1FAIH

Three-dimensional structure of two crystal forms of fab r19.9, from a monoclonal anti-arsonate antibody
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
221
structure length
221
Chain Sequence
b'QVQLQQSGAELVRAGSSVKMSCKASGYTFTSYGVNWVKQRPGQGLEWIGYINPGKGYLSYNEKFKGKTTLTVDRSSSTAYMQLRSLTSEDAAVYFCARSFYGGSDLAVYYFDSWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSALYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2B-KAPPA R19.9 FAB (LIGHT CHAIN)
publication title Three-dimensional structure of two crystal forms of FabR19.9 from a monoclonal anti-arsonate antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 37
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1992-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1faiH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1faiH02
3P9LB 3ULUE 3HAEB 1X5KA 4MDJB 4NJ9H 3G6DL 3BH8B 2EE3A 3CFKB 3UTSA 2MQCA 2YSSA 3PQYA 4I4WB 4CJ1A 5MHSD 1QLRB 1A7OH 4R7DA 2FBJH 4JHAH 4W4OA 5BW7A 2ICCA 5F9AC 5KVFH 3B2VL 2D7TH 2MHAA 2EICA 1FVEB 1CICB 4MJIA 3MREB 4PRDA 4RISL 4L1DA 43CAB 1HYSD 1EFXB 4X7SL 4QHMA 5JZ7C 3JSSA 2P7TA 4YPGA 2V6HA 5C2UB 2J88H 1ZHNB 4JZJA 1SJEA 1ZVYA 3OR6B 4PJHF 5HGDB 3BPLB 1T3FA 1DTUA 4F8QA 2OQJA 1CR9H 1KJ3H 4XMKH 1OLLA 2EKJA 4N9GA 2GJJA 1IC7H 4MXWL 1P7QD 5TH2A 1GHFH 1QBAA 1TMCB 1ZOXA 1LK2A 5FYKL 2VLJA 4ZSOB 3HUJF 1KLGA 3H3PH 3VD5A 3MNWB 5FO9B 5B39A 1X6NA 1JUFA 5FUCC 1ZHKA 4ZFFA 1OT1A 1DLFL 5T5NF 4GS7C 3ELAT 4XPGH 2CXKA 3Q1SL 2DQGL 4EUPH 5LQBL 4PJXB 3B9VA 3MJ8A 1CE1H 2RGSA 3U83A 1F3DJ 1BBJA 3GSXB 3AC0A 3PL6D 3WIFA 2E8ZA 4WRLA 2FLRT 3MV9E 4F2MB 3GMOA 4JRXE 4EDXB 3QH3B 5D7JC 4RFEA 3WS6A 3HI6L 4P46C 5DK0B 5KVDH 4XHJC 1U8PA 5E2WL 4OUUA 3MR9A 3P73B 1JTOA 5ISZE 1JHTA 1SHMA 3WS3A 5L2JB 1IEBB 1NCWL 3UTPE 5A16B 5TPWH 1A1OB 3CK0H 3O41A 3AY4A 4OCRH 4X5WB 3RWCB 3MJ6A 2R2HA 4YXLH 3IS0X 2QR0B 3LCYA 1WZKA 1ZV5A 2EEDA 2IAMC 3OR7A 3WNMA 5JPMB 4YXHH 4NQCD 1F58L 1KPRB 1J1OH 4JDTH 3KYMB 2IANB 3VE0B 1AD0B 4O4YH 1JPTH 3LS4H 5E9DE 1IFHL 5JHLH 4XVTL 2WANA 4N0RA 1FYTA 4P57A 1S5IH 4WV1B 4UT7H 5I1DB 7FABL 4XT1C 5JR1H 3TNMA 2YS4A 1CIUA 4HIXL 5HHNA 3VFTB 3WIIH 1OM3L 3N1MC 4UAOC 3O3AB 4NN6C 1E6JL 3NH7L 1YMMB 3VFWB 3NCCB 3MNZB 1IGJA 2D7OA 5JQ6H 1L7IL 2OR8A 1GXEA 2R1XB 2UWEF 1RFDH 2AQ2A 2NZ9C 5T3XL 4KKBC 5CSGA 3X12A 2H2SC 3JVGA 4FMKA 1Y6NR 4K94C 3GI9L 3TBSA 3GIZH 4OKVA 1KJ2H 2X4OA 1T1YA 2Y36L 3PHOA 2W9EH 4Y2DC 2JK5B 3CC5B 4L4VE 4JO3L 2P4AB 2HMID 4Z78A 3O9WD 1U8QA 3IDGB 2B7DT 2I9LA 3KJ6H 1XF5A 1JNHB 2GSGA 3L5IA 3GM8A 1XF2A 1KJMB 2YK1L 4X4XA 2UVFA 4AL8L 3PGFL 4XNYL 3ULVC 1N8ZB 3AAZB 3MRDB 3FRUB 2DQJH 3BP4B 5DUPL 4G6JH 1AXTL 5A2JH 4KFZC 2XN9E 3IDNA 2VQ1B 5GXBB 1QFWM 5AWNH 4YNYA 1RZKC 1QFWI 1QSEB 3PL6A 1R5VB 5D70H 5D9SA 1C5BL 2CDEA 1MNUH 1ADQH 1WFOA 4IDLA 3KPPB 3TWCH 5D2LA 4M6OH 3OGCA 1EERB 5IB1A 3GMPB 1K4DB 1YPZE 3MO1A 1WZ1L 5DURD 1RURL 2FJFA 2H2SD 3ABZA 1RVFH 2ZZUT 4PB0H 2I9TB 3NIFF 2BP3A 1DVFB 1FL5A 4LLVA 1G0YR 4P5KB 3OZ9H 2HKFH 4FG6D 2ARJA 4Y2DD 2ZPKL 1ORSB 5HVWA 1BFVH 4TULH 1T20A 2GIYA 1VESA 5JMOC 4I2XE 2IG2L 1YMHA 3OHXB 4MAUL 4FQHB 3HNTH 4ZO9A 2ZSWB 2CK0H 2WP3T 3DV4B 3ULVD 1AGCA 4MJ2A 2CDGB 1FL3A 1BFOB 1YJDH 1FZKA 5DEGB 3SN6N 4JVWA 1UB6A 5GZOC 1KN4L 4QTIL 5FYLE 2QQNL 2R9HC 1A7PL 4I3SH 1A4JB 4OD3L 3QNZA 2VERN 4NM8H 5IVOA 5SWSD 3WJLC 3QRFM 3C8DA 4P5TC 2GK0B 3U30C 5EB9A 1HXMA 1MCFA 4PJCE 4JY5L 5BJTA 4HPOH 1QFUL 3HE6B 2YR3A 3W5MA 3D87B 1JK8B 3GSUB 3GMMA 4OLZL 1Q1JH 5IIEA 3ZL4L 1FE8L 3FAWA 1CLCA 1UA6L 4JQIL 2EDTA 3UTQA 2BFVH 3D39A 3O9WA 3WO4C 5ERWB 3HR6A 3JTSB 5A40E 3S37L 1F2QA 5C0NC 3RIAF 2A6IB 2P44B 5H94B 2IAMA 3GBMH 2AJUL 2D0GA 1BJMA 1OL0A 1NH6A 4JO2L 3BKMH 4NNXB 1MH5A 1IC1A 4Z7VA 5IJVB 3U4EB 1TTUA 3TT1L 2WLYA 3TT3H 3D85D 1KGCE 2VIRB 1PAMA 2ZCLH 1EEUA 3HFMH 3S9DB 2HRPL 4JAMA 5JOPE 4O58H 2XTJD 1HOCA 4NUGL 4YDIL 3L7FA 5D7IE 4G7VL 4XP1H 4GH7B 5A3IC 4CVZA 3VD4A 1LMKA 4O51B 3DX8A 3BJ91 2DWEA 2X4QB 4GG6A 3INUH 4KK8C 4KKAC 2NX5D 1HNFA 2AK4B 4E5XA 1YEGL 3FQNB 3QO1A 2BHUA 3HCVB 4FFZH 2VXQH 1S9VA 1GZQB 2YD9A 5CBEB 2DQEL 3LOWA 5J9PA 4N8VG 2FX7H 2DIBA 3MFFA 3H9SD 2C1PB 4GAYA 3C6SB 4Y2DA 1ITCA 3THMH 2AQ1A 5FKAA 3VXPB 3QNYA 4JREC 1IL1A 1P7KA 1EAJA 4NN7C 4ETQA 4UUJB 2JCCE 2HLFC 1B2WL 5CIPH 3DGGA 3LKQB 3PDDA 1MLCB 3SQOH 1PEZA 4FXLA 1O7VA 4M5YH 4EI5C 2EEBA 4OGXH 4CU8A 1EXUA 3OX8B 3OKEA 2CUIA 2AXJA 1JVKA 4R0LB 2AEQH 5TDNA 4Z8FH 1NAKL 3EFFB 4IRZH 1IT9H 5SWSA 4LARH 4L8SA 1F4WH 3BKYL 3D18A 4LKCB 2PTUA 4H1LB 5IB2B 4Q58C 1HKLH 2IBZX 4W6YB 3X3FH 4KKAD 3UJJL 2EDYA 4WTXA 3Q3GA 4ZS7L 4M3JA 1QVOB 5DD0H 1FJ1B 3MODL 2I24N 2OS7A 4HF5L 2HP4A 4JG1L 5F72S 1CFQA 5LJYH 1TZHA 5E2TH 1FORL 2YPLE 1TXKA 4G5ZL 4GW1B 1ZLUK 3TH4T 3FTGA 4F57L 1CTNA 1T1ZB 3V0WH 1M71B 3QFDB 2LFGA 3ZDYE 5GGRB 1J12A 4QRRE 3D0LA 1K8DB 1XGRA 5E5MA 4J1UB 1CU4H 4JFXA 1C8PA 1EHAA 1K3ZA 4UTAL 2YD4A 2ZOKB 3D2UB 3D85A 4AY0A 4ALAH 3MXWH 5DHXB 5KJRH 1LE5A 5C71A 2OL3A 4PJEE 5M94B 1EO8H 4MXQD 1U6AL 3TIEA 2YA2A 3BWAB 1MHCA 4KI1A 3V6BR 6CGTA 3S3PA 1MRFL 5IFJB 1HZHL 1ITBB 2NX5A 3VFUA 3WJLA 2PUQT 3P9MB 2BY1A 2PN5A 1UM6H 1NCCH 4J3SA 4HXBH 3U7AA 1FBIH 2BVOA 4U1SA 2YRLA 3VFSB 1G7PA 3RDTC 3V79C 1U8HB 1JZ5A 4KVNL 4X8JA 2GAZA 3H9SA 1ZHLA 2DQHH 1WCBA 4XPHH 5CZVL 5I75C 2ZOLA 5GS2D 4LMQE 5IW3A 3NFSL 5KANI 5K9KA 1OGAB 2OZ4A 2FNBA 1V5JA 3C87A 3MGTB 3HZYB 3G5XA 5IROC 5EZIH 5GRUL 2X9WA 1J0YA 2WINA 5CINH 1ZWIB 1MPAL 5B38G 5IM7A 4Z7WE 5KSBF 5C9JB 3MV01 2N7BA 5C6PB 1T22B 1NGWB 1SYVB 4XBEL 5E7BA 4PGEB 1PJ9A 5IHUL 5GQBA 4HCRH 3BP6A 3LD8C 1ZEAH 4NC2B 1NMBL 4HG4J 3QQ3B 4NFDA 1EVTC 4TNWK 4MX7A 3BDBA 2VMFA 1K4CA 4AG4H 1LO2H 1U93B 3K46A 3P0GB 4P99A 4XCCL 2BVYA 1QNZH 4XTRD 3BP5A 3H6JA 2VLKB 5DQ9A 4M93B 5BZWB 3DX7A 5E56A 4NC1E 3TGXA 2HWZL 5CAYB 4CL7A 4LSSH 4PJFB 4NWUL 3EYVA 5CJOL 1MIEL 2DTML 4FQXB 4HS6A 4D0BB 5I1EL 4RGOL 4NP4L 4PJ7A 3QCVH 1MWAB 4MB3A 4ENED 3LB6C 3V5KB 3DI2B 3O4LA 4XPAH 3RNQA 4OIBA 3Q6GL 1BVZA 1NLDL 4FQIH 4PJAF 2IPKB 3QWRD 4XH2B 4Y5XB 1NEUA 1NJ9A 1U8LB 3PV6B 3O2DH 3LIZL 3RJDA 2AJVH 2X10A 3LDBB 4TVPD 5HGBB 4OI8A 4N8VA 3VWKC 4ZFZA 3OXSA 4K94L 2HFGH 5HYJD 4KTDL 1Q9OB 5GGQL 5DJCA 3O81A 1I8LC 2EE2A 4PRBA 4RAUA 4DFHA 2QKIA 1NL0H 4ZDHA 3CCHB 3ZDXF 1KXVC 2C4FT 3VI3E 1DJSA 5MERA 1YYLL 3B5GA 2H3NA 2UYLB 3BWUC 3BGMA 2ORBL 3JV4A 4NRXA 2WUBH 4JM2D 3ULVL 1G0XA 4UBDC 3RKPA 2APFA 5DFWH 3MV8B 3QEUA 2X44D 4XMPH 1ZK9A 4MGXA 4Y16C 1I7TB 3BDYL 4K7FA 3ZE2F 1N2RA 3KHQA 1RZKL 15C8L 3ZYJA 3OAZK 2Q7NA 3O4OC 5EU5B 4OF8A 1AGBA 1P2CB 4V1DA 5DFTA 5F21B 2P5WE 3PJSB 4S1RL 2CLZA 5HGHB 1NFIA 4PJHE 3ZTNH 1SVZA 2X89D 4HW6A 4JFDD 1I7RA 4KJPC 3EYUL 3QWOA 3NFNA 5E6ID 1A6VH 4XAWH 1A4KA 3UTOA 3DUHA 4U05A 3F12A 3GI8H 5H2BB 2FB4H 1MHEB 3VWKD 5C0RH 1CD1B 2DQUH 4HKJA 1SY6A 3HUJE 1FZOA 5C2BH 1HHHA 4CMHB 1BD2D 3ZO0A 4HGMA 4PLKD 4YDLC 4EUPG 3GBNH 4WGWB 4NBZB 5C0IB 3LEYL 4P3DA 4WEBL 5GSRA 1AC0A 3LEXB 4RMQA 3GBLA 5E5UB 3UC0L 2B0SL 4JO4H 1F11B 4QOKE 1W72B 3F7YA 1RJZA 4OCWL 4OCMC 1TQBC 1JNLL 2J5LC 4UBDD 3T8XA 1KXQE 3I2CH 3Q6FA 1HNGA 2XY1A 4QRPE 3VXQB 3D6GA 2VLRD 2G75B 4Y1AE 3OKKA 1OHQA 1QEWB 3L5XH 4NQSB 1LD9B 5I9QB 4M6MH 4PP2A 4OZFA 3RWEB 5IROA 3KLDA 5HSFA 4MCYA 3L95A 3O3EB 5JXAH 2YMXL 1P4IH 5EFIB 1I3RB 1MCNA 3GSRB 4G8GE 4QHLB 3LMJH 3S98A 4AEHL 1J1PL 5F93C 3ZLQC 4R4ND 5ABDE 3B43A 3O45A 4U3XA 3H3BC 5T1DH 3CDFA 4X6EB 1KTLA 2LAAA 4P23D 4ZXBC 2FCBA 4LGPB 3CVHA 4W6XB 4JM4H 1S9YA 4FQQA 3QYCA 1GC1C 1RK0A 1X4ZA 4CW1A 4BKLB 2EDXA 3EYSL 4ORZC 1F3RB 2OZ4L 3RX7A 4RFOL 3PDGA 1WWWX 3WKNA 3QNXA 4LSVH 1PKQB 1CZ8L 3RKDC 3TP4A 3QG7H 4PG2C 4WHCA 3FQWA 1ZSDB 4JM2A 1FV1B 4LCUA 3FT2B 4O9HH 1WIUA 2AERT 3DXAE 5AAMA 4Z7OE 4K3JL 3HC3L 5M95B 3A67L 4IIQC 1S7UA 3JUYA 5GGSA 1FFOB 1JN6B 3U36A 4K7PY 1AP2B 5GSVA 4B0MM 3BEVB 2Q87A 2UWEE 1H8NA 3PWVA 3KWWA 1QACA 3NIDF 3QUYC 2HVJB 3T1FA 1FNFA 3S36L 5GRJH 4GW4A 4GKSB 1MELA 4JFDA 4D9RD 4DGIH 4KMLB 5E6IA 1VDGA 1FDLL 1HE7A 3R8BB 3QXAA 1MCJA 3DTXB 3VWKA 2YXFA 3WDIA 1FG2A 1A9EA 4ZXBD 3R06A 1RI8A 5I19H 3DBXA 2HN7B 4TQEH 4M8VA 1BD2A 3BPCA 1UVQA 3IDJA 4OSUH 4MJ5B 3QQ9C 4FFYH 4KXZH 1PQZA 2ED7A 2Y25A 1R5WA 3U1SH 3PE9A 1F6AB 2H32B 4XCEA 1XGQA 3EZ8A 3L1OH 3VFPA 1HYRC 5BVJB 2GJ6B 4G7YL 5HYQB 1MJ7H 4M43H 5F1KC 5F3BB 4J8RB 1NFDE 2EDFA 1AY1H 1A3RH 1S7WB 1INQA 2EXYD 4Q6IC 4Y5VB 5IW6A 3MOAL 3P30L 1PX3A 5LXGL 3EZJB 4LSUL 4S1SH 5I8KL 1I9IH 4PLJD 2ZJSH 4DCQA 4PGDB 2FGWL 3T3PF 4BFIA 4CU6A 5JA9A 4N5EC 2LV4A 4WI2A 1KNOB 3VH8G 4MMZC 3QEGL 3K2UL 3O11A 5D8JH 4P23A 4I3RL 1RJLB 1E4XH 3IDYB 4J7RA 3GZKA 4LVHB 4RRPA 3OKLA 1RHFA 3VRLF 1EZVY 3V7AE 4MZ3A 1EGJH 4NJAH 5E2UH 1BVLA 2I27N 5F6HI 5D6DC 3DYPA 3W0WD 2CKBH 5DJ2A 5GS1B 3ZKSD 3VXOA 1QSZA 2NNAA 3QQ9D 1BFTA 4LOUC 2CMRH 4NHCL 2F58H 4MA8H 1JPSL 3LZFH 4FQ1H 3LSOA 1U8NA 1DUZB 2LU3A 3V6OE 1C5CL 4M6NH 2PYFA 1MJUL 2DJUA 1QHPA 3TA3B 5IEHA 1SY6L 1I1AB 3MYJA 1W8OA 4EUPA 1YJDC 2B1AL 3G6AA 2FX9H 3U7WL 4NUJA 5I17A 5IB4A 3MRMB 2DQTL 1OAQH 5GGVY 4R2GC 4WUUE 4N0UB 4DZBB 4F7EB 1IEAA 3B9EA 4QF1B 3VXRB 2Q7YA 5D2NB 1SYSA 1AO7D 4MWFA 1T83C 3EJJX 5J6HA 2V7NA 3LY6A 1KCKA 1F8TH 2G2RA 4F37K 3V0AC 4ZXBA 3C8KA 1TENA 5DJDA 1JWUB 2ZCKL 3FQXB 5BZDB 1ZS8B 1IM3A 1UWXK 4U1IA 1A64A 5D2LF 3GUTA 1A3QA 1BOYA 5J7CC 1SVCP 1OGTA 4TUKH 4PJ9C 3HMXH 1NCNA 1T4KA 3LN9A 2UVEA 5DJ0A 2ZP0T 3QEQB 2P8LB 4PG9B 3L5JA 5FA3B 4EEEA 4GAFB 5KSAB 2JLLA 1J0JA 3SDCC 5HHQA 3EO1B 3CVHL 3ZHDA 1UEMA 3WFCL 3MV9B 4JFZH 5ESVA 4HHAA 4AZ8A 1JF1A 4IIQA 4WCYL 5EG6C 3VXNA 4JRXB 5EOQH 3F58L 4ONFH 5DSCA 1MCWM 4PGBA 5I1KL 1A1MA 4TSCL 3UZQA 3N1QC 3BZFA 5C3TA 5HI3D 2VAAA 3P4MB 4HK0A 4IRJC 4HIEB 1DQMH 3LKPA 4NPYB 3QUYA 2Y5EA 2R1YA 2AI0L 2XPGA 4MLIA 5KSVB 4R2GD 4FTVB 4UT6H 1EH9A 1ZT1A 4H25B 1G6RH 5IMLB 2Q8AL 4EN3B 2E6QA 2W60A 2ZSVB 1P9MC 4KHXH 2J12B 2X4TB 2J8UA 5JDSB 5TE6L 4FFVC 5DQDL 4NZDA 4I0CC 1RPQA 2H8PB 4HMCA 5I76A 2RCSL 1XCTB 1KJ2A 1RUAL 3ZMRA 3W0WA 2X4UB 2EC8A 3CSYA 3PWPE 4N0FB 4RAVB 3SBWC 4K3DH 4Z95L 3KPSE 1QBLH 2VXUL 3HI1A 1L9NA 4PJ9D 4GRMA 3WD5L 1OW0C 5EU3B 2Z31C 4JG0H 2IADA 2BNRE 4P4KD 2A1WL 3OJDB 5EU6D 3SDCD 4JRYD 3U2SA 4YR6B 4I9WE 4ZUUA 4Q6IA 1JV5B 2ATPB 3ILQC 2Y5TB 1MFCL 2Z91B 1WFNA 1YEEL 2FECI 5IFHL 2BSRB 4XZUA 3QDGD 3QUKB 1H9VA 3H9HA 3MRFA 4TTDD 4MA7H 4P2RD 1DBML 3SKNB 1FLTX 2X4NA 4Z7VF 1KEGH 1DBKH 1ADQA 1QPXA 3NA9L 5IBUG 3SCMC 4JANA 1AO7A 2FIKB 2DMCA 1JF5A 4L4VB 5DD5H 1TTFA 3RVUD 3NIGE 1BQSA 1ES0A 4L9DA 3TIDB 4QT5A 3FO9B 4DKEL 1FFPA 3MRHB 3K1DA 1A7OL 2VXSL 1LO3H 3RI5F 2E7BA 1WEJH 4JHAL 3MRIB 4XI5D 4WEUD 1GSMA 5KVFL 5SWQB 2D7TL 4HH8A 3EOBA 2WZPD 1BAFH 4GG6F 4JFFB 4ZPVA 4DGYH 3BRFA 1JPFB 5D6DA 1AR2A 3VH8A 3T0ED 1W0WA 1BOGB 5D7KE 5HXMA 1D5ZA 1S5HB 3DETC 2B39A 2VLMD 1U8KA 4KJYB 3ARED 2XA8H 5FK9B 3LN5A 2H2PD 3UPRA 3VGHA 2AKRB 2J88L 1NC2D 1WICA 3KR3L 3S35L 4EIGB 2YA1A 4OT1H 4ZFGL 1KIUA 5I1AA 3O8XC 4FQ2H 2B1HH 1YDPA 4HDIA 4OI9A 1CR9L 4XMKL 4NO2A 4KK5C 4U1KB 3KNBA 4XRCA 3ARBD 1T7ZA 3MBXH 4BK5A 3NN8A 3SDXB 2V2TA 1GHFL 2IQAB 2XFXB 3MUJA 1EBPA 3ULVF 3I75B 4HV8A 1AGDB 3BQUD 3H3PL 2VITB 3KLAA 1M6OA 1A7NH 5MEPB 3VXSE 3ARDC 1QA9B 1DFBH 4OF7A 4PRHD 5ADPH 5I30L 4XPGL 2IQ9H 5J8OA 4N68A 2GITA 2HJFA 5FA4B 5JXED 4M7JH 1I85C 1JNNH 2PCPA 2OX5A 4PJ5A 2LTQC 4YHPB 3B5HA 2LQRA 4IRSB 1A6ZB 2YD1A 4PJ9A 1T21A 4ZNEE 4P49A 4D8PB 2M2DA 2SEBA 2D9QB 3MJ9L 3RL1B 4DQOH 4BQ9A 3DETD 5TGBA 1I1FB 1HILB 3KXFD 1MEXL 5HVGB 3NCYS 5SX4I 4HFUH 5EU6A 3SDCA 4JRYA 3FQUB 5FYKE 1RK1A 1T04A 3QDJD 4X6CE 4OFPA 1GC1L 2R23B 4HLZH 2ADIA 4YHMH 5C0JB 4OCYH 3QDGA 2PYEB 1MVUA 3VRIA 5GRWA 2NTFB 4OCRL 3IXAA 2BOCA 1P84K 4GG8A 4KK5D 4IRJA 4YXLL 5D1QB 3OXRB 4PJ8C 4Q9RH 3LKRA 5C0AE 2BY2A 1JMZA 3WLWC 4OKDA 4YDVB 1L9MA 3T1WA 3EYFB 1JPTL 1SBSL 3LS4L 4K23L 4FABH 4YK4B 3RUGF 2CLRA 1JGVL 4NDMB 4U1MB 5DS8A 4F8TA 3L7EB 1DQLH 4OD1H 3VCLA 5IUSA 1S5IL 2DQIH 3QEHA 1GPOL 3FO0H 3G5YB 4UT7L 3GB7A 5JR1L 5DUMH 1D6EB 4RIRA 3T0EA 3DLQR 3WIIL 2H9GA 3AREA 5EBLB 3CIQA 5IESH 3I3BA 5JQ6L 1JHKH 5ICZA 1HN1A 2ZUQC 1OW0A 4NQDD 2Z31A 3BIKB 3RWDA 1DE4B 4DUVA 3BMVA 2E7HA 2ITDB 2V17H 4LSTH 5CIPA 4YIQA 4RA3A 2GHWB 2V9QA 2WBJD 3P0VH 5C86A 4K7PL 5IB3A 4XPFH 4WWKC 1KJ2L 1VEMA 5JA8B 3WXWL 2W9EL 3H0TA 4X6FB 1DBBL 3VGGA 1GH7A 3EDKA 1U42A 1OAKH 4M7LT 3KLSA 4KI5C 5CEXB 5LCVH 1HSAB 3VGDA 5C0CA 3GGWA 2VL5A 2IC2A 3LPFA 3W39A 1HHKB 3HLAA 4PRHA 2DQJL 1BBDH 4WIQA 4Y4KB 2NY2B 4MJ4A 5JXEA 3U0TB 2OTWB 5T3XE 3WFHB 1T2QH 4MNGE 2E8YA 5B4MD 3T09A 1T2XA 5T1LD 3C6LB 2VSCA 4P59H 1MNUL 1ADQL 4U4BA 1ED3A 1RU9H 2UZYB 3KXFA 2DYPB 4YDJA 5JHDD 2JB6B 2PR4H 4L4TE 3QG6A 5ID0A 4CMMA 2BCKB 2NY6B 3QDJA 4PJ7F 2IMNA 1B0RB 2AJYH 3BD3A 4G6MH 5FHBL 2K1MA 1JZ8A 1Q72H 4OD2A 4P2QD 3QXUA 5DMGC 5KVMC 3ZSTA 4NNYA 4OZIA 3CFJA 1OOAA 1V7MH 3QIBC 2V5TA 3BW9A 4WWKD 5D7LE 2HKFL 4MVBC 2Q3ZA 5KAQF 4L9LB 2Y06H 2RFXA 4R4FH 1BFVL 4TULL 4PS4H 3RZCC 1BQHB 3N1FC 3F7VA 4QGYA 5J57B 4D0CB 3QUZD 1NQBA 2X4RB 4NKOB 5E08L 1JGDB 5HYIA 3UTSE 3BMWA 1HHJA 5HYSG 1B88A 3QO0B 3PQYE 2APTA 3WFBH 4F15B 2A73A 5EDXA 1Q9WB 1YJDL 4QRRB 3P3YA 1I85A 1Q9KA 1IAOB 2IGFH 3VFNA 5C0BB 1MQ8A 4NM4H 4NM8L 4NQDA 4GQ9H 4MJIE 1X9QA 3F5WB 1QBBA 5GRVK 4WU5A 1YN6A 4PJEB 3RGVC 2DQCH 3AMLA 2WBJA 4K8RH 5IOPB 3RVTC 3MRGA 5J1TC 4HPOL 4GRWF 3DUSB 3L3IB 4BSJA 5HI5C 3JWDC 3VXMD 3J7HA 3HI5H 2BFVL 2ZG2A 1T1XB 2VWEC 3LPGA 5J11B 3G04B 4HCRA 5D71L 5EO0B 1BZ7A 3DUUA 5GGVL 2CUHA 5CD5D 4OF6A 3H9YA 4RFNC 5DJ8B 3OB0H 5F7MC 2FWOA 4WFFE 1XFPA 3QJHA 4QHUB 3RZCD 3BKML 5HPMA 2VLJE 5E8DL 2I60L 5C6TH 3MQIA 2GK2A 1HWHB 3NCYP 4O2EB 1DQQA 3TT3L 5EA0H 2HG5A 2ZCLL 3CFDA 5K59E 1IC5L 5MEQA 1RZGB 4L3CA 4G6AD 3W9DA 4LQ1A 3QWQB 2GYSA 2Z9TA 4GBXC 1OLZA 2VH5H 4HS3A 5JHDA 3T0BA 2HAZA 3UBXA 2J6EH 2ZUTA 1CXLA 1NUGA 2PTTB 1KENL 5H37G 2FR4B 2J1KA 3WBDA 5T5FH 5EBMA 3P4NB 5INDB 3FB6A 2K3TA 4CVXA 1PW3A 2VE6A 3O2DA 3BH9B 4FFZL 4P2QA 2VXQL 4AIOA 4ZUWA 1OF2A 1S7TA 1N3NA 5IGXH 3MJ7A 2FX7L 4WWKA 3IFOB 3ROOA 4MAYC 2VL4A 5JIIA 2IFFH 4Z76A 1UXSA 3HZMA 3WUZA 3THML 1HQ4B 1YNTB 3HNVH 3EO9H 2XTLA 4OLWH 3DIFB 3QUZA 1NC4B 5F9WC 1UQSA 3HKFA 5EZLA 5DZOA 4C55A 3SQOL 3TBTA 1C08A 3T3PE 1V3JA 5EU7C 4M5YL 1ND0B 4Q2ZA 4K3HA 2VKXA 3CXDH 1FYTE 1D6VH 1EAPB 1JGLH 2VZ1A 2AEQL 4UILH 3STBA 3IJYA 1NUNB 1IT9L 4UNTA 4AM0B 5DMKB 4MA3B 2DI9A 1OWRM 2AGJH 1X6LA 2EDJA 4LARL 3VRLE 1AGFB 1M4KA 1YEKH 5I6XC 3IKCB 4IJ3C 4Q9QH 1FYHB 3ULUD 2GSIB 1NMCC 4UU9B 2AJSH 2NY5H 2IBZY 4HAFA 3VXMA 2ATKA 1B9ZA 4NKIH 2P5ED 4OZHA 5JO5B 1NDGB 3DMMB 4TUOB 3QIBA 5AEAA 5E8EA 4UDTA 5IJKC 3VG9C 5KTEH 3AS0A 4I0PC 1OPGL 4YO0A 1U8OA 4JJHA 3D69B 4OQ1A 3RZCA 4D94A 1L6ZA 3CD4A 3SE8H 3V0VA 3RUGB 2C3WA 4FS0A 2NW3A 2Q76A 4MQSB 3RVWC 1JJUA 2A6JA 3HNSL 4ALAL 3MXWL 3RWHB 4DTGH 2R4RH 3T77B 3TZVB 5FUOL 1GZPB 2VOTA 4TSAL 3VDBA 4UIKL 1TVDA 4JR9H 2N56A 2W92A 5D7SL 2ZUUA 5BRZA 4HIIA 5I1CL 2VDNH 5DRZB 2OR7A 1ZLSH 2A77H 1NGXA 3VFMA 1UM6L 2IBGA 3RIAK 2X09A 4NQVB 5HYSA 2CLVB 2GJZA 1MCQA 5EZOL 1C12B 4HXBL 1FBIL 2R29H 1XIWD 5LAXA 2B5IC 1PEWA 2VQUA 2DQHL 3ARXA 2CPCA 3H42H 4PD4K 4QOKB 2OYPA 2JJSC 2DQFB 2R8SL 3C2SA 3BESR 3BO8A 4QRPB 2J7LA 2EXWC 5EN2B 3SDAB 4XPBL 5CINL 3DECA 1S8DA 3CFIC 4X7TA 5KSUA 2FYYB 4JZOB 3P4OB 3CH1B 1N5YL 1GGCH 4P9MH 4RNRA 5BCAA 1ZVHA 1VHPA 2VO5A 2EH7H 2F5BH 4G8GB 5HTSA 5LGJB 1QKZH 4HCRL 2XWJA 3UTTB 1I8KA 2ESVD 1JPGA 1F4AA 1XGPB 1KFAL 3IU4L 2A0LC 1Q9LA 4DAGL 2VDML 1LO2L 2EKSB 4GBXA 2IMMA 3RVVD 1SEBB 2GTWA 4LLMA 1BQUA 3U79A 1T89C 3RWGA 1QQDB 4Y4HC 1R3IL 3F6LA 3A6CL 3QSKB 4KRNA 4RCAA 4ZD3L 1RULH 5LBSH 2P5EA 3CH8A 3HC0B 2MFNA 4JFYB 3QCVL 3DXAB 3G5VA 3GKZA 4H88H 3RTQB 1AH1A 4OTXH 3T2PA 1II4E 3D39E 3TBWB 4QXGH 1E6OL 3H2WA 2FO4A 1HEZB 1SEQL 4G6FD 4XVSH 3O2DL 3U4BH 2ADJB 2OLDA 5IW1B 4NO0D 3L3OA 1ACZA 4DZ8A 4XMLH 2ED8A 1N0XL 4KRPB 4N5UA 3SKOA 5I8CB 1IAKB 1FNSL 2IJ0C 3DX6B 1VGKB 4LP5A 1L6XA 3IFNH 1NL0L 5D93C 1J88A 4HUVA 2MPAL 4LQFH 3VD7A 2WK2A 5EUOA 3E3QC 4RMRA 4F3FA 3NMEA 2WUBL 4WW2F 4KROD 1JYXA 5FDYA 4RMUA 1CG9A 1CT8B 1XIWA 4HWUA 2RJMA 4XMPL 4HGWA 1QLFB 4CGTA 4YUEL 3V4PH 4URTB 1EX0A 4ELMA 1U58A 2AXFB 1UB5B 3RY6C 3QQNA 4MCZA 5C0DA 3TBYA 4YXKH 3U6RB 1NFDB 1EGJA 3AS1A 3FB5B 1V3LA 2XN9D 4OB5L 5F1NA 3ES6A 1J1XH 4F33A 5BXFB 4I0PA 2CKBA 2VR5A 5DUBA 5DK2B 3ZTNL 3PV7A 5AZ2H 4YBLB 5JOFB 2J8UF 3O2WH 3ROLB 1B0WA 4XAWL 3GI8L 3BD5A 2C7UB 4IOIA 4RQQA 5T1KB 1JHLH 3ULVE 5C0RL 5F7EL 2DQUL 4JPIB 3BPNB 4RGNB 2ESVA 1UKSA 3E8UH 1EO5A 1WWCA 5AD0B 1CICC 1N6QH 1HCVA 4F80A 1TCRA 4KV5E 1G7JA 3GBNL 4Z77B 2W0FA 5CZXC 3HRZB 4MNHB 5DJAB 3I6KB 3C5JA 3E2HB 3ULSB 5TFSH 5C07B 1Z6JT 4MNQA 4GUPB 1KIPB 5FOBB 1H15A 4O00A 5SWSE 2X4PB 4X6DB 3AGVA 2CGRH 3FN3A 2ICEB 3MCG1 3BPLC 1I1CA 3I2CL 4Z5RB 4I18A 4IM8A 3HZVB 3L5XL 4HLZG 3O3UN 2IH1B 2NY0B 2HFFA 5EO1B 2EDOA 4M6ML 1AXSB 1OQOA 3HMXA 4ZQKA 4ZUTB 1W72H 4HSQA 1WBYB 3LMJL 4HK3N 5L0QB 4NO0A 3BSZL 1W0YT 4LF3A 4WUUB 2VAJA 4OF5A 3PP4H 4JM4L 4BK4A 1A21A 5GRYA 3JWDL 1KCUH 4NOFA 3UTZA 1G9MC 4UDUB 3AXLB 1BM3H 4PUBH 1EHLH 2OK0L 1QOKA 3ARGD 1DBAH 1M7DA 3ALPA 3S4SB 3IDIB 4LSVL 2VDPH 1CICD 3FB7A 3QIUD 1RHHA 3QG7L 2O5YH 2FD6H 1CE6A 3PWNA 1EFXD 1QZ1A 1N4XH 1RZ8B 4IDJL 1ZHBB 4WI7A 1NEZB 3PWUA 1G6RA 4OLVH 2XICA 2NX5E 3BHBA 3QUXB 3L3HA 2JJUA 3KPOA 4LASL 3E6FB 3MRRA 4ODVL 2NY3B 3IDXL 1GL4B 2E6PA 1IAIH 3H9SE 1FNGA 2VXTH 5C0FA 4WHTA 1OAZH 1BX2A 4WUKL 3WL9B 2R56L 3TO2B 1A7RH 2P1YA 4WENB 3VWJD 4DGIL 3VFGH 2I07B 5FYKU 3B3IA 5MEOA 1NCBH 2OCFD 3NABH 1U91B 4O2CB 4D9QD 4WV1C 2APBA 2BMKA 5I19L 4TQEL 1S7RB 1CXHA 4HFWA 4A6YH 4OSUL 5D5MB 4QRTA 4FFYL 2JELL 5FKPB 4E41B 1CFNA 3U1SL 5HJ3A 3FQRA 2X70B 3L1OL 3VG0H 3UO1H 3EDFA 2UZXB 3X11A 1MJ7L 3ARFB 3PWPB 1KC5H 4Z6AT 2K7PA 3QFJB 4C4KO 3EAKA 3N0PB 5L2KA 1CVRA 2VZUA 35C8L 2QEJA 5SWZB 2GT9A 4O2FB 3D48R 4G9FD 5ICXA 4S1SL 3RY6A 4NHUA 1MCDA 3TV3L 3GRWL 2ZJSL 3FFCB 4RMVA 1J8HD 2H32H 4PJ7E 4F9PC 2O61B 1I9RL 4LDOB 4P3WA 4MDJA 4JN2A 3B2VH 2OJEB 2R0LL 4P3CH 1LGVA 2OMBA 2AV1B 1IM9D 3HR5B 4IMLA 4D2NA 3V95A 3O4LE 4I4WA 3NAAH 1FFNB 4BQ8A 1TDQA 1QLRA 5K9JL 1IGYB 1MQKH 4HBCH 4X7SH 1OTTC 3ARGA 4M4PA 1FP5A 1EGJL 2BOBA 1U92B 2HJKB 1FVEA 4H0HB 3OKNA 1CICA 2CKBL 3MREA 4XCNB 5IHZA 5DJYB 5HGGS 1YNKH 2YPLD 4HD9A 5DRNB 43CAA 1EFXA 3QUML 4WJ5B 4S11A 1KCVH 2XZQH 4MA8L 3LZFL 1ZHNA 5EC2B 1BMGA 1L7TH 4NN5B 2VDRH 2DD8H 3OR6A 1GGTA 4M6NL 1TVBB 1MUJB 4HKBB 2Y07L 4L29B 2MKLC 5C08B 1DVFC 1GGYA 1XCQA 3NVQA 3TEUA 1TJGH 1BWMA 3DI3B 4F7MB 1OAQL 4B53A 3Q1SH 1YNLL 2DQGH 5B3JF 4H8WC 1W2KT 1OP9A 4G8FB 4JGMA 3MRNB 4Z7UA 5ALCH 4ZSOA 4JFOB 3VWJA 3MNWA 4WFGD 5FO9A 2FSEB 4X5LA 3ZTJH 1RIUL 5F71A 1FNLA 3C60B 4ONGH 2VYRE 4S1DC 4P2CG 4K8RC 1D5BB 1F8TL 1SJVA 1GGIL 4GXUM 4PJXA 5D72L 3RZWA 3PDOA 1WLHA 3QAZB 3GSXA 1BGXL 4TUKL 4X0KA 3HMXL 4F2MA 3RFZC 1K8IB 1VSCA 4WW2B 1YEJH 1CWVA 1PX4A 4EDXA 2R39A 3QH3A 4WVRA 1JYWA 2Z35B 1T0NA 1ZA6B 3ZHKA 5K93A 5DK0A 4OZIF 2IF7A 3QPXH 5E00B 5FOJA 3HE6C 4MA1C 3P73A 2HRLA 5L2JA 4PJBF 1F58H 1IEBA 1DBJL 3KG5A 5EOQL 4NIKB 5AG8A 3IJSB 4ONFL 5A16A 5E8PB 3TN0D 1A1OA 3P0YH 4KZEL 4X5WA 3RWCA 1RD6A 1TNMA 1J8HA 2VDLL 1IFHH 1B4JL 2QR0A 1JIBA 1DQML 4X6CB 1J18A 4YHYB 5JPMA 4LEXH 4JLRB 3MCKB 1KPRA 4M8QA 4DK6A 1IM9A 4MD5A 1EEYB 5EOCH 4UT6L 7FABH 2X42A 3KYMA 3T0DA 1G6RL 2IANA 3SE3C 1XEDA 3VE0A 1AD0A 3DPBA 3G6JB 5JPNB 1MFDH 4TVPE 1UJTA 4WV1A 4PIRF 4PRIB 5ID1B 3VFTA 4OCSH 1U2HA 3O3AA 1FGVL 4R97B 3MNZA 4APQD 4HUWB 4XP9H 2R1XA 4NYLA 2OP4H 5IKCB 1PY9A 4JG0L 4QHKJ 4QCIB 4CN6A 2D9CA 4N8CH 2APXA 5GJSH 3GK8H 3UBXI 5T5NG 4Z18A 4H5SB 2PXYB 2YK1H 4JGJA 4AL8H 3EGSB 2JK5A 3CC5A 4XNYH 3QXWA 4JDVA 3IDGA 4KUCF 4JKMA 3WJJC 4MA7L 4CKVX 1AXTH 3SGJC 4JKKA 1KPUB 2W38A 2VKWA 1KEGL 1CFTB 4KZDH 4GKZA 2EC9T 3UJIH 4PGJA 2EDBA 2X4SB 1N8ZA 3MRDA 3WMSA 4JFDE 3IF1B 2QL1A 3ZYOA 4N0CC 4ZAKD 1LO3L 5IV2B 1WEJL 4KC3B 3E0GA 2VQ1A 3AROA 3FOMB 4W4NA 4ZUVB 1BAFL 4R0LC 1R5VA 5D1XB 3RIFF 1N5AB 3PWJB 5E6YA 4DGYL 5CP3H 1QSFB 1RURH 3SDDB 4UIMB 1BD2E 4RZCA 5D1ZB 1VADB 5JDJA 3KPPA 1YY9D 4MZ2A 4MNGB 3RL2B 3S97C 3GMPA 4PJDB 1K4DA 2P5WD 4PV9B 4RAHA 4XWGL 5GGUB 4OT1L 3L3KB 2IEPA 2IG2H 4NNPL 3TN0A 4PB9L 2I9TA 4L4TB 1CGVA 1DVFA 2X9YA 4P5KA 4KI5F 3MBXL 1ORSA 3GEWB 2VLLB 4Y8AA 1BPVA 2AXGB 2NYYC 4HZLB 2XZAH 3C08H 1ZA3A 3UJTL 5EC1A 5TF1H 1T2JA 3OHXA 4J6RL 1LNUB 1DEEB 1JYNA 1WISA 2ZSWA 4KKNA 4QTIH 4HKXB 3DV4A 3UX9B 5ADPL 2D03H 2CDGA 4M1DH 3WE6B 5AYUL 2NTSP 2IQ9L 4YHOL 3L3DA 1BFOA 4M7JL 5DEGA 1CGTA 3LPWA 4APQA 1A1NB 1QFUH 2XG4A 5FDWB 1A4JA 3SGDI 5HHOB 4Y1AD 3ZL4H 2GK0A 3U46A 3WFZA 3JV6B 4QRUA 3S37H 3PGCA 4JQXC 3HE6A 2WWKO 1YQVH 2AJUH 2XG5A 1MF2H 5FCUH 1G9ML 1FVCB 4JO2H 4OCYL 3KPRD 5F7FA 4OBSA 1I75A 2CK2A 5ERWA 3QDMD 4QHMB 4P9HC 3JTSA 4TVSa 1W0VA 5T3ZH 2KH2B 2P7TB 2A6IA 3TT1H 5H94A 1KG0B 4Q9RL 1X5HA 5CKGA 3WN5B 4X4YB 1SJEB 4P2YA 5GRXG 1EUTA 2XXMB 2HRPH 2NYYD 1N6VA 2J6EA 1T3FB 5FFLA 4NNXA 4LPXA 3CSPA 2DLEA 3SE3A 4R4BA 4D9RE 4G7VH 3BE1L 1R3HB 4N9GB 4FABL 1KTDB 4I8DA 5IJVA 4MD4B 3U4EA 1OWWA 1K5NA 4NRZB 3D2UD 1DQLL 4OD1L 2VIRA 5TH2B 1ZAGA 2DQIL 2CRMA 5MENB 1RY7B 2N1KA 1LK2B 4WO4B 4LPCA 2E7CA 5DUML 1YEGH 1KIRB 4WDIB 1K85A 1UKQA 4ODWA 3ALXA 4O51A 2X4QA 2VZTA 3ZKXB 4M93C 3NCJH 2AK4A 1B3JA 1ZTXH 3FQNA 3GMQA 4LSTL 1MCLA 3WSQL 3QXDA 1GZQA 3O6MH 3P0VL 4FQXC 4S1QL 3BGAA 5D4QA 5IVXE 1AKJB 1LO4H 1IGTB 3SCMB 4CN4A 5TDPB 3C6SA 4JFEB 1IQWL 3RI5K 2H1PH 3WJJA 3GHBH 3VXPA 1Z0MA 4IS6B 4Y5XC 5IWLA 3PABB 4UUJA 4OUUB 2KZWA 3T04D 3I6LD 3LKQA 1U36A 3LDBC 4N1HB 1JF6A 1MLCA 1NAKH 2DBJA 5CILL 4UV4H 1BBDL 4KXZI 2R2HB 4BZ2H 3DV6B 3OX8A 2HVKB 4LVOB 2UUDK 3UJJH 2DM2A 4ODUA 4R0LA 4JQVC 4JZNA 2GW5A 4H20H 4P59L 3W0WE 1RU9L 4JG1H 4QRSB 1QBML 3QBTB 1FORH 4LKCA 4C58B 1MCCA 2PR4L 5FV1L 1A9BB 4ODXB 2RIKA 5K9OB 3RVXC 3M45A 1FJ1A 5FB8B 3TNMB 4GW5B 5HHNB 2AJZB 1Q72L 3E6HA 1TZGL 4FQXD 3QDMA 2YD6A 3QQ4B 2Y06L 4R4FL 1L4IA 1E4XI 3ESVF 5FM5O 1HHGB 3QFDA 4PS4L 3X12B 4LU5L 3MRCA 3QP3A 5GGRA 3MLTB 3DSFH 4J1UA 4NSKB 3OF6D 1AO7E 3NZHL 1P7QB 3T08A 1MRFH 2ZOKA 3D2UA 4C54A 5C1MB 1P7HL 3WFBL 1U8QB 5HBBA 2P24A 1REIA 1DLHB 2D0FA 5E4EB 4CMHC 3DRQB 1MAJA 1XF2B 4XNXL 2FL5B 1IZKA 5SV3A 2DLTA 4PP1D 4H8WL 1MY5A 4KVNH 3DNKA 1NGZB 3TJHD 5IFJA 4OFDA 2XKUA 4NM4L 5KS9B 4GQ9L 2ZUWA 3P9MA 2EDDA 4ELMF 4NQUA 4NT6B 3S96B 1T0PB 1Z9MA 2DQCL 4PJIB 3F62A 4K8RL 3VFVA 3HE7B 4LFHG 3PL6B 4LRIC 1U8HA 3D3VB 1T5XA 5D9SB 1MPAH 5IHLB 5D96B 1OGAA 5I9QC 3QZWG 3MGTA 3HZYA 4BYHA 4XBEH 5IR1A 1PBYA 2P45B 5J89A 4NRYB 1I8MB 1ZWIA 5GHWH 1GOFA 3STLB 4MD0B 5C9JA 2OTUA 5F7DB 5C6TL 4X4MA 1T22A 2FHFA 1SYVA 4DKFH 1HINL 4XCCH 2ARJB 1YUHA 4PGEA 5EA0L 2ZUQB 4NQCB 5IMOB 5E2JA 4JCMA 3VU2A 2VSDA 3BOVA 3U4AA 5A2KH 1CDCA 4NWUH 3BEWB 1MIEH 3DARA 3WO3B 4N8PA 4OLYH 1BECA 5I1EH 4RGOH 4QWWC 1KXTB 1AGCB 2NR6C 5IT2L 1UH4A 5T5FL 3RPIA 2VLKA 1FL3B 1Q38A 1V3KA 3REVB 5ENWB 4PJFA 4Y8DC 3L9RB 2X1WL 4GJTB 1NLDH 5EU6E 4FQXA 2DJ4A 4JRYE 4POZD 5IGXL 4D0BA 4OF0A 3LIZH 3CFCH 4WNQB 2IFFL 3QNZB 3RGHA 3V5KA 3VFOB 4K94H 1S9XB 3QDGE 1N7ML 2UZIH 4P4RA 1O0VA 4OLWL 4KTDH 4GFTB 2IPKA 4JVUA 4XH2A 3QI9B 4Y5XA 5GGQH 1U8LA 3PV6A 3GMMB 3OV6A 1O7SA 3KPSD 3OF6A 4YEEA 4BH7B 4LFHD 1OY3B 3FONB 3O9WB 3N9GH 4R26H 4YH6A 1Q9OA 1I1YB 1OAYL 1UH3A 3VDAA 4GAJH 3TCXA 1JGLL 4HJ0C 3CCHA 4FQCH 4JQVA 2B8OT 1MCIA 4UILL 1JMXA 3AB0B 3GIVB 4LCCB 2AGJL 1QR1B 1UZ6F 3R1GL 3VMNA 3T0EE 1HH6B 4LPVA 2YPKB 2EYTB 3GSQB 4OGZA 5GJTL 3RBSA 3DVFA 3KYOB 4Q9QL 1U95B 2NR6D 3MV8A 4YX2L 4Y5VC 4S1RH 1I7TA 4JAMB 2JJWA 3P2TA 3GFUA 1HOCB 3L7FB 4OFYA 4PJGB 4X7DC 5EU5A 1A6UH 2AV7B 2DWEB 1KB9K 1P2CA 1D7FA 5KTEL 4Q9BA 5KANG 3PJSA 5HGHA 5GZNC 5DURB 4E5XB 1AHWC 3NOIA 2V2XA 3B2UD 2C1OB 3SE8L 5I8EB 5J9PB 4G6KH 4N9OB 3IDYC 1XZ0B 4LVHC 4G3YL 3LEYH 5CJ8A 4Z7QF 2E9WA 5C0CE 1KYOJ 3ZTJG 5H2BA 2EDKA 4LSPL 1MAML 4PRHE 3UC0H 1CD1A 5HVFB 3K0WA 2B0SH 2Z8WC 4JY4A 4DTGL 2R4RL 3A6OA 4OCWH 1JNLH 5GS1C 5EIVA 4JR9L 5C0IA 2Z8RA 3DGGB 4HQQH 1SMOA 5ACMA 1NGQH 1CXKA 5CFHA 1F11A 2A77L 2VISB 1W72A 3B8YA 4KQ3H 3KXFE 1R3LB 3A6BH 3OKEB 2R29L 5CGTA 3TA3C 3S5LG 4LRIA 1I1AC 3BDXA 3VXQA 3QDJE 3HG1D 4OIIL 1J1PH 3H42L 5SWSB 2G9HB 2G75A 4L8SB 5B21A 1QEWA 4OZIE 1LD9A 3GM0A 5C6WH 3RWEA 1A6AB 3O3EA 6FABL 1LEGB 1I3RA 1TTGA 3DVNB 3GSRA 4QHLA 3EYSH 4RFOH 2F5AH 1NCTA 4POUB 1S9KC 1TZHB 4YFEA 4X6EA 1CZ8H 1GIGH 3PGDB 5DZNA 4AIZB 4MJ6A 5E7FA 3FTGB 2EH7L 2P47B 4BKLA 4Q97A 4FZEH 1BF8A 5FYKD 1KTKE 2YRPA 3ARTA 1DQTA 4P9HL 4K3JH 2WW8A 1PKQA 1WWBX 3W9EA 3A67H 3D0LB 2VNCA 5IB5B 4PREB 1ZSDA 3M07A 5KSAC 1FV1A 3GSWB 3FT2A 3HC4H 3TBVB 3K80A 3GO1L 5BVPL 3GNML 3WHE1 1LE5B 4NQDE 2VDQH 2DBLH 1FO0B 1WZLA 2XTJB 3S36H 3CXHK 3H3KA 1JN6A 1RULL 1AP2A 4JPKL 1KPVB 3BEVA 3TA3D 5LBSL 4P48A 4RX4D 1IZJA 4U1LB 2R4SH 2DDQH 2ICWB 2NX5B 1FLRH 3DOSA 4A6YA 2M1KA 3LRGA 4ACPA 4WFHD 4ZTPL 3DURA 4QXGL 1CGWA 1WCQA 5ICYB 4EN3C 4PJXF 4C56B 3EDDA 3VXRD 3HPLA 4X8JB 3H9SB 1ZHLB 1JGEA 3U4BL 5AZEL 3DTXA 4XMLL 4R3SB 4LEOB 1MWAL 2HN7A 1UM4H 4G7YH 1I8IB 4HJGB 5LKNA 1F00I 1ACYH 4MJ5A 4OZGB 3IFNL 2Y23A 1PGRB 4J3VA 2JJVA 4DVBA 1LE9B 1J5OH 5LXGH 2MQ3A 4LSUH 4LQFL 2H32A 4Z0XB 3MLVH 5BVJA 2GJ6A 1BFSA 5HYQA 1JZ7A 3L3GB 3IAPA 5JHDE 5F3BA 2XWBA 4HLJA 4BQ6A 4KDTC 1S7WA 1T7WA 3V4PL 4PV8A 1JWSB 2ICES 4I48B 4KJQD 3QEGH 3K2UH 4ODTL 4P2QE 4NZUL 4PGDA 4I3RH 2DLGA 2JTDA 3QJFB 4OGYH 5T3XD 1X5LA 1VPOL 5DQ9B 2Q86B 4FN0A 3DX7B 5KSBA 1JTTA 3O2WL 1KT2B 3EYVB 4FTVD 1CDGA 3QHZH 4TSBH 1RJLA 5L6YL 1G6VK 3UPAA 1S3KH 4KI5E 2EIEA 3Q5YA 1LDPL 2EO1A 2DICA 3G5ZB 1AQKL 1WZMA 2PO6B 2CRZA 1C5CH 1NJ9B 5GS1A 1MJUH 3MRPB 4FZ8H 3H7BA 5TFSL 4N8VB 3BZ4B 5E8NB 2B1AH 3TJEL 4PRPB 3U7WH 4HUXB 2DQTH 5C09B 2DM7A 2CGRL 3WLBB 2MJWA 3HRPA 3VGFA 4ZYKA 3TA3A 3ARWA 4DOHE 3V4UL 5HHPA 1B90A 2WAHA 3P4LA 3MUY1 3KPLB 2BVUA 5IG7B 5MERB 2NXZB 2JIXB 3UTSD 4OQTL 3MRMA 3VXME 3PQYD 3BGMB 4CN1A 4FP8H 4PJAA 1CL7L 4OZHE 3WHXB 2E9JA 4N0UA 2NMSA 2C3VA 4DZBA 1W72L 3VXRA 4LSQL 1RAMA 5D2NA 4KGJA 2YUVA 3I3DA 5EIIB 4MJID 3LH2H 1AGBB 2X2YA 3FQXA 1XR9B 4OBRA 1KACB 1KCUL 5DRWB 1ZS8A 1BM3L 3IRPX 1EHLL 3IETB 4Y4HB 4IRSC 1GGUA 4JFFD 3VXTA 3WFEH 1ZANL 2VDPL 2XXCB 5F7NC 3STZB 1OTSC 4WCYH 3T3ME 1GYAA 3NFNB 3QEQA 2FD6L 3F58H 2P8LA 1A4KB 4PG9A 3F12B 5I1KH 1N4XL 5BRZE 1NLBL 4U6YB 2JJTA 1OCWL 4OLVL 1RIHH 2Z92B 5GGTH 4BZ1H 5HI4C 5TQ2H 2E5EA 2VLJD 5I66B 3U7YL 2FJGB 2Q8AH 1IAIL 4QKXB 5FF6B 4PLNC 2FBOJ 3QR2A 3P4MA 1FCGA 4HIEA 5D1QC 4Q0XH 5FGCB 5TE6H 4QTHA 1L0XA 2P42B 1EO7A 2VWEE 5DYOB 5KSVA 2RCSH 4FTVA 2WIIB 3T8XB 4CJ0A 1A7RL 4H25A 2X1QA 5IMLA 1JBJA 1WIPA 4R7NB 4XBPA 3SEPA 1TETL 3EO0B 2ZSVA 4YK4C 4Z95H 1BLNB 3O3BA 2X4TA 1NCBL 3NABL 5JDSA 4HIJA 1A6TB 2H8PA 1ZGLP 4YDKL 3RHWK 3G08B 1XCTA 1AR1C 3EYOB 2FEDD 2X4UA 4MCYB 3IB4A 4RAVA 4LIQH 1CD9B 4MQXC 2YD5A 3O45B 1MFCH 5T3ZD 1KTLB 5EU3A 3IYLW 3QHFH 5IFHH 3UO1L 5HYJB 1AQDB 5IQ9A 2ARJQ 1KC5L 4UV7H 1AI1H 3OJDA 1DBMH 1CLOL 4YR6A 4N90D 1JV5A 2ATPA 2EIDA 2FLBT 1CXEA 2QBWA 3TYFB 5CCKH 3KYKH 3NA9H 2Z91A 4F7PB 5EU4B 5EZJB 2BSRA 1DR9A 2YKLL 3QUKA 5B38B 4DKEH 5J06A 2P5EE 2VXSH 3SKNA 5CP3A 4DJMA 1FYTD 2EDQA 5FGBA 2PTVA 4P3CL 1SJHB 2FIKA 4HIHB 3U36B 3RA7H 5DA0B 3NAAL 5FYJH 3FO9A 5I18H 3MRHA 4Y4KC 2NY2C 4HBCL 1MQKL 1H3GA 5DMYA 2VDKH 3MRIA 3AMKA 5JNYB 4YAQB 1OARH 2MKWA 5SWQA 5CD3B 3IGAA 4OF3A 5BV7B 4QNPF 3KR3H 4JFFA 3S35H 4BFEA 3C6LC 1JPFA 4ZFGH 4EDWH 1BOGA 2UY7A 4CVUA 1S5HA 1MI5B 4PD4J 5E6IB 4C83B 4WI6A 1FGNH 1YNKL 4L8CA 3ARPA 5HHMB 3B9KC 1OAUL 4LAQH 4ZS6C 2F53D 1KCVL 2XZQL 4P5MA 1IGIH 1BQHG 2AKRA 4F7CA 3S3JA 2NY6C 1L7TL 2VDRL 5EUOE 2DD8L 3BPCB 3OQ3B 4XNQB 3WNOA 4LSRH 1RJCA 1R5WB 3CPLB 3UP1A 1E4JA 4ELME 4L9LC 1TJGL 3SDXA 2FX8H 4NFCA 2XFXA 2YD2A 5I30H 2NLJB 5FECA 3I75A 1D3CA 1CI5A 2NY1B 5ALCL 5TQ0H 3KPQB 5ANMA 1AGDA 2BC4B 2VITA 4MDIB 3PNWB 5IW6B 1E27B 5MEPA 3WHE0 2VLRB 1OVZA 1PG7H 3RWIB 1QA9A 4ONGL 5IEKB 3MJ9H 4YHZH 4F15C 1ZT7B 5FA4A 1MEXH 1D5MB 4YHPA 5JZ7D 3QRGH 1A6ZA 2ESVE 4WHYH 3O11B 1GC1H 3WV0A 1QPPA 3R8QA 3MA9L 4P23B 3RL1A 1YEJL 1HILA 2WWMC 4ZS6D 3BN3B 1NMAL 4MNQE 1XT5A 3FQUA 1H5BB 3QPXL 2CO6B 4IEFB 2NY6D 1WWAX 2R23A 1FZMB 1EPFA 5C0JA 2BVEA 1V8HA 2PYEA 1MCBA 5J11C 1QYGH 2NTFA 3P0YL 4G43B 1VB9A 3TCLB 1KJVB 1SBSH 4K23H 2CIKB 1JGVH 3OXRA 12E8H 1U8NB 4LEXL 5L8JB 1GPOH 3ZYIA 4PBXA 5EOCL 2E9BA 4KQ4L 2E7MA 4I5BA 1ZGLM 4YDVA 5IEHB 4B41A 1BJ8A 2WNGA 3EYFA 4EUPB 3O2VH 1GGBH 1MFDL 3G6AB 4U1MA 3B6SB 3MJGX 3L7EA 5I17B 1KIQA 4MS8C 3F8UB 4XCYB 3UYOD 7CGTA 1HIML 1D6EA 1V7NH 4HX1B 4QLRA 4OCXH 4ZO6A 2PETA 5I74B 4OCSL 5D7JD 3RNKB 4P46D 4KDVA 1XR8A 4U1HA 4XHJD 1H3WM 4K7PH 3OWEA 4XP9L 2AJXH 3T4YA 2F53A 2HT2C 3BKCL 5C0BD 4JVPA 1UXWA 3WXWH 4U1JB 4U0RB 1DE4A 5DJDB 2OP4L 1DBBH 3D39D 2ITDA 3FO2B 3SY0A 4N8CL 1KCRH 1EK3A 5GJSL 3GK8L 3T65B 2X7LB 3QIWB 4MB5A 3S3SA 2IAMD 1YYMH 4XWOC 5DJ0B 4X6FA 3JV0A 5J3HC 1AGEA 2KUTA 3V2AR 5HHQB 4G9DB 2J8HA 1CK0L 5IVXB 4NZTH 4M5ZH 2CSPA 5CEXA 4WTZA 1HSAA 2AXHA 2WBKA 5ESVB 5KN5B 4KZDL 1JF1B 2JKXA 3UJIL 1HHKA 1PVHA 2NQCA 1A1MB 4Y4KA 3U0TA 2VAAB 2OTWA 1Z5LA 4MXVF 3WFHA 1RZIB 3K2MC 1EBAA 2EDHA 2XNAA 2R1YB 4MS8D 5J13B 2NZ9D 3X13A 1RJYA 4LHUG 5FHBH 4KKBD 1ZT1B 2GKIA 3K4DA 4EOWL 2XKNB 3NBNA 3GJFB 5EOTA 1JYVA 2DYPA 4PJFF 2JB6A 2NW2B 1T66C 1FFQA 5F1IA 3IDUA 3O0RH 1FQ9C 4K2UH 2EDNA 3WIHL 1X5AA 1B0RA 5IF0B 2A2QT 3E3QE 3ARVA 5INCB 1M7IB 3ZSSA 1QTYT 1UCBH 3DMMC 5L2KE 3SGKC 2VZ3A 4KDWA 1P4LB 5E08H 4XWOD 4GRMB 4OCNC 3CZFB 4KHTL 4IHOA 4JPVH 4L9LA 5BOZG 1IQDB 4HT1H 3BRGC 1INDL 2IADB 4BZYA 2ZUVA 2AEIT 1BQHA 2XZAL 3C08L 4XB7A 4AEIH 4YZFF 5TF1L 4ZUUB 1NC4D 4U6XB 1CD0A 4OLXH 4YBQC 2MSPA 1SBBA 1QRNB 4XZUB 2XZZA 2D03L 4M1DL 1S7SA 3VGAB 5E95B 1UJ3B 4U7MA 5DQJA 3TZVC 1IAOA 5D7JA 3SJVB 3D25B 4P46A 5DWUH 1AO7B 4L8DA 4MA1B 5C0BA 4JPWH 1ZLVH 4QT5B 1WF5A 2HH0H 3F5WA 2B4CC 1MREH 4KTEL 5D71H 1AE6L 1F2XK 2V2WA 5GGVH 5IOPA 5HHXH 3DUSA 1S78C 1CDBA 2YD7A 1YQVL 3L5WB 3QCUH 4LLYA 5DGQA 1MF2L 3FT3B 5FCUL 3VH8B 1NBYA 3G9AB 3OKYA 1J0KA 1K2DB 2V5RA 4LHUD 3G04A 5E8DH 5EO0A 3LN5B 2F54D 4QEGA 2I60H 5T3ZL 2ZKHL 1WVZA 3SDAC 5EOCJ 1CDIA 5IBLC 1IC5H 4DFIA 1LILA 3FOLB 5FYLL 1YDPB 4Z7UE 4ZSOE 4HWZA 3FHQA 1WBXA 3JZ7A 1LEKB 3IAQA 4NO2B 5F1SA 3ZDZF 2FH6A 3L5HA 4FQJH 5GZOD 2FRGP 5K33A 3D0VB 2HT4C 2J8OA 1DN0B 4O2EA 1BJ1H 2R9HD 1KENH 1WTGT 2V2TB 4D9QE 3WKMH 1NDMA 4NFBA 2D3VA 4P5TD 4YC2B 2FO1A 4PJXE 3TO4B 5KAQG 3OTTA 1I3VA 3ARQA 3KLAB 3OKOB 4J12A 4F7TB 2PTTA 3N1GC 4EXPX 4CNIB 1KCSH 2XV6B 2FR4A 4HK3J 5DEFB 4RDQF 1IAII 3P4NA 3T0WA 3NCJL 5INDA 2GITB 5DVNA 1ZTXL 5CEZH 3BH9A 4N0YH 2A74B 3QT2A 3O6ML 5C0ND 1UWGH 1S78D 2DN7A 1LO4L 3IFOA 5I8OH 1YEDB 5IP4A 3RTQC 1TIUA 4G9FE 1XF4B 1HQ4A 1YNTA 4P4KB 2H1PL 3GHBL 5EU6B 3IFLL 4JRYB 1J8HE 1NBVL 1NC4A 1RK1B 3RIFK 1MAKA 4BQCA 4Q6YA 4X80H 5CP7B 1UG9A 4UV4L 3HMWL 1MVUB 5DC4B 3VRIB 1ND0A 2IANE 3IXAB 4P2RB 4GG8B 4KRPC 2ZNXA 1DP0A 4BZ2L 5A3ID 2HT4D 2V7HB 2PKDA 4KK8D 1EAPA 4JFHE 1G9EA 4FFWC 1EFQA 2C9AA 3CFBB 4TRPH 3C5ZC 3WUWG 5DMKA 4AM0A 4H20L 3K81A 1AGFA 4S0SD 4NKMB 1WFUA 3BUTA 3IKCA 1KOAA 3PF2A 4X6BB 3QEHB 5DA4A 3ZE0F 4UU9A 1OPGH 4RIRB 3T0EB 4OM0H 2H9GB 3O4LD 3AREB 3D5OF 4LHUA 5HDOA 5JO5A 1NDGA 1K9TA 2XT1B 3DMMA 2F54A 4TUOA 2HLFD 5DHYB 4LLUA 3SGKA 2YA0A 1F4XL 4TPRH 3RTQD 4PR5B 1NC2B 5DLMH 3HNSH 4YBLC 1FZJA 3EOTL 5CS7A 3D69A 4KAQH 1WUNT 2GFBB 4TNWF 4EI5D 5LVEA 1T1WB 1AJ7L 4LNVA 4TSAH 5FUOH 3MZGB 3RUGA 4WFGE 3OG6B 4UIKH 3DSFL 2Y6SC 3TFKC 3ARBB 5DD6A 1F6FB 3S7GA 5D7SH 3MLYH 5I1CH 3SGEI 4I13B 5CSZA 3DHMA 4KH2A 2P49B 5A2FA 3BPNC 4OZFG 4P5TA 4RGNC 4KRPD 3T77A 3BQUB 1GZPA 5EZOH 2HTKC 5EBGA 4BSWB 1FIEA 4Z7NF 1CFSA 3E2HC 1WT5C 4BM7A 5CEYA 3FT4B 5DRZA 3LKSA 2Y7QB 2C4FU 4UINL 4NQVA 4DN4H 5KG9A 2LU4A 2CLVA 1QFOA 2R8SH 4M62H 1C12A 4X5XB 4OAWA 4V1DD 1EEZA 4KK6C 4XPBH 5IBUB 1ED3B 3OGOE 4QOKA 3KXFB 5I15L 1N5YH 1JGUH 3FZUC 4XX1G 3V6OC 4ZG1A 2NY0C 2DQFA 3VXUB 5KBNC 5EBWB 5ID0B 1ZKAA 3SDAA 5EN2A 4JY6B 5GHWL 2DAVA 1UWEH 5L0QC 3LQMA 2FYYA 2BVPB 4JZOA 4KJWC 3K7UA 3CH1A 1KFAH 3IU4H 3CFJB 4DAGH 2VDMH 3O3DB 1J05A 5JW3L 3TFKD 1IKNC 2ZUXA 1AFVL 1T6VN 4DKFL 4G8GA 1R3IH 3UTTA 2WP3O 3A6CH 5L88H 4RGND 3MGOA 4BJLA 1U8MA 1XGPA 5F88B 3NFPB 2R0ZH 4ZD3H 2OR9H 3ILPB 2EKSA 4TUJB 3MYZA 1SEBA 2VZVA 3BPOB 4OLYL 3RDTD 1DDHB 1QQDA 5F9DC 1J8KA 3X14B 3KPMA 4PTTB 5DHVB 5J1AB 1TNNA 3QUXC 4TNVF 1UENA 1J86A 1E6OH 2NY3C 4ONHB 5DO2C 2EO9A 3HC0A 4UZGA 1SEQH 4JFYA 3WFDH 1DANT 3CFCL 1OSPL 1X5FA 4X9GA 3RTQA 4M61B 1WC7A 4WU5B 2UZIL 1MLBA 3IVKB 3TBWA 2KPNA 3WNLA 2VXVL 4EI5A 1R3JB 2VUYA 1N0XH 2WBJB 2ADGA 3V6FB 3MRGB 1FNSH 1ZLWK 2VN4A 2Q20A 4ZFOL 2ADJA 1CFVL 4QXUL 2R2BA 2J4WL 2MPAH 4R26L 3N9GL 3IS1X 5F6HJ 4KVCL 3NZ8B 4XPTH 2EYSB 5FM5M 1IAKA 1LP9B 2FEEL 5AG9A 1MCOL 1BZ9B 4HWEL 1VGKA 4OIAA 4GAJL 1QHOA 2MWCA 4OV5A 4FQCL 3QJHB 4YUEH 4W81A 5HPMB 3MLSH 1DSFL 4RRPG 5ALBL 1MFBL 4CBPA 1OAXL 3ARFC 8FABA 4LCWD 4HUMB 4OB5H 1CT8A 4QNPE 3LB6D 1FPTL 1QLFA 5T1LB 1JWMB 4JDZB 2AXFA 1UB5A 3SE9L 4U0QB 3WUWA 5C0EA 1PZ5B 4NO5B 1A6UL 4M9PA 4F58L 4YHNB 3FB5A 3RY4A 43C9B 4L3EB 5EBMB 5BXFA 4CVXB 4LBEB 5F7EH 5JOFA 2EDWA 2ITCB 1C16B 4ZUWB 3ROLA 1WSST 4G6KL 3MJ7B 4XC1H 5HGAB 5J56B 5T1KA 3P40A 1Y6MR 3HZMB 1PG7W 1AD9A 4FOMA 4JPIA 2M8XA 2X41A 4XCFH 5AD0A 5BO1H 3QUZB 3SGDH 1UQSB 4Z77A 3HRZA 5DJAA 5F96H 2CXGA 3V8OA 4HQQL 3ULSA 1WT5A 4Y16D 3RDTA 5C07A 2E7LC 3DVGA 4GUPA 1KIPA 1NGQL 1I7UB 2BHZA 5FOBA 3BVNB 4X6DA 4NN5C 4WHYG 4P2OB 4KQ3L 5LGHL 3A6BL 5K9QI 4Z5RA 2PW2B 1U3HB 4LNRB 3UXFA 1PSKL 5SWZD 4PYHA 5DJ6B 2Z4QB 5T1MB 3BSZH 3HZVA 4KJPD 3KPRE 3V6OA 3FFCD 3QDME 1AXSA 4RMTA 3JWDH 5DDHA 4ZUTA 1WBYA 2B4CL 2OK0H 3VD9A 3EJZC 2F5AL 2XWTA 3C60C 3FB8A 2W91A 4H26A 4E42A 4OZHB 1GIGL 1WFTA 4WUUA 3ARSA 5E8EB 5GGTA 1IKNA 1I3GH 4UDUA 3AXLA 4IDJH 4FZEL 3QAZC 5ITFB 1U8OB 3JTTB 4R8WH 3NTCL 3S4SA 3V4VL 3ZHLA 4Z9KB 4LASH 4KTYA 3I85A 4ODVH 4WW2C 1YY8B 5E8OB 3IDXH 4GKNB 1RZ8A 4LCWA 1ZHBA 2Q76B 3HC4L 1BEYH 3W11C 3QB7C 2VDQL 2DBLL 4WUKH 2R56H 3SDXF 3TVMB 3E6FA 3MRKB 1ZLWH 1WTLA 1QUNA 2YUZA 1B6UA 3OMZA 4KK9C 5C08D 2R4SL 3BISA 4BH8B 1LO5A 3N50A 2DDQL 1HHIB 1Y6KR 4DK3A 1FLRL 1ETZB 4YHYC 5JW4Q 3VFMB 3WL9A 3FHAA 1VACB 2NZIA 1OGAE 3M1BB 5HYSB 2GJZB 1U3YA 1FO0H 1FRGH 1I8LA 1MCSA 2I07A 2XZCH 1XH3B 3I6LE 3F7QA 2JELH 1G7IB 4O2CA 1MCPL 3RKDD 2AAVA 4JFPB 5C70A 2GI7A 1G9NC 1UM4L 1S7RA 3BO8B 4X4ME 1UACH 1ACYL 3X3GL 4LLQA 1TPXB 5D5MA 4R97C 4G8EB 1S8DB 4Y16A 35C8H 4Y2OA 1KULA 5FKPA 4E41A 1J5OL 1LO0L 2X70A 2W65B 3TV3H 5DI8A 3MLVL 3GRWH 4JKPH 4UI2A 1NANI 3ARFA 1OP3K 3TESA 2J2ZA 5JLZB 3QFJA 4PJCF 3W11D 2XWJB 2PXYC 3MPCA 1I9RH 2VLKE 5DJZB 1JPGB 3N85L 5SWZA 2R0LH 3QUYD 3LQZB 4O2FA 1AHWB 4PJFE 1J9CT 3NCBB 2AQ3A 2WSKA 2GTWB 3NIFE 4GMSL 3AFLA 4LLMB 5D6CA 1KEMH 4KK9D 3FFCA 5K9JH 4OGYL 2DM3A 2OJEA 4PRAB 3IFPB 5F8QC 3VA6A 2AV1A 2BJMH 3LS5L 4G8IB 3QHZL 4TSBL 1FFNA 2HJLB 1A3LL 1IGYA 1Q94B 1S3KL 3DVIA 1K3IA 3G5VB 1BIIB 3QUMH 3BZDA 4U6VL 1RIVH 5IHBA 5D1XC 1U8JB 5JIHA 2HJKA 4E9LA 3M8OL 4PRID 5ACZB 2YC1B 3SDDC 2ZCHH 5DJYA 1UKTA 4FXKB 5D1ZC 5DRNA 1J10A 2Y07H 4FZ8L 4WJ5A 2E7LA 4JHWL 3SPVA 2XYCA 1I7ZB 5EC2A 4N1CA 2H41A 4G80B 1NPUA 2QLVB 1YNLH 4JB9L 1MUJA 2DI7A 1U2CA 4HKBA 4L29A 4N5ED 3Q48A 1L0QA 3MJ9A 2D4FA 4HC1L 5C08A 1RIUH 3K74B 2AABH 4RSVA 5HD8C 5F9JA 4R96B 5DC9B 5EUOB 1QFWL 1HI6B 4F7MA 4DEPB 4FP8L 3UAJC 1GGIH 4G8FA 4AYFA 5D72H 1XIWB 4JFOA 4WY7L 2C4XA 1T7VA 2FSEA 5SX5H 1BGXH 1U58B 5C0GA 2BHYA 3C60A 4LRNH 5C0DB 3TBYB 2GY5A 4X99A 4XXCC 1A2YA 1D5BA 4KKCC 3LH2L 4PG2A 1BP3B 4LOUD 5F1NB 3U0WL 3LKOB 2A38A 1CQYA 1XGYL 1HXYA 4F33B 5L8KB 5A2LH 3IDMA 5BS0D 1YEIH 1DQDL 5GS0C 4GLRH 3WFEL 1TJHL 5IMKB 1XGUB 1DBJH 4KPHL 4MQ7A 2QQLL 4WW2A 5JIPA 3U0PB 5D1ZD 3ZE1F 1MRDH 5BW7C 4W4OC 2Z35A 4KZEH 4O5LL 5DD3H 2VDLH 3CAFA 3PHQB 1B4JH 5ISZB 1VKXB 1RIHL 2Q1EA 2NXYC 5GGTL 1Y18B 2CKNA 4BZ1L 1TCRB 2IPTL 5JW4R 1F90H 5TQ2L 4PY7A 1P1ZB 3IJSA 3I9GL 2BSTB 4U6HB 4Y4FB 3PUCA 3GKWL 1JPST 4Q0XL 4PGZA 1F97A 2BRQA 3WN5C 4JLRA 3HS0A 3MCKA 4KMTL 2XQYK 2BSSB 1JNJA 2AVGA 3ZT6A 4PJ5D 3G6JA 4I18B 5E9DB 5JPNA 1FGVH 4IOFC 4UT9H 4CRPA 3AUVA 3I02B 1Q8MA 3LV3B 1S7QB 2LVEA 2X5PA 3VDCA 3V9FA 4KKCD 4OGAC 1OP3H 5MP6L 4WO4C 2MTPA 1L0YA 2HT3C 4PRIA 4C59B 3CVIH 4X98B 4ZQKB 1UADC 4PJEF 4G6FB 4ZPTA 4LIQL 5L7XH 4NO0B 1KB9J 2O5XH 2Q3AA 2G60H 1PKQE 3ZKXC 3QHFL 1K6QH 5IKCA 2WMPA 3BGFB 4QCIA 4BFGA 4UV7L 1AI1L 4IRJD 1MRCH 3FFDA 1M7DB 4H5SA 2PXYA 5CCKL 3KYKL 5IMMB 3DYOA 1CIDA 3TNNA 4ODSL 3FB7B 1XMWA 3EGSA 2H26B 5CJBA 4TVPH 1YEHH 4KROB 1HDMA 2FIRT 1CDYA 3B5TA 1IGFL 1KPUA 5HDQH 3PWUB 4LHJB 1LEIB 3SOBH 1CFTA 1Q0XH 4FFVD 2HFTA 2EDRA 4JE4B 3MRRB 2M26A 4Y5YB 1GCFA 4LLAA 3HAEH 3RA7L 5FYJL 3B9DA 4NO3B 4UQ2B 5I18L 3AY4C 4LDLB 4LKXB 3S88H 5IV2A 2XN9B 1NAMB 3CU7A 3V5DB 2VDKL 3L3JB 1YN7B 5CEZD 1A7QL 3FOMA 1BX2B 1OARL 3DX9A 3IXTB 4J23A 4LVOC 5HVHB 5BS0A 4ZUVA 5D1XA 1QFPA 1X3DA 4XWGH 3OJMB 5DXWA 5MEND 2Z31D 1D5XB 3PWJA 1QSFA 3FKUS 4EDWL 4UIMA 4NNPH 5D1ZA 1VADA 1FGNL 1WJ3A 5ESQB 4PB9H 3B3IB 3ILQD 4LAQL 4MNGA 3RL2A 1IKFH 4W6WB 1NUFA 1IGIL 1YPZB 4PJDA 1MCRA 1F3JA 3MACL 1G7LA 3TH3T 2DLFL 4RBPH 2GJ6E 3L3KA 3VFRB 4HFWB 4OV6F 4YHIB 2BNQD 3UJTH 4FNLH 4NKDB 3BT2H 4J6RH 4J3WA 4QRTB 1HYSC 5CUSL 4LSRL 1WQVT 1AKJD 3SCMD 3HG1E 1NKRA 5C0CD 1T83A 2FX8L 2VLLA 1A6WL 3P77B 3RWFB 5AYUH 5HYFA 2AXGA 4HZLA 4I2XB 4YHOH 1HWGB 5TQ0L 1DEEA 4QGTA 4HS8L 3R0MA 3T0XA 5KSBE 1T6WA 3QPQC 4HKXA 3CDYA 1PG7L 3V52L 4ZOCA 1NCAL 1T03L 3WE6A 1MIMH 3VJ6A 4YHZL 3BXNB 5E4EC 3X17A 1G1CA 3CXHJ 5TDOB 3Q0HA 4MQTB 1KYOK 4JN2B 4V2CB 1A1NA 5I2IB 3S6CA 3QRGL 5FDWA 4IMLB 5HHOA 3VI3F 1G9MH 1D9KB 3O8XD 4K3EH 3CJJA 1R24A 4MYWB 4PJCB 3JV6A 3I84A 3QXVA 5HDBF 1QLEH 3HE7C 3ARGB 5B8CB 1F02I 1X5ZA 2BOBB 1X44A 4JRWA 3PL6C 1OD7A 3OKNB 1KELL 4FHBD 3SKJH 1FVCA 3QIUB 5IHZB 1AIFB 3UBXG 1M05A 5D96C 4U49A 1QYGL 2W9DL 3BE1H 1TZIA 5E6ZA 1X7QA 4K07A 1P9MA 3MRQB 3V7MA 12E8L 1UCTA 1KG0A 3ARDD 2MNUA 1PFCA 3WN5A 1G7QA 4X4YA 1I9EA 4WFHE 2UV3A 3EFDL 4PJAE 3OB0K 1FNEA 3BFOA 4N0UE 5L8LB 1U8IB 1R3HA 3SBWA 3VXRE 3O2VL 1KTDA 1XCQB 5CWSB 1NBZB 1GGBL 3KAAA 4MD4A 4NRZA 5D2NE 1DQJB 1H3PH 3QPQD 1Z9OA 2IALB 3K4ZA 5MENA 1INEL 2H6PB 2HA1A 4WO4A 3GSVA 3Q2CA 4Z7UB 4LCYA 1V7NL 3W81A 3VWJB 4OCXL 1KIRA 4WDIA 5D7IB 3ORJA 3WSQH 2QHLA 4S1QH 3ZDXE 1RUKL 5CGYC 2NY7L 2AJXL 3MV7D 3VRJA 1MCWW 3S34L 4EVNB 1IQWH 5DF0A 5J0BA 3QEQE 3SO3B 2GTZB 3PDOB 2C3GA 3MRJB 2WUCH 3LEVL 3SDYH 2BNQA 1KCRL 4M7LH 3HE7D 4LLDB 4PJ8D 1G9NL 1AKJA 3D3VD 4X0KB 1EMTH 1YYML 3RP1A 1IGTA 3SCMA 3ZE2E 1MSPA 5TDPA 4S2SB 3I3EA 4JFEA 4NQXB 5CILH 3WLWD 2EE6A 4KUCD 3VMOA 1OT2A 2YEZB 4NOBA 4WU7B 1T0NB 4ODHH 3JWOH 5C3LD 1UM5H 4IS6A 3CFEB 3QI9C 2JCCB 4NZTL 3PABA 4M5ZL 1U3JA 4D9LL 1CDJA 1YEFH 1MFAH 1Z9SA 4AH2A 5F70A 4G9FB 5CHNB 4FTVE 2HMIC 3O9WC 4X83A 3O6FB 3MUGB 4XNMA 1J8HB 1QBMH 3DV6A 3B9KB 1GVIA 5I1LB 1ONQB 2HVKA 3I6GA 4M8QB 5BOPA 1IM9B 4MD5B 3AB0C 1CLYH 4LCCC 3FQTB 3O8XA 3BZEB 4QRSA 1TZGH 1RQ5A 5FO8A 5CGYD 3O0RL 1MCKA 1A9BA 2ZUYA 4K2UL 4ODXA 5I1HL 2OXGA 5DRXA 5K9OA 4PJBA 4JKWA 4PTUB 3RWJB 5FB8A 5EH1A 3IJHB 4Z7OF 5KZCB 2BDNH 4GW5A 2AJZA 4HUUB 4LU5H 1X5YA 2MMXA 3TPKA 2CDFA 2YPLB 1Z2KA 1UCBL 4RWYH 4KI5D 4OLUL 3BN9C 4NYLB 3QQ4A 3GJFH 3NZHH 4JPVL 3EKCA 3ARDA 4HT1L 2XQBL 1RSFA 4KWUA 1WBZB 1HHGA 5JUEH 4YEFA 4AEIL 4POYA 3QI9D 3MLTA 3DRTA 5I1JL 3LN4B 4XNXH 4BSVB 4NSKA 4OLXL 4FG6C 4H8WH 1P7QA 5CSBA 1ORQB 4YPJA 3IU3A 4X8XA 3FL7A 4JDVB 2WBWB 4YQXH 1DLHA 1T0MA 3DRQA 4GXUN 4XP6H 2V5YA 1CD8A 2FL5A 5DWUL 4GKZB 3MV7A 1I4FB 1NGZA 2K7QA 4JFFE 4JPWL 1R3KB 5KS9A 4UQ3B 2HH0L 2HKHH 5DMGD 4DVRH 1HH9B 3SO5A 4NT6A 3S96A 3LVEA 1MREL 5SV4A 4PJIA 3QIBD 1NFDF 1UZ8B 3HE7A 3MUZ1 4MVBD 4S10A 3C5SB 5HHXL 1BQLH 2P8MB 1IGMH 1UEYA 3BKJH 3QCUL 3D3VA 4PJ8A 4X7FC 1OD9A 4ODBD 4Q74A 4RZCB 5A2IH 4GKOA 4L8SC 1RV6X 3M17B 4NQED 5GS0L 1ZVSB 4WFED 5DTFA 2Q6WB 2WQ8A 1YA5A 4OFIA 3BN9D 1HINH 2ENYA 2Z93B 3NIDE 3CLFL 4NRYA 3SDXE 1I8MA 2VR4A 3ECBB 1G7MA 2EH8H 4Z7WB 1SMAA 5ILTH 3STLA 5E1HB 1R5IA 4WI5A 4MD0A 3MC0A 3TN0B 4AEEA 3BYTA 5ANME 5EORL 5F7DA 4FQJL 3V6ZB 2DWDB 1DUYB 3P9WB 4WGVB 4XC3H 5BRZD 5IT2H 4NQCA 5IMOA 1FAIH 3C9NB 3WKML 3AU1B 1ZA3B 4YBHA 5EC1B 4ZFOB 4HPYH 4X6DF 3RGVD 4KY1H 3BEWA 3RVTD 4OZ4B 4OCLC 4XAKD 4XGZB 1FN4B 1KCSL 5HI5D 5ETUB 5T3ZE 4ISVB 1MJJB 1NCDH 2IH3B 3L3DB 3REVA 2XTJC 1N7MH 5ENWA 5CEZL 3MRBB 4N0YL 2QQKL 3L9RA 4ORGB 2F74B 4APQB 4XNUH 1VFMA 1HSBA 4N90E 1UWGL 5KW9L 3HZKB 3Q5OA 5I8OL 2XIDA 4WNQA 4UNVA 2MOVA 3VFOA 4KU1A 3U46B 1S9XA 1H0DA 2PYEE 3EOAA 1YC7A 4QRUB 3T2QA 3PGCB 3QI9A 1OAYH 4WI3A 3OKMB 1HQRB 4MHHI 1XGTB 4BH7A 2V9RA 3PWLB 4X80L 3FONA 3LKNA 3R1GH 25C8L 2G5BB 4GBXD 5GIRA 1W0VB 3RX8A 1I1YA 5GJTH 2R69H 4XBGA 4PGCA 5BQ7B 1UH2A 4YX2H 4R6UA 4TRPL 2GUOB 1B0GB 5GRZA 4JJ5B 3GIVA 4LCCA 1QR1A 3GMRA 1HH6A 4R4BB 4ZAKB 1LVEA 2YPKA 2EYTA 4AMKH 3GSQA 4KKLC 1K5NB 3KYOA 4M00A 2F53E 4MAYD 1U95A 3MRLB 3EDEA 4WW1A 4WI8A 3GJEB 4X4ZA 4H1LH 1H3TA 5HY9A 3ME0A 4OM0L 1QO3B 2HLAA 4PJGA 4ODWB 4NQEA 3ZT7A 4G42A 1VERA 1Z0NA 2AV7A 3CSBA 1Z3GL 3MMEA 4M02A 4G3YH 1CVSC 1DL7H 1S9WB 3TYGH 2W1NA 2P5WB 4TPRL 4PJHB 5F7WC 4LSPH 1MAMH 5DLML 1E28B 3GMQB 4KAQL 3QXDB 3T2OA 2C1OA 5I8EA 4JO1L 1PY4A 3LQAL 4QY8B 1XZ0A 3KYAA 4C56D 4CVWA 1D5IL 4KGLA 1C7SA 4D0DB 1P4BL 5D5MF 3MLYL 1VFAB 2CD0A 3NGBB 3HUJB 1IRAY 2PO6C 4EI6A 4QHNA 1S7XA 3RGVA 1A47A 2PW1A 5D2LE 2PF6A 4XXDB 4OIIH 3KHOA 1VFUA 1JL8A 4QXTB 1T5WA 3C2AL 4QYOA 2VISA 2D31B 1R3LA 4KKLD 2QSVA 3N1PC 4DN4L 4M62L 4MXQC 1FG9C 6FABH 4ODUB 4I0PD 5T33L 4JZNB 1JE6A 2BVQB 4Y1AB 2G9HA 3ZE1E 1FL6B 2NXZC 3MNVB 3U9PH 2DB8A 1JGUL 1PYWB 3LRSB 5IVZA 1A6AA 2QADB 5FUCE 1LEGA 4JHZA 3DVNA 3RVWD 4LK4A 1UWEL 4P9HH 3E6HB 4PLOB 3KPRB 5F89A 3MA7A 3NIGF 3PGDA 4AIZA 1BJ1J 3QDMB 2HFEB 5L9DL 4MNQD 1MHPH 3GO1H 5BVPH 3MLRL 5FUZL 2E27L 3GNMH 5L88L 3MRCB 2PO6D 4K3GA 4U7KA 5AYQA 2R0ZL 2OR9L 1KB5B 4JPKH 3JUZA 4PREA 5IB5A 1RUQL 4JHBA 5IK3B 3BAEL 3GSWA 3TBVA 4MAYA 5C0BE 3UPCA 4PRPD 2DKSA 2P24B 1G7HB 2YWZA 1FO0A 5C09D 2DQDH 4CADB 1KLUB 1S7VA 4ZTPH 4XP5L 1F6LL 1U0QA 2CJUL 1KPVA 3MROB 3W82A 2EXWD 1XF3B 2UWEB 1NFKA 3CNKA 4U1LA 3WFDL 4U1NB 4XTRC 2IBBA 5AZEH 2F19L 4HKZ