5F6HJ

Crystal structure of tier 2 neutralizing antibody dh427 from a rhesus macaque
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
SALTQPPSVSKSLGQSVTISCTGTSSDIGAYTGVSWYQQHSGTAPRLLIYDVSKRPSGVSDRFSGSKSGNTASLTISGLQTDDEADYYCCSYRTGATYIFGTGTRVTVLGQPKGAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords DH427 Antibody Light Chain
publication title Structural Constraints of Vaccine-Induced Tier-2 Autologous HIV Neutralizing Antibodies Targeting the Receptor-Binding Site.
pubmed doi rcsb
source organism Macaca mulatta
total genus 51
structure length 212
sequence length 212
chains with identical sequence L, N, P
ec nomenclature
pdb deposition date 2015-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f6hJ01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f6hJ02
4PFEA 4Y2DA 3C08H 1IAKB 3D87B 4ODSH 2VWEC 4O02H 1QSZA 4G6KH 4KI5C 1MCDA 1A1NA 1X4XA 3GHBL 3FQRA 4L9LC 2NY3B 2H2PC 4RMVA 4UT9L 1CZ8H 1WFOA 5GS0D 5D7IA 3OKKB 5KZCB 5ISZB 5DD3L 3L95B 4ETYA 4Y8AA 1INQA 3BQUC 3VXNB 5B38G 4GRMB 3VRIA 2V2XB 1IGFL 4YX2L 2ADGA 2ZCHH 3O2DH 1Z0NA 4M1CC 1YPZA 3U0TA 1BQHA 4XWOC 1FYTE 3FB7A 5J1SC 4WDIA 5ID0B 2G75B 3RVTC 4E5XB 5EFIA 3WNKA 3AREC 2E5EA 4YBQD 4RISH 1IQWL 4HXBL 4EQ3A 5H35A 3TV3H 2BY2A 3VWJC 2UWEE 3HZMB 4S1RH 3PQYE 5IIEB 4M93C 4ZNEE 2MNUA 1U8QA 2NTFA 1FBIL 1X5FA 1IM9D 1JPSL 3BRDA 5HI4D 1F3JB 4F3FB 4PRPE 4NO5B 1V3KA 1BZ9A 4RGOH 4LFHD 4HJ0D 3B5GA 5EU7E 1NAMH 2ITDB 3V7AG 2IALB 3SQBA 4DQOH 2AQ3A 4WI3A 2EDJA 3GO1L 4ZQKB 1KCRL 2DMCA 2AABH 1NCBH 4KK9D 1CYGA 1IM9B 5D1QA 1YEJH 3IAQA 1ZS8B 5FYJU 5L9DH 2BVOB 5FYJH 1AGDB 2DQJL 4GKNB 2RBLA 1N64H 4PV8B 2PR4L 5KSVB 3DIFA 1GZQB 1VEOA 2R2BB 4L3EE 5T5FH 1MCCA 4TQEL 1BD2A 3BAEL 1OD7A 3EOTL 3BFOA 3HPJB 3L3IA 1NFDE 2CDGB 3HI6H 4C4KO 1ODAA 1QBLL 3HR5A 3PWPD 3QUXD 2UWEF 1T1YB 4HGWA 1QFWI 1NCDL 4EUPB 2DTML 2A74A 1C5CL 2FIRT 3QCVH 4YHNB 1TPXB 1DUZA 4BFIB 2GUOA 1HXYA 4MMXC 1JZ5A 1DN0B 1LHZA 3NCYP 2ATPA 3GMOA 4TVPD 1NEZB 1Y0LA 4Z6AT 4YZFF 3O41B 1YYML 4M43L 4JY6A 2I9TB 4PJGA 1MREL 4ZUUA 3VXMB 5E8NA 1E4JA 1T5XA 3VFWA 2VE6B 3PWPB 2YA1A 3FAWA 3QUXB 4QTIH 4YHZH 3KWWB 1ZLUK 1G7MA 4UU9A 4I18A 3OXRA 2W60B 5E2TH 4WU7A 1CQKA 2VABB 2YPLD 3MOAL 4GBXC 3MLYL 5C07D 4N1HB 5EA0L 3RQ3A 1HINH 2XN9D 3UYRL 2M26A 3KPMA 4HGMA 1AGFA 5IVZA 5EZJB 5F21B 5CSZB 4QTHB 3TZVD 2AXFB 4P59L 2PO6C 3FT2A 4HX1B 2YPLB 1A5FH 3OBAA 3OJDB 5JPNB 4NJ9H 5C07B 3O6LH 1B0GA 4LSQL 3DWTA 3IT8D 2WSKA 3GHEH 5EZIL 3X11B 5HYEA 3SKOB 1HH6B 2XN9B 1NFDF 2QEJA 2FHFA 1C7TA 2BY3A 5I76B 2E7LC 2RR3A 3TZVB 3A6BH 1GL4B 5A16A 4GW4A 3SY0A 3MNZA 5IB3A 2DM7A 2HFGH 1JV5B 1OSPH 3C2AL 4OLXL 3GUTB 5B39G 4LVEA 4U1SB 5AZ2H 3TBWB 4DAGL 4AEIH 4DUXA 4JFEA 5DRXA 2VXSL 1LD9A 1UZ8B 1EEYA 1YQ2A 2HFFB 3ARWA 5C3LD 1JZ2A 3S96A 1V3JA 3OGCA 3EDJA 4PYGA 2OX5A 1GIGL 4O5LH 3MC0A 2QJDA 2AI0L 3S97C 2GJZB 2GTWA 1JN6A 2IQ9L 3CCHA 3G6JA 4X98A 1A7RL 1MIEH 4F33B 1SBSL 4RAHA 1RZKC 2JTDA 2JJWA 4NHCL 4G6AD 4MB3A 4K7PH 4N8VB 4Z76B 5LQBH 3TO4A 1REIA 4PREB 4WUUA 4TTDC 1UH3A 2H6PA 5HYSG 2CIIB 3V7AE 3I3DA 2IG2H 2DM3A 2A1WH 3H42H 3I2CL 5FOJA 1LVEA 1A1MA 3UAJD 5IF0A 4OCSH 2DQGL 2AP2A 4HWNA 1A02N 4S2SB 4HCRH 4M6OH 3WJJA 5TE7H 2COQA 1KNOA 5DQ9B 5L8JB 3MRIA 2K9UA 1K3IA 3QXVA 1CR9H 4P4RA 1KCUH 3C60C 3PGCB 3MLZL 1BQSA 4UQ3A 4Y4HD 2DLIA 4DKEH 3UJTH 3LB6D 4NC1E 1MEXH 3WUZA 3GSOA 1JPGA 2R2HB 3OF6D 2ENYA 1NGYB 3MO1A 5DS8A 1KB9J 4Q58C 1H3WM 3CFCL 2QSCL 4PY7B 3MOQA 5ALBL 1A14L 4NZTL 1AO7D 3ZLQC 5JIIA 5BVJB 3WFBH 2FB4H 1OTTC 4F8QA 2BHUA 5I8EB 4QYOB 2R0KL 4XNYL 4P5MA 4F9LA 4Y4HB 3RJQB 1VKXB 1RUQL 5FYKD 4XCEB 1RUMH 4YO0B 5DDHA 3SCMD 4E0RB 1S9VB 5C6TH 5ID1A 4FP8H 4QRQA 3RDTD 4P2OC 1IAOA 4PJ8D 1K6QL 5L2JB 3RIAK 5IP4A 1UENA 5DGRA 3O3BB 4M5ZL 4S1SL 3L3KB 2L4OA 2X42A 1VGEH 1NCAL 1IARB 4ALAL 4I9WE 4P4KC 5DJXB 1XF2B 1QVOB 2XXCB 2DF3A 2FHCA 3SE8L 2PUQT 3SCMB 2C4FU 1X5JA 5MERA 3VFNB 3GMMB 3CPLA 2VLKA 1XGRB 1R5VA 4PJ8B 4PJXA 2VAAB 3BQUD 5IFJB 3UROR 1A6PA 4PGCA 2Y6SC 4XPBL 4Y5XC 3WFCH 2OR7A 3ZSSA 4G6FD 3BP4A 2K1MA 4PRHE 3ULSB 4FQHB 3PNWB 5D93B 4ONOA 2WQRA 1OAXH 1RJZA 3VH8A 3KPRD 3GSNA 1CF8H 5EU5B 4QHLA 3W11D 4LMQE 3C8KB 1RZIB 3VFTB 3VWJD 1GZPB 4NQDA 2PETA 4XMKL 2LU4A 2VLMD 3RNKB 1PW3A 4G6FB 4EKXA 1W0VB 4G6MH 4J2XA 1H3XA 3HKFA 35C8H 1RZGA 3F62A 1L0YA 5F7NC 3RZWA 2IANE 4FHBD 4QY8A 4ODTL 5JLZA 1RIVH 3FT3A 4LCWE 25C8L 3SE9L 4LKCA 3KPRB 1I8LA 1HILB 4YR6A 1MFBH 3VWJB 4HH9A 1E6OH 2FX8H 1N7ML 4LL9A 4ZAKA 1LO0L 3ARFD 4PJFA 4F80A 1MNUH 1QFPA 4X6DF 2FLBT 2YMXH 4POYA 5TDPB 5E8DL 1FZKA 1G7JA 3FOMB 3C5JB 1NDGA 3OR7B 2ZCLL 3S36H 4CN6A 1VGKB 1HYRC 1JK8A 4NO3A 2HT4D 3V5DA 1NH6A 5EO9B 1JUFA 3ARFB 1JFQL 4GT7A 4P5TA 1MWAA 3T0EA 2MQ3A 3BUYB 1J05A 3LZFL 4TPRH 4YK4C 5EU6A 4OI7A 3BKJL 1B2WL 4X7SH 1LEIB 2VDKH 4N0YL 5C0AA 1G7PA 1PEZA 3VMPA 5ANMB 3OXSB 2CKNA 3IGAB 3QJFA 2DQUH 3AU1A 4OGXH 3KYOB 4MJ6B 5C92A 4FQIL 3P3YA 5CCKH 3CVIH 1Z5LB 2AJSL 3C6LD 1OTUC 1MHEA 3VXUB 2DTSA 4IRSD 5GS3A 4F7EB 1KIPA 1P69B 4P99A 4Z0BL 3RWEA 2YZ1A 5BV7C 4M00A 4J4PA 4N0RA 1PG7W 3SKUD 5F9AC 2ZUVA 3IU3A 5C0DA 3NACH 1EK3A 5I8KL 2M2DA 3NA9L 2CLVA 1ZA3B 3C6LB 2C1OA 2JB5H 2I07B 4PJBB 4WWKA 4Z7UA 4IRSB 2HLAB 3MRPA 3VGAC 1MCWM 3E0GA 1NLBH 3ILPA 3KPNB 1V5JA 3VXQB 1TNMA 3STLA 5CZKA 2VLLA 3SKMA 3MLPA 2GHWB 1EFXD 3LEXA 3HB3C 2PYEA 2YBRA 3KPTA 2JK5B 2M1KA 3VXOA 4YHKL 3SDYH 1UQSA 5DJ8B 4X8XA 3D9AL 2DQFA 1U3HC 2CDEA 2Q8BH 2ZG3A 1MFAL 4JFZH 4M7KL 4U3CA 1EO7A 3L3OA 4RFNB 2DQTL 2F54E 4UTAL 3P77A 5T1MA 1EFXB 4AENA 4UDUA 3OG6B 1XIWA 1ZT7B 5DVNA 3D25A 3I9GH 5C0JB 1BECA 2H9GB 3MRNB 2FO4B 2K7PA 4Z0XA 4P57A 4L8DA 4LHQB 3OKOA 4I77H 2ADJB 3RL1B 1JIBA 2FECL 2NY4C 4MA7H 3HC4H 3U83A 4I3RH 2ED8A 1NMBL 4U1LA 1UB5B 4YHIB 5JIHA 4FNLL 3LQAC 3BISA 5TF1L 5D1ZA 3CDFA 2W9DH 5IR1B 1Q0XH 1CD8A 4D8PA 3TYGH 4TTDD 4GMTH 3AS3A 3R4DA 4JRYD 1MRCL 2A6DA 4DKFL 5CEZH 1EHLH 3BVNA 1KB5A 1L9NA 1WEJL 4GW5A 4LLUA 3FQWA 5E2VL 4Y1AB 2ZUSA 2IGFH 1X4YA 5GQBA 3PHSA 5I17A 3S4SA 4X6FA 2IAMA 1ZLVK 5IHBA 1D5ZB 2E27H 2JB6B 1OF2B 5DWUH 5FHBL 4JFFE 4PB0L 5FB8B 5D5MB 1HHHB 5GGSB 1FL6A 2YC1A 1CT8B 1P2CB 3UZEA 4JRYB 5ALCH 3BE1H 1Y6NR 3TFKD 1C08B 4GQ9H 2H1PL 4JZOA 3WMSA 3U9PH 2OK0L 5EU7C 3C60D 3O6MH 2KZWA 5GZOC 2Y7QB 1K4CB 1VENA 4CDGC 2V5YA 1QLRB 3WIFB 4J3TA 3V5KB 4P3DB 3MRQB 3ZO0A 5IEHA 2IBZY 5DVKA 5E6ZA 2ARWA 4AMKH 1VERA 5KSBA 3HNVH 5HGDB 2F53E 1F58H 1EO5A 1IKFH 4JN1H 3RNQB 4MSWA 2W0KA 5GSVB 4UIMB 4YBLC 5E4EB 1GC1H 5EO1A 5CD5D 1PY9A 4OCRL 2GI7A 2HLFD 4LLQB 4X7DC 2VR5A 3VFRA 4HEME 3VXTB 2V9TA 4F7CB 1ZWIB 32C2B 4HPYL 5FM4A 1U93A 2VLJD 2R9HD 1CXLA 1MPAH 4OGYL 3T77A 5DMYA 4P46A 4K55A 2ZSVB 3RWCA 5AWNH 5CWSA 1S9KC 1JHKL 3JV4B 3MLVH 3JBG7 4OLYL 4P4KD 5J6GA 5IJKC 1Q0YH 2QQLH 5F88A 2F8XC 5I1EH 4ZTPH 1ZHKA 3ZT6A 5IKCA 5JZ7C 2VLJB 4GUPA 3LPGA 3OB0H 1NCNA 5D6DC 4QT5B 4PYHA 2DMKA 4OUUA 5LWYL 4NKIH 4P4KB 4G7YL 1RQ5A 4X5WA 3FFCE 4LSDA 1ZHNA 1FFRA 4UUJA 1XGUB 3BD4A 1AQDA 2FL5B 3TNMB 5JR1H 2EC9T 3W9EB 1FFNB 4MQXD 5B3JE 1KEML 3N85L 4JRXA 4PTUA 2GT9B 5BW7C 2DQIH 1G7QB 2LTQC 2FSEA 1ZLSL 1F4WL 4PLJD 3D2UA 3VFVB 3L3DA 4HLJA 4LVNC 4AEEA 4NFBA 3U4EA 4OI9A 3STZA 1Q94B 4BA8A 1UM5L 1UXSB 4Q9BA 2V17H 5H2BA 4Y4KC 1T0MA 4JB9H 3D85D 3ULUH 2H8PA 1TCMA 4LIQE 5L88H 4LHUD 4W81A 5C6PB 1QPPA 5CINL 3UX9B 3V4PH 3NCFB 4ELME 4YPJA 1AP2A 3MLRH 4WTWA 2EDXA 3S6CA 4HJGA 1U0QA 2W38A 4LHJB 5C0IB 4JKMA 4Q9RH 1UA6L 4YQXL 2KUTA 5DJ0B 3T08A 4PJ5D 4HWBA 1N6QH 1S7WA 3D85B 4JDVA 3P73B 4U1HB 5BZWA 5HHOA 3HR6A 1NFKA 12E8L 4Y19D 3MGTB 4LHUB 5F1KC 3VRJB 4EDWH 2HWZL 4FABH 4HS6B 1JPTH 3QNZA 4HIXH 2IMNA 4MDIA 2RCSL 4JY4A 1KYOK 2BMKB 1YMME 1HZHL 3AAZA 3CU7A 3HI5H 5F7DA 5IQ7L 3CLFL 4PJ5B 4GRLD 4R26L 1MVUA 2BSTA 5B3JF 1A47A 3VWKA 3FONB 4MNGA 3I6KB 2Z31D 2FBJL 1BOGA 1OGAE 3GI8L 4QCIB 2VLRA 1PGRB 4OQTH 3E8UL 4PD4J 3DRQB 4GRLB 3BZEB 1QG3A 1F13A 3HFML 4Z7VA 1JRHI 4P2QE 1XF5A 4KY1L 1OGTB 5HYQA 2HT3D 1QP1A 3KS0J 5IVNA 2Z31B 1AC6A 2EE6A 2PW1A 1ACYL 1FNEB 1PYWB 2R2EB 4ELMF 4X5XB 1FG2A 1YNTA 3GEWB 3GFUA 1J9CT 2NW3A 4G8EA 1IGYB 9CGTA 2D4DA 1LK2A 3QWRA 4E42B 5J9PA 3KPQB 2NX5A 1IBGL 4NC1C 2LV4A 2OQJB 2HVJA 5D8JL 2EICA 4NKMB 1ORQA 3FN9A 3MRBB 4J23A 2VL5A 5BV7H 2HJLB 3OZ9H 2FR4A 3O2VH 3H9SD 5J4MA 1AD9B 4Q74A 3QIWA 1IEBB 4W70A 3OB8A 4UT6L 4PRNB 5E2UH 1N5YL 3QZWG 3BYTA 1I9JL 3ESUF 3ZKXB 5KJRL 2CXGA 4RWHA 3MA9H 4XRCA 5E8EA 4PJHB 2OCFD 4CDHA 1T6WA 3CX5K 5TDOA 3NAAH 5JQ6L 4WO4A 1HDMA 4KRPC 5DD5L 3MRLB 3H9SB 2AEQH 2APTA 5A1AA 1KIUA 1YEIH 3FT4B 4U1MB 4JPWH 2FATL 2R0LH 1KPUA 1F45A 3VFOA 4MNHA 4RFOH 2CSPA 2J3SA 2NY6C 3NCEB 5C0CA 1CIDA 5HGHA 4PPTA 1I8IA 3O9WC 2EKSA 5FCSH 2CRZA 1AI1H 4JVWA 3WFEH 3EYSL 2H3NB 5C0FB 1KJMB 4YGVB 3LPWA 3Q6GL 3S5LA 5E9DE 4HMEA 1JPST 2Q8AH 3DGGA 4G8IB 2J1KA 2LVCA 4FQCL 3HE7A 4MHHI 3O11A 4M4PA 4C83A 4XCYB 4ZUSB 1M71A 5D2NA 1FFOA 3QNYA 2EDOA 2VC2L 4U6HA 3BO8A 5I30H 1FYTD 4NZUH 3CK0L 4BZ2L 4DEPC 4ODVH 3MXVH 3AFLA 3FFDA 2PKDA 3RWIB 3BKCL 1H3TA 4LDOB 1JNLH 2XWJA 3U7YL 3EO0A 4B50A 3MRMB 4MNQE 1ZVYA 1GGCL 4MX7A 4BZYA 4WTZA 3PQYD 2Y07L 3TNNB 1MCQA 3PF2A 3FTGB 4JFPB 4WEMB 3IETB 1FYTB 1XT5A 4PRPD 1MY5A 2QSTA 3T8XB 1I1AA 2J12B 3B2VL 1EGJA 3DSFH 1XF3B 1JNNH 3QP3A 5H8DA 5GZOD 4ZD3L 3GSXA 4UBDD 2YSSB 1U8HA 2BERA 3KYMA 3IVKA 1QSVA 1U8PA 5I18L 3FMGL 4DN3H 1VEMA 1CE6A 5JHDE 3KAAA 1T83A 4M5YH 4LLDB 4PRPB 1D9KA 5C8JB 4MAUH 4XTRD 2EO9A 3MODL 5C6WH 4AH2A 3CFBA 1B6UA 5IW6A 2ED7A 5F1NB 1QA9B 4L3ED 3JZ7A 4HKBA 3PL6C 3QHZL 4LARH 2D3VA 1NKRA 1NSNH 3ARSA 1DL7L 4NQED 2IH1B 2MHAB 3G9VA 2E7BA 3KLAB 3MZTA 2A38A 3B43A 4HKZB 2CO6B 4NM4H 1A9BB 3OWEA 4N0CD 4N68A 3WO4C 3VW3H 3IXAB 5DEZA 5TDNB 3L3HB 1LWRA 1MRDH 4D2NA 2DB8A 4QRRE 1GCFA 1VADA 1UJTA 4L3EB 4OUOA 1OP9A 4OJFL 3GMQA 3KPOA 4WI6A 4EXPX 4ZPTA 3OG4B 2BXYA 4NQXA 4X9IA 4OCXL 4NQEB 3LH2H 3QEHB 1NGXA 4P0DA 3IJYA 2F5BL 2RFXB 3WS6C 4NP4H 3P9MA 1CGSH 4RAUA 1A7NL 1FZMA 5IVXB 1QHOA 4Y5YC 4BSWB 2ATKB 4MAYA 4LQ1A 2CUIA 4P2YA 2EDEA 3HI1A 5D70L 5F9DC 4C56D 4BH7B 1Z9MA 4PRAA 3HCVA 2HVKB 1MFEL 1I3RA 1A0QH 4Y89A 2FBOJ 2NXZD 4A6YL 3RVVD 2J8UE 2VDLH 4U2YA 5E1HB 3R8QA 4L8BA 5KVMC 3CDCA 1UM6H 2Z91B 4W4OC 5HDQL 3IDJB 3TYFB 1QR4A 3WS3A 1ITBB 2WK2A 3MRCA 3BEWA 1BMGA 3RIFF 3AB0C 4L4VA 4C56B 5D2LF 1G7LA 5MP6H 3T65A 3FQUA 4ZFFB 2NR6C 2W65B 5JMOC 2NXZB 1KBGL 1HH9A 1R5IB 1CFBA 1UVQB 1KPRB 4KUZH 4MJ2A 3VFSB 3Q5TA 5KVGL 3BN3B 4KPHL 3DURA 2HTLD 2YN3A 3TT1H 3DBXA 5J0BA 4LVHB 2FLRT 4UZGA 2IJ0C 4XHQA 1GPOL 3V5HB 1LEGB 2QADC 4N9GB 2OTUA 4U1KB 4WHYG 3PABB 3N0PB 2YHGA 3EYQC 3O4LA 4LCCC 4NO2A 4JDZA 1MAML 3DETC 2LAAA 3SDDA 1IEAA 1A6TA 3ARGC 1HSAB 1V7ML 3BHBB 2XA8L 2PYFA 1INDL 5DQJB 4DGYL 4OT1L 2FJGB 4WRLA 1I9EA 4Q7DA 3T4YB 2N56A 4G5ZH 3VCLA 1OHQA 1P4BL 1WC7A 5F9WB 2XPGA 3T0VA 2GJJA 1E4KA 5HPOA 3P0VL 2VO5A 3H9ZA 5CIPH 3OKDB 4YFLF 3FQNB 3L6FB 5JA8B 3CSGA 3L1OH 1II4E 3H3PL 3HG1D 4NOFA 4XCCL 4LPYA 2VXUH 1H0DB 2BJMH 3MRFA 5K9JH 3BGFC 3T0BA 1T20B 2ZP0T 3MFFB 2GCYB 3NFSL 3BIAX 1SY6A 4XT1C 1P7QA 4OZGA 5GGVY 1BBJA 1UYWH 4UB0H 3LRGA 3GMRA 5CJXA 2W9LA 4JVUA 2ZSWA 1D6VH 4HF5L 4MZ2A 5F96H 1V3MA 5HHNB 4LSPH 1IL1A 3QDGE 2XKUA 3HG1B 1TNNA 5GS1B 5GIRA 1N2RB 1HNFA 3AY4C 1TZHB 3HLAB 4OZFA 5AUMA 1J8KA 2RB8A 4NBZB 4JN2B 2EC9U 5B22A 4WHTA 5I66B 4DK3A 1VFAA 1BBDH 2WQ8A 3D5OF 4NQUA 2O5YL 4M48H 4HSQA 4Y2DD 5FKPB 3UTQB 5CJ8A 4D0DB 1XCQA 1BF2A 4ZXBC 1JJUA 3TJHC 3SDXE 3SGKA 3F12A 2BDNL 4ONFH 4OKVA 1T03L 3WIIL 5HYIA 4C57C 3QXWA 1YZZA 4M1GH 2OL3A 2X70A 4NCDA 1FO0A 5C09A 2Y06L 1ZT1A 1UZ6E 2UUDH 1EVUA 3RAJL 5H37G 3KPPA 4Y2DB 2DLTA 3I3BA 3BDYL 3ZHLA 3EFFB 4XC1L 3MBEA 3BEVA 5DK0B 5FAAA 1H3VA 3HMWH 2EDLA 1UJ3B 1NMAL 3FQRB 2HA1A 4RX4D 5DQDL 3B9KC 1XGTB 1H3UA 3GSWB 4H26A 4AL8H 1C1EH 5E2JA 3P30H 3UBXG 2ICCA 2I5YL 4KMLB 1X3DA 2CRMA 4UQ2A 4Y7MA 4C55A 3VRIB 3PP4L 3BP6B 3EYUH 3ARPA 4TNVK 2LE9A 4D9QE 4FQXA 4ORZC 2IEPA 1YPZB 4YE4H 3U0TB 5ADOH 2JJTC 4Y16C 1N4XH 4M02A 4HS8H 3K2MC 4OGZA 2VDQL 5DUML 5EFIB 1DSFL 4KK5C 1AGBA 1B4JL 3LEYH 4PRHD 5GGQH 1GGTA 1JTTA 4PGBB 2E6JA 1RUKH 3G6DH 5FYLE 1GYAA 1T22A 2YR3A 2AV7A 4TSAH 1U8QB 2NTFB 3LKQA 3DPBA 3BXNA 5D1QD 3SQOL 5CBAB 1MCHA 3VFMA 1BZ9B 1UZ6F 3S9DB 4FZ8H 3GSRA 1P4LB 1S9XA 4R97C 3QFJE 4YDVB 1KIQA 3CLEL 3EJZC 1DQQA 1Q9LB 2IAND 4XHJD 1RURL 1WICA 5JHLH 1INEH 1F11A 3R8BB 4XP9L 1BD2D 5GGTA 2GSGB 4KHTL 4XP6L 5D1QB 4XX1G 3CFJB 1HQRA 2AK1L 1F4XH 5LKNA 3V52H 3T04D 3B2UD 1ZOXA 1YEHH 3KPSA 4PRIA 5B39B 1K4DA 2IANB 2X1PA 5LCVL 4WFHE 3ZE1E 4LF3B 5I15H 2BNUA 5F3HA 5KN5B 1LK3L 1AHWC 2RGSA 1CCZA 3QCUL 1BD2B 3ARQA 3GHBH 2PW2B 4M6AA 2RQ8A 3KHQA 4JQXA 3U82B 5DD3H 4CMMB 4HGWB 4QHNA 1BHGA 1DUZB 2OJEA 1HXYB 3K4AA 4RFEA 3WN5C 5JORA 3L5HA 5K9QG 1IGFH 4YX2H 4EDXB 5HYJE 1LO4L 4UOW1 1Y0LB 4O2EA 5HYSB 3B3IA 4JY6B 4PJGB 4HC1A 5GGUA 5E8NB 3VDBA 1T5XB 1W72A 4J3SA 4QWWC 3MLSH 3P11L 4B7LA 3KJ4B 1G7MB 4UU9B 4I18B 3ARUA 1IQWH 4HXBH 4U3XA 3LPFA 3V8OA 4WY7L 1I8KA 3UPRB 3QXDB 3PHQA 4HQQL 2CH8A 3EJYC 1FBIH 3QQ3A 4KXZH 1VFMA 3JUYA 3DI3B 5D7SL 5HD8D 4R4BA 1AGFB 1JPSH 2HG5B 5I6XC 3V7MA 1I4FA 4KK8C 1FP5A 4I3GA 4JPIB 3OTTA 3B5TA 4B53A 4H20L 5TGBB 1R3KA 3GRWA 3GO1H 1JYWA 1KCRH 1B0GB 2IBGA 4FXKA 4RBPH 2BSSA 3Q3GA 2X1QA 3UPCA 1V8HA 7FABL 4Y5VC 2AXGA 2CK2A 3VRLE 1WFNA 2XWBA 1UC6A 4X6CA 4HPOL 4IDJL 4PJEE 3QXUA 4GMSL 3BIKB 1PAMA 1MCFA 5I74C 3DRTA 4JPVL 1I3UA 2DQJH 4GW4B 1LO5A 1OY3B 2JLLA 5TPWL 5SWSE 3RUGE 4WUKL 5C08E 1UKSA 2PR4H 5IB3B 2NTSP 3BD5A 3DXAE 1VFUA 2IPTL 1M1SA 1JWUA 3VMNA 1M6OB 4TQEH 3ET9F 3BAEH 3EOTH 5DRXB 4HFWA 2F54D 5CJOH 1EEYB 3GSNL 1QBLH 3EYQD 3OGCB 1MAJA 4WJ5A 1S78D 3AXLA 4LQFL 1NCDH 2DTMH 1IE5A 1A7PL 1C5CH 2GTWB 3CCHB 1QR1A 3G6JB 5H94A 3KS0H 1XAUA 3QWQB 5DJYB 4LPCA 4HDIB 4WENB 2P49B 2Y4SA 3FB6B 3NFNA 1WT5A 2F54B 4V2BA 1YYMH 4M43H 5DJDA 2Y23A 1T89C 3TO4B 3LN5B 1MREH 1DTUA 1V05A 2H6PB 4NKQB 4LCCB 1DJSA 4BQ9A 3IRZA 3C5SB 1HHGA 3EYOA 2BNQA 2R1WA 3MOAH 3SDAA 4LMQI 3MLYH 3VXSE 4JRWA 4NC0B 5IF0B 5EA0H 1AXIB 3VRLF 3TN0C 4BJLA 1EIBA 5B3NA 3UYRH 4XX1E 6FABL 4C4KT 3MRIB 2YK1L 5MENA 3RUGF 4P59H 1UWGL 3FB5B 1OW0C 1CFVL 5FYKU 1MWAL 1Y18B 2NYYC 1MQKH 1DBAL 4M3JA 1QBBA 4LSQH 1WBYA 1CICA 2BCKB 2GYSA 4PJDF 5IB4A 5EBWA 5EZIH 1CGVA 5KW9L 3DO7A 4JHAL 4JPKL 3QDME 5DD6B 1SQ2N 1CXHA 2I24N 2YXFA 2XWTA 1OARL 2FZ3A 5KSAC 4P5MB 2NZ9C 2MQCA 2R1YA 4P3CL 5DDHB 3QQ9D 1P84K 5KS9A 3QG6A 2F53D 3QDJE 3C2AH 3D3VE 3NPSC 4G43A 4OLXH 2DDQL 2VLKD 5DEGB 3ZZ1A 5KG9A 2KQMA 1YN6B 3CGTA 1YMHA 5ID1B 1KOAA 4NNYA 5F97E 4DAGH 1IAOB 3L3JA 4QLRA 2VXSH 2YD3A 4OLZL 4GAYB 3EDFA 4ZOCA 4XWGL 4KVCL 4ETQA 1GIGH 3SBWC 4P9HC 2AI0H 4U6TA 3O2WL 4ODXA 5D7IF 4ZUVA 2F53B 3RX7A 5MERB 3EJJX 3CPLB 3OMZA 2VLKB 1A7RH 1V3LA 4R3SB 1R5VB 1MHHA 1SBSH 4NHCH 4PJXB 4MA3A 3MACL 2X5PA 3HAEH 4JAMB 1SBBA 3JTSA 5F7WC 4LGRB 2H32A 5SV4A 5BQ7A 4NQDD 3QO0A 4PGCB 3LDBC 4NSKA 3TVMA 2ZUTA 3UTTE 1MCRA 2IBBA 3BP4B 2ZWLT 3I2CH 5FO9B 2X4SA 1JZ4A 1RJZB 1VESA 5T3ZE 3CMGA 2Z8VC 4AT6B 2DQGH 2V9QA 3VFGL 1PDKA 3VH8B 3FFCD 4XGZA 1FH5L 3C09B 4QHLB 2MSPA 3HNTL 1UB6A 1NFIA 4IOFD 1O5DT 1EBPA 4NQDB 1MJUL 1QSFE 5DJ6A 3OX8B 2ICEA 3MLZH 4JQIL 3BKML 4POZC 5DZOA 1PX4A 3GJEB 3IDNA 1Q9KA 5J6HB 4QY8B 3RX8A 3FFCB 4LKCB 3CFCH 4YR6B 2QSCH 4OD3L 4WI2A 2NPLX 5ALBH 1A14H 4NZTH 4F9PA 3EOAA 4M4RA 3BT2L 5D72L 2R0KH 4XNYH 3H7BA 2HP4A 3RVXC 4U0QB 1FZKB 1G7JB 1NDGB 1RUQH 3GBNL 4TUOA 5E99L 5EULV 4YHOL 1X5XA 3EO9L 1MCPL 4I5BA 4NO3B 1RJYB 3CSYB 3DX8A 2FHBA 1U8MA 3MRDB 4IOIA 5TQ0L 2XICA 5C0AD 1K6QH 3V5DB 5L0QC 4O51B 2AV1B 4M5ZH 3ZE2E 4L4JA 4S1SH 1JUFB 4MZ3A 2B1HL 1NCAH 3UTSA 1HWGB 4ALAH 3T0EB 4BSVA 4EI5A 3GIVA 4UAOB 4CJ1A 1T3FA 5EU3B 4WTXA 3UTZA 4AYFA 1DDHA 3P4OB 5I1LA 1ETZA 1YMMD 3HUJE 4HIHA 4HMDA 4NGHH 5C0AB 4X80L 1RUAL 4GKZB 5C0BE 1URLA 4J4PD 1EVTC 2YD2A 3X13A 5JDJA 4XPBH 3PJSB 1MCEA 3WHXA 4NPYA 4JG1L 4K7FB 1KULA 3PDOB 1OGAD 1N3NA 4NNPL 3TBSA 5T3XL 1YMMB 4P23D 1UEYA 2JIXA 3GGWA 1KIPB 1QNZL 4RWYL 3N1QC 3RWEB 1YY8A 4KQ3L 5EPMB 4M6NL 3RIAF 4P2QD 2A0LD 3V8CA 4XMKH 3GK8L 3HTLX 3IU3B 5IMKA 1OGAB 4R4NC 4IMKC 2PYED 2CLVB 1VPOL 4P23B 4WUUE 4QHMB 4K9EL 2HN7A 4KK6D 1EBAA 4KK8D 4ODTH 3OR6B 5GRXG 25C8H 3MRPB 3ZE2F 3GIZL 3SE9H 5C9JA 4U7KA 3CDGA 5CKGA 1MFCL 3HE6A 2FWOA 3ILPB 4HKJA 1N7MH 3O45A 4P2QB 3STLB 2VLLB 2BRRL 4TUJA 5DR5L 3SKMB 4DW2L 3WNOA 1AXSB 3C8HA 3T1WA 1WZLA 1KJVB 4JANA 3LEXB 4L4TE 5E8DH 2PYEB 2EE3A 1BM3L 2ZCLH 3VXOB 5HJ3A 3SKJH 2FJHA 4RSVA 1UQSB 2X4UA 1IAKA 1GOFA 2CDEB 2DQFB 4Z7WA 1K2DB 4OCWL 4Y4FC 1R3IL 2EYRB 1BJ1J 5D7KE 1J86A 1JFQH 3BGMB 1MHPL 5DJ2A 3LKSB 3TC9A 4D94A 3OKKA 4KJPC 4UDUB 4BQBA 5DZNA 4QHUA 3LZFH 5DO2C 1NQBA 4HH8A 2H45A 3HC0A 3D25B 4CN4A 2FEEI 3VXNA 4OFYD 4EOWL 3CIQA 4YH6A 4Z0XB 2WWMD 4P57B 4N0YH 1ZA6B 2V2XA 4DTGL 3OKOB 3MR9A 2J7LA 2I26N 4ZTOL 3MJ9A 4TUKL 1Z3GL 3MLXL 5AYUL 1PFCA 4N0UE 1TDQA 4GH7B 5IG7B 4FQIH 2OSLB 5ID0A 2PXYC 4E5XA 4ZSOE 1OAKL 3TBYA 5GZNC 5MEOB 2AJSH 2A2QT 4D8PB 1I1RA 3HZMA 5FKAA 3BVNB 1KB5B 4GW5B 3FQWB 4Z0BH 4UTBL 5DHYB 5I17B 3S4SB 3DYPA 4X6FB 3NMEA 1BAFL 4LNRA 5EIVA 4F3FA 2D9CA 4NO5A 4HWBL 1EA9C 5I8KH 5T3XD 4JFOB 3NA9H 2ITDA 1FL6B 1NAMA 4TRPL 4N8CL 1XMWA 1T21B 3DNKA 1DVFC 5MEPB 3DMMD 5GHWL 4Z8FL 5DA4A 4BKLB 1CU4H 2QSQA 4YHKH 5KSBB 1K9TA 4FZEL 4HZAA 3MBXL 1N0XL 1GZQA 3D9AH 1JGUL 2H2SD 5E5UB 1MFAH 4H0HB 4M7KH 3VFRB 2DQTH 3DMMB 3HPJA 5EUKB 4UTAH 2CDGA 4HK3J 1J8HE 1U93B 3H6JA 1H9VA 5ETUB 1I75A 1S7XA 3EYFA 4EUPA 1IKNA 2AEPL 3T77B 3RWCB 5I2IB 4MS8C 1WWCA 5CWSB 4RMSA 3KR3L 1L0XA 3FKUS 5F88B 1I3VA 4DCQA 1K8DA 4WFGE 2Z93B 1NMBH 1IC4L 3MNVB 3REWA 2WBJD 4FNLH 5J06A 5IKCB 5TF1H 3QUXA 2QHRL 1ITCA 1F90L 4GUPB 4GG6E 1NKOA 4JRXD 2VABA 4FRWA 2AERT 4DKFH 2ZOLA 1WAAA 5FGBC 5E2VH 1WEJH 3SGEH 1KUMA 4X5WB 2AJUL 1U91B 1ZHNB 1TQBB 5EU6E 4JQVA 5DGQA 1GHFL 2AK4E 3TBTB 1WWAX 5EZJA 2WBJB 3LHPL 3MNWB 5CSZA 5HI5D 4CVXB 4QTHA 2DLFL 5FHBH 1QOKA 4PB0H 4JRXB 4HZLB 3G08A 4GRWF 4HX1A 1IGCL 2FSEB 3T0WA 3UDWC 1NANI 3RTQD 1FGVL 2ADIB 1UCBL 1CWVA 3OJDA 5JPNA 2H1PH 2OK0H 3L3DB 3LKNB 4ODUB 2BSRA 3U4EB 3X11A 3SKOA 1HH6A 2XN9A 3MRJB 4PS4L 2ID5A 3RVWD 4R2GC 3O3EB 5HTSA 3WNLA 3TZVA 5F7EL 2H8PB 1E4WL 1BIIB 1ULVA 2RJMA 4PJFF 2D7TL 3RTQB 1CGUA 3QZWB 4KI1A 5KANI 3IB4A 1JF5A 2HAZA 2JKXA 1AP2B 1JZ8A 3JWOC 3QDHA 4YXKL 3GUTA 2J8UB 4HUKB 4U1SA 4OCRH 3P0YH 3TBWA 3ARBA 3TIEB 3VD7A 5EBGA 2GJ6A 1S7WB 3GSQB 4JDVB 4HPYH 1B0RB 3G6AB 5BZWB 3VWKD 3JVGA 5KVFL 4XNQB 2X9WA 4JO2L 3PWLB 4OGYH 4Z7OE 2BX5A 4OLEA 4K3DL 2GJZA 3I6LE 3AAZB 1JHKH 4EN3D 3T4AB 4OLYH 5F7DB 4V1DA 1I3GL 4N8VA 1MVUB 2BSTB 4PREA 3VWKB 2CIIA 5GRVK 3PXJA 1JWSB 1BOGB 1EGJL 3RWHB 2V7HA 3WXWL 3RY4A 1QBML 5LWYH 4EN3B 2IH3B 5FM8A 4G7YH 3QJHA 4DUVA 1K85A 2RAMA 3NA4A 1MUJB 3SGDH 5HYQB 1VCAA 5DC9B 4P2CG 1KEMH 2PW1B 3N85H 3VFUB 1FG2B 4FG6D 1IGIL 1ZLSH 3RU8L 1F4WH 2IQAB 2NW3B 4XNUL 3HZYA 2NY1D 1NGYA 4GKSB 5J9PB 4Z7UF 1SYSB 5D1XC 1FORL 1UM5H 4JO4H 4PY7A 5MI0C 4S0SD 3VA2C 5BVJA 1EX0A 1NGQL 1QFOA 3B9AA 4YPGB 2VL5B 3ALXA 5I8EA 4QYOA 4Z7OF 2ICWJ 2R0WL 2E8YA 4WFEE 2X9YA 1VKXA 5CINH 2FR4B 3QAZB 5JW4M 1KTLA 4YO0A 3V9FA 2D9QB 4E0RA 5IROC 2KQNA 3OF6A 2NY1B 2X41A 1S9VA 1J10A 1UA6H 4M9PA 4YQXH 3MV9A 5LGJB 2DWEA 1ZGLA 4N1EA 2XA3A 5L2JA 3MV7E 1AO7A 4OCLC 3O3BA 5T1KA 1EO8L 4NQVA 5ELIA 2VKXA 12E8H 1HDMB 2OS7A 1DP0A 3P4MB 2HWZH 4KJQD 3SCMA 2RCSH 3QEGL 1TCRB 3VFNA 3GMMA 1HZHH 4RGNE 2KKQA 3LEVH 5GRWA 1X5ZA 5IB1B 4YEEA 1XGRA 3L5IA 3RDTA 2W0FA 1KPUB 3SDXB 5IQ7H 4YXHL 3CLFH 4MNHB 2VAAA 5DO2D 3VGDA 4R26H 4GOSA 4KDVA 1WZMA 5IFJA 2LABA 2WLZA 4BYHA 3I50L 4J8RA 3WE6B 4H1LB 2FBJH 4R0LB 1KCVL 1WTGT 2CMRH 3ULSA 3GI8H 4L9LA 1KENL 2FX9L 4KV5E 4PJ9D 1JNHA 4D9QD 5J57B 3RHWK 3E8UH 1GGIL 5EC2B 5D2NB 1FFOB 2EDKA 4OFVA 4U6HB 3BQUA 3HFMH 3VFTA 3BO8B 4KY1H 3NN8A 1IAIL 3T3PF 1I1AD 3FFDB 1ACYH 2VXQL 2AEWA 3ARYA 4GQPH 4G7VL 1NAKL 4PJ9B 5FYJE 4MX7B 5FYLD 3RWGB 3QRGL 3ARVA 3OJMB 2CRIA 3RX5A 1OTSD 3AREA 5DSCB 1G6RA 3DGCR 1IBGH 2HKHL 4GLRH 5JOFA 2W9EL 3VWJA 3TO2A 3MQIA 3JV5A 5D8JH 4P2RA 1D9KD 3WDJA 4YC2C 2BHZA 4AIZB 1I1AB 1LDPL 4NUGL 5DVLA 4AK1A 1JHTA 2AJ3A 4P9ML 5TDPA 3CDYA 3B8YA 3FZUD 3QFJD 3FOMA 3C5JA 2EDBA 3QCTL 1U8KA 1VGKA 3KYMB 4UT6H 5EO0A 1N5YH 3FCTB 2D03L 1I9JH 4X9HA 1NUGA 5EUOE 5KJRH 1CE6B 5FF6B 1D9KB 2EIBA 1WIUA 3S5LG 3IU4L 2X4OA 4U1GC 2Z9TA 5JQ6H 4EQ2A 3C5ZC 3S88L 3CFBB 5IW6B 3QFJB 2XZCL 4KV5F 5AEAA 5I1IL 4M3KB 5DD5H 3MJGX 4WFHD 3GZKA 3AGVA 1DZBA 1ZVHA 4RAVA 1SY6L 2FATH 1LEIA 4R96B 4K71C 3OXSA 4J1UA 3FRUB 4AQOA 1WVZA 1RIHL 2NY0C 4A2MA 3U0PA 3KYOA 4MJ6A 4PG9A 3KNBB 3EYSH 2A77L 1A7BA 3IYLW 3Q6GH 4APQC 1Z5LA 2CO7B 5ILTL 3LKOA 1RZ7L 4NRXA 1H5BC 4FQCH 4ZPTB 5HYJD 4K2UL 2X4QA 2Q3AA 2VC2H 1XR9B 4MA1C 4BZ2H 3CK0H 3ESVF 3P9MB 5EB9A 3K4DA 5D71L 2CDFA 4CU8A 3F58L 1FZMB 3BKCH 4X7TB 3PWJB 4LASL 1KF9B 2OP4L 4NBYB 3U7YH 2OL3L 4MAYB 4L4VD 4NC2B 4NT6B 3HI1B 1GGCH 2YEZA 1FO0L 4Q0XL 4DN4L 4PRAB 2Y07H 3VXRE 5HYJB 1A6ZB 1I3RB 4L1DA 2HLAA 2NY5L 4RMUA 1EV2E 1Q38A 4LDEB 3VXQA 1E27B 1VB9A 4L8BB 1NLDL 2I25N 1DLHB 3W9DB 4LSSL 5F6IB 3B2VH 1IGJA 5DMGC 3WS3B 3BEWB 3MRCB 5KAQF 2J6EA 5JIKA 4ZD3H 4PGZA 4L4VB 2HTKC 4Z9KB 1G7LB 3T65B 5DHVB 2XY2A 4R2GD 5K9OA 2DBLL 2A83B 3FB8A 4U1IB 3FQUB 3GMLA 5I18H 3FMGH 3WJJC 4MVBD 4BZ1L 1M7IA 2PO6A 1HH9B 3IFLL 3QUKA 5CZVH 3GI9L 2YD7A 3SDDD 5H37H 1EZVY 3MODH 5BJTB 4GS7C 3DURB 3ILQC 5SWSD 5C08D 5JXEC 1G1CA 4R2GB 1ZT7A 2E7HA 4XCFL 1AJ7L 3MLTA 2OTUB 3DXAD 3MRNA 2HMIC 2FEDC 3QHZH 4KQ4L 1QHPA 1CL7I 3VDAA 1OAQL 4JDZB 4I1NB 4PJEB 1DL7H 3RL1A 2P42B 2ZZUT 3SDDB 1KJ2L 1A6TB 2JCCA 1AR1D 3IDIA 5SWSB 5C08B 1FDLL 2WUBL 5IT2L 3S37L 3FQXB 2F58L 3DXAB 5JDSA 4OJFH 3VCLB 4XC3L 1WC7B 2NY2D 3V6OE 2XPGB 4QOKE 2MPAH 4N0FA 4NN7C 3F6LA 4HWUA 4OCXH 3ULVL 3H0TA 4PJIE 2F5BH 1CVSC 1OVZA 1KN4L 2CLZB 4MCZB 5HHVL 5GGTL 1KYOJ 3MRFB 1D5ZA 1A7NH 2JB6A 4Z7VF 5CZXC 5I1CL 1ZLUH 4MXVE 5FB8A 1XF4A 1HHHA 5D70H 5CGTA 5GGSA 1WQVT 2NY2B 1CT8A 1P2CA 1IZKA 1MFEH 4QXUL 2ZSWB 4A6YH 2AKRB 4ZOBA 4CMHB 4OD1L 1TFHA 4IIQC 1K4CA 1IL1B 3G9AB 1QLRA 3KYAA 4OIAA 4HIEB 2X4PB 3WIFA 5J13C 4X4YA 5HDQH 3V5KA 4K8RL 4JY5L 5FXCH 5HHXH 4OZFB 5D1XD 1FIGL 1AY1L 1TIUA 2ORBL 4WHTB 1VFAB 2R0ZL 1L7TL 2CLRB 1LO2L 5HGDA 4YAQB 3ARDC 3RNQA 2UYLB 1KBGH 3C60A 4YXLL 1JZ6A 3QDMD 3F12B 2F9BT 4EI6A 1F4AA 2VQTA 2VAJA 3VXTA 3NCMA 3NOIA 5KVGH 4KPHH 4F7CA 32C2A 2XTJE 2N7BA 2DJUA 1NCWL 2AGJL 5IBLD 2X70B 4K94C 4HC1L 5D1XB 1FO0B 1GPOH 1W72L 4K3GA 4WCYL 3QDJD 5KVDL 3KPPB 1KLGA 2ZSVA 1T1ZA 4U31A 4PJIF 3WUWG 3JV4A 1MAMH 4ZFOA 3QDMB 4ZAKC 4ODWB 1EAPA 1V7MH 5FUZL 4MXVF 2XA8H 2EH8L 1PBYA 1INDH 4DGYH 2VLJA 4OT1H 4P2OA 4H26B 2G2RA 3QDJB 3MX0A 1BVKA 3BH9A 3HA0A 3GRWL 1YC7A 3CX5J 3P0VH 1J5OL 4P4KA 4YLQT 3H3PH 4P5TC 1XGUA 1U42A 4XCCH 4NOBA 1XCTA 3ORJA 2V2TB 1DBJL 1CDYA 1AGBB 3IDYC 1CLOL 3NFSH 1WTLA 2GT9A 3UEZA 4CRPA 1G7QA 1G9NC 2IFFL 3C2SA 4JFDE 5IWLC 4J3OC 3VFVA 4Y5XA 1T22B 4HF5H 4R90L 2AV7B 3AS0A 3EHBD 1G7HB 3LKQB 4RMQA 1Q94A 3TJEL 1QSFD 4E41E 2P44B 2W0PA 3VFMB 1C5DB 2EEDA 4MJIE 3RWJA 2DBJA 4OM0L 3ZDYE 3KPSD 4FXGB 4PRID 4MMZC 1DQQB 2IWGA 2O5YH 4EBQL 4OQ1A 1WLHA 1F11B 1S5IL 4YDLC 2C5DC 5C0IA 3UBXI 2YKLL 5I9QB 3LKPB 2J5LC 1I9RL 5DJ0A 5FUOL 2BDNH 1QSFB 2JF1A 1T03H 5B21A 3WIIH 3D85A 2AJZA 2X89A 3P73A 1HQRB 2PCPA 5T33L 1CFNA 4MQTB 4RGMC 4LVOC 2Y06H 2Y25A 3MGTA 3CAFA 3KPSB 4LHUA 4PRIB 4URTB 2X10A 3RAJH 3VRJA 2OI9C 4I0PC 4WWKC 2YD1A 2WZPD 2BNUB 3BDYH 2BMKA 5F3HB 1DCLA 5EZOL 3RVUD 3C5ZD 4XC1H 1JWMB 1PD6A 1ZTXL 5HVHB 1MAKA 1NMAH 3OKEB 1KSRA 5DQDH 3AC0A 4Y19A 1T2XA 3I6KA 1NBVL 4QHNB 4NFDA 5BO1L 2I5YH 4XVJL 3ZE0E 2OJEB 4RFEB 5A40E 5JORB 3PP4H 5DFWH 4CW1B 5EN2A 5J3HC 4N5EC 4IDLA 4O2EB 4XI5D 1A64A 4PP1D 5C0BD 3B3IB 4JZJB 4NN5C 3O4LE 3IKKA 4U7MA 3U7WL 2VDQH 5DUMH 1G0XA 4FTVE 3ZDYF 4K71B 1DSFH 1B4JH 5DD0L 2R2EA 3GKWL 2LAGB 4X5XA 1FC1A 4Y2OA 5F6HJ 1TVDA 4BK5A 3HUJB 2BNRD 1I8KB 3IF1A 4U49A 3I85A 3MMEA 4I3SL 3GJFA 1IGYA 2DYPD 4C54A 4E42A 3QIUC 1CDBA 3KPQA 5C0BB 4R4BB 3TF7C 3SQOH 4LBEB 1H5BB 5IQ9B 2J88L 4QO1A 1YNKL 5D1ZC 5KVEL 5E1AA 5E4IA 3OKLA 4NYLB 4ACPA 4ZS6D 1R3KB 2XI9A 1I7TB 3CLEH 2BNRB 2XT1B 3CD4A 5IFAL 1RURH 3DUSB 4WFFE 1IEBA 2DYPB 4PRNA 3QWOB 3Q3GB 4TNVF 2VH5L 1ONQA 4K23L 4XP9H 1FNHA 3WO3B 4OTXL 4XP6H 4DVRL 2AVGA 2PF6A 1RK1A 2Q6WA 3MRKB 5K9QI 2B2XL 3DRTB 2AK1H 4HUXB 2Y1VA 1LO5B 3VMOA 1U95A 4XPTL 1LGVA 43CAB 5LCVH 2FO1A 1UKTA 2W59A 4HJJL 4I0KA 1LK3H 3HMXA 3ILQD 4X83A 3BH8A 4WNQB 3QCUH 2Q87A 5CEZE 3U1SL 4RGNC 1R3HB 4B7IA 2YUXA 4LCIL 5JTWA 4L8SB 1BJ8A 3DVIA 2HFTA 4LPTA 4WJ5B 3GDBA 3AXLB 5AYQA 4YHYB 1LE5B 4PBXA 2E7CA 3SDAD 3MPCA 1QR1B 5DJAB 4G8IA 1LO4H 3MJ7B 2E6PA 4ZUSA 3B9DA 3MV8E 1M7XA 3V2AR 3BPCB 3BPOC 1L7IL 4K9EC 3DOSA 4NJAL 1YJDL 3EYOB 3VD5A 3JTTB 4WY7H 3SDAB 5JA9A 1MCOH 3UXFA 3NH7L 1CICD 4HQQH 3U0WL 2B4CL 5CZXD 4OZGF 3LS4L 5D7SH 1YY9C 3ZKNC 2WWKO 5IVOA 3IETA 4N0UB 1FYTA 4JM2D 4PJCE 1W8OA 3T8XA 4FQJL 3DVNA 4M7JL 4R6UA 3EIFA 1XF3A 4NWUL 3ZYIA 1GVIA 2B1AL 4H20H 1QZ1A 3FO1B 2UWEA 4LPXA 2YSSA 5JXAL 3MV11 3QB7C 1WBYB 1CICB 3PQYA 5EBWB 4ZNEA 5I73B 7FABH 2VSCA 4Z78A 3NIGF 1RZJL 4OZIE 4PTTB 3DO7B 4HPOH 4IDJH 4GMSH 5AAMA 5J12C 4JM2B 4PRPA 3PWUB 2XWTB 3ME0A 4NWTL 2FZ3B 1IJ9A 3LQMA 4JPVH 1UXWA 4AQ1B 3DUUA 3L7EA 5TPWH 1UFUA 4IIQB 4JCMA 4WUKH 5F1NA 3VE0B 5KS9B 1CDJA 3MCG1 3LN4B 4NO0A 4MD4B 4G43B 3QULA 2X4NA 5KG9B 1DQML 2IPTH 1YMHB 2F15A 4NNYB 3L5WA 1QKZL 1QFWL 3L3JB 2OBGA 1H3GA 2IH1A 4WV1C 3GSNH 3KLAA 4PGEB 2B39A 3FO2B 4K3JL 2D2OA 3RBGA 4ETQB 1A9BA 1WITA 3TVMD 3LOWA 4LQFH 4IRJC 4XNMB 4GRWH 3IXAA 4WU5B 5HSFA 2ZNWA 1A7PH 1FAKT 3UZVB 2VXVL 3QUZC 4ONGH 4L3EA 3PG2A 4NRZB 5D96C 1QRNE 1MHHB 4KMTL 1RIUL 1TZIB 4OGAD 4PJCF 3GNML 3JTSB 1J0IA 1NFDA 2H32B 1HYSD 5BQ7B 3CFIC 2Q76B 4NSKB 3OAYH 4KDTC 3TVMB 1BLNB 2CUMA 3ZT7A 1RSFA 3X12A 3ULUE 2X4SB 4AEFA 2ATKA 1QQDB 1QTYT 5IB5A 1RJCA 3LKRA 2R4SH 4OZIF 1MFDL 4IHOB 4BFBD 2HJKB 4XGZB 3PE9A 1CG9A 6FABH 2AK4D 1XEDA 5D6DA 2YK1H 4M61B 3VDCA 4ODSL 5EBMB 1UWGH 2ICEB 4GG6B 3IDJA 1CFVH 1WBXB 1MWAH 3IDNB 1DN2A 1BF8A 1DBAH 4W6WB 3S7GA 1Q9KB 1RU9L 3MLWL 4WI9A 4FQ2L 5ITBL 3PP3K 2W65A 4PLKC 3IDYB 5KW9H 5BW7A 5HXMA 2AK4B 4JHAH 1R5IA 4JPKH 3ULVF 4GSDL 1F2XK 4RQQB 2NXYD 3O6FC 6CGTA 4JREC 1OARH 2QKIA 3MJ9L 3VFSA 3UTSD 1T5WA 3RA7L 1YQVL 1UKQA 2V7NB 3MUY1 4JFHE 4TUOB 5GS0L 1EJOL 4P3CH 3P4LA 4Y4KA 2VJXA 4XPAL 4UNUA 2DDQH 1NGPL 4U1KA 1TTUA 3OHXB 4IOIB 3JUZA 4S1QL 5ABDE 2EEAA 4DOHB 2P43B 2NXYB 4JFQB 4OLZH 1ZLWK 5CEYB 3UTSB 4XWGH 1HSAA 4KVCH 3ULUF 4PJ7E 1FG9C 4TSBH 1KEGL 1R0AL 5B38A 3O2WH 1T3FB 3QIWC 3F6IA 5TF0A 3UTZB 1DDHB 3I6LD 1ETZB 5DFVD 4Z7NE 2ICWI 4RGOL 1MI5E 2JIXD 4HIHB 3W0WE 4LNVA 1ED3A 5T5NG 3MACH 1CD1B 2VZTA 1CXIA 1ZAGA 3L6FA 1TXKA 2B5IB 4F15C 2AABL 4WO4C 5K9KB 3WBDA 1H0DA 3QFDA 4NPYB 2WINA 5GRVL 2WBKA 1N3NB 2Z92A 3JV0A 3TBSB 2GCYA 5E6IC 1HSBB 3QEQE 1OAUL 1G0YR 2JIXB 3VFGH 4NQSA 1UG9A 2NCMA 4U6YB 1FH5H 3HNTH 3HE6D 1CDGA 3ZTNL 2APXA 3D18A 1MJUH 4XNZC 5CJ5A 2CGRL 3Q6FA 1N2RA 4JQIH 3BKMH 3OPZL 5IMKB 2DWDB 1TZHA 3HLAA 1CLYL 2HJFB 3TESA 5C0NC 4NN5B 3REVA 3CMOL 3GKZA 2W92A 3OAUL 4WW1B 5A3ID 1RVFL 3IFPA 5GGRY 3TEUA 3HE6B 2FWOB 2BNQE 2VDRH 3IDGA 4OD3H 3O45B 1Z6JT 4FQ1L 3P40A 3BT2H 1E4XI 5D72H 2RIKA 1BPVA 1S9YB 4YNYB 4X6CF 4JANB 4KC3B 4WFED 3QG7L 5IBUG 2V5MA 3GBNH 3T1FB 4Z7NF 1EAJA 4YHOH 3QT2A 2DKMA 4MD0A 1MCPH 3MRHA 2FJHB 3U30B 2BHYA 5MENE 4I4WB 1I1YB 2XTJC 2X4UB 4PP2B 5TQ0H 1EHXA 3EFFA 4Z7WB 4JJ5A 4O2CB 5DK0A 1IMHC 1RZFL 2L7UA 1UJ3A 3L9RA 4X7FC 1CE1L 1NBZB 4TVPL 5DJ2B 2B1HH 5LVEA 5CD3B 1XGTA 4P3WA 2AJVL 1RI8A 4QHUB 3GSWA 4KJWD 4HMCA 3HC0B 4ERSL 4DK6A 1M7DB 4NZJA 2PNDA 4KVNL 1PG7L 3BP6A 4KUCF 4X80H 4ENED 5IMLA 3MR9B 4YGAB 1RUAH 1I1FA 1J0YA 4IEFB 5BRZE 2EDRA 2WMPA 3FN0L 4RX4A 3PHOB 1NL0L 3I75A 5EOCL 4JG1H 3TBYB 2EDQA 4NNPH 3CH1B 4PGBA 4XVUD 5FKAB 3O9WA 1QNZH 1IILE 1LP9E 1WZKA 1AXTL 4KQ3H 4M6NH 1P1ZA 2XFXB 1ZHBA 5SX4I 2APVA 3GK8H 4HIIA 5GRZA 5C9KA 4LNRB 5CBAA 5GISL 5AZ2L 2B8OT 4YZFE 2HFEB 3EO1B 2WV3A 4PRHA 4X0KA 1VPOH 5ACMA 1P4LA 2XQYK 4J12A 2GSIB 4YDVA 2ZCKL 5FYJD 4K9EH 1NAMB 2A9ML 1X44A 3NABL 1Q9LA 4PG2C 3BPOB 5B4MC 2VMFA 3GIZH 3I3EA 3BMWA 1MFCH 3CFKB 2Q7YA 1ZV5A 2GSGA 4HS3A 1TZGL 4QRPE 5DR5H 2BRRH 1SJHB 4DW2H 4AG4L 3QPXL 4NUJA 3CFJA 1BM3H 2RHEA 3E1F1 3I02B 3TBVB 1YC8A 2UY6A 5B39A 2IANA 2XKSA 3A6OA 4LF3A 3NVQA 4LCWA 5EOQL 3MGAA 4LKXA 5KN5A 4OCWH 1R3IH 1HN1A 4YHML 2PW2A 3WD5L 4HIJB 1MHPH 1ZVSB 2ARJA 1S7QB 2VUYA 3LIZL 1Q1JL 1FL3A 4CMMA 4DZ8A 5B8CB 1S7XB 3EYFB 5IB2B 4OCMC 5J12B 1R3LB 2JELL 2OLDA 4EOWH 1KGCE 1LP9F 3RZCC 2XY1A 5EUOB 2XQBL 4DTGH 4AM0A 4BUGA 1EXUB 1Z0MA 4IRJD 5ICYB 3NIFE 4EDXA 4QHKJ 4ZTOH 4YHLL 3MUGA 3SN6N 4TUKH 4DCQB 1K8DB 5HYSA 1Z3GH 3QUZD 1JBJA 2P46B 3MLXH 5AYUH 3REWB 3PL6A 3UTPD 2ERJC 1OAKH 1OPGL 4MXQD 3IKCA 4R8WL 1AGCB 1IAIM 2MWCA 3RPKA 2ZOLB 3UCRA 4PJAE 1JYXA 1L6ZA 3QXDA 3UPRA 1E28B 4IRJB 4UTBH 4LFHG 4UINL 1T66D 1NCCL 4QNPF 3EAKA 3WV0A 3WCYA 3QUZB 5AD0A 2P7TB 3M17A 1BAFH 1MJ7L 3EDEA 3HPLA 2HG5A 4DVBB 4HWBH 3BUTA 4LP5A 4JPIA 2VR4A 3G08B 1DR9A 5T5NF 5TGBA 2Z0BA 3SE3C 4TRPH 1E4KC 3VXRD 2BSED 4N8CH 5FYKL 8CGTA 4DGVL 2BSRB 4IRZL 4OZHE 3DX6B 1RK0B 4IJ3B 4Y5YA 5HY9A 3ARBD 3DUHA 1ERNA 4EUPG 2GJ6D 5GHWH 3BIKA 4Z8FH 5EORL 3DVFA 1NEZG 1MJJA 4FZEH 3MBXH 3VXRB 3O6FD 1N0XH 3NIFF 5DC4B 1FPTL 3BPNC 1TQCC 1JGUH 4NIKB 5DI8A 5GJTL 3WSQL 1M6OA 4XCNA 3ARBB 2X1WL 3UMTA 4V1DD 4LEOA 2GJ6B 2GITA 2P5WE 2BOCA 3ABZA 3AMKA 1MH5A 3WEXB 4I2XE 2DRUA 4D9RE 2AEPH 4PJAF 2O26U 4M7LL 3KR3H 5DJYA 4HDIA 4V1DB 4WEUD 2R29H 3FB6A 5D7JC 2F54A 4LOUC 1IC4H 1G6RL 3LN5A 5CBEA 4LCCA 2JJSA 3INUL 1X9QA 5CILL 4D0BB 2QHRH 1F90H 3CSBA 3EFDL 3C5SA 5FV2A 2NY5C 3PGDB 4U0RB 1RZ8B 2V7HB 3BN9D 2XZAL 4OZHF 4QOKD 1NMCB 3MBEC 5ISZE 4S1DC 2AJUH 3QJHB 1ZE3C 1TENA 4J7RA 1GHFH 4KTDL 2SEBA 2A6IA 4FXLA 1GJIA 3LHPH 3EYVB 5AG9A 3O81A 3PGFL 2DLFH 1PVHA 2M8XA 3FB5A 3ZKMD 1IGCH 4TVSa 4XP5L 4X7EC 1Y18A 2ZUUA 1FGVH 1UCBH 1GC1C 1L6XA 4F15B 4OF6A 1MLBA 3DO3A 4QOKB 3L5XL 3HZYB 4FQXC 2BCKA 5D7LE 2X6MA 3LMJL 3X17A 4CBPA 4PS4H 3MV9D 2P8LB 4I48B 2IBZX 3C87A 3V4UL 4JLRA 5DD6A 3CFDA 3WLWC 5T1KD 5F7EH 3BRGC 1FSKC 3UJIL 3NGBC 1E4WH 4JFFA 5I75B 1XH3B 2D7TH 4QRTA 4BQ6A 1PY4A 1OM3H 1I9IL 3K74B 1KTLB 3DROB 2YWYA 1A3RL 4YXKH 3A67L 3AY4A 5DEGA 4JKWA 1YN6A 1U58A 1JCKA 3MV9B 2DWEB 4W4NA 4K7PX 1ZGLB 5E00A 1AO7B 4OCYL 5T1KB 4NQVB 4G42A 3O0RL 5DMIL 4GAYA 1IQDB 5KVFH 1ORSA 4G6JL 4JO2H 4KI5D 5C2UB 4X6DE 3N1PC 4KKBC 5DUPL 2F53A 4K3DH 4CL7A 2H2PD 4KFZC 4M8VA 4R3SA 3RDTB 2W0FB 1ADQA 4PRDB 4WI8A 1I3GH 5HI3C 4JAMA 4UIKL 3T2QA 2E7MA 5J11B 4YDKL 3MREA 4J8RB 1X6LA 2O93L 2XZQL 1EGJH 1T7WA 2DQCL 5DZLA 1P5VA 4M1CD 3WXWH 4L9LB 5FO9A 2J6EL 3KLSA 1QBMH 4XWOD 1FAIL 4AT6A 1JNHB 4HWEL 1NBYB 3P2TA 3RVTD 2PTTA 4K8RC 3ULUC 3ARED 3BQUB 3D1MC 4JQXC 5ADPL 3VGGA 1FFPA 2UZXB 3NN8B 4P2RD 3QH3B 4ORGB 2W91A 2VXTL 2CXKA 4RDQG 3OX8A 3U9UB 1X5GA 2MFNA 3LRSA 1OP5K 1A1OB 1IGIH 2JE8A 2H41A 2X44D 3GJEA 2JJTA 4Y16A 3RU8H 5FK9B 4JFDD 1HI6A 3VXME 4XNUH 5J6HA 3PWPE 1Y6MR 5I1KL 3PXHA 4NQCE 3FFCA 2FX7L 3SOBL 3AREB 3U4BH 1HQ4B 1KACB 3ZKSD 5LXGL 1G6RB 3LRHA 4OM1L 5JOFB 3TO2B 4H5SB 2QR0B 4E41D 2G9HA 4P2RB 3B8SA 2R56L 4JKLA 1NGQH 4MJID 3E2HC 5B4MD 4M93B 1JHTB 2AJ3B 2DAVA 4XP1L 2ZUQC 4JFDB 4QF1A 1U8KB 2EYTA 5FDWA 3FRPA 1CGWA 5EO0B 3PV6A 1RJYA 3CSYA 5D4QA 5F6HI 3MRDA 4KKNA 2YPLE 1SEQL 2AV1A 4O51A 4E41B 4UDTB 2X4OB 1EO8H 4N90D 4OFIA 4MJIB 5C07E 3U7AA 3BIBX 3U2SA 4X9BA 5EU3A 4ELMA 2R1XB 1RZKL 3P4OA 4XBGA 5HPMB 4RAVB 3DVGA 2F5AL 2GEEA 4OV5A 2WNGA 2CKBA 1BWWA 1PZ5A 4J1UB 3WYRA 4GKZA 3QXTA 2HRPL 3U0PB 3U9PL 3I50H 3PJSA 5CHNA 4PG9B 2ICES 1AHWA 3ARRA 4LSVL 3HAEG 3IXTB 4K7FA 3PDOA 1KFAL 1J1XH 1KCVH 2MJWA 2PTUA 2YN5A 3CXDL 4LLWA 1KENH 2FX9H 3LKOB 1HHJA 1D5IL 4NRXB 1JRHL 1YMMA 4FFYL 3IJSA 2X4QB 1GGIH 5C70A 4L9DA 1WAAF 4BFGA 5EPMA 3C8DA 1XZ0A 4GBXD 5F1OB 1IAIH 3T0AA 2N1KA 3WN5A 5DA0B 3DV6B 1JGDA 4FQLL 2CDFB 2WIMA 4FTVD 4NCC1 2VXQH 4G7VH 1OGAA 1NAKH 1C16B 5C7XL 3S36X 4CVZB 1JGVL 2FH6A 2YEZB 4P23A 4QHMA 4XBEL 3QRGH 3QI9C 3OR6A 3O8XC 4O4YL 3AUVA 1I8MA 2PO6D 2AQ2A 3QDAA 3NIDE 2W9EH 5BOZG 4GW1A 4GBXB 4P2QA 4ZFOL 2X2YA 4FTVB 1LDPH 4NUGH 1IGJB 1AXSA 5F44A 4P9MH 1PEWA 3TA3C 1KJVA 1FNFA 2EXWC 5FUCE 4NKDB 3QCTH 4OFKA 3Q5OA 1OSZA 5K9OB 1DBKL 3FB8B 3GMLB 3ROLB 2D03H 1M7IB 2PO6B 3RHWF 2R69L 4LLMA 1K2DA 4P48A 1JNJA 2EYRA 3QUKB 4XVSL 1ACZA 3CXHK 5JOEA 3IU4H 4JFYA 5ESQB 3BGMA 3MV01 3RKDC 4NNXA 3LKSA 3S88H 3MRRA 2KBGA 4KKAC 1DLFL 3W81A 2XZCH 5I1IH 4H0GA 4Y5VA 1A2YB 4WW2F 3EGSB 1FE8L 3MLTB 4X5LA 1SY6H 3D0VA 3SO3C 4ONHA 1ZA6A 1S7TA 3U36B 4PLNC 1RIHH 2JCCB 1PKQE 4ZODA 4X4ME 5FA3A 4S11A 3IDIB 5IG7A 3OAYK 2OSLA 2A77H 3GB7A 5DMKB 1D6EA 5ILTH 5MEOA 1RZ7H 4OZFH 4Q6IC 3AVEA 5JDSB 1WSST 4OFYA 4XH2B 4WI4A 5F9JB 4N0FB 3NIDF 3MRGA 5GGVL 4K2UH 2DIBA 1MSPA 3VFPB 5SX5H 5FYKE 1TVHB 2P47B 3H0TB 4KAQL 3QNXB 5DHYA 3MLRL 5D71H 2IADA 3F58H 1TTFA 4S1DD 1SYVB 4LASH 1J1OL 2OP4H 4KHXL 4JFOA 1NGWB 1XF4B 2OL3H 3HN3A 5E9DA 1FO0H 3QUYC 4Q0XH 4DN4H 5JO5A 3K7UA 4BUHA 3U79A 4LGSB 5I71C 3OKYA 2NY5H 1T21A 3X3FL 5BOPA 1A7QL 3HRPA 1NLDH 2F8VA 4BSJA 5MEPA 4LSSH 5F7MC 4X4YB 4BKLA 1EERB 4JGUA 3TN0A 5I1DA 4UOW0 4MNQA 2XKNB 3W2DL 2DBLH 1UADC 4UV4L 4CAGA 1OTTD 1DQLL 4BZ1H 3C60B 4NRYA 3ZTJH 4RDQF 3IFLH 2FCBA 4PR5A 3GI9H 4EI6B 5J8OA 3DMMA 5EUKA 2WW8A 4KZDL 1M05B 1U6AL 2X4TA 4K7PY 1OWWA 1IT9L 1T2QL 3KPRE 4MB5A 4P2OD 3F7VB 1T4KA 5ETUA 1A7OL 3HZKA 4XCFH 1AJ7H 1KLGB 2BC4A 5BXFB 1T1ZB 5I2IA 4KQ4H 3S3PA 1RUPL 1OAQH 4ZFOB 5JHDA 4F9PC 5CGYC 1XGYL 3ETBF 4KKBD 1YJDC 1BZ7A 1KJ2H 1EAPB 3PWVB 3RGVC 2Z93A 2UZIL 3MNVA 1T0NA 3D69A 5HYFA 1KG0A 1Q72L 1FIEA 4X6EA 4P2OB 2G2RB 4K07A 4M62L 4MXWL 1FDLH 2WUBH 5IT2H 4JZNB 4LLYA 1BVKB 2F58H 5F7FA 5TFSL 1BFOA 3BH9B 4XC3H 2J4WL 3QIBC 2Y6SD 3S34L 2PN5A 3ULVH 2LVEA 1U91A 2OR9L 1KN4H 3SKNA 3TBTA 5E2UL 1FRGL 5HHVH 5GGTH 1XCTB 3W39A 4EI5C 1RULL 2WBJA 1U8OA 5I1CH 1QLEL 3MNWA 4PIRF 4CVXA 1KXVC 5ANME 3ULUD 4HZLA 4Z95L 4QRRA 3FOLA 2ADIA 1QSEE 3EOBA 4QXUH 4Y5XB 5ERWA 3LKNA 1JF1B 4ODUA 4NN6C 4OD1H 5DJCA 3HMXL 3MRJA 1FFQA 3O3EA 4K8RH 3VXUE 4JY5H 3IFOA 2R0LL 2X89D 3RWJB 2ILLA 1FIGH 1BIIA 2ORBH 3CH8A 4B41A 2R0ZH 1L7TH 3RTQA 1LO2H 3QZWA 2DI8A 4M1DL 3T09A 4KDWA 1JGLL 3QO1B 2VTFA 2J8UA 4YXLH 2EIZB 3GSUB 1FC2D 4OSUL 3TIEA 4CGTA 5F7YC 1LE9B 2VDML 4KKLC 4PJBE 3GSQA 2AJZB 1J18A 1B0RA 2PCPB 2FD6L 3G6AA 1CFNB 1NCWH 2AGJH 2O5XL 3D0LB 5E24E 4HC1H 1EHAA 4JFHD 1QFWM 1W72H 4WCYH 4XNQA 5KVDH 3PWLA 5GS2H 3KLHC 3E2HB 2YOCA 1WZ1L 2ESVE 3T4AA 3LQAL 2CJUL 1ZSDA 3EDKA 5FUZH 1N6VA 2HYMA 4OBRA 2EH8H 3R06A 3WFHA 4Y19B 3GM8A 3SE4C 3NCJL 1JWSA 3RWHA 1SM3L 2XG5A 1FNGB 4DJMA 3W0WD 1JNNL 3GRWH 4MHHG 5I16B 4EN3A 5EN2B 4CN1A 1J5OH 2IH3A 4OKDA 1CS6A 3BX7C 2NY3C 3V0AC 4YK4B 2DS4A 1RHFA 4L5FH 4U05A 5HGAA 4PJ7B 3OJVC 1MUJA 4DN3L 1OTUD 3U4AA 1DBJH 2X09A 1DBML 1CLOH 4XPGL 1S7VA 3VFUA 3QEQD 1S3KL 1A3LH 2IFFH 3IF1B 1T7VA 3W0WB 4EZMA 5JW4R 3MMEB 2E8ZA 2IQAA 3GJFB 4R90H 2ENSA 3FHQA 3SGJC 4ZPVB 4GKSA 3TWCL 4H25A 4PJBF 1SYSA 2Z8RA 3TJEH 1NC4A 4JHZA 4LHUG 4YHPA 1CQYA 5LBSL 5GS0C 3H8NA 5IMOA 1KLUB 4MD5A 1EMTL 1CLZL 4XAWH 3BP7A 3O8XD 4YPGA 5E1AB 2QSVA 2CR6A 2WIIB 4Y1AE 3OKLB 5JIPA 4L29B 4OM0H 3QEQB 4XMPL 5BV7B 5FDYA 4EBQH 3RWDA 1S5IH 3D39E 3M8OL 3TCLB 3TA3D 1ONQB 4B0MM 2YKLH 3HB3D 4IMKA 5D5ME 1I9RH 3QDGA 5LGJA 2BFVL 5IEKB 5FUOH 1UT9A 2E3VA 2W1NA 4JRYE 1RK1B 2Q6WB 4I0CC 5T1DL 3IJHB 5JW3L 5T33H 1GAFL 4KTYA 3O8XB 1WCQA 4YBQC 3VGAB 1U3HD 1U95B 4XPFL 5KTEL 3P9LB 1PZUB 3WXVL 3P4MA 4G8GE 4NP4L 3ES6B 1U3ZA 1ZHLB 1TCRA 1VFBA 2QQKL 3TA3B 3PIQA 5IB1A 3BH8B 1ZTXH 3SDXA 2L7JA 5HI4C 3CVHA 1S8DB 1KPVB 4PUBL 4JHBA 4HJ0C 4BFEA 4UOJA 1U3HB 3WE6A 4H1LA 4R0LA 1P9MA 1CI5A 5BO1H 4XVJH 1D3CA 2NY4D 2EO1A 2AXHA 4KTEL 3KPLB 4CNIB 5TJWK 4KK9C 2DI7A 5IV2A 2D31A 1RHHB 5GJSL 5EC2A 5BRZD 5F7UA 4YBHA 3KYNA 3QXAA 3U7WH 3SO3B 3K0WA 1YEFL 5DD0H 4U7SA 1IKNC 1LDSA 1XF1A 3GKWH 5IBTL 1KC5L 1TPXC 2D7NA 1BVZA 2NY4B 4PJ9A 4CVWA 4DUWA 3UYOD 2I60L 4Z77B 4I3SH 3RWGA 5D5MF 4WI5A 4F7PA 5C3TA 2C3HA 5DSCA 3IDMA 5BRZB 1YA5A 2OMBA 1YN7A 1OB1B 5F7KC 2J88H 3QUXC 1YNKH 5DRWA 4G3YH 4RRPG 4AIZA 3DVNB 4QHKI 4HG4J 5KVEH 4QXGL 4OF5A 1N8ZB 1MCKA 3BDBA 5E70A 2UWEB 2DL9A 2WUCL 5IFAH 5LGHL 1MF2L 4NO0D 3PQYB 4PRBB 1T7XA 2VH5H 1EEZB 3FCTA 4K23H 4Z78B 4OF3A 4OTXH 5JW4Q 4DVRH 4G5ZL 4QRPD 5FF6A 4YFDB 2ZPKL 4O58H 5E7BA 2B2XH 1UXWB 4NZDA 2H32H 2E9IA 1LQSR 2YS4A 3DUUB 3L7EB 4XPTH 3QFJA 1DVFA 4GG8A 4R7DA 4NO0B 5DUBA 1BGXL 2DJ4A 3F7QA 4HJJH 3QULB 2X4NB 1OCWL 5D2LE 4ZO9A 4KH2A 3L5WB 3MUHL 4R96A 2EDYA 3BKYL 4QRPB 3U1SH 3FRUA 4EXKA 3TZVC 1UYWL 2VQ1B 4LCIH 3VXPA 3W82A 1A6WL 4Q6YA 2B0SL 3MGOB 3OAZK 4YBLB 5AZEL 3KNBA 3BJ91 3B9VA 2D7QA 3X3GL 3I6GB 1I7RB 1KGCD 4F58L 1WF5A 5JZ7D 4FQQA 2V9RA 1X7QA 1NFDB 1G7IB 4WW2C 1XR9A 5LAXA 4G9DA 1LO3L 1L7IH 1CGYA 2D0HA 3N9GL 4XXCA 4NJAH 3HRZA 1YJDH 1U3YA 2Z35B 4X7TA 3PWJA 3X12B 43C9B 1FZJA 4PJ5E 4RNRA 1AGEB 4NT6A 1T0PB 5IB5B 3NH7H 3LKRB 4UMGA 1D5BB 5K93A 3U0WH 2B4CH 5HYJA 1A6ZA 3LS4H 5L2KE 5EZLA 1CG9B 1C12A 5L6YL 1VEPA 4HHAA 1FCGA 1E27A 1DLHA 4FQJH 3W9DA 3FQTB 4M7JH 4NWUH 2B1AH 2OR8A 2DM4A 5JXAH 1ZK9A 2P5EE 4Y4KD 5DHVA 1O7SA 2A83A 4U1IA 2IPKA 3BPLC 5FUCC 1J0HA 1RZJH 3WHE1 3OGOE 2LTQB 1FJ1B 3TPUB 3UDWA 1P7HL 4D3CL 4CUCA 1OT1A 3EYUL 4NWTH 2QKIB 4M7LT 1T5WB 4LVNB 5BJTA 4DKAA 4HFUL 3KGRA 5FV1L 1DBBL 3MUJA 5I1JL 4Y4KB 1FLRL 1DQMH 1U8JA 1QKZH 1PX3A 2WWKT 5EBLA 1PSKL 5IUSA 4PJEA 5E5MB 4K3JH 4NBXB 5F9OL 2A9NL 4HUWA 3QSKB 3UBXA 4Y4HC 4D9RD 2YXMA 2ZJSL 5SWSA 1KN2L 3RUGA 3C6SB 5C08A 5B38B 1IGTA 1KELL 3FQXA 2VXVH 4PJHE 1WIOA 3DXAA 3G5XB 5DJZA 4KMTH 1RIUH 3MLUL 1ED3B 3S8WA 2WANA 3GNMH 3TIDA 2XXMB 3H9SE 4M03A 2UZYB 2WP3O 5CIPB 4Z5RA 5I19L 2CLZA 3BI9X 4I2XB 4MCZA 1N5AA 3KJ6L 3QFDB 2WINB 1KXTB 3TH4T 2Z92B 4JE4B 1Y6KR 3SCMC 5ACZB 5EC1A 2BVEA 3H2WA 2AQ1A 2VISB 4M6ML 3TH2T 1ZGLM 3ALPA 3DSNA 1BX2B 2XYCA 2BK8A 1MFDH 4NQSB 4PJ8C 4NCC2 5I8OH 5FO8A 3ALWA 2AKRA 4A6YA 5I15L 3D18B 1Q9OB 4HIEA 1MCWW 2X4PA 3Q6FB 1J1PL 4F7MB 1L4IA 1J12A 5D93C 3VXSA 1RU9H 3MLWH 4PY8J 3REVB 2CLRA 1OLLA 2GTZB 4FQ2H 3PDGA 5D7LD 2QLVB 1IM3A 2ZG1A 3O3DA 4E9LA 4YAQA 2GY5A 5ITBH 5E7FA 2UYLA 3IFPB 4G9FE 2XQYG 5FGRA 3IDGB 4GSDH 4GXUN 4TNWK 2V2WA 2IPUK 3MJ9H 5E6YA 1SHMA 3RA7H 2FDBP 4OLVL 1YQVH 5JW4N 3FL7A 4PJHF 5D1XA 5GS0H 1EJOH 4MD0B 5HDOA 3MRHB 1MLCA 4XPAH 3MLSL 1NGPH 5D7LB 2BP3A 1FVDA 3BWAB 3W11C 4S1QH 5I0ZA 1U2CA 3GMPA 4KRPD 5TE4L 4JJ5B 1EH9A 1KTDA 3QDMA 2NLJB 4LSUL 3L9RB 4ODWA 1SVCP 5IROA 1F6FB 2X1OA 3HC3L 1KLFA 3O3UN 1JTOA 2R15A 4I9WD 2XNAA 1KEGH 1R0AH 1KTKE 1TVBA 3QDJA 1SJVA 5SWZE 2NY6D 3D3VA 2YD5A 2NY7L 4LEXL 4KGJA 1MCLA 3O9WD 2OZ4A 4KRPB 5IMLB 1H15B 1I1FB 1ES0B 2P45B 1HWHB 3ARFC 1Z9LA 3HHRB 5TH2B 1CK0L 3I75B 2V2TA 4X6DB 1FLTX 5CLTA 2NY6B 1RMFL 1OAUH 1CIUA 3MROA 1BWMA 2HT4C 4WEBH 5BS0E 3O9WB 1BJMA 2DQDL 2EEBA 1KJ3L 1R5WA 1G7HA 2Y36L 3QYCA 1P1ZB 4HV8B 3ZTNH 1ZHBB 2Q20A 4AJ0A 3UZQA 4MQSB 4HIIB 5E2WL 1IC5L 2A6KA 2CGRH 3UTTA 2VZUA 1C5DA 1P7KA 3OPZH 3WKML 4PRHB 1CLYH 4AEHL 4X0KB 4UV7L 2XRAL 4NQEE 5CJOL 4FXGA 1CBVL 3CMOH 3VXMD 1OD9A 4DEPB 1CFTB 4EUPH 3OAUH 4NQCD 4LCWD 1RVFH 5IVXE 1TITA 4OLWL 7CGTA 1J7VR 1NPUA 2Q7YB 4U1JA 3T2OA 4FQ1H 3LKPA 1ZGLP 1I85C 3UC0L 4HS3B 1K5NA 2GFBB 1QSFA 5F3BB 4NUJB 3QHTC 3QG7H 3BESR 3C6LC 3TPKA 2V6HA 2P8MB 4JKPL 1CD9B 4IRSC 4NQCB 1BQHG 4LCWB 4H88L 5GGRA 3K1KC 4LKXB 4H8WL 2AJYL 4JO3L 4LGPB 1JWMA 2C3XA 3ZL4L 1UACL 1RZFH 2VDPL 4C56E 1CE1H 4TVPH 3OKEA 2ARJB 3THML 3AROA 4UT9H 3RWFA 4LRNL 4HAFA 5F71A 2AJVH 1FL3B 3PL6D 1I7UA 4DZ8B 5I8CB 3KXFE 8FABB 1QFUL 4ERSH 4KVNH 3NBNA 1MIML 4PV9B 1PG7H 3G5ZB 4AM0B 3C5ZA 4CW1A 4RA3A 3SJVE 5SX5K 1MQKL 1BQUA 3MUGB 4RFNC 3FN0H 1NL0H 4JZJA 2YWZA 3PL6B 5EOCH 5DT1L 3UTOA 3IKCB 3T0XA 2ZG2A 3MCLL 1BQLL 3HUJA 1BZQK 5IVXF 5BVPL 3WO4B 5DEFB 3WIHA 1AXTH 3R1GL 4PLOB 4APQA 3GMNA 3N1GC 5C0BA 5AD0B 3M17B 1A4JB 4LBEA 1H5BA 3HPLB 5GISH 5IQ9A 5IHLB 3CFEB 4NYLA 2ZCKH 4WW2B 1I7TA 2BNRA 2A9MH 3NABH 3MJ6A 3DUSA 4DKDC 1U92B 2DYPA 3AS2A 3QWOA 5J7CC 4NZRL 1JZ7A 4Y5YB 5HY9B 2HH0L 1TZGH 1ADQL 4HT1L 4FOMA 4AG4H 1FNLA 3QPXH 5HVWA 3MRKA 3E6FB 4HUXA 4IOSD 2NR6D 4HXAL 4XPHL 5E08L 1MELA 3MJ8B 1MJJB 43CAA 3HG1E 4YWGL 5EOQH 1PG7X 5FM5M 2CUHA 5DI8B 4AZ8A 1ZT4A 4WNQA 4XCNB 4PJDE 3AB0B 4YHMH 4LEOB 3WD5H 2GITB 4X4ZA 2BOCB 3DHMA 1H3PL 4LRIA 4BQCA 3LIZH 2FEEL 1R3HA 2QADD 3V0VB 4BM7A 3IAPA 1MH5B 4HUMB 1AD0A 1Q1JH 4L4TA 4L8SA 3BPLB 5E56A 3T3ME 3DETD 3BZFA 3TFKC 1LE5A 4GXVL 2JELH 1A3QA 5GRJL 3ARGD 4OIIL 5DJAA 2XQBH 5E4EC 2X4RB 1V7NL 4LDLB 1YDPA 4YHLH 1X5KA 3MJ7A 5JXEA 3RPIA 4XP4L 2QADB 2GQHA 1F6AB 5CBEB 1N0LA 2VDOL 3BPCA 2Q3ZA 1OPGH 4R8WH 3JTTA 2GK0A 3ARGB 2ZUYA 4JCLA 5D7IE 5CD5C 5FHAL 2HLFC 3BSZL 4UINH 1NCCH 2VZVA 2ICWA 1MOEA 3IRPX 2SEBB 2A6IB 1QUNA 1PKQB 5F70A 3UPAA 1MJ7H 4N0UA 3MA7A 3QUMA 2DQHL 2R9HC 4ZSOA 4YUEL 4JFFD 5A2FA 1YPZE 4KGLA 4WGWB 3SPVB 4LIQL 3FO1A 2F8OA 1S5HB 3CUPA 1MLBB 1JI1A 5FYKH 2C26A 4DGVH 5CLWA 1CDCA 2DLEA 2LU3A 4IRZH 3BGFB 2Z4QB 4EVNA 4PTTA 4JLRB 3NCCB 3CFDB 4JM2A 2AJXL 3NFPB 2CKBL 3PWUA 4NGHL 2H26B 5EORH 3T3MF 3NTCL 2YD6A 4JFFB 3TLRA 4X99B 4QRTB 5CP3A 3H9HA 4IIQA 4ZXBD 5INCA 4L8CB 4LK4A 3VE0A 3TJHD 4KZEL 2EYSB 3LN4A 1FPTH 1DEEA 4MD4A 1WCBA 1D5XA 4HLZH 5GJTH 3WSQH 1U58B 3HZVB 2BVQA 1BFSA 5E00B 3RRQA 4MQXC 4G42B 4PGEA 3FO2A 3ARDA 3TT3L 1ZEAL 2O61A 3LAFA 4ZXBB 1ORSB 4XNMA 1D7FA 4WU5A 4PLJC 5JPMB 4CADB 2IQ9H 4M7LH 4MWFA 2Q86A 2UVFA 3B9KD 4NRZA 1LEKA 4KXZI 1U8NB 1TZIA 4ZNCD 2IMMA 3T2PA 1G6RH 3HAEB 3MREB 1XGQB 1JMXA 5ICXB 3ECBA 1YPZF 1J8HA 3INUH 2Q76A 5CILH 2R4RL 1BLNA 3EFDH 3DV4A 1BD2E 1YNLL 4Y16D 2XZAH 1QLFA 4Q2ZB 1QQDA 3B9KB 1VDGA 4LU5L 4IHOA 2PTTB 2HJKA 2BVPB 2FJFB 3WJLC 3SKJL 3OSKA 4KK5D 4KTDH 1FFPB 1AIFB 1F4HA 4M61A 5TE6L 3PGFH 5EBMA 4GG6A 1L9MA 2BVUA 3LRSB 4G80A 1XGPB 1WBXA 4NM8L 4XP5H 4Y16B 1UGNA 3IFNL 4PJGE 1QSED 1HI6B 2BOBB 3L5XH 5CP7B 1Q9WA 3CZFA 3QPQC 2CPCA 4OAWB 3K1DA 3LMJH