3WFEL

Reduced and cyanide-bound cytochrome c-dependent nitric oxide reductase (cnor) from pseudomonas aeruginosa in complex with antibody fragment
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
213
structure length
213
Chain Sequence
DIQMTQSPPYLAASPGETITINCRASKSIRKYLAWYQEKPGKTNKLLIYSGSTLQFGIPSRFSGSGSGTEFTLTISSLEPEDFAMYYCQQHNEYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/oxidoreductase
molecule keywords antibody fab fragment light chain
publication title Structures of reduced and ligand-bound nitric oxide reductase provide insights into functional differences in respiratory enzymes
pubmed doi rcsb
total genus 51
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2013-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wfeL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wfeL01
1ROWA 5IMOB 2DYPB 3ARFC 5I2IB 1YEFL 4I0PC 5GGTH 1BIIB 3TT3H 1A6AB 3CXDL 3KPRB 3ES6A 2C26A 3G5VB 3GNML 4FFVC 5EPMB 4DK3A 4U6HA 5DHVA 3RHWF 2Q3AA 3OHXB 4Z95L 5IMOA 1H3WM 5I2IA 3PWLB 4BFBD 1G7PB 5E2UL 4Y19B 3LKPB 4MCYB 2Z9TA 2UV3A 3D85B 1A6AA 5J11C 3KPRA 3V4PH 5KG9B 3G5VA 4DKFH 3DROB 5ADPL 1HILB 4JJ5A 4KRPD 3ZT6A 3OHXA 4HWZB 3PWLA 5LGHL 1U8QB 3BJ91 3TA3B 5I18L 4Y19A 3RAJH 4MCYA 1MLBB 1UWGL 4PRBA 4RMQA 1BP3B 1Q9WB 1SEBB 3D85A 5KG9A 4M93B 3V9FA 3WXVL 4FHBD 2XQBL 2E3VA 3G08B 5FYKD 1FPTH 1BBDH 4G6KL 4LAQH 4QGYA 1SJVA 2DQIH 2DQGH 4HWZA 2FECL 4I77L 4MXQC 1F3DH 2Q76B 4LVHB 4KMLB 5CGTA 1MLBA 1QFWH 1FC2D 3KPNB 1Q9WA 1XF3B 2FJHB 4JPWL 2M1KA 4H20L 3G08A 3WKML 3KHQA 4M1CC 4M7ZC 5FGCB 5TH2B 1GJIA 4J1UB 4NFDA 4OF6A 4PP1C 5EU5B 1FCCA 1KBGL 1RQ5A 2Q76A 5FDYA 1E0OB 4FQ1L 3VFGH 2MKLC 4CNIB 3KPNA 4HK0B 1XF3A 2FJHA 2LVCA 1BVLA 4ORZC 3P30H 5INCA 1JZ4A 2P42B 4J1UA 1KPUA 3OGOE 5E2TH 3V2AR 3WSQL 3MRHB 3W11C 3QXVA 3TZVD 4HK3J 4CNIA 3I84A 4KV5F 4HK0A 2CO7B 3TM6A 1M7IB 43CAA 2VYRE 1DTUA 3RVUD 1FAIH 4WUKL 1IGTB 3QDJB 3MRHA 2V5RA 3LKNB 2FEEI 4WEMB 4ZPTB 1HCVA 1M7IA 1T7WA 1U6AH 2R2EB 3E6FA 4JB9H 2HT3C 1IGTA 2RFXB 4UT9H 3QDJA 1UCBL 3MBEC 4PBXA 3MJ9L 5E70A 3I75B 4U3XA 2MQCA 2D7OA 3LKNA 4LSVL 4ZPTA 5KVMC 1FYHB 3QUZB 4V2BA 5FXCH 1J8KA 1RHHA 5CEZE 3TEUA 1SYSA 5HD8C 3H7LA 1IEHA 1CBVH 2RFXA 4NBZB 3AXLB 1MRDL 3I75A 1JGUH 4O4YL 5AZEL 4CJ0A 5JUEH 3KXFD 5D6DC 2IBBA 4NQVB 3DSFH 5D7LB 5DC9B 1DUYB 1YNKL 4MA7L 4QRPE 2DIBA 1HK6A 4U1KB 3TN0D 2FHCA 4HZLB 3AXLA 4OZIE 1UB6B 4A2LA 4ETQA 3N85L 4X83A 4HWEH 5M95B 1A7OH 1NBVL 5D7LA 4UOW1 1ORSB 1YMMB 1OGAB 1DUYA 1Q0YL 4W6YB 4RBPK 1QSEE 4HZLA 3IKKA 4JDZB 1RK0A 1UB6A 2FBJH 1W0WB 2Y06H 4GKSB 4LSUL 4NWTL 4NZDA 4PREB 2C3VB 3KWWB 1CFVH 1FFRA 1EV2E 5D2NE 1FORL 1MCBA 1ORSA 3PDGA 1YMMA 2HT2C 1OGAA 1WTLA 4M9PA 5FO7B 1UEMA 3FT3B 2NZIA 1T5XB 3TIEB 4GKSA 4QCIB 4PREA 2C3VA 2EDDA 5J57B 5E5UB 4GOSA 5I1AA 1NAMH 3H42L 1BBJB 3QWRA 1H3TA 5EBGA 3T08A 3VFSA 5MEQB 5FO7A 2DD8H 3FT3A 3IDNB 1T5XA 2X4PB 3TIEA 4IRSC 2C9AA 4UOW0 1BWWA 4QCIA 4XC1L 1TVHB 1J5OL 4LIQL 4GG6F 1BBJA 4U1IB 5MEQA 1NDMB 3G6AB 1RIHH 3IDNA 2VSCA 5F72S 2X4PA 5HGHB 1S7QB 2UWEB 4N0RA 1TMCB 3V5HA 3NZHL 4XVUC 2LU7A 4G5ZH 4OFYD 4D94A 1BVZA 4EQ3A 4MD5B 3BJLA 1ZA3B 4U1IA 1NDMA 1PG7X 3EYQC 5HGHA 2VRAA 1IAKB 3GIVB 1S7QA 3O6KL 2Z91A 2VAAB 1EUUA 1Q72H 3OKNB 4XT1C 2IH3B 3LZFH 4P23A 2GJJA 5J13B 4KRPB 4MD5A 4Q7DA 3QR2A 1ZA3A 5IEHB 2EDYA 1XF4B 4CMHC 4LPCA 2G5RA 4JZJC 4HUVB 2ZWLT 3HI6H 1TZGH 3QRGL 1JP5A 3GIVA 3H9SD 5AWNL 3HNSH 5DRZB 5CEXB 5IF0B 5I0ZA 2VAAA 4WTZA 2EXWD 3OKNA 4K94C 3OJDB 4WU5B 3SKUD 2IH3A 4BYHA 4QOKB 2NY2B 1NAKH 3ARQA 5C3TA 5IEHA 4ODWB 4HGKC 4WO4C 1P53A 1FP5A 2AK4D 3PWJB 5CCKH 4OI8A 1MOEA 3VGFA 4PJGB 2RGSA 4OKVB 5DRZA 5IF0A 2QSVA 3EOYG 4NNXB 4WTZG 4KROB 3ZKMD 4WU5A 5CZKA 3C8KB 4POZC 3V52L 1EAJA 4QOKA 2WP3T 5EG6C 1JYXA 2BNUA 2VDPH 4OUUB 3PWPB 3CVHL 3PWJA 1YEIL 1K2DB 1T21B 2HFEA 2O61A 4PJGA 2CR3A 3SGKC 1VKXB 4W70A 5SV4A 4OKVA 3SGDH 2ZZUT 3Q6FB 4NNXA 4LHQB 5DK0A 3WYRA 3C8KA 4P2YA 3EW3B 3NTCL 3LQZB 3EOTH 3GO1L 1I9JH 4U6VL 4U1NB 3MNVA 1INDH 4OUUA 3PWPA 4DN4H 3TZVB 1K2DA 1T21A 4KKLD 4F7MA 4NQSB 4Y5VC 5FFLA 3HN3A 5C0EB 2MTPA 4JKMA 3U48A 3Q6FA 5HTSA 2VLRB 1RUML 4DWHA 2R56H 3LN5A 5KVGH 3LQZA 4KDTC 1XEDA 4LRNL 3CXHK 3HR5B 3IFNH 4U1NA 4YX2H 4H25B 3RWEB 5C86A 3QDGD 4PV8B 1H3GA 3NFNB 2EO9A 1VGEH 1CD9B 4NQSA 5DJDB 3F5WB 5EOCJ 1ND0A 1X5XA 3FQTB 3QHFL 4JPIA 4PJHB 5C0EA 1KC5H 2VLRA 4M9OA 4AIXA 3KS0J 1HIML 2Q6WB 3DXAB 5DD5H 2I9LB 1B0RB 2Q8BL 4KI1A 2LABA 3SOBH 4KVCL 4LSRH 4R4ND 5LBSL 4HKZA 5I1JH 1WICA 5CIPH 1B0WA 3RWEA 3C5SB 4PV8A 3NFNA 3I9GH 5DJDA 3F5WA 3FQTA 3JUZA 4PJHA 4UNVA 4HS8H 1W2KT 1Z3GL 3VXSD 3ARPA 2YRZA 2L7UA 4M3JA 2Q6WA 1B2WL 3DXAA 4HJ0D 1B0RA 2GI7A 3BH9A 5T1DL 5JORB 1YY9D 3SE8H 5BRZD 5J12C 3UPCA 1JN6B 1NBQA 1JGEB 1OAZL 3QG6B 3FN3A 4XNYH 4UI2A 1Q0XL 2BP3A 3PV7A 2J88L 2JB6A 1KENL 4JO3L 5JORA 1A6VL 3BEVB 2QHRL 3MXVH 2R39A 5BVJB 1T4KB 2P5WE 4OJFH 1JN6A 2PO6A 1HH6A 1JGEA 3DVGB 3QG6A 1LO0H 5HSFA 2W91A 2C3WA 1TJIL 4MQXD 2OJZH 2XWTB 4G8GE 3U7WH 3AM8A 2VLMD 2IPTH 1G7JB 3B3IB 3BEVA 3WS6A 2JJVA 5TFSL 3UJJL 1PAMA 3PWVA 1JF1B 3MLWL 3DVGA 1A9EB 4FABH 4KI5D 3O2WL 4OZGB 3K2MC 4D3CL 2FB4H 5FUCC 2XWTA 1SY6H 4YFEA 4ZSOE 4N1HB 1FNGB 1G7JA 4WY7L 3ZKND 3B3IA 3U4AA 1WZ1H 4GAJH 1DN0B 4JN1H 1UACL 1JF1A 4KAQL 5FK9B 3WE6B 3BUYB 3WJLC 3VWJC 1S7WB 4RGOL 3RKDC 1FRGH 1S7VB 4AQOA 1FNGA 2OL3L 4H1LB 5IB4B 1UT9A 4PRHA 2D9CA 4YHIA 4Z7OE 1UYWL 2YZ8A 5J6GB 1DN0A 5K9KB 4P4KB 2C1PB 1SQ2N 5DT1H 1PKQE 5FK9A 2XXMB 4MZ2A 3GHEH 5CD3A 1S7WA 4EXPX 1WBYB 2B0SH 4RGNC 4WFFD 1FHGA 4H1LA 4PJXB 4WI8A 5IB4A 4D8PB 3QQ3B 2D7TH 2AGJH 5J6GA 3ARTA 5K9KA 3KLAB 3D2UD 4P4KA 3WCYA 4LLWB 2X4OB 5BXFB 1LO4H 4JHZA 1HHHB 3QI9D 4K3EH 1YYLL 4XMKL 2B1HL 3T2NL 3SHSA 4D8PA 3QQ3A 5BW7C 1JFQH 2MHAB 4QTHA 1AGBB 4EEEA 3QIUD 1UCTA 1MHPL 3I6LE 1J11A 4FFWD 4GFTB 4LLWA 3V0VB 1VPOL 3BKCH 5HXMA 2X4OA 1XMWA 5BXFA 1KCSL 2X40A 2EDRA 2MHAA 1AGBA 4M43H 4LSPL 2KQNA 4UQ3B 2UVEA 1D5IL 3V0VA 1KCKA 5E5MB 4P3WA 2X4QB 3UBXI 2AK4B 2K1MA 1YUHB 3F7YB 1VEPA 3DLQR 3RL2A 4Q9CA 3CCHA 4JAMB 4K8RH 1INEH 1QEWB 1NGXB 4LCCC 4UQ3A 1FBIH 4HPYL 4F9LA 5ABDE 3BYYA 5JIIA 5HYSG 3O3DB 3C5ZA 2AK1L 2X4QA 4KJPD 1YUHA 3F7YA 4CAGA 1Q94B 4JAMA 5I1DB 5E5RB 1QEWA 1NGXA 1PKOA 3OKOB 2ZCLL 1YQVH 5JQ6L 2NY6D 3BGFB 4HMCA 3VFRB 4O00A 2Z4QA 4DGIL 3O3DA 4S2SB 4L5FL 3MRDB 1AHWC 4R4FH 3PDOB 1Q94A 1HXMB 3K4ZA 4KK6C 2IBZX 4UT7H 3EYFB 4HIXL 2NY5C 4OLVL 3VFRA 2XA8L 3MRDA 1WIOA 2PTTB 3T0BA 3X3FH 1LHZA 3PDOA 3WXWL 2IF7A 4OFDA 5ALBL 2E9WA 3ARBB 4MDJB 1HXMA 3O6LL 1EHLH 4K71B 3O3BB 3EYFA 4XCYB 3V7AG 1DQJB 5E0QA 3TESA 3FO9B 2AJ3A 2BY0A 4QHUB 1AO7E 3EYOB 3NIFE 1HE7A 2K9UA 4HCRL 1KNOB 2EE9A 3K2UL 3ARBA 3OAZH 1K6QL 3O3BA 5ETUB 2DQUL 4XCYA 3UBXB 3EO0B 5JOFB 4ONFH 4QHUA 3OJVC 4PGEA 2VB5A 4HW6A 5HYJB 1MI5E 3EYOA 1QVOB 4F57H 5E6IB 1KNOA 3U36B 5EZIH 4I18B 3VGGA 3TO4C 2J1KA 1T1YB 5ETUA 4YJZL 4PJIF 3UBXA 3EBAA 1U3HA 3EO0A 5JOFA 3GSNB 5D7IE 1KTLB 1AQKL 4N0FB 5HYJA 1Y0LA 5D72H 2A9NL 5ICZB 4OFVA 1QVOA 3ULVH 5E6IA 3JTTB 3U36A 3GIZH 3H8NA 4NJAH 1S7TA 4R96B 3BQUD 4R4BB 3K1DA 2ZKHH 2EDLA 5KVEL 1KTLA 4CJ1A 2DM7A 4EDWL 2FYYB 4CGTA 5ICZA 1T22B 3CD4A 5C71A 4WTWA 2X4UB 1RVFL 2JK5B 4JQXC 3JTTA 1PGRB 3MV7A 5I30L 4D9RE 1CLZL 4R4BA 4UZGA 2DN7A 1A7QL 1V7MH 1N7MH 2NTFB 4XGZB 4M02A 1R5VB 2CLRB 5DZOA 1W0VB 3QXTA 1T22A 3S98A 2X4UA 3CX5K 3BT2L 2JK5A 4YHKL 1GGCH 2KDGA 3RWHB 1OAXH 4N0UE 3WFHB 3JWOC 1ZANL 1JI1A 2NTFA 2WUBH 3ARFB 2MFNA 2P47B 4XGZA 5SWZE 1R5VA 2CLRA 1RZGB 3P4MB 1W0VA 4CMMB 4DFIA 4JY4A 3EYSL 1E27B 4GXUN 5F97E 3ALPA 4M6NL 2Q7YA 3P9WB 1MFAH 4R8WH 2FGWH 3QFDB 3HZYB 3O6FD 4UTBL 1MLCA 4PJAF 3ARFA 1XGUB 3ZMRA 3MOBL 2AEQL 5CSZA 4JZOB 1V5JA 3P4MA 4CMMA 2AV1B 1J12A 3LQAL 5EU6B 5J11B 1D5MB 4BKLB 1E27A 3VGBA 5TE6L 4XP6H 4BK4A 5FYJL 4LL9A 3SDAC 1FO0L 1EGJH 4P3DA 1XR9A 3HZYA 3QI9B 3MV9A 2OR8A 1DANT 5B3JE 1XGUA 3VXMB 4KRMB 4NNYB 3QIUB 1ZEAL 2OP4H 4L3ED 3HFMH 5EU6A 3UXFA 4U0QB 4BZ2H 5I15L 4NO3B 4GRWB 5F8QC 4DQOL 5IFJA 4CUCA 3D3VB 2DQCL 5JW4R 3CSGA 1E4WL 5I6XC 5JIPA 3VXMA 2R8SL 4Q0XH 1KB5B 2PXYD 3IB4A 4KPHH 2CRYA 2PNDA 5GJSL 4M7ZB 4NO3A 1QHPA 2H2SD 4HQQH 4P2CG 2EDHA 5F70A 3VJ6B 1S5IH 1AD9B 4HPOH 1Y6KR 1JRHH 3D3VA 5J0BA 2YWYA 3LVEA 1A3LH 2Y23A 2Y5TA 1DQQA 1MCRA 5CWSA 1G6RA 1QKZH 1URLA 4XPTL 2R0WH 4FA8A 2R0ZL 4POYA 4FP8H 3UAJD 2IAMD 2HLAB 3VFNB 3VJ6A 2EYSB 1AD9A 3QEQD 4OQTH 3FMGH 2N4IA 3DUSB 2DMKA 4YHZH 1BM3L 4JFDD 1HINH 3L9RB 5IFAL 3DVNB 4QGTA 2HLAA 3VFNA 2IQ9L 4OCWL 1DL7L 2BNQB 4X0KB 4GAYB 3DUSA 3L3DB 4HIJB 4C83B 1VDGA 3HC4H 1CIDA 3L9RA 4LPYA 3UJIL 4K3DH 3DVNA 2PCPB 1G7MA 3IDYC 4MD4B 3EDDA 3W9EB 4X6CF 3IRZA 3MBEB 2BNQA 4OAWB 4M00A 1A7BA 4X0KA 1TTUA 3BKML 4FQ2L 4HHAB 3BKJH 2YD6A 3DI2B 4NQEB 1LEGB 5SWSB 1IAII 5DC0A 5A3ID 2PCPA 3THML 2D2OA 4QLRA 4MD4A 1ZWIB 3W9EA 2XFXB 3MBEA 4LHUB 43C9B 4OAWA 3P0YL 3UDWC 3D0VB 3LS4L 4OT1L 4PJDF 5JO5A 5D71H 4HHAA 3HZMA 5FM8A 1A9BB 1KN4H 3STLB 3WEXB 2CKNA 4NQEA 4H8WH 4JGMA 4JFHD 5SWSA 2D4FA 1I7ZB 5HI5C 1UM6L 6CGTA 2XFXA 4LHUA 4QHMA 5HDOA 4L8CA 2VXQL 3QAZC 1PD6A 4AK1A 3D0VA 4V1DD 4ZNEE 3ECBB 5D6DA 2QR0B 1A9BA 4LCIL 3STLA 3WEXA 5HHXH 5HGAB 5KSAC 5BOZG 4LCWD 3P40A 5E56A 4F33B 1NBZA 4OM0L 3U82B 4L3CB 4UDUB 2Z31D 1OSPL 2NYYD 1I7ZA 3S3PA 4PV9A 4U2ZA 1SYVB 4MQTB 5J9PB 2XYCA 1KGCD 1LK3L 4XCFL 3EGSB 1MWAL 2NXYC 3ECBA 2QR0A 3MOQA 4UILH 3VXNA 5HGAA 1G9EA 3MLXH 2XWJA 5BVPL 2VKWA 4GS7C 3S4SB 1QQDB 4L3CA 2NX5B 1F90L 1SYVA 4TQEL 5J9PA 1HHIA 4G6FD 1NJ9B 3EGSA 4G9FE 5D7JC 2VN7A 5H37G 4OLWH 4ELKB 5C0CB 3B9VA 5J7CC 2NR6C 3S4SA 4Q58C 2NX5A 5GRJH 5KN5B 1I9IH 1MJUH 4MCZB 1CZ8L 1GC1L 1FYTB 1NJ9A 5KSBE 5I19L 1J8HD 2R2CA 5E00B 3RZCC 1JHKH 3D69B 3CJJA 4ELKA 4PJ7A 2HJKA 5C0CA 1JPSL 4DGVH 2A77L 1NMAL 3T1WA 2CXGA 5FYLE 2A9ML 3UEZA 4YC2C 5KN5A 5IW3A 4YXHL 1FYTA 2E8YA 3ZTJG 3ULUE 5J6HA 3T4AB 2V9TA 5E00A 3D69A 2F53E 4PGZA 1Z5LA 3RY4A 5D6CB 3O6FB 3ZE2E 1KJ2H 2J4WH 3E8UH 4HLZG 3QIWD 4PRPA 5B39B 3TPKA 4YDVB 2I60L 2OJEB 3FB7B 5CS7A 2XRAH 4RFOL 3T4AA 2BVPA 2NQCA 3BP5A 5F89B 1FNFA 1RY7B 4ODXB 3MGAA 2ITCB 4LK4A 4CMHB 2DBLH 2QQQA 4PJEB 1IC4H 4UDTA 5B39A 5LAXA 3T0EC 4YDVA 1DQDH 2OJEA 3FB7A 1HDMB 3ZDZE 1MRFH 3MLRL 4JFOB 1G0YR 5E8EB 5F89A 1LP9B 4EIGB 4OD3H 4Z0BH 5K9OB 1WC7B 4N1EA 4ODXA 2A83B 3O4LA 4NRYB 3T2QA 2MQ0A 2OS7A 1T1ZB 2XZQH 4J8RB 4WO4B 4PJEA 4L4VA 4FQXD 4IDLA 5FKAB 5ID1B 2PXYB 1EVUA 1U95B 2CDGB 1HDMA 4K3JL 4Y2DD 4JFOA 1OP3K 5E8EA 1A4KB 3LKOB 3IF1B 5T33L 5K9OA 1WC7A 4WUUB 4NRYA 1T1ZA 4LQFH 4J8RA 4WO4A 2UWEE 5I1EH 3LN4B 3KPSB 5ID1A 1YYMH 3P9LB 3KDMB 4D9LL 5HHMD 2CDGA 1JJUA 1CXEA 2XV6B 1EJOH 1A4KA 3LKOA 4KK5D 4WUUA 4ZPVB 3DJ9A 5I71C 4CRPA 1HZHH 2QQKH 4JDVA 4NC1C 3LN4A 3TV3L 3KPSA 3SGKA 4Y5VB 3P9LA 4ZQKA 1A6WL 3KDMA 5C9JA 3GMPB 4NM4H 3O2VL 1EA9C 1QBAA 3HZKB 1DLFH 4QT5B 4FS0A 4ZPVA 4YHNB 4ZYKA 3QUYC 1NMCC 5D1ZC 3X3GL 2R29H 1MY5A 4Y5VA 3ARSA 2GSIB 5FYKE 3GMPA 3MA7B 3HZKA 1BFVL 1P4IL 4KDTA 5DQ9B 3CUPB 4YHNA 1H3PL 2ICWI 1CICD 1CQKA 3O8XD 2VL4A 3GI9H 1OAQH 2GSIA 3I02A 3C9NB 3MA7A 3R06B 2P5EB 4ZOAA 4MZ3A 3QQ9C 3C6LC 4X9IA 5I76B 2DL9A 4K55A 5H37H 2VL5B 4KKNA 1VFBB 5J12B 3RIAK 1YC7A 1MCOH 3C9NA 4XX1G 3R06A 2P5EA 5EBLB 2EH8H 3VG0H 3MROB 4N5ED 2YRLA 4WI6A 1GPOH 1RUKH 3VW3H 4KTDH 3JZ7A 3O2DH 3ZDXF 2R1XB 2DAVA 5I76A 1LVEA 2VL5A 3LV3B 4FQPA 4S1SH 1R3IL 2BXZA 3JXAA 1NEZB 3CU7A 5EBLA 1CLOL 4K7PH 1AY1H 2DLFL 3MROA 1FIGH 4OF0A 4X9BA 1BJ1H 2BRRL 3AB0C 3SGDI 3ZTJH 1P7HL 2R1XA 5C0JB 1H0DB 1IEAB 4ZTPH 3LV3A 5ESVB 4ZD3L 3BH8B 2XZAL 4QRTA 4OI9A 4Y8DC 4L4TA 1OP3H 4BQCA 4HLZH 2I07B 2DTSA 3WNKA 1BWMA 1S8DA 4TNWF 1RK1B 3WFCH 4UIKL 1EO8H 4GBXC 4OD1L 5TF0A 1FLRL 5T5NF 4G6FB 1PDKA 3TJEL 1IEAA 3UTPD 2QQNH 4MA8H 3WNOA 1CXKA 4S1DD 2J6EH 3BH8A 4G8FB 3P9MB 1R6VA 3VWJB 4ONGH 4AENB 3HMXA 2H2PD 5E2JA 5FAAA 4KK9D 1QBLH 1RK1A 2ICWB 2AQ1A 3VFOB 4MLSA 1E4XH 3KXFE 1DR9A 2VDLL 1NLDL 3SN6N 1R24B 4QXGH 4X7DC 4G8FA 3RTQC 5L2KD 4U3CA 1ADQH 3WJLA 3VWJA 3O3UN 2FLBT 1UWEH 4LBEB 4AENA 3NPSC 4FQIH 2ICWA 2WIIA 4RGNB 1BOYA 2A1WL 1SJXA 3BXNB 1U8PB 5IOPB 3UJTH 3FO0L 1DBKL 1R24A 1GOHA 3CH1A 2DS4A 5LG1A 4NNPH 4GSDH 3MTRA 4LBEA 5F1OB 1YY8B 4P99A 3JV4B 2B2XL 4YPJA 2CIIB 3QIWB 3RVXC 2ZOKB 4J23A 1JL8A 2NY4D 3PQYD 3IETB 4P46C 4NRZB 5AG9A 1U8PA 5IOPA 5FOBB 3VRIB 2OTPA 2I5YH 3M8OL 4OZGE 3U0WL 2P8PB 1K8DB 2X4SB 1IC5L 5DR5L 2D7QA 3MQIA 4FMKA 4FQCL 5CJQL 2APWA 1C5BL 2CIIA 1RIUH 3G6DH 3UTSD 1KJ3L 5BW7A 3QUML 4NRZA 5FOBA 2B4CC 3VRIA 3NABH 2HN7B 1P4BL 2P8PA 2VITA 1K8DA 2X4SA 2RR3A 3NVQA 3UPRA 4WEBL 2VZ3A 5JXED 2B1AH 1CR9H 2VH5H 3DX8B 3MRNA 4LCCB 4Y2DB 5TQ2H 3WFBL 5HDBF 3ZYJA 4OZFB 2E8ZA 2P24A 4JHBA 3BIKB 1E6OL 2R4SH 3FOLB 4N8VB 4PJXE 5DJXB 2BERA 4ZTOL 2E9JA 4H88L 1E28B 1JGVL 3DX8A 1IAIM 4Y1AD 1UZ6E 2GJZB 5BJTB 5K9JL 4TSAH 4XP4L 5FCUH 4LCCA 4Y2DA 5CIPB 5ILTL 4OZFA 2DWDB 3LPGA 4N8VA 4ODHH 5TDOB 3WL9B 5DJXA 1N64L 1AHWB 1QFWM 1E28A 1CDIA 2GJZA 5JW4M 2GW5A 5BZWB 1AGFB 1N0XL 3LB6D 5KS9F 2I25N 5DQDH 1ACYH 2KBGA 5I8OH 5L7XL 4L29B 1AGCA 2DWDA 3F7PC 5TDOA 1DQMH 5EOCL 4ZUUB 3WL9A 4A6YB 1L4IA 3H9SE 1AHWA 1SJHB 1PLGH 1TVDA 1K85A 1A6PA 5BZWA 2Y7QB 4WI3A 3ULVD 4OGAD 5IQ7L 3A6CL 2DQHL 4L29A 3B5GA 1MRCL 2AK4E 4A6YA 1D5BB 5GIRB 5GISL 1YJDH 3TH2T 4XP5H 4JREB 1SJHA 1AFVH 5T1LD 15C8H 2H26B 1LWRA 3UYRL 4QWWD 3BRGC 2Y7QA 4HUNB 3QCVL 1UM4L 2DI8A 3HG1D 3QDMD 1UXSB 4PLNC 3X17A 4OLZL 1D5BA 5GIRA 4QXUH 1NPUA 5FB8B 4PJFB 5DJ2A 5IHLB 2ZPKH 3FQNB 5GJTH 4ODUB 1K8IA 2H26A 2XN9D 3GJEB 1PG7W 4FG6D 5KSAD 1R0AH 3WO3B 2YUZA 4O51A 1UXSA 1XIWD 1JF5A 1HYSD 4GMTH 5T1KD 4BFGA 1CD8A 5SWQB 5I1HL 1I75A 2WSKA 5FB8A 2Q3ZA 4PJFA 3T4YB 3TYGL 4WDIB 3FQNA 4XWGH 3TO4A 1IJ9A 3DETD 3MOAL 2DLHA 5DD0L 3BP6B 5CD5D 2DKMA 5F6HI 2BX5A 3DYOA 2D0FA 4OD2B 3CSPA 3QDGE 5SWQA 4PB9L 3MFFB 4UTAH 3WDJA 3TBWB 1U91B 3T4YA 4O2CA 4WDIA 5ESAB 1G0DA 1BLNB 2YEZB 4NHCL 3EAKA 1QR4A 3EDFA 4Z7QF 2FH6A 2WUCH 4P2QD 5CILH 1SEQL 5DMJB 4OD2A 3C08H 5F1IA 3MFFA 3TBWA 1U91A 4MJID 3GM0A 4JQXA 4IDJH 5ESAA 5MEOB 3Q0HA 4P5MB 1L7TH 1RZ8B 3RZCD 2YEZA 4JFZL 4KHTH 4ODTL 4OUOA 3SE9H 3VXSE 3QCUH 2FIRT 1WFUA 4NDMB 3VFMB 1Z0MA 4LSSH 4F58L 5HYJE 4NO0D 1FNLA 5BRZE 3QQ4B 4JQIL 5L2KB 2BOBB 3VI4E 1ZAGA 1RZ8A 3VRLF 32C2B 3FB6B 3G5ZB 4P59L 1B9ZA 1UWXK 3VRJB 2FNBA 3MLYH 2WIMA 2AJZB 3B9KD 4F3FB 2X7LB 3OPZH 3RVWC 2BOBA 3OXRA 3U9UA 4NM8L 4XI5C 2VLME 4O58L 32C2A 3G5ZA 2OCFD 1EO7A 1PY9A 2C5DC 2NY4B 3REWB 3SKNB 5DWUH 3BESR 2VLKB 2AJZA 2X7LA 4KI5E 4XHJD 4CL7A 1C5CL 1F42A 1EX0A 3SDAA 2J8UE 3L1OH 2A6IB 5FA3B 1F3DJ 3SCMD 4F15C 3KPMA 5IHZA 3QG7L 4OV5A 5GRUL 2IFGA 4WRLA 2DLEA 3SKNA 4ORGB 3REWA 2VLKA 1UC6A 4XPAL 2R2HB 3CFDB 1S9WB 3WMSA 4IHOB 3P2TA 3F58L 4MNQB 3L5XH 2A6IA 4CN1A 4CU6A 5A2FA 2QQLH 3U4BL 1UXWB 5E9DA 1P5VA 2ERJC 4ORGA 2V2XB 5TQ0L 4HT1L 1SVZA 5HI4C 2IPUG 4JQVC 2R2HA 2A0LC 3CFDA 1S9WA 5IG7B 3VXUB 5CAYB 4IHOA 5IGXL 4FQJH 3S9DB 4MNQA 4FQHB 2WBKA 4LOUD 3H2WA 2DLIA 3AVEA 4WFFE 3DARA 5JXEA 2W38A 2F58H 1UVQA 1CXIA 5GZND 1UXWA 4Y1AB 4AG4L 1AKJA 1A7NH 3FQXB 2R4RH 4MAYC 2V2XA 5CMAB 1A3RH 1J88A 2NY5H 3HMWL 4I2XA 3VXUA 5IG7A 1KCVL 4FQHA 1MF2L 2DWEB 4JR9H 2LAAA 4MXWH 3FQXA 1AXSB 1QA9B 2FATH 5CMAA 3KNBB 4OLUL 3MJ9A 5E1AB 4G6JL 4KK8C 3PGCB 4HWNA 2VO5A 2XPGA 5FUOH 4UB0L 5K59E 4MMXC 5D2LE 1BD2A 1CFSA 4IEFB 5D2NC 2DWEA 4YHOH 1KJMA 2XA3A 5FHAH 2APXA 1AXSA 2OQJB 3CVIL 3KNBA 4DUWA 2PW2B 3DUHA 5E1AA 3B8SA 4Z7VF 1CL7I 4WW2C 4Y5YC 3PGCA 4Y89A 2Y6SC 5JHLH 1UWXH 3ZHLA 4PJCB 3M17B 4HZAA 4HUUB 3I6KB 4YAQB 2OQJA 2QADC 3IJHB 2PW2A 3OQ3B 5I66A 1RZFH 4OZ4A 4KUCF 3QEUB 5A2KH 4KJQD 4YFLI 4PJCA 4WCYL 5ANMB 2HKFL 4JPVH 1LDPL 3UDWA 1CGWA 4ZO7A 1I3RB 3I6KA 4KQ3H 4J3VA 3IJHA 3C5JA 3EO1B 5KSAB 2D03L 2X9WA 3RPIB 1AE6L 1UZ6F 3GMLA 3SDXF 2N56A 2BVEA 2MOVA 5B38G 4ZXBD 3SPVB 5DMKA 3UROR 1C12A 2WINA 5ANMA 1V3MA 2NCMA 1BREA 5KSAA 4FZ8L 3RPIA 4GS7B 4JDTH 4X6DF 3BVNB 5DVKA 1WAAF 5J1SC 5DJ0B 4LVEA 4Z95H 5FYLL 1B3JA 1G84A 1ZTXL 1XF5A 5CZVL 5D7JB 5FYKU 3EJZD 4PJ9C 3ULUL 1PZUB 5F93C 3DUUB 3VWKC 3BSZL 5ADPH 4DKAA 5HYSB 4D2NA 3BVNA 2FH8A 3T3PE 1WBXB 2VSDA 5DJ0A 3PIQB 3MRPB 5DURD 2R0LH 5I18H 4MJIB 4PJBB 2YS4A 3C8DA 4ALAH 5D7JA 2WBJC 2YOCA 3RZCB 3WXVH 2XQBH 2V17L 4BQ6A 1OT1A 1HEZB 2Y36L 1Q9OB 1HH9A 1WBXA 3LHPL 3PIQA 1QP1A 3MRPA 4YC2B 3F7RA 2FEEL 1OD7A 5AYUL 3LRGA 4PJBA 3W39B 1UH4A 5JR1L 3NFPA 4LPWA 3RZCA 3O9WD 3JV6B 5IMLB 1PZ5B 3AREC 2VNCA 1EZVY 3GBML 3WKMH 1HEZA 3LIZL 1NSNH 4HBCL 1KBGH 3BD4A 5DEZA 3B9KB 4RRPG 4FQ1H 4EI6A 2ICWJ 2BMKB 4G6ML 5I1CH 3JV6A 4MXVE 5IMLA 1PZ5A 3WIIL 5D93C 3H3BC 1FN4B 1GL4B 2IG2L 3BPLC 2LE9A 3WSQH 5C0AD 3RP1A 3AS2A 2B5IC 3ZKXC 1MAJA 4D0CB 3SDDD 4Z7UB 1BAFH 2HTKD 5IMMB 2ZNXA 2BMKA 4EN3D 2PTVA 1RUQL 4YBQC 4AEIL 1FN4A 2AJYL 2C1OB 1U42A 2FJGA 1PBYA 2IALA 4XNXL 1NLBH 2YUVA 3T0EA 1LEIA 4D0CA 4Z7UA 2V2WA 5IMMA 2C3HA 4IRZL 1FVDB 2JCCE 3BYTA 1B90A 1CT8B 5KVDL 2C1OA 1YEHL 5IB2B 2CPCA 5HGGS 1S5HB 2HKHH 1UCBH 5DLML 1U93B 1GCFA 1HWHB 2CXKA 5BV7C 3L3KB 4RAUB 5FYKL 1W72H 1CT8A 3L5IA 1MCDA 2NY0C 5D8JL 2H3NB 3C60C 4PLKC 5IB2A 4Z7NE 1U93A 3S3SA 4O4YH 1F5WA 3L3KA 4RAUA 3QHZH 5L88H 3AFLA 3HE7D 3L3IB 3NBNA 1IL1A 4JKLA 2FSEB 2P43B 1GXEA 4IIQC 4LP4A 4KKAC 4MA7H 4RWYH 2H3NA 5E4IA 3EO9H 4MWFB 3QWOB 3QUYB 4JM2F 5D1ZB 1OAKH 1AIFB 4L3EE 1XCTB 1NGPL 1H8SA 1FQ9C 2B7DT 2NY7H 1G9MH 1LP9E 5H94A 2Y25A 3NCCB 3RI5F 5IW1B 5AZ2H 4HULB 4JGJA 2Q8AL 4NJ9H 3QDAA 3QWOA 4MWFA 3QUYA 5D1ZA 1NC2A 4K2UL 2NY1D 1S3KH 4YDIH 4YNYB 2J8UF 3H3PL 1AIFA 4NWTH 4LSUH 4LLQB 1GGYA 5EZJB 2EC9U 5FA4B 3GEWB 4TYUA 1ZLSH 4YXLH 3BN9D 5IW1A 4QKXB 1DEEB 3C6LB 4G7YH 3FQUB 2R2BA 5TE4L 4M62H 5T5NG 2EIBA 2WW8A 4AQ1B 4YNYA 1EEQA 3CFBB 1GOFA 1DQLH 4G8EA 5EZJA 1JI2A 5FA4A 4Z7WA 3QPXL 4M1GH 3IDXL 4C56D 5B4MD 3H42H 3N1FC 2DQJH 3QEQE 5DGQA 1DEEA 4E41D 1YEJL 3C6LA 2ZG2A 4NFCA 3FQUA 3LS5L 3WHXB 3TWCL 4LU5H 1YN7B 4TSBH 3CFBA 5I75C 4JFDE 1J5OH 4UV4L 4MSWB 1CG9B 1ZT4B 4XCEB 1NCWL 3WHXA 3DO3A 3LKQB 4DGYL 2OL3B 4OCLC 4TOYL 1S7SB 3GBNL 3NACH 3HC0B 4XPGL 2CDEB 1KT2A 1ERNA 1LGVA 1CG9A 1IBGL 3LD8C 4GBXB 3GSRB 2VXSL 5A2LH 4XCEA 2DMCA 3GK8L 1NFIB 3LEYH 3LKQA 4KY1L 1AJ7L 5J3HC 5IQ9B 2OL3A 3HNVH 3HC0A 3G6JF 2HTLC 4HWUA 2CDEA 4EBQL 1U8OB 4RZCB 1SBSL 4GBXA 5MEND 4F2MB 3QRGH 1NFIA 1SHMA 2ARWA 5AWNH 5GRVK 5IQ9A 3RTQB 3DVIA 4JFHE 3RVTC 2D7PA 4FQLL 3CXHJ 1N5YH 3NPSB 1U8OA 3C8HA 5ID0B 3BIAX 1QSZA 5TDNB 1JZ3A 2YPLA 4V1DE 3IDGB 4U1SB 4F2MA 1Z2KA 3REVB 4EVNB 2VR9A 4LCWE 3O9WB 3RTQA 3TBTB 4GRLD 4K9EL 3RJDA 1PX3A 2J5LC 1D9KC 1DE4B 4N8CL 3V52H 4KJWD 4XP9L 5ID0A 1KGCE 4AM0B 2XI9A 5TDNA 1F4XL 1RZIA 3CVHH 2G5BB 3MLVL 4P46B 5E2VL 1BQLH 3GBLA 3REVA 4EVNA 2O93L 2DKUA 3G5YB 1U58A 3TBTA 3EFDL 4OLXL 1E6JH 3NTCH 4KQ4H 1UM5L 3BE1L 1Q1JL 4AM0A 4W6XB 5C0AB 1DSFL 4XPHL 2NTSP 3DRQB 4P46A 4ZUSB 3SDDB 2UZIL 1LO3L 4U4BA 3G5YA 4EN3B 5DEFB 4JRXD 4ELMB 2IPKB 4TTDC 4YEFA 3RX7A 3KPTA 1VCAA 1YPZA 4HXAL 5F7WC 5IVXB 3DX6B 1JWMB 3NIGE 1FZMA 4I3RL 3RUGF 2L4OA 3OZ9L 4G42B 3DRQA 1J8HE 1VEMA 3SDDA 4ZUSA 1IM9D 3PGFH 2YK1L 5D70L 2DTMH 5DMGD 5DEFA 1CGVA 4ELMA 2HH0H 2IPKA 4PY7B 3T0WA 5IESL 4GG6B 3C09C 3BKYL 5IVXA 1FZJA 1JPST 2ZCKH 4GUPB 3DX6A 4C54A 1JWMA 3R1GH 3MUHL 1TQBC 4KVCH 5LBSH 1CF8H 4G42A 4MHHG 4MGXA 4RQQB 2DJUA 3BGMB 4G7VL 4HV8B 4EI5D 3H3KA 3BD5A 4PY7A 4GG6A 3NH7L 1BJ8A 1DBMH 5HDQH 1Z3GH 3CLEL 4GUPA 4HJJL 2YKLL 1ETZB 2MMXA 1ZT1B 5MP6L 1KCRL 4WEUD 2EKSB 3WIHL 4JJHA 3HB3C 1UKQA 2GKIA 4ZNCD 3MLZL 4HV8A 1A6TB 3QDHA 3HE7B 5FUZL 4TPRL 2MPAL 1Q0XH 1NCBL 2OZ4H 1ZT1A 3PP3H 2EIEA 3FT2B 4JO3H 1A6VH 4HGWA 4QY8B 5GSRB 5MEPB 2ZOLB 1N8ZA 1CGUA 4GG8B 1RV6X 1WSST 2H45A 4HCRA 4CBPA 1MIMH 5C09D 5E8DH 1TJIH 1RURL 3RWGB 4XMPH 4HUKB 3RQ3A 4YDKH 5K9QG 3RVVC 3FT2A 5IB1B 5EUKB 1KELL 4QY8A 5MEPA 1INQA 1K4DB 5TFSH 3UJJH 4BFEA 3MLWH 2IMNA 4GG8A 3FHQA 1XGTA 3O2WH 2AJVL 1PJ9A 1ZLWH 1XF1A 4D3CH 1VA9A 1VFMA 3MBXH 3BDYL 3RWGA 4HWBH 1J05B 4X7FC 4WY7H 5IB1A 5EUKA 4EOWL 5HHME 4JFED 3K4DA 5JLZB 1K4DA 1UACH 4BFIB 2WV3A 5E7BA 3QEGL 4B0MM 3HCVA 5CJXC 5F7EL 3A67H 1KB9J 5HVGB 4E41B 3BPCB 2GT9A 5C0RH 3CK0L 1FNHA 3FRPA 2CKBL 1UYWH 3MJGX 4HS6B 3A6BL 5JLZA 2Y07L 1TPXB 3C2SA 4BFIA 4Z7NF 2WLYA 1EVTC 1MFNA 4LGSB 3BAEH 5F6IC 2OTWB 3BPCA 4E41A 1MCEA 5DSCA 5KJRL 5GS0H 4M4PA 4NT6B 2UUDK 4ZUWB 4HS6A 4JY5H 2EYTA 1N6QH 3V0WL 5DO2D 3K46A 2P1YA 1L9NA 2QSCL 1S7RB 3BUTA 3GSNL 1U8HB 2OTWA 3NGBC 4KJYA 3F8UB 1TZHA 4XMLL 2B1HH 3IAQA 5FOJA 4DTGL 2BFVL 3KLSA 4NT6A 4TVPD 4ZUWA 5E8NA 4IMLB 3BZ4A 5EO0B 5DRXA 1MHPH 2ED9A 3EJYD 1WFOA 1ZLUK 4FXKB 3WLWC 1QFUL 25C8L 1VPOH 4RDQF 3N9GL 1S7RA 4JZNB 5GGVL 1KCSH 3CDFA 1GGBH 3MZTA 3UZQA 2O5YL 4Y4HD 1FO0B 5DA4A 1F2XK 2VXTL 3JWNC 3GSOB 3LMJH 4LSPH 3L3GB 2OMNA 5C0BD 4AY0A 4ENED 4J12A 4DKEH 3V4UL 5DVMA 1FO0A 2NNAB 3GSOA 4P48A 4LRIC 3ZYZA 1QNZL 3QPQD 2CMRH 5F7MC 1J0YA 1RFDL 4RAHA 2K7PA 3K8KA 1GYAA 3GMNB 4E9LA 2X5PA 5BMFL 1ZGLP 5ADOH 3VFVB 2NNAA 4LSTH 1I7UB 5SX4H 4M6ML 5C0IB 3FB5B 3J7HA 3G5XB 3NFSL 4GKNB 3TA3C 5LGJB 1I4FB 4PY8I 5JQ6H 1IAOA 2P8LB 1CDYA 4O2EB 3DBXB 3CSYB 3FFCD 4YHML 3GMNA 3UTPE 2HJLB 3VFVA 1AP2A 1MHHA 2V9QA 1I7UA 4TUJB 2JLLA 4B41A 5C0IA 1IKFL 2XOTA 3G5XA 4GKNA 4JRXB 4OZHF 5IFHH 1CXFA 1L7IH 1LEKA 1I4FA 3VMNA 1P4LB 2P8LA 4OLVH 3DBXA 1EFXB 3CSYA 4E0RA 4JKPL 2E5EA 4J3TA 4LP5A 2HJLA 3SKJL 3IS0X 3TF7C 1JTTA 5L2KE 3Q2CA 1QACA 5ALBH 5D1QD 5IR1B 1KSRA 3O6LH 1V3JA 4GQ9H 1HHKA 5GGQL 3GHBL 3DVFA 4H26B 1P4LA 3KVQA 1XT5A 4X7TB 3BZFB 1EFXA 1DEDA 1RZ7L 1CDUA 1MPAL 1T89C 3ET9F 4QRPB 1LO5B 4CADA 4EI5B 2FR4B 1KB5L 4PTTA 3NMEA 4JQVA 4OZIB 2CGRL 1K6QH 2D9QB 4PUBL 3WFEL 1ZHBB 3D39D 3L3OB 4H26A 3HAEA 4X7TA 3BZFA 4O02L 5F8RC 4HX1B 3PQYE 3CX5J 4M61A 1FE8H 5EIVA 4QRPA 2FR4A 1TQCB 1LO5A 4MAYA 3WFDL 2IAND 2R1WB 3LKSB 4OZIA 1DBAH 1P5UA 1ZHBA 3L3OA 2FL5B 5I17B 3UTSE 5DUMH 1JE6A 3KR3L 3PHQB 3MFGB 1YECL 3MA9H 2WWMC 2R1WA 5C09B 4KTEL 4Y5YB 3QUZC 3OTTA 1J9CT 2FL5A 5I17A 5KVEH 5D2NA 4DJMA 4LARL 4YUEL 8FABB 1J7VR 1NUGA 2J12B 5T3XH 3S5LG 4KHXL 3PHQA 4I3SL 5GZOC 1RVFH 4JY6A 1ES0B 5EC2A 4Y16C 3NIGF 5F7LB 2LVEA 4GXVL 4WW2A 4LKCA 1UKTA 4Y5YA 1IARB 1GGTA 1A7QH 2AP2A 4Y1AE 35C8L 4MA1B 8FABA 4JFEB 4RX4D 5EWIL 1AGEA 4X4ME 3VFWB 4DN3L 2YA2A 1ES0A 3DMMD 4DAGH 1NUDA 3BO8A 1P7KB 3ULUC 1MWAA 3T0AA 3FN0L 4IOIB 3HI5L 5HI3C 2VDNL 3GJFK 4G8IB 5GXBB 1X5YA 4GJTB 4X98B 3Q5TA 4IRJC 4JFEA 4ONHB 2AABL 4G6AC 4NWUL 5EIQA 3MREB 5C08D 3S34L 1U8NA 4HC1L 1P7KA 2SEBA 2EICA 3U6RB 4OI7A 4IOIA 4I48B 2EDBA 3GRWL 3MOBH 2AEQH 2DQEH 4AIZA 3Q5OA 1I3GL 1DJSA 3LQAH 4PJ9B 3ULVE 5ESQB 3O4OB 2MCPL 3VWKB 5T3ZL 5F7YC 2DKSA 1OTTC 5FYJH 4GAGL 4TSCH 3U6RA 3I2CH 3NA9L 5CUSL 5DZNA 1OT2A 2RAMA 2ADFL 2WAHA 3MLTA 4PJ9A 1D6VH 5ESQA 3VWKA 3HG1E 3QDME 5D7SL 3CLFL 4NZRH 3TT3L 2WQRA 4ODSL 4DQOH 3TVMD 3KYNB 3SDCC 4FFZH 3B9AA 5D9SB 1T20B 2XN9E 3T1FB 2WBJA 3TNNB 2YD1A 2AJSL 5C0BB 1JWSB 2PYED 4DKFL 3CPLB 3L6FB 1A1OB 2KZ1B 3DRTA 4WFHD 5ACLA 4U7SA 1CDJA 5D9SA 1T20A 4M6AA 1JBJA 3ISWA 2J8HA 3IDMB 3RAJL 4XPTH 3TNNA 4XBPB 4ISVB 1RULH 5DUPL 1IAIL 3AREA 3K74B 3RBSA 2IGFL 1NMBL 1WBZB 1JNLH 3CPLA 3TJHD 1A6UL 1JPGB 1MCPH 4XVSL 5CHNB 5J13C 4KRPC 4HH9A 1FNSL 2DQGL 2BC4B 4M8VA 3ZKXB 3L5JA 4JHAH 5HHNB 3OR7B 4XBPA 1BM3H 4ISVA 1LDSA 1RZJC 4LDLB 4P2QE 4DW2H 3MUGB 2OXHA 4KXZH 3RWFB 1WBZA 5IBUG 5IFAH 4Q6IC 3FFCB 4XXCC 1JPGA 2IQ9H 5CHNA 5J1TC 3B2UD 4GXUM 5E7FA 4MJIE 4NHUA 5LXGL 3MV8D 1PQZB 3VFGL 2C3GA 4L4JA 5HHNA 1CGYA 3SE3C 3W2DL 3MUGA 3UJIH 3RWFA 3V6ZB 4ZMAT 5C2BL 1CDHA 5BCAA 3RWIA 3ARWA 5BV7B 1MCNA 3QCTL 3BKMH 1KLUA 3ESUF 1PQZA 4X7SH 1J1OH 1ZE3C 2AXJA 4K94L 3LPFA 5E8OB 5A40E 4ZUTB 2ILLA 3V6ZA 3C60B 4KTYA 2Y72A 5CP3A 4PJAB 4X4XB 3N1QC 1WEJL 3T2OA 3UPAA 4CVWA 3K1KC 1NANH 2EZ0D 4LSQL 1PEZA 4WV1C 3HNTL 4RMWA 4P9HC 3TZVC 4WHCA 3V7AE 2P5WB 5FGSA 5E8OA 1EFQA 4IIQB 3U0PB 3ARUA 1I9EA 1EHNA 1U6AL 3C60A 4PJAA 4X4XA 1ZT7B 1UM6H 1X5JA 3NIDE 3RVUC 1XZ0B 1DBJL 2AXGA 2ESVD 2VXQH 4G8GB 4U1LB 3MLSL 4FMFA 3GMQB 3TT1L 1UGNA 2P5WA 3CMGA 4IIQA 4OM0H 1S9KC 5IHUH 1YEGL 1NKOA 5DS8B 1CWVA 1OSPH 3HE6D 3FFDA 1F4WH 1ZT7A 3ZKSD 3K8LA 1XZ0A 4N68A 1CBVL 1U2HA 1KIPB 2PR4H 4G8GA 2XY1A 4U1LA 4ZSOB 5DYOA 4O5LL 5JUEL 2O26U 2NW2A 1OCWL 3GSUB 3DSFL 5BVPH 4KVNL 5DS8A 1T6VN 5BZDB 2VDQH 4TQEH 1KIPA 4AH2B 3BGAA 4ZSOA 4X5WB 1KCUL 1YN6A 4HWEL 4PJGF 1JWUB 3GSUA 2QV2A 3OB0K 3MYJA 1Q9KB 3QNZA 5BZDA 4PGBB 3ZDYF 3TN0C 5DUBB 3QA3B 3LEXB 5I75B 1GC1H 1WQVT 2Y06L 4LVOB 4X5WA 5GGUB 1K3IA 5I19H 2IQAB 4OF3A 1L6ZA 1ONQA 5E03A 5IBLD 1CFVL 2DM2A 1BJ1J 1JWUA 5DTFB 4O2FB 4DUVA 4DKDC 2OR9L 3TCXA 2A77H 4NN5B 1Q9KA 1PKQA 1NMAH 1WITA 3BZEB 4PGBA 1F97A 5DUBA 3QA3A 2NXZD 5EDXA 2W59A 1T1XB 5EO1A 5GGUA 2IQAA 2DQDH 2X1QA 3OAYK 5DTFA 3SKOB 5HVHC 3U2SB 4O2FA 3VH8B 9CGTA 1RZKC 3T0VA 5HHOD 1I8MB 4FOMA 4HD9A 3QFJD 3BZEA 3GKZA 3A6OA 1NGWB 2W92A 2ZUSA 2VWEE 1T1XA 5EU7E 2EDOA 1NGQH 3JTSB 3WN5C 3SKOA 3U2SA 3FAWA 3VH8A 4PJHF 3CGTA 4K9EC 1IMHC 3R0NA 5F1SA 2HT4D 1RIHL 3JV0A 2XG5A 4PJ5D 2H32B 1GRWA 3QULB 4HAGA 4QHLB 1MNUH 2VISA 1U8LB 1NGWA 4X8XA 1HI6B 3J8F7 2VXVH 4HMEA 3JTSA 3TVMB 1X44A 2OM5A 4KGLA 1F3JB 3CFCH 1UA6L 4HKJA 2DDQL 3NCYP 4YZFF 2H32A 4KV5E 3QULA 4QHLA 2BNRD 1U8LA 3UTZB 1JZ5A 1HI6A 2J5LB 1DUZA 1D9KB 4EDXA 1VADB 4NQXB 3RNKA 3D48R 1ODAA 1J0ZA 5E6YA 1F3JA 1BQHA 1X3DA 1FGNL 4P2RD 4KU1A 1TZGL 3UTZA 3KYAA 3PP4H 4B7LA 1D9KA 4FQQB 3ABZA 4C58B 1VADA 4WNQB 4NQXA 2HFFB 1QSFD 1W72B 4YEEA 3DURB 3U1SH 4UBDD 4CVZA 3TV3H 4XPBH 1ZHLB 4S1QH 4K23L 4FQQA 2EXWC 1U3ZA 4WNQA 2HFFA 4OCNC 4YH6A 3H7BA 3LN9A 2H6PB 1EJ6A 2GSGA 3CFKB 3DURA 1A64A 3PDDA 4NKOB 2APBA 5ALCH 1ZHLA 3RGVD 4JO4L 3ZKMC 2H6PA 3EOTL 2VR4A 1JGLL 1I9JL 3CFKA 1CU4H 5C1MB 3NCYS 4NKOA 3OAYH 3WUWA 2DB8A 3FO1B 4M5ZH 2XXCB 5IP4A 3BGFC 4HSQA 3IFNL 4YX2L 5D7IB 4QRRD 3MODH 4GLRI 5GSVB 2RCSH 1X5GA 4TUKL 1MI5A 4KKLC 1VFAB 5L2JA 3WUWG 2YA0A 4XNMB 5C0AE 4LLDB 5DD5L 1OAYH 2AKRB 4Z6AT 2EXYD 3SOBL 4LSRL 3MCLL 5D7IA 5I1JL 3QO1A 1EEYB 5JZ7D 5JW5B 1VFAA 5HYIA 4Q9RL 3I9GL 1BOGB 1JMXA 2KL6A 1IVLA 4K71C 3H9HB 4XNMA 5IKCA 1A7RH 2W1NA 1P84J 4LLDA 4YPGB 2AKRA 5C3LD 1JPTL 2X44D 5IK3B 1XCQB 4R4NC 3QHTC 4ZD3H 2A73B 5GS0D 4I0CC 2XZAH 1EEYA 5JW5A 4GG6E 4IOFD 2FX8H 1BOGA 4XNYL 1DVFD 3MNZB 1BX2B 4LFHD 5IIEB 3IDJB 4OCRL 3H9HA 1CN4A 1A5FH 1VHPA 3MC0A 3RIFK 4UIKH 4JANA 2EYRA 4OD1H 4YPGA 4HJ0C 4BQBA 5IB5B 1YY9C 3I6GB 1C08B 5SWZB 4OJFL 1V05A 4XAWH 2EO1A 3B83A 4I18C 3MNZA 1BX2A 4DOHE 5IIEA 4RDQG 5EU4A 4MJ5B 1I9RH 5B8CC 4I9WD 2OJZL 2IMMA 4N0UA 3U7WL 5HDLA 3U0TA 2VDLH 2BJML 2X1PA 1NLDH 3FTGA 3B4NA 3I6GA 1C08A 5SWZA 2VUOA 5CJXA 4L8SC 4FABL 4PRID 2E6QA 1F4YL 1JPFB 5F6IB 1ZK9A 4MJ5A 2FB4L 4MQXC 1SY6L 4TRPL 3T0XA 4PGJA 2A1WH 4JRYD 2NXZB 4GAJL 1U41A 3FO0H 1DBKH 1X5LA 4JN1L 5DJCB 5GS2H 3FO2B 4KI5C 1JPFA 4W68A 3DSNA 3NGBB 4HS3B 4WWKC 2F8XC 3AS0A 4AT6B 3HC3H 1E4JA 1A14H 3NN8B 4HIEB 3ZKNC 3IXAB 3FT4B 5GHWH 2EDKA 5IW6B 5JQHC 3I50L 2DJSA 5DJCA 1IC5H 5DR5H 2M8XA 4OGYH 3FO2A 4FQCH 4D0BB 2CDFA 3GHEL 4C4KT 1D6EB 4HS3A 1P2CA 4AT6A 4FXGB 4ZDHA 2B0SL 4PJ5B 5EZLA 1CXLA 4QNPF 3NN8A 1FL6B 3QUMH 4HIEA 3IXAA 4N90D 1ZHNA 2VQ1A 1CQYA 2D7TL 2AGJL 3FT4A 4NUGL 4C56E 1P4BH 1C1EL 4Z18A 3RGHA 4S10A 5E2WH 4D0BA 4E42B 4E41E 3ZSSA 3RJQB 5CGMA 1I7RA 4HUXB 1D6EA 1LO4L 1ZGLM 4K3EL 5J4MA 1G1YA 3MACH 2BNRB 1FL6A 2DYPA 2AJXL 4XB7A 3WFBH 1BIIA 2ZUWA 2VZ1A 4L8BB 4OCSL 3JWOL 5EBMB 5EIIB 2XQYK 4E42A 5EPMA 4WTXA 3BKCL 2YD2A 5F21B 5JXAH 4Y4FD 3QI9C 4P2RB 1JGVH 2H9GB 3V79C 4LRIA 1IGCL 1TETH 5K9JH 4XCCL 4XP4H 1G7PA 3LKPA 3QIUC 2YXFA 4P2OD 4CDGC 5EIIA 3ARVA 3EDEA 4FFWC 3DROA 1FG2B 4QTIL 3U30B 1HILA 1N64H 4PJ8D 5I8CB 1U8QA 3TA3A 4Y5XC 2ORBL 1INEL 1X4XA 3V6FB 1KYOK 1SEBA 1P69B 3OKEB 4HKBB 5L7XH 5IWLC 2WANA 1BEYL 1FBIL 1FG2A 5EOCH 5MENE 1H8OA 5F3HB 5DMIL 3FZUD 4ZS6D 1T2XA 3CDCA 4ZAKD 3RGVB 1EXUB 3L5HA 3A6CH 4OM1H 3OKEA 1XGYH 5TH2A 3OF6A 2RB8A 5GISH 1JHLH 5EU5A 2YUWA 3M07A 4KJPC 4LVNC 2I24N 3SKMB 4YGVB 5T3XD 3UYRH 1IGYB 1ED3B 3RGVA 3MXWH 2J8OA 3T77B 1G6VK 3U7YL 1UM4H 1K4CB 2HFTA 2UYLB 2NY6C 2FIKB 2EEBA 4OLZH 4U31A 3RFZC 1T89A 4QRRB 5EC1B 3X3FL 3SKMA 4YGVA 2NLJB 3L3JB 3U83A 1IGYA 4M5YL 2BSRB 4MYWB 4ZNEA 3WNMA 1K4CA 2UYLA 1LE9B 2FIKA 4NOBA 4XX1E 3TYGH 4JRXE 2X9XA 2NLJA 2W07A 4UT6H 3L3JA 1H3VA 3LPWA 1AI1H 2BSRA 2ATPB 2EDTA 4G9FB 4FTVD 1FJ1B 4R0LC 1LQSR 4OSUL 4G43B 1LE9A 1QPPA 1MIEL 2R2EA 4GRWF 2E6JA 4PB9H 4Y16B 4ZUVB 4F57L 2HFGH 1EMTH 2E9IA 2IH1B 3JWDH 4M6OL 4NHCH 1DVFB 4OFPA 5KSBB 1AR1D 2ATPA 4EUPB 3QUZA 4G9FA 1FJ1A 1WGOA 3IU4H 3PL6D 5FYJD 3S96B 2VLJD 1NL0H 2ZUXA 1HSAB 1HOCB 1R3LB 4PTUB 5CJ8A 2JE8A 3O0RH 4Y16A 4ZUVA 3ULVL 3AAZB 4JFZH 4ODTH 1WCBB 5KSBA 4EUPA 4NQVA 3VD9A 2F53B 2EDFA 3DYPA 3S96A 1H15B 4IRJB 4U1KA 3IAPA 1HSAA 1HOCA 1R3LA 4PTUA 2EKJA 2PF6A 3AAZA 3EHBD 2HYMA 3F12B 3BQUC 2F53A 4QRQB 4JRYB 4IRJA 1X5AA 5KOVC 4CN6A 3N1PC 4JDZA 1IRAY 5D96C 3GGWB 5C09E 4KWUA 1W0WA 1GGCL 4FRWA 4MNHB 4P3CL 3WJJC 2QLVB 5DHVH 3KWWA 4NM8H 1OAXL 2BSED 4O58H 1J87A 1TJGH 3P4OB 3F12A 1YNLL 1KEML 4J4PD 3O81A 2HG5B 4RWHA 5DJ8B 2WUBL 4UIMB 3LEVH 3HTLX 4MNHA 1WF5A 2WBWB 2JJWA 4H0IA 1Z9SA 1OTUD 4KUCD 3SDCB 4R8WL 3P4OA 1J1XL 5EB9A 5DD3H 3QG7H 2ZUYA 4JFEE 5GRUH 5IM7B 5D7KD 4UIMA 4XNUH 2GJ6D 4X4YB 5EOQH 1G7IB 1TVHA 3S7GA 4XP6L 3SDCA 1NCCL 2E7BA 5F71A 1EGJL 2R0KH 4TULH 1MFBL 3O6FC 4TNVK 2X05A 4AMKH 3MCG1 3G6AA 5IM7A 5TQ0H 1MCLA 1N5AB 1CL7L 3BW9B 5BS0D 4X4YA 2UWEA 2OP4L 3QWQB 3HFML 5IGXH 1G7IA 1W0YT 5F9JB 1WWCA 1CFBA 2ID5A 3ALXA 2YBRB 4XVTH 4Y4FB 3VFUB 1MCIA 3QXUA 2F19L 1N5AA 4Q0XL 3BW9A 1IAKA 4Z5RB 3VG9B 1QSED 3CSBA 4P2OB 3HMWH 2QSTA 2BVOB 2F5BL 4Q6IB 1GH7A 1V7NL 5E4EC 4U49A 1BGXH 1MF2H 4R90L 4TVPE 1T80A 2X2YA 4PJ8B 4Y4FA 4HPOL 1JRHL 4P5TD 1XF4A 1WFNA 5GRWA 4HUVA 1A3LL 1WZMA 5DA0B 3DHJA 5JA9A 4OLUH 1NBYB 2PXYC 3W5NA 2VQUA 1PFCA 5CEXA 4XAKD 2BHYA 2G60L 4FP8L 4Q6IA 4XXCA 4PJ7F 3OJDA 1QRND 2H2SC 3QIBD 2DBJA 1IAMA 4WI2A 4PJ8A 4ODWA 4OQTL 4PLJD 3ESVF 3CFIC 5C0BE 3SE3A 1U0QA 3ALWA 1NBYA 4YHZL 4PJIE 2OX5A 4UAOB 5EUOE 1H9VA 5K93A 3UAJC 4BQ9A 1I1FB 2IAMC 4G3YL 5D1XD 4PGCB 1DDHB 2CRIA 1A0QH 4WV1B 3VD5A 3GSXB 2CR6A 3MLUH 3HC4L 2KKQA 3WBDA 1QLEH 1VKXA 3U9PL 3V6OE 4GKZB 2BZDA 1OD9A 3PHSA 2OBGA 4PGCA 1DDHA 3U4EB 1CYGA 1LDPH 1QYGH 4WV1A 3TZVA 3GSXA 4YO0B 2W0PA 5E99H 1GGIL 1AE6H 3BKJL 4P0DA 3FFCE 3ROLB 2XY2A 3OL2A 5JNYB 1A21A 4JVPA 3U4EA 3HR5A 4WIQA 4PJEF 4N8PA 4H25A 3KYOB 3PJSB 4YO0A 4M1DH 5TF1L 1KN4L 3GSQB 4FZ8H 4U6YB 3ROLA 2LAGB 4HEPG 1OAUL 2CRMA 4X5XB 4M7LL 3PV6B 5A3IC 1EEUA 5FYLH 1HN1A 2I9LA 5CZVH 4HXBH 3KXFB 3KYOA 3PJSA 3C5SA 5HHXL 3GSQA 3BSZH 1RI8A 3BRDA 4U6YA 5FM5M 5GRZA 4PJAE 1OP9A 1T66D 2GTZB 1BQSA 2VLJB 3PV6A 3TN0B 2N7AA 2YD3A 4MA3B 3KXFA 4APQD 4C4KO 4UILL 3D39E 1P9MC 3ZE1F 1S9XB 2V17H 5JHDD 1A4JB 2VXUH 2GTZA 3CDGB 4JM2D 2Z31C 2NYYC 3TN0A 3HRPA 2X89D 2IANE 2QEJA 5KVFL 2J7LA 5JR1H 1T5WB 1MJ8H 5BVJA 1T4KA 4S1RH 1MFDL 4OLWL 5HVHB 1S9XA 3GBMH 3LIZH 1A4JA 2YPVL 4PD4K 1FVEB 3CFEB 4WWKD 3UP1A 1NEUA 5GRJL 4QYOB 1MJUL 4Z8FL 3BWAB 2J3SA 4NKIL 1T5WA 4Z7VB 3DHMA 3OKDB 2WWKO 2VABB 3WN5B 1AC0A 1A9EA 2X1OA 2IG2H 4OZGA 1FVEA 1T0MB 4NIKB 4YBHA 1KIQB 3N1MC 3ZT7A 5SX5H 4QYOA 2X6MA 3BWAA 5KAQF 1RUQH 2VABA 3WN5A 2ZG1A 4AEIH 3WE6A 3BUYA 2AJYH 3PGDB 1PY4A 1OM3H 1KJ2L 1T0MA 3B2VH 2J4WL 1KIQA 3E8UL 1P1ZB 1S7VA 2CLZB 4XNXH 1DFBL 2GJ6B 4ZG1A 4YHPB 4ZFFB 1J0IA 3OAZK 3SDXB 2C1PA 2R69H 1CFQB 4MB4A 3MRRB 3RU8H 4JHWH 3PGDA 1YEHH 3X12B 4RFEB 3VXRD 4Z76B 1BVKB 2DBLL 1WBYA 5DLMH 3GJFB 1IC4L 1P1ZA 2CLZA 3QIWC 3QXAB 4PJXA 4H1LG 2WQ8A 2YMXL 5C08E 4BSWB 2CH8A 1DQDL 1KIRB 1M6OB 1MRFL 4X6DB 3KLAA 1KCLA 4XPFH 1CFQA 4M4RA 4OFYA 1Z9LA 4X6CE 4OD3L 4Z0BL 5FECB 3MRRA 5D8JH 4HEME 4LNRB 4RFEA 1ITBB 3S5LB 3CNKA 1BVKA 1OVZA 2AEPH 4Z76A 1HHHA 3GJFA 4LPVA 1KB9K 2M26A 5F9OL 1IGIL 3VE0B 4BJLA 3H9SB 4BSWA 1KIRA 2DICA 2PUQT 4YK4C 1JK8B 2EECA 5FECA 1BIHA 1BFOB 4LQFL 4PJDE 1FDLL 1TJHL 2HVKB 4FQXC 3VE0A 3GFUA 3H9SA 1YYML 1I8IB 3SJVD 4W4NA 3GI8H 4Y2DC 1EJOL 1QRNB 1MREL 3JBG7 5E5MA 1BFOA 1W8OA 4K2UH 1A7PH 5JPMB 5C07D 1KV3A 5FV1L 1HZHL 2HVKA 2QQKL 2AK4A 2B4CL 2WLZA 1AGDB 2PYEE 2MWCA 3WIHA 1I8IA 3O11B 4GT7A 4K07A 4NM4L 5DFWH 2XACC 5GGSY 4L8DB 1MCWM 2ARJQ 2AI0L 4WFHE 5F88B 3Q6GL 4YLQT 2X41A 4KK5C 5D1XB 1TDQA 1OARH 2ADIB 4R7NB 5TE4H 2YPKB 4FZEH 4NFBA 1G7QB 4UV7H 1ORQB 4F7CB 5JPMA 1AGDA 4OIAA 3Q48A 3MRLB 2FEDD 4M7KL 5I1DA 3IDXH 2YD9A 4L8DA 3OKOA 2ED8A 5F88A 3QNYB 3IFLH 1YEJH 4YR6B 2ADIA 4R7NA 2HP4A 3AMKA 2YPKA 4M7JL 3TWCH 1G7QA 4S2SA 1ORQA 4F7CA 3VXQB 5J89A 4BZYA 4BUGA 3QDGB 3GI9L 1OAQL 2XNAB 4I0KA 4UV4H 3MRLA 3V6BR 3ARRA 4WGVB 5I1GH 1O7VA 2CK0H 3G04B 4YR6A 3M1BB 3MV8E 4Z9KB 3VXQA 2PTTA 2CKBB 1CICC 1J1PL 3GBNH 3O8XC 3QDGA 3BRFA 4JREC 4I8DA 3DV4B 5IHBA 1MCOL 4MDJA 3VG0L 1CGSL 3VXSB 2BVUA 5GS2D 4MJ6B 3G04A 1RUKL 3VW3L 1DQJA 1KPVB 3FO9A 3O2DL 5B21A 5MI0C 3VFPB 3M1BA 4KY1H 5ENWB 4S1SL 1P7QD 2CKBA 5BRZB 4PRDB 3DV4A 5H2BB 1IZKA 4GRMB 5GS1C 5MHSD 5TDPB 1AY1L 3UTTD 1ZKAA 1WWWX 4N5EC 5F7NC 3VXSA 5B8CB 5EA0L 4MJ6A 5BOPA 1KPVA 1NDGB 2Z93B 3VFPA 5EUOF 3HLAB 2F5AL 3HZVB 4APQB 1MFEH 5BRZA 5C6TH 1WIUA 4JFFD 4PRDA 1ULVA 3SDYL 4L8SB 5IBUB 5H2BA 4NP4L 2COQA 4GRMA 1I1AD 3PHOB 4I18A 5TDPA 2OSLB 5HHVH 5I9QB 1T1YA 3RKPA 5B8CA 2LU3A 1KN2H 1CVSC 2XKSA 1RJCA 3UBXG 1EO8L 3OX8B 1NDGA 3FQRB 3GSNA 2Z93A 4TTGA 4N0FA 3HLAA 2QQNL 4MA8L 3RA7L 3HZVA 1CE6B 4APQA 2J6EL 4Y7MA 4L8SA 3PHOA 4KFZC 2OSLA 4WWKB 4PS4H 4NQDD 4XNQB 4XP9H 4R96A 4H1LH 1QBLL 2J8UB 1IC7L 3MRJB 3MLVH 3OX8A 1E4XL 5E2VH 1VSCA 2FYYA 1CE6A 2X10A 4QXGL 4S1DC 5LQBH 2AVGA 3EFDH 4D9QD 4OLXH 1UWEL 2H1PH 4WWKA 4XNQA 3BE1H 5DD1L 1Q1JH 2JIXD 2H2PC 2D7NA 4KK9C 2J8UA 4FQIL 3TGXA 1DSFH 3K80A 3MRJA 3VXPB 2UZIH 2PYFB 2W65B 1I8KB 3IGAB 3UJTL 3OR6B 1DLHB 5DC4B 2BXYA 3RWHA 2YC1B 4HXAH 3RHWK 2ITDB 3WFHA 3JV5A 1DANU 1KLGB 4I3RH 4KKBC 5DF0A 3PNWB 2X1WL 1I1CA 1KUMA 4P4RB 4NQUA 3VXPA 2PYFA 2YK1H 1RZGA 1I8KA 2VDRH 2W65A 5D70H 4PJFF 3IGAA 4RMUA 3OR6A 3D2UB 2I5YL 1MH5B 1T3FB 1DLHA 4NZTH 2YC1A 3QUXD 3R8QA 4XC3L 3QFDA 4MNGB 1KLGA 3ZE0F 2IEPA 3PNWA 2Y4SA 1RIUL 3G6DL 3P0GB 4P4RA 3RX8A 3DWTA 4JZOA 2NY4C 2AV1A 3NABL 3D2UA 1D5MA 1MH5A 1T3FA 4BKLA 5HHOE 3MV11 3QJHB 3KPLB 3QFJE 2D31B 4ODVH 4BELD 4HJJH 2YKLH 4X6EB 2E6PA 5MP6H 1KCRH 4CVUA 2B1AL 3N50A 3QI9A 4WFED 4R2GC 5D2LB 3BN3B 4Y5XB 4NNYA 3QIUA 4IBLT 5FUZH 4TPRH 5TQ2L 4MLIA 4X7CC 2MPAH 3OB8A 5HGBB 3V0AC 1T83C 1IQWH 4X6EA 2R4SL 4U0RC 4PJ5E 3W0WD 4MDIB 2Y9RT 2PKDA 4R26L 1YNTB 5JXEC 5D2LA 4I5BB 4Y5XA 3S88L 3CZJA 5F9WB 4JO2L 1KB5A 5A1AA 1HXYB 5IWLA 4K3HA 3ZDXE 2Z35B 5HGBA 1RURH 3RDTD 3FOMB 1RHFA 4MDIA 5KTEL 2BNRE 2P7TB 1YNTA 3BDXA 4LPXA 4LVNB 1KJVB 4I5BA 3RRQA 5B3NA 4JEGB 2AJVH 5DQDL 1VFUA 3Q3GB 1FZOB 1HXYA 1KOAA 4LPTA 1A1NB 5I8OL 2YD4A 2Z35A 4I4WB 2NY6B 3VU2A 4M8QB 4Y4KD 3FOMA 4P2RE 5CEZL 5EN2B 2EYSA 1PYWB 2P7TA 4EOWH 4KUZL 3BHBB 1TCMA 1S9YB 4ZFOB 1QSFE 3LB6C 1I1YB 1RMFL 3EYUH 5I1IL 1A1NA 4AL8H 5TE7H 4M8QA 3E2HC 4NYLB 1PYWA 3ZL4L 1YJDL 3A6BH 3BHBA 4GAYA 1AFVL 15C8L 7FABL 1S9YA 4OCXL 3L3DA 4HIJA 4ZFOA 4C83A 4OBSA 1I1YA 4R0LB 3V95A 4U6TA 3ULVC 4OGAC 3EOAB 3RUGB 3ARDC 4NYLA 4YHYB 4QXUL 3IU3B 4LCYB 2ZPKL 3OAUL 4Z77B 1F6FB 4QWWC 4R0LA 2QSCH 1YDPB 1SM3L 3FRUB 1LEGA 3EOAA 1QFWI 4GMTL 4NQCD 5F96H 2GY7B 4XMLH 4DTGH 1ZWIA 1KEGH 3R4DA 4XBEH 2MCG1 43C9A 2NPLX 4LCYA 1FNEB 3IFOB 4XWGL 3KPRD 1LO2L 4FG6C 25C8H 1YDPA 4ZFZB 1XIWC 1D7FA 4HC1A 1HYSC 2YZ1A 4QRRE 1YEDB 4UTAL 3GRWA 4LHUG 1CDBA 4JFFB 4Y19D 3ZHDA 5ITFB 3IFOA 4MJ4A 1F58H 5L6YH 1I1AB 1LK2B 2I27N 3D85D 3DETC 1YZZA 4PG9B 5CD5C 4J6RL 3ILQD 4WENB 3BQUB 4ZFZA 2GFBB 3V4UH 4F33A 2O5XL 3OJ2C 5BQ7B 4UDUA 1DZBA 1YEDA 3C08L 1GSMA 1A3QA 2P48B 5HY9B 1QNZH 1B6DA 1S7UB 5D96B 1KULA 4IDJL 1OTSD 1S9VB 1I1AA 1L7TL 1LK2A 3KPOB 5DI8B 1RFDH 5GGTA 3SE9L 4PG9A 1QLRB 5C92A 3BQUA 5KOMC 4C59B 1MHCB 1QQDA 3CH8A 2Z8RA 3TPUB 4FNLL 5HDBE 1S7UA 1DCLA 5EU3B 1JZ8A 1S9VA 3WJJA 1ZLVH 3KPOA 4NCDA 5DI8A 5C0ND 3VFTB 1R3JB 1QLRA 5CBEB 2Y5EA 1MHCA 2JCCB 3S4SG 4IJ3C 4Q6YA 2LQRA 3TBVB 3IFPB 4PJCF 3MLYL 3H0TB 4MCZA 1IKFH 3NCMA 4YQXH 5JW3H 3OPZL 5EU3A 2KUTA 1WJ3A 5CZXD 1IKNC 1EEZB 5KANI 4I9WE 3AS3A 3VFTA 2QTEA 1R3JA 4DZ8B 2FX9H 2JCCA 4JKPH 4TVPL 3SKJH 1MVUB 5KS9E 2VQTA 3H0TA 1F8TH 3B9KC 4PRIE 5GGQH 1MCWW 4GRWH 5DJZB 5JOPD 3L1OL 4K7PY 2EDEA 4DZ8A 1MCFA 5DJAB 4JRYE 5D6CA 3O6FA 5DJYB 1RZ7H 1MVUA 4LEXH 1G9NL 3HUJF 1G6RH 2W9DH 3QDJD 4QXTB 4U05A 4MS8D 3T65B 4DUXA 2CUHA 4L3EB 4XHJC 1NGYB 1ZSDB 4PUBH 5C0DB 4YWGH 1EDQA 5E4EB 5DJZA 1T03L 4KH2A 5DJAA 3SCMC 5FDWB 5DJYA 2DIAA 2QQLL 2ITCA 4B7IA 3PWNB 2V7HB 4HFUL 3W9DB 4QXTA 5B39G 1UADC 4WFGD 3BPOC 1JV5B 4L3EA 1NGYA 1ZSDA 2RJMA 4O9HL 4FQJL 1LP9A 4U1HB 3QH3B 2A83A 2M2DA 5FDWA 1MCKA 3KR3H 4LPUA 4N90E 2V7HA 5F1NB 4BM7A 3KJ6H 3W9DA 1A7NL 1X4YA 2NZ9D 2R4RL 5FKAA 4PJBF 2PXYA 1JV5A 3QUKB 1U95A 4GO6B 1ZS8B 5D7LD 3F7VB 3IF1A 2IAMB 4U1HA 4LOUC 3QH3A 4LARH 1PX4A 4YFDB 3QEQB 4YUEH 4KHXH 5F1NA 5GZNC 4MXWL 4I3SH 3CZFB 2EEAA 5FM4A 4GXVH 2PW1B 3QUKA 4JFDB 2JJSC 3IKCB 1GZQB 1ZS8A 5FUOL 1YMMD 2IAMA 3BFOA 1OGAD 4LLVB 4YFLF 3D18B 4ZO8A 5BV7L 3QEQA 4H8WC 1U8IB 4CW1B 5IBTL 2DOCA 1FZKB 5EWIH 3QZWB 3CZFA 4Z7QE 3WKNA 3KJ4B 2GEEA 3I3BA 5HHQB 4OIIL 1X5FA 2A6KB 4JFDA 3ZT5A 5DQJB 2HVJB 2IBGA 3FN0H 1GZQA 2IFFH 1ZVYA 2LV4A 5JHLL 3U7AA 4QT5A 3QWRD 4L9LC 1U8IA 3BDBA 4G9DB 2AABH 1FZKA 3E6HB 3QZWA 3E3QE 3ARYA 4NWUH 4OZHB 4NBXB 1NCDH 4N0YL 3P73B 1FSKC 2ZCHL 3S34H 4Z7UF 2A6KA 2AS5M 5J1AB 2VWEC 2JJTC 5EU7C 3V5DB 1U2CA 3DV6B 5DQ9A 3CUPA 1N59B 3IXTB 3E6HA 4KZEH 2MCPH 2XZZA 3VRLE 4KQ3L 5T3ZH 3WHE1 4XTRD 3MRCB 4U6HB 5J1AA 5DHVB 4NQCB 4YIQB 3NA9H 5JIHA 5CUSH 1EBAA 2YD5A 3V5DA 2ADFH 1NAMB 4KJQC 3DV6A 4PRAB 2HMID 4Q2ZB 2AJUH 5T3XE 1N59A 3IXTA 4U1JB 2MJWA 3GDBA 4V1DB 3TFKD 1VFBA 5D7SH 3CLFH 5KAQG 4LCWB 4ODSH 3MRCA 3WDIA 3NAAL 4JDTL 4P23D 4NQCA 4YIQA 4JJ5B 2Z31B 2BY1A 1NAMA 4ZXBC 1HNFA 4NUJB 4PRAA 4Q2ZA 4U1JA 4V1DA 2AJSH 4PRBB 3OGCB 1P9MA 4WJ5B 5FKPB 4M48L 3NA4A 2AQ2A 4LCWA 1NEZA 1FH5H 3E1F1 1FFQA 2Z31A 2HRPH 4DVRL 3Q1SH 1QUNA 4NUJA 4YXKL 4HUMB 3WHE0 2R0LL 5C0JA 1H0DA 4JFYB 4ALAL 4DFHA 3EJZC 4FTVE 5DUPH 1IAIH 3OGCA 5CJOL 4WJ5A 5ESVA 5FKPA 2IGFH 1NMBH 5FGBC 4JO1L 5BO1L 1NEZG 1OPGH 1A6UH 3C2AH 4XVSH 2VN4A 2I07A 4QOKD 1CE1H 2NY2D 1FNSH 4PYGA 4XHQA 1AD0B 1FLTX 1VESA 4U3HA 5KSUB 4JFYA 4M3KB 1J8HB 2H8PB 5CLTA 3P9MA 4Z7WF 1MY7A 2HWZH 5FYJE 4KROD 2VLJE 1BVLB 5INCB 3VCLB 1MFCL 4KKBD 1EH9A 1KPUB 1NSNL 1MELA 1X5ZA 3DOSA 1AD0A 1MHEB 1S78D 3VFOA 3PWPD 5LXGH 3W82A 3AU1B 5KSUA 3W2DH 1P84K 2K3TA 1J8HA 2H8PA 5I1CL 3O9WC 43CAB 4K8RD 1O0VA 5C2BH 2A38A 3VCLA 2GCYB 1CLYH 1NFDE 1MQKL 1FFOB 2FD6H 4POUB 5DFVD 1MHEA 3QCTH 3ULSB 1WWBX 1VGKB 3AU1A 1CI5A 3BXNA 1IGML 4K94H 3T3MF 1BAFL 4PGDB 1B4JL 1HKLL 1MJ7H 1FGVH 2VLRD 3E6FB 4NBYB 1WEJH 1YY8A 2GCYA 3JV4A 4OLEA 4R2GD 3QIWA 1FFOA 4LSQH 1NLBL 4Z7VE 3P0VH 3ULSA 2ZOKA 3HNTH 3P11H 1HQ4B 1VGKA 3IETA 4OTXH 3SDDC 3B5TA 4NCC1 3S6CA 4PGDA 2HTKC 4YK4B 4EN3C 2CK2A 2XT1B 1X9QA 1RHHB 3TP4A 1SYSB 4XVJH 3DXAD 3FQWB 1DBJH 2HKHL 1MAMH 3EKCA 3MLSH 4FQXB 3TT1H 2ZJSL 1HQ4A 4IS6B 1W72L 2HN7A 1YEGH 5FGRA 1WT5C 2BVTA 1U8MB 4LEOB 2MSPA 4OLYH 5D7KE 3FQWA 3ARXA 2GJ6E 5I1LB 4FQXA 4O5LH 4KMTL 4ETQB 4OCYH 2UVFA 1BPVA 2IWGA 1OCWH 5HHMB 3SDXE 3QHZL 5L88L 2PO6D 4IS6A 3KPPB 4ONOA 4KVNH 2E27H 5I8KH 1U8MA 4ZFGH 4LEOA 3BIKA 4RWYL 3FOLA 3EO9L 4LHJB 1OAKL 5BS0E 5I1LA 1KIUA 2EH7L 3D25B 1ZMYA 1RK0B 1ZVHA 1KCUH 5BJTA 2NY7L 4X6DE 1WAAE 1WWAX 1G9ML 4GMSH 5CIPA 3D9AL 3HE7C 4U7MA 3KPPA 1I3VA 4WI7A 1TZIB 5AZ2L 4OZFG 4CN4A 5GPRA 1GAFL 4N0CD 4NJ9L 4RISH 4N8VG 5H35B 3SQOL 1S3KL 4YDIL 1BZQK 2BK8A 3D25A 1I1RA 1AGFA 1ZLSL 5I1AB 2OR9H 4YXLL 5I73B 1EHXA 1TZIA 1QRKA 2EIDA 1YPZF 3VFSB 4G7YL 3ARDD 2HJFB 4ZUUA 3SBWC 5H35A 4M62L 2RHEA 2NY1C 2IC2A 4PRHD 1CICB 3O8XB 3KYKL 4XAKE 1DQLL 5DEGB 2XTJD 2Z8VC 2VDMH 1CCZA 1QD0A 2PETA 1QRNE 4M1GL 4ELMF 1NGZB 4MQSB 3BN9C 2DQJL 4N9GB 5I0DA 5IVXF 1T2QH 5MI0B 2HJFA 4BA8A 5HGDB 4LU5L 1CICA 3GMOB 4TSBL 3O8XA 3V5HB 4XB8A 5DEGA 3O45B 4KMQA 5GS1B 4P4KD 1F45A 1TVBB 2FBOJ 1NGZA 6FABH 5B4MC 4N9GA 4PB0L 2E7LA 5HGDA 1SY6A 2GAZB 3GMOA 5F3BB 5F9DC 1CDCA 2Z91B 3CC5B 4MVBD 3O45A 3KLHD 5GS1A 4ODUA 3NACL 1TPXC 3HMXH 3GJEA 1TVBA 1EAPB 4P23B 5LCVL 3RX5A 4LGRB 1UA6H 1CK0L 2DDQH 5E24E 5CJ5A 1HWGB 3LEYL 2GAZA 2C7UB 5F3BA 2W9EL 3IRPX 3HNVL 3CC5A 3TYFB 1NQBA 3G9VA 1RUAH 1JNHB 1EAPA 3BP6A 4XP1L 4Y0GA 2BHUA 3ZTNH 4KZDH 3OSKA 3S37L 1FGNH 3VI3F 5GGRY 2C7UA 3TYFA 3INUL 3CDYA 1IFHH 1BLNA 1JNHA 4L3AA 1J86A 1N5YL 4KKCD 2APTA 4M7LT 4BZ1L 5J06A 2BNUB 3C5ZD 3S35L 4BUHA 3DNKA 1IQDB 2BVQB 2HFEB 2YN5A 2O61B 4K23H 2JELH 3PXHA 2BRQA 1CFTB 2R9HD 5GRYA 5FV2A 5MEOA 4P5MA 3P77B 5DK0B 1QBML 1DQTA 5SV3A 3AC0A 4NDMA 3VFMA 5CGYD 3MNVB 5EZOL 4RBPH 1OHQA 1IQDA 3QQ4A 1EPFA 1BQLL 5E6ZA 2BVQA 4I3GA 4F7MB 3LRHA 5JHDE 2AAVA 4NZUL 4LQ1A 1CFTA 5L2KA 4GRLC 3DO7B 3P77A 4JO4H 1EBPA 1NCUA 1E6JL 1TNMA 3LN5B 4KQ4L 4KJWC 1JGLH 3FB6A 5J8OA 3VRJA 3PUCA 3PQYB 4B53A 1KF9B 4ERSH 3PWUB 4F3FA 4OCMC 1ND0B 4JPIB 2P49B 3DO7A 1P6FA 2DIJA 4R2GB 4AZ8A 3UTSB 4HKZB 2XG4A 3PQYA 4TUKH 1PSKL 3PGFL 4WI4A 5I1KL 3PWUA 4OZFH 2DTML 1OWRM 2A2QT 3ARBD 4YGAB 2HH0L 4JG1H 1J10A 3VDAA 3RWCB 4U0RB 2ZCKL 5FA3A 3TBSB 3R1GL 3BH9B 3OG4B 3MCLH 4XWOD 3UTSA 1CF8L 4AEHL 1QFPA 2HLFD 3MGTB 5DHXB 1N4XL 4Q9RH 5DMGC 3BMWA 5ISZD 3RWCA 1DBML 1T83A 5HDQL 3QEHB 4HFWB 2JB6B 1U3HD 3TBSA 1JPTH 4JPKL 3RY6C 5HYJD 1T6WA 3QBTB 3MGTA 2V6HA 3MR9B 5E6ID 2PO6B 4EI5C 1YJDC 1HH6B 3GUTB 1IILE 2DF3A 3RIAF 4OCRH 4DEPC 3VXRE 4A6YH 1J0KA 4MNGE 3QEHA 4HFWA 2OZ4L 1FL3B 2CJUH 3QSKB 3WO4C 4Y1AA 5GRVL 4YE4H 1MEXL 1TQCC 3MR9A 1NFDF 3PWVB 5EORH 3GUTA 4X4MA 5FHBL 3MV7D 4PPTA 1MIML 5E8DL 12E8H 1IGFH 5JIKA 3E2HB 4XMPL 1FL3A 4P49A 4YDKL 3QXDB 4WWID 2BJMH 2IPUK 1OSZB 4LASH 3LCYA 4J2XA 3G6JE 3NCJL 1ZA6B 1N2RB 5D5ME 2E7MA 1QA9A 1NCAH 2I9TB 2NY3D 1F4YH 3KG5A 4UMGA 4JM4H 1KG0B 2Z0BA 3MBXL 1OB1B 3ARDB 4TRPH 4HWBL 3QXDA 4PRHB 4YHIB 3BP4B 1OSZA 3SJVE 1Y18B 5IVOA 3ARGD 2XTJB 2ZNWA 3FONB 1ZA6A 1CD0A 4PG2C 1N2RA 4ODBD 5T1LB 2NW3B