1FAIH

Three-dimensional structure of two crystal forms of fab r19.9, from a monoclonal anti-arsonate antibody
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
221
structure length
221
Chain Sequence
QVQLQQSGAELVRAGSSVKMSCKASGYTFTSYGVNWVKQRPGQGLEWIGYINPGKGYLSYNEKFKGKTTLTVDRSSSTAYMQLRSLTSEDAAVYFCARSFYGGSDLAVYYFDSWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSALYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG2B-KAPPA R19.9 FAB (LIGHT CHAIN)
publication title Three-dimensional structure of two crystal forms of FabR19.9 from a monoclonal anti-arsonate antibody.
pubmed doi rcsb
source organism Mus musculus
total genus 37
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1992-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1faiH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1faiH02
3QO0B 3S37L 1FCCA 1EEUA 3F7QA 4LPTA 4PP2B 5EU6E 5JR1L 1NSNL 5F3HA 3GM0A 1G6VK 1RAMA 1PD6A 3ZTJG 2G75A 2R8SL 4YDJB 4PREB 4LSUH 2UWEF 4P5MB 2OR8A 3LN9A 1EBAA 4EUPG 2MQ3A 2PTVA 4XCEA 4CJ1A 5E8PA 1YEGL 4MD5B 2CUHA 4OZIF 5BVPH 1CDHA 3CLFL 3D18A 4PTTB 3EOAB 4AEHH 3M17A 3MRMA 4YHZH 3SDDA 2OTPA 1YEFH 5FHAH 3SE3A 4JKPH 4WW1A 5JO5A 4P4RA 3GJFK 1CDGA 2RR3A 1MFDL 1GHFH 2ZUUA 3HE7C 5BMFH 1T0MB 3CVIL 3WS6C 1WZMA 3LKOB 1EJOH 5JPNB 1F3JA 2OJEB 2PXYD 4ODUB 5DQJB 3DI3B 1N3NB 4PJHF 3MV9B 2BZDA 4WW2F 35C8H 4EI5C 2GK2A 1QO3A 2ED7A 4G8GD 1DSFH 2DQFA 3SKNB 5EO1B 3THMH 4UT9H 4WI8A 2J1KA 1FN4B 1KFAH 1MPAL 4CJ0A 2KKQA 2JJTC 5T5FL 1M71B 4XBPB 3ME0A 3GMOB 1QFHA 3I2CH 3U9UA 3JV5A 3ZE1E 5C0EB 5CJ5A 2W0LA 4XAWH 3KPRE 3HC4L 2ZWLT 4M4RA 4HG4K 3IF1B 4POYA 4JJ5B 2BNRB 5D6CA 5FKPA 3L5IA 1BPVA 3BRGC 5EIQA 3GIVB 1HH6A 3MFGB 5F6HJ 3F12B 2VAJA 4WGWB 3MRBB 1WEJL 2AEQH 1HOCB 3OJDA 2LU7A 4CN4A 4KU1A 4QF1A 1GGTA 1KGCE 5A16A 5F21B 3P73B 1I8MA 1QQDA 3SDXA 5DRNB 4G8GA 3X12B 2Z93A 3PWPE 5FUCC 1F45A 4FQLH 1G7PB 3L5WA 4YHPA 5I17B 4X6CE 1UWEH 5IHUH 3ZKXB 1ZGLA 2LAAA 2XA8H 1R3HB 4KVCL 4NNYB 4ZS6C 1D3CA 5EIIA 2OI9B 2W91A 4X7TA 3MRHA 1JHLH 2ITDB 2Y06L 5KVGL 5MEQB 5D93C 3I50H 3CUPB 1OVZA 3ET9F 5KVDH 2DMCA 2QHLA 3S5LA 3T08A 5F3BA 3FMGH 3MR9A 3OF6D 4PGDB 1N8ZA 5L2KD 4OF7A 3P0VH 1IEAA 2OQJB 3QUYD 2CLRA 5GGUB 1YY8A 3CFBB 2ATKA 3V4VL 5DJ8B 5BO1H 1KCRL 1ES0A 2VXTH 1FIGL 1KIQB 3RL2A 4W68A 1RZFL 1G7IB 3NTCL 3ZDYF 2MTPA 1BVKA 3E3QE 4LCWD 4Y1AD 3F7VB 2DQUH 2FSEA 2FX8L 4WWID 3L7EA 2NNAB 2P48B 3CDGA 4XZUB 3ZSSA 1CD8A 2HWZL 3GO1L 4H8WH 4JZNB 3MLSL 1TPXC 4NBYB 5F97E 4OCWH 5IEHB 2XQBL 3KYKH 3QIWC 3VG9C 4XNUH 1LE9B 4RGNB 1J88A 3F58H 4Y5VB 2O61B 2H2PC 2AQ3A 3N85L 4NUJB 2BOBA 4RMSA 1N5YH 1MCCA 1P5UA 1T1XB 5CWSA 3OF6A 5L2KA 5DD1L 3QEGL 3MXWH 4X4ZA 4KTDH 5SWZE 3QUYA 3AS1A 1SVZA 2J4WH 2EICA 5DT1L 1DQQB 1KPRB 3FAWA 5ANMB 4HIHA 5I2IB 5DR5H 4YBLB 5IG7B 2EDJA 4F57H 5IBTH 4LCWA 4Y1AA 2ZUVA 4XI5D 2VZUA 1JZ2A 4QXTB 3MROA 4P5TC 2FBJL 1LO3L 1KLGB 4LIQH 5E8NB 3NFSL 3QXVA 5TE4H 43CAB 5IMOB 2OTUB 1HHJA 4JM4H 2WP3T 3VG0L 4JLRB 4Z7UA 1RJZA 4MB3A 1CK0L 3MQIA 4GS7C 3U7YH 2H1PH 25C8L 4GXVH 4LGSB 4BZ2H 5EBLB 3CXHJ 5CSZA 3TJEH 3ARGB 4M7JH 2DLFH 5C9JB 4I48A 4ZD3H 3BRFA 3KPNB 3WLWC 3DX7B 4JQXA 3BFOA 4EDWH 1A6TB 3DX9A 3H2WA 1U58A 1QHPA 4AJ0A 2PCPB 5B3JF 4OF6A 2DRUA 3RI5K 1YEDA 2QADB 4JFDB 4AIZB 5IQ9A 5FAAA 4J3UA 5IV2B 4X5LA 1U91B 1V7NH 1QSFD 4RMUA 3REVA 3IJSB 1OAZL 1B4JH 5T1LB 2G5BA 4L4VE 2YWZA 1QVOB 1J18A 4DGIL 4KROD 4ELMB 4KUZL 3FRPG 5IQ7L 3WIHL 1SEBB 4OGXH 1UWXH 3U1SL 2X1XR 4UDUA 2BSRB 2DL9A 1ZSDA 4UOW0 3WFZA 5KSVB 3VXSD 5DS8B 3LSOB 3JWDL 4PGJA 2W07A 4FNLH 2ORBH 3VFPA 1CDBA 4X5XA 1Z5LB 2CKBH 4NQSA 5C0GB 1DQTA 3FOMB 5I16A 1TZIB 1ETZB 1AO7B 4Y8AA 1P84J 5JQ6L 5GGVH 5J3HC 4JFFE 1LK2B 3FO1A 4O02H 3V6OC 5JHDD 2ZCLL 2DJ4A 4HZAA 1GGCH 3GKZA 3NPZB 3GSUA 5AUMB 3C5SB 3PDGA 3UZQA 3EGSB 1QSFA 2X4QB 3RI5F 1I9IH 4Y16C 2G60L 3E8UL 3VFVA 5CD3B 3CDFA 4X6EA 5INCA 3UTZA 2VZOA 2D7MA 4W6YB 3BE1L 5E08H 3PWUB 5ILTH 1IGJA 1DBBL 4XC3L 1RZIA 1L6XA 4JDTL 2ENSA 3BPNB 3MLTB 1C1EL 3GSNB 4Z7NF 3FT2A 3VXSA 5D5MA 4W4OC 5J7CC 1WIUA 2ED9A 4U6XA 1N6UA 3BGAA 5B39G 1CL7H 3RHWK 3RWGB 5HYIA 3KLSA 5HHXL 1NBVL 1AGFA 3R0MA 3QXAA 1BZ9A 4ZDHA 1T7WA 4A6YH 3TIDB 3WUWG 5JHDA 4NPYA 1U92B 4GG6F 3C2SA 3FFDA 4GQ9H 4TUOB 4BK4A 1RZJC 4J6RL 4L29A 1KXVC 3CMOL 1WAAA 3V5DA 5BV7C 4PPTA 1VEOA 3O3DB 4YGVB 1AJ7H 1EEYA 1WVZA 1LO4L 2NW2A 2CLZA 3EYQC 5DXWA 2ID5A 3GHEH 3DROA 1NAMB 2BX5A 1JF5A 3D25B 1TCMA 4HK0B 1B2WH 3QFJB 4OB5H 4WFGE 1QFWI 2FHCA 3GM8A 5LCVL 1BIIA 4ELKA 5GPRA 3V0WH 2AJYL 3IDXL 3RHWF 2EDXA 5EOCH 4JO4L 5D2NB 2BVYA 3D39B 4XT1C 4QRPB 2UVFA 2YPLD 2PYFB 3BJ91 1QUNA 4O9HH 4M93C 2UYLB 1UYWL 2NY5C 1I8LA 1FCGA 4YPGA 1FLTX 4P23B 3K4DA 1R0AL 2VDNL 2BOCA 1Q9LB 1EO5A 3OXRA 2LU3A 3VW3L 5I19H 1AFVL 5B38B 4BELD 1KACB 5GIRB 1QR1B 4GBXB 4YEEA 4OLVL 4G6AC 4NIKB 4PJXB 4ZUWB 2W9EH 3K74B 3SPVA 4IIQA 4X7EC 3CC5B 5FYLE 4H20L 3BKCL 1R3IH 2GUOA 1A2YA 3TZVB 1X9QA 4X6FB 2VJXA 4D94A 5CJXC 3MO1B 2XWJB 2YPLA 5H94B 1A0QH 2YD5A 4NQCD 4QHMB 3WFCH 5CGTA 2NY0C 2PW1A 1NJ9A 5DJAA 1CFVH 1Q72L 1CZ8H 4ZTOL 2C5DC 4HUUA 5BOPA 2XN9A 4PP1C 3QDMB 3DVIA 1C08B 1VB9A 5CZXC 3FCTA 4RRPG 5JIKA 3PF2A 3VWJD 2O5ZH 5DSCA 2NTSP 3PQYB 4D3CH 4XNQA 4DW2H 3H3BC 2Q7YA 4C56D 5DRWB 5EORH 3FT4B 4OLZH 2VTFA 2EEBA 3T1FA 1I9JH 2VLRE 4FQ2H 2OR9H 1KJ2A 4LBEA 1Z6JT 4NQCA 5ACZA 5BVPL 4PJ7F 5KS9B 5DGQA 4AEHL 1Y18B 4YHZL 4OQTA 2PTTB 1R5WA 3PXHA 5HHMD 4NKMB 4LK4A 4MJ5A 1KELH 1ODAA 1YEFL 5FHAL 1MCLA 3HCVA 4PLJD 4POUB 4JKPL 1UH4A 3LB6C 4GXUN 4WHYH 2WUCH 2WINB 1FFPB 4Y2DB 1GHFL 4NC1E 5KVEH 1IZJA 1OAYH 2X4OA 2HRLA 5BMFL 4TUJB 1OT2A 1B0RB 1TJGH 1EJOL 3VWJA 4DWHA 3OKKA 3MNWA 3KPMA 4NO2A 4W70A 4NDMB 4C56A 2YN3A 1C16A 5D7SH 4U7SA 2ZOLB 1DSFL 3P9MA 3THML 4UT9L 4XCNA 4HWNA 1KFAL 2FLRT 5I76B 1T89A 5IHLB 4KWUA 5I73C 3VFUA 2NY2B 4XMLL 1SQ2N 3TLRA 4W6XB 4Y4FB 3TA3D 1G7JA 3I2CL 3P9LA 4I9WD 4NQEE 3VGDA 5FM8A 4DK3A 4XAWL 3PHQA 3U36A 2BVPB 4PY7A 4PJCE 3QDJE 3OHXB 1CD1A 1CXHA 5I6XC 2OL3H 5KSAC 5DJYB 3ZYJA 2AEQL 5IB2B 3DNKA 1A1MA 3SE4C 4EXPX 12E8H 1J8HE 2X4PA 1OWRM 4X4MA 4XPBH 5F7UA 1AKJB 3PE9A 1XZ0B 2EDDA 2EDBA 5DJXB 5K9KA 3OR7B 3QIUB 3WSQH 1I85C 2VDLH 4FQLL 5IHUL 1UWEL 1WWBX 2VLJE 3EYSH 5C0CE 5E95B 5J1AB 1FL3B 2C9AA 3FFCB 4U1HB 5HPOA 3KGRA 2XA8L 4BSWB 1YEJH 4X9GA 5EZLA 2ZPKH 1T7VA 3T0ED 4FG6D 3R06B 3OKLA 4PIRF 1UZ6E 1T04A 1JHLL 2V7NB 4MNGE 3FTGA 3I50L 3IU3B 3LKSA 1IM3B 4KUCF 3E0GA 5CMAA 5KVDL 3U6RA 3FMGL 1QA9A 4RMVA 4JN2A 5HYQA 4P2RE 3RNKA 3V5HA 1LEKB 2W65B 4YDLB 1B9ZA 3RVXC 1ZLVK 3S7GA 5BO1L 4PJIE 4R9HA 4PRIB 2VXTL 2KH2B 2RHEA 4QY8A 3CPLA 4GOSA 5JW4N 4D0CB 3RVTC 2DQUL 4LKXB 1UJ3B 5D7JD 1LDSA 3KLAB 4H8WL 2X7LA 3GMNB 5JPMB 1FJ1A 4OCWL 3KYKL 2ZUQC 4XNUL 2QLVB 1RULH 2RFXA 3F58L 5HYJD 4NN6C 4PJGE 1DUYB 4KRNA 1D5ZB 4NC2B 3C6LD 1LK3H 2Z35B 5INDB 1N5YL 2FNBA 5JW3H 3AU1A 4S2SA 1FVCA 3MXWL 5HY9A 1IEBB 4KTDL 4D9QE 4YJZL 3B5TA 3UTPD 5MEPB 1K6QH 2J4WL 1AQDA 4HS3A 4U2YA 4HGWB 3AXLB 5DR5L 2X4UB 5C8JB 1YPZE 4F57L 5IBTL 4KK6D 3SDYH 1A7QH 2RGSA 2VISA 5I1DB 5DVMA 5DK0B 1A4KB 3E3QC 1FBIH 4ALAH 4LIQL 4H26B 1P7QB 3RIFK 3QBTB 1X5XA 5HHVH 3QUXD 3ZE1F 5TE4L 1Q94B 1OP3H 1IGMH 4JM4L 5FA4A 3WJJA 3SY0A 4M1CD 3U7YL 2H1PL 4GXVL 2VC2H 4N8VB 4BZ2L 3C08H 5L6YL 1YNTA 4QWWC 4TVPD 3JV6A 1S7UA 5IKCB 3TJEL 1EZVY 1VFMA 2DLFL 3EW3B 4M7JL 5MHSD 4ZD3L 3VCLA 4S0SD 2ADFH 3MJ7A 4EDWL 3WDHA 2QR0B 1TCRA 4ZXBC 3H3PH 3VXUE 3V0AC 4X6CF 5DURB 4CVXB 2P5WB 3MOAH 1U8QA 4Z5RA 2FECL 3TF7C 4DKFH 1BOGA 2HT2D 5C0RH 2B7DT 3O6MH 1B4JL 1A6ZB 2NX5B 4PFEA 3X17A 3RRQA 3CFCH 2CIKA 3RZWA 1JV5A 3SCMB 4OGXL 4JCLA 4KK6C 3RIFF 4HIIA 4KGLA 5C08B 5GS0C 3HNSH 2YR3A 3MTRA 1WT5C 2F54E 1ZE3C 2ORBL 4M4PA 1NGQH 3T4AA 1G6RA 3QUXC 2CKBL 3DO7A 1MJJA 1T22B 2AAVA 4LASH 2Z31D 4LPXA 4KXZI 1T3FB 4A2LA 5D7IF 4J4PD 2C3WA 3V95A 3IDJB 3FONA 1YC8A 3IS0X 1C5CH 4LKCA 5DMJB 5GGVL 3D85B 3HI5H 1JHTB 3KPSB 4M1CC 2FZ3B 4O02L 1OGAA 1Z9MA 1GGCL 1TZHA 1P2CA 2NR6C 3FZUC 4YLQT 5C0BE 1I9IL 4L1HA 5TDOA 4B5EA 3RVWD 1KCSH 1PLGH 5E1AA 1D9KC 2WK2A 3VE0B 3VJ6A 5E08L 3MV7B 5ILTL 1JFQL 1FYTE 3L3KA 2H26B 3RY4A 3FO2B 1G9MC 1QD0A 4ZQKA 3NCBB 3MV01 2P4AB 4NRXB 1OT1A 4NQXB 3DV4A 4JG1H 5ALCH 4ZNEE 1CL7L 3PJSA 3F7YA 3VXTA 1MY7A 3TN0B 4OD2A 5T1MB 2HTKC 3U0PA 2Z4QB 4N0UB 5SWQB 4J4PA 1IRAY 4A6YL 1X7QA 5BXFA 4O51A 2Z91B 1P5VA 2WLZA 3C6SA 2ICEB 5HI3C 1QFUH 4GQ9L 5D1XB 2D7TH 5D1QD 1BBJB 3P77A 4J3TA 4G8EB 4MA1C 2E8YA 5ESVA 4YQXH 2AKRB 5C09D 2JJUA 2EE6A 4ESKA 4NKDA 4M62H 4PJ5D 3MLUH 4M8VA 1AJ7L 2QL1A 3BVNB 4NO0D 4PJFA 4I18A 5C0DB 2UY6A 3RUGE 3GHEL 2SEBB 4X9FA 3CXDH 1K3ZA 1UB5A 3U4AA 2E7LC 3BZ4B 1HILA 3RWFA 5DTFA 1B2WL 4OB5L 4UZGA 2CIIA 3QIBD 3VFOB 2I07A 1U3JA 4X6DB 5FOBA 3LKQA 1GPOH 5JNYA 3OL2A 1F6LL 3EAKA 3V0WL 1KBGH 2GCYB 3ZKQD 4YNYA 4IRSC 1J8KA 1KB5B 2VNCA 3HZKB 5D1QA 2EO1A 1P9MA 5DEFA 3JV4A 4P5KA 4O9HL 1NFIB 4HF5H 5CP3A 1R5VA 1MUJA 2OSLA 4OF8A 4LDEB 2DWEB 4S10A 1ZHKB 4OCSH 3OJVC 5EU4B 5K9QI 4HPYH 3OSKA 4P3DA 1C5DB 1ZHBA 1X5HA 4HGMA 3GB7B 4UOW1 1JMXA 1RJYB 1B6DA 3H6JA 4YDKH 5I19L 5E8DH 4MX7B 1NMCB 2VXQL 1CT8A 3T3PE 3QIBA 3RWEB 2OK0H 3J7HA 3CSPA 4MDJA 1NFDB 4UIMB 2W9EL 2BNQB 1BQLH 1TITA 1AGCA 1EVTC 4U7KA 5ID0B 3DBXB 5E8OA 2VE6A 1A0QL 1RHHB 3QJFB 2R4SH 4LP4A 2PF6A 4MS8C 2A6KA 2VN7A 3VXOB 2EDKA 3WFCL 4KI5D 3C09C 3EYUH 4ZSOA 3O9WC 2K7PA 3QEQB 3MV9E 1CFVL 3P4OB 1JNNH 1CZ8L 1XAUA 2EDOA 3MRNB 4UDTA 1BJ1H 4K07A 1JJUA 1JPGA 2HT4D 5E00B 1S8DA 1ZOXA 3STLA 2O5ZL 5ISZD 3FO9A 4DW2L 1UM5H 1ZTXH 5EOTA 4DTGH 5FYJD 2K3TA 2HFFA 5EORL 4GT7A 5MEND 3IETA 4OLZL 1PYWA 2WBJD 1ZVHA 2J8UA 4JGJA 4IRJB 4HK3N 5JXED 1I9JL 4WU5A 2UUDH 3MYZA 4FQ2L 2OR9L 2BNRE 1JL8A 1CI5A 1QLFA 3EO0A 4NOBA 5FDWA 1HZHH 3WFHA 2APTA 1KELL 2FL5A 1HK6A 3HHRB 1KTDA 4WO4A 2WUCL 3G08A 3MXVH 5HD8C 5K9QG 4KKBC 4F7TA 5KVEL 3BGFC 1OAYL 4H5SB 3HS0A 2BRRH 5FFLA 4X7SH 2IGFH 2BC4B 3FB7A 2D0FA 2GJ6B 4OF5A 4M6NH 5I1HH 5L88H 3PGDA 3K1KC 3O4LD 5D7SL 3MMEB 1DEDA 5MENA 1JTTA 2WBJA 5DJCB 1GAFH 1OAUL 4H1LH 5TF0A 5I74C 5JXEA 2I9TB 4IBLT 2DDQH 4WI4A 2F74B 4MNHB 1VCAA 1EAPA 4TRPH 5DEGA 1ZT1B 2AV1B 2YS4A 5SWSD 3HRZA 3A0OA 3N1GC 2IQAB 3QDAA 4FXKA 4OAWA 2X42A 2EDTA 3W9DA 3BPOC 5J12C 4Y5XA 1FFNB 3L3GA 2UZXB 3PL6B 3N1QC 3SGEH 4I4WB 1WCBB 4NC1C 3VFMA 2ZUSA 2OL3L 3L3HA 4L5FH 1ZLWH 2R2HB 4X8XA 3QZWA 3O4LA 4RGNE 12E8L 2IALB 2MHAA 4XPBL 1F11B 4FFYH 3GMQB 5ESQA 3WSQL 4X5WA 5DWUH 4HDIA 2VDLL 1TTGA 1HHKB 3D1MC 2DYPD 3EYSL 3BW9A 4BSVB 1W72A 1ACYH 4ZUTA 2VABA 3QDHA 1YEJL 4XH2B 4QYOB 2V9TA 2ZPKL 2GFBA 4G6JH 4RGMC 3U30C 5JOEA 1F2QA 4LLQB 4JY6B 5SWSA 2NQCA 3H3KA 5ANME 4XAKD 1BQHB 4K71B 4IMKA 1OB1A 3BH8A 3RGVD 3UPRB 5D1ZB 5A1AA 3VXMB 5J9PA 4GW1B 5DDHA 2FJGA 2H2SD 5MI0C 3DVGB 2ZNWA 4JM2C 3TBTA 3LQAH 2I5YH 1Q9WB 4KKLD 5LGHH 3TCLA 1F02I 4PLKD 5TQ2H 4MAYB 3B9KC 3LN4B 1A4JA 4IHOA 1MCSA 4JG0H 3DXAD 3MPCA 1YDPA 1OARH 4O2FB 5EFIA 1KIRB 2DYPA 4R0LB 5GRXG 5IMMB 5C2BH 4ETQB 2EDLA 4X99A 1NFKA 1TFHA 3BPCB 1JYWA 3HPJA 3Q1SL 2BSED 3MREA 3MRQA 2HG5A 3HZVA 1RULL 4PTUB 4HUVA 4JFDE 2V5SA 3TBWA 2EECA 3RGVA 2C3VA 3C2AH 4XBGA 1LK3L 3Q0HA 4O2CA 4OZHA 2QKIB 3C5ZD 4U1GC 5JW3L 3ARZA 4LLVB 5CIPA 5AWNH 4ELME 1K6QL 5HGBA 4JFZH 5GS1A 4LLMB 5TGBB 3OKMB 3DXAA 1CGSH 1A7QL 3SDYL 2JJWA 3WXWH 3TO4C 5I30H 3ARXA 3V6FA 1FBIL 3WIFA 4ALAL 4HQQH 3WEXB 4B7LA 1OTUC 5HVHB 2Q3AA 5HHVL 4ZOCA 5I15H 3KHOA 1AO7E 4NN7C 2N56A 4CGTA 1TQBB 4PJCF 1IGML 2IPUK 2DMBA 4HKJB 4JM2F 4PJHA 4WW2A 1JE6A 3WNNA 5CJ8A 3FT3A 2VC2L 3C08L 5I9QC 6CGTA 5DJ2A 3C5ZA 3CZFB 5EZIH 4BK5A 4E9LA 3E6HA 1K5NA 1I7ZA 4PJBB 2GSGB 2ADFL 2JJSA 2APXA 5GJSH 4PLOB 3SJVD 1UKQA 4H0GA 5DFTA 3H3PL 1S5HA 2CKNA 3TIEB 3MOAL 4XVUD 1JWUB 2YKLL 4ZFFB 4DKFL 2EIEA 1FL6B 4NNXA 5DO2D 5C0RL 3O6ML 1T83C 3EYFB 1IQWH 4KGJA 2E9BA 2Y6SD 3CFCL 1KSRA 4NRYA 3GJFA 5D7LA 4R97B 4FQQA 5CFHA 1KTRL 1N5AB 2XFXA 5E4EC 4BH7B 3HNSL 1FFQA 4DCQB 1INQA 3MUZ1 3PDOA 5DJZA 1NGQL 2DIAA 2P49B 3VXRB 4YAQB 4PJIF 4Z7QF 1DZBA 3BUYB 2VLME 4LASL 5KANI 5HYEA 1T66D 1Z3GH 1D5BA 4EKXA 2FGZA 4POZC 4UB0H 3SJVA 3HI5L 4JN1H 3WS6A 4OI8A 4I0PC 3L9RB 1XH3A 4WENB 3UTSB 3PABB 3IAQA 4QGYA 4F3FA 1FZKB 4F33A 4FFWC 5EOQH 2GJZA 3QB7C 3QFJE 3KAAA 4N5ED 2JCCF 3AS0A 1KCSL 3NGBB 3RZCD 2HLFD 1PLGL 3B9VA 3GGWB 2P7TA 1F6AA 1JZ5A 4EN3A 5KG9B 4G8IB 3BISA 2R23A 4WGVB 1U8NA 5TPWH 1VEPA 3AROA 2HKFH 4FZ8H 4N0RA 3HE6B 4OZFA 5D2NE 1IQDA 2XXCB 1C12B 3D39E 3DYPA 3U0TA 1RZ8A 4QRPE 4PJEA 1AXIB 3IYLW 5AD0A 2HVJA 2HFGH 4JG1L 2Y6SC 5ALCL 1QBLH 4O2EA 3B5HA 2XZAH 1A6WH 2VIRB 4LVHC 4BFEA 5HHOD 2GK0A 4GW4A 4RFNB 3OAYH 3EO9H 1QFUL 4CBPA 2D7TL 3JTTA 3L6FB 2AQ1A 3T0AA 4Y5YC 4YQXL 2DB8A 1S9XB 3RZCA 3GBLA 4PJXE 4X4XB 3L3JB 4M62L 3BWUC 3MLUL 3QNXB 2H8PA 4X9BA 2VL5A 2DLGA 5C07D 4HEPG 1A9EB 2EDNA 4KK5C 4RIRB 1V3KA 3CXDL 3MYJB 4OBRA 2DTMH 3LPWA 4JQIH 5HGAB 2DN7A 4PJ9C 5IVXA 3ARBC 4Y4KD 5EUOA 5DQDH 1GPOL 3H9YA 3G5XA 1KBGL 4BZ1L 3QDME 1BFVH 3BQUC 3IFOA 4JGMA 2J8OA 1H0DA 3HZMB 1NGZB 3E2HC 4HF5L 1VENA 3PQYE 4I0KA 1YECH 1A1NA 4OCSL 1FG9C 2NY6D 1VPOH 1MREH 1KJ3H 3RTQB 4HPYL 5C07A 3T1WA 2CDFA 4HHAB 3UAJC 4NWUH 4I3SH 4GAJH 1PZ5B 3SGJA 4HX1A 3CIQA 4P0DA 4YDKL 5E8DL 3L7FA 5IF0A 5KS9E 4QEGA 4Y4KA 2OK0L 3AGVA 5E99H 1L9MA 2VDPH 1LO5B 1BQLL 5IVZA 3S4SB 2R1WA 3GMPA 5DRXB 1G7HA 4N90D 3BN9C 1MOEA 5E6ID 1IAOA 4HIEB 4IM8A 2R4SL 5T3XE 3KDMA 4JFQB 4NCC2 2Y07H 3EYUL 4ZUUA 3B3IB 1DP0A 1JNNL 3DX8A 4CVZA 3DETD 2M1KA 1RD6A 4S1SH 5A2JH 1W8OA 4IMLB 3VXNB 4U3XA 3RDTB 3ZYOA 4F7PA 2EXYC 4U7MA 4JE4B 3KPOA 1M7DB 3QQ9C 4UINL 1UM5L 1ZTXL 4R4BB 2DIBA 4DTGL 3S35X 5SX5K 4BQ8A 2Y1VA 3ZL4H 5GZND 4KDTC 1D6EB 4PB9H 3QT2A 5E6IA 3SQBA 1FG2A 1NEZB 4U6TA 1WIOA 1HZHL 1K3IA 4YC2B 4CVUA 3FB6B 2JB6A 2JB5H 3RUGF 2VO5A 1MCRA 4RZCB 4NJAH 3MXVL 1EXUA 1KJ2H 3H9SA 1PZUB 2CXGA 4WUKH 1UT9A 1F00I 2APFA 4GAGH 4OGAC 3FFCE 2BRRL 3OB8A 4OQTH 4X7SL 2IGFL 3WIIH 3GJEA 1QFPA 1J1OH 4M6NL 5CEZD 5I1HL 5IR1B 3H7BB 5L88L 3ULSA 4GG8B 4KJWC 2YMXH 3DO3A 1GAFL 2DDQL 4HT1H 2AEPH 3GI9H 3VGAB 4NKOB 3RL1A 3ESVF 2EIDA 4N0CC 3AREB 3BHBA 2P24A 3ARDB 1G1CA 2D4DA 4TRPL 3QG6B 5AYUH 3PGCB 4JEGB 4PRIE 4AQ1B 1CFQA 5TE6H 3AB0B 4Y16A 4MZ3A 3TBVB 5T3ZE 4KK8D 1CLOH 4U0RB 1JWSA 1LD9A 4XNZB 3SO3B 3I75A 1F8TH 2IQ9H 1FV1A 4HWZA 2X9YA 5BRZA 1QNZH 1FFRA 4MWFA 5A2FA 1QACA 3ZKXC 4LHUG 1S5IH 5A3ID 4L5FL 1RZKC 4F37K 2R0LL 2W9LA 2OI9C 1XFPA 4FFYL 3NCYS 5HJ3A 1EV2E 4WHDA 4HFWA 5DWUL 5FGBA 5HDLA 5DD5H 1IM9D 4G43B 3RWJB 1ACYL 1H8SA 3GBNH 3ZT6A 1EEQA 4G6JL 4RNRA 4E41B 1O0VA 1XCTB 4PRHB 2NZ9D 2V9QA 1E4XH 5F8RC 1YA5A 4V1DD 3MLYL 3LQAL 1A7BA 2I5YL 5TH2B 2C1OA 5LGHL 2IPUG 4I2XB 4HUWA 3OXSB 3UJTH 2L0DA 5TQ2L 1KT2B 1R3KA 3IXAA 4RGNC 4JG0L 4Y5VC 4F37F 1OARL 3CJJA 1EEZA 1KLUB 1IM9A 3VFRB 2AXGB 1NL0H 5C2BL 5EA0H 4ENED 3UPAA 2V7HA 5C9KA 4Z9KB 1JNLH 4R4ND 4FTVB 2EE2A 4OI7A 4LAJH 2KPNA 5E5RB 2P5WE 4DZBA 1XGTB 4DUVA 4JZOB 1U8KA 3EJJX 1R3LA 3C2AL 4HIJA 4YBLC 4XCCH 3UX9B 5B39B 4GAYB 2DLEA 1IAKA 1ZHLB 1MI5D 4QRUA 1QOKA 2NX5E 2JK5B 4RFOH 2A83A 5AWNL 4PJ7A 1URLA 3CFDA 2E6QA 1F4HA 4GKSB 4OZ4A 4JFZL 5C08E 3GSVA 2QQNH 4ZUSB 1XF5B 2WANA 1CGSL 3RWIA 3WXWL 4JJHA 4FP8L 5I30L 2KZWA 5CZVH 4HQQL 4RBPK 4OZIB 2DQTH 4GRLB 3ARGC 3RX8A 1EUTA 5I15L 5E2TH 4QOKD 2VLLA 4OFYD 4FXLA 3C8HA 5F88A 3VFWA 2ADGB 3KPSE 5GJTH 4CU8A 3SKOA 2QADC 4OBSA 5I1LB 5EZIL 2BSTB 1DANT 4LARL 2EIZB 3ZE2E 4YEFA 2VRAA 3LDBB 2KQNA 4HKBB 3UBXI 5GJSL 4AQOA 5JLZA 1UFUA 3QXDA 4J3SA 5EU3B 3MV7E 2FWOA 1I7TA 3C60D 3KPTA 2Y7QA 1NAKH 3BGMA 2KL6A 2M2DA 3OR6B 2NY1B 2Q8BH 2IAMB 4AEIH 4XNMA 4H88H 2IAND 5EZJA 3SHSA 1IQWL 3RPIA 4QHNB 4KMLB 5CBEB 2XT1B 1T1WA 4N0UE 4GKZA 4OFYA 4PYGA 3BZEB 4FQXB 4LLYA 4XMKL 5KJRH 1U8LA 3JZ7A 1AGDB 3DRTB 3UTOA 5JW4Q 1U95A 3PIQB 4OF0A 3V5KB 3GK8H 1X6LA 2MCPH 3IU4H 3MRCA 4HJ0C 5F3HB 5CINL 2O26U 1Z3GL 1NGYB 4UB0L 2G75B 4JN1L 1DLFH 3C60A 1BOYA 3S6CA 4XX1G 1G6RH 3K7UA 3TCXA 3WMSA 4ZG1A 2H3NA 3DVNB 3BPNC 5GRVK 5EOQL 2IANA 4XP4H 4G80B 2ICWA 3OB0K 3PG2A 1ZWIA 4XCEB 5E8PB 1RIHH 4K3JH 4X6DE 2P8MA 3KLHC 3D18B 5TPWL 2QSQA 1S7QA 2HKFL 3M17B 3MRMB 4FZ8L 2XZCH 4L1DA 1CD9B 1S7XB 3SDDB 1I1CA 2Q76A 2XOTA 5J1SC 3MJ8A 4P2OB 4WW1B 4ELMF 5JO5B 4P4RB 2HFGL 4YO0A 3L3IB 1QBLL 4R8WH 2XZAL 1NC2D 3ELAT 3E1F1 3UBXG 1A6WL 1F3JB 4BFGA 1TJHH 3WNKA 4XTRD 5EPMB 4WCYH 5ERWA 3EO9L 3PV6A 3CD4A 1ORSA 5FK9A 4ORGB 2JE8A 5LXGH 2DQFB 1S7VA 4ODSH 4TSBH 3WHE0 1BLNA 5F1KC 5IB5B 4Q7DA 2W0KA 1NFDE 3GSRA 4NO3A 5J8OA 1I85A 2BNQE 2GW5A 1X4ZA 1H15A 4ZO8A 5I8CA 3WHXA 5LQBH 1CD0A 3PDDA 3U9UB 5D2NC 2DTML 4JQIL 3DMMC 3JSSA 7CGTA 1YMHA 5EBWA 2FATH 4MA3B 3QEQE 5D6CB 3JWOH 1JN6A 5DQDL 5FKPB 4XCYB 1HH6B 5D4QA 1EK3A 5EBMA 3KPRA 4MVBC 3TYFA 3OJDB 3GSOA 2PXYB 4P23C 4RAVA 1BFVL 4PGBA 4QF1B 1T0PB 4QNPE 1ZA6A 2BVOB 1I8MB 3MLPA 1QQDB 3SDXB 2CRYA 4G8GB 5CGYC 4UT7L 5JHLH 1YECL 1N7MH 1UXWA 4Z8FH 1ZGLB 3ZT5A 3CGTA 1VPOL 1MREL 1KJ3L 3QNZB 3UPCA 2E6JA 3V0VA 3PWPA 4OIBA 4LIQE 4NWUL 4I3SL 3MRHB 4GAJL 4P9HC 5CP3H 3U4EA 2O93L 1JPFB 3OAUH 3TZVC 1AD9B 2CLVB 3S5LB 1N59B 2EXWC 4LHQB 5HGHA 2BHUA 3WUZA 3QHTC 4ZFGH 3X11B 2NXZC 5E99L 2VDPL 5ICXB 2CLRB 1YY8B 5LJYH 1DVFA 2ATKB 4O4YH 2LV4A 1OF2A 4XXCC 2AW2A 3PHOB 3VG9B 1TJIH 2C3GA 1WBXA 1QHOA 2Y07L 2GJ6E 5GISH 3ULVH 4WY7H 3HAEH 2FSEB 3AS2A 4ETYA 1HHGA 3KYNA 3L7EB 8CGTA 1JTPA 2CJUH 3O4OC 2BERA 2P47B 1J0HA 1FQ9C 2GT9B 1AE6H 2FEEI 4S1SL 2R1XA 1H3PH 1JZ8A 5LKNA 1WBZA 4UQ2B 2XIDA 3MSPA 2BOBB 4M00A 4OIIH 1HHHB 4K2UH 5L2KB 3R4DA 1RJCA 3W2DH 3ZL4L 4GH7B 3QUYB 1U8IA 2J12B 2VZ3A 3QUMB 4PB9L 4R4FH 3ZO0A 4HZLA 4Y2DC 5DD3H 4HIHB 5DJDB 4PJXF 4WUUD 1LDPH 2DQDH 4LCWB 4Y1AB 2JB5L 3MROB 5TDPB 1XGRA 5AG8A 4NJAL 1AR1C 3K4AA 1M05B 4WUKL 5DD0H 5F7HA 3MNVA 2VZVA 4Z7UB 5CP7B 1RJZB 4GAGL 4LVNB 5T1KB 3UTQA 4OQTL 2M26A 1DBKH 3WIIL 4R2GD 2GJJA 4MB5A 3ETBF 5GGRY 1J1OL 5GRYA 5CSZB 1WT5A 1PAMA 2X44D 4I48B 4Y4FC 1T6VN 4RGOL 2YMXL 3LEXA 1MCPH 5C0FA 3DX9B 1U58B 3NZHH 2P5ED 4HT1L 2AEPL 5F7WC 3GI9L 4GG6B 3VXME 4FXGB 3REWB 3QPXH 5IQ9B 3IDYB 3LH2H 1GGBH 5IT2H 1IGYA 2ADIA 5J6HB 3RWHA 5KN5B 4JFFD 1V3LA 2G5BB 2FO4A 5TE6L 4HKXA 4AIOA 4DVBA 4NRZB 1CLOL 4QXWA 3MRFA 5I18H 1KCKA 1UQSB 2IQ9L 2YZ1A 3QIUC 4K9EC 1QNZL 4H0IA 1WZLA 1S5IL 1EX0A 5JOPE 3BKYH 3VFPB 4X5XB 3I3EA 4NQSB 2X9WA 5I16B 2ZG3A 4K23H 4R7NA 4XPFH 3LKPA 4CKVX 3B2UD 5DD5L 5DJ0A 3U48A 4NUGH 4OSUH 5H2BA 3GBNL 1N64H 4NN5B 3IKKA 5HHNB 1QSFB 4OFPA 4JFFA 1K8IA 1I8KA 4XRCB 4X6EB 4KROB 3G5ZB 1N6QL 2BVEA 3BEVB 4EJ1C 1IGJB 1E4XL 3D69B 1RZIB 1X5AA 4BM7A 3LN5A 1UJ3C 4WHTA 3FT2B 3VXSB 5D5MB 5CZKA 4U6XB 3UJTL 1NGWA 5EC1A 1MCIA 1GC1H 4G9FD 3QXAB 1GZPA 2EKSA 1GGUA 3CNKA 1NL0L 5JHDB 4NPYB 4PJBE 5EA0L 3FFDB 1JNLL 4L29B 4M61B 5ADPH 1JF1A 3O6FD 1JF6A 1FAKT 2V2WA 2X10A 5C92A 3V5DB 1ZLUH 5GGRA 4QT5A 1GOFA 1M7IA 2YXMA 4XCCL 1KEGH 1NCDH 1RHFA 5I1IH 1B0GB 2CLZB 1ZXQA 4RFOL 2DQGH 3FB8A 4JDZA 1T1ZB 4LL9A 4M93B 4RISH 2QQNL 2F9BT 1E6OH 1AIFA 1A3LH 1BIIB 4ELKB 5CIPH 4WWKD 3VXRE 4YH6A 5CZVL 4G6FB 3MGOA 1HH9A 2DQTL 4S1RH 1JYVA 3RWCA 5L2JA 1P7KB 5E2TL 4BH8B 3EDFA 5FGCB 2QEJA 2XKUA 3G5YA 2IMNA 2YD1A 3MRKA 2W0FA 2GKIA 5GJTL 3UTSE 4ODBD 3T2PA 4YPGB 3V2AR 5JTWA 2QSVA 1KOAA 3ZHLA 1IGTA 1G0DA 5BZWA 2QTEA 1IAIH 3MRGA 3DYOA 3O6FC 1BM3L 1X4YA 4KKCD 1MVFA 1EHNA 2P45B 2MKWA 1NAKL 3SCMC 2NY0B 1HKFA 3FO0H 2Y36H 5HYSA 4J8RA 2Q8BL 3SPVB 4AEIL 4S1DC 4EIZC 1HXYA 2F53D 2FJHA 4JO2H 5FA3A 1D7FA 2OLDA 2YPLB 1F42A 1S7TA 3H7LA 4K94H 3VXQA 1NGXA 2X4SB 3RBGA 2PW1B 5KJRL 4JFYA 1NJ9B 5DJAB 4KDWA 1MNUH 1JK8A 4WWKC 1FC1A 3LMJH 2A74A 4JY4A 4HUUB 3GJFH 4J23A 4GW5A 4KRLB 3GK8L 3FCTB 3IU4L 2MCPL 3Q3GA 4PD4J 1GRWA 1DLFL 1HI6A 2WQ8A 4XNQB 5E8EA 1G6RL 1NCTA 1MLBA 3GSQA 5EU5A 2YA1A 4XP4L 3T1FB 4YBQC 2CRIA 1KNOA 1RIHL 4NHUA 2V2TA 1KJ2B 5DZNA 2DS4A 2CUMA 4OD1H 4LBEB 3BAEH 5F9AC 4NQCB 4HWEH 1H3GA 3TN0C 4LCIH 2XZCL 4JRXD 3GSXA 4HS6B 3HCVB 3K46A 5D1XC 3EDDA 3VD9A 1Z9SA 3RX7A 4W81A 3QI9D 4GXUM 4R8WL 4JDVB 3ROOA 3O8XD 4OZFH 3L3OB 2D7PA 4U6HB 5DF0A 3VWJB 4HH9B 3OKKB 1JGUH 1TJHL 3MNWB 4QXGH 4L8DB 4WCYL 3GMRA 5I8EB 4C56B 4Y8DC 1NUFA 5HVFB 3DARA 5LXGL 1MLCA 3HRPA 5JQHC 4ODSL 3T65A 3P9MB 4TSBL 5K59E 2NY4D 5EBGA 2WWKO 3P30L 3V52H 3GKWH 3QULA 3VFUB 3VRIA 1NANI 3HB3C 5HGDA 5LQBL 5HHMB 3LV3B 3ZE2F 1MHCA 3KPLA 4YXLH 2FIKA 3NZ8B 1FYHB 5IW1A 3PHQB 4PY7B 4Y7MA 1G7QA 1NCAH 1I1FA 2FATL 2XI9A 3CU1A 2Z92A 2HVKA 1LWRA 3JWOL 4NQEA 3CSGA 3QI9A 3O8XA 1CD1B 3TV3H 3PP3H 4M5YH 3G6AB 2BDNH 2CK0H 1I4FB 4MXQD 4PLNC 3B43A 3ARUA 1C7SA 3AFLA 2XNAB 4JKMA 2X4PB 4HFUH 3K80A 5K9KB 2WIIA 1WUNT 5ICYA 5JHLL 4MDIA 2VQTA 1F4WH 1N7ML 1NMCC 3IFLH 5DRZA 4Z8FL 2R29H 4GLRI 3W9EA 5SV3A 5EZLB 1YY9D 3QJHA 1WF5A 5A2LH 2GTZA 1FFOA 3AUVA 2FDBP 1KXQE 3TA3B 5C0CA 1T04B 3OAUL 4OLEA 3UTTD 3LKSB 1FGNH 3JTSA 3DV6A 1QA9B 4MNGA 4JN2B 4MJ6A 1NKRA 4ZFGL 3RNKB 2YUWA 3U7WH 1JUFB 4XNYH 3OKYA 1MF2H 3HLAB 5E94A 1SJXA 4GUPA 4CDHA 4O4YL 1P7HL 3HNTH 4X6DF 1LGVA 2GITA 3FQTB 3SN6N 1R3JB 2Z8RA 1TJIL 2ZUQB 3MODH 4XPTH 4QY8B 5IROC 3CPLB 3ULVL 5GISL 2AXFA 4K8RD 1H5BC 4WY7L 1F3RB 3ESUF 2FIRT 2CJUL 4TTGA 5JMOC 5JW4M 3DUSA 3TO4A 1T03H 2CH8A 5DVOA 1AE6L 2VKWA 3T0EB 3VFSA 1V7MH 4IRJC 1E28A 2RFXB 1S7RA 1SYVA 3UTTA 2ESVD 4OIIL 3JUZA 5E5MA 1U8JB 4PG2C 3AU1B 4PJ8D 3JXAA 4K2UL 2BY2A 1YY9C 5HY9B 5BJTA 2HP4A 4PJGA 5D7IB 3W2DL 4TNVF 2MPAL 4R4FL 1HCVA 3MV8D 1QR4A 5IFAH 1AQDB 5DD3L 4HS3B 5JDSB 4XCFH 1L7TH 3IRPX 4HBQA 1LDPL 1LEGA 3WHE1 2DQDL 4PRAB 1UVQA 5C6PB 1WFTA 4P2YA 4X0KB 5EZOH 3MC0A 5D7JB 3T0WA 1QSZA 4ZOEA 5JZ7C 1YPZA 1QSVA 1I9RH 1T83A 1PG7X 5DD0L 3PWNB 1MQ8A 5FA4B 3I6GB 3SY0B 4R90H 5HYJB 4JB9H 1DBKL 1IC1A 3FRUA 3C6LB 2ESVA 4P46C 1YNTB 3JV6B 4PJ8A 4E41E 1M1SA 3VH8A 2C3XA 4P4KD 5GZOC 4OUOA 4MA8H 4PRHE 2OJZH 5FM5M 1MCPL 3MJ7B 2E6PA 4JR9H 3NZHL 5FDYA 4AYFA 1IVLA 3MV8A 1FO0H 2OXGA 1FNGA 3QPXL 3UCRA 2XZQH 3V4UH 3FQXA 1U8QB 3LH2L 4Z5RB 3PL6C 4Y19D 1GGBL 5IT2L 4P59H 1U9KA 1BOGB 5D8JH 5FYKH 4I2XE 1CDUA 2C7UB 3A6BH 2O5XH 3QUXB 2CIKB 4WI5A 1JV5B 2H32A 4LLWB 5I1AA 1OW0C 5I18L 1ZEAH 1X5GA 4JANA 2E7MA 2ZG2A 2FD6L 4FTVE 4NSKA 3BKYL 3T4AB 4PRPD 3AMLA 3DO7B 4P4KA 3NAAH 5J0BA 2F54A 4K23L 4K71C 3UP1A 4XPFL 3ILQD 4QHUA 1BIHA 1U2HA 3FONB 3ZT7A 4LKCB 4LEOA 1N6VA 5D1ZC 2YBRA 4NUGL 4OSUL 5CEZH 2DM4A 4Q2ZA 4Y19A 1GCFA 1N64L 4TTDC 3QXWA 3EYVB 1SEQH 4F7CA 4J3XA 5TDOB 2YSSB 4KJYA 1YYMH 5F1OB 1KTLA 5C0BA 5I71B 2WWMD 3L3KB 1S9WA 4OZIE 4R0LC 5ALBH 4NT6A 4ZQKB 5LBSH 1RZJH 2AJVH 2NY3D 2QBWA 1FYTA 1R24B 3DV4B 2BMKB 4OLYH 3HPLA 3VFTA 3VMNA 3MUGB 3F62A 4UIKH 1KCUH 3F7YB 3VXTB 4D0DA 1GC1L 1ZS8A 5BV7H 5B8CA 4OD2B 2Z31B 4PJ9A 3U0PB 4HCRH 3ARBA 4XXDB 5BXFB 4H25B 4HEME 1OLLA 4WFFE 3KS0H 3C6SB 2X4RB 1E4JA 3RKDD 1ZA3A 2G5RA 3G9AB 1DANU 3D0VB 3VGGA 3WJLC 4NQDD 3WL9A 3P77B 2XG4A 3BQUA 5ADPL 2D4FA 4LCUB 3IDGA 4OFKA 1QFWM 1CG9A 2FB4H 5ESVB 1IEHA 5FOJA 4NKDB 1BJMA 1KEGL 1NCDL 4MXWH 5I1IL 3BZFA 3T4YA 1WWWX 4PJFB 5ENWB 1UB5B 1JPSH 3BO8A 1HILB 1HKLH 1MHPH 3STZA 2NMSA 2DQGL 4JFPA 5DTFB 5HVHC 5ECJE 4UU9A 2CIIB 1KYOJ 1QRND 2I07B 2NY5H 1H3VA 1TQBC 3ZHDA 3LKQB 4RISL 4F9PC 4UQ3A 5JNYB 1E6OL 1A3LL 1DBMH 5IJKA 5IWLA 3FAXA 3M1BA 2DM2A 4YNYB 1F5WA 1CGUA 4S1RL 1DBAH 5D1QB 1MHHA 5C0JA 4PG9B 5ESAA 2DQIH 1MUJB 2OSLB 2B20A 4TUKH 5GRZA 3GMMB 1I8IB 4YDIH 5C09B 2CXKA 3GFUA 2Y5EA 4KK9D 5D6DC 2LAGB 4PJ5B 5HYFA 4NM8L 1RZGA 2V5YA 2EEDA 3PXJA 3VFNA 4P3DB 4KXZH 4NO0B 5E2WH 4YDJA 1ZHBB 1IAIL 1VGKA 1T0NA 4AH2B 3BEWA 4BYHA 4YUEH 2J88H 4KRPD 1QRNA 4R97C 2AABH 3P4NA 2YPKB 4APQD 3NA9H 2Y36L 3FO0L 3O9WB 2R8SH 1AGCB 3S8WA 2CDGA 4JO2L 2DICA 5CEXB 3U9PH 4BFIA 4U31A 3ZKMC 4K94L 3E6FA 3CK0H 2VWEC 2ARWA 4C4KO 4U33A 4CU6A 5TE7H 4MQXC 4O00A 4Y4HC 1T0MA 2FCBA 3ZDYE 1MNUL 3LKOA 3LMJL 5JPNA 5I8OH 1M4KA 2OJEA 3PNWA 3TNMB 4ODUA 3WO4B 1PJ9A 2YC1A 5E03A 1ZGLP 3EHBC 1GZQA 3UEZA 1JPGB 3H0TB 3NGBC 1S8DB 4YR6B 1EFQA 2OX5A 3WYRA 3FO9B 4IS6A 2EYRA 1FN4A 4RX4D 4PJBF 2HFFB 3HE6C 5EUKA 3UDWC 1M71A 4XBPA 2R9HC 3WN5C 4WU5B 2BHZA 2FH8A 1JGDB 2BVQB 3BGFB 4OD1L 5FUCE 3BAEL 4WI9A 4HWEL 3QQ3A 1QLFB 3NACH 2IG2H 4LCIL 5FDWB 4OV5A 3WFHB 1D5XA 3ILPA 3IF1A 2BNRA 4NGHH 3RFZC 4RFNC 3GIVA 4MLIA 3VGEA 3SDXE 1AP2B 3G08B 4G8GE 4OF3A 1HOCA 5D2LA 2ARJQ 2OL3A 1FH5H 5E2UH 3TNNB 3BKMH 5I74B 1AXSB 3ZKNC 5CEYA 2EEAA 2R1YB 1DQDH 2R2EB 3P73A 3Q6GH 2BRQA 5DFWH 1JGUL 3FQUA 4QXGL 3BP5B 5E7BA 3FB7B 3RP1A 1LEIA 5ISZB 3QG7H 4RX4A 1EO8H 1JWMA 4K55A 1J0ZA 4HKZA 5MENB 3IB4A 4LLUA 3F65A 3PV7A 4MQ7A 4WV1A 1KJVB 3VXPB 1TVHA 2ITDA 5MEQA 3V52L 3GKWL 1CLYH 1EAPB 2YA2A 3CUPA 2DM3A 3MRPA 5B3JE 5DEGB 4IOFD 1LNUB 2XKNA 5DUPH 4F8QA 5L0QB 3MV11 4YXLL 1MWAB 3S9DB 4OAWB 1NCAL 5CKAA 4Y5XB 3L3GB 4QHKI 3HC0B 1KIQA 3TV3L 3VFMB 2OCFD 2ZUWA 1G7IA 5CSBA 4M5YL 3L3HB 2CRZA 2BDNL 5ELIA 2CK0L 3DGGA 3F7VA 1GYAA 1ZLVH 3QZWB 4RGMB 3RTQC 3FQRA 3O4LB 3LPFA 4HFUL 1CICD 4XZUA 5K9OA 5ESQB 3ARRA 2VQUA 1DDHB 3BDYH 3OJ2C 1F4WL 5LWYH 3OKEA 3O2VL 3IFLL 3V9FA 2KQMA 2R29L 3IDIB 1W72B 5L2KE 4XWOD 4Y5VA 2VABB 3NCYP 4NUJA 1X5FA 2GFBB 4R3SA 4KJQD 3V8CA 1T1XA 5SWSB 5B22A 4KZDH 1XF1A 3CFKB 1FGNL 3BH8B 3EFFA 4LCWE 4Y1AE 1U3HD 2XV6B 3UO1H 5ANMA 5CGMA 5DDHB 2FJGB 4JFDD 5I2IA 5IG7A 1AD0A 3QFDB 3TBTB 3U7WL 4XNYL 4JAMB 4M3JA 3HNTL 4Z7UE 2Y4SA 1SBSH 4U1NB 1KLGA 1CICA 3CMGA 1A8JH 3MODL 4IHOB 1RPQA 3F8UB 4XPTL 2BSSA 3RDTC 43CAA 4M6OH 2OTUA 5EFIB 3MBED 2DYPB 1DJSA 4JLRA 5IBLD 2R56H 4K7PX 4M1DH 2ILLA 5EBLA 3MRQB 4GG6E 5C9JA 1X3DA 3HZVB 2HT3D 2Y72A 1FNHA 3JV0A 5FO9B 3TBWB 3WFDH 5I0DA 3RGVB 1A6TA 1YEKH 2C3VB 4XBGB 2NTFB 3MLXH 4O2CB 3ARYA 3DURA 4OZHB 2PCPA 4E42A 1KN2H 3GZKA 4Z18A 2GTWA 2EYTB 4JFDA 1OL0A 4YC2C 5IV2A 1EJ6A 3RWDA 4NZUH 5IFAL 5HGBB 1T6WA 5T1LA 2XXMB 4XCFL 5GS1B 1L7TL 1QVOA 1HSBB 3TVMD 3DXAB 1OSZA 1I7UB 5EZOL 3MBEA 1SEBA 1J0IA 2JCCB 1X44A 1CGWA 2NXYD 1I9RL 4PJAF 4EQ2A 5DS8A 2GEEA 1RV6X 2MSPA 3ZDXE 1I7RA 4R90L 4JB9L 3MCG1 3VGAC 2AK4D 4NHCH 3FT3B 4GRMA 1I3GH 1QFOA 3AREC 1QSFE 2YD4A 3C5ZB 5DJ2B 3ARDC 5D9SA 4UBDD 1LK2A 1I7ZB 3KHQA 1BQHG 4MA8L 2JJVA 2OJZL 1JCKA 2BFVH 1LP9A 3C5SA 4AT6B 1J05B 4JR9L 3LEYH 1MCBA 3AB0C 1FO0L 1RFDH 5T33H 1S5HB 2X4NB 2XPGA 5E1HB 4U0RC 2A38A 5LAXA 3V4UL 2XZQL 2VLMD 4XNZC 5GS0H 3SO3C 4P59L 3VXSE 5D5ME 3PWUA 5D8JL 5E2VH 5FYKL 2P8LA 3A6BL 2O5XL 3QWOA 3GSNA 5H37H 2ITCB 4GRWH 4FQQB 4PD4K 1T7ZA 1ZEAL 5L9DH 5JHDE 1KENH 2AK4A 43C9B 1INQB 5DJZB 5F1IA 3D2UD 2NYYC 2NXYC 4OM0H 4C55A 1HWGB 1U92A 1WAAE 3NAAL 4TUOA 4F8TA 1D5BB 3SJVB 3MRRA 4KC3B 1XH3B 4N1EA 4F3FB 5ICZB 1SEQL 4F33B 4Z7VB 1HNGA 3QDGD 3MNZB 2ZCKH 3OV6A 3GI8H 2DBLH 2DQJH 1NBQA 2FHBA 1YYML 5SV4A 1GVIA 1A64A 1NAMA 2P7TB 4EI6A 1OSPH 1UWGH 1U8NB 4HK0A 4NOFA 5CS7A 2R2CA 4GBXD 1X5ZA 2BCKA 2O5YH 1D6VH 5ALBL 3U0TB 3FQNB 4PJEB 5LBSL 1RZJL 1MIMH 2AJVL 2HVJB 2D7NA 4OLYL 5FGCE 5DC9B 4UIKL 4Y0GA 1KCUL 5FCSH 3L95B 4O2EB 4EDXB 5BQ7A 4Y5YB 5BV7L 2PYFA 3QPQC 4IOSD 4HCRL 4QRSA 3DUUA 1WC7A 4JFHD 5FYJU 2C26A 4P23A 4NWTH 1BVLA 1TTUA 1Q9LA 2FB4L 4MJID 1BFTA 3RZCB 1KPVB 2HJLA 3IJHB 4ZTPH 3EIFA 5B38A 1AGBA 3MRIB 4MXWL 1ZT7A 5HVGB 2VL5B 1QR1A 4GBXA 2X2YA 4I3RH 3UBXB 1T5WA 3JVGA 5M94B 3NIDE 1JPSL 1RQ5A 1VHPA 1YN7B 1HKLL 1MHPL 2YPLE 3CC5A 4GRLC 4WTWA 2I26N 4CRPA 5CILH 2NY5L 2V9RA 5EUOB 4X6FA 5HI4C 4N0YH 3VW3H 5DQ9B 5H94A 5D70H 1HDMA 4QHMA 1DBML 2W1NA 5IM7B 3S37X 1HQRA 2I25N 3IDUA 5HHOB 2A0LC 4M6AA 1OTTD 3IFOB 1DBAL 1H0DB 3KYAA 4LCCC 3LDBC 2DQIL 4X4YA 4TUKL 3QDMA 4K7FA 4MJIA 3CH1B 2ZSWA 1BBDH 1A1NB 4YDIL 2CPCA 1E4KA 5DD6B 4B41A 4WI3A 4ZYKB 3PQYA 5EO0A 2G2RA 5C07B 4M7LH 5E2WL 1WJ3A 2IAMC 2CDFB 1CXEA 4PBVC 5DRWA 4BKLA 2QQKH 4WHYG 4YHOH 4HX1B 4ZTOH 3O3EA 3FT4A 4NQCE 4XPGH 3L7FB 4YUEL 4IOIA 2GYSA 2J88L 3FOLB 4OCNC 3SBWC 3M8OH 4X6BB 4UTAH 4Y4KB 2AABL 3NA9L 2K7QA 4FQXC 1IKNC 1KN4H 3TJHD 1OGTA 5IVZB 5KS9A 2R1WB 3GMPB 1Y18A 3MLZH 3S36H 1G7HB 4NKMA 3U9PL 2IPTH 5EO9A 5FM4A 4LLDA 1HHIB 1TTFA 4Q58C 3KDMB 3CK0L 2HRPH 3D6GA 4I8DA 2WINA 5IB3A 3LZFH 5TE7L 3EO1B 2P42B 1FE8H 4C56E 4TUJA 1B0RA 3NMEA 4U3HA 3DX8B 3TPUB 2NY6B 4CVZB 5I8OL 5SX4I 2EZ0D 2Y5TA 4NDMA 3VWKD 5GGQH 4NQVA 4F7PB 1Y0LB 2D31A 2PO6D 3CCHA 3KPOB 4H1LA 5HHME 4KTEH 4UMGA 3SDDC 1A7PH 5C3TA 4DFIA 3CAFA 4P2OC 4RA0C 5EU7E 5E6IB 1ORQA 4U6YB 3SO5A 4F80A 1H3TA 3NACL 2IG2L 2I27N 2G9HA 4NGHL 5JIPA 4LF3A 3B6SA 1NBYB 1AI1H 2FGWL 4X4ME 4XMLH 5T5NF 1PEZA 1CYGA 1EXUB 4BUHA 1YEHH 2GHWB 4L8SA 1FH5L 5E2UL 3BKML 3VWKA 3WNOA 1NMAH 3ULUD 1VSCA 2MQ0A 1DQDL 3Q6GL 2J7LA 2HTLD 4LSDA 2A1WH 4NO5A 2PO6A 4ZFOB 3GJEB 2Z9TA 3QG7L 4DVRH 3Q6FB 1EO8L 4I9WE 4LNRA 5J1AA 1FL3A 3I6KA 3HMXH 5D7KD 1A1OA 2F8VA 3OKDA 1KUMA 4QRRD 3RL1B 1KJMB 1CLYL 3BHBB 4LPCA 1JRHH 4PR5A 3S4SG 4OFVA 1OCWH 4WFHD 5DUPL 5EC2B 2VLKD 4MGXA 4HAFA 1N4XH 2PXYC 1EIBA 1CFQB 3HA0A 4WTZG 2HFEB 2W65A 1YMMD 5GRUH 2IC2A 2E7BA 2D0GA 4PRIA 5IB4B 4MWFB 1JNHB 1KCLA 4I1NB 5DJ6B 3T0EE 3ZYIA 3IFNH 1NCWH 4D0BB 4QHLA 4HW6A 3NIFE 3HUJB 3QWQB 3JBG7 3BDYL 5LWYL 5JPMA 3AY4A 3W0WD 4QRRA 3A6OA 5D7IE 3CVHH 2VDMH 2DTSA 4RNRB 5INDA 2VLKA 3PWJA 4KZDL 1UCTA 2YD2A 1YMMA 1NEZG 3UO1L 3C8KB 1G7MB 4HGWA 4YX2H 3AXLA 2HMID 4KJPD 5C8JA 2CO7B 2FJFA 1I1AD 3HG1D 2ZUYA 2IBGA 1SBSL 2VDRH 5HYJE 4H26A 1FL5A 1R3KB 4XVJH 2IMMA 3T0VA 1BX2A 2WAHA 4U1LA 4M6OL 1F6FB 1EEZB 3W0WA 2R56L 5AZEH 4LSTH 4M1DL 5B4MD 4D8PA 2V7HB 1MCEA 4L9LB 3SDXF 4N8VA 3BWAB 3UTPE 4K3HA 4CMMB 1KYOK 3QUYC 4PYHA 1CFTB 3KYOA 2XQYG 4DZBB 1XIWD 1NEUA 3WFDL 3BXNA 4F2MA 2JF1A 1U8KB 4HIJB 1R3LB 1YEKL 4BQCA 3MLXL 2X4TA 2DI8A 1KN2L 1CIDA 1DBJH 1IAKB 3ZDZE 1CE6B 4V1DB 4LVOC 4QRUB 1DQLH 2CRMA 5L6YH 2A83B 3MBXH 4XHQA 3CZJA 1I1AA 3CFDB 3ARVA 3EKCA 4NZUL 3HG1A 1A6ZA 4OZ4B 5ABDE 5C3LD 5AYQA 2V2XB 3OKOA 3KPQB 4DGYH 5AAWA 4ZAKD 4LVNC 4X7DC 5CJBA 1E27B 5HHPB 1OY3B 4TVPE 3IXTA 5MHSE 5C08A 4P3CH 3QHZH 2ZKHH 4RFEA 2C1PB 2F8XC 3QA3A 3WFBH 4K8RH 4ERSH 3IKCA 5DMKA 1UB6B 1XIWA 4NHCL 4DJMA 2PYED 1J12A 1I3GL 1Q9KA 3IDYC 3IDJA 3TM6A 2Q7NA 3KPSA 4MD4B 1U8OB 4XI5C 1MI5B 5JW5B 2WV3A 3Q5TA 2BFVL 2GIYA 5JLZB 5CUSH 3LEYL 3QXDB 5FGSA 1RFDL 1I7TB 5T33L 2HYMA 2LVCA 3BGMB 5GS0L 4JHZA 4ZAKA 4OFDA 2BY1A 4F7EB 4I5BB 2RB8A 5E2VL 2GSIB 3MV7A 1CVRA 1TNMA 2H26A 1HN1A 5EZJB 3FO2A 3QSKB 3RPIB 4HMCA 4QOKB 3DJ9A 4NRXA 4NQXA 5IEKA 3BPLC 3P2TA 4GKZB 4JVWA 3DSFH 4EVNA 4QTHB 4LP5A 5L9DL 1KENL 2PYEA 1NUNB 2Z4QA 3QUZD 1IE5A 1J1PH 1JFQH 4N0UA 5SWQA 3BJLA 2H6PB 2Y9RT 4NN5C 4OM0L 1HINL 1CDIA 1U95B 2H32H 4Z7UF 2Z91A 3VFGH 2ICEA 3EOYG 3MOQA 2QJDA 3MRCB 1SJHA 4KROC 3VMPA 3C60B 4LOUD 4PJFE 4IDJH 3FB5B 2ZUTA 2HLAA 2IANB 2ICWB 1UACH 5C0DA 2ZCKL 3GI8L 2DBLL 2DQJL 2SEBA 2FYYB 3NCFB 3BZ4A 1CXIA 1OSPL 3RX5A 1UWGL 3KJ6H 3QH3A 2AJUH 4AM0A 2M8XA 3SGDH 4JFED 1S7QB 3VFOA 3MJGX 2O5YL 3P4MB 4PGEA 1D6VL 3LKNA 1CXKA 4LPWA 3QUZA 2BNQD 3O2DA 1MIML 1FZMB 4JGUA 4YO0B 2A6IB 5C09E 1KB5A 3HZKA 4N9GB 2E9IA 4PJ5E 2VQ1A 1HWHB 2DWEA 1ZHKA 3CFJA 1ORSB 5FK9B 5HHQA 1MCOH 4NWTL 3RY5A 4HUNB 5EU4A 1S7VB 3ZDXF 3DMMB 3GB7A 1RJYA 2VZTA 3AM8A 3GSRB 4ZTPL 1H15B 1YNKH 3QQ4B 1XCQA 4JFEA 5I8CB 3WHXB 1U3ZA 4I3RL 1WTGT 1K8DB 1NFDA 1T5XA 1CS6A 2BNQA 1HYSD 2XN9D 2AJ3B 5T5NG 4OCYH 3WS3A 4Q9RH 5E4IA 3C9NA 1YMHB 5EBWB 5CILL 1QLEH 3BESR 1JN6B 3BMWA 5ID0A 4N0YL 4WTXA 2VXQH 1NC2B 3I9GH 5D70L 3QJFA 3TESA 3VXOA 5D5MF 1I8LC 3TYFB 1VA9A 3QRGH 3GSOB 1AHWA 5E0QA 4LMQI 4Y2OA 1OTSD 4YDVB 3K8LA 4FRWA 1M6OA 4PV9A 3EDEA 1UXWB 1BBDL 3IDNA 4WJ5A 4L4TD 1RUQH 5E00A 4GSDL 5DHVA 2NXZB 3V0VB 4M7LL 4IIQC 1JZ3A 2EKJA 4YIQB 3U4EB 1WAAF 2QQKL 4YHOL 1T2XA 4XPGL 2X70A 1RK1B 4KI5E 3M8OL 5AZ2H 4UTAL 3QXUA 5HGHB 1KN4L 2R2BB 1WLHA 3O3BB 1YNLH 3O4OB 3MLZL 3S36L 4ZPVA 1J1XH 1KF9B 1LO2H 2IPTL 5CJQH 1N2RB 2HRPL 4M9OA 1WBXB 3ALWA 5ISZE 3LZFL 4WNQA 1FE8L 3KYNB 5FYJE 4L4TA 5DA4A 1GXEA 5MENE 2A9NH 1YC7A 4I77H 1OTSC 2GJ6A 5FYLL 2B39A 3EZJB 5GGQL 1XR9A 4XVTL 3MMEA 5BVJA 1S7SB 5DJCA 4XNXH 2BXZA 5J57B 3WKMH 1SY6L 4Z0XA 4G7VH 4KTEL 5FUOH 4MNHA 5JIIA 4WDIB 1ERNA 2R0KH 4XC1H 1A7PL 5EULV 1PY9A 3MACH 3O0RH 1YN6B 2AV1A 1T4KA 4Z7WA 4Y89A 4HZLB 1R5IA 4M8QB 5E9DD 1GGYA 1OAUH 1QSEB 5EN2A 3KR3H 3RNQB 1EH9A 4Q6IA 3VWJC 4GKNA 3O4LE 3NIDF 1AI1L 3I6LD 4HXAH 1YEHL 2R2HA 4UOJA 5FGRA 5J06A 3D0LA 4Q9CA 1NMAL 5CHNA 3KG5A 3UTQB 3DIFA 4MAYD 2KUTA 1B88A 2A1WL 3GMQA 1CVSC 1T89C 4M7KH 2VDKH 4DVRL 1HHKA 5SWSE 1FSKC 3TEUA 5J13B 3DGCR 1A6AA 1XR8A 4LFHD 4KI1A 2VH5H 4OUUB 3HMXL 3GHBH 4QYOA 5C0FB 2XY1A 4PLJC 4CN1A 1WTLA 4AZ8A 3S5LG 3UC0H 5E9DA 4GRWB 1BWWA 1QBBA 4RMTA 5EU7C 4UV4H 1OQXA 1PBYA 1JRHL 2VUOA 2X1PA 2ADIB 4WUUB 3UPRA 1OCWL 3RWHB 1N4XL 4ZUVB 3QEUB 2EDWA 4XHJD 3AAZB 1Q9OA 4PRBA 4F9LA 3ARQA 1Q9WA 3PP4H 5GRUL 5HVWA 3MRFB 4J1UB 5BS0D 5KVMC 4OGZA 4MAYA 3LN4A 4R2GB 1CGXA 4O2FA 1KIRA 1FRGH 3IFNL 1NUDA 1XGUA 1IC5H 1NCWL 4R0LA 4XAKE 3TA3C 4ETQA 1FVDA 5IP4A 3W5NA 2P5EB 3D3VD 4OZHE 4Z7QE 3TBSA 2JELH 5DJ0B 5H2BB 4QKXB 3CVHL 2VDML 3L1OH 1BD2B 4MNQD 2CQVA 4WEUD 2VR5A 5JDJA 1K8IB 5F96H 4LLVA 4GMTH 3Q1SH 1L9NA 1EHAA 3DXAE 2A2QT 3MX0A 2UVEA 5BS0A 2JCCE 1FGVH 4YX2L 3SGKA 5DI8A 4WHTB 3OKMA 4EOWH 4KHXH 3GMLA 2Z0BA 3T0EC 4FG6C 2VDRL 4XVJL 1J7VR 4TOYH 1GZPB 3D3VA 1INDH 2A77H 3QAZC 1MSPA 5E2JA 4EXKA 5AZEL 4FFVD 4LSTL 1ZVSB 4RBPH 5TDNA 2I9LB 1RY7B 3TO2A 4MNQA 3SDAD 1S9VB 1FNFA 1JF1B 4RAUA 3VXRD 1AQKH 1P53A 3TYGH 5L8LB 4PJBA 1EHLH 2YUZA 3CDYA 5GGRB 5C1MB 1M7IB 3K8MA 5IESH 1DBJL 4JHBA 3VGBA 2VOTA 3QR2A 3OGOE 1DQLL 2DM7A 5D7JC 4JPIA 4JZJA 3O6LH 4ZFFA 1FL6A 3MBXL 4LSSH 4M02A 2EIBA 2GY7B 3EYFA 1DL7H 4DGYL 4G9FB 5IFHH 1AIFB 2CUIA 1IJ9A 1OGAD 4RWHA 3U46B 5A2KH 3C6LC 2XA3A 4LSVH 2YKLH 3S3PA 3WLBB 1HH9B 4P3CL 3QHZL 5DFVD 2ZKHL 3X14A 2EDEA 5L2JB 4I0CC 1A9BA 5KZCD 3SDAA 3SJVE 3G5YB 3WFBL 3O6FB 3VXRA 2H9GA 3MRKB 2OS7A 2W0FB 4K8RL 4ERSL 3BUYA 3HR5A 3MJ6A 3W11D 5L8KB 1RIUH 3O3AA 4Z7VE 1IGTB 1UZ8A 5A2IH 2EDQA 2Q6WA 5IJVB 1AGEA 3NIFF 1NDMB 3MRGB 1FZKA 5CUSL 1T2QH 4OZGA 1XF2B 4CADA 1DQJA 1ITCA 3KLDA 3LRHA 4PJEE 5IFJA 2A6JA 3VI3E 1HXYB 4WWKB 3U2SA 1A3QA 2FJHB 4XX1E 5FA3B 5IOPA 1RI8A 3OB0H 4JQVC 3UDWA 1C12A 4ZPTB 4FHBD 1S7TB 3DSNA 3VXQB 3DSFL 15C8H 4R7DB 4ZO7A 4GQPH 4XWGH 4JFYB 3DHMA 3BOVA 1J1PL 4EUPA 2A74B 5JOFA 3GSNH 4JY4B 1WGOA 1VESA 2JIXD 5I1EH 2V5RA 3VFGL 2HT2C 1Z0MA 3X13B 3L6FA 2I24N 1FIEA 1TQCB 1QEWB 1IARB 4AY0A 1HI6B 4OGYH 1S9XA 3AS3A 5BW7A 5I71C 5E8EB 3H9HB 1ZMYA 4IDJL 4GMSH 3EJYD 2FEDD 1MLBB 3QNXA 3GSQB 1NCNA 1MCHA 1J86A 1UACL 2F53B 4M7ZB 5EUOE 4NHUB 4HJGB 3KJ6L 2AJUL 2Z31C 5HHOE 2BY0A 1JNJA 2WM0A 4J4PC 3ZDZF 1IT9H 4J3OC 3NFPA 1MJ8H 1NAMH 4DAGH 2JIXA 4RMQA 3HTLX 3ROOB 1NGZA 2Y23A 3RVWC 1PKQA 5C07E 4ZOBA 3GMRB 3JWOC 4QRQA 4UNVA 1Z2KA 3ULVD 3VDCA 1WIPA 4LRIA 1MCOL 1BMGA 1MLCB 4BZ1H 1PFCA 3OX8A 5HDOA 2B4CC 4NJ9H 4HHAA 1PZ5A 1YNKL 3D48R 5C0ND 3VRIB 3T8XA 5BCAA 5HGDB 1J9CT 4JRXB 1MHCB 4DZ8A 1F3DJ 4R96A 2FIKB 1CBVH 4AENB 1MCWM 1X5KA 2NPLX 1LO5A 4Q9RL 1K9TA 4OCYL 5D1QC 5IW1B 3RJQB 4AEEA 1WFNA 5DRXA 1QLEL 5ITBH 3QI9B 3O8XB 3I9GL 1SBBA 5JORA 4HAGA 4BA8A 3QRGL 1EHXA 2D3VA 3B3IA 1ZK9A 2AP2A 3HAEA 1MRCH 1GGIH 1IC4H 2Q86A 1JHKH 1KIPB 1XF4A 3SEPA 2WIIB 1MFBH 5ICYB 2NY4B 4MDIB 5DRZB 3ZZ1A 4IMLA 3VXNA 3QIBC 1RUQL 4JFXA 4CDGC 5ACMA 2IEPA 4G8FA 4LPVA 4U0QB 2GTZB 1FFOB 1JP5A 4HBCH 3ECBA 5HI5D 2EH7H 4WO4D 3SDCD 4KKAD 1YUHB 4PRNB 1I1YA 3DV6B 3N1MC 4RDQF 4YHYB 1D6EA 1I1RA 5AZ2L 4PJFF 2R0WH 5FB8A 1G9NC 5C0NC 1H5BB 1U8PB 1U36A 3BSZH 2BY3A 1NQBA 1ZLSH 1YNLL 4UINH 3MFFA 3FB6A 1J1XL 1TNNA 1LO2L 3WO4C 1EGJA 1BP3B 2GITB 5CJQL 2DOCA 4QCIA 1NDGA 4U1MB 5FO7B 3ARFD 2A9NL 4I77L 2QQLH 2DWDA 1QKZH 3OAZK 4S11A 5IR1A 3H7BA 1MH5B 5IIEB 5KSUA 4NFDA 1E28B 3SDCA 1S7RB 3B5GA 1SYVB 4NQTA 1PVHA 5FF6A 3UTTB 1UXSB 4XNXL 3BP4A 3WKML 2WLYA 4RMWA 5T3XH 4MD0A 3QNYA 4KI5C 4G7VL 3MCKB 5FUOL 1KV3A 5BJTB 4JPKH 2XTJD 2R0KL 4XC1L 3EJZD 5F7EH 3ARDA 3MACL 3O0RL 3QG6A 4F58H 4MQSB 1JZ4A 3KR3L 3QWRD 5KW9L 2HT4C 1UVQB 1DTUA 5CEZE 4P46B 5IK3A 5KSBB 3NH7L 2AVGA 3F5WA 4UUJA 3ARFA 3FHAA 3HUJE 3KWWB 4HXAL 2WBJC 4FFZH 2YD9A 5JXEC 4JVUA 1G1YA 2WP3O 5J6GA 2CKBB 2ZSVA 1FNEB 2VDKL 2ESVB 3FRUB 4IJ3B 4M7KL 4PJDA 4MCYA 4PJ8B 1MFAH 1KEMH 1NLBH 3VH8B 1IGCH 5L0QC 2VH5L 3FRPA 3GHBL 3MGTA 4GLRH 2R0LH 3MV8B 3UC0L 4K9EH 1FNGB 1CE1H 4Y5XC 3FQXB 4PRHA 4UV4L 2P43B 4BSJA 3QWRA 5GS2H 4XGZB 1F97A 4FQHB 1QLRB 1VFAB 1EFXD 3TGXA 1CN4A 3PP4L 5TH2A 4KI5F 1JZ6A 1UADC 2V5TA 2DAVA 4LSQH 1EUUA 1KT2A 2BK8A 4JANB 5AG9A 5I1KH 2VZ1A 2HN7A 3WE6A 4NSKB 1FRGL 1IC5L 4NKIH 3MLYH 3VFRA 4A6YB 5FO8A 4P4KB 1CFSA 3OG6B 2V6HA 4FTVA 3ULUH 5DMGD 4P99A 2XWTB 4QHUB 2JELL 5T3ZH 2YBRB 4V1DE 1H3UA 3VMOA 4Q2ZB 4Y19B 2H45A 3RPKA 3O11A 4LPUA 3L1OL 4JPWH 5B39A 1H8NA 4F7CB 1BEYH 1EFXA 3O41B 4MXVE 5ID1A 5F96L 2RJMA 4KJYB 4GMTL 3VRJA 1CDYA 1KTLB 3LKRA 3F7PC 4ZS7H 1NBZB 2L4OA 3WUWA 1FGVL 2UWEA 3BIAX 1DN0A 2IADB 2NY1D 4NNPH 4NT6B 2L7JA 4EOWL 5L7XH 5GGTH 4KHXL 4RQQA 3VFTB 1LHZA 2YUXA 3HPLB 4PRPB 2V5MA 4OZIA 3AMKA 5AEAA 4X83A 5B8CB 4TOYL 4OCMC 1PEWA 1INDL 2A77L 3RGVC 4L8BA 4N68A 2W9DH 3DRQA 4XPAH 1MI5E 2WSKA 1CTOA 2VUYA 4FP8H 2H2SC 5KOVC 3WL9B 1GIGH 1Q0YH 2BSTA 1UEYA 4KKLC 7FABH 2F8OA 1AQKL 3TYGL 1EHLL 4PLKC 4CNIA 5D7LD 1F58H 4HC1A 1EMTH 3O6KH 4HKBA 5GS1C 1DEEA 3PWVA 3CDCA 5GQBA 5IESL 3BZFB 3CSYA 3T4YB 4LPYA 3OR6A 3O6LL 3BO8B 3STZB 4QOKE 2IAMA 4LSSL 4GAFB 3F6IA 4LARH 5IBUG 2NY3B 3ALPA 4UU9B 3T77A 2A9MH 4QHNA 1DL7L 3QISA 4WFED 3WXVH 4B0MM 4P57B 4UQ3B 5IFHL 3HE7D 1VKXB 2VR9A 1ND0B 4FQXA 3K8KA 4LSVL 4B50A 3C5ZC 5C71A 4MMXC 3G6JB 3HC3H 1PW3A 1MHHB 4NQDB 5C0JB 1AGDA 4I13B 1LQSR 4EI5D 3TBYB 4OKDA 2P8PA 3PIQA 3V5KA 4EN3D 4KFZC 4K94C 1RIUL 1RZGB 1NGYA 2AXJA 2IANE 3VFNB 4XMKH 1IGIH 1VGKB 1T0NB 4HV8A 3BEWB 4HH8A 4U6VH 5DK2B 3DVNA 1T2QL 4OZHF 1OAKH 3K1DA 4G80A 1JI2A 1QRNB 4ACPA 3P4NB 2DQCL 5CINH 3KXFD 4Y4HB 3HE7A 3Q5YA 5K9JH 1MIEH 4V2CB 5GRVL 4M3KB 3U82B 2CDGB 1S7XA 2IFGA 4RRPA 4HIXL 4BFIB 4LU5H 2EE9A 3SKMB 4P2OA 3E6FB 2JKXA 4NYLA 4TN9A 4EI5A 15C8L 3L3IA 4XWGL 2B0SH 4PB0H 2R0ZH 4XVUC 3GSNL 3LRGA 2KZ1B 3PNWB 5EPMA 3KYMA 5I1EL 5F7NC 2YC1B 2JJTA 5DO2C 5TFSH 1GZQB 4ZS6D 1WISA 4ODTH 4V2BA 1DE4A 3WN5B 3MZTA 3IDMA 4ORGA 1VFBA 1JGEB 4RDQG 4KRPB 4U1IB 4UAOB 3RU8H 4EN3C 4OGYL 5HXMA 2HJKA 4IS6B 2EYRB 5IB5A 1B90A 1OHQA 4APQB 1AXTH 2PTUA 4GMSL 1IZKA 2YD7A 3KXFA 3R8QA 3X3GH 3MGAA 5EUKB 3VU2A 1YQVH 2Q1EA 3HI1B 5FIEA 1B0WA 1FDLH 2AQ2A 3PGFH 3QQ3B 4MCZA 1RK0A 3K3QA 4B7IA 4F15B 4OV5B 1D5XB 1T66C 3ILPB 4MA3A 2LU4A 2J6EA 1IT9L 4PY8J 1S9KC 1S7WA 4XCYA 2QSCH 1O7VA 2Q87A 5KVFH 4MYWB 1MJ8L 5D2LB 1QPPA 2PXYA 1NAML 4DAGL 2OL3B 1G7LA 2BVOA 5CEYB 4N5EC 3QIWD 3RZCC 1NH6A 2HLFC 3FQUB 1LEIB 2H2PD 3TH4T 3O2DH 1FNSH 1NMBH 1UGNA 3GSWA 3SKUD 1BFOA 1JWMB 5BZDA 4HKZB 4LLUB 5C0AD 1KB5H 3QNZA 4MQ7B 4WV1B 4NJ9L 1W0WB 5IUSA 1QYGH 1S9YA 1TVHB 1JPFA 1S78D 4UT7H 1AD9A 3MRPB 3HAEG 2CLVA 2XKNB 4Z7VF 3IJYA 3GUTB 1N59A 5IW6B 4JRYB 3PP3K 1MFCH 3X11A 1CBVL 4N1HB 4P5TD 1VACA 5ICXA 1HQ4B 1FVEB 4NKQB 4KMQA 5ITBL 3QUKA 1P4IH 3PHOA 3QIWA 4PJEF 1E0OB 5F6IB 4F7MB 2W0PA 3DGGB 5DYOB 4G42A 3VI3F 4P9HL 3FQRB 1NC4B 5IB1A 1MRCL 1GGIL 5C0AA 1IC4L 5K9OB 3SGJC 1JHKL 2LTQC 3WLWD 2GT9A 1GOGA 1MFBL 1UG9A 1PGRB 3BIKA 4D9RD 3OKEB 3T04D 5T1KD 4PJAB 1YYLL 4UQ2A 3T2NH 4Y4KC 9CGTA 1E6JH 4R3SB 3OGCB 3NFNA 4HBCL 1HHHA 1A5FH 2EH7L 2V17H 1JGVH 3BP7A 4OD3H 2ADJB 3H9SD 4P5TA 1QSEE 2WQRA 3EFFB 3QUMA 1A6PA 1S78C 5DHVH 2R0WL 1JPTH 5DJDA 3BSZL 2DKSA 1AD0B 1ZLSL 4E0RA 2AJZA 2NY6C 1J5OH 5IVXF 5EUOF 5TDPA 5E70A 5FYKD 1CICB 5DC0A 3EOBB 2BSSB 1ADQL 5I75B 1M05A 4LNVA 3EBAA 4X9IA 3ZMRA 5CP7A 5T1KA 4WU7A 2CMRH 5J3HD 1IMHC 2QQLL 1QKZL 4WHCA 3A6CH 3BP6B 4R26H 1JGLH 1FNAA 4GRWE 4L3CB 4Y16D 5E6IC 4WUUE 5JA9A 5T3XL 3DURB 2WNGA 5BRZD 4E42B 1U3HB 4GG6A 1OPGH 4FXGA 2GTWB 3REWA 5DC4B 1FO0A 5C0IA 4JPKL 1IL1B 5F7EL 2AJXH 5J6HA 3RWDB 2AJSH 4F58L 3DETC 4RGOH 5IMKB 5KN5A 4Z7OE 4NQUA 3OKNA 1VGEH 4NRZA 1OSZB 1U0QA 3MBEB 3QZWG 1UQSA 1ED3B 3EZ8A 4FMKA 4N0FA 1WV7T 4H0HB 3V6OA 2P5EE 2IFFH 4KY1H 4CVWA 1AR2A 5H35B 5GZNC 4FFZL 2J5LB 1I7RB 1T7YA 4GRMB 1BD2E 1IAII 2D7OA 1U8MA 2XWBA 5D9SB 5B21A 1K4DA 1MFAL 3C5JA 1KEML 1NLBL 1IGCL 2HFTA 4YFDB 4L3EB 1LP9B 3EYQD 1ZT4A 5HHNA 3S96A 4W4OA 4K9EL 1W2KT 2XPGB 5MERA 1CE1L 5LAXB 1J0YA 4XRCA 3OG4B 5ETUA 1SMAA 5LGJB 3G5ZA 3TVMB 1JYXA 3BEVA 1MHEB 4HULB 3D69A 2P8LB 4KTYA 2F15A 1SM3H 2EYSB 3FHQA 2NXYB 3QWOB 3ROLB 3W39A 5B3NA 1J11A 1FZJA 2VXUH 3IFPB 4UI2A 3WCYA 3BRDA 2FR4B 3S3JA 4LSQL 5FGBC 1HCFX 2AK4B 3BDBA 5I1KL 3R1GH 1N6QH 5F1IB 4K3GA 4MSWA 2GAZA 2PN5A 2IPKA 4HCRA 4NKIL 4G6FD 2ZOKA 3NIGE 3ULUL 4ZOAA 3BX7C 4M61A 2QV2A 3L3DA 3MRRB 2MMXA 3MUY1 2VERN 2CDEB 4KK8C 5T3ZL 4QTIH 4C83A 2C4FT 3WV0A 3K81A 4G6AD 4HD9A 1JVKA 4L8CA 2K9UA 4JPWL 3L5HA 5A3IC 4X7CC 1BEYL 3CH8A 4U49A 1B0GA 3MUJA 1R6VA 2HJFB 4G9FE 4ZS7L 5F7KC 4EI6B 3VA2C 5D96C 2CK2A 1BQUA 1T1ZA 1X5IA 4LHJB 2BCKB 2NY0D 4MZ2A 2NLJB 1A02N 4NNPL 5L7XL 4P2QD 5GGTL 3B83A 5DK3A 4Z77A 4U1SA 4L9LC 1DN2A 2ICES 3D2UB 2DQHH 4LSPH 3CFEB 4XMPH 5BQ7B 4PP1D 1P7KA 4BH8A 2NZ9C 4QRSB 3DUUB 5CZXD 1WC7B 2W9DL 4XPAL 4A2MA 5TJWK 2D2OA 2YZ8A 3HUJF 5D72H 3T0XA 4JFOA 1GIGL 1Q0YL 1BVLB 3QDGB 7FABL 1I9EA 1M7XA 1F58L 2EDRA 1EMTL 2HJLB 1F4XH 3O6KL 5CD5D 5CJXA 1AGBB 4OKVB 4NZJA 1OWWA 1ZT7B 4UV7H 3DX6B 2IH3A 1T5WB 4NBZB 4P2QA 4JKWA 4ENEC 4JHWH 4R4NC 3UROR 4U1JA 3LB6D 1ULVA 2OTWA 4LCCB 4TNWK 2A9ML 8FABB 2DIJA 1BM3H 3WXVL 2IF7A 1ONQA 1HDMB 3BD4A 1HQRB 1EPFA 3MRJA 3IRZA 1MVUB 2X4SA 5EU6D 3HC3L 2UY7A 4KUCD 3JUYA 3IAPA 3N9GH 4X4YB 5EB9A 3QEHB 4K7FB 4MJIB 2ZSWB 1RU9H 2PW2A 2OP4H 3GIZH 5EO0B 2G2RB 5CBAB 2F53E 2AV7A 1IGIL 4LSUL 4BKLB 3O3EB 4U6VL 4IOIB 1OAKL 1OLZA 5KBNC 4QHKJ 5CD5C 3UXFA 4OZFG 5C6WH 1B4RA 1OGTB 5GSVA 5K9JL 3GNMH 1K85A 1MIEL 4HLZH 4Z76A 4TNWF 5F93C 3TT1H 1H3WM 5EU6A 3FQWA 4MXVF 5KSAD 5J56B 1N0XH 4HS6A 4LU5L 5EO9B 2DMKA 4LLDB 3UMTA 5IB3B 3BKJH 1IAMA 3MJ9A 2E3VA 2B0SL 3LQZA 4PB0L 4JDVA 3C60C 3L3OA 2R0ZL 4U6HA 4HH9A 4GKOA 4OCLC 4L8DA 3ZTJH 2Y5TB 5TFSL 5I8EA 35C8L 4ODTL 4ODXA 2BJMH 2COQA 4NQVB 5F72S 2D31B 5FV2A 3FKUS 2DKUA 3RU8L 3CCHB 4H1LB 4JRXE 4EUPH 1AXTL 4JKKA 3KPRD 4CW1A 3X3GL 1YQ2A 1YQVL 4DEPB 5KSAA 3LV3A 2N4IA 3B2VH 1ORQB 1FDLL 3RVXD 1QO3B 3PGFL 3SE4