3WFEL

Reduced and cyanide-bound cytochrome c-dependent nitric oxide reductase (cnor) from pseudomonas aeruginosa in complex with antibody fragment
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
213
structure length
213
Chain Sequence
DIQMTQSPPYLAASPGETITINCRASKSIRKYLAWYQEKPGKTNKLLIYSGSTLQFGIPSRFSGSGSGTEFTLTISSLEPEDFAMYYCQQHNEYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody fab fragment light chain
publication title Structures of reduced and ligand-bound nitric oxide reductase provide insights into functional differences in respiratory enzymes
pubmed doi rcsb
molecule tags Immune system/oxidoreductase
total genus 51
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2013-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wfeL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wfeL01
2K1MA 2R0LL 4HKBB 3MJ9A 2Q7NA 2VIRA 4JHZA 4LSPH 1T89A 1X5HA 2Y4SA 1R24A 1X3DA 1A2YA 5SV4A 4DZ8A 6FABH 1R3LA 4ODXB 1J1PH 3QUZD 4XPBL 1NBZA 5H94A 3D69B 3RDTD 5CEZH 3FRUA 1N4XL 3BP5A 1HOCB 5F6IB 2HT2C 2GJ6A 1B6UA 4X6CA 1YQVH 3ARBC 3OB8A 4XPAH 5I17A 4HZAA 4MVBC 2CLVB 5E4EC 1CLYH 1NBQA 5KANG 3W0WD 4PJCE 1L4IA 1CN4A 1AGFB 3CFBA 1OGAB 3MACL 1P7QD 2EYSA 5EA0H 5SWSE 1YYLH 4JPIA 3DRTA 3IU3B 4PJIB 5FAAA 4KXZI 3G5ZB 2WK2A 3C08H 2LVCA 3MRKA 5T1MA 3GSNL 3RL2B 3SCMC 3M45A 5KSAA 4R8WH 5C9KA 2Z92B 5I9QC 3QPXL 5JDSA 5D5MB 1M6OB 3DGCR 2CJUL 4D94A 3TZVC 5J6GB 1RJZA 1CT8A 4OLYL 2EIZA 5E8NA 1I9EA 2FIKA 3RNKB 5BS0A 1I7RA 5HVHC 4FQXD 2JLLA 5DURB 5C0IA 1NC2B 1JRHH 5HHMB 5A2FA 3UPRB 3ZL4L 1ZVSB 3ZYJA 5F1IA 3VXOB 3QRFM 4U49A 2GYSA 3D85D 4LLVB 3GGWA 3Q6FB 3HMWL 2A2QT 1MRDH 5GJSH 4BELD 2DBLL 2Z31D 2D7NA 1I1FA 4KVCL 3FB5A 1U8HA 1UCBL 5T1KD 1XH3B 2ICES 3V95A 1U36A 4AEFA 4Z76B 1C7SA 3NOIA 1WIUA 4L3EB 4M03A 3WEXB 1CD9B 5FKAA 4MQSB 1WK0A 3GI8L 1V8HA 2X4RB 1P4BH 4PJAE 5FUOH 3LN5A 2C4XA 1NFIB 2BNQD 2OI9C 3GKZA 1ZLVK 2X4TB 2AKRB 2WINA 3SDAD 4KK5D 3CSYB 3DUUA 2H8PB 3Q1SL 1Q9KB 1QFWL 5D2LB 5JW4N 4XXDB 2VDOH 2BVOB 3V8OA 5DMKB 3IDGA 4LHUA 4U3HA 3VXTB 4ZOBA 4TNVK 4JFFA 3SOBH 5GRVL 5FEBA 3EO0A 1TDQA 1OAZL 3FT4B 4Q6IB 2Z4QA 2DN7A 3IGAA 5IEHA 4JDVB 4K9EH 3QEHB 5I76A 1FNFA 3B3IA 4WWKC 1UZ6E 5ISZB 3B6SB 4LARH 4X7SH 3HG1A 3MJ8A 1T1WB 1MFDH 3KHOA 3C8KB 1QSFB 1I8KB 1FZOB 4JFYA 4P99A 5C0DA 4ACPA 4QF1A 4OZIF 2OQJA 3NABL 1JWMA 5FYKH 3EJZC 1RU9H 3ZT5A 2A0LD 3QO1B 4AENB 5A16B 5JO5B 4M5ZH 4R4ND 4LVEA 4WV1C 4Q6YA 4UUJA 2ZG1A 4DGYH 4JY4B 5MI0B 2PR4L 1FG2B 1R5IB 5HPMB 2GW5A 2ARJA 4X5WB 1CGYA 2XG5A 4NQXB 4AG4H 3EOAA 4C56B 2RCSL 1HHGA 2DMKA 2ZSVB 3UJIH 5FV2A 4R0LA 1U58A 1TETL 3INUH 1K4DA 1X9QA 3ARFD 4R96A 3OXSA 4OBSA 5JW3L 3WUWB 4YWGL 1NSNH 3C9NA 4PG2C 1WCBB 4FFWC 1UJ3B 2NY4C 5SWSD 2XZZA 2ICWJ 3QQ3B 3KG5A 5AZEH 4GG6F 1FDLL 3CMOL 1QUNA 1XIWA 5DD1H 3KPMB 1C12A 3TJHC 5GS0H 1KTDA 2BVUA 2X4QA 1RFDH 5D1XB 3HFML 2VL4A 3BJ91 1X4XA 2QADD 2H45A 3LKQA 4MA3B 5IMLA 3IAQA 2HG5B 3S5LG 1ONQB 4OIIH 2FNBA 2XWTB 1IGYA 3I75A 2YUWA 3UAJC 4X9BA 3NGBB 3B5GA 4MA1C 3FQRB 1D6VH 3O41A 2EDKA 3DIFB 2HWZH 1XFPA 5HJ3B 4D3CH 1JZ4A 2E6PA 3HMXA 1BECA 1F4YH 1DVFD 3MMEA 3GO1H 3QXAB 2HTKC 2Y6SC 1A3RL 2HTLC 3GDBA 3BZ4B 1CDIA 4WHTA 1M7XA 3EO9L 2PTTA 2QLVB 3QEGL 3VGBA 3FQXA 3KPLB 4HS3B 1JYVA 1U91B 1ORSA 2EZ0C 1RZJC 1CBVL 2HT4C 3WJLC 5FIEA 4LOUD 5I1IH 3TVMA 3MRJA 4QHUB 1N6VA 3B2VH 3LHPL 3FB8B 3OMZA 4X98B 4I3RH 3D0LB 3FN9A 3UO1L 2H9GA 3IFNH 4JM2C 1GGIL 5E1AA 2NXZD 1DE4B 2F15A 1RQ5A 1AGBB 2UZXB 1RIHH 5DRWA 3C5ZD 4JN1L 2AJUH 5DRNB 4KK6C 1MH5A 3NPSC 3IDJB 4JQXC 3P3YA 3IFOA 4JZOB 3IB4A 1AHWB 1WFUA 1YEFL 4WTZG 5C2BL 5IOPB 5IF0B 2JELL 1UB6A 1HI6B 2R1XA 5D1ZA 3ARUA 1VKXA 1FNHA 2I26N 3O6FD 5JPNB 4HC1H 4KHTL 2HMIC 3MUHL 3EO1A 2UUDH 1Z0MA 2OL3H 1E4WH 4LAJH 3NCFB 2WWMC 2E9JA 4HH9A 4BSVA 4O4YH 4R26H 2EIEA 3QZWA 5ILTL 3IDIA 4H26B 4F9PA 1HSAA 4I77L 5T1LB 5DRXA 3X14A 4X6CF 3KVQA 3CX5J 1ZXQA 4J3TA 5ACZB 4LCWA 3UX9B 4TUJB 5J57B 1J5OL 2CIIB 4QRQB 4XVJH 2VQTA 5E2VL 1MLCA 4K8RD 3JTTB 3RZCB 2EE2A 1GIGH 5F1NB 1F45A 1R3JA 2EXWC 5FV1L 1T7YA 2WIIB 4EIZC 1I1AA 3S6CA 4Z5RA 1PLGL 3RWDB 2R1YA 5JHLH 5B4MC 2ORBH 4PLJC 4Z8FL 2R8SL 4S1QL 3VRIB 5ANMB 3WDHA 4U33A 1A7QH 4NNYA 1IZKA 3IXTB 5CILL 5ITBL 1MRCH 1EAPA 3G6JA 3WS6A 2QBWA 4NBXB 4BQ9A 1T2QH 2OM5A 4JRYE 5F8QC 4XZUA 4MDJB 1ERNA 2ZOKA 3L3GB 2XFXA 5DDHB 1V7MH 1AGCB 1RI8A 3CK0H 2A73B 1S9XB 2DQFA 4KRNA 3GBML 3ET9F 1J12A 5MEQB 1J7VR 3MFFA 1DLFL 3FO1A 3MV7E 3CFJA 5DVNA 5KS9A 1PQZA 1U8PA 3TYFA 4PJXE 3TIDB 2BSSB 5E99H 5GSVB 3BAEL 1CZ8L 4XXCA 4NO3A 2DI8A 3KYMB 4QXGH 2JCCE 4KKLC 3BI9X 2XTJB 5IKCB 2PXYA 1QBML 4OZFA 4IRSB 4OM1H 1J8HB 1OTSC 1U8IB 1XCTB 1ZLUK 1NAKL 1RK1B 4MAYD 3KGRA 4LPWA 1HHJB 4PP2A 2X6MA 3E1F1 4NCDA 4PRPA 1TZHB 4UIKL 1HHHB 1VB9A 4J4PD 3DXAA 2DQHH 2EH8H 1INDH 2H2SD 4MD5A 2V7NA 4FABL 5JW4Q 1U93A 3VXSB 3ULVD 3LCYA 4UDUB 3HE7A 1U3HC 1L0XA 2C3VA 5DHYA 4MB5A 5E4IA 1DBJH 3HNSH 3TO4A 3KYAA 3MLSL 2X1OA 3Q6GH 4QYOB 1KCRH 5DUPH 4IS6A 1IE5A 4JFQB 5T3XH 5E6YA 5IW6B 2VLLA 4B7LA 1UACL 4K3JL 3M17A 5CHNA 2O5YL 1CVSC 3GJFA 5CKGA 5LGJB 1DL7H 2EDYA 1F4AA 2YEZB 3MV9B 5E8EA 4P2CG 2OZ4A 2AJVH 3OXRA 2VXTL 4I3SH 4LKXB 4POZC 1Q0YL 4P2OA 3DVGA 3VFVB 1ADQL 4XP5L 2IBZY 1T04B 2DQUH 4ZXBD 2BP3A 2MQ3A 3UROR 1ZA6A 1U8MA 5IMKB 2X5PA 4TUOB 2F54B 4P23B 1UT9A 3JWOL 2R4RL 2X05A 3LS4H 2XZCH 3A6OA 3HPJA 3DX6A 5GGUB 1QRNA 1A9EA 3KPSA 4Y19E 4N5UA 2J3SA 3RRQA 1IKNC 1KJ2L 1HNFA 5JXEA 4YO0B 3QUXB 3GIZH 1ULVA 5KVGH 4P0DA 4G8EA 3MZTA 1CQYA 5I1JL 4BQ8A 1P6FA 1Q0XH 4OLZL 5DRZB 1TIUA 1HH9B 4JZJB 1MFCH 1QA9B 2VN4A 3BXNA 1UA6H 1U8JB 2NTSP 1O7SA 1K8IA 2Y25A 2XKSA 4D9QE 3C6LC 4L3CB 2YWYA 4V2CB 3LV3B 5HHNA 1NMBH 3VRJB 4F7PA 3MRMB 2LAGB 2F5BL 3D39E 3H42H 3HPLA 2X09A 2DQJL 1CD1A 1CXFA 4NDMB 3MA7A 5FO8B 1YYMH 2FL5B 3OKLA 5E6ID 2HJFB 2V7HA 2W0KA 4JRYD 1E4KC 1OARL 2JK5B 1JTOA 4Y5VC 3U4AA 4Y5YA 5LCVH 5FYJH 4DZBB 5F7UA 2RBLA 5I18H 3ARXA 1MAMH 2IPKB 3AMKA 4XPFH 2EEDA 3L3DA 5A2KH 3F65A 1X5XA 1QSEE 2CLRB 2D2OA 1BJ1H 1FL5A 4NKOB 3OKKA 5I19H 4G8FB 4PD4K 5IM7A 3MV7D 5HHOA 3W39A 2GJ6E 4X6CE 3GK8L 1YEGH 4FN0A 2VXQL 2VXVL 4ORGB 3QDGE 3G9VA 3MYJA 1NGYB 3TCLB 4I0PB 2FLBT 3VXUA 5EFIB 5TH2B 2GJZA 4Y2DD 3PWNB 3ULSA 4PGDB 4XAKE 1QNZL 4YR6A 5I16B 2JB5H 3MRCB 3GB7A 3U48A 5EUOE 1MJ7H 4WEMB 1OAUH 1XGRA 3HZMA 4WI4A 1H8OA 4YDLB 4ALAH 1P1ZB 2NY1B 3ESUF 2YR3A 4LCYB 3LQZA 1DBKH 2V2TB 1NEZA 3FOMA 1FNSH 4L9DA 2VISA 3HAEG 5GRWA 3AXLA 3PP3H 3R0NA 3MLXL 1AQKH 1FVEB 3JUZA 5BS0E 4OQ1A 3MR9A 3VDAA 2NPLX 3VW3L 3VXPB 4C58B 1IQWL 4ZG1A 1RD6A 4Z7WF 3FL7A 3UTSB 1CK0L 1N64H 4WW2C 1WCQA 2PYEE 2A6IB 1OSZA 3SGKC 2QQKL 3M8OH 4QRUA 4FTVA 1YJDC 3IJHA 4JREB 4QKXB 2FBJH 5AWNL 5F1KC 2I60L 2HH0L 5DLML 1PEWA 3ARQA 2XXCB 3D25A 5F88B 1HSBB 5IV2B 4OLXL 3QXVA 3LQAL 2VAJA 4HS6B 4CKVX 2IG2H 3HLAB 2YRZA 5GSRA 2OTUB 3D3VB 3HI6H 4MNHA 1ES0A 3KDMA 1MHHA 3I9GL 3S34H 3WJJA 4PRDB 4Q9QH 4QRRB 2N1KA 3GMQB 5HDQH 2R2EB 1QLRA 5BVPL 4JFFE 4WEBH 5I1AB 2HFEB 1HQRA 2EC9U 1FNAA 3G6JF 3AFLA 5L0QB 3KJ4C 1QTYT 5SWZE 5EU6A 4QOKB 3FRPA 5KSVB 4E5XA 3F7YB 3HG1E 4D9QD 4PY7B 3QCUH 4Z78A 3QDAA 2YA0A 1ZS8A 3MRHB 4HJJH 4WHYG 4GLRI 3VXQA 1M1SA 3BH9B 3U0WL 3BZDA 3D39D 2VITA 4MCZA 4P46C 1TCRB 4CADB 4GOSA 5M95B 1VACB 2Q76A 5F7DA 5D2NA 5IVXE 5KS9F 5FM5O 5DMIL 1H8NA 4JHWL 2IAMC 4G6MH 4ZSOA 5DQDH 1NGZA 1I8LC 3BSZH 3VRLE 4ZOAA 3QI9B 5DT1L 3VGFA 1QSED 4LCUA 5IR1B 4HUUB 5ID1A 3BRGC 3V8CA 3MRBB 1YNKL 5HPOA 1FN4A 1SEQH 4KRPB 4Y1AA 3IFPB 5IMMB 4R90H 3QDGD 4U3XA 3ILPB 4U1IA 4YPGA 2CDFB 5I30L 5GGQL 4PY8I 1NCUA 3FKUS 1INQB 1RZ7L 2DQCH 4XAKD 1B4JH 3NZ8A 4UI2A 4WNQA 1TZIB 1NCNA 3IVKA 1CICB 3W81A 3WIHL 3LMJH 4YGVA 1MCKA 4HQQH 2NX5B 4OF8A 2ZG3A 4RIRB 4LCCC 5E8PB 2XY2A 4QXTB 5IG7A 5EC2A 1MCPH 2F8OA 5B38G 1MLBB 1FFNA 4PRHA 1FYTD 4J6RL 4OCXL 3GNML 4U1KA 4HIHB 2CKBA 2LTQC 2XY1A 2IPUK 4RRPG 1EFQA 2AAVA 5BS0D 3UTZA 2NZ9C 3BP7A 3ARBB 3JTSB 2VQ1A 5CEXB 4MX7B 1FH5H 3QNXB 4JRWA 2W9LA 4CVWA 2Q86A 3ARPA 3O9WC 3WL9A 3SKNB 1FFOA 2PYED 4Y0GA 1F90L 1CL7I 3QSKB 2J6EL 1MELA 4KPHL 1I9JL 5D7IA 4EVNA 3V6OA 1IMHC 4GRLC 3SO3C 1Q94B 2JF1A 3SCMB 3H9YA 4MAUH 3I50H 1PAMA 4H0GA 4CMMB 5I9QB 1A7PL 3ARVA 4HWZA 3TZVB 4OGXL 2ICWI 1H5BA 2GAZB 2B1AL 4RNRA 3DVNA 5LJYH 2AI0H 3IFLL 5EOQH 1O7VA 4BZ2L 3W2DL 4YAQB 1ZKAA 4LPUA 4E41A 4XPTL 3FQTA 4HK0B 5HVHB 4HT1H 4NRYA 4NQDD 4HDIB 5EBLA 3E3QC 4ERSH 1MWAL 1OD7A 1P4IL 4JR9L 4HIXL 4NN6B 4PJGB 1G7JB 4YDJA 3O2VL 4GKNA 4Y4KD 1T7VA 4JFDA 2Y72A 3OTTA 4JFFD 4XBEH 1C1EH 3NZHL 5GHWL 1G9MC 5IVNA 3QHTC 1N6QL 3I6KA 5SWZD 2GK0A 4F58H 1XT5A 3JZ7A 1UYWL 2P8MA 5IHLB 1LDSA 1P7KB 1E6JL 3EIFA 3U0PA 4RISL 1HN1A 1RIUL 3HG1D 5IBTH 4AH2A 4RWHA 2NW2B 3DSFH 1D5IH 4P9HL 32C2B 3QIBC 2OI9B 4DCQA 5HI4D 1KN2L 4YHNB 2CIKB 3HCVB 3L3KB 1IBGL 5HDBF 4JFZL 4G7YH 3R4DA 3IETA 3BOVA 4P5KB 4IM8A 4XT1C 3NMEA 3QDJB 4WFGD 3VFPB 4KMTH 5L9DH 4YXHL 4WY7H 4PP1C 5GS1A 3V6ZB 2BFVH 1HKLH 2D31A 4DAGH 4CDGC 5BV7C 4LCWE 5E7FA 4YDIL 4IDLA 2YKLL 3WD5L 1K6QL 4M7KH 1NJ9A 3O45B 1ZGLA 4TUKH 2G9HB 1M71B 2OSLA 4JPWH 5TE4H 2AVGA 1IGJB 3MRPA 2XKNB 4HKJA 1QQDA 4WWKB 5F1SA 4XHQA 4X6EB 5C0NC 5EBGA 3ARRA 4OCYL 5DEGA 3X3GH 1P69B 1XGYH 2VH5H 4UINH 5IB4A 4HEPG 4IHOB 3MNWB 3P4OB 2CK0H 3HR5B 4XNQA 4NKIL 5GGRB 3BGFC 15C8L 3ALWA 1FNEB 2FX7L 2F19L 4H0HB 3LSOB 5KSBA 4N1CA 3TIEB 4TSCH 4WJ5A 5T1DH 5T5NG 2AW2A 4WV1B 2DOCA 2W38A 3LZFH 4CVXB 3BZEB 4PJFA 4Z6AT 3S35L 4F57H 4UILL 2VB5A 2WUCH 3AAZA 4FRWA 4D0BA 5EG6C 1TZGH 3RUGB 3MUJA 5CFHA 4PRNB 2OCFD 2P24A 4I4WB 4Z7UB 4H25B 1LP9F 4UMGA 3ULUF 1Q72L 5D70L 1X5FA 3IDUA 1UCTA 2ENSA 1BFOA 5F7MC 4U05A 1GGBH 1V3LA 2FYYB 1PDKA 4ZUVB 1MCWM 5CEZD 4GSDH 1BZQK 1PZ5B 1KNOB 5TF1L 5CEYB 2HYMA 4W68A 1IFHH 1ZSDA 3C60D 4FG6D 4O2EB 3FQUB 5GGTL 4RFOH 1MPAH 5FO7B 1I1RA 3D2UB 4G9DA 4MXWL 5B21A 4JPKH 3JV0A 4YHZL 3G6DL 2AQ3A 3WYRA 5HGHA 1TCMA 3VXRE 3SGEI 1AP2A 1KB5B 4FHBD 3DXAE 4I48A 4LHQB 2MCPH 5HVFB 4G6KH 3VFNA 5DEFB 1N5AA 3L7FB 2R4SH 5DJDB 4MA1B 4OT1L 5TFSH 3FO9A 1BZ7B 2DF3A 3SHSA 4YHOL 3BDYL 4M7LL 3B9KA 1UM6H 5A2JH 5DJZB 1X5AA 4G8GA 1GXEA 1NCBH 1WBXA 1FZMA 1MCWW 3VWJC 5BVJA 3O4OC 4JKPH 1U8OA 3RY5A 3QDHA 4RAVA 4YH6A 4HPYL 4PD4J 1FC1A 3T0EA 4GUPB 1JVKA 3L9RB 5IB5B 4LLYB 4WI7A 3PGCA 1EERB 3S7GA 4G9FB 3AU1A 2R1WA 2Q8BH 2OJEB 2UWEA 2WWKT 3T8XB 3V7AE 4JM2B 3EZ8A 3P0YL 2X4UB 1P2CB 5IJKA 1BBJA 2UUDK 3WDIA 1X7QA 4OZHB 4NHUB 2VLKB 5C0BD 4AIXA 3HB3C 3L1OH 2CRMA 4NRXA 3KPSE 4XHJC 2EYRA 4HJ0D 1NC4B 1B0GB 1HXYA 4LCWD 4PTUB 3RZWA 5E7BA 4M93C 3VFGH 3QUYA 3DRQB 1KIUA 4RA0C 3OWEA 4Y2OA 4NYLA 4R4FL 1QPXA 2AXGA 2BY2A 3WIIL 3OKEB 1U9KA 4YC2C 1BLNB 2IADB 1J05A 3DMMA 5E8OA 1I1AD 2DQIH 3H0TB 4OUUA 1EO7A 5IP4A 1TTUA 1EO8L 3QXDB 2W9DH 3G5XA 1KJ3H 3MGOB 4RBPK 3UTTA 3AS2A 3R1GH 4RFNC 2KH2B 4KXZH 1G7IA 1I1YA 5T5FH 1JWUA 4U1MA 3NA9L 1NGPL 4PB0L 5IWLC 5HDLA 3DUSA 4TRPH 4EQ3A 5D9SA 4OD2B 2QQQA 2DMCA 2YA2A 1NMAH 5FGCE 2X7LB 4XRCB 2D7PA 3NTCH 1YY8B 1F8TH 4NO0D 4OQTL 5F97E 3QA3A 3EW3B 5DD5H 2H32A 5D8JL 3ILQC 1P9MA 1D9KD 1CDUA 3KWWA 2OS7A 5FYKD 5HGBB 2GSGA 1NANI 4HKBA 5EC1B 3MYZA 5E9DB 5D7IF 1LWRA 5HDBE 3VFMB 4ODHL 3H9ZA 1PSKH 3LPFA 2GCYB 1FLTX 2AJXL 3LEXB 4DQOL 5L7XH 4P2RE 2YBRB 4ODXA 1PKQB 4NKDB 1T83A 3MOBL 3D69A 1A9BB 1T03L 3CCHB 2AJSL 3AY4C 1HOCA 1IEHA 1YNLL 1A7NH 3HI5H 2CLVA 3VG9C 2VZVA 1ACZA 3MODL 4D0CB 1AGFA 1OGAA 4ELMB 1MNUH 5HD8C 2YD3A 4PJIA 1S78C 3G5ZA 1RZKL 4I0CC 3IDNB 3VD7A 2DRUA 4HS8L 5KVFH 3VXRD 1YJDH 3QPQC 3RL2A 3DXAD 4K3DL 1RJCA 2NY6D 2AJYL 1IM3B 1AKJB 3QNZB 3S97C 3RGVD 4NUJB 2Z92A 1AFVH 5D5MA 2NY0C 4ZFFB 1M6OA 4S1DC 1OP3H 4FQHB 1F3DH 3GZKA 5J6GA 4MS8D 2WV3A 1B88A 4QRPE 3KPRB 1DLHB 4TPRH 1PJ9A 4RWYH 1AR2A 2DTMH 3RNKA 1EGJH 1RHHB 4LSRL 4NP4H 3TPUB 4UTAL 1NC2A 3T0WA 2XOTA 5C9JB 1AJ7L 5C71A 3EJJX 4FTVE 3UPRA 1ZVSA 2VR4A 3VXOA 1ZANL 3EFDL 4LLVA 4N0CC 3STLB 3Q6FA 1GPOH 1I9IL 5TQ0H 2DDQL 3ULUE 2YPVH 2WBKA 4O5LH 4NZRH 1MCNA 4KDWA 3HN3A 2XACC 4JPVH 1JZ6A 1XH3A 4UOW0 4Z76A 4KUZL 5GRZA 3V6BR 7CGTA 2CRIA 3QFJB 5DF0A 1U3HB 4L3EA 4HUVB 1FFPB 5J89A 3WEXA 4PBVC 2X4RA 5CCKL 3OR7B 1NFIA 4JKWA 4ZYKB 5I8KL 3NFNB 1YECL 2OR9H 1CXIA 2PW2B 4NM4H 4MA8H 4GAGL 2X4TA 2AKRA 2YRPA 1F6FB 2YPKB 3CSYA 1BZ9B 5GRJH 2H8PA 2B1HH 1LMKA 3LEVL 1Q9KA 5D2LA 1NCDH 4LIQE 4XXDA 1PVHA 2BVOA 3CFKB 1LO2H 5DMKA 5JZ7D 5KSBF 4GJTB 3VXTA 3MLWL 1ZHBB 3AVEA 4XVTH 3Q3GB 3KXFE 3GBNH 1IAIM 3FT4A 4PJFF 4Q6IA 2FX9H 4JDVA 3RKDD 3VWKC 3VD9A 1N7ML 3U1SH 5ISZA 4L8SC 4FQLH 1IARB 3B6SA 1X44A 4YNYB 25C8H 4NOFA 4YUEH 3IDYC 1T1WA 3C8KA 1QSFA 1I8KA 1FZOA 1JBJA 5FO9B 5D2NE 3N0PB 3PE9A 4RMRA 2C4FT 3V5HB 3PGFH 3QO1A 4Q58C 4AENA 3F5WB 4S2SA 5A16A 2YD6A 2ZUYA 5IROA 1ZLWH 5I1CH 3MLVH 5JO5A 3D48R 1LK3L 4ZSOE 2P5WB 5CP3A 4N8CL 4JY4A 1FG2A 1MREL 3T0AA 1R5IA 5HPMA 2FRGP 3O2DL 4X5WA 5ELIA 1IGML 4NQXA 4P2RD 3GSNH 4C56A 4Y1AE 3C6LB 2ZSVA 4TSBH 2AABL 5E8DL 1G9NH 1QBLL 2CXGA 4LLMB 5FKPB 2UZIH 1I3UA 3WN5C 3K7UA 3WUWA 3SDCC 4ZS6D 1WCBA 4ONGH 5I1KL 1UJ3A 3QQ3A 2QJDA 3K4DA 1DQQB 1HHKB 4Y5VB 2P46B 3MBXL 4HXAH 3KPMA 4JO1L 4YEFA 1Q9LB 3HUJB 1KIRB 3C09C 5D1XA 1E28B 3HMWH 5DJYB 4MA3A 5D1QC 1CGXA 3OGCB 2HG5A 1ONQA 4KQ3H 4V1DE 2IGFL 1T22B 3TBSB 2NXYD 2XWTA 3PP3K 2P5EE 4QRPD 1SY6H 4JN2B 4APQC 1OOAA 3HAEH 3FQRA 1KCUH 3ZYIA 3DIFA 4WTWA 2A83B 3EKCA 5HJ3A 2GY7B 3M1BB 4ONFL 2B4CC 3QXAA 3V6OE 4JM4L 3MJ9L 3Q5TA 3D0VB 4YHML 2ZG2A 6CGTA 3BPLC 3BZ4A 3MLRL 4YBLC 3RJDA 1A7BA 3KPLA 1G9MH 4HS3A 1U91A 4MQ7B 1QP1A 1RZ8B 5AUMB 1WIPA 3CU7A 1IRAY 3OZ9L 3HS0B 4PJEF 1QYGH 4QHUA 3MXVL 1BEYH 3R0MA 1I8MB 1LEGB 5DK3A 3FB8A 4X98A 3PJSB 3D0LA 1LO4L 1OT2A 3QUZC 2HFGL 1DE4A 3RDTC 5EWIH 1AGBA 1LGVA 3GBLA 1GAFL 4YBQD 2YD4A 2VC2L 2IFGA 1F3JB 1JGDB 1L6ZA 2VABA 2Y5TB 4JFDE 4WW2B 1MRFL 2VL5B 1AGEB 4OF6A 3BJLA 1MFEL 2ZUSA 1MEXL 3QJFB 3SE8L 5DRNA 2R39A 3BPOB 1EAJA 3AS0A 3IDJA 5BV7H 4HZLB 4JZOA 3KXFD 1AHWA 1EJOH 5F89B 3T65B 5IOPA 4K23H 5IF0A 1W72H 4I13B 3N1GC 1HI6A 3FCTB 2HFFB 1YN7B 5JPNA 1CD8A 1DTUA 3OF6D 4OB5H 1WISA 3L5XL 2VLJE 4WHYH 4PJ9D 1TETH 3MFGB 3WBDA 4FZEL 3H9SB 3T3ME 4K7PL 2V6HA 3DUHA 1IC5H 3BIAX 5FXCH 2JJWA 5I1DB 2IANE 3MV01 4MQTB 1L7TL 4FQXC 4LVNC 5T1LA 4MB3A 4YFLF 4NJ9L 3T0VA 1VDGA 1BFTA 5ACZA 4TUJA 1KGCE 3OBAA 3KJ4B 2EICA 2CIIA 4M48L 4QRQA 2YMXL 2FH6A 3JTTA 4PREB 3RU8L 1U8QB 1P5UA 4PJIF 5F1NA 3S4SG 2Z31C 3BKMH 1FCCA 4UDTB 2WIIA 3N85H 4XCFH 4XWGL 2IQ9H 3DWTA 2YHGA 1OP9A 3C8DA 1CDYA 4N1HB 3QUKB 3RWDA 2J8UE 2CUIA 3V2AR 1EBPA 4Y16D 7FABL 1S5IL 5ANMA 1G9EA 2HJLB 4JFPB 2B5IC 1F3RB 3IXTA 3KYOB 3U9PL 4P3WA 1BF8A 2D7MA 1HZHL 3DNKA 3BVNB 4PJFE 5GGRY 4KK5C 3SDAC 1IT9H 2IAMB 3B9VA 3FHQA 4MDJA 1A3RH 2X10A 4BZ1L 5E70A 4RDQG 4XVSL 3L3GA 5DDHA 1P4LB 1AGCA 5TE6L 2NCMA 4V1DD 1BVZA 1SYSB 2A73A 5GZOD 1S9XA 2BVPB 1CBVH 4NT6B 2F5AL 3F7RA 3CXDL 2P5ED 4Z95H 3FO0L 3OPZL 4M6AA 1KULA 5C0FB 4L1DA 2XZQL 4JANB 1GYAA 2RGSA 3UZVB 1JGVL 2IPTL 2MPAH 3TIDA 2BSSA 5GSVA 5IFAH 3RTQD 3KYMA 4QGTA 3ISWA 4DGVH 2A0LC 3P77A 5IKCA 4LCCB 4I5BB 4RGND 3OX8B 3TV3H 4IRSA 4M6OH 3UMTA 3VFTB 3WHXB 2NYYD 1J8HA 1JGUL 1MHPH 4R4NC 5AZ2L 4P9ML 1U8IA 3U7WL 1XCTA 3UTOA 1SM3L 1RK1A 3I02B 1AR1C 4OCSH 1HHJA 1WVZA 4GW1B 4DOHE 2LTQB 3KLAB 1TZHA 1HHHA 5JUEH 4XMPL 2Y07H 3VXSA 4G8GE 4N0UE 4UDUA 1RZFH 4KJWD 5BO1H 4KHTH 2DBJA 3ARFC 2AEPH 3EDJA 3VJ6B 1CGSH 3KS0H 1G6VK 3NAAL 4M43L 3A6BH 5FA3B 4QYOA 4MJ6B 5HYFA 4JFQA 2XQBH 1QPPA 5ILTH 3SO3B 5IW6A 5ETUB 2V5RA 3RX8A 2HRLA 2BSTB 1AE6L 3CNKA 3GHBL 5LGJA 3MV9A 2YEZA 2UWEE 1A64A 5HYQB 5E2VH 5CWSB 4ONHB 4LKXA 1SYVB 4JO2L 1S7QB 3V5DB 3ZE2E 3OKYA 3VFVA 2DM2A 3UJJL 2CRZA 3HAEB 1T04A 3NH7L 1VCAA 3SBWA 1WF5A 2VLJD 1AXIB 5IMKA 4XVUD 4O02L 4WDIB 3HMXL 2F54A 2BY3A 4TUOA 3LY6A 1UM5L 4BSJA 4P23A 5K9JL 1EXUB 4Z8FH 2R8SH 2IAND 4S1QH 1BX2B 4MWFB 4U1HB 5GGUA 4PRAB 1DVFC 3KPNB 5K9OB 4YO0A 12E8H 3QUXA 1QOKA 3T1WA 4GG6B 5EU5B 1LEKB 1A14L 1UGNA 4OV6F 3UTTE 1HH9A 4JZJA 4LOUC 3EOBB 1QA9A 3QIBB 4NKMB 1U8JA 2DB8A 4NWUH 2ZCKL 2D4DA 3T4AB 4L3CA 1BQLH 4GRWE 2MMXA 3LV3A 5DA4A 2NXZC 5EDXA 3VRJA 1T20A 3MRMA 1IJ9A 5BV7B 3C5ZC 4NDMA 4MNGB 2F53B 3DV6B 5FO8A 2FL5A 3MOAH 2XZAH 1MIEL 2HJFA 1CZ8H 4N8VB 3TN0B 2G60H 5KVEL 1J1OL 4JO3L 4NHCL 2JK5A 1VENA 1GH7A 4JJ5B 2EYTB 3HHRB 4DZBA 5DUML 4GBXD 4ZTOL 5H8DA 3AMLA 3V7MA 2VDQH 2IPKA 4DN4H 2VMFA 4HC1A 4G5ZL 3V0WL 2CLRA 5INCB 1UADC 4NKOA 4R2GD 4G8FA 4LBEB 3O6FC 3BGFB 4JFOB 2GT9B 3CC5B 4ORGA 3UTPE 1NGYA 3TCLA 3DJ9A 4I0PA 1OGAE 5DD3L 4E0RB 3IJYB 5EFIA 4LGPB 5TH2A 1C5CH 4OCRL 3PWNA 4PJIE 4PGDA 1E6OL 4J3WA 3K2UL 5I16A 4X7CC 2ZZUT 3MRCA 4Y5XC 4JKMA 2EDFA 1OM3L 1NDMB 2AEQL 1P1ZA 4PJ8D 5D5ME 2CKNA 4K8RC 4PJBE 4LCYA 2V2TA 1AI1L 3ZT6A 1S7RA 4WENB 2Q7YB 4DJMA 3ROLB 2J1KA 2XWBB 3QWRA 1FVEA 1RUML 4XP1H 3CAFA 3VD5A 2H1PL 3FMGH 5JIKA 2ADFH 3RIFF 4M00A 3DI2B 5HHME 3UTSA 3ZTNH 3JWOH 1JHKL 3BEVB 2OTWB 3BT2L 3BUTA 1BJ1J 2A6IA 3L7EB 4HGMA 5HYJE 3EYFB 3BKYL 4GLRH 5C6WH 3UYRL 4POUB 2DKUA 5A1AA 1YN6B 4XH2B 4EXKA 5EB9A 4OI7A 2EC8A 5B3NA 1BJMA 3MJ6A 5B38B 5I1JH 1EEQA 1XGTB 5F88A 3ZHDA 1L0QA 1HSBA 5IV2A 5E5MB 1KACB 3TA3B 4QCIB 1BVKB 5J11C 4DK6A 3JV6B 4HS6A 1WTLA 4C83B 4JRXB 1V3JA 4PGJA 3HLAA 2ZUQC 3VWJB 2OTUA 3D3VA 3O4OB 5FGSA 3QUYD 3V4VL 4PRDA 1KSRA 4XCYB 4X9FA 5D2LE 3FFCE 4QRRA 1I9RH 3GMQA 2NY5C 4IBLT 1UKSA 3DMMD 2R2EA 4DEPC 3ARYA 1VESA 1KBGH 3VXMB 4EI5D 4TTDD 3GSRB 4PTTB 4DGIL 5I1AA 2HFEA 1OARH 3F58L 3EYSL 4QOKA 5C6TL 4MAYC 2LABA 5IGXH 4OLUL 5ISZE 5KSVA 1WZLA 2W0LA 1BAFL 3F7YA 2RFXB 4PY7A 1SJXA 2OX5A 3MRHA 4J4PC 1XR8B 3WSQL 5JPMB 2H2SC 5FYLE 5D7LB 3V0AC 3ULVC 3CLEH 3BH9A 2ADGB 3HNTH 3UZQA 1Q9WB 3QIWD 4Z77B 3BRFA 1TCRA 4CADA 5C6PB 1VACA 2SEBB 2VXQH 4M5YL 1HIMH 4MGXA 3UPAA 1Z9MA 3NIDE 3SQBA 1PFCA 3QHFL 3X11A 4YC2B 4ONOA 3UXFA 2OZ4L 4PRIE 1NLBH 1T2JA 5F7LB 4OLVH 2QSTA 4FQCH 1OAYL 3S37H 4FFYH 4C56E 2D03H 2IH3B 4H5SB 3QI9A 5IR1A 4HUUA 4RFNB 4YX2L 1CL7H 5H37H 3MRBA 1IGTB 2KZWA 1V3KA 3IFPA 5IMMA 4PUBH 5KJRH 3UTPD 5E2WH 1KT2B 1KN4L 3MBEC 4ZXBC 3ILPA 2FR4B 1OGAD 5JOPE 2CDFA 1INQA 1OD9A 1TZIA 1NAMB 3E6FB 1CK0H 1CICA 2B4CH 5TPWL 4ZD3L 3CZJA 1TENA 4FQIL 1TQCB 2NX5A 4RIRA 3NCJH 1IKFH 4K55A 4PJHB 1JZ7A 2QQKH 5E8PA 3P2TA 2OJZL 2ZP0T 4QXTA 5ALBL 4KU1A 1DZBA 1MLBA 5AYUL 2ICCA 4NZTL 2I60H 4CUCA 3FB7B 2EDHA 1ACYL 3LPWA 4HIHA 1OCWH 4OLXH 5SX4I 5SX5H 2DM4A 5H2BA 5DURD 3SPVB 3L5WB 3ARBA 1MHCB 3JTSA 5HI3D 5CEXA 5C07B 4MX7A 3VG9B 5DZOA 5HHMD 3G9AB 3QNXA 2JIXD 1GJIA 1N0LA 2R0KH 3RWHB 3SKNA 4NGHH 5LWYH 4A6YH 5HYJD 3GSUB 3LN4B 3LVEA 4RSVA 3E8UH 3RIFK 1D5MB 5E6IC 1Q94A 3SCMA 1I7UB 4NO2B 2DICA 4CMMA 5LKNA 1X5GA 3WS3B 2NY0B 3RIAF 3BGMB 1XR9B 4P59H 3TZVA 1Z0NA 3BDXA 4FQ1L 5MEND 2R69H 2GAZA 5DD6B 1U3JA 4X80L 2ESVB 3DROB 4U6HB 3WFBH 43CAB 1N5YL 1VPOH 1U41A 1JYWA 4YAQA 2WBJD 1PD6A 2ZCHL 4KRLB 4HK0A 5EORL 1MCDA 4YHLH 4HDIA 3U36B 3K8MA 3IKKA 3FFCD 4M1CD 1UQSB 4PJGA 3RWIB 1IC4L 3IU4L 4Y2DC 4MXVF 4P49A 5LGHL 4X7DC 4QO1A 5C0AB 4JHBA 1JNLH 5F96H 3G04B 1CE1L 4WGVB 5ISZD 1MI5B 5JQ6L 1P7KA 4R3SB 5MP6H 4B53A 1N59B 3NCYP 2NW2A 2ZUVA 1WJ3A 5DT1H 32C2A 5MEPB 5EOCL 4WGWB 4YHNA 2H6PB 1RUPH 2CIKA 4PV9B 3GMRB 3HCVA 4LNVA 3L3KA 4P5KA 3QDJA 3VFPA 2VR9A 2MKWA 3OL2A 1DQLL 1LO3L 2JJSC 3V6ZA 1WBZB 2VWEE 1IAKB 5EBMB 5I30H 1ZV5A 1G7PB 5EZJB 4PRID 2RQ8A 1RZ7H 1XGPB 3EGSB 4WI8A 4D9RE 4OZGB 3O45A 3K4AA 4C56D 1DSFL 3WIHH 3ULUL 2G9HA 1F2QA 1M71A 2ZNWA 4Q9CA 1RJLB 1IGJA 2XKNA 4WWKA 4L8SB 4LVOC 4X6EA 4TQEL 5IESH 2AK1L 1SQ2N 3IDYB 5MEOB 3MJGX 2PF6A 4J7RA 3SJVB 3QXUA 3FN0L 4IHOA 3GNMH 3MNWA 3P4OA 5C09B 3LKPA 5ANME 4YZFE 1ZMYA 3HR5A 4X6FB 4UTBL 5GGRA 4AL8L 1A6VL 1TJIH 1KLGB 4OLWL 1FNEA 2V17H 3MRFB 3SGEH 3LSOA 1RIVH 3TIEA 1FGVH 1CS6A 2BDNH 4WV1A 3PQYB 1UH3A 4CVXA 1F90H 1U3ZA 3BZEA 3FB6B 5CJQH 2ERJC 4Z7WB 3OHXB 5GRYA 3B9AA 4M4PA 3KHQA 4BQ6A 3HA0A 3WNMA 3TJEL 4P5TD 1UXWB 3PWPE 3RWCB 2DLHA 3RUGA 4PRNA 1A4JB 1LQSR 3S88H 4I4WA 4Z7UA 4H25A 4U1JB 3WN5B 4G7VH 1HYSD 2IH1B 5I1HH 4PG2A 1N26A 5FGRA 1FO0H 3VMOA 5JHDB 1R5WB 2FYYA 2XTJE 4G8IB 4QHLB 5GGVL 4ZUVA 3TP4A 4UQ2B 1JP5A 3U4BL 1PZ5A 1KNOA 5CEYA 4HKZB 2VKWA 4O2EA 3FQUA 1XGQB 3C09B 5J8OA 4W81A 5FO7A 1FPTH 3D2UA 3S3SA 5GHWH 5D1QB 3NIFE 3STZB 1CCZA 1MCBA 1WV7T 1KB5A 4KDTC 4ODSH 4RQQB 3P4NB 1HILB 5DEFA 5GRVK 4KHXL 4X99B 2PN5A 4LQ1A 3L7FA 5DJDA 4K2UL 1BZ7A 2P44B 4UT7H 4ZOCA 5B39B 5DJZA 2ICWB 4NNPH 4PB9H 3WFCL 4ENED 5DZLA 1KN2H 4MLIA 4OM0H 3VGGA 3EFFB 4FFZL 4OF5A 3WNLA 1PEZA 5IBLD 4TTGA 1EMTL 4P5MB 2DQEL 5DS8B 2IFFL 3BPLB 4YBLB 3DYPA 1GC1C 3G5VB 2BXYA 1J0HA 3WFDH 2Q3AA 4GUPA 4YDIH 3L9RA 3P4MB 5IB5A 1CFNB 2VXUH 4LLYA 1K6QH 1FC2D 3WJLA 5IJVB 3G08B 4KZEL 1NKRA 3L3OB 3PDDA 4G9FA 4HGWB 2CKBL 2HJKB 3T8XA 4PR5B 3QUZB 4JM2A 3ZTJH 2X4UA 2GSIB 1P2CA 3RDTB 3UC0L 2F54E 3KNBB 4XX1E 4WFEE 3N50A 3SY0B 5FHAH 4OZHA 3RX7A 4NHUA 1NANH 2VLKA 4DTGH 4Z7VE 1AO7B 4TSAL 4RMWA 4NKIH 3RHWK 2IPUG 3W0WB 1NC4A 1B0GA 2VDKL 4PTUA 2X9XA 3B4NA 1DQML 1P7QB 4JQXA 3N9GL 3DRQA 2C3XA 4OFKA 4YFDB 4KZDH 2OTPA 3MA9H 2F8VA 4D9RD 2JJVA 2WP3O 3IKCB 5CBAB 4GAJH 1VGEH 1VFUA 2IADA 4KUCD 3KR3H 3H0TA 1SBBA 2EH7L 2APFA 5FK9B 2QV2A 3OAUH 3S35H 1FORH 4NC1E 3CD4A 4F15C 2HT3D 3QT2A 2ADJB 4KAQL 1XF1A 4CJ0A 3MGOA 4C4KT 1NCAH 3MUGB 4M8VA 2IWGA 4UT9L 1TJHL 1QFUH 4RGMC 3P9WB 5D70H 4OD2A 5F9OL 4LVNB 1IC7H 2X7LA 3DX9B 4XRCA 5CJOL 5TQ2H 1WTGT 4HIIB 1YY8A 4H1LB 1CGTA 4RMVA 4Y4KC 1HH6B 5D71H 3PHQB 1YEDB 5EC1A 4NZUH 5E9DA 2VDML 1ZLVH 3VFMA 5LGKA 3PWPD 2GCYA 3LEXA 4OGAD 2EDWA 2DI7A 5DHVH 2YBRA 3IAGC 4DKFL 3L6FB 1PKQA 2BY0A 1YQ2A 4NKDA 4NUGH 4UBDD 1A9BA 2Y06L 3CCHA 2BNQB 5HI4C 4X8JB 2B5IB 4JG0L 5IB3B 4YHOH 4M7LH 3VU2A 4UV7L 2J4WH 4U1NB 4AEIL 3RVXC 3SDAB 5E0QA 4QXUH 4Y8AA 2YUVA 4D0CA 1B2WL 2ILLA 5F21B 3VMPA 4ELMA 2C5DC 3PWVB 3SDYH 5BOPA 1ZE3C 2D7TL 3BPCB 3JWDL 2DQGH 1ITCA 4Z9KB 3UBXG 4PJGF 3IDNA 4LAQH 4EZMA 2EDTA 5TE7L 3PP4L 4XNXL 3QNZA 1IM3A 1AKJA 2BVEA 4XPGL 1OAQL 2MJWA 1A3LH 1RVFH 4NUJA 4OKVB 4ZFFA 1FE8H 5J1AB 1YPZB 3IJSB 1XZ0B 4FQHA 3MX0A 5J3HD 3CZFB 5I74C 2D9CA 4OJFH 1UC6A 4KDVA 1N6UA 1S7WB 2PNDA 4LNRA 5D7SL 3ZO0A 3KPRA 3BE1H 1DLHA 2J6EA 3UTSE 3LDBC 2BNUB 5DR5H 1RHHA 2W9EH 2J88H 3TPUA 4HWNA 5C9JA 5KOMC 1KCVH 4M9OA 1A47A 4OGYL 2M26A 1LE9B 3W82A 3KLSA 2NY5H 5L2JB 4MNQE 3STLA 3WHE0 3W5NA 1DJSA 1OSPH 3WIIH 3JVGA 4KKBD 1OHQA 1RK0B 2OBGA 4Z7NF 4AK1A 3GMPB 1JYNA 4WFHE 5CD5D 4MHHI 2RAMA 2V9QA 5DD0L 4BUHA 3QFJA 2F54D 4KC3B 1U3HA 4WFED 1FFPA 5FECA 4P23D 1P84J 3D1MC 2CXKA 3MV8A 1FO0B 1FBIL 2FO4B 3OR7A 2A1WL 2CDEB 2YXMA 1N8ZB 4ZYKA 3NFNA 3ULVH 1SEBB 1ZEAL 1OB1B 2PW2A 4PJCB 4QRRE 1PYWB 2VDRH 1BGXH 3OV6A 3NA9H 4NJAH 5SWSB 4U6XB 2YPKA 3HNVL 1J86A 1BZ9A 4W4OC 4YLQT 3SKJL 1EHLL 4KV5F 1KPRB 2EXYD 2BC4B 4M8QB 3CFKA 2FB4H 3C60C 5J0BA 3QUMH 4QOKE 4AEHH 1ZHBA 2CUHA 3Q3GA 1HNGA 3V7AG 1JFQL 3WE6B 3CFEB 3MRDB 3DV4B 3MRIB 4H20H 4ODHH 1YDPB 5CLWA 4HSQA 4YNYA 3CLFH 4HPOL 3MOBH 1GZQB 5FO9A 5J1SC 2DD8L 4Z7UF 4UOW1 2WWKO 4K7PY 3V5HA 5E24E 1J0IA 1LP9B 5DSCB 1IKNA 1UJTA 1WEJH 3F5WA 1AXSB 4J8RB 3SGDI 5E2TH 3X13B 2NR6D 3MODH 4Z7OF 1TVBB 35C8L 4LPXA 5K9KB 5KZCD 5L2KD 1HEZB 2P5WA 5DJXB 4G6FD 4WTZA 3UYPA 5EUKB 5I1EL 1RZKH 2C7UB 2FGWH 5KAQG 2VDLH 3C2AL 3RX5A 1QLEL 1MCJA 2AJYH 3C6LA 3U9UB 4BYHA 1NEUA 2X70B 5F7HA 4LLMA 3U4EB 3O6LH 5E08L 5FKPA 3TBYB 1QLFB 1VFAB 3U83A 4XI5D 4OD3H 3LS5L 4M62H 4KJYA 3VFSB 3LRSB 4HJ0C 5HDOA 1DQQA 1E4KA 3UJTL 1HHKA 4Y5VA 4EJ1C 4XP6L 1ZLSH 1Q9LA 3G6AB 3HUJA 1AIFB 1KIRA 1MFAL 2VJXA 1CIDA 1IL1B 1E28A 1QZ1A 4N90E 3S4SB 3EJYD 2VXSL 5DJYA 1I9IH 2DDQH 5LAXB 3OGCA 1DANU 5HSFA 1JK8B 3H2WA 1T22A 3O6FB 3NCBB 2VO5A 4ODTH 3U7YL 4JN2A 4H8WL 4QHMB 4XWOD 4JM2F 2P43B 4MMXC 1NUFA 4QNPF 3BISA 4CAGA 5FYJE 1B0WA 5L88H 2A83A 4F7EB 3M1BA 4HJGB 4K9EC 4OZHF 1KEGL 5I15H 2FJGB 1HYRC 4Y5XB 4MNQD 4O9HL 4NWTH 2FX8L 3D0VA 5D6CB 3GI9H 1D9KC 2X42A 3P9MB 2ED7A 5DHVB 4MQ7A 1RZ8A 3MZGB 5AUMA 3D18B 4WIQA 2DQDL 2DIBA 3HS0A 1I8MA 1LEGA 2P49B 3MGTB 1BJ8A 3PJSA 4GXUN 4YQXL 1NL0L 1YEEL 1N7MH 4LSQH 4QRRD 4P3CH 4N0YH 1MIMH 4XBPB 4PS4H 1F3JA 1JGDA 2C1OB 2Y5TA 4BFIB 4M61B 3ZKMD 4WW2A 1LVEA 2VL5A 1AGEA 3EUUA 2WSKA 1JN6B 4O2CB 3SGKA 1U3YA 1F4XH 1UEMA 3QJFA 5C7XL 4XC3H 4HZLA 1GC1L 1F6LL 2ARJQ 4FQ2H 1C5BH 5F89A 3T65A 1OVZA 3RFZC 3I84A 2NY6C 5J11B 3BW9B 3RGVC 1Q1JH 2AXFB 4IMKC 3FCTA 2HFFA 1YN7A 1Q8MA 4MS8C 2ZPKL 5I8OH 1VGKB 2DKSA 3QDJE 5IBUG 5E8DH 2CR6A 1ZLUH 2BOBB 1P53A 2CPCA 3H9SA 3MXWL 4S10A 4N68A 3ARED 3SQOL 4DEPB 4HFUL 5I1DA 4L4TD 2HVJB 4I9WE 5TDNB 5DZNA 1U8LB 2CMRL 2L4OA 2NY7H 1OP5H 4K3EL 3MBXH 4PREA 4MAYB 3C87A 4ELMF 1U8QA 4AZ8A 5K33A 1IAOB 4WU7B 4KRPD 4JE4B 4UDTA 3I2CL 3BQUD 2RR3A 2AV1B 4HV8B 1MJ8L 3STBA 3QUKA 1D5ZB 2EDEA 1GOGA 3BHBB 1KFAH 1BM3L 3X12B 1CFVL 3CUPB 4JCLA 4KTEL 2YOCA 2HJLA 4JFPA 1H0DB 3QISA 43C9B 5C0RL 2GUOB 3KYOA 4MJ5B 3LIZH 3QUMB 3BVNA 2IAMA 5CAYB 5D7JB 2VUOA 1I8LA 4MLSA 3S96B 3MJ9H 4NO5B 4YHMH 4LSVH 4N90D 1UB5B 4O58H 1P4LA 4S1RH 4JB9H 2EE6A 4JO4L 3RUGE 2FIRT 2XT1B 1SYSA 2BVPA 4NT6A 4FZ8H 4X6DE 3RKDC 5C0EB 4LEOB 5FYLL 4GT7A 3MBEB 5C0FA 4XMLL 4ZXBB 2I9LB 4JANA 3FO2B 5EO1B 4HCRH 1INEH 4MHHG 5KVDL 2R0WL 5D4QA 3ROOB 2DLEA 5IQ7L 4PJ5D 4NZJA 5EO0B 4HF5H 2OMBA 5F7EL 3MO1B 4LCCA 4I5BA 3OX8A 4K07A 1PG7H 3OQ3B 3IXAB 4Q0XL 1F13A 3VFTA 1CLOL 4RX4A 3WHXA 1WAAE 4Q2ZB 3SGJC 4NQEB 4DKEH 3RL1B 3I02A 2W60B 1XEDA 1M7DB 2BMKB 4WO4C 2HLAB 4GW1A 3L5HA 3LAFA 3KLAA 5GRUL 5ID0B 4XCCL 5DJAA 1YEHH 2P1YA 4FQPA 4BH7B 1LO0H 3IYLW 3PL6D 3VJ6A 1HINH 4K7PX 4ZS6C 1BQHG 5FA3A 4MJ6A 5E6IB 1C5DB 4R7NB 4JRYB 5ETUA 1GZPB 3I3DA 1UKQA 2BSTA 4CMHB 1JZ5A 3CFCL 3QCVL 4G9FE 4LDLB 2QQLL 1ZK9A 4HUWB 3B8SA 1E4JA 5HYQA 5CWSA 4Z0BL 1JPTH 4ONHA 2YMXH 3O6KH 1SYVA 3RU8H 5F7YC 1S7QA 3V5DA 4IOSD 3WLWD 1OLLA 3HAEA 3SKOB 1MJUH 2R0ZH 4OZHE 4XWGH 1JHLL 2C3GA 2VLKE 2BCKB 1W0VB 4PJXB 4WDIA 3QEQD 5IIEB 4RMUA 2IALB 1G6RH 4NFDA 4EEEA 1EXUA 2JCCB 1BX2A 4LSPL 4MWFA 4OFYD 4U1HA 4I9WD 7FABH 4LSSH 4Y2DB 4ZO9A 1LHZA 5DHXB 4PRAA 1G1YA 3BD4A 3KPNA 3ZDYF 5K9OA 3U9PH 1HZHH 1ETZB 1J1PL 3QBTB 4NRZB 1XF5B 2ZWLT 5ENWB 4GG6A 5EU5A 3MPCA 1IC1A 1LEKA 4QTIH 3KS0J 3VCLB 2PUQT 3HUJF 1YQVL 3QIBA 3MCLH 1CLYL 4FOMA 4NKMA 1YC8A 1KCSL 1MFBL 1QHOA 4NCC2 3T4AA 5EA0L 1ODAA 3AS3A 1YYLL 3SO5A 1BP3B 4YJZL 5ACLA 4RFEB 1H3PL 2WLZA 1I1CA 3WJJC 4F80A 3C08L 4MSWB 5F7KC 1EIBA 4YBQC 4L4VE 5GQBA 2IPTH 4MNGA 2LU7A 2F53A 4R8WL 3DV6A 1Z5LB 4EOWH 4N8VA 3TN0A 5HI5D 3REWB 4JJ5A 1EUUA 1JTPA 5HGAB 2DLFL 2EYTA 1T1ZB 3WMSA 4LVOB 4GMSH 4RA3A 3U7WH 4HWBA 5TF0A 1Z9SA 5INCA 2B39A 4KTYA 2UVFA 4FFWD 3UDWA 1JRHL 1NGQH 3RY4A 1CFTB 4IMLB 4LBEA 3ZE1E 1BFVH 4JFOA 4XMPH 2YD7A 3EDFA 2GT9A 2X4SB 3CC5A 1ZT1B 4PJEB 1CXHA 3RPKA 1MRDL 4PJ9C 5GJSL 4E0RA 5JTWA 3IJYA 2O5ZH 1JI1A 2CQVA 4LMQE 2ERJB 4WW2F 5HHXH 1ZHLB 3GSVB 4LLDB 4F37F 5E5RB 2WZPD 2FHFA 1D6EB 1NDMA 1P4BL 1AE6H 5K59F 1FRGL 1FFQA 4Q9RH 5B8CC 3L5IA 4ZDHB 3WDJA 1G7HB 2Q7YA 1G84A 4FP8H 4CBPA 1FIGH 5HHQB 4JO2H 3ROLA 1B6DA 1Z3GH 2XWBA 3KPRE 5CSGA 1WFTA 3NH7H 1RULL 2VDOL 3D39B 5IMOB 1FG9C 3QHZL 1KTLB 2MSPA 5EULV 4NM8H 5D72H 4O02H 4Y16C 2V2XB 4MZ2A 3SOBL 4LQFH 5LQBH 2EZ0D 1KJVB 3BEVA 2OTWA 5GXBB 2P8PB 3E6HA 1K85A 3L7EA 4P2QE 3EYFA 4G9FD 3JWNC 2RHEA 1MCEA 3DHJA 3ZKSD 1UEYA 3OJMB 4LARL 1YN6A 4X7SL 4XH2A 1X5ZA 4C54A 1MFDL 3RBGA 4OCLC 1QSEB 4U1SB 5B38A 3PG2A 3QFJE 3MTRA 4GAYB 1XGTA 3CDGB 1RU9L 3MV8E 5E5MA 3TA3A 4QCIA 4L5FL 5GZOC 1WLHA 5HHPB 4RRPA 1IGCH 3EZJB 3JV6A 4LSTH 4JRXA 1A5FH 4C57C 3QDGB 4D8PB 1VHPA 5DTFB 3SKMB 5JOFB 3VWJA 4KK6D 4M5ZL 4POYA 4XP9L 4DGYL 3OKNB 4XCYA 1U92B 4AG4L 3RTQC 1FNGB 1AD9B 5EUOB 3VXMA 1H3UA 3LQMA 4H88L 3FT2B 3GSRA 4PTTA 3CFIC 4RGNC 3UJIL 5KVEH 4KI5E 1KV3A 3INUL 2NYYC 1BIHA 4RAUB 4ZTOH 2WWMD 1FYTB 3QNYB 2NY3D 4MXQD 1C08B 4WWID 2RFXA 1Q38A 3GM8A 5AZEL 5C08B 2Q20A 1XR8A 4LLUB 5JPMA 4O00A 5D7LA 5DD1L 2ADGA 3B2UD 4KJWC 5GS0L 3NIGE 1Q9WA 4Z77A 2FEEL 2FATH 3NCMA 4L4VD 4O51B 2SEBA 1XF2B 1NCWH 2PYEB 2LU3A 2EXWD 1ED3B 2XG4A 2P4AB 4LSUL 2P5WE 5FYJU 4OIIL 1I1FB 4MD0B 1T21B 5SX4H 3O6MH 2NLJB 1NQBA 2EE9A 1LNUB 3S37X 4AY0A 4HBCH 2I5YH 2IH3A 3BFOA 3PIQB 4H5SA 3WKMH 4OFPA 4F15B 4WI5A 1OM3H 4WEUD 1D6VL 4DN3L 1YEKH 5TJWK 5IHZB 4D3CL 1F4YL 4P4KB 1G6RB 1IGTA 3GO1L 4HK3N 5IWLA 3ZYZA 4HUKB 4RGMB 5F9AC 1KT2A 4NQDB 2FR4A 5DYOB 1RUMH 2Q1EA 4XVUC 5GS1C 5ADPH 1BD2E 4ZFGH 1G7LB 3MLTB 4Y4FD 4PY8J 4Y4KB 3CVIH 1D5XB 1A0QH 1NAMA 3BMWA 3E6FA 3HUJE 3B2VL 1I3GH 3REVB 5B3JF 3LKOB 5FB8B 5SWZB 4I3RL 1CI5A 1OY3B 2QQNH 3BKYH 3IFNL 4PJHA 1S9WB 5BXFB 4IRJD 4BFEA 1R0AH 3RI5F 4FNLL 1T7XA 2FLRT 1RIHL 1ZHNB 3BEWB 3FB7A 5JR1H 1FGNL 2YPLD 4M9PA 2A9MH 3VD3A 2AJUL 4N1EA 3SPVA 3L5WA 1MHCA 3SKUD 5C07A 4ZNCD 3D9AL 5IVXB 1R3KB 3EBAA 3LKNB 3AB0C 5GGVY 3RWHA 1RMFH 3FHAA 4P2QD 3GSUA 3LN4A 3BKCH 5F7WC 4OZFH 2B2XH 1D5MA 2IC2A 3V52H 4L29B 4HC1L 3CVHB 5DXWA 5J56B 1I7UA 4XGZB 2OL3L 4NO2A 4L1HA 2APWA 3WS3A 3QFJD 4GBXC 4O2FB 4DGIH 3BGMA 1XR9A 3MV8D 1FL3B 2VR5A 4O4YL 4R26L 4TVPE 3GMMB 5DD6A 3VA2C 1KXQE 5I74B 4JGUA 2ESVA 1NFDF 4U6TA 4XPHH 3DROA 1DEEB 4U6HA 1CWVA 2DL2A 43CAA 4NPYB 1DBMH 1A1NB 4R6UA 3HRZB 3GSQB 3LDBB 1A8JH 1WGOA 3U36A 3GJEB 2OP4L 3QWQB 3H3KA 1UQSA 1T5XB 1GIGL 4K94L 4JKKA 5K59E 3RWIA 2KBGA 4HX1B 1I3VA 4OSUH 5J1TC 4IIQC 4B0MM 4KI5D 1G7QB 5IMLB 3OAZH 1JJUA 4UNTA 1O0VA 5C0AA 1HCFX 5JHLL 4I8DA 4OI9A 2WAHA 4UU9B 3FOLB 1MI5A 5I8CB 2EDBA 5F72S 4PJ8C 4JGJA 4R3SA 3HC3H 1N59A 2QSCL 1A7QL 2X4NB 4CGTA 3SE4C 4HIJB 1MRCL 4PGBB 3KLHD 5MEPA 2PO6D 2XN9E 4YX2H 2H6PA 4PV9A 2Z8SA 3GMRA 2VLRE 5DWUH 4GMTH 5HVWA 5ADOL 4NOBA 1DFBH 1V7ML 1WBZA 2MWCA 1IAKA 1ROWA 5EBMA 3CK0L 4YHPB 1MVUB 1G7PA 2NMSA 5EZJA 2R2BB 3C60B 1T5WB 3SEPA 1XGPA 3EGSA 1FZKB 1QSVA 4OZGA 3ETBF 5TPWH 4ZD3H 1ZT7B 3WFHB 4FQIH 4UB0H 1RJLA 2DAVA 4I2XE 1TVDA 3NACH 4L8SA 5E99L 4LASH 3SDDC 3WNPA 5AYUH 5MEOA 3OAYK 3LH2H 3F8UB 3SJVA 4ZS7L 5I66B 5C09A 4X83A 1BD2D 4X6FA 4OM1L 1F6AB 4P48A 1KLGA 3MRFA 1RY7B 1HWGB 1JNNH 4PYGA 3PQYA 4ZUSB 1OQXA 2DQHL 2EH8L 3H7BB 1INDL 5EOTB 4EDXB 4EI5C 3FB6A 3RAJH 4Z7WA 1IAMA 1QFWI 3OHXA 4X5XB 3JV5A 4ZFOB 4OBRA 1DBJL 1UH2A 3HI1B 1MCLA 3ZT7A 1WBYB 3HNSL 2E6QA 1UXWA 3RWCA 3ESVF 1A4JA 4DK3A 4U1JA 2KKQA 5IW3A 3WN5A 3ZKXC 5DVMA 5T3XL 4OIAA 4G6JH 2IH1A 1WWWX 4BFGA 3VD4A 2K7QA 5C0BB 4U2YA 5DRXB 5JHDA 2ZCHH 3QIWC 1R5WA 4OCMC 1DQDL 5EORH 2X2YA 4G8IA 2AJVL 4QHLA 4JFHE 4UQ2A 4L8DB 3U46B 3FZUD 4RBPH 4HKZA 1XGQA 3Q48A 1BVLB 1AY1L 2Z0BA 5D1QA 1PX3A 2XA8H 5LGHH 3STZA 4D9LH 4Q97A 4NQCE 1EK3A 3T09A 4RQQA 3AM8C 1QFWM 2YC1B 3P4NA 2XIDA 1HILA 3LS4L 5JQ6H 4JLRB 4X99A 2XZCL 3L5JA 1CE6B 3T0XA 4Z0XB 2ATPB 1J0ZA 5B39A 4ZAKC 4HKXB 2ICWA 3GIZL 5B3JE 5KVGL 4OZIE 3EFFA 5GS2D 4TNWF 3BX7C 1A7OH 3BYYA 1NCCH 3T4YB 1FJ1B 4NO0B 4P5MA 1Q0XL 5DS8A 3RWEB 1LO3H 2X89A 2XFXB 3G5VA 1D9KB 2BVQB 1F4WH 4HUXB 1MFCL 1GCFA 3UBXB 1UA6L 5KOVC 3TWCH 4UV4L 3P4MA 1CFNA 4X9GA 2GK2A 5IJVA 4W6XB 3G08A 4S1SL 4UT6H 1G1CA 3L3OA 1KCLA 2HJKA 2EECA 4HGWA 1NMBL 2P7TB 4L8BB 3H42L 2OR8A 4PR5A 3CFJB 3QUZA 1L0YA 3E3QE 2GSIA 2XN9D 3QP3A 3RDTA 3KNBA 1YYML 3GMLB 2VLRD 3PV7A 2YXFA 2DQTL 3SY0A 4YXKH 3F62A 3TYGH 5FYJL 1AO7A 3DETD 4KVNH 5HI3C 5I18L 1PY9A 3W0WA 4QRTB 1MAML 1UWXH 4XPFL 2YUXA 1P7QA 2R23B 4BSWB 3ORJA 2DLTA 3IKCA 5CBAA 5A3ID 3MLUH 4GG6E 4LIQH 5I19L 4FMFA 3QFDB 3VXRB 1OP5K 2NY6B 3O8XD 2E27H 4NNXB 5FK9A 1YEGL 2ADIB 3RGVB 5JA8B 3FFDB 2FJFB 1IGFH 4YEEA 4WCYH 4PJHF 3VG0L 2ADJA 4WI6A 1J1XH 3MUGA 4F2MB 2JB5L 2WBJC 3QIUD 3KJ6H 5KSUB 1J88A 1MJ7L 1BOYA 1OAUL 1XCQB 4MNGE 2F53E 2H26B 3DX9A 4ALAL 1S9VA 4M1CC 3FT3B 4HIIA 5I0ZA 4H1LA 1DBKL 1FNSL 1JHTB 3W5MA 1HH6A 5FCUH 4UIMB 2NZIA 3PHQA 1YEDA 1GSMA 1AQKL 4LCIH 5T5NF 2DL9A 4YE4H 3QQNA 5KTEH 2LQRA 3K4ZA 1MJJB 1UVQB 2CO7B 5D7KE 3KPOB 4YDVB 3DPBA 2DYPD 4MMZC 4XNYH 4CN1A 3BN9C 2HKFH 3L6FA 4W6WB 4K3HA 3HR6A 1T6VN 4ZQKB 2BNQA 4X4MA 3O11B 3M8OL 4X8JA 2J5LB 5K93A 5IB3A 3MOQA 4PJDB 1RUQH 4JFHD 4PG9B 5DK2B 1AXTH 5F3HB 4U1NA 3SDAA 2FBJL 2DM7A 4RX4D 1T6WA 3QXTA 3PWVA 4FFZH 5C3LD 5J9PB 5MI0C 3BPCA 3QG7H 2IFFH 3KLDA 2VE6B 3TT1H 3RGHA 1MSPA 2IG2L 4NQCD 3RJQB 2CSPA 1EVUA 1ZOXA 1Y6MR 3HI6L 4OKVA 4KZEH 2F74B 2V5MA 5J1AA 1KPVB 1YPZA 2B0SH 3IJSA 1XZ0A 3MNVB 4WU5B 5KVMC 3DECA 4Q9QL 1MCOH 3CZFA 3DURB 1I4FB 1FVDB 5HDQL 1ORQB 1NBVL 1S8DB 2Q8AH 1S7WA 4MJIB 3ES6B 4WEBL 5FGCB 3TCXA 5JIIA 5DJ2B 2BNUA 4GAFB 5C0JB 4IRZH 2R29H 3BP4B 4NQVB 1EFXD 2OL3B 3ALPA 1LE9A 5L2JA 1DQMH 2EO9A 1AD0B 3K1DA 4HJJL 2AXJA 2YD2A 4WO4B 4RCAA 4GS7C 1RK0A 1RUAH 1D7FA 3GMPA 4P2RB 5FM8A 5BMFH 5BRZB 5IFJB 2EH7H 1YY9D 2EIDA 4OZGF 5K9QI 4I3GA 2I24N 4P5TC 1EEYB 3NGBC 3EOTH 3SGDH 3WXWH 1FO0A 3DX7B 1JUFB 4KAQH 3HZYB 2FO4A 2CDEA 3UEZA 1N8ZA 4LGRB 1HYSC 5EO9B 1SEBA 5F9DC 4PJCA 1OB1A 4G6ML 5TDPB 1T7ZA 1PYWA 1TJHH 4LRNH 5SWSA 4U6XA 5DQDL 4C55A 1II4E 3BSZL 1MCSA 3BKJH 3BUYB 3VXME 5F9OH 1SBSH 2A9NH 2W07A 4LPTA 1KPRA 3BPNC 5CJOH 2BC4A 4M8QA 1RJYB 5MERB 1B9ZA 1KB5L 3AC0A 2CDGB 2VUYA 2VISB 4YDKH 3GHEL 3LD8C 3QIBD 4R90L 3V5KB 3PABB 3QEUB 5F71A 3WE6A 3MCKB 3KPPB 3CFEA 3MRDA 2BERA 1OPGH 3MRIA 4XX1G 4K71C 1YDPA 3X3FL 3HE6D 1B4JL 4QRPB 1EHNA 4XMKL 4E42B 3EDDA 4DKFH 3LMJL 5DGRA 3VDCA 4HQQL 1GZQA 3SE9L 3TN0D 3ZYOA 4ENEC 3TFKD 2XRAH 1LP9A 5DSCA 1CF8L 1MCPL 3UCRA 4UV7H 1AXSA 4J8RA 5IBLC 1RZJL 1HHIB 1QFPA 1TVBA 5ICYB 1EEUA 5K9KA 2Y7QB 1HEZA 4FFVD 2VOTA 5DJXA 3JWDH 1U8KB 3P30L 5D7KD 1T1YB 5EUKA 2C7UA 2COQA 1FH5L 4Y19D 4XPGH 3U9UA 3EYQD 5BW7C 5AAWA 2X70A 3U4EA 5IVZB 5IBUB 2VQUA 4DKAA 3TBYA 1QLFA 5EU3B 5DUBB 2P47B 1R6VA 4MAUL 3VFSA 1S7TB 4GW5B 3JSSA 3LRSA 2JJTC 4I18C 2VWEC 1C7TA 2KQMA 3U0TB 2AI0L 4PJHE 2G5BB 3G6AA 3MLZH 3KXFB 1AIFA 4F7TB 5EPMA 1FV1B 1IL1A 4Y4HD 5BZWB 1DN2A 4HT1L 5DA0B 5LAXA 4ERSL 2GJJA 5DJ6B 4RZCB 1JK8A 3JXAA 1DN0B 3O6FA 4PJ7F 2HT3C 1JZ8A 4LLWB 5C07E 4XBEL 1C1EL 1SJVA 4QHMA 3O3DB 4PJ9B 2V5SA 4YK4B 1AH1A 1R3IH 4F7EA 4F58L 2KUTA 2R9HD 4HJGA 1ZEAH 2FJGA 4EN3C 3RVWD 1FYHB 4Y5XA 5IBTL 3DSFL 1CG9B 1AC6A 1IM9B 2GJ6D 3BP6B 5D6CA 3JUYA 4HWEH 1CXLA 5CGTA 1EHLH 5CSZB 2ZUWA 4HAFA 3P9MA 5B8CB 4M3KB 5DHVA 3TA3D 5DQJB 1K4CB 3D18A 4G7YL 3ARDB 4KMTL 5L9DL 4WY7L 2IEPA 3MGAA 3MGTA 3VWJD 4OGAC 2BFVL 1HKLL 3WNNA 4DAGL 4QHNB 5KSAD 4UBDC 1NMCC 1FAIL 4M7KL 4Y16B 4M1DL 1HKFA 1JE6A 2OMNA 4XBPA 4HPOH 2C1OA 4BFIA 1OAKL 4M61A 3GMNB 4JPWL 3UYOD 3PXJA 5TE4L 5HHVL 2X9WA 1MCFA 1JN6A 4O2CA 2VERN 2DLIA 1G9NC 1P6AB 5ESVB 3X3GL 4UINL 1XGYL 2VH5L 4KQ4H 4XP4H 5EU7E 35C8H 2A38A 5E4EB 3HKFA 4MCYB 4V1DB 3BW9A 2F58H 2AXFA 3ZKQD 2P5EB 2CH8A 1JF1B 3C2AH 1KELH 1VGKA 1ZHKB 5T1DL 4XNZC 1MCIA 2DLGA 4R97C 2A6KB 4L3AA 2ZUTA 2BOBA 3ZE0F 5E08H 4F7CB 4X9IA 1BQHB 2V5TA 3G5YB 4F57L 4JDZB 3RTQB 2WUCL 3T3PF 1H3VA 4ISVB 2HVJA 1QHPA 5TDNA 4B5EA 4RGNB 3ZKND 4MZ3A 1U8LA 1PGRB 4KI1A 1TZGL 1CU4H 1I8IB 3H8NA 5I71C 4MAYA 3NFSL 1UG9A 5C70A 2E8ZA 4GO6B 1IAOA 2ZJSH 5KANI 4WU7A 3LB6D 2YD1A 3GSWB 4KKBC 3VH8G 3SBWC 3VFUB 4J4PA 3SJVE 5CD5C 2HKHH 2AV1A 4HV8A 1GGBL 5EZLB 4LHUD 1WZ1H 1FAKT 2PYFB 1D5ZA 4PLKD 3CDCA 5HTSA 2DWEB 1IFHL 1VFOA 1YPZF 3BHBA 4R9HA 4GQ9L 4JHAH 4GRWH 4LRIA 2ZOLB 4RFOL 3X12A 3CUPA 5J12C 4JPKL 1H0DA 43C9A 2GUOA 3GRWH 3PQYE 2VDNL 4MJ5A 3QUMA 2MCPL 4G6KL 4XCEB 1CXKA 1KTKE 1NH6A 1K5NB 4Z7WE 2O5XH 2EXYC 5D7JA 4KFZC 2R4SL 3S96A 4O9HH 2FX8H 1EUTA 2CGRH 4NN7C 4NO5A 5TFSL 5L8LB 1UB5A 3FTGB 4NQSB 2HLFD 5F6HI 1CDBA 1QR4A 1NCBL 3SE3C 2FWOB 3ARGC 1EEZB 4JKPL 2AERT 1RZGB 5F8RC 5C0EA 1X4YA 4LEOA 5IB2B 2VLJB 4YXLH 3MBEA 4ZXBA 2I9LA 3O3BB 3FO2A 3VFOB 4W4NA 1JPST 5TGBB 5EO1A 5JHDE 4JDTH 5K9QG 2P8LB 1MF2L 2WW8A 4S11A 3KYKH 2IANB 3ROOA 3QDMB 5EO0A 2DTSA 1AC0A 3QPQD 4KTDH 2E5EA 3MO1A 1GOFA 2Q8BL 4PJCF 1S3KH 2W59A 3VI3F 3QCTL 3GSOB 4M1GH 3IXAA 1PG7X 2NR6C 2ZKHH 4F33B 1I85A 1BQUA 2VZ1A 4Q2ZA 1DQTA 4NQEA 4KKCD 3RL1A 2YN5A 2W60A 5JORB 1M7DA 4K7FB 2BMKA 5CJXC 2HLAA 2E7MA 1XIWD 3L1OL 2X1WL 5HY9B 5ID0A 3G6JE 4NFCA 2J8UB 1MOEA 5L6YH 3VFGL 4BH7A 3EYOB 5BCAA 2V9TA 3B83A 2IQAB 1JGLH 4N0CD 3AB0B 4XI5C 2DQIL 3GKWH 3MRNB 3IDXH 4WTXA 1CTNA 2BRRH 4TN9A 5INDB 3DO7B 5E6IA 4EUPG 4LFHD 2W9DL 1C5DA 1KJ3L 2DIJA 4R7NA 4JRYA 1GZPA 3EAKA 4H0IA 3CIQA 4AQ1B 3FONB 2X40A 5KS9E 5F7NC 4GBXB 3OAZK 4KK8D 4OI8A 3R1GL 3GJFK 2CMRH 4P4RB 5FUCE 4HUWA 5T5FL 1OWWA 2W0PA 2X4PB 2NY4B 3BWAB 4TRPL 3EJYC 2QHRL 3SKOA 3IF1B 1F8TL 4LMQI 1A22B 2BCKA 4U6VH 5DD5L 1W0VA 4Z7QF 4PJXA 1AO7E 5IIEA 3W0WE 3TVMD 2IALA 4PJAF 1OTTD 4KROD 4XWOC 3VI4F 3L95B 3QRGH 3T0DA 5FGBC 4PRPE 2JCCA 5IT2H 4KTEH 4Y2DA 1T66D 4QWWD 2J8HA 1TPXC 4IIQB 2E7LC 1PSKL 4OAWB 5C0RH 2ZCLH 1EPFA 4P57B 5L7XL 1ETZA 1RZIB 2EDRA 4NRZA 4OLEA 4YFEA 3W9EB 2XPGB 4LGSB 1XF5A 5ENWA 4PJ8B 4ETQB 5I75C 3S36H 4OTXH 5EZIH 1TXKA 3VCLA 4TVPL 3F12B 2AP2A 2RB8A 5DQ9B 1A7NL 4N0UB 4JO4H 3I6GB 4WI9A 2J7LA 4IJ3C 1A6ZB 3B5HA 1UZ6F 3S98A 4RFEA 2KDGA 5FYLH 1KLUB 4JQVC 5GPRA 2JJSA 4MSWA 4N8PA 4YHIB 2VN7A 1B90A 5D1ZD 2WLYA 1JV5B 3PQYD 5KVFL 4Y7MA 1YJDL 3VFWB 4XC1L 4GQPH 3HTLX 2R0WH 3PDOB 3ZKMC 1Z5LA 5EZOH 1AFVL 4ZUTB 4PGCB 5DVLA 3HC4H 3REWA 8FABB 4FXGB 2ZUXA 2EO1A 5CP3H 5HGAA 4A2MA 1NLDH 1T1ZA 3V0VB 1EHXA 4CVZB 1YMHB 5T33H 3SDDB 4TPRL 1QRNE 3L3JB 5DGQA 2F8XC 4RWYL 2DTML 3THMH 3ZE0E 1EGJL 4RDQF 5GISH 3NPSB 4NP4L 3V4PL 5ERWB 4B41A 1CLZH 4X4ME 5GRUH 1CFTA 4IMLA 3QO0B 1F97A 4XNUL 1TNMA 1JF6A 2X4SA 4PJEA 1ZT1A 4PRBB 4TNVF 5F44A 4Q74A 1GPOL 3AUVA 3PWUB 5TQ0L 1FQ9C 3N1PC 2YPVL 4O5LL 4X9HA 2L7JA 2E9BA 4PGZA 1YMMB 1U6AH 3RVTC 3CSGA 3AREC 4ZTPL 4JPVL 4EI5B 5F9JB 1YA5A 4M6MH 1VSCA 2Y36H 1YEIH 1ZHLA 3GSVA 3EDEA 4LLDA 4AMKL 2CK2A 1D6EA 3BMVA 3L3HB 4HD9A 2OR9L 4ZDHA 1J0KA 1G7HA 4KRPC 2YWZA 3ZKXB 5I2IB 3BQUC 4URTB 4XBGB 5HHQA 1MAKA 1MVFA 2C4FU 2B1HL 4HFWA 4AYFA 1NCDL 4GRMB 1L7IH 1U42A 3D39A 3QIWB 5IMOA 1LO2L 1SJHB 2A77L 5FFLA 1KTLA 1V7NH 2V2XA 4XVTL 5H37G 1KJVA 4GKZB 2FDBP 5C8JB 1BBDL 2P8PA 2FX9L 5HHOE 4PV8B 2MKLC 4GH7B 2UYLB 3U1SL 4FQLL 25C8L 2A74B 2BZDA 1BREA 4YUEL 4KDTA 3U6RB 1KC5H 5SWQB 3VXUE 5GIRB 1QSEA 4U1SA 5CINH 1I3RB 2PXYD 4GAYA 5EIVA 4KY1H 3CDGA 1NUNB 4JY6B 4PLOB 4RGOH 4YBHA 3TBVB 3TGXA 4F9LC 4HCRA 5HHPA 3PGFL 3MUZ1 5CMAB 1S7UB 4ZAKB 1AO7D 1CR9H 3IU3A 3QDGA 4WUUB 4D8PA 5DTFA 3SKMA 1KIPB 5JOFA 5I1CL 3MLVL 1KCSH 1MFBH 1A6WH 1KEMH 4OF7A 3VI3E 1W0WB 4XAWH 3TT3H 4CW1B 1TQBC 4PRPD 3ULVF 3OKNA 3MRQB 1H3PH 3T2NH 2N7AA 1UWXK 1OGTB 3V4UH 3HE7D 1U92A 5LXGL 1FNGA 1T80A 1AD9A 5EUOA 1Y0LB 1WWBX 1QKZH 4TVSa 5KG9B 3FT2A 4L8CB 3TO4D 4TSBL 2DIAA 1G9NL 4PJBB 5C3TA 5ACMA 5IHUH 3N06B 1CQKA 1RUKH 2UZIL 2DLFH 2AGJH 4RAUA 4HGKC 4U4BA 3O0RL 4XB7A 1OT1A 1FYTA 5IB1B 3QNYA 4ZFZB 4ONGL 4F8TA 1A6TB 4CU7A 1C08A 1JPSH 5CZXC 3ARZA 4TULH 5EIQA 5C08A 4LLUA 3C6SB 4M7JH 2XKUA 5CZVH 4HXAL 5E95B 4P2OD 1LP9E 1UM4L 3PL6C 2BNRB 4NN6C 2JIXB 2D9QB 3LOWA 4O51A 1XF2A 2BOCB 2PYEA 1KENH 5HYJB 3F7QA 3S5LB 1BWMA 1NDGB 5I1GL 5EBWB 1ED3A 2V9RA 1SMAA 1KIQB 4KQ3L 1GGCH 5IFHH 4MD0A 3N1FC 1T21A 2NLJA 1H3TA 4MA7H 1A7RH 1LNUA 1HWHB 1SY6L 1QRND 3CX2A 4WFFE 4Z7QE 3KPSD 3PIQA 3GEWB 4KKAD 3JWOC 5HXMA 5MENB 5JXED 1KCUL 3VI4E 2JB6B 5IHZA 1FRGH 3JV4B 2YD5A 1N2RB 4P4KA 2ED8A 5IQ9B 1G6RA 1WZMA 3WLWC 1NBYB 2NNAB 2WBJB 2BJMH 3A67H 4NFBA 4NQDA 5EU6E 5DYOA 1XF3B 1Y6KR 4HXBL 1RULH 3FFCB 4UNUA 1G9ML 4JJHA 4HMCA 4GXVL 1YUHB 3QHZH 2R0LH 1G7LA 1MQKL 3MLTA 4LPVA 4Y4KA 1D5XA 1EJ6A 1K9TA 4LEXL 4CU6A 3QEHA 1QYGL 3REVA 1BEYL 2AEWA 2Q6WB 3LKOA 4ZPVB 5FB8A 5SWZA 1WT5C 4J3SA 1S9WA 4XPBH 4M6NL 5BXFA 5EWIL 4OV5B 1N4XH 1ZHNA 3BEWA 3P0VL 1DCLA 2FHCA 4GW4B 3T77B 4L5FH 5BV7L 3MACH 3OKMB 3S3JA 4S2SB 2OK0L 5IVXA 3OR6B 2GTWB 1R3KA 4PJXF 1EJOL 3LKNA 4XP9H 4K23L 5HHOD 1AR1D 1W72L 4PRIB 1H3GA 1XGUB 5FA4B 5GZND 1VEMA 3QPXH 2JCCF 5HI5C 2CJUH 4L29A 3CVHA 4HWBL 5JOEA 4XGZA 3VXUD 4H88H 4OLYH 3QR2A 4OB5L 5JXAL 4O2FA 4N0FB 3T2OA 3RPIB 4PGEB 3RWJB 1FL3A 1I7TB 3GMMA 5ITFB 1IC5L 2VRAA 1R5VB 1DEEA 3VFRB 4NPYA 1OQOA 1A1NA 5BJTB 1BF2A 3TNNB 3HRZA 3GSQA 2R2CA 2ZSWB 3ZL4H 1UXSB 3BESR 3GJEA 4PRHE 2YZ1A 3RY6C 1YNTB 1I7ZB 1T5XA 1VEPA 4RAHA 2DBLH 3QG6B 3BKML 4HX1A 3N85L 4XCFL 1T0NB 2IQ9L 4KVCH 1UCBH 4UZGA 1G7QA 4LSUH 4GS7B 1JZ2A 3GI8H 4UU9A 3FOLA 5I8CA 4YHYC 4P5TB 1QR1B 2DKMA 3LN9A 3NCCB 2X4NA 4FTVD 5D7IE 1B0RB 4HIJA 5F7FA 2NW3B 3WCYA 4PGBA 3W11C 4DN3H 1T1XB 4HW6A 4AT6B 1EO5A 1IT9L 5CGYD 3Q1SH 3ULUD 1QFWH 2WM0A 4WI2A 4MYWB 2OLDA 2GEEA 1XF4B 3MSPA 4W4OA 4F7MB 3BPNB 4YHPA 1MVUA 1F02I 3C60A 1OAZH 2FGZA 2HA1A 1T5WA 2R2BA 5AD0B 4E41E 3LQAC 3LD8B 4Z95L 1FZKA 3F7VB 2AK4B 4WFFD 1ZT7A 3WFHA 3WFEL 3HZVB 4N9OB 4XCNB 1C16B 3TESA 1K2DB 4NC2B 4EI6B 1EVTC 4K71B 4HUMB 2MPAL 3RWFB 3NABH 3ULVE 4FNLH 5IFAL 5JNYB 3WNKA 4DGVL 1QG3A 2VABB 5I66A 3VMNA 5SV3A 1FGNH 5EU6D 3TV3L 4JZNB 4M6OL 1F6AA 1MHPL 1UZ8B 3O4LB 3ZTJG 3CSPA 2PR4H 1FLRL 2VNCA 3D9AH 2FHBA 3ZDZF 4OCSL 1A21A 1T4KB 5E2UL 2NY2D 2FBOJ 4ZUSA 5JUEL 1MHEB 1HQ4B 3H7BA 2RCSH 5EOTA 4EDXA 2Y07L 2Q3ZA 4X5XA 4ZFOA 1RZFL 5BO1L 3LRHA 3ZDXF 2AEPL 3HI1A 1WBYA 5JW3H 4LVHC 1CGSL 4YWGH 1DQJB 4H26A 3A6BL 2NY3C 4S0TD 3DARA 4MXQC 5D96C 1OW0A 2K9UA 1HK6A 2XQBL 1MCQA 1FDLH 3CMOH 1UWEL 5C0BA 5DI8B 4F3FB 3RZCA 3B2UC 3B9EA 5A40E 1S7VB 4I18B 2PTVA 4Y89A 2EE3A 4JEGB 3ALXA 3HFMH 4Y1AD 4L8DA 4BM7A 3U46A 2OP4H 4JCMA 1ZT4B 4K94H 4JAMB 4U1GC 3T2PA 1BVLA 4NQEE 5HGDB 4P46B 5EUOF 1RHFA 1ZTXL 3VRIA 5KSBE 3BD5A 3ME0A 2ITDB 2YC1A 1QVOB 4KJPD 4JLRA 1X5IA 1KTRL 1CE6A 4X5LA 4Z0XA 4HIEB 2QSCH 2ATPA 4ODBD 1CYGA 1WWAX 4MDIB 12E8L 4HKXA 4OD1L 2EDNA 4PRHD 1DUYB 3I85A 1MCRA 4EN3B 4N5ED 1NAML 4G80B 4QT5B 2YSSB 3EO9H 9CGTA 3QEGH 1IGIL 3T4YA 1FJ1A 4NO0A 4ZNEA 3RWEA 5ADOH 4Y4FC 5MEQA 1D9KA 2BVQA 4HUXA 3UBXA 4M4RA 3QJHB 5BZDB 3LHPH 4NWUL 1BQLL 3HZKB 3UO1H 1GGIH 4JVPA 4IRJC 3PWPB 3QQ9D 4B50A 2P7TA 4L8BA 1NMCB 3ZLQC 3J8F7 3GMLA 3MOAL 2XZAL 1MCCA 4JN1H 4JFEB 3QXWA 2G60L 1ZGLP 3GSNB 4ZS7H 1JCKA 1HDMB 3P77B 3S3PA 4QRTA 2VDQL 1FCGA 5F70A 2I27N 4DN4L 2HVKB 1LD9B 5A2IH 1YEFH 5C2BH 2CRYA 4E41D 3A6CL 3TBTB 2R23A 4QRSB 2JELH 4BSWA 1HXMB 3JVGC 3MRLB 3CFDB 3QFDA 3VXRA 4U7SA 4NNXA 5EOCJ 5J13C 2ADIA 3RGVA 3O9WB 3FFDA 4IMKA 4JFDD 5FUZL 1NGWB 2FJFA 3NFPB 3IS1X 4D0DB 2EDQA 1Y6NR 2H41A 3T0EE 4XNZB 1C5CL 4GRLB 4R97B 4FMKA 4J23A 5FM4A