1FAIH

Three-dimensional structure of two crystal forms of fab r19.9, from a monoclonal anti-arsonate antibody
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
221
structure length
221
Chain Sequence
QVQLQQSGAELVRAGSSVKMSCKASGYTFTSYGVNWVKQRPGQGLEWIGYINPGKGYLSYNEKFKGKTTLTVDRSSSTAYMQLRSLTSEDAAVYFCARSFYGGSDLAVYYFDSWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSALYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of two crystal forms of FabR19.9 from a monoclonal anti-arsonate antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG2B-KAPPA R19.9 FAB (LIGHT CHAIN)
total genus 37
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1992-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1faiH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1faiH02
4I3SL 4X6CB 3VFMA 1LWRA 1D5MA 1N64H 2B2XH 2FHFA 1I9RL 1WBXB 3RZCA 2OI9B 3CPLA 2NY3D 1HOCB 1FZKB 1H0DA 1UM6H 5GGQL 3WJJA 4JG0L 2JJSA 4HJJL 3VFRB 4DJMA 1P7QA 3D2UD 4H1LA 1C1EL 3IDNA 3S35H 1MIMH 2DQHH 4M48L 4LIQH 2Q1EA 5ITBL 5T1DL 5CD3A 1G7JA 2RBLA 1TTUA 2X05A 1FJ1B 1MRCL 1J1PH 3BWUC 1S7TA 4TULL 5AZEH 5ALBL 4NUJA 3T0ED 3VDAA 4K94H 5DZOA 1MH5A 1RUPH 5I71C 1PEZA 4N0RA 2HFGH 3L3JA 4LARH 3CFBA 4YR6A 4NC2B 5J6GB 2X42A 3RDTA 3QCUL 5MHSD 4RRPA 5ERWA 3CFBB 1R5VB 3G04B 5CD5C 3H0TB 1JGEA 5K33A 2DTSA 2X9YA 3LIZL 5GGVH 3WXVH 4IOFC 1BAFL 2IGFH 4AIZA 1D5IL 3RVUD 2J2ZA 4XNMB 2GTZB 4JO1L 3MJ7B 5E9DA 3PWPE 4L8CB 5CUSL 3BJLA 2EIDA 3MRQB 4WWKC 5DJCA 1RZJH 2ARJB 2G75A 4JRXE 5F6HJ 1IRAY 4OCLC 1R3KB 1P4IL 1KJ2B 2ADFL 4RFOL 4M6NH 1U8OB 4P5TC 1C5CL 4RWYH 3IDGB 1EO8L 5F7DB 2MJWA 3CDGA 3P30H 2QSCH 4ZNEE 1D5MB 4OFYA 3B2VL 2AK4B 4FQ1H 3HI1B 3L1OL 2AJUH 1FAIL 5ANMA 1HHIA 5HHVH 5DHYB 1QA9B 2BVUA 3H9SE 3JTSA 3VI4F 1CLZL 4Y5VA 5C09A 3PQYE 1Q0XL 2QV2A 5E1AA 3QWRA 3BKYL 4P2OB 4G9FD 4PJFB 3UBXI 4J8RB 5J1TC 2CMRL 1WAAA 5JW4Q 2AQ3A 4G8GD 5HYJD 5EU6B 3BAEL 5FIEA 3AM8A 5T3XL 3BO8A 3R06A 4WFHD 4NN5B 3QFJD 3GMPA 3BDYH 2JJVA 1I1YA 5E1HB 3V5KA 1D6EB 2PTVA 5ANME 1CDHA 3PL6C 2VITA 1UB6B 4IHOB 5D2NC 2Q8BH 4X7SH 5C09D 1DBAH 4G8EA 3DVGA 1B0GA 3DI3B 3PXJA 4R3SB 3RWGA 3EDKA 5ISZB 1U2HA 2UY6A 3MCKB 2ZUTA 5H35A 1CE6B 4FQCL 3LSOA 4NN6B 5HGHB 1A6TB 4CKVX 4MAYA 1T83C 4Y4FB 1V3LA 2DN7A 4DK3A 3QG7H 3G6DH 4OZ4A 1DLHB 4HIHA 2F58L 2Y07L 3LHPH 1GYAA 2OLDA 4HH8A 2WNGA 2NY1B 3WNKA 1CXFA 4HKZA 3GHEH 1YEJH 3ZO0A 2E7CA 5SWZE 3CFCH 3FCTA 2DQCH 2DQJL 4LEXL 3BIAX 3P4LA 4P46C 4OLVL 4A6YL 4NRZB 5JIPA 2BMKB 1QSFD 4UBDD 3HMWL 2ERJB 1Q94B 3PABB 3VWJA 5FYJU 2DB8A 2HG5B 1K4CA 3SDXF 1KLUB 5HJ3A 2AABL 2KKQA 3W11D 4LGRB 2AJVL 1Y6NR 4PY8J 2OS7A 5IM7A 1W0WB 2HLFD 1KJ2A 3QUYC 5C07A 4BZ2H 2R0ZH 3DMMD 4NO5B 3MRCA 4LKXB 2XZAH 2HWZH 3DX8A 3WIFB 4F33B 2F8OA 3WUWB 4KK6D 2VUOA 5HI5D 2VLME 2B7DT 3D6GA 4CAGA 4CDHA 1LP9E 1BQHA 5E9DE 1BGXH 1C5BH 3WO3B 1OF2A 4NN7B 5ADPH 5JORA 2CSPA 4ONHB 4Y5YC 3TPUA 4N0FB 4RFNC 3TESA 4M9PA 4ZS7L 4JM2C 4Z0XB 4PYGA 1A21A 1FNSL 2DBLL 4NKIH 3FQNA 4YDVB 1XGTB 5D7LE 3UMTA 1P7KB 5C0BD 3LRSB 3SGKC 1T4KB 3KWWA 4PRIA 4XAWH 4Z7WE 4Y7MA 4P2RA 2OBGA 2IANA 3S96B 3S36X 4NP4H 3LCYA 2RR3A 1FFOA 3C2AL 1NGQH 4M6AA 4DGYH 2HT3C 3BUTA 3O45A 4G3YL 1X5KA 5IK3B 4TSBL 3V0WL 3ZT6A 1QFWL 3V9FA 5DD1H 3ZTNL 3VFPB 5ID1B 1S78D 1RULH 1FL5B 3K0WA 5C0BA 4NNYA 4C4KO 2DKMA 2Z93A 5JMOC 5K9QI 2J5LB 3Q1SL 4H20L 4OLVH 4PY7A 4A6YH 4AYFA 1NJ9A 1EO5A 5C0RH 2VH5H 3U30B 3DMMA 1A9BB 1IC5L 2P5WA 1U8IB 3EIFA 2LVEA 1JRHI 4HX1A 4XC3L 1LEGA 3L3HB 4PJBA 2NW2B 1JIBA 3MXWH 2NW3B 2W9LA 2I24N 1Q9OA 3AXLB 3W0WB 1MCEA 4E41D 2BOBB 2VZVA 3MRFB 3MRMA 3TT1H 1P9MA 3GM8A 1VFUA 2L7UA 1WSST 3VFVA 3LMJH 4M62H 1I1RA 5D71L 5JHDA 3OKDA 1HHGB 4IM8A 5D2NA 4WUUE 1T03L 4LSVH 4QRRD 4FMKA 1RJYA 1JNNH 5FOBB 4WFFE 3REWA 1GZQB 4GAGH 4F2MA 4R7DA 2VR5A 4PJIF 5CZKA 3CVHA 1RY7B 4MA8H 4U3CA 2BSED 1Z3GH 4HIJA 2R56H 3KPOB 4ZOEA 2R2BA 1QVOB 1KPVA 2CR6A 1JF6A 1DFBL 1R5IB 3NIFE 1NGQL 3DXAD 3EHBD 3EYFB 4JPWL 4BQ8A 1FVCB 2VN4A 2HRPH 2GFBA 3JWDC 5L7XH 4BELD 3BP4A 3D3VA 3GI9H 4P4RB 5DD3L 4UIMB 3ULVF 5GS0C 5JW4N 3MLZL 1QQDA 3CZJA 4OFDA 5FGBA 3DURA 2FX8L 4OF7A 4YXKL 4I3RL 3BSZL 1JGLH 3WKMH 4EI5B 4OIIL 1KACB 2CK0H 2V5YA 2AAVA 1UACH 5HDQH 1E6JH 2X1WL 1WZ1H 4PJAF 4XCEA 4XVSL 5DMGD 1CR9L 5BQ7B 1CFQA 5ISZD 3T4YA 2GJ6B 1T5XA 4HJGA 4J4PC 3OMZA 1MRFL 3IJYA 1Z9MA 3BGMA 5F7EL 3QEUB 1F90L 3V0AC 5KS9F 2GITA 4Q6IC 3ZDYF 4DOHB 1O7SA 2YWZA 4UDUA 1NUGA 4ELKA 3JXAA 4V2BA 2HYMA 5IBUG 1PEWA 3C5ZC 5M94B 4ERSL 4FFVD 4P23A 5F1NA 3V6ZA 5D7IB 4P9HC 3DIFB 3U2SA 2XFXA 2LE9A 1TPXB 1LO5B 1KT2A 2OCFD 1WEJL 1RZGB 1A6AA 3IFNH 3HMXH 3JV4B 3DX9A 4MD4B 5DYOA 1FZMB 4WEMB 2EDTA 1M7XA 3SE8L 3S37X 5I8KH 1IMHC 1YEIH 1SJEA 2V17L 3OKKA 2JELL 3UDWC 3MYJA 5JW3H 2MKLC 2JB5H 4LCWD 1A5FL 5GRWA 3RVWD 3SDXB 1EO7A 2CLZA 4GAYA 3QDGD 5HYQB 5B3NA 4HJJH 4PRAA 2W60A 4HFWA 4PJBE 4OQ1A 4M4PA 4NO0D 2EH7L 1OT2A 3QQ4B 4GMSL 5IBTL 4X7TB 1YEGH 4Q6YA 5D1QB 2EDBA 2IFFL 1LO2L 5IB3A 2IQAA 4FZ8H 4NHUB 2XT1B 4PJCF 4ZFZB 5F8RC 43CAA 3VXUB 2R4SH 5IFJB 1I8IB 1ND0A 5E5UB 4YHNA 4MQ7B 4XVSH 1QBAA 1S3KH 3FZUD 3M45A 1F13A 3HE7B 1FNLA 2BOCB 1M6OB 5I2IA 5L2KD 3MOBH 2BNUB 4K55A 4KVNL 3M8OH 1TNMA 4BSJA 1U8LA 1NQBA 3UO1L 2AQ1A 1UXSA 2O5XH 2A9NL 3WEXA 4N8VA 4PB0H 5T33L 5EUOA 3B3IA 2C3VB 1NC2B 3CSYB 2Y7QB 3FONB 3QIBB 4FQ1L 2EDQA 4L9DA 1IAOA 3WYRA 4QXGL 1AO7A 5DYOB 4JAMA 3NCYS 1MCIA 2BVEA 4WGWB 3KLAB 3IFOB 1D7FA 4IJ3B 4HF5H 3PNWB 1M7IA 5FB8A 1SJHB 4J3XA 3PXHA 1TPXC 5JW5B 4F58L 5BXFA 3MRLA 3PGCB 5D7IA 2MFNA 1A6WH 4ZD3L 4DOHE 2VABA 3TBWB 3QXUA 5GS0L 5DJ6A 4LQFL 1B2WH 2NY5L 3BH9A 1SMOA 4MHHG 3AREC 4I0CC 3ULUD 2IADA 3VDCA 3ARGD 4UU9B 4Z0XA 2VLJE 1LMKA 2I5YH 4LPTA 2JIXB 4L1HA 4RA3A 1GAFH 1CIUA 4PV9A 2BZDA 3BE1H 4JPKL 1A7BA 1IGIH 3MRKA 4UT9L 3GMNB 3SDDD 2X1QA 3LQZA 4GRLC 5EFIB 3H9SB 5CCKH 1BMGA 2XY1A 5LWYH 4CVUA 5ID1A 1N59B 1A7RL 1NBVH 1H3UA 1EERB 3O4LB 4ZO9A 3SGDH 4L4TE 5LAXA 3O45B 3PHSA 2BY1A 4EXKA 2IFGA 4QF1B 4JDTH 4UINL 2AEIT 4P23D 4ZYKB 4JG1H 2B0SH 1FPTL 3IDXH 4PB0L 3HC0A 4P2RB 1TQBC 4DEPB 3D39D 1YEKL 3MLUL 5I1CL 3C08L 1MI5E 4CUCA 2AV7B 2YPKA 3VXUE 4LCUA 4M6MH 4TUOB 4YHIA 1DLFL 2P24A 3MLYH 1NCCL 4GKSB 1YMMB 2HKHL 4Q58C 3SE8H 4TVSa 4QXUL 1EZVY 2OL3A 2VDRH 3RIFK 2UYLA 3CZFB 5JMRA 1RJZA 2DDQL 4WJ5A 2FRGP 3KYKH 3WFHA 3BGFB 1OTSD 5FOBA 3KDMB 3IVKB 2EDFA 4HEME 1CL7L 5F88A 1JWMB 4HKZB 5I1HH 4PGEA 1FZOB 4XGZA 5GRXG 4Y2DD 1FQ9C 3IU3A 3O9WB 5FM4A 4JO3L 5IBTH 1OLZA 1HXYA 2HFEB 3ZTJG 4IBLT 3S6CA 1U3ZA 1ODAA 2NTSP 3TJEH 4XHJC 1NUNB 3D69B 5BZWB 4HFUL 2ZCLH 4TUJA 3ZT5A 2H9GA 2R0WH 4DGVL 2QADD 3BZDA 4G9FA 1W0WA 5EZJB 1CYGA 5L6YH 3C8DA 2A0LC 4ZUTA 4GLRH 4FQJL 4DN3L 1HXMA 4OLXL 5SV3A 4Z18A 2N7AA 3GKZA 4E41E 4Q6IA 4KK8D 4JFYA 2ARWA 9CGTA 5FOJA 3DBXA 3QIUB 1X9QA 4MNQE 2D31B 1BFTA 4PJFE 3OKLB 1FG2A 4YX2H 1F4WL 2GI7A 1CBVL 3FO1A 4OCWL 1MSPA 3PWNA 4QNPF 4M1CC 1QFOA 4NQSA 4F9LC 1WBZA 3MODH 2DBJA 5CP3A 1I3GH 2WBJA 5KG9B 5ANMB 4QOKD 5C0JB 5IEKA 3HI1A 3GKWL 4WI8A 5IB2A 4G5ZL 1N5AA 1T4KA 4B50A 5SWZB 3WFCH 1IC5H 4OIBA 3TIEB 4YDVA 2KBGA 1R3LB 4YGVB 4LPWA 5JQ6H 4FABH 4PBWD 3WNMA 3K8LA 1UCBL 2OR9H 2YZ1A 4J3TA 4OCXH 5D7LB 4GRWF 3TPUB 2IH3A 2G2RA 3AC0A 3RWEA 3VWKC 1F3DH 2VXVL 3L95A 1UCTA 2AXGA 4KMTH 4GKOA 3G6JA 4XPFH 2CRYA 2DLGA 4NQEA 3RGHA 2NXYD 3RBSA 3QA3A 1QD0A 4RA0C 3MLVH 3P9LA 2VWEC 1MPAL 2V7NA 2VOTA 3QIWD 4ONOA 3GSQB 2O5YL 4CADA 1FZJB 2PW1A 4P2RD 3D25A 3TVMB 3MMEB 3D39B 3BRFA 2X4RB 1QOKA 4NKMB 4LHUG 3BD4A 1I4FB 2GSIB 4ORZC 5I8EA 3IXAB 4ZMAT 4MJ5B 5C0AD 35C8L 4KKLD 5C0JA 2VAAA 2F15A 3OAZH 4HCRL 1RZKL 1TQBB 4LFHG 5L7XL 1A2YA 4UDTB 1R0AH 4XX1G 4NQSB 2L7JA 3ARVA 4F7EB 1BAFH 3ZKMC 5DJCB 3MLTB 4YHZL 3IDNB 3TA3C 2QLVB 6FABL 3BEVB 5HSFA 5CS7A 4YX2L 1Q0YH 4KHXL 4PR5B 2AJXL 4YXHH 2D31A 2XTJC 1WFOA 5MEQA 1T5WA 3SDAD 2F19L 1IGMH 4YC2C 5EO9A 1WBXA 5CP7B 2ADGB 5D7KD 3C8HA 2FB4H 1A6ZA 1B88A 3JV0A 4ONGL 3V6OE 1JFQH 5ERWB 3DVGB 3WIHL 1HQ4A 1AO7E 2CR3A 2FATL 2NXYB 5HVWA 4FS0A 2ZUWA 2DIJA 2CLVB 3ARBB 3V6OC 4D9LH 5EU5B 3AREB 4ODVH 1ZVYA 3R0MA 5D1QC 3B9DA 1S7WA 3CFCL 5CEYA 1CG9B 1OAQL 4JHAL 2GYSA 3MLVL 5HYEA 4BH8A 3SCMB 4XVJL 2XTLA 3EYQC 4ALAH 5AD0A 2BVPB 4DGIL 3V4UL 4PGEB 4OFPA 2EEBA 1OSPH 1F11A 3RQ3A 1WBYA 3MV7D 5D70L 3T8XB 8FABA 3PNWA 4RWHA 3O3BA 4G6KL 3I3EA 3O3AA 3SDCD 4GS7B 4H26B 1FVEB 1F6FB 1T0MA 4E0RA 1H8SA 2XQYG 1F3JB 5DMKA 3MRRA 2NQCA 4PTTA 1HI6A 3W9DA 1RZJC 2FD6H 4NHCH 4PG9B 1MJ7H 5EZIL 3QIBC 2NNAA 1HOCA 3EOAA 1J05B 3PWLA 4XZUB 4XVUC 1XGQB 1RHHA 4CMHC 2CXGA 4YBLB 5TQ2H 3B8YA 3WLBA 3MJ9A 1KXTB 1KELH 4P5TB 3IT8D 4I13B 4UV7H 3B43A 3ZE1E 5I16B 3FQRA 1JV5A 2E27L 3ARTA 5CKAA 1J0KA 3LDBC 2AK1H 1MCOL 2AJSH 4NWTL 3O6KH 3MXVH 3EOBA 5F9WB 5C9JB 3IS1X 5AAWA 3NFPB 1J7VR 1WT5A 3FQWB 5HHPA 4APQD 1U3HD 1PKQE 3I6LD 3OJDA 1GZPB 1MCFA 1PZ5B 1CDBA 4OCMC 5F88B 2DMCA 1KB9J 4E9LA 3ZL4L 1NMCC 1D5BA 3P73B 2YBRA 4P4KD 4LVOB 1U3HA 3X11B 1T21A 4JGUA 5AWNL 1KCLA 2WP3T 3KPRE 5FUZL 1H3VA 1YMMA 2BHUA 2P24B 3HZYB 1TFHA 3RWDA 1MVUB 2N4IA 2FB4L 1DN2A 4PJ8B 1NMBL 1A14L 1VA9A 2GJ6E 3B9KD 3LN5A 4JFDE 3ARPA 1JJUA 5J1SC 4LLWA 4QXTA 1BLNB 1YY8A 1A6WL 1JI2A 2APVA 5GISL 4GG6B 2Z35A 5JZ7C 4ZYKA 4FG6D 4NGHL 4LL9A 2YMXH 5E2WL 4PRDA 2NLJB 3QYCA 1FAKT 3L6FB 2O61A 1GGCL 1KTRL 2KPNA 3UTQB 4P2QE 1N59A 1NMCB 2R2HB 3KPRA 3U9UA 3T0AA 5GRVK 4TULH 4XHQA 4S1RL 4G6JH 3H9ZA 4ZO7A 2H1PH 2CRIA 3TV3L 1JWUB 5IKCB 5EOTA 1BJ1J 4AZ8A 4L4VD 1AD0B 4GAJL 4P2QA 4S1SL 5I8CA 2WIIA 1UWXK 3EYOB 3O2VL 1CXEA 1JHLL 2IAMA 2SEBB 4MA7H 4QWWC 4RIRB 1L6ZA 3OR7A 3GGWB 5F3HB 5DJ6B 5DSCB 1G1YA 2DQGL 5HVHB 5J06A 3QUXC 1RIVL 4YHLH 1FDLL 2CO7B 2VNCA 2WMPA 3KR3L 5D7KE 4YAQB 3ESVF 3CXHK 4QRPE 5GRVL 1CZ8L 1N7MH 4ETQB 3NACL 3HFMH 3QPQD 4DTGL 4HAGA 4ZNCD 5IJVB 3ZKXC 1IGFL 1FE8L 4OCSH 2XXMB 3UXFA 4JHWH 3LD8B 4GAYB 1CL7H 4WEBL 1P2CB 1FNGB 4IRSC 5DHVH 5IW1A 4Q9BA 5C70A 5GGVL 4Z7VA 4LKCB 1AJ7L 3GMRA 3QRFM 3CFKA 4JDTL 1EVUA 2XYCA 5E94B 5DFVD 1VEOA 3HE7A 1J1OH 3RGVA 3RKDD 2IMNA 1QHOA 1KTKE 1B4JH 4XXDB 1JPTL 5BZDB 3C5SA 1BD2D 4KUCD 4KC3B 4R4BB 3U2SB 1CXHA 5CHNA 3NAAH 43CAB 5JPMA 2FLBT 3QUMA 1NSNH 1NEZA 3TA3B 3C09C 4X7TA 1SYVA 1TTFA 4X6DA 4GAJH 3WJJC 1G7LA 1G7HB 1I9JH 1XF2B 5MERA 4P3DB 1CLCA 4RQQA 2EYTA 3O81A 4TNWK 1S7RB 3UJIH 4JFED 2DQEL 3FB6B 5ADOH 2G60H 1JF1B 4UUJA 4C83A 2B8OT 5JUEL 1AD0A 3IFNL 2W07A 3OPZL 2W0KA 4R96B 4JY4B 4XPHL 4OT1L 3VXTB 4R8WL 1NKOA 3ES6B 5D9SA 3BPLC 4F57L 2CPCA 5DURD 4N5UA 1GPOH 1J0HA 1UFUA 1PFCA 3B8SA 3TVMC 2X4OA 3DX9B 4XRCA 3L5IA 3JUZA 3NOIA 3W82A 4YHLL 3M17B 2CQVA 4OCSL 4OLYL 4YHPA 2AEWA 3ESUF 5K59F 1A6UH 2ERJC 5C0CA 4D94A 5CEXA 3KYMB 2XPGA 5FYJL 3ZDZF 4KJYA 2Y25A 3AGVA 3PL6A 1TVHA 4OFVA 1S7XA 4NRXA 2YZ8A 1KJVB 3F6LA 3PDGA 4YNYB 1FE8H 2D4FA 5IEHB 3OB0H 1CD1A 1D6VH 4U1GC 5E8DL 1I7TB 3L5XH 4K71B 5CKGA 3B83A 1KJ2H 4QRPB 3VE0B 1BF2A 3KPNA 4BSVB 4QGYA 1UENA 3BN9D 3BPNC 5CJQL 3F5WA 2Q7NA 4XPAL 1A64A 5HYIA 1TQCB 1ZSDA 4DVBB 5D2NB 1RFDH 5DEGA 1R3JA 3I6GB 2YPVL 3UZQA 4OCXL 5FYKU 3B6SA 3KJ6L 4MAUL 1IGCL 4Y16A 2VXSH 3MJGX 4GOSA 3U4EB 4XMPL 4U05A 2IBBA 5KSBF 4RGOH 3E8UH 1S7UB 1W8OA 2NY4B 3SGEI 3STZA 1G0XA 1QLEH 4KDWA 4NM4H 3C60D 2QQLL 1I7ZA 2GSGA 5J8OA 1CFNA 2X09A 4JQVC 4FZ8L 5JR1L 2P47B 1B2WL 5HJ3B 2YSSA 5D2LF 5I1JL 3HZMA 1XGPB 5B22A 1TNNA 3S37H 2HVJB 3GK8L 3WDHA 4NQDE 4X4ME 4XBPB 3VI3F 1UKQA 5DMKB 2BSTB 1GGBH 3OKNA 1DBMH 3LPGA 5ENWA 2F53B 5JDSB 4FXKA 2Y07H 1KTDB 3FQTA 3O3BB 4O2EB 3I85A 1XCQB 1QEWB 1RJYB 4XNYH 2HTKD 2WANA 1XH3B 2AXHA 1C08A 1SYSB 4HK0B 4MDIB 2AP2A 5F89B 2XN9E 2AKRA 3A6BH 4JFOA 1J88A 1PG7X 3BW9A 5EWIL 5IVXF 3UTZB 1WWCA 2BOBA 4X9BA 4ZAKA 5ECJE 5EU5A 5JOEA 4YDLB 2NW3A 1G7PB 3PP4H 4NP4L 4JFZH 4IMLB 1X5FA 3LRGA 3HZKB 4JO2H 4ZTOH 4J3VA 4WTZG 4ODUB 1E27A 2DLIA 3DGCR 4IMLA 5KVFL 1I8LC 2B2XL 2QQKL 5TH2A 3EW3B 3TGXA 5JA8B 4LQ1A 4OD1H 1HH9B 4AJ0A 2IC2A 3ZKXB 2ITCB 4G6MH 5F9OH 1IZJA 4FNLH 4FQQA 3GFUA 5C9KA 1AGBA 3WE6B 1CF8L 4HLZG 4Q0XL 1QRNB 5ICXB 3HAEG 5DI8B 4NO2A 4C56A 4DN4H 4DZBB 3TN0A 4JY6B 3QZWG 1MFAL 1X6LA 2DD8L 1FFNB 4PJIA 2JJTA 3UTTE 2B1HL 3A6OA 3FMGH 5F9DC 3CNKA 3BP7B 4Y4KD 5HGDA 1S7QB 2XRAH 4KY1L 4P5KA 3LKQA 1LO0L 1FFPA 2A6IB 3RL2A 1H15A 2DRUA 2Z4QA 4WFEE 4XB7A 4KROC 4HUWA 5I75B 1KLGA 3U46B 4XP6H 4QNPE 5DO2D 5DC9B 4X6DE 1Q1JL 3C5JA 1NBQA 3LN4A 3Q48A 4PJAB 1X3DA 4JRXB 3KXFB 4MA8L 1FHGA 4DKEL 1ZA3A 2HFTA 5D7IE 4ZFOL 5IBLC 3T09A 3QHZH 1CGTA 1MFDL 3HS0B 2BC4A 1A3RL 2HP4A 1ZK9A 1WISA 1TETH 4L4TA 3RU8L 3VXPA 1HIMH 4KPHH 2GK2A 5DK2A 4LVEA 1L4IA 3UPCA 5AWNH 4H88H 4GS7C 3PE9A 2UUDH 3U36A 3RNQA 1DQJB 3L3IB 4JO3H 5F1IA 4GQ9L 4L3EA 3BH8A 4JQVA 1GJIA 5D5MF 3BMVA 1PZ5A 4U1LA 1KF9B 3IDMA 3S34L 4W6WB 4J8RA 3UBXG 4BKLA 4GQPH 4NBZB 5BO1L 3BSZH 4ZODA 5J6HA 4JQIL 1P1ZB 2XWJB 3H8NA 4QTHA 5DQ9B 4OLXH 4PJ7A 1D5XA 1XIWB 5GS1B 4O5LL 2F74A 2NYYD 1UYWL 5SWSA 2UVFA 4G8GE 1BX2A 3BZEB 2OK0H 3EYSL 3JVGC 4Z9KB 5C0CB 4LSPH 4QHNA 1MFCH 5F7NC 3PP3H 4MAYB 2JJSC 3RZCB 1L0QA 2YC1A 3MCKA 3VRLE 1QSVA 2EXYD 1SM3L 3K46A 3GMMB 4KKBC 2WV3A 1BECA 4NM8L 4U6XB 2PTTB 3AB0B 4IRZL 2ZUUA 4MQXD 2V5RA 3BQUC 4ZTOL 5E8OA 2CJUL 3MLRH 4JN1L 2BRQA 4OBSA 1UWGH 3P3YA 2X4SA 5D7LD 2UZXB 3GSRB 4HAFA 2JTDA 2FO1A 2F54A 4CMHB 1PVHA 1N6VA 3JV6B 4Z7UF 1G7HA 4TVPL 4NNXA 4U0RB 4I77L 4KTDL 3G6DL 3L3IA 4HHAB 3WFHB 4L9LA 1A7QL 4LU5L 3AREA 2CDEA 5AYQA 2OR9L 4LCWB 1KIRB 3JZ7A 3FN3A 4HWBL 3VXSB 5K9OA 1T66C 2I07A 3EGSB 3LH2L 3STLB 1EHLH 4WRLA 2IG2L 3FRPA 2GY7B 4IRJD 2E7LC 5GIRA 3IDGA 2V5MA 3CLEH 1JP5A 3HS0A 1S5IL 2VXQL 1A4JA 4OGXH 5J7CC 2FCBA 2C1OA 4F7CB 1DUYB 4PG2A 4ZDHA 1DCLA 3FKUS 1M05B 3O4LA 1P7HL 5FDYA 1XIWC 2ZPKL 2HVKB 5BVPL 3C6LA 4O02L 5HI4C 5EUKA 1LO0H 2ARJQ 3T1WA 1BBJA 4O9HL 4HS8H 35C8H 2EEAA 2GJZA 2E9WA 3C8KB 4QRRE 4HH9B 3TO4A 1J12A 1SVCP 4X6CA 2X4RA 4NKMA 3QG6B 3LVEA 3W0WD 1FPTH 2MHAB 3HNVH 2YN5A 4EBQL 5CEZL 3T2NH 3VFSB 4TSCH 4JY5H 1YN7B 5EOCH 5HDLA 4QRTA 4HV8B 1ZWIA 3SDCA 5E8DH 3O8XB 1CDUA 5DFWH 4ESKA 4NSKA 3OKEA 8CGTA 3G6JB 1BD2A 5KBNC 1A1NB 1R24A 2ORBL 3MA9H 4GBXD 5DVKA 4XH2A 3TYFB 1PKOA 1YC8A 2E6QA 4KJQC 4U7KA 1K6QH 3MBEA 1IKFH 4LLVB 1YDPB 4MMXC 5EOTB 4EQ3A 5E4EC 2PYED 4Z76A 2B4CC 1LO4H 1X5ZA 2D0HA 5E8PA 1FO0B 4MWFB 5B39G 5I1DA 4LHQB 5FYLD 5C6TH 2R0LH 5J11C 3MOBL 3GSUA 4G80A 3CXDL 3SE3C 3VGFA 4LAQH 2XICA 3WLWD 3VFMB 4BK5A 3VJ6B 1ZHKA 4YFLF 2DDQH 1QSZA 3MV8E 3GMLA 2Z35B 1P4BH 5I17B 3K8KA 4ZPVA 1IJ9A 1NLBH 3WS3B 3O2DA 3WFEH 4HS3A 1H3GA 4W4OC 1NLDL 1CFTB 4PB9L 1ED3B 2I26N 3MR9A 5JDSA 4JKPH 2HLAA 4UQ3B 2V2TA 3NBNA 4XBEH 5EO1A 3LEXB 4GG6F 4J2XA 2KQNA 1KBGH 3CFIC 4NBXB 3MNZB 1ACYH 4XC1H 1KENH 4KJPC 4L9LB 5GZOC 1FP5A 4ZTPL 5L2JB 2N56A 4PRBB 5CWSA 1U58A 2EDDA 4YDJB 5TGBB 2EDHA 1RPQA 3TV3H 3OL2A 4HIEA 1QBBA 3QIUC 3RVVD 2CUMA 2PYEB 4F7MA 1NMAH 1GC1H 4WFHE 5DHVB 4UAOC 2DYPD 4I0PC 3LN4B 5IHUH 4LSUH 2P8LA 4FXLA 5GS3A 4GW4B 5CSZA 3WLBB 2VDKL 2OL3L 2IAMD 1A1OA 2Z4QB 5DQJA 3NIGF 1F6AA 1WCQA 2DQGH 3P9MB 3WHXB 2F8XC 3KPNB 4KWUA 4Q7DA 5IMOB 2B5IB 4R6UA 5CZXC 5I1LA 1F3JA 3W9DB 3S36H 4Q74A 2XWJA 4Y5YA 5TDOA 4YK4C 2VO5A 1QNZH 2VLRA 4L1DA 5HTSA 4FQ2H 3O6FB 2ZUVA 1LILA 5C0BE 2BHZA 3MLUH 5F96H 4XP4H 4OM1H 3EJZD 3RTQD 3ARGB 3ZMRA 4LVHC 1LEIA 1YEFL 5KTEH 1D5ZB 4U1LB 2EDYA 1Q9KA 3HLAB 1D9KB 1L9MA 3LV3B 4G6JL 1N7ML 5HVFB 5CEYB 3HN3A 2Q6WA 3X3FH 3RWHA 2NXZB 1JWSA 4YGAB 1MJUL 3DJ9A 3JTTA 4HXBH 3HUJB 1G9NC 2X7LA 4NCC1 1KPUA 1P9MC 4LLQA 2X41A 4E5XB 1MF2L 4DEPC 4LHUD 1GGUA 1EUUA 2MQ3A 2Y6SD 4N0YH 2W1NA 4HIXH 4R90H 1BPVA 1KENL 2V7HB 3VWJC 1F4AA 5DLMH 4K7PL 1TQCC 1KYOK 4ELMA 1GOFA 1A02N 1LO3H 1N6QH 4X7CC 4RQQB 4WW2C 1RV6X 3S7GA 3OR6B 3O6ML 4JPIB 1MAJA 2EDLA 3MLTA 2J1KA 3HB3C 3N50A 4LLYB 1SYVB 2YD7A 1MREH 2D2OA 4G9DB 4BZ1L 2AKRB 5I8KL 1NAKH 1YEGL 4M3KB 1J9CT 1V05A 2PUQT 4RGMC 3JBG7 1CICA 5FF6A 5B4MC 3GRWA 3SJVA 5FA4A 3LOWA 3WFBH 5ICZA 4L8SA 4PGCB 4UTBL 1G7MA 3GEWB 4JJ5B 3EDEA 1T7YA 4FXKB 4YEFA 3ULVD 3O11A 4L8DA 1T0PB 1UZ8A 3OWEA 1WAAE 5IROA 2XN9A 3QUYB 5K9JL 1RUKH 4N8VB 1V7MH 4ZOBA 1EEZB 4JR9L 5E6IB 4LLYA 5TE4L 4MA3B 1I1AC 3DUHA 5F70A 4H1LG 1A3RH 4JHWL 3F12A 1RZ7H 1FL6A 4LSPL 5EORH 4KRPD 1P5VA 4LSRL 1QSED 3EO0B 3L3GB 2AXGB 2V7HA 2BFVL 3IDIA 1CQKA 1DEEB 1ZVSA 1MHEA 4U0RC 2V2XB 3QFJB 1CGUA 2IH3B 3WSQL 3CVHH 2C3XA 1EEUA 2HKFH 1NMAL 5EBWA 4KZDL 4DVBA 5I19H 1KELL 4ZG1A 3GSNL 3ZYZA 5A3ID 4M00A 3KLHC 1WUNT 4MZ2A 3F5WB 4UNTA 2IQAB 4MS8C 1VFAB 5H94A 3HPJA 3QJFA 1MJ7L 5JIKA 4LLMB 3LV3A 3E2HB 3VXSD 2GTWB 4DKAA 2PXYC 1WWBX 5C0IA 4XCYB 3H3KA 5KOVC 5FYJD 3BT2L 4RFEB 5B21A 4U1JB 3KWWB 4OZHA 2QR0B 4PRIB 2IWGA 1JGVL 1XCQA 1CLOH 3PL6B 3NGBB 3ILPB 2P7TA 4WTWA 3KJ4B 4KQ4H 4HUVB 2CUHA 1F45A 1U93A 5DUBB 2X5PA 5D7JC 3VXOA 3WNOA 4Q97A 3D9AH 1T04A 1PX3A 3BDXA 1U95A 4HUNB 2YSSB 1SMAA 3MZGB 1U8PB 3E6HA 1K2DA 3UTOA 1FLRL 2Z8RA 3DX6B 5EBLA 3BIBX 1IQDA 4LSSH 2ZCKL 4Y19D 1INQB 2OTWA 1ZHBA 3NIGE 5FYKL 3KS0J 1RZFL 2APWA 1FYTE 2C4FT 3NZHH 4AQ1B 3FFDA 3GSWA 5TPWH 2DQTL 2EO1A 1MI5B 5HVHC 5I30L 5AUMB 4NDMB 1T03H 1SBSH 3S5LB 5D72L 5C0CE 4NZDA 3CSBA 3LEVL 4JRYB 1E4XH 1U6AH 4Y8AA 1KCVL 4WW1B 2Z8VC 3G5ZA 5E2VL 3QDMD 4OB5H 1KLUA 5L2KA 3QEQE 2ATPB 3LKQB 2J6EL 1U8MA 4RMSA 1S7QA 1I9IL 3LDBB 4X5XA 3FFCA 5CEZH 3T77A 1KCSL 2WQRA 1PDKA 2X4QA 3NCCB 4HS3B 4UIKL 3U1SH 5DR5H 5DJAA 3RI5K 2OJZL 4XNXH 3PJSB 3ZKNC 1FAIH 4ZXBD 4BFEA 3V4PL 1MWAL 2CDFB 3RHWK 1PYWA 5FUCE 1R5WB 4P5TA 3DSFL 4FQQB 4JCMA 5H94B 3LSOB 5HGHA 4YHPB 5E99H 4DW2L 3TJEL 2JJUA 1FIGH 1T7VA 2QQKH 4CJ1A 5EA0H 1ZVHA 4L5FL 4KRLB 4GUPA 3MRPA 5K9JH 4PJ8C 4ETQA 4KUZH 4DVRH 1ZT1A 4TOYH 1HH6B 5DRWB 4RNRB 1PY4A 3INUL 1JF1A 3QNZA 4U1NB 5EUOE 5JW4R 2BVPA 1H3WM 4NSKB 4QO1A 1KPRA 4M93B 3VRJB 1MCKA 2X4TB 4Y4KB 3UPRB 3VFSA 3UTZA 2CRZA 3QUMB 3IAGC 2SEBA 4RIRA 1GCFA 3QEGL 1IFHL 1EO8H 1YY9D 2AEPL 3PIQB 1IGYA 5DZLA 3VFWB 1RU9H 1ZTXH 2VQTA 5GGRY 2H6PA 1LEGB 1U91B 3L3HA 3Q6GH 1KN4H 1KBGL 4HGWB 3NCFB 3S4SG 3RTQB 4HGKC 4RGNB 3EJYD 1F00I 1DUZB 1ZT1B 5C3LD 1T1ZA 5D1XB 4JAMB 1L0YA 1QUNA 3N9GL 4ISVB 2X10A 3OHXA 1KOAA 3WL9A 3ZSTA 3CUPB 2QHRL 4P0DA 1N0XH 3VXSE 1J0JA 5I1EH 2FYYB 2HT4D 3PGFL 4EDWL 3MSPA 4DKFH 4ZDHB 1BQHG 2WWKT 2EDRA 4PRDB 5FHAL 2WLZA 2CIKB 2CDFA 3MJ7A 5DJ0A 5BRZE 3NMEA 4NUGL 3L3DA 5F7YC 3TJHD 1QFUH 3QDMA 3STZB 2BNUA 2VDPH 2OJEB 4HKXA 3TNMA 5KW9H 2BOCA 1VPOL 3VG9C 4Y89A 2R69L 1G9MC 1CS6A 1E0OB 4Q9CA 4KHXH 3V4PH 1Y6KR 1MVFA 3I3DA 3SCMC 1FLRH 1LDSA 5KAQF 4PLJC 1U8HA 1DP0A 1DL7H 1KFAH 4N0CD 3VFTA 1CGXA 2F58H 2IALA 3RFZC 4LMQE 3IFPA 3VG0L 5D1QA 1H9VA 3W5NA 4P9MH 5KJRH 5GGSA 5KVMC 1HE7A 1S9WB 4IMKA 1T1XA 1BD2E 3K3QA 1FC1A 5E2VH 2KZ1B 2XI9A 4LSUL 4ZSOE 4A2LA 1S7XB 4Y5YB 4NO5A 5TDOB 4K8RD 1TCRB 2YEZA 4QRRB 3SKJH 3SQOH 1NAMB 3CX5J 5CILL 3QEQD 1MFDH 2DI8A 1G9ML 1EFXD 2NY4D 2R1XB 3UTQA 1HKLL 4QHNB 3EYVA 4IEFB 4PRHB 4Q9QL 3KHOA 1Q94A 1AKJB 4LQFH 2HWZL 4LCIH 1KCUH 1ZLUH 4K3GA 5ILTH 2W65A 3I02A 4JFDD 4U1MB 4R90L 2PYEA 3T4AA 2VKWA 3CK0L 5DRXA 1N0XL 1XR9A 4OGYH 4UDUB 5FKPB 3QCVH 5I1EL 4BZ1H 2I5YL 2CUIA 5C08A 1W72B 1PLGL 4M3JA 4W68A 4F3FA 3AY4A 1IM9B 5C0IB 2A77H 4I5BB 3WNLA 3E3QE 3ZLQC 1EHLL 4MXQC 1UWXH 5EIQA 4JPKH 1T5XB 1A6TA 3TC9A 5H35B 3MNZA 5JPMB 1MLBA 4NQED 2E6PA 1U3HC 2H8PA 4XNYL 4F7TA 4KK5C 3KPPA 5HHMB 1N5YH 3VXPB 5GZNC 1EFQA 1BVLB 4LHUB 5CP7A 2WINB 3T3PE 1BP3B 1NUDA 2OSLB 3O0RH 5B39A 2IJ0C 2Z8WC 5E8NA 3N0PB 4XNZC 3EOTH 2FO4A 3IRZA 2BHYA 1R3HA 3FO2B 1NAKL 1BWMA 4PJAA 5B8CC 3CFEA 2CJUH 4L3EE 4DFIA 3MA7B 3BEVA 5JHDE 4W6YB 5E5RB 4ODSH 3VD5A 1OAXH 5EC1A 3OXSB 2MNUA 4HUWB 4R97C 5J12C 3X13B 1A2YB 3ZYOA 4RCAA 3WS6A 3QWQB 2CKNA 1ZGLB 2NY6C 4RGOL 2XN9D 4WY7H 2WBJC 3EBAA 2I60H 5IT2H 5GGTL 2OMNA 2XQBL 4K23L 1KEGH 3BP7A 3L1OH 2P5WE 3CDGB 4PJGF 4XPTH 4LPXA 3O6FD 5FFLA 5CSGA 2EXWD 1FC2D 5E03A 5FA3B 4MDJA 3ARFB 7CGTA 3IJSA 5IGXH 3HG1B 1BD2B 4OLZH 4Z78A 1VSCA 2FGWL 3KPRD 2DLHA 4HS6B 2EE6A 3SDCB 2G75B 5LKNA 5E8EA 4P2RE 5LGHH 4F7PB 3AFLA 5TE6L 1NFDF 5CFHA 5IJKA 3V4VL 3MRFA 1NC4A 2E8YA 4HPYH 3T0EB 2VLKB 3LAFA 2BY2A 3O6LL 3C5ZA 3UTTB 2NXZD 5D8JL 4XNMA 4R2GC 2OYPA 4JFEB 3JVGA 4PJDB 4X8JB 3WFDH 4MJID 1AP2B 4GKZB 2ZJSL 4HH9A 1DQMH 5EO9B 1DDHB 4Y16D 5GGVY 4FFYH 2G9HA 3QUXD 1EUTA 3IFLH 1NJ9B 4GBXB 3MREA 4UT6L 5D96B 2JIXA 1WTLA 1CFSA 3FT3B 4M43H 4TTDC 2Q20A 1M05A 3KXFE 3ALXA 2YKLH 1X5XA 3LB6C 1FV1B 3TBVA 4OSUL 4YXLL 4V1DB 4Y0GA 5DC4B 3HG1D 1P5UA 1U41A 4OZIB 3WS6C 4HS6A 4YHKL 4GG6A 1F58L 1X5YA 2W9DL 2HT2D 1GSMA 2JB6A 5ESQB 1T0NA 3IXAA 4NQVA 2HMID 4NRYB 2P8MA 4YBQD 5GGRB 4KU1A 1JGVH 3MMEA 2ENSA 1EPFA 1BFSA 3BZ4A 3L7EA 5IVZB 1NSNL 1AY1H 1CXIA 1F6AB 5D2LE 3S88L 1A1OB 5E9DD 3E3QC 5IMKB 1GVIA 1JF5A 5EC1B 4OLWH 3TWCH 5HHMD 1FFRA 5EZJA 1Q9LB 2C3GA 1I7RB 4MA1B 4S1DD 3SDDA 4HUXA 3GI8H 1HEZA 2C4FU 4PGDB 5E8NB 1FO0H 4RMUA 3ZTNH 1F8TL 2P5WD 2H2SD 3D2UA 2G2RB 4WU7B 4JDZB 2D7TL 1CGWA 5DEGB 5IESH 1Z0NA 2PXYB 2HN7A 3BX7C 4Z78B 1ADQA 4R7NA 3QRGH 3VA2C 4MDJB 3VXUA 4PTUB 1T89C 2ADIB 3KPSD 5E99L 1NFDB 1J05A 3PWLB 4N1CA 3PABA 3VWJB 1YQVL 4ZQKA 5EZLB 2PR4L 4P49A 5D7JA 4G7YH 3I50H 4JN2B 3ILQC 3TH3T 1KJVA 1YNKH 4WHCA 3GUTB 4PJ7F 4AENB 4PUBL 4ZPVB 1ZTXL 4AEFA 5EBMA 4P5MB 1LO2H 5LXGL 5KSAB 4L3EB 5I0ZA 4OLUH 2WINA 1F58H 4POZC 4XPBL 3SOBL 5C09E 3RJDA 4QLRA 4TSBH 4LLDB 4JFFB 1EBAA 2A1WL 3OZ9H 1MCPH 3QXDA 2JCCA 1OD9A 5EPMA 2P5EA 4IHOA 4EDWH 3DXAB 2XKNA 1TCRA 3O4OC 2EDJA 4NQDA 1PG7H 1DDHA 3BEWB 5C0RL 3SY0B 1MEXH 4FQIL 4KUZL 3TH2T 1U0QA 4WFFD 1BZ9B 1OAKH 3OX8B 2R0KH 1JZ4A 2BJMH 1A7OH 1NGPH 4FXGB 1SM3H 3SKNB 4PR5A 3U0TB 3HE6D 1BEYH 2FL5A 2ED7A 1M4KA 4ODWA 1N4XL 2UWEF 3KYNA 5MERB 1FZOA 4XGZB 3QPXL 1OPGH 3ROOA 3ARYA 1FCGA 1VEPA 5BS0D 2NR6C 2DQDL 1XR9B 1FYTB 2VABB 3GNMH 5D1ZC 5I6XB 1YPZA 2VDMH 3I75A 3HG1A 2EIZA 3N9GH 4KMQA 1WAAF 5D2LB 5IG7B 2VLJA 1HINL 4CNIB 3UTPD 4LHJB 3BN3B 1KN4L 5C0ND 3QH3A 1BBJB 1LEKB 3WSQH 5DI8A 3ARFD 3HC4H 2DQFB 4JRXD 3FT4B 4JE4B 2Z9TA 3K4ZA 1YEHL 1LK3L 2YRLA 3WXWL 4KVCL 4ZAKD 3VG0H 3GI9L 2BFVH 4FOMA 2A83B 1LQSR 5KS9E 1E28B 4WNQA 5D6DA 1D9KC 1ZLWH 4P9HH 4PRPD 4XP1L 3RL1B 2C1OB 2CDGB 1EHXA 1HH9A 1GGIH 4NFDA 4Y4HD 1IGJB 2ZZUT 4U1KA 1TENA 1V3JA 2X40A 2YD2A 3GSXA 2LQRA 4FMFA 3DYOA 1OM3L 1DQDL 3NFSH 2XA8H 3DROA 5MHSE 4MQ7A 3G04A 2L4OA 1NKRA 4HGWA 1OSZB 3WCYA 2A74A 4UV4H 1HDMB 2DAVA 2E7MA 2V2WB 4QHUA 1CGSH 4XI5D 5SWQB 1IBGH 1BEYL 1N5AB 1WFNA 3TO2A 1WFTA 3GGWA 5F3HA 2RQ8A 4M61B 5FM5M 4QGTA 3TNMB 3CFJA 4I9WE 3A67L 2WP3O 3IS0X 1NDGA 3F58H 1DBKL 1BJ8A 2LU7A 5C6PB 5CINH 2BCKA 4Z7NE 1OP3K 3QIWB 1O7VA 4UTAL 3QPXH 4X7SL 4OCNC 2DMBA 5DJZB 1KTDA 4O2EA 1QBMH 5E08H 3I02B 4N0UB 4I4WA 2ZUQB 4KRPB 3CUPA 3RUGB 4YIQA 5F7UA 1JGUL 2E5EA 1FL5A 4JFYB 5LXGH 1VB9A 3BISA 4MNGB 2C3HA 3KPRB 4TSAL 5T3XD 1OAYH 5KZCB 1EBPA 2ICWA 2O61B 2NLJA 1R5WA 3MC0A 4HD9A 3BKYH 3D85B 1BX2B 1AKJD 3DUSA 3LKSB 2WLYA 1LD9B 5KVFH 2R8SH 5CBEA 2PYEE 2H9GB 5D7SL 4EQ2A 2NY3B 1S7UA 2ZOLA 4Q0XH 3SKOB 2HA1A 1I85C 5T3XH 3B6SB 4K3JH 4ZUWB 4B0MM 4D9QE 1WF5A 4KVCH 5DD0L 3O9WA 3WUWG 5GJSH 2BXYA 4NBYB 3DVNA 4LSQH 3VI4E 4U1NA 5C08D 4LPVA 5GGSB 4FQXC 1U3HB 4XP1H 1KB9K 4I3GA 1FGVL 5BJTB 1V8HA 1OGTA 3SN6N 1CN4A 4QT5A 4ZUVA 2Q8AH 2XA8L 5GGTH 4KQ4L 1Y0LA 1BM3L 3MRPB 4QRPA 1MCQA 4RISL 5E4EB 4JM2F 3S5LA 5HGBB 1WC7B 4IIQA 4OM1L 5KS9B 5C2BH 1QR4A 1XFPA 5FXCH 4LBEA 2DQDH 1HINH 1ES0A 3Q6FB 4LRIC 2J5LC 1UB5A 3LEVH 1UVQA 3TBTB 4MCYB 1PYWB 4HKXB 3P11H 2PO6C 1WCBA 3O41B 4HBCH 5E7BA 4OF8A 4QY8A 4U3XA 2YK1L 4NQDD 3O8XC 1INDH 1QFHA 2GW5A 4JFDA 4DUVA 1UA6H 3R1GL 1GOGA 5ALCL 4KI5D 1A6AB 5GGTA 3VXME 3AU1B 1LP9B 1UEYA 2HTLC 5E08L 3S3PA 3EZJB 1U8MB 4LAJH 4OJFH 1KJMA 1S78C 4UZGA 5DS8B 4BZ2L 1IKNC 4WI9A 1WBYB 3IDUA 2GEEA 3ARDC 4D8PB 2DS4A 1Z2KA 1RK1B 2MPAH 3DUUA 3O4LE 1JMZA 3RZCC 5A43C 4QHMB 1AHWA 2EH7H 2B4CH 3WE6A 3CMOH 4LRNL 4PLKC 4Y4FA 1QBLH 1CG9A 3N1GC 4AIOA 3QJFB 3LPWA 2VXSL 4YHKH 2GJ6A 5HHNA 4LEOA 3HPLA 4OUUB 3RWFA 1X4ZA 3X17A 3PGDA 4M48H 3IU4H 3TZVC 4CVXB 1B0GB 2YRZA 2FSEB 3DUSB 5CHNB 1XF4B 3RWGB 3U0WL 3V52L 2DQIH 4PRHE 4HX1B 4KJWC 4G7VH 4OGZA 2VITB 2HJLB 3IETB 2F5AL 4S2SB 1ZHLB 2BVQA 3IKKA 2D03L 3GBNH 3WHE0 3IDIB 1ZEAH 3R06B 4NQTA 5FYJH 5AZ2H 3I2CL 5E94A 3S37L 2VZ1A 3CLFH 1BBDL 5DT1H 1DQML 3E1F1 2R9HD 5EBMB 2EZ0C 2QHLA 1M71B 3QWOB 4Q2ZB 2VSDA 5HHQA 3ULSB 4NM8H 1LNUA 3KPSE 3VFUB 3C08H 4GG8A 4K7PH 3FT4A 1G84A 2V5TA 1K8IB 2GTWA 4HZAA 4EN3C 3CVHB 1OVZA 4AM0B 4Z77A 2UZIH 4N0YL 5INDA 4X4YA 2QBWA 1P7KA 3H42L 3FO0H 1LE9B 3QI9C 4CVZB 1INEH 2IH1A 5JPNA 1NGZA 5KVDL 2X4NB 5CMAB 4G8GA 5KSBA 1IAII 4NKOB 2V2XA 4MAYC 2F9BT 4QXUH 4F80A 3T65A 1QFUL 4LNVA 3S5LG 2PF6A 4X99A 2FX8H 4TTGA 2VDLH 1IL1B 2FDBP 1MHCB 2L0DA 2DQIL 2XACC 3DRTA 4MJIB 2VDQL 5IFAH 1U36A 3QCVL 4WI4A 1TZHB 1AFVH 3OZ9L 3A6CH 1G6VK 4OGAC 1C12A 4K8RL 1J0IA 2LU3A 3L9RA 4PY7B 4LCIL 1HYSD 2AI0L 2UY7A 3QDJE 4LCCC 4JFFA 4YGVA 3D3VD 2P8PA 5DD6A 1VERA 3L3JB 2RHEA 4YR6B 3HG1E 4FTVE 5I18H 4LFHD 1Z3GL 4DKDC 3B5HA 4QCIB 1NGXA 2VR4A 4Y4HA 3P4OB 1PLGH 4HZLA 1BJMA 1NC4D 4NUJB 3SKMB 5ICZB 5D6DC 4XWGL 3T0EE 15C8L 3H3BC 5CJ8A 4PJHB 3FOLA 2PCPA 3CAFA 5IHBA 4AG4L 1CVSC 2A2QT 1IC7H 3VRIA 5A16A 2FWOB 3ROLA 2FJGA 4KAQL 4H0HB 3MROB 4PS4L 3RY6C 1FBIH 1LK2A 2AV1B 4IDLA 4PUBH 4ZFFA 1NBZB 2IANE 4M03A 4CGTA 3OX8A 3QI9B 2R4RH 1LO4L 4Q6IB 3WHXA 1XCTB 3RKDC 1HHHA 5E56A 5JORB 3QQ9C 1NGWB 2FNBA 1F3RB 3MLWH 3Q3GA 1G6RL 1KNOB 2IPKA 2VDNH 1EMTL 3Q5TA 4YJZL 1T2XA 4LLQB 3MJ8A 4D0CA 2EEDA 2VC2H 1ACZA 3FOMA 2YA1A 4HG4K 4WU7A 1YJDH 3STBA 4WENB 5B8CA 3NFPA 5LQBL 2R2CA 3RA7L 2Q7YA 3MLXL 1T3FA 2VB5A 1ZLUK 2J8UA 4IOSD 1G7LB 3V6BR 3FT2A 1MRDL 4LNRB 4PP1D 3EYFA 3EZ8A 5ETUA 5C09B 4XPTL 3QUYA 3GMOB 1AGEA 5DUML 5IVZA 3OF6D 3BZ4B 5D7JB 1BBDH 5FYLH 1U3JA 3S36L 2BMKA 4O5LH 1AGFA 3KJ4C 4JJ5A 3QUZD 2V6HA 1OCWL 5E6ID 1H8NA 2F53D 1AGDA 3VXUD 1WEJH 4TQEH 4O2CA 3S4SA 1N5YL 4KTEH 1A5FH 5F1SA 5DTFB 3VD9A 3PQYA 4JHZA 3ECBB 2J8UB 3Q0HA 4HGMA 3CIQA 1R3HB 3ULVL 4LKCA 3SCMA 1NANH 3O3DB 4V1DA 3E2HC 5DF0A 1JZ2A 2XZQH 4ZS6D 3F7PC 1ZE3C 4IIQC 4HWEL 4UT6H 5T1KA 4NN7C 4WO4D 6FABH 1ZGLP 1SHMA 4AL8L 4PRBA 3MGTA 1DQLL 3C2AH 1ZLWK 3Q3GB 1YDPA 4BQ6A 1XR8A 3WKNA 1NDMB 3O3EB 3GO1H 2QQQA 2F8VA 5HI3D 3BPOB 3G6JF 2PYFB 4ZO8A 4K8RH 2WSKA 3MACL 5EO1B 3ET9F 4L5FH 2AV1A 1C16A 4F3FB 1NCBL 4X4MA 4ZFOA 5FKAB 3MROA 4G9FE 4HEPG 3DXAE 3G08B 4NQVB 1BOGB 5K9KB 3QNXB 5TF0A 3UTSE 5CINL 4PP2B 1AE6H 3H9SD 5GHWH 4KI5E 2YPLD 3HLAA 1Z5LA 4XP9H 4UDTA 2VIRB 2J8HA 3VWJD 2E9IA 2IANB 3FB5A 3VJ6A 4J1UB 3BOVA 2EKSB 1HSAB 1SJHA 3W39A 1E4KA 4WW2A 4NKIL 1YEFH 5KTEL 4R4FH 5E2TL 3RJQB 2GJZB 5FHBH 5IHZA 3MUY1 2XG4A 4OZFH 4CMMA 4WI2A 3JWOL 2DM7A 1F02I 5ADPL 2Q8AL 4I0PA 5FGCE 4BFIB 4DQOH 2K3TA 4MJIA 4XXCC 4PJ5D 3WJLC 2MCPH 1A1NA 4RFNB 2XY2A 3FO9A 3GM0A 4MSWB 3MV11 5M7QA 3BPCB 3FO2A 4R26H 3W5MA 3QEHA 1V7ML 4WU5A 3U0PA 4QRTB 3WDIA 2RGSA 5DD5L 4PRNA 4U31A 3GSNA 4TSCL 2P49B 4IMKC 2MHAA 2DOCA 2UVEA 5KN5B 5KSBB 3BWAB 5GRJL 4JQIH 4ZFOB 5FAAA 4JZNA 1A22B 1I8KB 1JGDB 1EDQA 3U7WH 5ESVA 2CLRB 4JFPB 4KRPC 4XWOD 4OCRL 4DFHA 5GJSL 4NZJA 1MFCL 5F6IC 3QWRD 3C5ZD 2X9WA 2A0LD 3LS5L 1NL0H 3QQ4A 1W0YT 2Z31C 5IEKB 3W9EA 5IJKC 3JV6A 5EDXA 3B2UC 5EN2B 5CEZE 4KK8C 1F3DJ 2ZOKB 3EO1B 3NIDF 4G43B 1A6VH 3V0VA 3FHAA 1KULA 3G5VA 4MB5A 1LHZA 5INCB 3HNTH 3BT2H 2PXYD 2PTTA 3SHSA 3FQRB 4QHLB 3ARZA 1H0DB 1ZHKB 4J4PA 3QIUA 1S8DB 5BW7A 4PRHA 4U1IA 1CDIA 1YYML 1Y18B 2E7HA 5HYJB 1EZVX 2R1WB 1INDL 2VZUA 3GSUB 4NQXA 5BMFH 4PJ5A 5TDPA 1LO5A 4N0UE 3P0YH 1MFAH 2DICA 3U4BH 4YQXL 2LABA 4BUGA 4S11A 3PGDB 3HPLB 3RWFB 4X6EA 4HT1L 3LRHA 3NZHL 3QQ3A 5ETUB 3BO8B 4UB0H 4GW1B 4NCDA 1HXYB 3OQ3B 4U1SA 4Z7UA 4H25A 1KC5H 1II4E 3HC4L 3ZSSA 1W72A 3LZFL 1BVKA 1IM9D 5AG9A 4NFBA 3F7YA 4KK6C 5CIPA 2NY1D 4QHKJ 4TNWF 2Q3AA 3HI5H 3IAPA 3MRNB 4OZIF 3AU1A 3JWDL 2FX9L 2FHBA 4YHYC 2BRRH 1KB5H 2DM4A 5F3BB 5MEQB 3BZEA 3RGVC 2ZSWB 5FV2A 5EG6C 5MENE 1WCBB 2IPUK 3O41A 3QUXB 4Y1AA 1IEAB 4NNPH 1K8DA 4EVNB 1B6DA 1FL3A 1UB5B 3BYTA 3MNVB 4KZEL 3CLFL 1KPVB 1AH1A 4R4FL 5E2TH 4MXVE 1G7QB 4CN6A 2DQTH 2NY5H 5A2FA 2W0LA 1CGSL 5FGSA 1FSKC 2OMBA 1NCTA 5HGDB 2DMKA 3QCTL 5D1XA 4BJLA 3IFPB 3EDJA 2MCG1 2VAJA 2XOTA 4R4ND 4WW1A 3WO4B 3QDGA 1U6AL 1LDPL 3HKFA 3OGCB 1A7NH 3GSVB 1ROWA 1DN0A 3V5HA 1XEDA 4CADB 1X5HA 5BV7B 3ZKQD 4NT6A 4RRPG 3VGBA 3UPRA 1G0DA 3DRTB 3SQBA 4IOFD 1I3RA 2YXMA 4WWID 4P4KB 5D1QD 3RX7A 5BOPA 1JHTB 5C0AE 2O5YH 2YD5A 1NUFA 4WGVB 5DUPL 3HTLX 4MHHI 4RNRA 3KLAA 5H2BB 1F4YH 5CMAA 5HGGS 4UV4L 1ZXQA 3SO3B 1HN1A 3WL9B 5CJXA 4LVOC 1FZKA 3VFPA 2P7TB 4Y2DB 2XZAL 4U2YA 5EUOB 3MLYL 4DWHA 5CJBA 3NZ8B 1I9EA 5JDJA 3BW9B 5D2NE 4U33A 1GXEA 3O4LD 4J1UA 1PKQA 3MLSL 3P2TA 1O5DT 1YJDL 3P9WB 2BRRL 4TUKH 4X9HA 4MA1C 4ZFGL 1NCAH 3EHBC 4POYA 5C2BL 4P3WA 4TPRH 5EOQH 1CL7I 3TO2B 2DL2A 3CJJA 1MFBL 3QNXA 2NX5D 1VACB 2W9EH 1EGJL 5IMMB 3GI8L 1WFUA 3TFKC 1HDMA 4QHUB 4B5EA 2HRLA 4DK6A 5DDHB 5MENA 3MV9D 4L8SC 3DECA 1ZT4B 4NQUA 2HVJA 3MJ6A 3X3FL 3HZMB 3DVFA 4PJFF 3FN0L 3P4NA 2D7TH 1T1WB 5CJOL 2FHCA 4GLRI 3S34H 3NH7L 3G5ZB 4QRQA 3ARBD 5C7XL 3TIDA 5MEOA 3NN8A 3VXMA 2R29H 3DO7B 1IGJA 3ZZ1A 4LP4A 3CH8A 5DRZB 1BJ1H 1TXKA 4OUUA 4PRAB 4JJHA 1I3RB 4U6VL 3ULVE 1ZHNB 3KPQB 1YJDC 4U4BA 4CL7A 3O3DA 1ZA3B 3UYPA 5IB5A 1INQA 1AHWB 1BFVH 3BFOA 1RIUH 2XN9B 4ODXB 4NKDB 1KGCD 5KVEH 3E8UL 3B9KC 1C08B 1I3UA 1MQ8A 1WIPA 2ICWJ 4XMPH 2N7BA 3QH3B 1K2DB 3GRWH 3QXAA 4GRWE 1NCDL 5EULV 3KPLB 1ZA6A 1H15B 1PG7L 1RJLB 1DQQA 5F93C 2VLJB 7FABH 1Z9SA 2NTFB 5GRUH 4KKCD 1ZLSH 1AGFB 4LP5A 1G9MH 1JPGB 3LIZH 4UBDC 1I7TA 1LP9A 2YHGA 3BZFB 5L8JB 4WIQA 4XPBH 1RVFH 4HBCL 1CR9H 2WW8A 4TVPH 1PD6A 2C5DC 1NC2D 4BYHA 4ZSOB 2A6KB 3WLWC 3FT2B 1L7TH 2QJDA 4MJIE 3L5XL 4Y1AB 4WUUD 5E0QA 1EAPB 2UWEB 2ZSWA 3RDTD 5C86A 4NJAL 1OP9A 4CN1A 2AK1L 4OZFA 4FZEL 4Y16B 4PJGE 3ZL4H 1MHPL 1FH5L 2VLKD 5KAQG 4YUEL 2HRPL 1W0VB 2XKNB 4TPRL 5EOQL 2LFGA 4PRPB 4H8WH 1IQWL 1UB6A 4K7FA 2DJUA 5T1KD 4QRQB 5GSRA 2JKXA 3RWHB 4EI5A 4MXVF 3CDFA 1NFIB 1TDQA 5IWLC 3GBLA 3EO0A 3GSNH 2FBJL 2IQ9L 5B38B 5DD3H 3QEQA 4GAFB 5EO0A 4NC1E 4LGSB 3FB8B 3ARGA 3GMQB 4JVWA 1RZIB 4IDJL 4RMQA 5BVPH 4ZAKB 1OAZL 3ROLB 5E7FA 2P46B 1YUHA 2A6DB 5E6IA 5E1AB 3TA3A 3MRJA 2W91A 5IB4B 2JB5L 3RVVC 1AE6L 3KPOA 2F5AH 4D0DB 2IFFH 4MNQA 1LD9A 5HYSG 2DF3A 4D2NA 4O4YH 1JTOA 4MCZA 4QCIA 2EE2A 5FM8A 4MNGA 3MLSH 3VMNA 4KRNA 3RGVB 3KR3H 4HDIB 4WUUB 4W4OA 3OG6B 2H2PD 2BVOA 4K7PX 4B7LA 4CDGC 4JDZA 4M02A 4ODXA 5HHXL 4QXWA 3U30C 4HC1L 4R0LA 1NLDH 1ACYL 2YD1A 1HKFA 4RMTA 3P77A 1NBYA 5CLWA 5C0FA 3HMXL 1MHCA 3TYGH 1TJIH 1RVFL 4NWUL 4U6HA 3ZDYE 4NZRL 4M7ZB 5I2IB 1IAIM 4YDIL 2R2EA 4OZHE 2V17H 1INEL 2VL4A 3MUJA 3QBTB 4GO6B 2Z0BA 5MEPA 2P5WB 3HMXA 3D18B 5C6TL 1SJXA 1VGEL 1DN0B 3L5JA 2YA0A 2YOCA 4WHTB 3L7EB 1ZT4A 1NGZB 3LS5H 2UZIL 2Q86B 4J4PD 5BZDA 1CDJA 5EU4A 1BZ7A 4RMVA 4OCRH 3QO0A 2J8UE 2E7LA 4P9HL 5J89A 4E42A 5KVDH 4XB8A 5FA4B 1CD9B 1WZMA 2R4SL 5LCVL 2ESVA 3TT3L 3UJJH 4WUKH 1G7IA 4HPOH 4EUPG 1CDYA 5IB1A 4AT6A 1T22A 5C92A 3VFUA 1MWAA 3VGGA 4UV7L 1MJJA 1MNUL 5BO1H 3LRSA 5CP3H 3O9WC 5J11B 3QEQB 3O6KL 3CXHJ 5C0DA 1WVZA 4TOYL 5FUOH 4ETYA 2XZZA 1RZGA 3C6LC 1C5BL 1ZHLA 2J6EA 1JYWA 2NY7L 1MHPH 2VLMD 4NZTH 4NQCB 3HUJA 1XF4A 3CMGA 5F6IB 4WHYH 4IJ3C 1XMWA 4LEOB 4F33A 2FH6A 1U8NA 4LOUD 2Q6WB 3P0YL 1Z5LB 1OARL 1V7NL 4EXPX 3LMJL 1YN7A 3LN5B 4NT6B 2VLRE 5KZCD 4KKAD 1XF5B 3EFFA 4HT1H 4I9WD 5J1AA 5DR5L 4BH7B 1JGUH 1QLRA 1QKZL 1CDCA 1IE5A 4XHJD 5TQ2L 2CH8A 5DMIL 1OQXA 2VISB 3M07A 2FZ3A 1NDMA 3O3EA 2FJHA 4KDTC 4M7JL 4NGHH 2H2SC 5DFTA 1KIPB 3DXAA 3FRUA 3RWJB 2A73A 4WWKA 3HE7C 3DX7B 3BMWA 43C9A 4W4NA 5KSUB 1G7QA 5DQJB 4NUGH 1EV2E 4PJ9A 2MQ0A 3R0NA 3EOBB 1HK6A 1DBBL 5HGAB 1RSFA 4LRNH 1VESA 4IRSA 1UXWA 4RGND 1CU4L 5AYUH 1A4JB 3PGFH 4P5MA 1TCMA 5INCA 4ODTL 4AEIL 5DTFA 4MCYA 4IRSB 5T3ZL 2H32B 2BSSA 1WITA 3MX0A 4X0KB 4A6YB 1C5DA 2R2BB 3MNWA 4HIIA 4UILL 1BVLA 2ZCHH 3SDYL 3STLA 2OX5A 3NPSC 3NFNA 1MLBB 4FHBD 1T0MB 4E0RB 1OAUH 1D6EA 2FJHB 5JLZA 1I7UA 5F7WC 3T8XA 2D0GA 8FABB 3TYFA 2ADIA 1YPZF 5MENB 4PJXE 2EC9T 2CMRH 2YK1H 3QDJA 4XP5H 5BV7C 3M1BB 2VLJD 4NIKB 5IMMA 1MIEH 2Z92A 5I1CH 2EECA 1OLLA 4OF3A 4M6NL 5JQHC 2JK5B 3ZE2F 1EGJA 3JTSB 3AAZB 1U92A 1I7RA 1JV5B 2DI9A 3JWOH 4F8QA 2EDEA 3CX2A 3D85A 4PJEA 4Y4FC 5IQ7H 3ULUL 5SX4I 1DQTA 4JFQB 3GJFA 1HHHB 1U8IA 1A9BA 4WCYH 5IW3A 2YRPA 1F4YL 1PSKH 5ID0A 3CH1B 3MRRB 4PTTB 2R0KL 4M93C 2P8MB 3MRIA 3MBEB 5FUOL 5DJZA 3MRBB 4XP9L 3W39B 4F7CA 1MEXL 1JTTA 4L3CB 1FVDA 2APXA 5T1MA 3O2WL 3AS2A 1B0WA 3QFDA 4LMQI 5EN2A 4EI5C 4UNUA 5I71B 2A38A 4O58H 4OI9A 1CU4H 2J8UF 3MRHA 4JRYD 1ZWIB 3N1MC 4M61A 3BDYL 1FNFA 4MJ5A 5F1IB 2VTFA 4KK9C 1K9TA 4GMTH 4YZFE 1BFVL 3QO0B 3H0TA 4Y1AD 2NX5B 1QRNE 2IALB 3HRZB 4ODTH 4AEIH 1C16B 2CLRA 2A74B 3UX9B 1OM3H 2LAGB 4OIAA 4LCWA 1CBVH 4GBXA 2B1HH 4JLRA 3QNYA 4PJ8D 1J1OL 1D5BB 4JANB 4G5ZH 1OF2B 3MCG1 5L9DH 3QG7L 1DE4B 2FH8A 2NY2D 4KI1A 2IEPA 3NH7H 3F58L 4U1KB 4DKEH 1C8PA 2HJFB 1YN6A 3OB0K 3C5ZB 2O5XL 1T2QL 4HJ0C 5DMIH 2X70A 4G6ML 5F9OL 4F7PA 5I75C 2A83A 3M8OL 1F2XK 4NKOA 2A6IA 5EC2B 1R0AL 3MUHL 1A3QA 4P2OD 3OBAA 5JPNB 3UAJD 2C26A 3KVQA 3RBGA 2K9UA 4RDQG 4ENED 1KCRL 3K4DA 4CNIA 2HG5A 4GH7B 1J86A 5IGXL 4JZOA 1L0XA 4DZBA 4XNQA 4XPFL 1IQWH 1CQYA 4IDJH 1U92B 4LVNB 1AGEB 4PJ7B 4PIRF 3FCTB 4CJ0A 2VDNL 1AR1D 1DVFB 1I1AB 2FBJH 2IQ9H 3S88H 1BF8A 3DV6B 1S7SB 3O0RL 3MV8D 4JFXA 1G9EA 1N2RA 3M1BA 1MCHA 1W72L 4Z7UB 4OTXL 5C8JA 2BNQE 3U36B 1OSPL 5FDWB 4ZTPH 2N1KA 4LPUA 1JYVA 4DGIH 3MV8A 5F9JB 5I1IH 4UOW0 3HZKA 2BNRB 3NFNB 5IR1A 5L9DL 1D6VL 5FECB 4G6FD 4UB0L 3TBSB 1R3IH 1I1YB 3ULVH 1TJGH 4MLIA 4C57C 3BKCL 3WDJA 4QYOA 3VXQB 4GXVH 4JFOB 1EA9C 1GGBL 3MLWL 5J0BA 2AEQH 3OPZH 1PQZA 5EZOL 1N2RB 3PJSA 4HWEH 4WDIA 4ZOAA 5LGKA 2R4RL 5J6HB 1IGML 2VERN 3IVKA 4JM4H 1IGCH 5EOCJ 2HTKC 1ORSB 5AG8A 5BS0E 1EH9A 3TCLA 3MV9E 5KSUA 2OR7A 1ADQH 2PO6D 5C0CD 2UYLB 3OKNB 1RFDL 3O6LH 5F71A 4LDLB 5JOFB 3FTGA 4NYLA 1J1PL 4JZOB 1UJ3B 4L29B 4OLUL 2OQJB 3G6AA 3S35L 3TN0B 1K3IA 1WZLA 2J3SA 4R7NB 3D39A 3BPLB 5GRYA 3B2VH 3ZKMD 3FL7A 2YEZB 4QRRA 2QSCL 5EC2A 5KN5A 4DGVH 5A2JH 3V8CA 2V7NB 5JHDD 2J88H 2XNAA 2Y9RT 3QRGL 3T2QA 4L8CA 3MTRA 5TF1L 4BSWA 2RFXB 1IEBB 1YN6B 2ESVD 2HJFA 4PRIE 2EC8A 1DL7L 1KFAL 1VGKA 3MGOA 3NN8B 5TQ0H 3VXMB 4LASH 3TIDB 3QHTC 3UTTD 2B5IC 1KNOA 2IPKB 4LSRH 2FEDC 4RDQF 4MX7A 4RGMB 2P1YA 3RWEB 1WICA 4URTB 3RL2B 4EKXA 3BPNB 3HE6A 4ZUSB 2ILLA 4BSVA 5DUBA 3VXOB 4HS8L 5DDHA 4Z8FL 1A47A 2HKFL 4K71C 4PJBF 1AQDA 2D03H 3CU7A 1WIOA 4NRYA 3UEZA 3MBED 5I0DA 1AY1L 3EYQD 5ELIA 1K4DA 2P5ED 3FAXA 4Y4KC 3ZE1F 2CIIA 1NCWH 3WV0A 1FJ1A 5I74C 4XCYA 2ZKHH 3WFCL 3D5OF 3KYMA 3U0WH 4UTBH 1QRND 2JF1A 4MA7L 1NCUA 1QEWA 4CVWA 5DJDB 4QOKB 3FO1B 3RI5F 3MFFA 2J7LA 3QIBD 1B3JA 4HPOL 3TF7C 3E6FA 3MRIB 4RAUA 1AO7B 1I3VA 2P8PB 5DD6B 2BSTA 4YIQB 3LQZB 3TN0C 3V52H 2Y7QA 5E2WH 1TJHL 2LTQC 1IAIH 4MQTB 4U6VH 2EYSB 4N0UA 1T6VN 5HI5C 4KQ3L 4OD3L 4ODUA 3QAZC 4XBGA 1EEYA 1MHEB 2DKUA 2AW2A 4TNVF 1B0RA 3WEXB 4C83B 2GSGB 1A7OL 1NGPL 3QIWA 4G6FB 4BZYA 3BPOC 3TPKA 5I73C 4I48B 3ALPA 3HAEA 3KNBB 5BZWA 2RCSL 4I18A 1NCDH 2AJZB 2J4WL 5KOMC 1RI8A 1MCWM 3VCLB 4M9OA 4M8QA 1IZKA 4OFIA 1TZIA 4XC1L 5MP6H 2X4NA 1SYSA 3MZTA 2WWMD 5HDBE 5C7XH 3V5DA 3ZHDA 2C7UB 4L4VA 4Z8FH 1AFVL 4NHUA 4WVRA 2BNQB 1FNSH 2DBLH 4F9PC 4MCZB 4X80L 2MCPL 4XX1E 2R29L 2OL3B 1DJSA 3GSXB 5EIIB 4XBPA 5ABDE 1UJTA 2AK4D 3C2SA 4PGBA 1OGAB 4HXAH 4XVUD 1JL8A 2YPKB 3K74B 4M5YH 4P46A 1FNGA 5FYKE 4EN3A 1DVFD 2H32A 4NRXB 4X0KA 2Z31A 1WGOA 3C6SB 3CCHB 1MIEL 2XPGB 2ZUXA 3ULUH 1CXKA 3C9NA 2HT2C 3BKJH 4M5ZH 5GJTL 3JV4A 4PJ9B 4JO4H 4MZ3A 3AMKA 3QQNA 1MCCA 5KS9A 1PSKL 4X5XB 1ND0B 3QB7C 1KB5L 5EU3B 4GT7A 4N5EC 1N26A 3GIVB 4F15C 4H0GA 4UQ2B 5CIPB 5IB3B 1W8NA 3DGGB 3UDWA 1YYMH 4OCYL 4D3CL 1L7TL 2FR4A 1QFPA 2VC2L 3OKOB 4J3UA 4GG6E 3OAYH 5AUMA 2ZG3A 4L8BA 4ODVL 3DUUB 2AXJA 1FH5H 5J1AB 1DTUA 25C8L 1QR1A 3ULUF 1CT8A 3RVTD 3OKOA 1NH6A 2NY2B 2W59A 2X1PA 1YECH 4X6DB 4XC3H 4XWGH 2NZ9D 4HJGB 3MYJB 3OG4B 1W2KT 3LS4L 5I76B 4X6EB 1CFQB 2X1OA 1X5JA 1KIQB 4JPVH 4KAQH 2YD8A 1IFHH 1J5OH 3ARDA 3CX5K 5EIVA 5HHXH 1E4XI 5A40E 5IF0A 1UA6L 5HVGB 3QEGH 5HHOE 2PW2A 4O02H 2R8SL 3NCBB 4KTEL 1OTUC 1A6VL 4QHLA 3L9RB 4I4WB 2G5BA 1OAYL 3MV7A 3QR2A 4HF5L 4B7IA 2QHRH 4R96A 4H8WC 3EOYG 3GB7B 1MJJB 3R8BB 5GGQH 3LKNA 1U8LB 3SKJL 4B41A 5EA0L 3I84A 4HWNA 3DO7A 3O2WH 5DJYB 4LRIA 2NPLX 5HYSB 4LLMA 2FR4B 3IDYB 2CKBL 3V8OA 4E41B 2I9TB 4QKXB 5JNYA 5IVXB 5SWQA 1F8TH 2XG5A 2AJUL 1A3LL 2WUCL 1RURL 2OK0L 4OCYH 4XCEB 1U8HB 4R4BA 5DUMH 4P9ML 3HCVA 3DVNB 4WHTA 4N1EA 3O4OB 5DSCA 3GHBH 3PWVA 2AJYL 3LZFH 5DVMA 2NY7H 3DO3A 5EWIH 3TLRA 3D1MC 3IDXL 3MXVL 3FQUA 3QEHB 1HHJA 3KNBA 5I17A 1BWWA 4S10A 4YO0A 3NABH 4UNVA 2HFFA 1OOAA 1NBYB 2WIIB 4EN3B 1Q72H 1F97A 1FGNH 4GRLD 4X80H 1EEYB 1M71A 2NY0D 1TVBB 5JXEC 1EK3A 3MV7B 5FCUH 1E6OH 1JWUA 5IKCA 2DQFA 5IJVA 4WHYG 3T2OA 1QO3A 1FZMA 2CGRL 1QPPA 2AJ3B 2A6JB 3KLSA 5DUPH 3PHOA 3O11B 4LLVA 5IVNA 1VGEH 2V5SA 4P23C 2VXQH 4OGXL 5F6HI 4I18C 5EBGA 1T20A 1ZANL 3I3BA 4YH6A 1UQSB 4L8SB 2W0FA 4WFGD 2P43B 1XF3B 2H6PB 1ITBB 3HC3H 1QLEL 4KROD 4NM4L 4MNQB 3CMOL 2X9XA 4CW1A 4XVTL 4OZFG 5C08E 2VIRA 2ZCLL 3CVIH 3VFVB 2VE6B 3IKCB 3PDOA 4HMCA 5IMLB 3TT3H 3W0WA 3TZVB 4Z7QE 1S5IH 3V5HB 1WTGT 4HK3N 3GSVA 4EEEA 1S9VA 4FQJH 1YEJL 3QNZB 5B3JE 2VDLL 5IROC 4N0FA 1A6ZB 1L9NA 3OKMA 3F62A 5IVOA 4Y2DC 5CGMA 5GSRB 4DN4L 2GK0A 3MUGA 1WQVT 3MGTB 3VI3E 4M1GH 2VXUH 3Q5YA 5CZVL 3HR5B 5DA0B 1UKSA 4X6DF 5EUKB 5F8QC 4OBRA 4XAKE 4RAUB 1W0VA 1CICD 3FMGL 4UAOB 4NO0A 1A3LH 2C9AA 1CTOA 2VLKA 1QSFA 4QRUB 4OZGF 3GHEL 5MI0C 5CSBA 3C60C 1BQUA 3LN9A 1QQDB 5E8EB 3DETC 4LSDA 2AJYH 3ARRA 4PRHD 3T0BA 2XXCB 1BLNA 1YY8B 4LLWB 4QXTB 1KTLB 4MD0A 1UVQB 1K4DB 4X6BB 2Z91A 4OZGA 5D93B 1XF1A 3F7RA 4PGBB 3EJZC 1CLOL 3EOAB 3V7MA 3DHMA 5ACMA 3VA6A 5DHXB 4KXZH 1KCVH 1T21B 5F21B 2YPLB 4NZUL 4H26A 4YDLC 3ARGC 2Y5EA 3REWB 3RX5A 5BJTA 3P9LB 1V3KA 4O2FB 4G8IA 5JXAH 2J88L 3GBNL 1RURH 3QT2A 1CE1L 1ORQA 2AK4E 4TRPL 2PXYA 3UJIL 4APQA 3BQUD 4BQBA 4H25B 4HMEA 2OZ4A 1QTYT 3SDDC 1P6FA 5TQ0L 1JNLL 4Z0BL 1E4XL 4OZIE 3MRCB 4R8WH 1EJOH 1CK0H 1AC0A 1Q9OB 3AXLA 4N9OB 3PL6D 1JFQL 2OTWB 3VD7A 2BNRD 4NQDB 4JB9H 4PLNC 4YDJA 4WWKD 4PJBB 5T1DH 1V5JA 3MPCA 4XTRD 4MVBD 5FO7B 5IR1B 3U83A 5DVNA 2CKBA 4A2MA 4FQXD 5SWSE 3EYUL 5L2JA 2BDNL 2AERT 4MNHA 5LWYL 1UM5L 2COQA 3R4DA 2DWDB 3LKRB 1HSBA 3GMPB 4P5TD 1KG0A 1GPOL 1QBML 4QTIL 1MUJA 2IPTH 2RIKA 4I5BA 5T5FH 1VKXB 2CK2A 4EUPB 1J0YA 4UINH 5HDOA 5DEFA 1TITA 1C7TA 4WFGE 3S35X 2AEPH 5EU6E 4P2OA 4HIXL 2YKLL 5FKPA 1URLA 4AEHL 2AJXH 2IF7A 2JJTC 3B5TA 1NCWL 3GMLB 4U1HA 1HILA 3N1QC 3VMOA 3VXRB 3CFJB 4QXGH 4XXCA 3C60B 3CC5B 2EKJA 2AK4A 3ZE2E 5BRZA 2W9DH 3RNQB 1N0LA 1S7WB 1X5GA 2O26U 4P3CH 1ZANH 4L4JA 4FTVB 4H5SB 4XNZB 3UYOD 2VUYA 5FO7A 1NCCH 3T0XA 2IBZX 2G9HB 1E4KC 4L4TB 5TDNB 4CN4A 1L7IL 1TZHA 3P40A 3QUZB 3GBMH 5IOPB 3HI5L 4PLJD 1RJCA 1IVLA 1GRWA 1RUML 1FL6B 3GJEB 3SDDB 2DM3A 1KCKA 3BPCA 5FEBA 5IQ9B 2F5BH 3HI6H 2BX5A 2HJKB 4HXBL 1KLGB 3U46A 2M2DA 1QSEB 1S7VB 2EE3A 4HG4J 1FFPB 4V1DD 2UUDK 4JG1L 3PV6A 5KW9L 1RUAH 4NZTL 3UP1A 4C56E 4XMLL 4D0BB 2OQJA 3G6AB 4GRWH 3JWOC 1MLCA 5E5MA 2VLLB 1I8MB 5E95B 4OD2A 1RZ7L 1MHHA 3FB5B 1QRNA 1ZGLA 3GSQA 1OW0A 1FYTA 4L3CA 2HT3D 3T0DA 1J11A 5AZ2L 2MTPA 2HJKA 2X70B 2GCYA 5HHQB 3C09B 2FBOJ 1QSFB 4J3OC 1P7QD 1RUQH 1TZGL 1PQZB 5I1JH 3D87B 3LQAH 5ID0B 4AIZB 1MUJB 1MREL 4S1QH 3C87A 1DE4A 3CPLB 4JEGB 3MRKB 2QQLH 3RWCB 1IAKA 2B39A 4QHKI 4OQTH 1SBSL 2EO9A 1QPXA 4GKZA 5CD5D 3MACH 3WFBL 1KCUL 5EPMB 2HH0L 3QUKA 1KXVC 3QXDB 5HDQL 1G7PA 3UTTA 4Z7WB 1OHQA 3LPFA 2DJ4A 4TUJB 2CDEB 5T1KB 3RVUC 1HKLH 1UWEH 4Z0BH 4DN3H 2FEEI 2X1XR 2YMXL 3G9VA 4PJHF 2EDOA 3CC5A 2HFEA 1BVKB 4LAQL 4PG2C 2R15A 3BRGC 3VRJA 4TQEL 2R0LL 2PO6A 3N06B 1EGJH 4X7DC 3TO4D 1WBZB 1NGYA 1A14H 2XZCL 3SQOL 3RPKA 1BFOA 1H3TA 4OQTA 3W0WE 5KSAC 2X4SB 2PNDA 3KDMA 5I1IL 3UBXA 3ETBF 5A2LH 2W65B 1EX0A 4YHMH 3DLQR 4PB9H 1JCKA 5E2UH 1J8HA 4GUPB 4OGAD 3DHJA 4WEUD 5DJ2A 3ZT7A 3IDJA 3B3IB 3GMOA 4NQXB 4OZGB 2GUOB 4XCNB 5EOCL 4G42B 3FN0H 2QKIA 1MELA 1IM3A 3F7VA 3LQAC 1U8OA 1QFWM 4Z7WF 5I9QC 2D3VA 3CFEB 3UO1H 4JFFD 1I9IH 1HHJB 3AB0C 3D69A 3P4MB 5A2KH 1ADQL 2JK5A 2VZ3A 1UG9A 3U4EA 4BA8A 2JELH 2D0FA 4BK4A 2H45A 5DJ8A 2Y5TA 1QLFA 3KPMA 4LHUA 1DSFH 4YHNB 3HR5A 5HBBA 4GKNA 3UZVB 2XIDA 3GMNA 4ZFZA 5IVXA 1TETL 1QZ1A 1FBIL 1CWVA 3LKOB 3WIHA 5E70A 4R2GD 3ZKSD 3VE0A 5FK9B 4P59H 3BP5A 4F57H 2ZG2A 4X6CF 2ZUSA 3SDCC 3CU1A 1OD7A 3EOTL 1T80A 3SEPA 2XTJE 4YFEA 1ED3A 4ZUWA 4PJ9C 2BP3A 4X6BA 4IRJC 4NJAH 3K1KC 4XMKH 4UTAH 3PWPA 3AMLA 3QDMB 5C6WH 2RJMA 4KJQD 5EBLB 1HNFA 4UOW1 3EKCA 4P46D 2W0FB 4OUOA 2KUTA 1JZ3A 1B6UA 4K3HA 4H1LB 4HCRA 4NCC2 3U4BL 4JRYE 4JFEE 2A6JA 4PJDE 1IT9H 4HUVA 4ISVA 4MJ2A 1WIUA 1T1ZB 4TN9A 4EI6B 3MJ9H 4X98A 5ESAA 2P5EE 4PREA 5FYLL 1LE5A 2YUXA 1N3NA 2AJSL 4JFEA 4PJDA 4X8JA 2JE8A 1IAMA 1QR1B 5IB1B 4DZ8A 1EAJA 4IRZH 3LEYH 1FNEB 3PIQA 5J13C 3HC3L 3H9HA 3FQUB 4ONFH 2YPVH 5DURB 1I9RH 3PDOB 3RNKA 4R2GB 4FRWA 2X2YA 3TBWA 3VFGH 1KJ3L 5FYKD 2FX9H 4UQ2A 1MWAH 1TIUA 3L7FA 4I0KA 3Q1SH 5HYJE 3NPZB 4F15B 4M1GL 1T20B 2J8OA 5L88L 5JZ7D 3F8UB 1CXLA 4LF3B 3VH8A 3P0VL 1FGVH 4JREB 1JGLL 1YYLL 5IVXE 5C0DB 5I15L 1J8HE 4IRJB 1YNTA 3FONA 1OTTD 3PF2A 3QIBA 5IP4A 1BM3H 3CFKB 3SGJC 4FQHB 2NY4C 4HWZA 1JN6A 1JPFB 3LKNB 1VPOH 5EORL 5CZVH 1BIIA 4PJXF 4M1DH 1NEUA 5DA4A 5I1GL 2NY6B 3QULA 4HWZB 4YPGB 5F89A 2FYYA 2ENYA 5KANG 4JR9H 1LEKA 3AS1A 4F8TA 3PWVB 1T2QH 1H5BA 1MCLA 4RBPK 3O9WD 5T3ZD 43C9B 4LU5H 4WV1A 1N6UA 1IC4H 3ARDB 3I75B 1WWAX 2H3NA 2V9TA 5DVLA 2GQHA 4AL8H 3ARSA 5F1NB 2YS4A 2EC9U 5E00B 5GZOD 1S9KC 2NZIA 4H0IA 4AEHH 3KPSA 2X4TA 4Y4KA 1YUHB 4N8VG 5FM5O 3UCRA 4JM4L 4FQCH 4BH7A 3MO1B 1MI5A 4P59L 2ED9A 1DQLH 5C08B 4Y5XC 1MCPL 4YWGL 4J6RL 3GB7A 5C07D 4P2QB 5I8CB 1Q0XH 3FAWA 4X98B 5DRXB 3LHPL 2DQUH 5ESAB 1SJEB 4Q9QH 4HLJA 3H9YA 5BQ7A 2G5BB 3U6RB 3GIVA 3H7BA 1KPUB 1EXUA 3GMMA 32C2A 3CK0H 4M7JH