5F6HJ

Crystal structure of tier 2 neutralizing antibody dh427 from a rhesus macaque
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
b'SALTQPPSVSKSLGQSVTISCTGTSSDIGAYTGVSWYQQHSGTAPRLLIYDVSKRPSGVSDRFSGSKSGNTASLTISGLQTDDEADYYCCSYRTGATYIFGTGTRVTVLGQPKGAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DH427 Antibody Light Chain
publication title Structural Constraints of Vaccine-Induced Tier-2 Autologous HIV Neutralizing Antibodies Targeting the Receptor-Binding Site.
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Immune system
total genus 51
structure length 212
sequence length 212
chains with identical sequence L, N, P
ec nomenclature
pdb deposition date 2015-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f6hJ01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f6hJ02
2Q20A 3MLVL 3FCTA 5E6IA 3O4LA 5DK0A 4OCMC 4PB0H 3WIFB 25C8L 4PJXB 4JPKH 5LAXB 1SVCP 5CFHA 4YDIL 3RVUC 4PS4L 1A9EB 3MCLL 4LSPH 2C1OB 5JPNA 5DMIH 1I3GL 5JLZA 2P5EB 4L4VD 4S1SH 1OHQA 3GMQA 4GBXB 4HDIB 5C07D 3SDDA 3KPOA 2F19H 4X8JA 3VH8B 4MYWB 2IAMA 1PVHA 4O2CA 4L8DA 1ZHNA 1DANU 2G60L 2VXVH 4NN5B 5FGBC 4IRJC 5HI5D 1JMXA 1JPST 5AAWA 4LPXA 4JVWA 2UWEB 4KUCD 3IVKB 2ZCLH 4Q0XL 4XAKD 1P7QB 1I1AA 1G9MH 5BS0A 3NCBB 1MELA 4QRSA 4PGJA 1CWVA 3U48A 4LCCB 3V8CA 5LG1A 4G8GA 1ADQH 5GRJH 3SJVD 4ZUSA 5ESVA 1G9NL 5AD0B 3CH1B 5I30L 2VDQL 1A7PH 4LP4A 1JMZA 2F5AH 4ZSOE 2HLAA 2HG5A 4Z0XA 3TA3A 2D7TH 2HVKA 4P5TB 2J5LB 4RMRA 4X4YB 2Q8BH 3QFJB 4TVPL 1M05A 2NLJB 3QDME 2FWOA 4O2EA 3L6FA 2OBGA 4K71C 5FUOH 1L4IA 2HT2D 5C6WH 3S4SB 3VXNB 5DJ2B 1JTPA 4S1QH 5MERA 5DUPH 1YUHA 5HSFA 2CLZB 1ZWIA 2YN3A 1G7IA 1OT2A 4GAFB 4PJHB 1XMWA 2VISB 3V6ZA 3VXTB 2V17L 2RCSH 3PWNA 1F00I 5I8KL 3S88H 3QIWD 3HRPA 4HKZB 3ET9F 5BRZE 2ZOLA 2X4RA 2OYPA 1EDQA 5TE4H 2A73B 3I6LE 3H3PL 2ITCB 2FO4B 4UIMA 3EYFB 4XNXH 4RISH 4YHLL 4DN3L 1NCAL 4PTTB 2NY3D 4ZAKA 4N1CA 1K8IA 5FYKH 4GUPB 2KQMA 2VXSL 1XCTA 1U58B 1JPFB 1IM3A 1S9VA 4P4KD 3MRRB 5MENA 2V2WA 4I2XA 3N1GC 3O45A 3ZYIA 1B0RA 4KMTL 3D18A 2PTTA 4IOFD 1EERB 3G08A 3VXQA 4F33A 5AEAA 3ULVD 1DVFB 1CG9B 4PRIA 4LPVA 1WGOA 1QFUL 1CK0L 4ONOA 1JGDA 3S7GA 1BBJB 1CN4A 3U0WH 4DKDC 1CFQB 3QH3B 4GRWB 3QAZC 2X1PA 3MRIB 4ONHB 3BP6A 5F88B 1JFQH 5J56B 1J5OL 1MFDL 5C0CD 2VB5A 5IESH 1MEXL 4R0LB 4P3DA 1XGYH 3P2TA 5DYOB 1TZHA 12E8H 1YNTB 4OUOA 1EO8L 4MXWH 5IG7A 4LU5H 2IPKB 3P9LA 5F9OL 2PXYA 3G6JA 8FABB 2ICWI 2P5WA 2NY1B 1AHWA 5DQDL 3HR5B 2GTZB 1CGVA 1QPPA 1Q0YH 3OAZH 3VGDA 3IAQA 3CC5A 3DV4B 2Z31C 4EUPB 4YHNB 2AJSH 3EUUA 1A6UL 5HGHA 2P7TA 3MUJA 3GSRA 3MJ7A 1XGPB 4UTAH 4G80A 3TH3T 3VWKC 2EO9A 5DA0B 4G9DA 1BD2D 1BJ8A 1JRHL 3RDTD 1JHLH 1R3LB 4GXUN 2ARWA 4UNTA 5BXFB 1TZIA 2X41A 4JDTL 1GOGA 5HHPA 4B7IA 4CRPA 4NQED 3CDGA 4IHOB 1X5YA 3MLRH 2ADGB 4RRPG 4Y4HA 1KIPB 4LLVB 4HKXA 1UZ6F 1I9IL 3FO9B 2XKSA 5FHAL 3SKNA 4CDHA 1KACB 3DUUA 3PGDA 5GGSY 3OWEA 3U0PB 3QJHB 5CEZE 3HZVB 4ZDHB 2WUBL 4QRUA 5DJDA 5JXEA 5KSVA 5HHOE 3KJ4C 4BQ6A 1ACZA 3EFFA 3VXMA 1EK3A 2QSTA 2MSPA 2PNDA 5E1AB 1KIUA 1BQUA 2WWMC 2MFNA 2FBOJ 3QUZD 5C0GA 1NMCB 2CMRL 2QR0A 3IGAA 2R2BA 3HAEB 4LLMB 4HH9B 3N9GL 3FQTB 3RZCB 4PJ8A 3E3QC 2DRUA 3SCMD 4F8TA 4DZBB 1NCWH 1PQZB 1MSPA 1KJ2A 1RZKH 3B5GA 4O58H 2AJ3B 3RX7A 5HHXH 2PW2B 3E2HC 3O8XA 4Z76B 4ZG1A 1JUFB 4L8SB 1P4LB 2IAND 1LK2A 4UINH 1DEEB 3HG1E 1T7VA 3GSWA 3WS6A 1QACA 5LGHL 1NBVH 4TPRL 4ZOBA 5ACLA 1CIUA 4NWUL 3PDGA 4X6CB 1E4KC 1T66C 5F89A 1W72L 2XKNB 3O6MH 1Q9WA 4L4TA 1ORSA 3G6JF 4D9QD 5ILTH 1CFSB 2CDFB 3T1WA 1N5YL 4U1GB 1BFVH 3MRCB 4D2NA 2YD6A 3SKOB 3O4OB 3QEGL 5IQ7L 4LASL 4XCCH 5T1KD 5E99H 5EUOA 2AXHA 5CEZL 1QSEB 2JE8A 3IU4L 5D1ZB 4ZUWB 3VXPA 5I17B 3VFVB 3QEQE 5GXBB 1KB9K 3G5YB 4OI7A 1JI1A 1FNGA 5ALCH 5LQBL 1DBKH 5D2LB 3OJDA 3GMOA 3GUTA 1INEL 3IDIA 4JFDB 1KIQA 4M43L 4K7PH 2OZ4H 4HIXH 2O5ZH 3TLRA 3BPCB 4QXTB 3OTTA 4LLDA 5DMKB 1BVKB 5I75B 5HGBB 3HI5L 1HXYB 1KEMH 5F1IB 5IFHL 1S7QB 1JF6A 4X7FC 2VDNH 3QHZH 1UWXK 1TETL 3R1GL 4QRRD 3I75A 3GBNH 3Q6GL 4DCQB 5FA3B 2YR3A 2C7UB 1BVLA 1X5GA 1AGEA 5FECB 4OD2B 5F9AC 1FL6A 1QSFA 4Z7WB 1ZK9A 3Q6FA 5TDOA 1BQHA 1YDPB 1D5BA 1OSPL 2AJUL 4DJMA 1DP0A 5AZ2H 7CGTA 5TPWH 5KSAC 5HD8D 3IJYB 4ZYKB 2BOCB 2FJHB 2CKBB 2R2HB 2F58L 2AKRB 3AXLA 5TH2A 1I9JL 2Z4QA 5DSCA 1I3VA 3QQNA 2E5EA 1BWWA 3LEXB 2HKFL 2OQJA 2UUDH 3CLFH 3D25A 2QSCH 2WANA 4JFFA 4ZTOH 1F4WL 2CH8A 3HE7B 1A6PA 3MV8A 4MLSA 2ARJB 1P7KA 5GSVA 2CK0H 4R3SB 2AEQL 5MEPB 4OZGE 5H37H 3IJHB 3QNXA 5CMAB 3NZHH 1J1PL 4Z9KB 5GGSB 3SKMA 3TT1L 3QEUA 4GAGL 3PE9A 4RMUA 2Y5TA 5KJRL 5CGMA 5HDLA 2APWA 4F8QA 3BX7C 5D8JL 5MEQB 4RGMB 3FRPG 3QQ3B 2BVOA 1A3LL 4OCRH 4XCYB 1YMMD 2D2OA 4Q9RL 3GSQB 1A1OB 7FABH 4Y4KA 4DVRH 3UP1A 3NBNA 5CP7A 4Y19E 1IAOB 4I9WE 5C09E 1ZVHA 1G6RH 5I1AA 1B0GB 1CCZA 3FO1B 2R1WA 5A16B 3HZKB 1F45A 5JTWA 3ALWA 1OW0A 5EUOF 4BELD 3ZKMD 1IKFH 4NQDD 3WJLC 3QPXL 5ACZA 3UZVB 3EO9H 5ENWA 2BVQB 2Q3ZA 5GSRB 4TNVK 1S3KL 1ZA3A 1G7QB 3WS3A 3TP4A 3MUHL 1AR1D 4P5MB 3MLTA 3BXNB 4WI7A 3MNVB 1OLZA 3SDCC 1DQJA 1AGCB 2H1PL 1GPOH 5I1GH 1U42A 4RGNB 5D7SL 1C08A 3C09B 4CNIB 5FV2A 1KJMB 9CGTA 3L3OA 2EC9T 2FGZA 2PTVA 4I0PB 5FDWA 3DETD 3VRJB 1ZSDB 3NCEB 5F71A 4WDIA 3TWCL 5IVZB 1YNLL 4JR9L 1UB6B 1PX4A 1Q9OB 2PYED 5A43C 1KUMA 1JYWA 5JHDB 4XBEH 2A1WL 2CD0A 3EYUL 2HLFD 2WV3A 4CVXB 3ECBB 5EB9A 3MO1A 5IW1A 3R06B 5DR5L 4BH8B 2I07B 5DGQA 4I4WB 5LWYH 3DGGB 4DFHA 2BHZA 1V5JA 3PWPB 3H3KA 1CU4L 2XQBH 4NQSB 5MEOA 1SYVA 4XRCA 2QQNL 3X3GH 2GTWB 5MHSD 5JZ7D 4UUJB 3N1MC 5HHVL 3IDMA 4DW2L 1NGQL 3GGWB 2V9TA 1RZJH 2Q86B 1CGTA 3QIBD 3IFOB 3UC0H 3FT3A 4A6YH 2NZ9D 5KW9L 3QI9C 3PL6B 3VH8G 3TN0A 3AM8A 4WEUD 3RWFA 3VJ6A 1QOKA 3C2AH 3B6SA 5H2BB 2CO6B 4KJPC 4ZQKB 2GFBB 4AQOA 1AY1L 3C5JB 2IPTL 3DVGA 5EZJA 3MODH 3SN6N 2IG2H 3RWJA 5BZWB 2YD2A 5F3HA 3RVUD 4TRPH 2A9MH 2VABA 4O4YL 4F7PB 3GMRA 1X5AA 3A6CH 3GHEL 4HUVB 5IBTL 3HNVL 4G6MH 4IRJD 2JJWA 4OLZH 3LV3B 3V0WH 1FFPA 1OY3B 3QDGB 3VG9C 3SE8H 1Z2KA 5IEKB 1A0QH 4CMHB 4PUBL 5BO1H 3ZKQD 1RU9H 1U6AL 3IJSB 1KG0A 2D4FA 4Y16C 4WO4C 3QXAB 3G04B 3S4SG 4L4JA 1ZANH 3RA7L 2WMPA 4L4VA 5GS2D 2GJ6D 1MCQA 2ZCHL 5C07A 4NJ9L 5I74C 1SVZA 3HE6C 4G7VL 5E08H 1T1ZA 1RMFL 2BOBA 3B9KB 1FZOB 5DQJA 5DJ0B 2ZSWB 4M62L 4PV9B 1A1NB 1FFOB 3M17B 4DZ8A 5BV7B 3AU1B 1MIML 1Q0XH 5AYUL 1MVUB 4PJEE 3QRGL 3VRLF 1UM5H 3U4AA 3WFCL 2NCMA 4PRAB 3D9AL 3MOAH 3SJVA 1Z9SA 1KBGL 3HCVA 3EYQC 1E28B 1AO7B 5FYLH 2J8UA 2VLKB 1U8KB 1MFNA 4CVZB 1VGKA 3GZKA 4GW5B 3IYLW 3L5IA 2HJFB 3QUMB 4RZCB 5CUSH 1DUZB 1I9RL 1Y6MR 3CSGA 3DI2B 2XWJB 2D7QA 4OQTH 4ZFGH 5TQ2L 4XNYH 5DD3L 3TIEB 4OTXH 4QKXB 3QDAA 5IHLB 2CJUH 3FCTB 5E6IB 4B5EA 3QZWA 3O4LB 1H8NA 2IH1A 1T1YA 2BNRD 5ESQA 1T04B 3C5SA 1NMAH 2RBLA 35C8L 3QIWA 4BFGA 5JPNB 1RURL 3MRJB 2EYRB 3VRIA 3IDJA 3KPOB 5IBUB 4X8JB 3QXDA 2IAMB 3OGCA 4LSSL 1MF2H 4UU9B 1ZHNB 4OKVA 1NCTA 4U6VH 1A6ZA 1CFTA 1YC8A 4QRPE 3QXWA 4F57H 5E94A 5FYJH 1RZIA 4BFIA 4ZD3H 1PG7W 5BS0B 3B4NA 2W0LA 4P4KA 4EUPG 1AQDA 2BK8A 4ZUSB 3AROA 5ESVB 3U7WL 2DYPD 3B8SA 1T5XA 2B7DT 5HDQL 1JYXA 2WNGA 4K7PX 4LNVA 2AV1A 2LAAA 2OL3H 4OCLC 3VXSE 2MPAL 2HVKB 5EU4B 1IJ9A 2C3VA 4Q6IA 4ZS7L 5I0DA 1A7BA 3KJ6H 4UI2A 2HFEB 3LEVH 1RZ7H 3ZE2E 1J0YA 1M05B 1R6VA 4XPFL 5IM7A 2FWOB 4O2EB 5CWSB 3G9AB 4HPOL 5IHUL 1CR9H 2Z31D 1U3HD 4XBPB 4OZIA 1CDIA 5C0CA 3UTSD 1ZWIB 1G7IB 2WP3T 1MCWM 4JM2F 3V6ZB 2C3GA 3KVQA 1CE1L 3ROOB 3S3PA 4QXGL 3U82B 1NL0H 3H7BA 2HRPL 2X4RB 4PJXE 4WGWB 1ZLSL 2NR6C 1FZMA 1RUPH 1H3XA 2D9QB 2HFFA 3O11A 3RPIA 2YMXH 1NCCH 4NWTL 1I3RB 2P5EE 2XG5A 32C2A 2J8UF 3PWUB 3VXOA 1CT8A 1K8IB 1BVZA 3L95A 5HPOA 4UT9H 4P9HL 4JY5H 1XCTB 4OLXH 1K8DB 1S9VB 2B1HH 4LSVL 2YWZA 1JHKH 1FIGH 3ZTNH 5MENB 4RMQA 2UWEE 3JWOC 3OMZA 2V2WB 4Q9QL 4I2XB 1KT2A 3HAEG 3DX8B 1B0RB 2HFGH 3VXQB 2PTTB 4RX4D 3G08B 3FB8B 5EOQH 4F33B 4FXLA 2RB8A 1BD2A 2OR9H 3RDTA 3P73A 4FA8A 4GW4A 3WN5C 1AH1A 1GC1H 1PSKH 1QD0A 2EDEA 1GZQA 1JGDB 1U8JA 2DM3A 4PY7A 2EH8L 4NQEA 4NZTH 1LP9F 4RBPK 3VG0H 5FHBL 5KANI 1YPZA 2WWMD 3VFPA 3QFJE 5FUZL 5EULV 5E08L 3DGCR 5GRUH 1EMTH 2FH8A 1F4YL 3BEWA 4P2CG 1TZHB 1IGTA 3ZHKA 2VO5A 4P2QE 5IG7B 4MQXC 3O2DA 3P9LB 3DYMA 2VDOH 1P53A 2Y07L 3CCHB 1OP3H 2PXYB 1N64L 3D2UB 3G6JB 1RULL 2R69L 2P5WB 2M8XA 3VFGL 4K3JL 5T1DL 3V5KA 4IRZH 4YX2H 3CC5B 1T66D 3NCYS 5FCUH 1SMOA 5JW4Q 4GRLB 3QUZA 1I8MB 3OKNA 2BSRA 3KPQA 2DI9A 2XZCL 3PGCB 3SE4A 5HGHB 4NGHL 3H0TA 4YHOL 3SCMA 3OXRA 3MJ7B 1PG7H 1U36A 1SJVA 4PB9H 5EOCJ 3U9PH 5TE6L 1OP5H 4OZIF 3KR3L 4XC3L 2IANA 3ULUC 5B3JE 4QTIH 4G7YL 3DYPA 4WJ5A 1NCUA 1TZIB 3HC4L 3GO1L 2P46B 3LVEA 4Y5XA 4YO0B 5F6IC 4HWZA 4YQXH 1WZ1H 3KWWA 4Y4HB 2DQHH 4HKXB 3BSZH 4UB0H 2EYSA 3SKNB 3BZEA 1P4BL 4GRWE 3DUUB 5DD5H 5JMOC 3QXVA 4M9OA 2I5YH 3FFCB 3PV7A 4O02H 2VC2H 1JZ2A 3NVQA 2YEZA 4QRUB 5DJDB 5KSVB 1AC0A 3QR2A 3B3IB 5T1KA 4KI5E 5F7EH 2Z8RA 4OD1L 2IPUG 3RVVC 2IBBA 3VXMB 4OZFB 4KY1L 5ADPH 4H88H 5M95B 3RGHA 4WW1A 4HUWA 3ZE1E 3EYOA 3BIKA 2A2QT 5KSAD 5C0GB 5ICZB 1VSCA 5ESAB 4GLRH 1NCNA 3BIBX 3K8MA 4PJ8B 4Z8FH 4LGPB 3BOVA 4F7MA 3S5LB 2AK1L 1YPZF 3O8XB 4QRRA 1P6FA 5IVXE 3MV01 1CLZH 1LK2B 5F1SA 3RNKA 3GSWB 2EDYA 4YAQA 4QCIA 4OD3H 4UQ2A 3CNKA 4L5FL 5E2WL 1Q9WB 1ORSB 2MNUA 4PJ9C 2JIXD 1N6QL 1NGZA 2UZXB 3T3ME 3KHQA 1KJVA 3GRWL 3ZSTA 4FFYH 4ZPTA 1FORL 5DHVA 4WI8A 3BIAX 5EUOB 1UA6H 4NNXA 1G0YR 3VXPB 2X1XR 3RY6A 2W60A 3N85H 1T83A 3KXFD 3PWJA 1E6JL 2FGWL 5KAQG 3GUTB 4FMKA 4L9LC 3IDIB 1KIQB 1PDKA 2D0FA 3S96A 3PUCA 1QUNA 4LLDB 4WEBL 2UY6A 4JQIL 1W0YT 3O6LL 2R9HC 2GCYA 3O41A 5I1IL 4TVPD 1A5FH 3IS0X 2EEBA 1I7UA 2APVA 2P49B 1RHHA 1U95A 3C60C 1YMMA 1PBYA 2OI9B 5JXAH 4NZRL 1AXSA 3LH2L 2JELH 3DO7A 1BVLB 1AGEB 1S7TA 4XP9H 3SDCD 3BQUC 1QFWL 1FL6B 1QSFB 2VYRE 3Q6FB 1BQHB 4XB8A 2KZWA 4WUKL 1D5BB 1ZA6A 3PV6B 4MZ2A 1I7RA 2AJXH 1MFCL 3OJMB 4N0UA 1OCWH 1GGCL 1WBZB 1U2HA 3K4DA 1KPUA 3KPRE 5FO8A 4APQB 4WFEE 3FRUB 4X6CE 4OFIA 3AXLB 1PY4A 5FGRA 4NQDA 4OI8A 4C4KT 3K4AA 2Z4QB 1A22B 3PHQA 4P9ML 3OV6A 4ZUVA 5H94A 4HWBL 4D3CL 5I1DB 2X1QA 1MCLA 1MHEB 2YD9A 5ERWA 3RUGF 2OQJB 3D25B 1QQDB 3WHE0 1TZGH 3JWDL 4JFFB 1BJ1H 3MV8B 1UWGH 1GYAA 1P7KB 3L1OL 3NH7L 4J4PC 4L29A 1I8IA 1PZ5B 3QNXB 3BDYH 4ODBD 3WSQL 1L6ZA 3LEYH 4V2BA 5DJXA 2VDLH 2DKUA 1QSEE 5SWZD 1A02N 4YDVA 3QEUB 1JNHA 1F11B 5DWUL 1R3IL 3MRGA 5D2LE 1LEKA 1IC5L 4JFDE 2C3HA 3ZDYF 2Q1EA 2BVOB 4L3AA 4AEFA 4JRYE 3B2VH 5IFAL 4Y4KB 2PYEA 2DJ4A 4DFIA 5B38A 1ZTXH 2ICES 3QDMD 4U05A 5TE7H 3QEHB 4JO1H 5CP7B 1GIGL 5DI8A 2F54E 4LRNL 4YH6A 1YA5A 1DTUA 1Q94A 4K9EC 4H8WH 5I1AB 1KCRH 1FL5A 2R0ZH 1T03L 2H32H 1SMAA 1JGLH 1HH9A 3QI9D 4Z7WE 3UXFA 3ZYOA 2IJ0C 5ACZB 1NC2D 4KJPD 3TBWA 3MUGA 4OFPA 3WS3B 3HC3L 2DWDA 3MLTB 4MDJA 4W68A 2IFFL 5EO9A 1KC5L 3H6JA 1DQJB 4PJFA 3X14A 2DIBA 4YGAB 3SPVA 4KKAC 1F6AA 1P4IL 3BT2L 5GS1A 4ODSL 1TTFA 2NY6B 3SGKC 3QIBA 1C08B 1HXMA 3BJLA 3L3OB 3MLWL 3DRTA 1YMHA 3FO2B 3QIUC 1SJXA 4UAOC 1VA9A 1FG9C 3G5VA 2IBZX 3F65A 4K7PY 4K8RH 2F74A 3UJJH 5GHWH 5EUKA 5E4EB 5JW3H 2AABL 5DUMH 1S5HB 4P9HC 4Y16D 4WO4D 5EZOH 3S9DB 4HWNA 1L9NA 2OTWA 2KPNA 3HKFA 2BVYA 4H20L 1J0IA 3LMJH 1BJ1J 1HE7A 3OZ9H 1G7JA 3ISWA 4QNPF 4UIKL 5KVFH 2QQKL 3HE6D 2GT9A 3MO1B 3INUH 3OKKA 5FGBA 4IRJA 1AKJD 3KGRA 4G9FD 1IGYB 4JFPA 3U30C 2FYYA 3B5HA 1J87A 4G6JL 2RGSA 4YUEH 1IGFL 2YS4A 1DN0A 2H45A 1V7NL 4C59B 5MEOB 2V2XA 2X5PA 1UYWL 1S7RA 1U8PB 2A77L 1LDSA 2CDEB 1N3NB 3EYQD 4XNMB 4N68A 1A2YA 2KH2B 4M48L 1S5IH 3WIHA 1C5CH 2GJ6A 1YEGH 1Q9LA 2CKBL 3IDMB 1RZ8A 1RSFA 3CMGA 1CBVL 4KK6C 1IILE 5INDA 3VGGA 2I24N 5J12C 3N1FC 3QHFH 5IBUG 3MRBB 3TN0B 4N9GA 4TUKL 1PKQA 2B8OT 3B6SB 4RGNE 3WKMH 4NPYA 2CKNA 1ULVA 1MH5A 3LKNA 4C56B 1FH5L 1J8HA 1A9BA 5F3HB 4TSAH 4P48A 1JWSA 5EOTB 1FFRA 4Z7VA 1FG2B 3MOBH 4X83A 3FT4B 1D5ZA 3PGFH 4LEXH 3Q1SL 1GHFL 5BW7C 3GMRB 4WCYL 4YBQC 5JQ6H 4EQ3A 4EBQL 5JHDE 2W9DL 4EXKA 3STBA 1QLRA 4PJFF 4HS6A 5CEZD 4F2MA 5CD5C 1ED3B 4N5EC 2APBA 3LZFH 1GZPA 1RUML 3EYSL 5C0RH 5HHOD 2VR9A 2BNRA 5GGVH 3BH8A 4WWID 4PRHE 1AIFA 1MRDH 3PWPE 1I85C 4G3YH 4AEHL 5D4QA 3U9UA 1K3IA 4L4VB 4AEIL 1J10A 4P5TC 5C07B 1CFBA 2J5LC 3OKOA 3MFFA 4IOSD 3REVB 1T1ZB 2BOBB 4M8QA 5BMFL 1MFAL 5FK9A 4YXLL 4IJ3C 5DD0L 1ZLWH 5JDJA 3FQRA 2AXFB 4JM2B 5F7HA 1LEIA 3DBXB 4GT7A 4RA3A 4ACPA 3RWCA 4R7NA 2D0HA 3VFOB 4GMTH 4HLZH 3HG1D 4LVHC 3SJVB 4JKPL 2BRQA 1T7ZA 1FRGL 2DYPA 2EH7H 4NUGL 5EU6E 2J8UB 3DVFA 4UT7L 1EGJL 2CO7B 2GSIA 1JPSL 4H25A 1BM3L 5D1QC 2NR6D 3AREA 5JNYA 1JZ7A 5DJ8A 4C58B 3RWEA 2Z31A 1U3HA 4JPIB 1YEHL 3LKOB 3LS5H 2IH1B 1T1YB 3UTSA 4CKVX 1OP9A 1ORQA 3O3BA 1IFHL 4ZPVB 3QDGE 3SQBA 4JFQA 2ZUQB 1QKZH 3QIWB 3QEQD 2NW3A 1DVFC 2N1KA 1LP9B 3MRPB 3VRIB 3NCJL 5DRWB 3QXDB 4NHUA 4P2OB 3RIAK 4OKVB 4DUVA 1CE6B 4LF3A 4Z7VF 2WUCH 1A6ZB 1C7SA 4HZLA 1FHGA 4JPVH 1PYWA 5JIPA 4R0LC 2QBWA 1RUAL 5E94B 4BFIB 1TJGL 2GUOA 4KI5C 4S2SB 5AG8A 2Z0BA 1NMBH 1I1YA 2W9EH 4RX4A 3G5ZB 3K74B 1WBYA 1BMGA 3BAEL 1T5XB 2ARJQ 1D3CA 1YEIH 2AV1B 4MQXD 4XCEA 1ZS8A 2NY1C 4F9LA 4AJ0A 4NM8L 1RK1B 1AO7E 1SBBA 3S98A 4Q6IB 2VLKE 4XVTL 4M00A 4I0KA 4KHXL 1DBBL 2EC9U 4LSTL 4NKIH 1MI5D 5IM7B 1KN4L 2DD8H 1QO3A 4OZIB 4LDOB 3TBVA 3QUYB 4MA8L 5E6YA 4LMQE 2B4CH 5DURB 3DECA 4KZDH 4LRIC 4WWKD 1UENA 1GGIL 3ULUD 3HPLA 3VW3H 1FZMB 4L3EB 2HFFB 1RI8A 3RPIB 4Q9CA 32C2B 1B2WH 3VXOB 1KEGH 1E4KA 1HN1A 3L95B 3MRLA 3V4PH 1LMKA 1ZAGA 1VPOL 2R8SL 5FF6B 3UJTH 3IDNA 3V52L 2BSED 3W5MA 2IQAA 5F7FA 1WJ3A 3U7YL 4JHAL 4Y19D 4XMPH 1KT2B 4XPTH 4I9WD 4M1GL 5FOBA 5C09D 2J4WL 4XVJL 4LLUB 2XWBA 5DMYA 4EN3B 5F96L 3L5HA 3S5LG 1OAUL 3P73B 4GW4B 2FECI 5BV7L 4J12A 4DKFH 4DK6A 1A7RL 4ZO6A 5E9DB 1GZQB 4Z7NF 1U8JB 3RVVD 3WNNA 3FOMA 4LCYA 5J6GA 4I3RL 1KTLB 5E7FA 1LDPL 1D5IH 2WIMA 1YPZB 2IPUK 3RFZC 4NP4L 3ZKXB 1DQTA 3VFPB 1MHPL 4JANA 2E9BA 3GMNA 1CVSC 1ZGLM 1SJEA 2BY3A 1FVEB 2R29L 3LKQA 3QUML 4L8SC 3BEWB 3MC0A 4J6RH 1DBMH 3BP7B 1MREH 1IGTB 1A3RH 4IBLT 2DQTH 2VL5A 2UYLA 4LNRA 5CBEA 4HS3A 1OAKL 4CW1A 4U2ZA 1OSZA 5TFSL 4R4FL 3WFDL 2EC8A 4KTEL 3ZL4H 5CKGA 2ZWLT 2VDRH 4I3SL 1L7TL 3MUZ1 4ETQB 2V9QA 1EVUA 1HKLL 2MOVA 1JNNL 3QUZB 5KSAA 1BQLL 1UZ6E 4JZJB 4JJ5A 4PJAA 5DD6B 3KPQB 3T0XA 2E7CA 4PJ9D 4NC0B 2VZTA 4U1GC 5I16B 3LHPL 3WNLA 4DQOL 4JO3H 3GSNH 3O4OC 1AGBA 5DMJB 4PJCF 3QQ9C 4UQ3B 4TSCL 2IANB 3K0WA 4I2XE 3RBGA 3VGAB 4WJ5B 4YR6B 2AV7A 1A47A 1R3HB 4Y5XB 3KYKH 4QT5B 3NGBC 5J0BA 1I75A 3KWWB 1BQHG 3KLAA 4HCRH 1NAMA 5IB1A 2JIXA 3CFEA 3CXDH 2Z8SA 3G6AA 5L0QB 2I27N 4MB5A 5ICXA 1MVFA 3BZEB 3CMOH 4D94A 5C0NC 1N7MH 2R9HD 2FX9L 1HYRC 1DQQA 1DSFL 3C60D 3QO0B 4PJGA 5L8KB 5FYKU 5IMKB 3MREB 3MXVH 4B41A 2YEZB 2IBZY 3FN0L 4RAVA 2YUZA 1CDCA 1B4RA 1LVEA 3BQUD 3T2OA 1KYOJ 3KXFA 1RJLB 1FGVH 3ALXA 3MJ9H 4OGYL 4WW1B 3RUGB 3TBTA 4HHAA 4PGBB 4HUWB 15C8H 3G6JE 5DK2A 1D6VH 2BNUA 2DQJH 3BIKB 1UCTA 3MRQA 2P5WE 1EUTA 2XA8L 5BVPL 3WJLA 3BISA 4F7MB 5E8DH 5IW6B 3MRFA 3HE7C 1HQ4A 1K3ZA 2WBWB 3TO4C 3UJIL 3NOIA 5DXWA 2HJLB 1YZZA 3HZYB 3RVWC 5F1KC 3C8HA 3SDCA 4YAQB 3CVHA 4JEGB 4QCIB 1KCKA 4J4PD 2WK2A 4UQ2B 4IM8A 1OAYH 1UGNA 3Q2CA 4X0KA 2F15A 2XRAL 1DFBL 4O5LL 3JUYA 1UM4H 5MP6H 4BQBA 1NGZB 4RGMC 1KJVB 2X4UA 3HN3A 1MRFL 2G9HB 3QO1B 4WNQB 4XH2A 1XGUA 1J1OH 2R2EA 4HJJH 5DHVB 4PJAF 3J8F7 3K8LA 4GSDL 1V7MH 3LDBB 5I76A 4NNXB 5KVDL 2W60B 3FFCE 4UTBL 1EHNA 1WWBX 2NW2B 4OCYL 1ZHLA 3H8NA 4QGYA 4PJ5E 3UPRA 3S96B 4TOYH 4M1DL 5SWZA 5JR1H 4LEOB 4ZSOA 5HY9A 3B83A 4PYHA 3O41B 2GCYB 2EDXA 1I7UB 4XNUL 3S35H 1RHHB 1FGNH 2G5BA 5J3HC 2YK1H 3BN9C 1JWMA 2MKLC 1AXSB 1S7TB 1A7OL 4OCXL 4RGNC 1OD9A 3IT8D 1ZEAH 2XQYG 3C09C 3HC0B 4KKAD 1OM3L 1G6VK 1XCQA 2OX5A 3BO8A 4LSDA 4PJGF 2VN4A 2DLGA 1I7RB 3RIFF 3HNSH 4N0UB 5DVMA 4E5XA 3QI9A 4FQIL 5HGDA 2ZUVA 4MA1C 3QIUD 1NLBH 1MAKA 3DO3A 4NQDB 1NC2A 4UZGA 3O6FC 3LRGA 3HLAA 4ZUVB 5H94B 1LHZA 3GSOA 5ERWB 1EZVY 2OL3B 5HTSA 1U0QA 3H2WA 3QG7H 4LCUB 3MA7A 2CPCA 4BUHA 4KU1A 2I60H 3LD8B 2DLFH 4L29B 1I8IB 4QRPD 5IBLC 3U7AA 5I19H 5DFTA 5AZEL 2VXUL 5D72H 1PX3A 3GJFH 2AGJH 4C55A 4DEPC 3MV9E 4LHJB 5EUOE 2HMIC 1QZ1A 3MMEA 3RBSA 1JNHB 4ERSL 4YHML 3MRGB 4XNZC 1LEKB 4JKLA 1FCGA 3WIIL 2HJKA 3VXSD 4EJ1C 1IGCL 3O2WL 4Y16A 3T0BA 4WO4A 4JB9H 2ICEA 4KVNL 3DSNA 2PYEB 5HYSA 1SEQH 2AXGB 2YUWA 3NFSL 4LVOB 2A83A 1HHKA 4MMXC 3X11A 1KENH 5DI8B 2Z8VC 1BAFH 2BFVL 3FZUC 1IM9D 3HE6A 5SWSD 4NZUH 4KK6D 2MHAA 1AKJA 1TQCB 4G9FA 1HH9B 3T4AB 1QSFE 1FNEB 4MWFA 2PCPB 4P59H 3ARSA 5DEFA 3S3JA 1MHHA 4JVUA 4R90H 3TBWB 5ANMA 2ILLA 3EO0A 3MUGB 1RUKL 3JV5A 5FDYA 2DWDB 3EOBA 2P5ED 1F3DH 1MPAL 1EBPA 3X14B 3HRZA 3SPVB 4NM4L 1YJDL 3QFDA 2YRLA 4JN1H 4P0DA 5JHLH 3TPUB 3HMXA 1HXMB 1HQRA 3MV8E 1W0WA 3QIBB 4YBQD 3MLYH 4G43A 4KAQH 3ZT5A 4FTVD 5GGTH 5DJYA 3HI6H 1YMHB 4RNRA 1NGWA 3G5VB 2NTSP 4DGIH 4UT6L 5A2LH 1F4AA 5EUKB 5CD5D 1LO2L 3F7YB 1U93A 2WW8A 4N5ED 2GEEA 1FNHA 3I50L 4BH7A 4WHYH 2E6QA 3E6HA 1S9YA 1G1CA 4PB0L 5GGRA 1R0AH 4JPKL 1S7WA 3B9KC 5J57B 1G7JB 4P5TD 1WK0A 4QHUA 2BSTA 4LSPL 2GT9B 1FYTD 5DMIL 1IGMH 4JZOA 4HC1H 4S1SL 2VTFA 4U6HA 3OKKB 3C6SA 1EHLH 4IRJB 3VFWA 4JFPB 4CN6A 2F19L 2FYYB 5FYKE 2K9UA 5DJ6A 4P2QD 5E8EA 5DC9B 2Z91A 5HHOA 5D6DC 2ZCLL 3GKWH 3QZWG 1S7RB 1G9ML 4FP8L 3PHSA 2L7UA 1Y6KR 2N7AA 1DLHA 2OR7A 1ADQL 1D5MA 2JK5A 5GRJL 5LBSH 4M8VA 3F7PC 1Q9LB 3AS0A 5BZDB 5D1QD 3AS1A 1RZ8B 1A7PL 3N50A 3TNMA 3F6LA 1NAKH 3REWA 5INDB 1AFVH 1XF3A 2VDKL 5IVOA 3PJSA 3LKRA 4N9GB 2JCCA 3RQ3A 2OM5A 4GO6B 4K71B 3RWIA 2DBJA 2AAVA 4NPYB 3OB0K 3MUY1 1MH5B 3HG1A 3LKNB 2WQRA 4Q2ZA 1J8HB 5FUOL 3U6RA 4PGEB 4S1QL 2WINA 4CMMB 4Z7VB 3HUJF 3B9AA 1DVFD 4O9HH 3AC0A 4NOBA 3LN4B 2RCSL 2J8OA 4ZO9A 5H37G 1SBSH 3B9EA 1NEZA 4RDQF 4FABH 2OJZH 5IMLB 5JW5A 4HS6B 1ES0A 3D48R 4IEFB 4CDGC 2I9TB 4Z0BH 1GZPB 2BNRB 5FYKL 3DOSA 3P4NA 3BH8B 1V3JA 4KI5D 5I66A 1CICC 5C0AE 4LKXA 1AIFB 4ODHH 3QEQA 4J3TA 3UO1L 3RX5A 2VZUA 5I9QC 4PRPB 3OKOB 1N6UA 1I8KA 4M8QB 2NY1D 3LKPA 3WN5A 5FK9B 1R5IB 1J1XH 2VITA 3IDUA 3TYGL 3BKJL 3CK0H 1KB5H 3CSBA 1LO3L 4ESKA 3MRDB 3QYCA 3QRFM 2BSSA 3RWCB 4R7NB 3QAZB 3RRQA 1HIML 1P2CA 2O5XH 1GGTA 2JKXA 2XWTB 1FNSL 2YHGA 1JFQL 1ZT4B 1BOGA 4L8BB 3OKLA 2GSIB 4Z7OF 2N56A 4H25B 4C56E 1XGYL 4FOMA 3CDCA 4WTWA 4LPUA 12E8L 5F7DA 3TFKC 4K3EH 5ECJE 4X6FA 3AREB 4LU5L 1MCBA 2HVJA 3ARXA 1MI5A 1S7SB 1T7XA 2YUXA 4PJBA 1AI1L 3KPNA 3BPOC 1INQB 1UZ8B 1U3HB 3OR7A 2YWYA 4YHPA 5C0JA 3BPNB 2VERN 3GMLB 1JZ6A 1TVBB 1ORQB 3O3BB 4OZGA 4XPHH 5I1JL 3DPBA 3KPLB 4NQVA 2JCCF 4GKZA 2NW3B 1KNOA 4WWKA 5D7LD 4OT1H 1QBLL 2HFTA 5LVEA 4PY8J 1OPGL 5GPRA 5KVMC 2DM7A 4NQUA 2J6EH 3DMMB 4NHUB 2DF3A 5TGBA 5AWNH 4G5ZH 2DM2A 4XP6H 2AJZB 3P11L 5C07E 4KTYA 4RMVA 4G6KH 5GQBA 1AD9A 3CD4A 4NZDA 4JHWL 5F8QC 2GUOB 3CZFA 4LHQB 3D5OF 2X4NA 2O5YH 1I1YB 3BP4A 4Y19A 4XAKE 2QKIB 1HILA 1HKFA 3QCTL 5C09A 3QT2A 1EPFA 1H8SA 4AIZA 2N4IA 4OFDA 3UTZB 2E7MA 4NNYB 4JM4H 3SJVE 5CJQL 4XCEB 1ZS8B 3MLSL 3QJFA 5FUCE 3KJ4B 3KPRD 3L3HB 4WFED 1CS6A 5EC2A 2J8UE 4N5UA 4GRLC 4KUZL 3P30H 5C70A 3S35X 4HUXA 1A4KA 2H41A 2FEDC 4FMFA 4P46B 4PJCB 4ZTPH 4YXKL 4QY8B 2DM4A 3WFBH 4M5ZL 3L3DA 5BQ7A 1H3TA 5GGVY 1OT1A 5DTFB 4XCFH 5C6TH 3VI4F 3DYOA 5EA0H 3ARQA 3E2HB 4FZ8H 1IAII 1NCWL 1VGEH 2VDMH 3QQ9D 4V1DD 4AT6B 2W38A 5J6HA 1KELH 1AP2B 3HPLB 4XCNA 4O58L 4K94H 1T21A 4JFZH 5I6XB 1LP9E 5JIKA 3M1BB 1W8NA 3LB6C 1GGBH 4RWYH 3MRLB 3IDYC 4JRYD 5IMMB 3BGFC 1NDMA 2R56H 3IDNB 4R7DA 4PJ9A 2C1PB 3HS0A 4XBGA 2IQAB 4XC1H 3SDXB 1KCLA 5C0ND 1XR8A 2F54D 4PJBF 5HDOA 5FOBB 1YEJH 3WYRA 2P8MA 5C08B 4FQLL 1PZUB 4JKKA 1TTGA 4Z5RB 3RWDA 3X13B 4OZGF 1NLDL 2EDFA 1OARH 3FOMB 2DQIH 5J6GB 2FL5A 4YHZH 5LGJA 2ORBL 5JA8B 4PJDF 4L9LA 1BEYL 3O0RH 4F7TA 1VKXA 3I9GL 3ULUF 5JQHC 4HJGB 3PP3K 5FO9B 5ACMA 4JANB 1Q72H 1IC1A 1DBKL 1UC6A 5F1OB 4K7PL 2O5ZL 3LKQB 5EC1A 3P0GB 5T1MA 4HIHA 3C60A 3AFLA 4WVRA 2VL5B 3ZDXF 4LNRB 1JPTH 2K1MA 1SY6A 2V9RA 3HE7D 5I1CL 3TO4D 4HS3B 4JY6B 4CW1B 5EO0A 3P4MA 5K9KB 4JG0H 3RVWD 2J2ZA 2VDNL 4NQCE 5FYJU 3QHZL 4ALAH 3BQUA 1WF5A 1NFDF 3LAFA 4HX1A 3VWJD 5DGRA 1T3FA 4L3EE 2V2TA 5KSAB 4TUOA 4POZC 4PJAB 5JORB 1HK6A 2DLHA 1BGXL 5FM4A 4TYUA 5AZ2L 4MB3A 3BH9B 4NYLB 2EDJA 2EIZB 3C9NA 4RGOH 4DKAA 3E1F1 1AGBB 3R0NA 4R8WH 5IEHA 5CEYA 4YHKH 3CLFL 2AV7B 2NXYC 2X09A 2GI7A 4J4PA 1G7LA 3HTLX 2V7HA 5FGSA 3D3VE 5GS0H 4JY4B 5CP3H 2RFXB 5E9DE 3KLAB 1NAMB 4AL8H 2JIXB 2DS4A 1GGYA 3VGFA 3G6AB 5ICXB 3V7MA 1U8QA 1XF5A 3NZHL 3DARA 3BHBA 1YPZE 1ZHBA 2OI9C 1DQQB 1VFAA 3MLUL 3PF2A 2CUHA 4GMSL 4PJGB 2EEAA 1T6VN 1CLOL 4KJWC 2GK0A 5JW4R 5J3HD 3CSPA 3BN9D 1CF8H 4RAVB 4OCRL 1XF4A 4Q9BA 1G9MC 1P69B 4PJEA 5JDSA 1JK8B 4DVRL 1MJUH 3NFPA 2YA2A 1LE5A 4PGZA 2EDRA 3TBTB 3WDHA 4APQC 5DK2B 1J05A 2BNUB 3CDFA 2ADIA 4HXBH 3FRPA 2XQYK 2EYTA 2ZUTA 2VAAA 5SX4H 4PP1C 1M71B 5BOZG 3O6FD 2R0WH 4HULB 3MRFB 1HQ4B 4OLVL 4QWWC 1UH3A 1OTSC 5JHDD 3MROB 3HI1B 3ARDC 4N90D 2XICA 3CVHB 3R8QA 4EDWL 2VQUA 5IBLD 1WWWX 5KN5A 3SGKA 4PRHD 4X0KB 3NA9H 2P24A 5I1GL 1FAKT 3PWPD 3QIUA 3UZEA 4H1LA 1S7XA 2X4UB 1QEWB 2NY7H 2FJFA 2VR4A 4JFOA 4XH2B 2I26N 2Q76A 1IT9H 1NGPH 2HT3C 5ITFB 4BZ1L 1JGVH 5I76B 4QRPA 3LSOA 1ZHLB 3EHBC 4A2LA 1N4XH 3PIQB 1HINH 3FZUD 3MRNA 2EDNA 4QXWA 4YBHA 4XI5C 5T3ZH 1HSBA 3E6FA 4XBEL 3UPRB 1NBZA 2EXWC 5SWZB 5ID0A 3FL7A 4XP1H 4JLRB 2MKWA 3C2SA 1NQBA 5K93A 4H5SA 4UDTA 5EU6D 1U8HA 1UEYA 3O2DL 4ZSOB 5HY9B 5L6YL 4PRNA 1HHGA 4IRSB 4WW2B 2GY7B 3RUGE 3IB4A 3VXSA 3IFLL 5SX4I 4ETYA 5LWYL 1KTKE 4GAYA 4UBDC 2RR3A 3EDDA 3CXHJ 2CUMA 4M4PA 4RFOH 4DN4H 2XQBL 3VDCA 1JWMB 3RGVB 4PIRF 3JTTA 3K2MC 1G1YA 3M8OL 1FBIL 2PR4L 1IM9A 1KYOK 1XCQB 5DHYB 5SWSA 1JBJA 4XHJC 1BECA 3RPKA 5HGAA 3TJEH 3GI8H 2R0LH 4FQXB 3QDGD 4E5XB 1DQML 1I7TB 1OAQL 3VU2A 5E4EC 1KPVA 5HGDB 4YHIB 5EBWB 3UC0L 1NC2B 3ZDYE 5C2BL 3GI9H 1MAMH 5K9JH 5HHQA 3CFCL 2P5EA 5FYLE 3MA7B 1E0OB 1U9KA 3NFNA 1S7VB 5GRWA 5BVJB 3B9KD 4S1RH 5TQ0H 4LL9A 4LPYA 5BW7A 4O2FB 2UWEA 3VGBA 4FTVA 4TRPL 2A9ML 5IGXL 3IVKA 3MLVH 3MMEB 4LLAA 2IGFL 4U33A 1N0XH 3AMKA 5T1LB 1MRCL 1TQBC 4OLZL 4YDIH 2PUQT 4PS4H 2DL9A 3SE8L 3CH1A 3MCLH 1AO7D 4WO4B 1A0QL 1I3GH 1G7PA 2ICEB 1RJCA 5F7KC 1RU9L 1I85A 3BESR 3JBG7 1B88A 2JF1A 1HHKB 4P5TA 3X11B 2G60H 1HSAA 3HE6B 4X4YA 3PWLB 1FYTA 4KFZC 1JHTB 1H5BC 2NLJA 2W0KA 2MHAB 4Q0XH 2Y23A 4G9FB 1P6AB 4MWFB 5EBMA 3S4SA 5DJ2A 1SHMA 2D7OA 4P2QA 3HUJB 2CGRL 1U91B 5DEFB 5T3XD 1MHHB 5FYJE 4AH2A 2CLZA 4XZUB 4N0UE 2VISA 1G9NH 5ANMB 3EO0B 5DS8A 4S1DC 3EOBB 2AS5M 4HKZA 5F3BA 3E0GA 4OSUL 2ITCA 3HRZB 4QNPE 2MJWA 3QUXC 4TNWF 5D1QA 3QFDB 5AAMA 4X9BA 5FYLL 3F12B 1T2XA 4PTTA 1W0WB 1HQRB 3DIFA 1RZKC 4G43B 4GUPA 3JVGC 3ZE2F 2D7MA 5DJYB 1S7UB 1T2QL 1NGWB 1PEWA 5CUSL 2XFXA 4MNGB 3BGAA 5IUSA 4ZFGL 5FO7A 1LGVA 2V17H 2JJSC 4M6AA 1UWXH 2FHBA 4BH7B 4FNLL 1CICD 3SO5A 1ZKAA 3CIQA 3H3PH 1DVFA 1S7WB 2BX5A 4OLUL 2CK2A 2BNQE 3GRWA 4QHUB 2VR5A 4Z7UA 4JM2C 1NCAH 3DTXB 4P2YA 4U6HB 2Y25A 3C6SB 1CFQA 3QH3A 1HEZA 1MF2L 1BZ7A 3KPMA 4R0LA 1CGXA 1CIDA 4KMTH 2QHRH 4F58L 1OWRM 3QDJE 5I8OL 3ESVF 1YNTA 1Z3GL 4KTDL 4MS8C 5FYJL 3CDYA 1DLHB 2VIRA 2JK5B 1QFUH 1TJIH 1CK0H 4P23C 3TNMB 3HR5A 3REWB 2GTZA 5MHSE 3TFKD 3U2SB 1FPTL 3G6DH 2OL3L 4WHCA 2W92A 4YHNA 4KK5C 1ITCA 2DMKA 4BKLB 1J5OH 2JCCB 1MFDH 5D96C 5GGQL 4L1HA 3RWIB 3T0WA 1KXTB 5IVXA 3LEVL 1J88A 1RZ7L 1WFNA 3ETBF 5JW4M 1MUJB 1XGPA 1Y18A 1CR9L 3U6RB 1KLGB 1YY9C 4OKDA 4Y1AD 3RVXC 4LRIA 5M94B 1R3LA 1J0KA 4P2OC 4P99A 1PD6A 4HWBA 4HBCL 4RFNC 5CD3A 1RJYA 5DQDH 1VDGA 4OIAA 1NEZB 2NY2B 3BD3A 3FOLB 5EN2A 5D93C 5I15L 1C12B 2EE2A 4QO1A 2ADGA 3L5XL 5JW5B 1ES0B 1A6UH 2YMXL 1NCCL 1A8JH 2BRRL 1VFBA 4ELKB 3UZQA 3ARUA 3TT3L 4UT9L 1GVIA 5DJAA 5LKNA 3HZVA 3O81A 4JY5L 4PG2C 1YQ2A 5HI4C 5H35B 4XGZB 4ZDHA 3UBXI 3KYOA 1JRHH 3NIGF 3QEQB 5L8JB 2NXZB 2MQ3A 5D7LA 3N06B 1FIGL 3ZTNL 5DFWH 3D2UD 2BDNL 2YZ8A 5IIEB 2HFGL 5HDBF 4P2RE 3WN5B 2VITB 3EJJX 2OR9L 2EXYC 3ARRA 3GK8H 4GRLD 4U3HA 1GC1L 2EKSA 3U79A 3QUYC 4LLMA 2CRMA 1I9IH 2FEDD 2RIKA 5D7IB 4Z7UF 2D0GA 3D39D 1D9KB 2KBGA 4DZBA 4CU6A 1YEEH 1P2CB 3A6BH 1M4KA 2AJ3A 2YXMA 3GJEB 4AY0A 2PW2A 2FBJL 3VE0A 2WUBH 4L8SA 4DTGH 1BOGB 2ENYA 3OKLB 5FOJA 1HNFA 5CBAA 5FKAB 1A14L 1FC2D 4M4RA 1J8HE 4FQJH 3KPRA 4KI5F 4X6CA 4X6FB 1TNMA 3Q48A 4X99A 2XKNA 4HKBA 2HVJB 2VDOL 2FJGA 1N6VA 1MI5B 4PJBB 2CMRH 3LB6D 3ZE1F 1A6AA 3N9GH 4KVCL 5IK3A 3OR7B 4ODWB 4YHPB 5C0JB 1KN2L 1TFHA 3ME0A 4IRZL 2ADFL 2Y36L 3IFNL 4HZAA 3HMWH 4F7EA 5TDPA 4NQVB 3FFCD 4EN3C 3DHJA 3TV3L 1DLFL 1KNOB 4WWKB 5F8RC 2H2PC 1QSZA 2BNRE 4PJDB 1PG7L 1KPRB 4V1DA 5IVXF 4PJ5D 4TPRH 3U9PL 4NWUH 4ZUWA 1WT5C 2LQRA 5TGBB 1W72H 3G5YA 3ZHLA 1CDGA 3C08H 5D2LA 4N0FB 3TGXA 1CDJA 4QTIL 1JNLH 4PRPE 5EBLB 3BPCA 2YPKA 1BFSA 4QXTA 5F6IB 2NY4C 1Z9OA 1AD9B 4JRYA 5DMKA 3DVIA 3E8UL 5HVWA 5L7XH 3C8DA 5KSBA 1N5YH 2VWEE 4JE4B 5EORL 3CZFB 1BX2B 3A67L 2X4NB 4YQXL 4NT6B 1WZ1L 2F54A 3MNZA 1NFDB 2JJTC 1CZ8H 3QEGH 5FA3A 4AIZB 1WTGT 4UB0L 1A3QA 4LASH 4V2CB 3KYNB 5FECA 4OD2A 3D85D 1UFUA 3QJFB 4Y4FC 4Z7WA 3EYVB 3CSYA 3EDEA 5EC2B 5LQBH 2VC2L 3SGEH 1INEH 1UXWA 4M43H 4JZJC 4HUXB 1A4KB 3IJYA 4J2XA 1CVRA 1KTDA 3VFTA 2FJHA 1G0DA 1HDMA 2CKBA 2R2HA 1JE6A 2AKRA 4BA8A 2X9XA 3R4DA 4H88L 1U41A 4POZD 3S36L 3SHSA 4J7RA 4DGVL 5BQ7B 1QG3A 4UOW1 2EE6A 1F4HA 1TETH 3R1GH 3Q6GH 1RZJC 1JV5B 3H9YA 3HE7A 3MV9D 3TO4A 4PYGA 5J6HB 1J8KA 3JTSA 5MEPA 4FQHA 4Y5XC 4XCNB 3IJHA 4Z7NE 1T21B 1OSPH 2AJUH 4R4BA 2NXYD 1RIHH 4PBWD 1CLZL 4U4BA 2DWEA 4NJAH 3VWJA 5GGSA 2NY5H 3EJYC 4NKOA 1I9JH 2UVFA 4LHUD 3CFBB 1NDMB 4R7DB 1F5WA 3P3YA 1R3KA 4PJ9B 3HS0B 4XBGB 5B3NA 4GG6F 4JFXB 8CGTA 1J0HA 2HKFH 5MEQA 5A1AA 3QQ3A 4XCYA 3BP5A 4LMQI 1BLNB 1XR8B 2BJMH 4XTRC 1A1OA 2P8MB 1F4WH 2WLYA 3S8WA 4PG9A 5IWLC 4KJWD 2AEQH 1EAJA 5GRVL 4HW6A 5IJVA 3IDXH 3QNZB 3ARBC 1B0GA 5EO1B 3K1DA 2X89D 5LGJB 3C87A 3KS0J 3ILPA 4L9LB 4KQ3L 3TT1H 4APQD 4Z95H 1YYLL 1PLGL 2P43B 3EW3B 3CZJA 2LVEA 3R0MA 5D8JH 2EO1A 5DDHA 4HLZG 4ZOAA 1A3LH 2BVQA 4PP1D 3EZJB 3WXWL 1G7QA 5EC1B 4Q9RH 4PJCE 3IKCA 4HIHB 3BXNA 4QTHB 4QWWD 2ZCKH 1OTSD 3E3QE 1A5FL 5EO0B 1EO5A 5C7XH 3P4MB 5KSBF 3KPSE 2NY0C 4OGXH 3ARDD 1WCQA 4JFEE 2DL2A 1MWAA 5HYQB 4HX1B 1EGJA 3VXUD 3RY5A 1T3FB 2V2TB 1N2RA 4HXAH 4X6DA 4TUOB 4ONFL 2X7LB 2I25N 2XZAL 5D1XC 2AJXL 4W70A 3O6FA 4QHKJ 5IVZA 1AC6A 1DEDA 3LDBC 2H1PH 5HHMB 5CEYB 3SDXE 5JHDA 2HT3D 4MSWA 4UILH 5FYKD 4MCYB 4WEMB 1G84A 4TUJA 5C08E 3R06A 1TZGL 1G7LB 3EHBD 2HWZL 1UWGL 2Y4SA 1RY7B 3LIZH 4JO2H 1I8LC 1X5IA 4PRHA 4I4WA 4XI5D 3DGGA 2EXWD 1C5BL 1W0VA 3PWPA 2F53B 4S10A 5IHZA 1WAAA 5HYEA 1U8QB 1XF5B 3BDBA 4NQSA 1QFWM 3BD4A 3BHBB 5CCKL 4YPGA 1E4WL 1VFAB 2ZPKL 3ZMRA 4UBDD 1MJ7H 4R6UA 3BPLB 4UUJA 4NKMA 3EYUH 4PP2A 4NQTA 5JPMA 1UM6H 1WZKA 4WTXA 5JDSB 1JTOA 3NFPB 1IGJA 1LE5B 2VXTL 4TQEL 1J05B 5TE7L 1OP3K 2ADIB 2QSVA 4X6EA 1CU4H 5H2BA 2EYTB 5EU6A 3X12A 2K3TA 5ICYB 2GFBA 3K3QA 3C5JA 1JGLL 1DR9A 4FXGB 4UOJA 2QSQA 4W6WB 2UZIL 5F6HJ 4PJAE 3BKCH 5KOVC 3X3FL 5HHVH 3LD8C 4DW2H 1RIUH 4XXCC 1X5LA 4KK9C 1GGUA 1SM3L 4HUVA 4RBPH 4NKDA 5CJOH 1MLBA 3LV3A 3MR9A 3QDGA 4FQ1L 5C0AD 4ZO7A 3QIUB 3RL2A 4UAOB 3SQOH 1AY1H 4B50A 4H1LB 1T20A 1S7XB 4LSUL 2FJFB 4JFOB 4X6DF 4R97B 1JYNA 4O4YH 1AGFA 4RDQG 2P4AB 4D9RE 3B9KA 1FZOA 1OOAA 3HNVH 5DJ0A 1A1NA 1FFOA 3LMJL 3OZ9L 1NBZB 3AU1A 5ID0B 1T0NA 2LU3A 1K85A 3VFUA 3TVMC 3U30B 4H5SB 2X2YA 1U8HB 3GBLA 4PRNB 3D0LA 4PRAA 4C56D 1GC1C 1UKQA 3WJJC 3VXSB 1X5FA 1IZJA 3OQ3B 5D6DA 1AO7A 3PWVA 4S0TD 5HI3C 4S1DD 4XP4L 2ZCHH 4GW5A 4YUEL 4YDKH 2DBLH 3ES6B 1WAAF 1KIRA 2HJFA 3QUXD 1FVDB 1IM9B 1UXSA 2XWJA 4M62H 5SWSB 4JVPA 1S5IL 1C5CL 3EFDH 1MIMH 5J12B 4IDLA 5AYUH 1LO4L 3B9VA 1KPVB 3GFUA 1KFAL 1FQ9C 4JFYA 3D87B 3LQMA 2PW1B 1T04A 1FO0A 1QTYT 2P45B 1X6NA 5JW4N 5HHQB 3WKML 2A6JA 5E5RB 3MJ8A 3MRJA 3QCVH 4UNVA 2EYRA 2CRIA 3C8KB 3AS2A 1M7DB 3NFNB 2QHLA 1NAML 3CH8A 4QRQB 4X9FA 5GRVK 2V6HA 3B43A 4UU9A 1WIPA 4TSAL 4C4KO 3W9EA 4B0MM 4JM2D 4Z78A 3QG6A 3MOBL 1MFBL 3PGFL 4LEXL 1CI5A 5DD3H 4FTVB 1JF5A 5MI0B 4OLEA 4Y5VC 4YPJA 5JQ6L 2FR4A 1I4FA 1CFVL 5IT2L 1H0DA 1G7HA 1VHPA 2VUOA 4NIKB 5SWZE 1G7PB 1RURH 4BK4A 1CICA 1MY7A 5CIPA 5L2KE 4MS8D 5GGVL 1WZLA 5EU4A 3NCFB 2FHFA 4CAGA 1HSAB 3F58L 1MRDL 2C5DC 4G3YL 5FKPB 4NFCA 1FYTB 4P3WA 2HFEA 4P23D 4PGCA 2XPGA 4U1KA 2GAZA 4IJ3B 4J8RA 4WUUD 5I73B 5CWSA 1QYGH 1WFTA 4D8PA 1NEZG 4XBPA 4NBXB 5EBMB 4KK5D 2V5MA 1MLCB 4P2QB 4PGDA 4AH2B 1FNFA 3CVHL 3U7WH 2VLMD 3TIDB 3ROOA 1WBXB 5DS8B 4LVHB 1DQDL 3H3BC 3CXHK 4QXUL 2O61A 5F3BB 2VKWA 4GMTL 1YY9D 3RVXD 1L0YA 4CJ0A 4P2OD 4ZS7H 5D1QB 1FZJB 1I3RA 3BE1L 3PWUA 2CLRB 3DIFB 3HFMH 4HPOH 2XKUA 2FZ3A 5IHUH 5ITBL 1K8DA 2XFXB 2EDKA 5IF0B 5FO7B 1CE1H 2GSGA 3DX8A 5KVGH 3FB8A 1U92A 3UMTA 2FX7L 4OM0L 1U8NA 3GSXA 5HI4D 3VD9A 4Y1AA 4OCSH 3OF6D 5FM5M 4Z7UB 2YKLH 2VWEC 3DX9A 4O00A 2DJSA 3VFNA 1JVKA 3PQYB 4P9HH 2EXYD 2X4PB 2OP4L 1HEZB 3VFRA 1V3KA 5HJ3A 1BZ7B 4LSVH 2K7PA 3QUYD 3KPMB 5FEBA 1IL1B 5ISZE 2J88L 4G9FE 1NCBH 2WUCL 4TSBH 5DURD 5F1NB 4NQCD 5J8OA 4JPVL 3HUJE 1TVDA 2VOTA 2JJUA 3BW9A 4OBRA 2VIRB 5ANME 3CCHA 3D2UA 2A74A 3AREC 4L3ED 2FIKA 1DN2A 2W9EL 3RP1A 1A21A 2FECL 3RJDA 1YEIL 5FHBH 1U3HC 2EECA 4GRLA 1I8MA 2OK0L 3BPNC 3P0VH 3PGCA 5FUZH 2K7QA 1DDHA 3D39A 5IVXB 1MIEH 3WO4B 1Y18B 3ZHDA 4EN3D 2PKDA 4MNGE 2Y07H 3D3VD 4HGWA 2X6MA 3HA0A 4KKCC 4X5WA 1CD8A 5IKCA 3DMMC 2R69H 2B4CL 2H2PD 2HKHL 4O51A 1EJ6A 5E9DD 1OGAB 1RJYB 3VFGH 5CD3B 3L3GA 4KZDL 5T1DH 5HVHC 1VB9A 4HSQA 4YO0A 5EN2B 5FCSH 4LPWA 2A6IA 2O26U 3VW3L 4C57C 2P8PA 3RTQC 4GFTB 1EXUA 2NY4D 4YHOH 1S9WB 1VFBB 3WDJA 2Z92A 2PN5A 5TE6H 1B90A 5DJAB 1WUNT 3V4PL 3FFCA 4UDUA 3KYOB 4Z7OE 5F44A 3DUSB 5D7LB 4F9LC 4S0SD 3B3IA 4PJ5A 5I1LA 3RKDC 3GO1H 4XMPL 4HD9A 1BFOB 4OZFA 4Y4FD 1T7YA 1AE6L 2OMNA 4YWGH 5CHNB 4P46C 2EKSB 4DKFL 4EI5B 4U1MA 1J11A 1DL7L 5ICZA 2IMNA 5ESAA 1FDLL 2F5BL 1NC4D 1XF1A 4QGTA 3V5HA 1P4BH 2VXQL 3S5LA 1MJ8L 2JCCE 3UTPD 2W07A 1WISA 3VE0B 4H8WC 3HMXL 1D6EB 5A40E 4POUB 1NFIB 4W4OC 1WIUA 5CBAB 3D85A 3W2DH 2JTDA 4HS8L 5I6XC 3KPRB 4KY1H 3BYYA 1T1WA 4J6RL 1DBML 4LKCA 5IHBA 4GG6B 2YPVH 4X99B 4HKBB 4NO5A 1F6FB 4F9PC 3GBML 2FJGB 3ZL4L 4F37F 3MBEB 1A6AB 5IK3B 3TO2A 1IBGH 3EJYD 3RIFK 5GZOC 1LNUB 4M3JA 4TTGA 2VQ1A 2AK1H 3QQ4A 4F7EB 5TDPB 4NC1C 4C83A 4AG4H 4HPYL 4XTRD 3MV9A 4MJ6A 4V1DB 4KROB 3UTTE 4K8RC 1ROWA 4JO3L 3V7AG 1KCUL 3WNMA 1J18A 5E2WH 3ARBD 3NGBB 2YPKB 4JRYB 4HG4J 4LHUA 1ZLWK 3KYKL 5KSBB 1EEQA 1P9MA 4HF5L 2BMKB 4Y8AA 3VI4E 4U6XA 3U4EB 1UQSB 1FORH 2F54B 4BFBD 1EUUA 1E4XH 3MNZB 5D7IE 4B7LA 2WLZA 3BRDA 1BIIA 1N7ML 3NAAL 4IDJL 1OL0A 3F5WA 3QPQC 2FGWH 2NY0D 3CSYB 4Y2DC 1ZT1B 3OPZH 1T80A 1OQOA 3PV6A 1UXWB 2X89A 4D0CA 1WBZA 1ADQA 1P84J 1ODAA 5D9SB 1YEDB 1KTDB 1REIA 3VFTB 4WEBH 5D5MA 4APQA 1HDMB 3FRUA 2AJYH 2A0LC 3EBAA 4HFUH 3V79C 2XIDA 3O3EA 1FGVL 5FYLD 3MJ9L 3DXAB 4HIJA 3ULSB 2UZYB 5K59F 5GJSL 1MI5E 4PJBE 5I1DA 1MHEA 1XGQA 1D6VL 5D1XD 3FB6A 3KDMB 1QQDA 4NZRH 5CZKA 1EV2E 4EUPH 3WUWA 3TO4B 4YXHH 1QFWH 3JTSB 2NPLX 4FQHB 4OGAC 4OF8A 1PZ5A 3ARDA 4WUKH 1INDH 4R4BB 3UPAA 1Q1JH 5C3TA 1CXHA 4PJDE 1MFCH 1GGCH 2DWEB 3VWJB 3JWOL 3VXUA 3ULUE 4U3XA 1URLA 4NKOB 1Y0LB 4PPTA 1F11A 2J8HA 3MRMB 3UTQA 4P9MH 5DRXA 1R3KB 2ICWA 2D4DA 2DMBA 2R4RH 4XX1E 3BP5B 3ZDXE 4MNQB 3JWDH 4NQXA 3MTRA 1O7SA 1S9XA 1U8LB 1MQKH 4PG9B 4KKBC 3L1OH 1E4XI 1CDHA 3NH7H 3QEHA 3WSQH 1FAIH 1MJJA 5IJVB 1NFDE 3LS4L 1J1OL 5FYJD 4WI6A 2OR8A 1RIVL 5LXGL 4MAUH 3ILPB 1XIWC 3PXJA 1BBDH 5DWUH 1R3IH 4N0YL 4D9LL 1T5WB 3MBXL 1IC5H 3C6LC 5DDHB 1J86A 5JR1L 3IKCB 5IFAH 4H1LG 2Q6WB 1TPXC 3HAEH 3S35L 5B4MC 4MXQC 2X05A 1MCRA 4KK9D 3MV7E 1MWAB 4NDMA 3FO2A 4PBVC 1N2RB 3UBXB 1ZEAL 4X6DB 1EFQA 4MA1B 5HPMA 3OR6B 4MJIB 1S5HA 3ULUL 3HNSL 2BNQD 3V0AC 3O6FB 2VZVA 1N5AA 5IB2B 2VDPL 5D7KD 2IFFH 4QYOA 1G9EA 1KC5H 5D5MF 1NLBL 4FXKB 3FTGB 5KOMC 1YECH 2GQHA 3BI9X 1XAUA 4MSWB 1P4IH 3K7UA 3DV6B 2UY7A 1UADC 4QEGA 3QG7L 2EKJA 4TUJB 5JUEL 3MLWH 3BZFA 1IGYA 1JI2A 4PRHB 4DEPB 1ACYH 3QDJD 2VLJE 1WSST 4IRSC 4WW2C 5I19L 1W0VB 5C0AA 3LPGA 2ESVE 1RFDL 4E0RA 2AABH 3TVMD 5D72L 3KHOA 1HI6B 5IHZB 1A1MB 4XNZB 4M9PA 4YPGB 1G0XA 1U8PA 2CDEA 3P0YL 1N3NA 3RGVC 4XNMA 4X5LA 3NABL 5HI3D 2IF7A 1XH3A 4NHCL 1F90H 4NKMB 4PP2B 4NNPH 2KDGA 2XT1B 3FMGH 4AMKL 5JPMB 1QBMH 4I77L 4X7SH 5EU7E 2QQKH 3MGAA 2XTLA 5GJTL 3V7AE 1EIBA 4FQXC 3WD5L 1SEQL 1IGJB 3MRBA 1RK0B 1H5BA 4NO2B 2YD7A 5J1SC 4X6EB 4M7KH 1BAFL 4G6JH 4PBXA 5EU6B 3X12B 2E7BA 4I8DA 4NZUL 3V0VA 1EX0A 3QWOB 1V7NH 2LVCA 4C56A 1UYWH 3DNKA 4MVBC 2A77H 4P59L 5CJXC 3IKKA 5EOTA 4XVSL 2DQCL 2WBKA 4M48H 1FG2A 2VKXA 2W0PA 3FT4A 5E2TH 4F7CA 5C71A 1CBVH 1AXTL 5DQ9B 1OTTC 4KPHH 1CXEA 3QUXA 2E9JA 1L0XA 5HHME 4NKDB 1OLLA 2DICA 2B4CC 1MLBB 3MR9B 1YQVL 1A7NL 1R5VB 3TNNA 3JVGA 5KVEL 1M7XA 4JN1L 1ED3A 4GS7C 4XWGL 5JHLL 3RL2B 2CRZA 3L3KA 1T20B 1TJHH 1MCCA 4XMKH 1FH5H 3HI6L 2FIRT 1U8IA 2JJSA 4P2RD 5EWIL 3Q0HA 4DGIL 2F53E 4YHYC 1KXVC 4Y5YC 1GHFH 4XPAH 1AGFB 4U49A 3CX5K 3REVA 4WCYH 3T8XB 2FATL 2VMFA 5ALBL 4EBQH 1MCHA 2AXFA 1JCKA 2W9DH 4JM2A 3AB0C 2DKMA 2P44B 3DBXA 4N8VB 1A6TA 3OAYH 1T0NB 4JGUA 3VFUB 3PDOA 5DO2C 1SY6L 1YN6A 4JRXD 4MHHI 1RUMH 3EYSH 4HC1L 3VFOA 3D0LB 2CLVB 1A6VL 3MX0A 2X70B 5HYFA 1J8HD 4AEHH 4KKNA 2CUIA 3PWVB 3SO3B 1RVFH 2P47B 2HYMA 3VDAA 4AEIH 4U2YA 1KIRB 1MFAH 1WCBA 2W9LA 2OZ4A 3TYFB 1FFNB 1JPGB 5DD0H 1FE8H 2G2RA 3V4UL 1UXSB 4X5XA 4MCZB 4P23A 1YYML 4KZEL 3MXWL 4CADA 1N8ZB 5LBSL 1IAMA 2YD1A 3ARVA 5D70H 4WUUA 3S34H 4LDLB 1KLUA 3T2NH 4UV4L 3OJVC 1RUQL 4F3FA 2L4OA 4JPIA 3LKOA 4JFYB 4JKPH 4ZPVA 4WI4A 2BP3A 3L3IA 4HQQL 1FO0B 4NUGH 4RAUB 1CLCA 3RU8L 4UT7H 1HWGB 3T65A 4BSJA 2A6JB 3MJ8B 4P5KA 1LP9A 1LO5A 4HH8A 3F62A 3MRPA 3TCLB 1W2KT 4PRPD 3FQWB 3O3AA 5DRWA 3U46A 4P2OA 2FRGP 1CE6A 3W9EB 4Z78B 3QG6B 4O9HL 5LGKA 2AJVL 2B5IC 2Y72A 3ZKNC 2Y1VA 3MGOA 1YEHH 4DGYH 2DTML 2FR4B 2C4XA 4S2SA 4FABL 1I4FB 1IFHH 5AUMB 2OJZL 1H0DB 1G7HB 3QWRD 1CGWA 4MDIA 3G5ZA 5LCVL 4K9EL 1CICB 4PG2A 5CIPB 1PJ9A 1FV1B 1JP5A 1GAFL 3OF6A 5DZOA 5B22A 1C1EH 3QXUA 1RK1A 4FFZL 3ARED 5I9QB 1RHFA 4ODHL 4YZFF 4ZXBC 4PGCB 2XPGB 4U1KB 1FLRL 2GAZB 2LTQC 4J8RB 1DBJH 4D8PB 1F2QA 1QA9B 1RUAH 1FJ1A 5SWSE 1TJGH 5SX5K 4MMZC 5KBNC 3QUYA 4PGDB 4P57A 3DURA 6FABL 4FQ2L 3V6FB 4LPCA 3DSFL 5EOCH 5JO5A 4NQCA 2NNAB 3RJQB 1CQKA 2YBRA 2O61B 1G6RA 4BUGA 2Z93A 5IFJA 5JOFA 2O5XL 5DJCA 3OKDA 4KKCD 1CGSL 2NY2C 3DMMD 4OF5A 4L3EA 4BQ9A 4DKEH 3ARPA 4OLWH 4X4ZA 4RCAA 4KHXH 4LSTH 1BF2A 1TIUA 4MZ3A 2FZ3B 2BY1A 3Q5YA 1YY8B 5FF6A 3RTQD 4MA8H 3EOYG 3BPOB 2P1YA 4TTDC 5EU5B 1F8TL 4FTVE 4LSQH 2GSGB 5B8CC 3I2CL 2NXZC 1AQKL 1U92B 1F6LL 4JDVB 4LLUA 4EN3A 1U8NB 1VEMA 3GSXB 4Y1AB 5DHXB 1EJOH 3D3VA 3CU1A 5FGCB 3FT2B 4ZOCA 1MCFA 2PO6B 5DZLA 5E9DA 5A2KH 3RKDD 1IAIL 5L9DH 3DX9B 2M2DA 1WT5A 3OJ2C 1KTLA 5DEZA 3VFNB 4FS0A 4BSWB 1VPOH 4P46D 3VFRB 1D9KC 3V52H 3KNBA 2GITA 4OIIH 1FYTE 4NUJA 5AWNL 5HJ3B 4BYHA 4PJ7E 3SEPA 1T6WA 3U7YH 2AEWA 2E27L 2R4SH 3KPSD 1FVEA 4JCMA 4QHLB 2EDOA 4XVJH 3BP7A 4PTUA 4JFED 5F96H 1OAUH 3BW9B 5BV7H 2IEPA 2JJTA 1BQSA 4WTZA 1A7RH 2O5YL 3K2UL 2A74B 3UYRH 1MNUH 2FIKB 4I5BB 3UCRA 3DX7A 3K80A 1IRAY 4Y4FA 4I3RH 4ETQA 3VA2C 1LDPH 4JM4L 4NP4H 4JZJA 3BRFA 1XEDA 1FC1A 5DD6A 1P5VA 1NC4A 1DDHB 3FHAA 1LILA 3D39B 5I16A 3P30L 5GZOD 5CJ5A 1A6WH 3QUMH 3T08A 4DOHB 2XA3A 1CXFA 3NIGE 4WWKC 5C08D 4UQ3A 1OAKH 5TFSH 5IKCB 4HGWB 1QPXA 4X5WB 4A6YA 5HDBE 5T33L 5EFIA 4O51B 4YR6A 1L7TH 5C6TL 4GW1A 1R3HA 4NKQB 3L3GB 4K8RD 3GHBH 2Q8AH 2ITDA 4J3VA 1HKLH 2XV6B 4QT5A 1RZFL 1JNNH 3THML 3P4LA 2HAZA 2A6IB 1VADB 2P8PB 4Z7UE 3W0WB 4EIGB 1EXUB 4JFZL 3U1SH 3IDYB 1HZHH 5BJTA 3BGFB 3LHPH 1U8MA 1QR4A 3PQYE 2Z92B 1GGBL 1JN6A 3STZB 4RWYL 4KH2A 3QO0A 3BZDA 4UDUB 3LPWA 4TSCH 3WBDA 3NZ8B 5IMKA 2MQCA 3MREA 3UYPA 4XC1L 4PJ5B 2MCPL 5I1LB 5IWLA 4EXPX 4AZ8A 2BHUA 1RJLA 3QPQD 4Y2DD 2GYSA 3RUGA 3ARBA 4PGBA 4HUMB 4U1MB 4RSVA 4NO3A 5E56A 1IZKA 3BGMA 4YFEA 4JKMA 2IH3A 1OARL 2A0LD 2DQIL 2D31A 3V5HB 1NGXB 4NN6B 2FX9H 3BKMH 1DSFH 4MQSB 1DQLL 5IW6A 3Q5TA 2ZG1A 3DRQB 3U4BH 2YPLB 1Q72L 2HJLA 3FN0H 3K46A 3M45A 4AYFA 3HZYA 4OGZA 3NIDF 1UG9A 3D85B 1MCDA 3L7FB 1T1WB 4GRMB 4LKCB 4OGAD 4N8CH 1UT9A 4OGYH 2DJUA 1JPTL 1QR1A 4NO5B 2VLLA 1OGAE 3TO2B 2XA8H 5BVPH 2X4SB 2G9HA 2QL1A 2VQ1B 1OQXA 5D1XA 3QO1A 4D9RD 3QQ4B 4WNQA 2WZPD 3DLQR 2QADB 3UJIH 4C83B 3ARYA 3UDWC 3T1FA 3U0TA 1FSKC 1H15A 3MV9B 4MJ6B 4OQTA 3WNPA 4KKBD 4MGXA 5DK3A 5INCA 2NW2A 1GOHA 2NXYB 5D7LE 3KYMB 4YHKL 5I1EH 2XRAH 1DFBH 4MAYB 3FFDB 1I8LA 2A9NL 3GB7A 1XIWD 4LEOA 4LHUB 1MRFH 5GS0L 4GLRI 2EDBA 5EU7C 3C6LD 3UBXG 3T0EC 4U6XB 3AMLA 1P1ZB 5TF1L 4AL8L 3RL1A 1GH7A 4FFWC 4GSDH 1V8HA 3ZZ1A 4YDLB 4XXDA 1BIIB 3RI5F 4DAGL 3EDFA 3F5WB 4UTBH 3HC0A 4M6NL 4GAJH 5B4MD 1A7QL 4FFVC 4MXQD 2CQVA 2OXGA 4D0CB 5T3ZE 4M02A 2ZSVA 3T3PE 1BOYA 5D5MB 1K4CA 4GG6E 3O3EB 4WU5A 3A6OA 4HIJB 3WHXB 1XGQB 4JO4H 3FB6B 4HXBL 2OL3A 3LQZA 2EE9A 4LCUA 3DI3B 4GXVL 2SEBB 3WUWB 3CX2A 2AK4B 3T0AA 1TDQA 1QRNE 4XPBL 2R0WL 5E2JA 4K23L 4I0CC 5HYJB 1LEGA 4WV1C 1OM3H 3ARDB 2BCKA 4XXCA 1MCKA 5C0EB 4TNWK 4V1DE 4R4NC 3VXUB 3O2VH 1K6QH 4IRSD 5E24E 3UTQB 5L2KD 5DRXB 5KS9E 1EA9C 1Z9LA 2ICWB 4KHTH 2BNQA 3LQAL 2DI8A 1S8DB 3NA9L 3BPLC 2ZG2A 4NQXB 1S9XB 5KSBE 4W6YB 4TN9A 2AXGA 2YD5A 3BYTA 3RGVD 3ARZA 5L2JA 2KL6A 3H7LA 3JXAA 1TITA 5AZEH 1MJJB 2VXUH 1M6OB 1IT9L 2XTJB 4Q7DA 3CVIH 3MLXH 3FQUB 4FQXD 5C0FA 3T4AA 1JGVL 1FNEA 1X7QA 3QDJA 2PCPA 1KCVL 4YHMH 1BZQK 1J7VR 1Y6NR 4ORZC 4HG4K 3TVMA 1HINL 3WIIH 5FAAA 3PHOA 2ZOKB 1UKTA 4J3UA 4ZMAT 4KVNH 3WJJA 1BPVA 4MVBD 3LRSA 1T0PB 1MCWW 3DXAE 4FQPA 5IOPB 4HLJA 4PRDB 2YUVA 2BFVH 2F8OA 3TPUA 4RFOL 1KJ2H 1H3WM 1OTTD 5F7WC 5EG6C 5HVFB 4NDMB 3QISA 5KZCB 3MYJB 2OSLB 1P84K 3JSSA 4YNYB 1FYHB 2MCG1 2EICA 4WHTA 2IADA 3F7YA 5T1LD 3WV0A 5HPMB 4N0CC 5E8OA 3TJEL 4WFHE 3GI8L 5F7YC 4N8VG 1RUKH 1NCDL 1N5AB 1OAZH 4QYOB 4R97C 4FN0A 1WIOA 4U1LA 5GISL 4I3GA 4NFDA 1NJ9B 1YJDH 4NRZB 5I1HH 5F7MC 3NCMA 4MNQE 3SY0A 1ZLVH 3TZVB 3W9DA 4AEEA 4RQQB 4GKNA 4OB5H 3BZFB 5ISZD 3MJ6A 1H3PL 5DT1L 1WEJH 1I7ZB 4UT6H 1WC7A 1II4E 5C0AB 3WKNA 5TQ0L 2R0KL 1LO2H 2UVEA 4CVUA 4E0RB 5DO2D 2AI0H 5CAYB 4Y5VA 2P42B 4OFKA 1TQBB 1KOAA 1FZKB 3MLZL 1ZVSB 4P2RA 3VD7A 5E0QA 1N0XL 1XH3B 2DQFA 2FX8H 2H9GB 2ZUSA 4PLJC 3V4VH 5BZDA 2DN7A 2Z9TA 3HPJA 2PYFB 5C0IA 1T0MB 2XN9D 1H5BB 3QWQB 3SGJC 2HTLC 4JRXA 5F9DC 1GCFA 3P4OA 3V0VB 2C4FT 3L5JA 4X6DE 4FP8H 4PGEA 3V2AR 3OAUL 4BM7A 4CMMA 1UKSA 2M1KA 4MJIE 3H9HB 3LN4A 5I18L 1ZT7A 4F7CB 2CDGB 4NO0B 3QUXB 2YOCA 3HR6A 2DQUH 3NPZB 2VDKH 5MI0C 4XVUC 5IMLA 4N90E 3TNNB 3PP3H 3ZKND 3NACH 2I9TA 3L3KB 1UJ3B 4K94C 1U8IB 4G6FB 4JQVC 5SV3A 2KQNA 4YEFA 1NKOA 1WAAE 4IIQB 4MNHA 1WQVT 4PRPA 3VMOA 4MA7L 1FVCB 5CINL 1R5IA 4WY7L 5I73C 5DA4A 4ZXBD 4J3OC 2FB4H 3MRDA 1A6TB 4UV7H 3PDOB 2W1NA 5I0ZA 1YN6B 2VQTA 2L7JA 4NFBA 2CSPA 4ODUA 3WLBB 2XWTA 3QWRA 2ZUUA 3FN9A 2B39A 2XNAA 1ZT4A 3UO1H 1MWAL 3TH2T 4L8BA 1IEHA 4HWEH 1B9ZA 1DE4A 1LO0L 4NN7C 4R26L 5CEXA 2QHRL 1WCBB 1E6OH 1T7WA 4KJYA 4Y89A 1Z6JT 4GQ9L 1C7TA 4MJ2A 2NY2D 3CPLB 3TYGH 2G2RB 4U1IB 3BKJH 4X5XB 2IALA 4P23B 1VENA 4CADB 1LO3H 1S7SA 1TJIL 4WUUB 1KLUB 3BKYL 3N0PB 1INQA 1UZ8A 4F3FB 1HIMH 5D96B 3GMLA 1CLYL 1FNSH 1TVBA 3G6DL 3GSVA 4M5YH 4TTDD 3L3IB 4HWUA 3UTTD 3KPLA 3T65B 1JGUL 5T5NF 5E2VL 2NXZD 43CAB 1J12A 4P5KB 1LO5B 4XWOC 4LSRL 2Y7QA 3O3AB 4D0DB 3DMMA 3U46B 4YC2C 1NDGA 4RFNB 1YEFL 1NUFA 1UJTA 2AJZA 3ESUF 5C0BB 5D93B 1AI1H 1J0ZA 4BFEA 3HHRB 5CSGA 4AM0B 4PLNC 3MGOB 3JZ7A 2KUTA 3FONB 1G7MA 1HWHB 3TCXA 1QSVA 1D9KD 3RTQA 3ARWA 5DRNA 1XGRA 2ZJSH 4OF3A 5I1JH 4WU7A 4KDVA 2QKIA 4MDIB 5K9QI 3UROR 3UYOD 1QBLH 5GS0C 4KDTC 4ODVL 3TESA 5EPMA 3UTZA 4NNYA 1OPGH 3GM8A 3Q3GA 1FNAA 5IROC 3L3HA 3NPSC 2Q3AA 2H6PA 5DVLA 2ICWJ 4H0GA 3P11H 1QNZL 2D3VA 1T2JA 4P46A 4PJCA 4JHWH 1FJ1B 4MD4A 4QY8A 3WO4C 4U1NA 4HUUA 1KJ3H 4P57B 3DURB 1T4KA 1U3ZA 3GK8L 4ORGA 3QCTH 3KPSA 5JO5B 5DTFA 1RV6X 4BSVB 5E8NB 4NQCB 4ZS6C 4FHBD 2OTPA 2HA1A 4JFEA 2YBRB 4ONGL 3CFKA 4U31A 1G6RB 5T3XE 5CJQH 2Z93B 1YEEL 4AT6A 5IFJB 3MLSH 2DQDL 4LQFL 5DJCB 5JOFB 3OKDB 2H32A 1AP2A 4W4OA 3A6BL 4E42B 1QLEH 2IQ9L 4KUZH 5DF0A 4ZODA 5GRZA 4DTGL 2CIIA 3WFHB 3M1BA 3HNTL 1XR9A 3K81A 3CJJA 4HFWA 5D7JC 4F9PA 4OZFG 4WENB 4FQJL 5IMMA 4YXKH 4M5ZH 3AGVA 2C1PA 1KXQE 3SDXA 2YSSA 3FAXA 5EU3A 2ED9A 2DIJA 3FB7A 5C08A 1WZMA 3D3VB 3V5DB 3LQAC 2D03L 2V5TA 4XMLH 4LQ1A 3HMWL 2V7NB 4Z5RA 5SWQA 3X13A 2IWGA 5I1KL 4EI5C 5HBBA 3IXTA 1IEAA 5C8JA 5D2NB 4HJGA 3KNBB 5F21B 3JV0A 3SE9H 2GITB 5FO9A 4NUJB 2NY4B 4HK0A 3C08L 4B53A 4MX7A 4JG1L 3OX8A 2OCFD 4LFHD 4Y88A 1JNLL 4PTUB 4KQ4L 3MV7D 5L7XL 2GKIA 4FQLH 4JY6A 1UWEH 1JZ4A 5K9KA 3GNMH 1NLDH 3DX7B 5DD1L 4Y4FB 5T3XL 1CZ8L 4Y2DA 2ORBH 5TF0A 3MBEC 1FO0L 4LCWA 1BEYH 3I9GH 3SOBL 1U3JA 5JORA 1NC4B 2YC1B 4DVBA 2B0SL 3BH9A 4NYLA 2HN7A 2EIZA 3LKSA 1I3UA 1JZ5A 5E5MB 4KRNA 4LHUG 4ZFOA 3ARFB 5I1CH 2DI7A 4KROC 4KMQA 1FCCA 3LPFA 4A6YB 4LARH 2ENSA 1K4DB 5EFIB 2VLJD 1EEZA 2J1KA 4GW1B 2ESVD 4Y1AE 2ITDB 4Y8DC 4K3DH 4JY4A 5FGCE 2RFXA 1F13A 3QCUH 1YNKH 1NSNL 3QNYA 1BGXH 4QRTB 4Y7MA 5E03A 1VFMA 1RIHL 5BJTB 1U8MB 3O9WB 3U83A 2G75A 4NJAL 1JN6B 1NUGA 2NY5L 3EDKA 3T0ED 1JYVA 1GOFA 5D6CA 1F3RB 4BZ2L 4FFWD 3SDXF 4I18C 3EOTL 4U3CA 4JPWH 4QOKB 2A38A 2BJML 4GQPH 1CFNA 2A6KA 4HT1L 3WUWG 2X9YA 3MQIA 1JK8A 2WBJB 1IQWL 3T4YB 4X7DC 4U1HB 3ARBB 4FFVD 1B4JL 1MCPL 4TULH 4FQCL 1P7HL 1LK3L 3TM6A 4NO3B 3IDXL 3ULVH 1XIWA 3BGMB 1AJ7H 2IH3B 2D31B 1M71A 1GL4B 4OFVA 2JB6A 3C6LA 3MLUH 4GMSH 4Z95L 2LAGB 1CLOH 2ZKHH 5FV1L 3RWHA 2E3VA 3D39E 5HHMD 2GIYA 3ARGB 4HEME 3MROA 3IF1A 3HI1A 4DOHE 3NTCH 1TXKA 5L88L 2NY0B 3VWJC 1QR1B 4TVSa 2ZCKL 3VA6A 1G9NC 3L5WB 5C7XL 2VLLB 4OGXL 4J1UA 4R4ND 1DBAH 2P8LA 2ATPA 2F53D 2J12B 1PGRB 1CD1B 1CL7L 1QEWA 3P9WB 4PJIA 5D1XB 3W0WE 4OLVH 4HXAL 1J0JA 1OGTB 5K33A 2WIIB 4U1SA 2IC2A 4EIZC 3T1FB 3U0TB 1H15B 5ITFA 4EDWH 5INCB 4Z7QE 3MSPA 3PIQA 4FZEH 2EIBA 1O7VA 4UILL 2XY1A 2DDQH 4JLRA 5ADOL 3GB7B 3TBSA 5K59E 3OHXA 4JGJA 4IRSA 4WW2A 1HYSC 3MA9H 4URTB 5L2KA 3JV4A 3LIZL 4JO2L 4M7ZC 1KGCD 3GMMB 3RL1B 1K5NB 1H3UA 4CU7A </