 1EGJL 32C2A 1OOAA 3IRPX 5GPRA 4MB4A 3NOIA 1R3KB 4PJ7F 4XHJD 3LHPL 1KB5L 4U6HB 3GI8L 3BZ4A 4LLWA 4UU9B 4MAYD 1EHLL 5TE7L 3C5ZB 5DUPH 1A7QL 4PJXB 5DQ9B 1ONQB 1BJ8A 3PQYD 4XCFL 1K5NB 2DS4A 2ENYA 1XGYH 4XXCC 2NW2A 5EUKB 4G8IA 2WQ8A 3HUJA 3OHXB 4KI5F 5LG1A 1MCWM 5D93B 1RY7B 1IAKA 3RI5F 3BJLA 1XAUA 1N5YH 5IFHL 1CVSC 1BZQK 4H20H 4ELMA 4EXPX 4W70A 4XXCA 5A2FA 4GXVL 2YPVH 1MRCH 1X6NA 3QUZC 3RY6C 5HHNB 3JTTA 2YWZA 3C2AH 3TO4B 4HHAB 3PP4L 4QRSB 1EUTA 4YDIL 4UBDD 1A7RH 1JGVL 1SY6L 3KPRD 4HJGA 3VMNA 2EDHA 4JFOB 2ITCB 2YXMA 4I2XB 4OM0L 3W9DB 4Y5XC 5E9DE 2GJZB 2J5LB 2ZUVA 4HGMA 1NAML 4RAHA 5GJSL 4GAYA 2VDPL 1O7SA 3I6LD 1XGYL 2CUHA 2ENSA 4L8BB 3GMPA 4MA7L 3DX8B 1KPUA 2VLKE 3B5GA 4HPYL 4OBRA 3O9WB 2CRZA 5T1LA 3UTQA 1TNMA 3UROR 1SM3H 1UCBL 5T3XL 4M1GL 1MCQA 4YHMH 4CAGA 1T20B 2EIZA 1BQSA 5BCAA 1UG9A 4TPRH 3RUGF 3RY4A 3UTSE 2YPLE 5TJWK 3BKJH 5E9DD 1RUAL 1ZEAH 5H2BA 5EU7E 4AM0B 3HZMA 3HMXH 4GRMA 3IDYC 3MRGA 5J11B 4OD2A 3UTZA 3DIFB 3V52L 4UNTA 2P43B 1T2QH 4TOYH 4GKOA 2I07B 3MNVB 2UWEE 4N8PA 4LF3B 2D7TH 1BGXL 2MQCA 3VXUB 3GBNH 3T09A 3OKMA 1UFUA 2JKXA 5EOCJ 4IHOB 3OB0K 3HG1E 4WW2F 4Q0XH 1EK3A 2OL3A 2YSSB 1KJMA 3T0EB 5E1AB 3ZO0A 1YUHB 1A3LH 2XZAL 1C5DA 3NFNB 4Y19E 3RQ3A 4YDKL 3BPCA 4OZFB 3MREA 5SWZE 1J05A 5E8EB 3AMKA 1FNGB 3K0WA 4JFEE 8FABA 4R7NA 1AJ7H 2Q8AL 1CTNA 1HOCA 1RV6X 2AGJL 4P9HH 2YN3A 2EZ0C 3DURB 5HYQB 3QWOA 4G6ML 1TTUA 3EIFA 4MXWH 1AXTH 1A6PA 4XCEB 4JFFA 2AEIT 5DRXB 1ZT7B 1F6AB 5DQJA 3SDXE 5HHVL 3MXVH 2F53D 3LS5L 4OTXL 1VFBB 2EECA 4S10A 2OJZH 3LEXA 4H8WH 4NN7B 4WU5B 5DJZA 1R3JB 1MCRA 3QCTL 3P73B 3DTXB 2BNRE 4DGVL 1M6OB 3RVVD 5I8CB 4LRNL 3H42H 1A4JA 3RX7A 1BBJB 1JMZA 3L3JB 3HI1B 5ITBH 3QUYB 4BFIB 5JW5B 3CXDL 5D5ME 4J3SA 4ZAKA 1BEYH 1FDLL 3W39A 1BQHB 1I9EA 3L3DA 2NXZD 3NCJL 1BQUA 4J23A 5EC1B 1X9QA 1B2WL 4CN4A 1MCFA 2HFEB 1MFAH 3QNZA 4V1DE 3E3QC 3FFCB 1I9RL 2PETA 1DBBL 1XGUA 1OTUD 2GJ6D 3I9GL 5HHOA 1CFSB 1WWAX 2IGFH 3EZ8A 1OGAE 5HTSA 2VITB 4ZMAT 5J9PA 5EIIA 1Q9OB 4N9OB 2ATPB 3BKYL 5IIEB 3JV6A 2X1QA 4XX1G 1I8KA 4YXLH 2Q3ZA 2WQRA 2HLAB 1QFWL 5I8KL 3SE4C 4G5ZH 4PJDE 4V1DA 5CEZE 5TF1H 3O45A 2AJ3A 2OTWA 4XXDB 4CADA 2FRGP 4QXGL 5I1JL 2O5YL 4XPFH 2O61A 4TULL 4HXBL 2VR5A 1Z9OA 3QUXC 4R8WH 3IFOA 2DQFB 1QQDB 1MRFL 2C7UA 2OR9L 3S34H 1RJCA 3QNYA 2YD6A 1S7RA 3NABL 1A7BA 4GRLD 3IKKA 1O0VA 3GZKA 4LCWB 3TO4A 3MJ9H 2HWZH 4XH2A 3BW9B 3SGDI 2J8UB 3ARDD 1D6VH 1U8PB 1P5VA 3HE6C 2ESVA 3WKML 4ENED 3Q1SL 1MFDL 3D85A 1UCBH 5T3XH 1NCBH 3QAZB 3M1BA 3WIHH 4RWYL 4J8RB 2J1KA 1LK2A 3VGBA 4JFFE 4LQFL 3QIBA 5E2UL 1S7XB 4XNZB 3IDJB 2X4NB 3WDJA 3CLEH 4AQOA 7FABH 2G60L 5IM7A 2YD8A 3QWOB 3SE9L 4ISVB 4HKBB 1U8JA 4ZS7H 5T5NG 3W11C 1G9NC 4GKZA 3QRGH 1MCKA 4LASL 1RJYA 4U1SB 3QEHA 4PD4K 1IM9D 3RTQC 5GGTL 1MQKH 2VN4A 4HGWA 5GJTH 3DMMD 2EKSB 1RD6A 3B83A 4MNQA 1BWWA 4OLWH 4OT1H 1AR1D 5EC2B 1DANU 4X9FA 3V0VA 3GFUA 1EAJA 1YN6B 3LZFH 3D3VE 1M6OA 5IB5B 2IAND 2E7LA 3RIAF 2QHRL 4E41A 6CGTA 2BCKB 3GMRB 4PJ9B 1RZFL 5GRUH 3L3DB 4B7IA 5LVEA 3BAEH 2P48B 2JLLA 2I60L 3LKSB 1NANH 5TE7H 1WITA 3MGOB 4X0KB 2VDOL 3VD9A 3NCFB 1F58L 5JW4Q 5IB2B 3D2UD 3OQ3B 5ACLA 4MXVE 3GSQA 3LKOB 3RZCC 15C8L 1YPZB 2CIIB 4MLIA 3GB7A 4JZNB 4ORGA 3TFKD 3S37H 4BZ2H 4ISVA 1RZIB 4JFXA 4UUJB 3ES6A 4YX2H 2ORBH 2D0FA 2JB5H 4IRZL 3V6OA 1V7MH 5ILTL 4C56B 4WNQB 1M7IB 1B6UA 4M1DH 4F7TB 5IJVB 3MRDB 2R0KL 1QFPA 3B9VA 4WO4C 1TZIB 5I1GH 1C1EH 4UBDC 3RPIB 2R9HC 5GS2H 1CDHA 2R69H 4QRRB 5HI3D 4DKAA 1MJUH 3VWKA 4LARH 1YEHL 1BX2A 3FZUC 2BJMH 4XPGL 1LILA 3CFCH 3UDWC 4PPTA 3WJJA 3QNYB 3D2UB 1FYTE 3VXPA 4S2SA 1GZQA 5KVFH 5JIPA 5F6HI 3HCVA 5E08H 4ZFOA 1IC4H 2J8UF 2J8UA 2XOTA 3T0EE 5M94B 3GBLA 1JPST 3OKMB 3TCLB 3AAZA 1TETH 2UVEA 2N56A 4X6EB 1EXUA 3VFWB 2HTLC 1DEEB 4QGYA 3QO1A 1IEBA 2ADGB 4P46B 5ADPL 4RMWA 2JJTA 4LSTL 4PJIA 1XFPA 1T2JA 5HHVH 3L6FA 3UTTD 3V6OE 3WFHB 2MJWA 1YEFH 3VFTA 2EO1A 3L3OA 3GUTB 3MRGB 1XIWC 1MF2L 1B4RA 1B9ZA 3P0VL 5KS9B 3D39E 1R3LB 1FVEA 2JB6B 3RVXD 1BF2A 3LN5B 3E8UL 1M71B 5IF0B 5E6IB 2VZSA 3OAUL 4DZBB 5DC0A 5IKCB 2AJSH 1QKZH 5CZVH 1ZV5A 1L4IA 1INQA 3BESR 4JM2A 1N2RA 3QEQB 4LSSL 1FRGL 5AZEL 5H8DA 2BCKA 4PJ9A 3TM6A 1T5WB 4JY6B 2PYED 4KROB 3GMMB 4LPUA 3D3VA 3WIFA 3PWNB 5D7JB 1U3HD 4PP1C 1Y0LB 3TT3H 2OMBA 5IW6A 3ME0A 3OG6B 2H2SD 3ARZA 4PJFA 5IV2A 5EO9B 1RJZB 3GKWH 1AXSA 1JF1B 4ZUWB 5KW9H 1YEIH 3QA3A 2BVEA 4IRJB 2FBJL 3RAJL 1A7OL 1LEIB 2R15A 5EU5A 3WL9B 5F8RC 1F2QA 1I4FB 4DN4L 3ZSSA 2ARWA 3PV7A 3BKCH 3SCMA 1WAAE 4YBQD 1I1FA 1VB9A 3QQ4A 3QPXL 3MLVH 2WMPA 4DVBB 3IAQA 1AGEB 4OV5A 5D70H 5E95B 2OL3L 2OQJA 2F5BL 2J6EH 2FEDC 1IGFH 4XC3H 4JY5H 4HBCH 5GRVL 4M1GH 3FB6B 1X5LA 5LJYH 1HH6B 4XPAH 1ORQA 2FWOB 5C3LD 5F3HB 4RX4D 3QDMA 4RQQB 3VFVA 3KPMA 3QJFA 3SDYL 3LS4H 1I1YB 3O8XC 1YQ2A 4XCYA 4KTEH 2XNAB 2Z8RA 3HZYA 3MYJB 2HP4A 4WGVB 3T8XA 4U6XB 2IH1B 3PL6B 3BN3B 1NGZA 1HSAA 1U6AH 3NH7L 5FAAA 3A67H 2NY0D 1OARH 1KXQE 1TPXC 3SJVB 1IGCH 1NANI 3RWHA 1N5AB 2EDKA 3SCMB 3SGJA 1GVIA 5FA3B 3KJ6H 5FA4A 4LMQE 4OAWB 4M4PA 4CVXB 2KQNA 5DFVC 2V9RA 2CDFB 1JHTA 4K3EH 1JGLH 4MJIA 5TDNA 3C5ZA 3GUTA 4GRMB 2NY2C 2BOCA 5C09B 3U0PA 1A7QH 5JQ6L 1TQCB 4PJ7B 5DUPL 4RGMC 5HHOE 5LGKA 3WNNA 3MXWH 3QNZB 4R4BA 3QQ9D 2DWDA 5GIRA 3UCRA 3QDGE 1OY3B 4MNHA 2VISB 3H9HA 1HWHB 5HVHB 1G7JB 4JDTL 1MREL 3R0NA 4UQ2B 5C0FA 2APFA 3WNKA 4ENEC 4YK4C 1EPFA 1Q0XH 1A1MA 1OLLA 5DJ0B 1YJDL 4HWNA 1A6VH 1ZLUK 3S5LG 2ICEA 5B3NA 3FO9A 3VGHA 3GSUA 1PQZA 3IFLL 2C3VB 4ORZC 5IR1A 2VKWA 5TFSH 5D1QA 5BRZE 5D2LA 3FO2A 4XC1L 3RWDB 4RMVA 1MRCL 1LP9E 1F11B 5KW9L 2XI9A 2R0WH 3TBYA 2WSKA 2A73A 2Z91A 3HE6A 4RMQA 4IRSB 3OKEA 2UY7A 4G5ZL 3N0PB 1Z0NA 1NAKH 3L7FB 5F9OH 3U2SA 4D0DB 1X4XA 3AFLA 5I74C 3ZDXF 3QG6A 4NSKA 1HN1A 2R1XB 2DQIH 3GSQB 3CGTA 1VSCA 3BIKB 5HYIA 4X6CB 1EHLH 1S5HA 5E2TH 1O5DT 2XWTB 4M9OA 1P7QD 2G5BB 3STZB 3VFOB 1KSRA 1B90A 3VWJC 4RRPA 1IGFL 1HXMA 2YWYA 3LIZH 4QHMB 1RZGA 2JELH 3OJDB 2QQLL 4APQD 5IGXH 3RDTA 5JHDE 3VGEA 3O6FB 3QDAA 1ZVHA 2X9YA 4NNYB 3MV8D 4XBPB 1JZ2A 3JWOL 2OLDA 1LDPH 2GY7B 3WUWG 2LTQC 4UAOC 5DVLA 1I1CA 1D5ZA 1FN4B 2JIXD 3F7YB 3VD3A 1KYOJ 3BP6A 3O3UN 3TFKC 3TPKA 5HDQH 5ACMA 3BGAA 1GHFH 1ACYH 2EE3A 5C0BB 1JWMB 5EC2A 5C08D 3HFML 4LRIA 1MHEA 2BP3A 5CHNA 5IMLA 2V7HA 4E42B 4KK8D 4NQCB 4U2YA 1QSEA 3QUZD 1KLFA 3DYMA 4U1HA 4ZSOE 4YIQB 4XPGH 3QQ4B 1DQDL 3IXTB 3FOMB 3VWJA 1MHPH 1CD0A 2FECL 2IADB 3DX6A 4GOSA 3QP3A 3GDBA 3STLB 4KV5F 4DFHA 1X6LA 3DSFL 3T1FB 1X7QA 3GMLA 3H0TA 4G6JH 3QYCA 1B0RB 3PGFH 3UPRA 1YNLL 4EDWH 3N1MC 1MFEH 2IQAB 1HILB 1F5WA 1PG7L 4UNUA 5C08B 3TH3T 5C0BD 4G8GD 3BH8A 4ZYKB 2J4WL 1I75A 1A3QA 1KCRH 1OAKL 5TPWL 1QRNE 5D6CA 5KANI 5IHBA 4ZNEE 1IAII 1MCPH 2BHUA 3HC0A 3EO9H 1UWGH 2NMSA 2WINB 1KLUA 2C1PB 3DROA 1L7IL 1RUAH 1ZEAL 5L88H 5DD3H 5IVXE 4ONGL 3VGAB 2OK0H 2HJFB 3OKYA 1MQ8A 2VNCA 5DQ9A 5E2WH 5FF6B 4WJ5B 1C8PA 4U1KB 1ND0B 1U3HA 1WIPA 2CSPA 2CXKA 1KGCE 3FQUA 3ROOA 1WZ1L 1MVUA 2YA2A 5EA0H 4JFHE 2Q7YA 1AQKL 4BFEA 3VGDA 3IVKB 3G9AB 2NY3C 1X7QB 3GMLB 5AG8A 4S1DD 5D7SL 2XQBL 4NZUL 2I5YH 3AREA 1MJ7L 5SWSD 5EUOA 2EXWD 1I7TB 5D1ZA 3FO0L 2WANA 1MCOL 4XAKE 1S7SB 4CKVX 4L8DA 2DKUA 4X6BA 3WEXA 4FQJH 1JGUH 2WLZA 3OXSA 5IROA 5DK3A 3U79A 1PY9A 1RZ8A 1CIDA 35C8H 2RQ8A 3SDCD 5CWSB 4HUMB 2CDEA 4WFHE 2Y7QA 3BX7C 3HI6L 1H3GA 5BMFL 1UACH 4EEEA 3NGBB 2IAMC 4PJ8A 1FVDA 2JJUA 1W72A 4NKMB 3DUUA 4OB5L 5CMAA 2CLZB 2LU3A 5FFLA 3MJ8B 4PY7B 1RIUL 2DQGL 4NYLA 2EYTB 5AWNH 1YY8B 3HN3A 4F7TA 1JZ4A 5C8JA 4U1IB 4UB0H 5FO8B 4JFQB 3P9LB 3ZTJH 1CFQA 1FL3B 4P3DB 4PJXA 4LQ1A 5GGVL 3VFNB 4JPVH 5C07E 1JF1A 4N0UE 4ZUWA 2R2HA 2FSEB 3O8XD 3RGVA 4DGIH 3P30H 2XFXA 3MUGB 3FFCA 3QUMH 5J3HD 5D1ZB 1YA5A 3HE7B 4Z7VB 1YQVL 4P2RB 4FTVE 4ODHH 5GS0L 1T7ZA 3HZYB 4YHIA 4PJAE 3OXSB 5AZ2H 5FUZL 4I4WA 4X8JA 1BD2B 3MTRA 4Y1AB 4WI5A 1SEBB 4I3SH 1NC4B 3WIHL 1F3DH 1SJHB 2CK0L 2XN9A 3S35H 5EBMA 3AY4C 5IEHA 3U9UB 4ELKA 5FM5M 3K2UH 2HT4D 4JPIB 1UEYA 4O2FA 4O2EA 4X80L 1L6ZA 3BI9X 2EYSB 4D2NA 4WFGE 3D87B 5C8JB 3HMXA 3T4AB 1QSZA 3SE4A 3KPNA 4WW1A 4PG2A 4AIXA 2BNUB 5HY9B 4QF1A 1PEZA 4EBQL 4HDIA 1XF3B 3MO1A 2Z91B 3HE6B 4OKDA 5B39B 4K8RH 1HI6A 2O5YH 5MERB 2CDGA 5FCUH 4HLJA 4OZGE 3SDDC 2BNRB 5FXCH 4RFOL 3AS3A 5KVEH 4WY7L 2SEBA 2X89D 3WO3B 4GG6B 3VRJA 1HHGA 2EIEA 4QRUA 1J18A 4K7PL 1VPOL 2HTKC 3DX6B 5D1XB 5E0QA 1U8LA 3CFIC 1D5BA 3IS0X 2IQ9L 4X4YB 3RL1A 1NUDA 3VWKB 2CUIA 5GGTA 2HMID 5F1IB 3DHMA 5BMFH 1DBBH 1MWAA 4M03A 1QFHA 3V0WL 1DBKH 1EJOH 1AC0A 1E6JL 5DJYB 1G6RH 4YK4B 4LIQH 1EEYA 4XP1H 4ETQB 2NW2B 1OCWL 4NIKB 3UYRH 3G6DL 5D7KE 2E7BA 4U4BA 3PJSB 5ITFB 2XY2A 1HYRC 1BP3B 1UZ8A 2IBBA 1Z3GH 3TBVB 4AG4H 4QRQA 3FN0L 1JHKL 3SJVE 4C83A 4MJ2A 5IBLD 5CSBA 2PW1B 4JKMA 3VDAA 3PG2A 3MA9H 1YEKH 4PJIE 4P46A 3MODH 3QXVA 4F58H 1ITCA 5HDQL 4KHXH 1HQ4A 3MCKA 4HV8A 4MDJB 4JHAL 1TVBB 1OP5H 2NY5C 4U6HA 4YHKH 5ETUB 1ORSB 3RNQB 4KXZH 4QTHB 4U49A 5JOFA 3MRFA 2FJFB 3G6JE 4LBEA 4RAUA 1MH5B 1P7KB 3O0RL 2ZOLA 1MPAH 1JPTL 3SBWA 4Z77B 3FQNB 5I1KL 3BT2L 4YHML 4QY8A 4P57B 4JFED 1B0GB 3GHEL 2YPLB 4P59L 1WCBA 5HHNA 1HNGA 4WI9A 4MQXC 5B3JE 1FORL 3WFDL 5IMKA 1PG7H 5IVZA 4OLXH 5FHAL 2BRRL 3H3KA 2E9WA 3PGFL 3HMWH 4JHWH 4K7FB 4CW1B 1CLOL 3EYOA 1JHTB 4AL8H 1YEGH 3K46A 2DIAA 4QRPA 4WV1A 5IVXB 1QR1A 1NCWH 3DARA 1AO7B 4N8VB 1T21A 3CNKA 3QXDB 1I3GL 3OAZK 1CZ8H 4G6AD 5ERWB 2ITDB 2D7MA 5LQBL 1TCRA 1N5YL 1DUZB 2V9TA 1F8TL 1VCAA 4XPHH 3GSWA 1KG0B 1A6VL 4AEEA 1KCUL 1BJMA 5KAQF 1A7PL 4OD1L 1WLHA 4XPTH 3MOBL 5D8JH 1HQRA 1KTLA 4G9FB 4FXKA 1I9JL 1KELH 1LD9B 4RWHA 1C5CH 4QXTA 4XVSL 2X4RA 4TUKH 1GOGA 4FFWC 5KS9F 1U95B 4U6VL 2XT1B 5BW7A 3B9KA 4NKDA 5KAQG 1ZE3C 4I9WE 3ULSB 1IL1B 5EU4B 2GITA 3T4YB 3WN5B 3ARGB 4BSJA 3ZL4H 3TPUB 5DF0A 4MCYB 4ZD3H 3I85A 2VL5A 3T2NH 1N6VA 3LD8C 3TBTA 4L1DA 5D1ZD 5A1AA 1FFOA 3TBVA 2R1XA 2BSTA 3ARBD 5BS0B 4CVZB 3OKDA 4M62H 4JKPL 3BP7A 4YHPA 5DA4A 2XTJD 5FGBC 4LAQH 4NO5B 1OHQA 3ZE2F 5HGBA 1DN2A 1T03H 5DJCA 1J87A 1J8HA 4OLZH 5C9JB 1MLBB 5T1LB 3SJVD 2QSCH 3TJHC 4QNPF 5AYUH 1JNNH 5L2KB 1ZVSA 2DWDB 5GIRB 2VLJA 3QZWB 3MRFB 5ID0A 4AEHL 4OLZL 3HTLX 4L3ED 5GZOC 4XPAL 3W9EA 1NC2A 4HF5L 3OKNA 4XC3L 1OTTC 3Q48A 1PYWA 3QUXA 1DUYA 3HPJB 5HHMB 1IAOB 4QEGA 1XF3A 3NIDF 2IH3A 4YUEL 4MAUL 3PP3H 43C9B 4PJDA 2VXQH 4QLRA 2DL2A 1CQKA 3U7AA 1S3KH 4U7KA 5MENB 4MWFA 3IS1X 4K7FA 1KCKA 5I9QB 5A2LH 1MIML 2IH1A 3DVGB 1IBGH 3NTCL 4N5ED 4NBZB 2UZXB 3K8MA 2E8YA 1E6OH 4NM8H 2P5EB 5B4MC 2BXZA 1W72L 4ZUUA 1YMHB 3SCMC 5GS1B 3QXTA 2YZ8A 4X5LA 3VXRD 4K71C 4RNRB 5L0QB 2DIJA 3CFKB 4OD1H 2MPAL 4WUUB 1D7FA 1K85A 1TMCB 4NKIL 3GSNL 3GMMA 3BGFC 2YMXH 1MH5A 3FRPG 2BNRA 1S78C 2G75A 3CDGA 4BZ1L 4TUJB 1MCCA 4HX1B 1NCWL 4N0UA 4JANB 5A2JH 2H32B 4GBXA 1BFOA 2ADJA 2EIBA 1U8HA 1ZSDA 4K7PH 2YPKA 4LOUC 3KPNB 3O9WD 4JFEB 4ODTH 5B22A 2YA1A 4H88L 1LEIA 5KVGH 1WGOA 4UDUA 1MEXL 4M6NH 1T0NB 4JFYB 4OZ4A 4JZOA 3VXNB 3DYPA 2NCMA 5DHXB 5EO0A 2ZUTA 2W0FA 3TV3H 1HDMB 5D2LE 2PR4H 5MEPB 5JZ7D 4YE4H 3MPCA 2XN9B 4JDVB 1F4XL 4JKKA 4UI2A 3VD4A 1JWUB 3GJFK 4PLJD 5AD0B 1I85A 4AYFA 5H37G 3QEGH 3O41B 4WFGD 3BWAB 1EEUA 1NCAL 2E27H 4XP9L 4LSUL 5A2KH 2OM5A 3VFVB 4PRDB 1DUZA 1ZAGA 3BKCL 1HK6A 5F3HA 1ED3B 2L4OA 3ZKSD 1S8DB 5A2IH 1MY5A 5J7CC 4XRCB 3RWCB 1EA9C 1A7OH 5EZOH 4BK5A 4D9RE 4JY4B 2R69L 3MLRH 4KHXL 4ELMB 3VXSB 1IAIH 2HVJB 4EJ1C 2Z8WC 1AR1C 1T22A 1UWXH 3K74B 5KBNC 4RIRB 3G5YA 2EKJA 1NGQL 3MA9L 4Q6YA 4XXDA 3UDWA 4AEFA 4KKCC 4IM8A 5FA4B 2WIMA 3ZLQC 4Y16B 1FZKB 2A0LD 3TWCL 4X6DF 3UYRL 3GSRA 4C54A 4I77H 3F58L 4LCYB 4HIIB 5ADOH 2VH5L 4NKOA 1CDBA 4BH8A 5EO1A 1A6AB 3ULUE 4V2CB 3BD3A 3SKJL 4JGMA 3SGEH 2BSSB 4HH8A 3ALPA 3V6ZA 4KJWC 5FYLH 1JYNA 2VWEC 4KJPD 4P2RA 2O5ZH 4QOKE 4I5BA 3WV0A 1F4YH 3VRIA 3VFUB 5C0AD 4OB5H 4KI5D 1J12A 5EU3B 1XR9B 4NQDD 4BZYA 4I1NB 3WFCH 4J3WA 3RWIA 4QRPD 3CD4A 4JO1H 4OT1L 2WBJD 1N3NA 2FNBA 3HZVB 1TETL 3ARQA 1JBJA 4PP2A 5CZXC 4MYWB 2NXZB 3D9AL 1SYVA 4NDMB 2Y5TB 1HHIB 3RFZC 2B0SH 2P5WD 2HLFD 3QHZH 3N85H 1K6QH 1NCNA 4PTTB 4CNIB 5I18H 4OCYH 5FYLD 2MQ3A 1H3WM 5DMYA 2P8LB 1A6ZB 5EDXA 5CBAB 5MENE 1GPOL 1T4KB 2G2RA 1FGVL 3G5XA 4PJEA 4NQXB 1GGBL 3DUUB 4MQ7B 1XGUB 4FQQB 4NN5C 4BH7A 4KH2A 5H35B 3DV4A 1EAPA 3KYAA 1NMAL 3OXRB 3PHSA 2R0ZH 4ZUTA 1HZHL 2H2PD 3MLSL 1KEMH 2W9DH 3B2VH 1T7YA 2DI9A 3BPOC 3MRKA 1I8MB 5FYKE 2FSEA 1OAXL 3RGVB 1NDMA 4Y1AE 1YMHA 1L0YA 1KIRB 4NO5A 4IHOA 5DDHA 1ZT4A 4WW2B 4UV7L 1CLZL 3TEUA 4P4KC 4JVWA 5IBTL 2DQJL 2OSLA 5DMGD 2AV7B 4GSDL 5ECJE 3MRQB 3ECBA 1NKOA 4FS0A 2DQFA 4KZEL 2XV6B 1Y18B 2DLIA 3GSVA 4M3JA 4Z5RA 3OR7B 1NFDF 1YC7A 4LSVH 3TBTB 4XNYL 3WE6B 5I1AB 1H3UA 3AGVA 3KPOB 3MRRB 1IEBB 2ADGA 4LVHB 4Z7UB 5F6IC 4ZFGH 3OB8A 3KXFA 1CWVA 4HIHB 1J8KA 1KYOK 1DBAL 2PW1A 4EOWH 3BRGC 4R90L 1AKJD 5J1SC 4NQCE 5L8JB 4M8VA 4XGZA 5IEKB 5EUOF 5CJOH 1U91B 1DE4A 4PLKD 5HSFA 1L9NA 3QIBB 2DM2A 3NCJH 4IS6A 1FNSH 4O51B 1K2DB 1FYTA 4FTVB 2Y72A 3VG9C 1CFSA 3W11D 5F8QC 3L5XL 4JGUA 1LEKA 1DEDA 2DOCA 1TJHH 3H9SA 4OD3L 4PJGE 5ABDE 2HFEA 4P2YA 3STLA 5DS8A 2APBA 3UPCA 1UWXK 4OF3A 4OQTL 1BIHA 4NCC2 3P73A 1J0HA 1QZ1A 1CE1H 3I6GB 3V4UH 1E4KC 3MV7B 1ZGLA 5IROC 1JGEA 5BQ7A 4QHMA 1DDHA 4PRBB 3MNVA 3O45B 3VFSA 1HHGB 4QRUB 4NRYA 12E8L 4JZJA 2OJZL 3P9LA 4QRSA 4LPTA 1M05B 4Y1AD 4NQDE 1CGSH 2EDWA 4NFDA 2F74B 5JORB 5F97E 1WT5C 4CADB 5JOPE 3NPSC 3X14A 4PR5B 1UVQA 3RBGA 3OKLA 4NHCH 1KBGL 4OFIA 2YRZA 3ULUD 1OVZA 4HFUL 2FEEI 5DWUL 4O00A 3QRFM 5C0RH 3BD4A 3LDBC 5EULV 2GK0A 3HE7C 1U2HA 4LLVA 4ZPVB 5TDOA 4HBQA 2J5LC 5LKNA 4KK8C 1DQML 1RULL 1G9NL 1MRDH 4KRNA 3TWCH 2DKMA 1ZA3A 3O11B 4M8QB 4Z0XB 2EDQA 3RI5K 2CO7B 4JRYE 1N64H 3CCHA 4KJQD 3VRLE 5GRWA 2DTMH 3FOMA 4F8TA 5CFHA 4MA8L 1KT2B 2Z35B 5F6HJ 4B5EA 3H9YA 1J11A 1I8MA 5CIPH 4HWZB 4MDJA 4MNQE 5SV3A 5LGJB 1AGFA 4U0QB 4JZJC 1C16B 4FFVD 5FHBL 4BZ1H 4JN1H 1GXEA 1BJ1H 3QBTB 1QP1A 2VIRA 1W0WA 1E4KA 4N0YL 4OZHF 4N0FA 4PY8J 3PDGA 2YOCA 4HUXA 3OJMB 4PRHB 4AT6A 3PUCA 3IFNL 1IC5L 5E00A 4NKQB 3VI3F 3O3DA 2ICWA 4GBXC 4LKCA 5KSVA 5I1CL 4OAWA 1WAAA 5DEGA 3ARDC 2YUVA 3SDDD 3HFMH 3K1KC 1JGDA 3EHBC 5FV2A 3IU3B 3NFNA 3QCTH 3VWKC 1L7TH 4G8FA 4IRSD 5DHVA 4O9HH 1Z9LA 3RDTB 3ET9F 3PL6A 4P23A 4HT1H 5D96C 2JTDA 1KC5L 5HVGB 2CLVB 3GK8L 2M1KA 5CBEA 3NACH 2Q6WA 5DJ0A 2VDQL 1OARL 4IMKA 1BFVH 4QXUH 3RTQD 1G1CA 1S7RB 4WFFD 5IJKC 4F15C 4MNGE 3EO1A 3F7VA 3EOAB 1IAOA 2F54E 4QTIL 4R0LB 5D1QC 1HCFX 5D71H 5DRNB 4ZFGL 3QNXB 5HHPB 2JK5B 1GAFL 1T5XB 2VDRL 4YHZL 2DM7A 4PLNC 5JXEC 4X4ZA 5F88B 4LCIH 3WUZA 3RA7H 4XRCA 4R97C 3E6HB 5C6TL 1IGJB 3D2UA 2IALB 5IIEA 1JUFA 4UILH 4JFZH 5EU6E 5F71A 3NZHH 4LL9A 2VMFA 3RZCD 4R3SA 1OB1A 4M7LT 1NGYA 4M48L 3K4DA 3VH8A 2RCSL 2DM4A 4BQBA 5J6HA 2VUYA 3D48R 1D3CA 5MEOB 3U7YH 4Y19B 3U7WH 4DCQB 5BRZB 3UYOD 4W68A 3MV01 2GQHA 3OKDB 4P46D 4R4NC 1R24B 2PXYD 5I1DB 4WUUA 3BIAX 2VDNH 1FHGA 3C6LC 3EOBA 4I48A 4MQXD 3HUJF 1QSVA 1T7XA 3GMNA 3SDXF 3GMQB 1H5BB 4U1MB 3VH8G 4MA7H 1CT8A 4MJ5A 4NQDB 4GRLA 3PWPA 1S7WB 1PSKH 3MJ6A 2VIRB 4KKLD 3TO4C 1BFSA 3OGCB 1E4WH 4HJJL 3BISA 3N85L 5ICXA 2ICWB 1FSKC 3OX8A 1CXLA 4PJ5B 1GOFA 3QUXB 4NQTA 4PJIB 4L8SB 3VXUD 1S9KC 4QXUL 4JPIA 3OB0H 5IEHB 1ZHBB 3E8UH 3LKPB 4HK3N 5DFVD 3D3VB 4FQ1L 4HG4K 4MXVF 4JFDB 4CJ1A 5TE4H 2Q87A 1QYGH 1QSFA 4QWWD 4MVBC 1AXSB 2DTML 1CLOH 3MRPA 4LLVB 3DX7B 4ZPTB 4ZD3L 3I2CL 5I2IA 4F7MB 2ZP0T 4ZXBC 2M26A 5E7BA 2VDLL 1SYSA 1DQMH 5FM4A 5E2JA 3ARFC 1JRHL 2ADFL 1J5OL 3KPRA 2EKSA 3L3OB 1YEJL 4HK0A 1E28A 2J6EL 1HKFA 5DRNA 1OM3H 4LSDA 4H0IA 1VFAA 1GGUA 2YPLA 4A6YL 4NRYB 3WDHA 2PF6A 5F9AC 4PLKC 5CKGA 4HKZB 4HS8L 4KDVA 3BZEA 4JHAH 2CGRL 3CSYB 12E8H 1NGZB 3CDFA 4PG9A 3OF6D 2F53B 5DSCA 1FL6A 5HI5C 4HS8H 4RISH 4MQSB 5I2IB 2OR8A 1DLFL 2PTTB 2VAAB 1SBBA 2ICWI 4OZIE 5KSBF 1XR8A 3P4NA 3WFDH 1JK8B 1ORQB 1SHMA 2FWOA 3FO1B 4L4JA 5CILL 5CJXC 5MEOA 5BO1H 5F7MC 4LVNC 4G9FA 1BFTA 1WIUA 2CKBB 4PJDF 2ITCA 1INQB 5C0RL 2VLME 2LU4A 3JWDC 5GZND 5ID1B 1GGIL 5I1KH 2P5WB 4HQQL 4OKVA 4Y7MA 4NHCL 3EYUL 1G9EA 1ZHLA 1A0QL 3MRIB 3KPQB 1LEGB 2AJZB 4CDGC 5K9KA 3OGCA 2FR4A 4POUB 1QPPA 5DA0B 4X98B 3CVIL 3L3IB 4WWID 4JKWA 4X7TB 2FX8H 3EDJA 5F7WC 3LVEA 2JK5A 3V5KA 2P7TB 1MJ8H 4DKDC 2HVJA 2MSPA 4FQ1H 4GAFB 3D0VA 1AIFB 3ETBF 3H9ZA 4OCWL 3TYGL 4F37F 3ZDZF 3FT3B 2B4CC 1E27B 2EDNA 3TN0C 3V4UL 4OIBA 3B3IB 3H6JA 2FB4H 3P40A 3NVQA 1EAPB 4H25A 3FONB 1WBYA 3C60A 4DK3A 3VFMA 3REWA 3MUGA 2G60H 3B9EA 3PDDA 2VABA 3ZDZE 4X4XA 3O3EB 3HA0A 1KT2A 2Z35A 4MLSA 4ODUA 4Y4HA 3JXAA 1S7TA 1FGNL 1E6JH 3ILQD 1AY1H 4Z95L 4AENB 3QPQD 1T66D 2CRYA 3UJTH 5K59F 4FHBD 5IJVA 4P2OD 2E8ZA 1SQ2N 4PUBL 3BVNA 5TE6L 4GXUN 4UIMA 2X4SB 2N7AA 4OI7A 4JPWL 5F7NC 2DF3A 4RGNE 3O4OB 1FL3A 4Y4FC 3T0AA 5J13B 4ZUSB 3MRMB 3SE3C 1KTKE 3MBED 3Q2CA 4YO0A 2IH3B 4KC3B 4LKCB 5KSVB 5I1AA 2ORBL 5DZNA 3X12A 3QDMD 3VXME 1MRFH 4IRSC 1HE7A 4O2EB 4PGCB 3O3BA 4GKSA 1TLKA 4N1EA 3SKMB 3QA3B 5ISZB 2Y5TA 2HFGL 4Y4FA 2EDEA 3SO3C 5GS1C 2DLFL 4H25B 3SKOA 5EIVA 5SWZA 5DJYA 2ICEB 5IB1A 4M43L 5AWNL 1A21A 2VDRH 4UOJA 4X5WB 5MHSD 4PJBA 1OGTB 4NRZA 5F9WB 4PRPA 4K7PX 1YMME 1DQQB 5CP3H 5GS1A 3HG1A 1U8PA 1FC1A 4FQHA 3P4MA 1ODAA 3QEHB 1Q94A 4ZUTB 3QDGA 4U1KA 1LWRA 4P23C 4NGHL 4CU8A 4BA8A 1INEL 3OKKA 3I75A 2UWEA 1QEWA 3S35L 4ETYA 4HKJA 2VLMD 3IU3A 4I0PA 1OAUL 3BZFB 4AM0A 2EDYA 3F58H 4LEXL 2WWKT 3D0LB 1TTGA 4LCYA 1UQSA 3ARXA 4LASH 1YEDA 1GZPA 2O61B 1GYAA 4LFHG 3JVGA 3F6IA 4LLDA 4DTGH 5CSZB 2W60B 4Z7WA 4PJ7E 5GS0H 5ICZB 2H3NA 4U1NA 5GGUB 5FDWA 4JN2A 3TO2B 1G6RA 3KPSE 2Q1EA 3U0WH 4F33A 2UYLB 2ED8A 3DVFA 1VGKB 1KIUA 4WUUD 2FEDD 4I8DA 3OR7A 5I17B 2Z93A 2PW2B 1HH9A 2XZQL 3W39B 3QJHB 5D1XA 3UJJL 2VQ1B 1N3NB 1M7DB 1RUMH 4GG6F 4JG0H 5ALCH 1JNHA 4R4ND 5DR5L 1RMFL 4UOW0 3PL6C 4ODSH 3MOAL 2M2DA 1IMHC 2H41A 2IC2A 1OAQL 2F53A 4OCMC 2VABB 1X3DA 4C58B 5JW4M 4XPTL 3CX5K 5AYQA 4G8GB 3G5ZA 1LE9A 3MA7B 1EZVY 4I2XA 1J8HE 2PTTA 1F8TH 1MCPL 4URTB 5CUSL 2V2TB 5T5NF 5CJ5A 2EDJA 2DQDH 4P3DA 4OSUH 3FAXA 1AFVH 1HCVA 1QBML 3K3QA 4PJCE 2J4WH 4P2QB 2OZ4H 1U8OB 1MAKA 3D6GA 4ODXA 4KK5D 3W82A 4OLVL 2BDNH 1DCLA 5KVGL 1G7HB 4HIXH 1BLNA 2VXVL 4N0FB 3OZ9H 4PGEB 3KYKH 3U46A 4I18B 3HUJE 3BPOB 4LHQB 3W5MA 4CL7A 2C1OA 4PS4H 1E28B 2UZIH 3S5LB 1HEZA 1AHWA 4ZS6D 2Y6SD 4A2LA 3FQRA 4LOUD 2B1HL 1KB5A 4FRWA 5DWUH 1LO4H 5E2WL 5CJXA 2Y7QB 4MMXC 1PY4A 1S9VB 2MPAH 4MD0B 4Y0GA 4U05A 1AQDB 3EBAA 1MPAL 3CVHH 3NCBB 1FNEA 4UOW1 1A6AA 3PQYB 4Y4KC 4ZPVA 2E7MA 1RMFH 5ALCL 5DR5H 1J5OH 2XWTA 4PJIF 1XCTB 4I5BB 2Z9TA 1KCRL 5EUOB 4BYHA 1UCTA 4Z78A 4KRPD 2R29L 1IBGL 3NTCH 3L3IA 4H8WL 3RKDD 2FJHA 3PWVB 2X4QA 1GC1H 1DVFD 5KZCB 3RWGB 4M6NL 2W59A 3MXVL 1AGCB 2JCCB 4HIXL 3S3SA 3EYFA 4TQEH 3FQUB 4YBLC 3U1SH 1JCKA 4L3AA 4YFLI 5HI4C 4G6MH 4G6KH 5DTFB 1I1RA 2IFFL 3W0WD 1IZJA 3EYVA 3MV8B 3MJ8A 2D3VA 3H3BC 2K1MA 4G9FD 5D2NC 4AZ8A 5F1IA 5L8LB 3FN9A 3F62A 3PHOA 3IXAA 4WIQA 4C4KT 2ADIB 4IJ3C 2ARJB 2L0DA 4K7PY 4IOIA 1WFNA 2FIKB 2FYYB 3UAJC 4KMQA 2XZAH 2W9EL 4HCRH 1CCZA 3TA3D 3HAEA 4HJJH 1JE6A 1F90H 1CVRA 1YY9C 3SEPA 1WFOA 1OL0A 2GSIA 5SX5K 1P4BL 1DQLL 4NZRL 3ROOB 3H2WA 4KZEH 3MZGB 2NY4C 4DQOH 1ETZB 5JMRA 2VO5A 4R2GD 4YDLB 4OZGF 4HDIB 5DVOA 3HB3D 4K8RL 5FUCE 4G6FB 3JV5A 5IQ7L 4X7FC 3EYSL 5HY9A 5DSCB 2VKXA 3CH8A 3MRIA 5ESVB 1DN0B 1QBLH 1QUNA 5INDB 1H8OA 4FN0A 1NJ9B 5DRZB 4GJTB 4YQXL 1OAXH 1A2YA 4D0CB 4XP5H 3FQXB 4G43A 3ALWA 4L9DA 3JV4A 3HE7D 4TPRL 1KN4L 4U7MA 2NX5E 2PO6C 4JG1L 1ZWIA 1DL7L 3DRTB 1K4DB 4OCRL 3B5HA 3NCMA 2NZ9D 4P2OA 1CYGA 5IW1A 3GIZH 1EX0A 4TUKL 5E99H 2GT9A 3T08A 3REVB 1KXVC 1FNFA 2FX9L 3CLFL 2UWEB 3I75B 3I3BA 1FSKB 3BUTA 3PGCB 2BSRB 3V7AG 2DQTH 1S9VA 2GCYA 1A7PH 1BQLH 5L2JA 5DFWH 3U0PB 3EO0B 2R0WL 5HHQA 4HWBL 4X99A 5C70A 1WICA 2VC2L 4P4KA 1KULA 4DGIL 5IB1B 4G7VL 4MNHB 4Y4FD 3FMGL 4NWTL 3TBWA 1G9MH 5IFJB 2Z92A 3NPSB 3F6LA 4JDVA 1U6AL 5JIKA 1MI5E 3OR6B 2YR3A 4GS7B 1WTGT 5EWIH 5D1ZC 3OV6A 4N0UB 1EMTL 3IJYA 5FHAH 3FRPA 3G6AB 1AGDB 3TT1H 3MX0A 4L4VE 5IMOA 4CN6A 2GEEA 3EYUH 3HUJB 1P4IL 2FLBT 2YPKB 1X5IA 1ADQH 4KU1A 4ELKB 5E6YA 4PTUA 1RZJL 1FO0A 1P1ZB 3UTTA 2ZOLB 1ACZA 3MRJA 3S4SG 3U6RA 4I77L 5FGRA 4JQVA 4AIZB 3K1DA 5J13C 3SHSA 1KTDB 3KYMA 1JF5A 5TDOB 5J1AB 4PBVC 3CFBA 4PJAA 3EO0A 2EDXA 2P1YA 1D6EB 3BXNA 4GKNA 3QFJE 2QADB 4MA1C 3EKCA 4RMSA 4ONOA 4QOKB 5EZJA 5TQ0L 1OTTD 3Q6GH 3O6MH 4DVBA 5EFIA 5C0GA 1FZMA 4WJ5A 4PJXE 4WWKB 4N8VA 1U8KB 5AAWA 2B2XH 2IAMD 4K94C 4NO3A 1KNOA 2W60A 4IRJD 2OXGA 1JHKH 2YHGA 1LNUA 5DC9B 2BY3A 2EXYD 2X4OA 4EIGB 4ZODA 1A0QH 1VACA 3RKPA 3V7AE 1XGRB 3GJFB 4O5LL 3KPRB 1PAMA 5DLMH 2F5AH 4TNVK 1K3IA 2DYPA 1VERA 1S7QB 5E70A 4N5EC 1AE6H 4MQTB 1XEDA 5F96L 3NIGF 4NO0D 4YE4L 3S6CA 5IT2H 1PYWB 1RZKH 4U1JB 2VXTH 5FKAA 4B0MM 2MTPA 1XGQA 2DLTA 2LABA 2VDKH 3SDCB 1N59A 2FHFA 4I13B 4U3XA 5L6YH 1S78D 4XX1E 3C6SA 3HNVL 5JA8B 1ZLVH 4X7EC 4C4KO 1XF5A 1FNLA 4LHUA 4LSQH 1YEIL 3QFDA 3FT2B 3LY6A 5I75B 1OLZA 3B4NA 3RZCA 4LVEA 3M17A 1XF2B 2RGSA 4CW1A 2XWJB 3M8OL 4RFNB 4NC1E 4EKXA 1IC4L 4HUKB 3MV8A 3MCLL 1A6TB 1WEJH 5HYJD 4Z7UA 4NKDB 3CPLB 4X9BA 4POYA 1FNHA 4Z78B 3MYZA 1VHPA 1B0GA 4F9PC 5BV7H 1WWBX 3I3EA 2ADFH 4ERSH 3G6AA 1OAUH 3LKSA 1AGCA 1MCLA 2EEDA 2WM0A 4IDLA 4OFVA 3SY0B 4MVBD 1NC2B 1DL7H 2A6KB 2BMKB 3D39D 5DJXA 1C1EL 4L3CA 2H32A 1EMTH 3S97C 4MQ7A 1UZ6E 3DGGB 1V7ML 1N2RB 1I1AC 3QEQA 2X4UA 2ZNWA 4IIQC 3VA2C 1CGXA 3RGHA 1WFUA 1JUFB 3GHBH 4YZFF 3AS0A 1KN2L 4XNUH 5LBSL 5DD5H 5FCUL 4RA0C 5IQ7H 4NWTH 1U0QA 3MRDA 2FYYA 3LPWA 5GRZA 1FIGH 5T5FL 2IPUG 4NQSA 3T65A 4OCXH 5ALBL 5TQ2H 3THMH 2IANB 3PXHA 5JDSB 5JUEL 5DHVB 1E4JA 4JPVL 4HF5H 3RJQB 1FC2D 1T3FB 5GGQH 2JCCA 4BSVB 1BQLL 3MCKB 4GRWE 1K8DA 2FX7H 4GW1A 4Y4KB 1CT8B 4MJ5B 3WLWC 4P2CG 2GFBB 4KKAD 3SE8L 5F9OL 3BWUC 4NM4L 1PDKA 1I3RA 1J1OL 3V4VL 2P45B 1Y18A 1RHHA 4TVPD 4L4VB 4JQIH 4QO1A 4NHUA 1T6VN 1QVOA 1D9KA 3BP4B 2MFNA 3C08L 4HPOL 1MQKL 1ZS8B 5F7DB 1T0MB 4HWEL 5I1GL 1M05A 1YN6A 1ZVSB 1FN4A 2CPCA 4EQ2A 4QNPE 3F12A 5M95B 2GJZA 1XGQB 3M07A 1JI2A 3FO0H 1VDGA 4YHLH 4DKFL 5SWQB 1P84J 5FGBA 5EN2A 4L1HA 4HT1L 2Q3AA 3DPBA 2OYPA 2IALA 5IJKA 2CMRH 3BP7B 1S5IL 3E6HA 5DS8B 4P2QD 3QXDA 4GO6B 2DWEB 2HJFA 3T0ED 2A9ML 2I24N 5C9JA 4LCIL 1HHKB 3B9AA 2FX8L 1RK1B 4XVSH 1M7IA 4NO2B 1HNFA 5KG9B 5GRVK 2LVEA 1EO7A 1S7XA 4QOKD 1RIUH 5FB8B 3WS3B 4O02H 3QIUA 4OIAA 1ZA6B 3IDGA 1NEZA 1UWGL 2YEZA 1R5VA 2A77H 1G0XA 3X14B 2H26A 1NC4A 3SDAD 3PWJB 5ADOL 2BVPB 2WINA 4CVUA 3QDHA 2B1HH 4D8PB 1N0XH 1IGCL 4HXBH 4QXTB 2X2YA 3O2WL 3Q5TA 3BFOA 5I76A 2UZIL 4PJGB 2GITB 1RZ8B 2AI0H 1A14L 1S9YA 4L9LB 1QO3A 4Y8DC 1MFEL 5F7EH 3AC0A 5HYSB 3DVNA 3U30C 3JUZA 3V2AR 3VJ6A 3W9DA 4G6JL 2C4FU 3HCVB 4FQCL 3ARBA 5CBEB 2VAAA 4HK3J 1PD6A 1P9MA 2KDGA 4WV1C 2GIYA 3FT4B 4RWYH 4Y5XB 4FFWD 3MCG1 1KCLA 1IC7L 2CKNA 3RHWF 1U8HB 1ZSDB 3IDUA 2MOVA 4IMLB 1U3HB 4MZ3A 2R1WB 1ZLWH 4U1GC 1WCQA 4YBHA 2ZOKB 1DJSA 1WFTA 4PLJC 2HTKD 2OTUA 4XMPH 2XTJB 4XMPL 3MJ9L 1A7NH 2C3XA 3MLXH 5F9DC 1UM5L 4WW1B 4WHYG 2OCFD 4Z7WE 3RNKA 5HPMA 1WAAF 1JRHH 3VXRA 3CIQA 4KVCH 1IFHL 2XZCH 2FGWL 4GBXB 1CD8A 3QDJB 5DD0L 4I2XE 4UT6H 1IM9B 1HSBA 3QO0A 2UZYB 4L8DB 4K9EC 3ULVF 3QUYA 4BFIA 1BZ9A 4L4VD 5LWYH 3H7BB 1FYHB 4S0TD 1LO3L 1ITBB 2QQNH 4QYOA 3EUUA 1RZGB 1J7VR 3V7MA 5LGJA 4GG8B 4YHNB 2ICWJ 1PZUB 3CU1A 4NKOB 3JSSA 1A14H 1MI5D 3IFOB 4PJBE 1YNKH 2DRUA 3QXAA 1T1YA 4XP1L 2VQTA 4Q9BA 3FHQA 4KPHL 2XA8L 2P8LA 2AGJH 4P9HL 4MD0A 3DSNA 1DBKL 5JO5A 3ARUA 4NUGH 1RUPH 1YY8A 3IU4H 5EORL 2YMXL 3WO4B 3WNOA 4Z7WF 5SWSA 5TGBB 1LK3L 2WBJB 4UT9L 2W65B 3KWWB 3TVMB 4KKBD 4M7KL 2XRAL 1HINH 4YHYC 1C5BH 4GMSL 1YNTA 4HC1L 4KJWD 5KG9A 1RSFA 3MR9A 3ZKMC 1TZGH 3HG1D 2VL4A 4HXAH 1CFVH 1XF5B 1V3KA 4LHUB 3QFJD 3RRQA 4CRPA 4JRXA 1H8SA 2BNRD 2C26A 3ZKQD 3KVQA 5GGSA 4NQEA 4NWUH 3BSZH 5DMIH 3RBSA 1JGEB 5IM7B 4LCWE 4LVHC 4TSCL 3IDNB 4HIJB 4PRHE 3S96B 5JLZA 2CLVA 4XH2B 2FJGA 1PLGH 2L7JA 4FQ2H 3T3ME 4UZGA 2V6HA 2C3HA 4OQTH 3ZE2E 3O9WA 3UTQB 1CD1B 3WLBA 1NUFA 2EYRA 4M48H 2LAGB 2ESVB 1UKQA 1QPXA 4JVPA 3MBXL 3MLUH 4JFZL 5H35A 4UILL 2R0ZL 2YKLH 3IXAB 4L3CB 4WTZA 4I0KA 3VXNA 1VEMA 3RGVC 1SEQL 2PKDA 2BNUA 1FJ1B 5IBUB 1QNZL 1OP9A 3IFPA 3NA4A 4TSAH 5H37H 4KRPB 2AQ2A 4LKXA 4NZDA 4XGZB 5DUML 2D03H 5K9QI 1NFDE 2HTLD 4L4TE 4MJIB 5E94A 2ZOKA 1W0VB 3QXWA 5ENWB 4FQIL 2YN5A 2Q8BH 3BQUC 3KPSB 3T0DA 3EHBD 1Q9LB 3SGKC 3CUPA 4KROD 2IPKA 1D5ZB 1FIGL 3BYTA 4LEOB 5JHDB 3OAZH 4YDJA 1YUHA 1CBVL 3KR3L 4GQ9L 5HVHC 4JY4A 4H20L 3ARFD 4YWGL 5EU6B 2YD5A 1I8LC 4XVJL 1CDUA 1F3JA 1JZ6A 4KTDH 3DETD 3BAEL 3ZE1F 4TRPH 1HH6A 4YHOH 2YC1A 4WCYL 4F9LC 2BXYA 4JREC 4LPCA 4FP8L 3P11L 4RFEA 5DMKB 3MRPB 2X44D 1UEMA 5JPNA 4Z7OE 2DLEA 5C07A 4ZOCA 1RUKH 5IWLA 1U2CA 5A16A 3N1FC 4H0HB 2EH8L 1LO0L 3EFFA 5BV7L 1UH4A 3QCVH 4AIOA 2DQHL 4K71B 1JP5A 4GW5A 3IFNH 2KQMA 5C0AA 4OCLC 2CR3A 4J4PD 1BOGB 5CMAB 1S5HB 5BVJB 4KZDL 1AKJB 3D9AH 4ODXB 3IJHB 4R4FL 3LQAL 4WEBH 4CVXA 4UQ3B 1BBDH 5IBLC 1HHKA 1LVEA 5IHZB 4QHKJ 3C2AL 4G9FE 2VE6B 4LCUA 3V8OA 5LAXB 2I9TA 5EZOL 4YXKL 3WDIA 5IK3B 1NCTA 2EEAA 1AGFB 4K3GA 4OGXH 4XBPA 2WBKA 3NIFF 1G7LA 2DB8A 2P5WA 3E2HB 1KENH 1SYSB 2Y06L 4XVTL 4TVPL 1UKTA 1LO2H 2CKBL 5ICYA 5DD3L 1CU4L 4DZBA 3UTPE 3HNTL 1EEZA 2VLJB 3QZWA 4YPGB 1XIWB 2BFVH 2QQQA 1MHHB 1J1PL 5F9JA 2FCBA 3VXTB 3V0AC 2I27N 2WBJC 1NQBA 4L29B 4TUOA 1J8HD 4YC2C 5IVXF 3RIAK 1KN2H 4WV1B 4XNUL 1IARB 1AP2B 4MNGB 5LBSH 5IVXA 2PXYB 5I16A 1QR1B 2Q7YB 3UC0H 3I2CH 2EIZB 1FL5B 1QFWH 5I8KH 5FGCB 3RVUD 4M5YL 4L3EA 2HAZA 1EERB 1EFXD 3CPLA 3GEWB 3QUYC 3IGAB 5BS0E 1HHHB 2X4NA 4LLYB 3GSOA 4X9GA 5IHLB 3ELAT 4Z7UE 1U8OA 3RUGE 4A6YB 3VG0L 1CGWA 4MCYA 4MJ6A 1KNOB 3KLAA 4N8CL 5TQ0H 3G6JB 4G8IB 1ZT4B 4FXKB 5T1KD 1BBDL 1SJVA 3KPSD 1JTPA 3TT3L 4Z7QE 1FLRH 4OZGB 2OTPA 2XA3A 1MCWW 3T77B 3UXFA 5IB4B 5E6IC 1TXKA 2HJLA 3L7EB 3KLHC 1T1WB 1XIWA 1YYLH 3UEZA 4Z7VF 2F58H 4HCRA 1FLRL 1G6RL 1CD1A 3F7PC 4KDTA 4Z7QF 1J86A 3R0MA 1U93B 4KUCF 5DK0B 1T1ZA 2AJSL 4P5TD 5CEYA 1IKFL 5D72H 3WUWB 2OI9C 4R90H 4E41D 1UXSA 3CK0H 1TPXB 1CK0H 2ZNXA 1QG3A 2CIIA 4MB3A 1J1XL 2JJVA 4TSBL 2DICA 1A64A 3EAKA 4QRPB 3LKOA 2E5EA 2FGZA 3VFTB 3IJHA 2AJVL 1P4LA 2HJKB 4FTVD 1WK0A 5DGRA 5KSAC 3M17B 3MGTA 3OPZL 4HKXA 3FMGH 5B3JF 1UB5A 4WUUE 4D9LL 3GSNB 4DUWA 4X7DC 4UV7H 1JZ7A 2YA0A 1QEWB 3IRZA 3MUHL 4S11A 1XZ0B 1PQZB 4QYOB 1B4JL 4KWUA 2BY1A 5MP6H 2CJUH 4FQIH 2DDQH 3D69A 4KKCD 1LO5A 4O5LH 5DLML 1OGAB 4OUOA 5C0CD 4J3UA 2GT9B 3CVHA 3F5WA 4XVUC 3W0WA 4MNQB 1JGDB 5E6ZA 5E99L 1KOAA 4NPYA 1SVCP 2BJML 2GCYB 2VLRE 3RNKB 5HPMB 3PXJA 4YXKH 3MNWB 4JM4H 2ARJA 2IJ0C 3O6ML 4WTXA 1C7SA 4RX4A 2KBGA 4PGDA 4QXWA 1FFOB 2CLZA 1H8NA 2EH7L 2GK0B 4NC2B 1MI5B 4KJPC 1CIUA 3BPNC 1YEEL 5C86A 1GSMA 1OF2A 1DP0A 2AJXL 5IFJA 4AH2B 4G80B 5DJDB 2F8XC 4OV5B 3S37L 4BZ2L 2NR6D 7FABL 2P8MA 1CF8L 2PXYC 3V5HB 5C92A 5E2UH 3WFHA 3INUH 1D5BB 4TSCH 3U2SB 1VENA 4Z0BH 3C6LD 4BFBD 4FZ8H 5I1LB 2IAMA 1V3JA 5CD5C 1AD0B 1P4IH 4PRIA 1KJ2A 3VFSB 3P11H 4HD9A 4DEPB 4KK9D 3RWJA 1Z5LA 2P49B 1I7RA 2QHRH 1F4WH 3U4EB 3LKNB 1KG0A 3GSWB 3K2MC 5F1SA 3VRIB 4WI8A 2W9EH 2YUWA 5IR1B 3DVNB 2XACC 5I0ZA 3ZYIA 1ZWIB 3MLYH 4QT5A 3KR3H 4GQ9H 4NUGL 3OJ2C 5GGSB 1F3JB 1QRND 3TH2T 1Y6KR 4ZNCD 1U42A 4HKZA 2RHEA 1YMMD 4Z7UF 2B1AH 2Y6SC 4NCC1 2EEBA 3EOTL 4JZOB 2X40A 3JWNC 1M71A 2RB8A 5M7QA 5SWSE 1N6UA 4AQ1B 5DEZA 4P9ML 1NGQH 1ONQA 5BJTA 4M93B 3AAZB 2K7PA 3SDYH 3WJLA 5FUCC 5CEXA 4Z8FL 1FORH 1XF4A 3KPPB 4DOHE 5TDNB 2FEEL 1FFPA 3G5YB 3EJZC 3VGGA 3GIZL 4GLRI 3QI9D 4MAYC 5T3XE 5IESL 4LCCB 2FGWH 1IFHH 2XZCL 1MFDH 3MBEC 3PABA 2BVUA 5E1HB 4JRYA 4OCNC 2YKLL 4F7MA 1HWGB 4LLQB 4WRLA 2APWA 4M02A 5F9JB 3RL1B 3VWJB 3NABH 2X09A 3VFRA 5KVDL 5CLTA 1FBIL 3LEXB 2ZCKH 5JHLH 3BUYA 5DMJB 1ULVA 5I66A 4FQ2L 1CL7I 4L9LA 2R1YB 4YHIB 3EYSH 2GI7A 1I3RB 3H9SE 4PJGA 1CFTA 5JIHA 2FBJH 2A0LC 3U48A 2NW3B 2Z31D 4IDJL 3WLWD 2BOBA 5JMOC 3VMPA 5HXMA 5MI0B 5E8DH 1KB9J 1CFBA 2FH8A 1RIVL 1P2CA 1T0NA 2VXVH 1UJ3B 2QSTA 1LP9F 3RUGB 3KPOA 4UQ3A 2D7OA 5KN5B 1LK2B 4UTBH 1QSFD 4P0DA 1MAML 4PLOB 3PP3K 4HZLA 4XNMB 5K9QG 4Z9KB 2NQCA 4B53A 1NCCH 1NDMB 5CJOL 4IMLA 4R7DB 5FK9B 4I0PB 1H3VA 3CAFA 2B39A 5CZKA 1EVTC 4S0SD 4G6KL 1CG9B 3ZKND 4K8RD 3RU8L 2FJFA 3PDOB 2A6KA 5DEFA 3H9SB 1KGCD 5CCKH 5I66B 4QY8B 1WF5A 4Q0XL 4U6TA 3QULB 4Z77A 2IPTH 3X13B 4GS7C 5C08E 1TENA 2A6IB 4H1LA 3O2DA 3UJJH 5CD3A 3X17A 3LEYL 5MEQB 4MJ4A 2MQ0A 5GSRB 3LOWA 4RCAA 1A22B 2DQJH 3GRWH 4F58L 3KXFE 2EDBA 4PBWD 3NFPB 3HS0A 1P2CB 1U41A 3BGMA 2ZG2A 1RI8A 2VQ1A 1QHPA 4WVRA 2R2EA 3VFPB 5FCSH 3GJFH 2AERT 3KNBA 3HMXL 3U0TA 1F6FB 3UTPD 5CEXB 4Q6IB 5E8NB 2AJ3B 4JFHD 4NOFA 1A6UL 4D0DA 1NBZA 3S3JA 2A1WL 4DK6A 2CK0H 3CFJB 4JJHA 5FYKH 5LCVH 3WHXA 2XKUA 1MAMH 2VITA 5E4EB 4PJ5D 5AAMA 5HJ3B 1RQ5A 4JZJB 4TYUA 3RWIB 3KHQA 1G6VK 4J4PA 3T0VA 4OCYL 2J8OA 4P9MH 2C4FT 1AO7D 2MKLC 4GMTH 5A3ID 4FQXB 1DSFH 3QHZL 1NKRA 4OQTA 5CD3B 1ES0A 2R0LL 2NY3B 3LQZA 4PRAA 4WFED 4NN6C 3FOLB 5JUEH 2OZ4L 1G7JA 3GRWA 1G6RB 1KFAH 3T0WA 3VFGL 4RMRA 4YDLC 3X11A 4XT1C 3RVTD 4LU5H 1MFBH 3KNBB 2PW2A 3BIKA 3A6BL 5GS0D 5MERA 1QBBA 2BSTB 2DL9A 1L0QA 5J9PB 5ISZA 1HZHH 1VACB 3QIWD 4JDZA 1FVCB 3K4AA 1TQBB 2BSED 2V7HB 4E42A 1G7PA 2VZ1A 1DVFC 3HI6H 3FAWA 1K8DB 1FGVH 1JN6B 1EUUA 3MBEB 1A6WH 4Z95H 3IT8D 3TESA 3RIFK 4DW2L 4EUPB 1CTOA 2X4QB 1OGAA 4P2RE 1MVFA 3HLAB 2W91A 1NPUA 1DFBL 1GC1C 3QUZB 1XMWA 3U6RB 1ZXQA 2F54D 4HWUA 2PUQT 3B5TA 1R3JA 4Y88A 1RPQA 2P24A 1D9KB 3BP4A 2I07A 4WFFE 2DTSA 3CLEL 1MSPA 2EH7H 2AEPH 3P30L 3S4SA 4HWEH 2QL1A 1AD0A 3O8XA 3C09C 1GRWA 2FL5A 4Z7NF 2DJUA 3MLRL 5C71A 3ORJA 2PTUA 2X1WL 4QCIB 4QHUA 4RGNB 3DI2B 5JXEA 4R26H 4H26A 3OBAA 5DK2A 1KB5B 5C2BH 1YN7B 4RGNC 3QUMB 2BRRH 1F4WL 4PP2B 2XZZA 1HEZB 3JV0A 3SE3A 2A9NH 2GTWA 4K3DL 4KMTL 3PGDA 2X6MA 4GAGH 3SGJC 4R2GC 2QEJA 4K9EL 4RGOL 1PBYA 3VXMA 3A6BH 2CJUL 1U3ZA 3ESVF 4P5KB 2HN7A 2CLRB 2QLVB 4NN7C 4R8WL 3RTQA 5HYJB 1BLNB 4H0GA 4L8BA 2NZ9C 3INUL 1IQWL 4XWOC 1I9IH 4OCXL 5ALBH 4H5SA 2WW8A 4LHUG 3FT2A 1IGTA 4KY1H 1AR2A 5HHOD 1QLFB 2P24B 5K33A 3L3HB 4Q9QL 2VLRA 2L7UA 3FRUB 1NC4D 1XF1A 3SDAA 5FM8A 1WBXB 4GUPA 2Y25A 3LN5A 3WIIH 4PV9B 4JAMA 3KAAA 1H0DA 1R6VA 3DMMC 1I85C 4MHHG 3RNQA 1IM3A 5T1DL 1IAIL 3S88L 1YMMB 4U1LA 3Q6GL 5LCVL 3NFSH 3DJ9A 2IG2H 3QI9A 3EGSB 2WIIA 4JKLA 1V7NH 4HIIA 3D0VB 3OKLB 3TBYB 4KDWA 1RURL 1UA6L 2ATKA 1KIPB 3WCYA 4O58H 3EJJX 4XTRC 3VXSE 4JVUA 1FIEA 4ZXBD 4TN9A 3PF2A 2VR9A 1J9CT 1F4XH 3OKKB 4EI5A 1AHWC 3TZVA 3LEVH 4S1SH 3O81A 3I84A 2YBRA 4EXKA 1U92A 4HK0B 1S7TB 4XBEH 3X13A 1UQSB 4P99A 5HGDB 3GSXB 4KJYA 5ELIA 2HFTA 5C09D 3UO1H 3P9WB 1JTOA 1LO5B 3RWCA 3DOSA 3IDIA 3U83A 2VLKA 2VLJE 2GSGA 3VXUA 3UJIH 3ARGD 1F13A 1OB1B 2F8VA 3RX8A 1Q9KA 1G9ML 2CR6A 1X5AA 2EDTA 1MHPL 5HI3C 3P0GB 1QLRA 2GKIA 2E7CA 3WYRA 1CD9B 4P23D 1WZLA 5J12B 4ZTOL 4POZD 3SPVA 1QACA 3WHE1 4LCUB 2EDDA 2BZDA 1NBZB 3DMMA 4MNQD 1GGYA 1BF8A 2AP2A 1A4KB 4K2UL 1JNNL 2X10A 5D1QD 5CLWA 2QSCL 3GJEA 2AQ3A 3RX5A 3QIUC 1T3FA 3ILPA 5HDBE 1NAKL 5J6GB 3N50A 4JFEA 4KKBC 1ERNA 2YXFA 4LARL 2YZ1A 1MJUL 4FNLL 4MAYA 2E6PA 2Y5EA 2Y4SA 1FAKT 4M5ZL 4U6YA 8CGTA 1FCCA 1WC7A 3O6LL 2P5EE 3VXTA 5FDYA 2IMMA 4I18C 2OL3B 3DWTA 3DV6A 1S3KL 1LDPL 3ULUF 2A6DA 1KV3A 3MREB 4EIZC 2AK4D 2PO6B 1QFOA 5KZCD 2H32H 3GBML 2AABH 2DLHA 1L6XA 4I3GA 5JOPD 1TVHA 4AMKL 1T5WA 4JY6A 2DJSA 3HRPA 4X6DE 1NEZG 1G9MC 5IG7A 1J1PH 1SM3L 3RY6A 1OAYL 3CU7A 3MXWL 2VDOH 3NIFE 4GQPH 2XTLA 4EVNA 4U7SA 1FO0B 4EN3D 3ZKXC 4YNYB 2CDFA 3EFFB 2O26U 5IF0A 1W2KT 3ZDXE 4CNIA 4K3EL 5C0DB 5C2BL 4RIRA 1T66C 2XICA 2QSVA 3ARYA 3M45A 3O9WC 4LAQL 3V6FA 2CH8A 3TBSB 2QHLA 3B9KD 3QZWG 3BDYL 3VW3L 1AI1L 5L2KD 3DO7B 2VDQH 5ESVA 5L2KE 1CICA 4Y5XA 5EZLB 5E6ID 2DM3A 1ZHNA 4NBYB 5D5MF 3CZFA 4O2CB 4XAWH 5E9DA 3O6KL 1R5IA 1JWSA 2PO6A 4DAGL 3HKFA 2P5WE 3GSXA 2PYFA 3T3MF 4LVNB 4GMTL 4QWWC 4P5TC 3SKUD 2GSGB 3GSUB 4OLXL 2VSDA 5EOCL 2IAMB 4JR9L 4FZEL 2LAAA 3CXHK 3CJJA 3L95A 5ICYB 5EH1A 1OAYH 4YDJB 1BM3L 4IOIB 5FYKD 4KI5E 2OQJB 3RWEB 1HHJA 1FG2A 2NY7H 4LPXA 2YEZB 3MLUL 1F02I 4ZO6A 5D70L 4NRXB 5T3ZE 3CDCA 1KPVB 3KXFB 2RCSH 5J12C 5HGHA 3B43A 4N0YH 5AEAA 4DVRL 1Q94B 2OR9H 1NH6A 2WUBH 3E6FB 2ATKB 3EYOB 1DLHB 4YFLF 1OSZB 3L6FB 1FPTH 3O6LH 4G6AC 2E9IA 1WBXA 5DRWA 5DJ6A 4M7LL 2V7NA 3LMJL 1Q1JL 3IAPA 2AAVA 5E5MA 4U1LB 1DSFL 4XPBH 3I6GA 4KTEL 1WWWX 4ODVH 5I1IH 4BH7B 2HT2D 5DZOA 5D7IF 1TQCC 5ESQA 1WSST 1YZZA 1CL7L 2EXYC 4HV8B 1HQ4B 1I7ZB 1ROWA 2AEQL 4NT6B 2VE6A 1M4KA 1NCDL 5I8CA 1I9RH 4CUCA 4V1DD 1FO0H 1HH9B 4U0RC 4KI5C 1ZLWK 5JOFB 3IDXL 5EG6C 1ADQA 1BAFL 1OD7A 4KDTC 1KIQB 4JO2L 2Q76B 3B2UD 3O4LB 3GNMH 5C0CA 4EI5C 2FDBP 3BHBA 1AO7A 4NQEE 4UDUB 2AJVH 4MMZC 3PWPB 4XP4H 3MRCB 3ARBC 1MCDA 4RFNC 2QJDA 3ZDYF 2OS7A 1MFCH 4D3CH 3DX9A 1YNTB 2VDML 3TF7C 4P4KB 4ELMF 2GJ6A 1PVHA 3GJEB 2YSSA 5HHQB 4N1HB 1TNNA 3TNMA 4QCIA 4QHUB 1WBZA 4Z76A 1DQJB 4M61A 4FFYH 3I6KB 2XN9E 3ZT6A 2W38A 4W4OC 1TZGL 5E7FA 3QDJD 5HJ3A 3SDAC 5KJRH 1TJHL 4RNRA 25C8L 3ZYOA 4PGJA 3FJTA 3O6FA 4Q97A 2C1OB 3IAGC 1M7XA 2JF1A 2H2PC 4X6FA 1QKZL 5CZVL 5FYKU 1R5VB 3BQUD 1EO8L 1IEAB 1FO0L 2I9LA 5D1XD 1UWEL 2CK2A 4FFZL 1PKQB 3JV4B 3C9NA 3C60D 2D4DA 1ZHKA 2DYPD 5DC4B 2AJZA 4YGAB 5F21B 1OGAD 1VFBA 5BOZG 1NCUA 4LEOA 1XIWD 3O3BB 1KLUB 1MLCB 5IKCA 4HMDA 5T33H 5I17A 5DI8B 1KIPA 1I7UA 4XNYH 4X7TA 4OLUL 4KQ4L 2YD4A 1NC2D 2Z0BA 2YD7A 4P5TA 3QI9C 3N1GC 4Y5YB 5KS9E 3LV3B 4WWKC 2D7TL 2NZIA 3D85B 1UVQB 2OP4H 3VXQA 1YMMA 1AFVL 3RKDC 1BVLA 3K80A 4MXQD 1U8QA 1S7VB 1RUQH 1E4XH 4OF0A 3F8UB 5E08L 3WXVH 3LDBB 4MA1B 3DX8A 5E8PA 1CICB 5EU3A 1FAIL 5ESQB 1RZFH 2QQKL 2F19L 5GRUL 3FFCE 2DQGH 1IT9H 3BJ91 4J2XA 1LO2L 2CKBH 3UTOA 1PX3A 2E6JA 4FQQA 5HI4D 3BMVA 2DQEL 5GSVB 1TDQA 1DVFB 2R2HB 1Z5LB 3ZHDA 1BM3H 1CDYA 5SWZD 4NCDA 4OUUB 3AROA 3U4BH 2MHAB 5IVNA 3VI3E 3P3YA 3T3PF 5LGHH 3CMOL 3HI5H 1AGBB 3MRMA 3I6LE 3IJSB 5I9QC 3BHBB 1CLYL 1CE1L 2NY6D 4PY7A 4WFEE 5ILTH 3J7HA 4OFDA 4OM0H 1PKOA 2BC4B 2Z8VC 5IB3B 4FMKA 1EHNA 3G08B 4HH9A 4EDXB 1DFBH 1CLYH 4NZUH 4XHJC 3MRCA 1H3XA 2DQHH 3VXMB 2NX5D 5JDJA 4Z5RB 4JQXA 2ZG1A 1LO0H 3HB3C 4NNXA 1NFIA 1OTSC 5E56A 4X5WA 1CR9H 2WBWB 3ARBB 3ZTJG 4CBPA 3QEUA 3SKNB 5GRJH 1DQJA 2OI9B 4ONGH 3P4MB 3B9DA 4OGZA 3PABB 3LZFL 4N90D 3DVGA 4XNXH 1X5KA 4Y8AA 4NHUB 3BKML 1IKNA 4WO4B 5SX5H 5HHXL 1DBJL 3QHFL 4LU5L 3LB6D 3CZFB 1KB5H 3K81A 4JFQA 2A9MH 1WQVT 2EC8A 1OAKH 3QUZA 5TPWH 4HS3A 3U46B 2BVQA 3BZEB 4UINL 2BC4A 2FBOJ 4AEIL 3VWJD 2R0LH 2E3VA 3D5OF 4YHLL 2HA1A 1PFCA 3S5LA 4UTAL 3MACH 4FXGB 4LNRB 1NJ9A 1FVDB 4OCSL 1J1XH 1U8NA 1QRNA 2P42B 5GHWL 4APQB 5F7YC 1IQDA 2OZ4A 5C7XH 1N6QL 2IEPA 2EYTA 4EQ3A 2NY5H 4L8CA 1MHEB 4M5ZH 1J0KA 2OTUB 4B50A 2ZG3A 4ONHB 4PUBH 4JO4L 3FOLA 2JCCE 4XBGA 4F3FA 1EO8H 2P44B 1A3RL 1WZKA 4P3WA 4G8GA 5I30H 3O2VL 4QRRD 5HGAA 3RVVC 1A1OA 2C7UB 3PDOA 1WEJL 1FRGH 2HH0H 3PGCA 2NY1C 5DHYA 5GSVA 1RVFH 3FFDB 4X7SL 2IADA 2H6PA 4FMFA 3S34L 1NGYB 4WU5A 3FHAA 1QVOB 4ZTOH 4TULH 3NCYS 4MGXA 1N0LA 3EFDL 1K3ZA 4OCWH 5J3HC 2H1PL 1QO3B 5D6DC 4HEPG 1OP5K 2DMKA 5DD5L 1XH3A 4JO1L 3S35X 2APVA 3VFOA 2X4TA 4S1RL 3OKOA 5C6WH 1T6WA 2DQUL 3BZ4B 4LLWB 4HC1H 3KPLA 5BVPL 2W65A 3KWWA 3TVMA 2ED9A 4M6MH 1U8MA 4X6DA 1J0IA 3OKEB 4F8QA 3MSPA 2HVKA 3WN5A 3KHOA 2R2BA 1CS6A 1TZHB 3BOVA 3F7YA 4AENA 1EEQA 1KCVL 4WHTB 4M6OH 4BM7A 5CP3A 1HKLL 4PRNB 3MCLH 2MMXA 1N4XH 3I50H 1D6EA 2SEBB 2R2CA 4JB9L 3M8OH 1MLBA 4R7DA 2B2XL 4BH8B 4ZPTA 4IDJH 5D2LF 3CVHB 3F5WB 5HGBB 4AY0A 1T7VA 4K8RC 3S7GA 2JJSC 4MJID 1CICD 4PGCA 4W81A 5DYOB 2AKRA 3OHXA 5LAXA 5IMKB 3CSBA 3IFLH 4JLRA 2AS5M 4R4FH 1I1AB 2X70B 1FBIH 2FR4B 2ZSVA 5E5RB 1UB5B 1JI1A 3QUKA 4MXWL 4MAUH 3TBWB 1JWMA 2XY1A 3U82B 2FHBA 5C0DA 4OFYD 5FO9A 4JO2H 4PJ8B 2JELL 2NY7L 1RZKL 3D39B 1NUGA 2ZPKH 1MNUL 4L9LC 4DN3L 1Z2KA 5I19H 5SWSB 5FA3A 1FV1B 3IETA 5C6TH 5BV7B 4I0CC 2BFVL 3D18A 1BWMA 1KJMB 3AY4A 5JQ6H 2I60H 4AEHH 2V5SA 4IRJA 5CJQH 4NQUA 43CAB 3FL7A 1OWWA 5D1XC 4PRIB 3CH1B 3SDDA 3QEUB 3BO8A 1CR9L 4YDIH 3SN6N 1WJ3A 3CDYA 4PBXA 4OF5A 3OX8B 4PJ5A 1JRHI 1IAMA 3AB0C 4UQ2A 1P5UA 3WKNA 5DJCB 1A2YB 4D0CA 3KJ4B 3QCUL 5A40E 4GW4A 2OTWB 2PYEA 3LQAH 4WEBL 2YBRB 1KC5H 1UENA 2VLRD 3NN8A 2X4TB 4HUNB 4HAGA 1T83C 1DEEA 2FD6L 1E4WL 1LP9B 4F9LA 5F88A 5D7LB 1MREH 4QKXB 4EVNB 5FYJU 5HGHB 1AGBA 4NM8L 3S37X 3RHWK 2X4RB 4FZ8L 4JRWA 1Q9WB 5C9KA 5CSGA 1JFQH 1Q38A 3IDYB 4Z0BL 3VE0B 3V9FA 4OCRH 2G9HB 3DRQB 3WKMH 3GM0A 2EXWC 3WJLC 2DIBA 3SGKA 2AABL 2H9GA 2IBZY 1GIGH 5KSAD 4XVUD 3HC3L 3L5WB 1MHHA 5E03A 2NLJA 1F97A 4NFBA 5BZWA 3Q3GA 3TN0B 2VN7A 4DAGH 3UBXB 1FNAA 3VD5A 5EZLA 4XNZC 1UYWH 1NBVH 5LXGL 3DO7A 4DN4H 5HGAB 4IRJC 1KFAL 3VFGH 3ULUL 3L3HA 5FYJD 3MNZA 3QAZC 1VESA 3DYOA 5I73B 2H8PA 2IBGA 3P4LA 5ANME 1BVLB 3WXWL 3L3GB 3TIDA 1CXHA 5IFHH 4F7CA 2OBGA 3MV7D 3BH9B 3IDNA 3PV6A 1INDL 1ZANL 3ARDA 4OJFL 1OQOA 4MA3A 1DQLH 4NZRH 1SBSL 3CSYA 3HMWL 2DAVA 4JHWL 4QRTB 3TO2A 4A6YA 4PJXF 1NDGA 1QOKA 1C08B 2D03L 5EOQH 1W0WB 3TNNB <