3WFEL

Reduced and cyanide-bound cytochrome c-dependent nitric oxide reductase (cnor) from pseudomonas aeruginosa in complex with antibody fragment
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
213
structure length
213
Chain Sequence
DIQMTQSPPYLAASPGETITINCRASKSIRKYLAWYQEKPGKTNKLLIYSGSTLQFGIPSRFSGSGSGTEFTLTISSLEPEDFAMYYCQQHNEYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of reduced and ligand-bound nitric oxide reductase provide insights into functional differences in respiratory enzymes
pubmed doi rcsb
molecule tags Immune system/oxidoreductase
molecule keywords antibody fab fragment light chain
total genus 51
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2013-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wfeL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wfeL01
4Y4FC 3X3GL 1DL7H 2VDPH 4ZUUB 5IWLA 2JJSC 5TE7H 4UT7H 1P9MC 4PRDB 1IKFL 3PUCA 1C08A 2LTQB 1WQVT 1NJ9B 5FCSH 2VDQH 4RQQB 5D2NB 5EZLA 4TN9A 4JFEA 5E9DD 2XZCH 5T3ZL 1FC2D 3OKDA 2ITCA 5I1JH 9CGTA 2IPTH 5FGBC 1A7QL 3H2WA 1V7MH 5ICZA 3MA9L 1G6RA 1QBLH 2IANE 3S36H 4ODTL 2R0LH 3TP4A 4U31A 2XA8L 1PG7X 3JTSA 3BEWA 4V1DE 1BFTA 1NMBL 3MLTA 5DS8A 4KWUA 1AXTL 1KSRA 1GAFL 3KYOA 5D7SH 1BJMA 5F7HA 3C6LA 3B2VH 5FCUH 1C12A 1MJ8H 3BHBB 1BQHB 4ZUSB 3CVHA 2XZZA 1MFAL 4HFWA 5EFIB 4NZTH 4PGEA 4YBHA 1H15A 5IHZA 2W65A 1LDSA 4B5EA 5SX5H 2O5XL 1DBBH 2VLLA 1IAOA 1G7LB 1U8NB 3N9GH 4ZODA 2VMFA 1EGJL 3WN5A 4U3CA 4U1SB 3JWOL 5GS1B 3RDTC 2J8UF 3SKMA 3MRLA 4NZUH 2GIYA 2ATKA 3U82B 4ODVH 1NLDH 2HTKD 1EJOL 2OL3B 1RK0B 4JKKA 1VERA 4M1CD 1QSFB 3ROLB 5L7XH 4M48H 5DQ9A 3U6RA 1T5WB 2CD0A 4QHUB 4GXUN 4QRTB 1AR1D 4ZD3H 1QRNE 1HQRB 4AZ8A 5LJYH 3HC3L 1BFOB 4RWYL 2EDTA 5HHMD 4OLUL 3WXVL 3OKYA 3OKEA 4AMKH 4O2FA 5FF6A 1A64A 3DI2B 3MRMB 3QUYD 3P77B 3SDAC 3UZQA 2G5RA 5JMRA 3SKMB 5B22A 5HHVH 5ICXA 4HK0B 3HUJE 3BKMH 3VDCA 3PWVA 3VGBA 2X4NA 4CMHC 3V79C 2HT2D 1PQZA 1JGVH 5C07A 2R29H 1LWRA 2VDOH 3GSQB 5DZLA 1RIHL 2BFVH 3W39B 3GSQA 5IBUG 1XT5A 1G7MA 4GUPA 2CIIA 4WEMB 4KI5D 4QEGA 5FKAA 4JDZB 1NGYA 2YXMA 5I9QC 1KB5H 2O5YL 2NTFB 2X42A 5KBNC 1ORQB 3QYCA 4LCWE 1J5OL 3CFCL 4JFOB 3VFVA 1K8DB 2JIXB 1YPZB 2NXYD 4X6FA 2JJWA 1A3LL 1UWEL 2X4QA 1J0JA 2ENSA 2Z4QA 5C9JB 4JY5H 3VGDA 3P0YL 2WUCL 3N1QC 4OCSH 2P8LB 1FAKT 4ODSL 4HUKB 4R4BA 3UTSD 1OT2A 3ALPA 1P7QB 1HILB 1N2RA 4CMMA 3R1GL 5IM7B 2VLJA 1KJMA 4XWOC 3PQYA 2BRRL 5E95B 1IL1A 3QUXA 3BHBA 3CFCH 4ZUUA 3QIUB 1TIUA 2NW3A 2IH1B 2XWTB 3QUZC 4DN3L 4Z7NE 1IKNC 1C5CH 4OCRH 4EDXB 3MLWH 1KULA 2ZCLL 4U2YA 5EUKB 1UXSB 3D25A 1WCQA 5FUOL 4Z76A 4NQDA 5GIRB 3HLAA 1G9MC 1DUYB 5GRJL 3B9DA 3M17B 2YPKB 3EGSB 4TVPL 2QSTA 3B5HA 1IC4L 3BUYB 1ZHKB 3NABL 3D9AL 4PJGF 1NGXB 2P4AB 2NYYD 5JQ6L 4HIIA 4A6YL 1WIUA 2YUWA 5GRXG 3ZTJH 4YPJA 5T1DH 3D69A 1YEKL 3ARFC 3A6CL 1YEEH 3LRSB 3PWLA 4E0RB 1Y6NR 1JWSB 5GZNC 4P5TB 2J88H 4Y4KB 5INCA 5TFSL 1KYOK 1IGFL 4U6HB 4OM1H 1DBJL 3H3PH 4ORZC 1T3FA 2I60H 5ESAA 5F7EL 1BVKA 3MLPA 1A6VL 4P57B 2AI0H 5T3ZD 3C2AH 5EIQA 2OZ4L 1FLTX 3C60A 2VERN 5DD5H 5B39A 4Q9BA 1AQDB 1U3HA 3IKCA 5LAXB 3HC4H 3H8NA 1PG7H 5B4MC 4ZXBB 2ZOKB 1S9YB 2Y25A 4KQ4L 3LN5A 4O5LH 5ILTL 5F8QC 2V5RA 3U7WH 4ZYKB 4NQCE 5HVHB 3H3BC 1FPTL 2AEWA 4KK5C 5KJRL 3JUYA 2OTWB 3BPOC 5IMLA 4NWUH 1A9BA 2X1WL 5KZCD 4WW2B 15C8H 2FRGP 2F5BH 1GOFA 4OSUL 1MFAH 4HWBA 3L6FB 5E5UB 1ERNA 1ZHBB 3IFPB 4YDLC 4UT9H 2A0LD 3KHOA 1XGTB 1IM9A 1GGCH 3SDXB 2Y06L 4RAVB 3WLBB 2AGJL 4ODXB 2UV3A 2OR8A 2YD8A 2ZUQC 3B9KB 3B2UC 1SJHA 4L8BB 4LCYA 4PGBB 4QO1A 5FYJH 3S7GA 3SCMC 4TSBL 3SOBL 1DJSA 1G9NL 2NY7H 2EE6A 4WWID 2YPLD 3HG1B 1JPFA 1XCQB 1WVZA 1A7PH 4CNIB 1CD1A 4OAWB 4YHKL 4GBXA 3T4YB 1LEGA 2PCPB 2XZCL 1WZLA 4NWTH 4PY7B 1C5BL 4NN7C 2DI8A 3ARBC 1HHHB 2ZSVB 2NY5H 4NUJA 2EDHA 4NPYA 3WIFA 4LQFL 2XPGB 2XZAL 1KXQE 2ZUXA 4M6MH 3HMXA 4AM0B 3MXWL 1L9NA 3ETBF 3EYOA 1A6ZB 1K8DA 2AXFA 3P40A 4L9LA 4QOKB 1FYHB 1EFXA 3D85D 3MLRH 5JR1L 4LSRH 4M1GH 4ZOAA 2HAZA 3OF6A 3WSQH 4K7FB 2A0LC 4OCWL 4JQIL 1QHOA 2CIIB 2DF3A 3OZ9L 1ACYH 4UV4H 4WTWA 5T1KD 1N5AA 5GS1C 1G7PB 4PLKC 4LDEB 4U1MA 4HUXA 3SKOA 4Q97A 2X4SA 3ZL4L 1OL0A 2ZUVA 3MRDB 5HYJB 2YKLH 4G8GB 2NW3B 3VFVB 3FQTB 1FGVL 1GL4B 4G8GA 1FZJB 2O5YH 4J8RA 4POZD 4LLDA 3HCVB 4JGJA 5CD3B 1NMCC 3VD9A 5HI3D 3RWEB 5TE4L 5HDOA 1FNGA 1MFCL 1ZLWH 2P8LA 4QCIA 1EXUB 1BJ1H 4G6JH 5JNYB 3LN4B 1FNGB 4MNHA 4OLEA 4KZEH 4P3CL 2QQNL 1JF5A 2Y7QA 2VDLH 3LVEA 2OMNA 2CMRL 4ZQKA 3U0PA 5I17A 1MCIA 4R2GD 4K94H 1AP2A 5D7JA 4DKFL 2YPVH 3MJ9H 2ZUYA 5DQJB 3R1GH 5FUCE 4DW2H 3OXRA 1AD0B 3ECBB 1F4WH 4DTGH 1GGCL 5D93C 2JE8A 4M6AA 1YEJH 4ODWA 1Z3GH 1IE5A 3G6JB 2GJ6D 5FGCE 4P2RE 4MD5B 4AIOA 2YN5A 4BFGA 3IDUA 5JW4R 2V2WB 4YO0A 4JFPB 4I9WE 5T5NG 4HT1L 2P46B 1LD9B 2BNRA 3NZHH 3BIKB 3QEQB 4P0DA 4TYUA 5E9DB 5B21A 1DVFC 4WY7H 4Y4HB 5JPMA 1N6VA 4KHTL 1MH5A 3F12B 4JHWL 4WO4A 2G75B 4P9ML 3TCLA 1TJGH 4G8GD 1MFBL 1NL0L 4OKVA 5EU4B 1XGQA 4HUVA 4HG4K 1PZUB 3SDAA 4JFFD 3MROA 1HXMA 1I9RH 3NCYS 1FAIH 3FO0H 5IVZB 2EDFA 4A2MA 5HI5C 1IAOB 4Z7WB 3GBNH 2BOCA 2IQ9L 2FHFA 5IW6A 2GHWB 3H3PL 1QFWI 5BXFA 4WCYL 3IDYB 1LEIA 1OD9A 4YR6B 1YEDA 3OZ9H 3S36X 1Q9OA 2DD8L 1P53A 1OWRM 5BVJB 3DROB 5GGSY 2IALB 3WLBA 5JUEH 4LCUB 4GG6B 3TYGH 5IBTL 2W1NA 4JVUA 1F58L 4JM2F 1CDGA 2EDYA 5I1DA 2XKNA 3NIGF 5D2NC 4WW2A 4ZFGH 2VZSA 4QRTA 3TIDA 1XGRA 2W0PA 5HDBF 3QH3B 4MJ2A 2YUZA 1ADQA 4HH9A 5J1SC 4NO5B 2X9WA 1OCWH 1GH7A 1WWAX 3EHBC 4IDLA 3LKQA 5C0FB 4JLRA 1H15B 5DFVC 2HRLA 3BUTA 4E5XA 3U0WH 4WI6A 5DYOA 4FXGB 4GSDH 1E6OL 5F96H 1CFNB 3IDGB 5B39B 2E3VA 4P2RD 3WN5B 5CZVL 1T66D 2HVJA 3C8DA 4WV1B 5CEYA 3X12A 3T0BA 3BN3B 5IMOA 1F90H 3NIFE 3O9WD 3NCEB 4S1SL 2OMBA 5ADPL 3KYNB 3ISWA 1XF1A 4G3YL 1QR4A 3CZFB 1NC2A 4JFHD 2Z8WC 2I60L 5EDXA 4YDVA 4FQJH 4BFBD 2VLRD 1F6AB 1E6JH 5EZLB 2RGSA 1RIUL 5I1LB 3D39D 5DA4A 3KLAA 5I76A 1N0XL 3UPAA 5J6HA 5TGBB 3EKCA 5LGHH 3E2HC 1SBBA 1ORSA 4OI9A 4JHAH 4G9DB 3L3JB 1EGJA 2NNAB 1IC1A 2H2PC 3BPNC 1P5UA 3C87A 5LQBL 4TNWK 4BQ8A 2CO7B 5GJTL 5DHYA 5DI8B 1I3RB 2VXVL 4F15C 4XPBL 4ZNEA 3GSVA 4GXUM 1ZANH 1HOCB 5KVGL 2BFVL 4RX4A 3ULSA 2Q86A 3R8BB 1NCCL 5JHDB 2VIRA 2DL2A 2FDBP 3UBXG 3WUWG 1OY3B 3SDDA 1WAAE 5C0NC 5IMKB 1HXYB 2PYFA 4P2CG 5IB3B 2H2PD 1FVDB 4PY8I 1F6LL 3AGVA 3BD3A 5ACMA 4N0UB 2VDKH 5BXFB 1LEIB 3DVNA 2P44B 3PWPE 4TOYH 4BUGA 3O4OB 4RRPA 1A7RL 5DUMH 5K9OA 1QP1A 1U0QA 2QSQA 2R0KL 4LBEA 3DXAB 4JO4H 4K2UL 4QXTB 1UJTA 4KTYA 1NC2D 3P9LA 3QZWA 3ZYOA 3BH8B 3FQWA 4MA3B 2WK2A 4NRYA 3RWJA 1HZHL 2UUDH 3O9WA 1G9ML 5BMFH 2XWBB 2E9WA 4XCCH 5JOPE 2Y1VA 1QLFA 2AJYL 4Z7UA 4YC2B 4P2RA 4LIQE 1HXMB 3EAKA 2QQKH 4DN4L 4XMPH 5CEXB 2EDJA 1T2QH 3BO8B 1PKQE 1EEZA 3HE6D 1CFTA 5C0EB 3QO0B 1EK3A 4LLYB 4E42B 4YHYC 4KROC 3WIIL 3GI9L 3MV8A 3EJZD 3VWKC 5I75C 4X5XB 2HFFA 4GMTH 3HFMH 4Y4HA 4EUPA 4WU5A 4JPVH 2E7BA 3BEWB 1YEHH 4JFZL 3TBWB 2CSPA 4LNVA 4AH2B 5CP7A 1CS6A 5T3ZE 1RSFA 4P23B 1HEZB 2LABA 1EO5A 5I2IA 1A0QL 4MZ2A 3Q5OA 3WEXA 5HD8D 2ZG1A 4Y88A 4OTXH 4CDHA 2XN9A 1FVDA 4PJEF 5E2WL 1AKJB 2FSEB 3O6KL 4ODTH 4LPUA 3VFTA 5TQ2H 3BP5B 2VXUL 5BVPL 3MUY1 1KIQB 5KZCB 3U30C 2QKIB 1BVZA 2Z31A 3DO3A 4BQ6A 4J23A 3PL6C 1UWGH 2D31A 5DHYB 2BDNH 3ZT5A 2C4FU 2I9LA 4P5KB 5KS9A 2I07B 1IZJA 3I9GL 3ILQD 4GAYA 1SVZA 5IT2H 4XPFH 5EO1A 3CX2A 3GZKA 2DAVA 4NHCL 1YMHA 4YXHL 1QA9A 2FD6L 4OGZA 4XH2B 3HE6B 5BVPH 1CLOH 4H1LH 4U6YB 1MVUB 4KHXL 4MQ7A 5ECJE 1CFNA 5I1LA 3B9VA 4EVNA 3MCG1 3PQYE 1WGOA 3SDYL 1RJYB 1KELL 3LMJH 2C4FT 1FVCB 3QIBB 2C1OB 4A6YH 3VXSB 1INDH 3SDXA 1MCSA 3QZWG 3R4DA 4HAFA 1YY9C 3SY0B 2CLRB 4EN3A 3FTGA 1VFAB 2Q8BH 4I77H 3RTQC 2G5BA 2K7PA 4YHOH 4U05A 5GS0C 3W82A 4RRPG 2ADIB 1OTTC 4RGND 3FO0L 5CWSA 1K5NA 1ZWIB 4ORGB 3T4YA 4PJFB 4W6XB 4RQQA 3NAAL 3ES6B 2BNUA 4D94A 1XF2B 3IRZA 1ZGLA 1TZGL 3LY6A 3PDOA 4U0RC 1ZTXL 1BD2B 4JLRB 3WIFB 1RD6A 1HIML 2PO6C 4IIQB 1OAKL 4JB9L 3CX5K 4ODXA 1UQSA 3MJGX 3L7EA 5C2BH 2R4RL 2VLKB 3IKCB 5LAXA 4WNQB 1QUNA 4WV1C 3NZ8B 5TE6L 2NW2A 4OZIA 1U8PB 5CGYD 2GQHA 5HHPA 4F9LA 3GIVB 3RWIB 3MBED 1EHXA 4L8SC 3HUJA 3IAPA 4ZYKA 5K9KB 4MA8L 4EBQL 1MIEH 4IRZL 4K55A 2J2ZA 1BOGB 3QXWA 2VR9A 3I02A 4OD3L 1N6QL 4FQCL 2VSDA 3IKKA 3D85A 1JJUA 4U7KA 2IBGA 3D2UB 4IIQA 5JXEC 2Y07L 5IJKA 3QIUC 4KRLB 4XXCA 1TFHA 1INEH 5LBSH 2KQNA 4PLKD 2EDDA 2X5PA 3VFWA 3T0DA 3R0NA 2A73A 5EC1A 3S5LG 1XR9A 3OKLB 5MEQB 4QRPA 5B39G 4RMWA 1P7KB 1QZ1A 32C2B 1DBAL 2NY0B 5DJ8A 1MH5B 3LN5B 4N9OB 2GJ6B 1FJ1B 3I02B 5J12B 4XP5L 5TPWL 3U0PB 4KH2A 2PTUA 3FO2A 2AJVH 3PHQA 2Z8VC 1ACZA 3BAEH 2ZKHL 1Z2KA 4Z7WA 3TJEH 1SEBB 1RJZA 5HXMA 2V7HB 1I9EA 1XF5A 4QCIB 2YPKA 3QHFL 2J8OA 2H6PA 2HT4D 3RL2A 4OCWH 5HHQA 4QRPD 4IOSD 3W9EB 4K3HA 5GGSA 3F5WA 4UQ2B 3Q6FB 1YNLL 1LD9A 1KEML 2XA3A 3SGEI 4GMTL 5I8CB 2NMSA 4XX1E 4JDZA 4LSSL 3OL2A 2FJGB 3HPJB 2I9LB 2CJUL 5EU5B 5C2BL 1UXSA 4JFEE 1J0IA 3RWGA 1VFOA 2H26A 3KPSE 3S88H 3LKPB 4PG2C 4NWTL 5FM5M 1F8TL 5CZKA 3TFKC 5CD5C 4JVPA 4Y5YB 2MFNA 1FFNA 4HXAL 1X6LA 5TDPA 3I50H 5HDQH 5L8LB 4R97B 2Z4QB 2A6IA 4KAQL 2DBJA 4G5ZH 3VD7A 1N64L 2DM2A 3MLZH 4WI9A 1QFWL 2BSRB 3TWCL 4OUOA 4R26H 2JJUA 3WIHL 3SGJC 3X14B 5LGHL 1MFDH 1AXSB 4DKDC 1URLA 4LF3A 1FNLA 4RFNB 1JNLH 3WIHA 2DM7A 5IESH 4EZMA 1BD2E 1SYVA 4XPGL 4D8PA 3WKNA 5ELIA 4NHUA 1H5BB 4PJFE 3TYGL 1JPFB 5CJOL 4AIZB 5I1JL 3SDDD 1T7VA 3TBYB 2WQRA 1HKLL 1KJ2H 1MRFH 3GGWA 3GO1H 3FQTA 2NZIA 3E3QC 4F15B 2APTA 3MNWA 4Z78B 1QQDA 3L3IB 4NPYB 1VFBB 1GJIA 3TVMA 1JMXA 5KN5A 5GJSH 4M7KH 1U58B 5FYLH 2XTLA 4G7YL 3C5SA 4GSDL 1OGAA 5IQ7L 1JI1A 2LV4A 4LVOB 4Z9KB 5HY9B 1AGFA 2VAAA 1RZ8B 5C07B 4HWUA 3U6RB 3LD8C 4NZTL 1BIIA 3VGEA 3ZDXE 4P9HH 3SPVA 4G8FA 3W5NA 3IGAB 3G08B 5SWQB 5EOCJ 5AD0B 2EYSB 2HRPL 1Z9OA 5I15H 4JQXA 5K9JL 1T4KB 1OTSD 3MV11 1EX0A 3HR5A 1FFOB 4EKXA 5FYKD 2VTFA 3OKNA 4F7TB 4I13B 1V7NL 5DMYA 3QAZC 4N1EA 4MA1C 1D6VH 2Q7YA 1GVIA 3NZ8A 1I8LC 4HX1A 1F58H 1U8PA 3L3OB 5HHPB 2HKFH 1R5VB 5C0GA 4UMGA 1H3TA 3ARYA 5IV2B 2BVQA 1HYSD 3BDYH 3VH8B 4LP4A 2DM3A 4MNQA 2ZOKA 4I2XE 1DE4B 1JZ3A 3KS0H 1VKXA 3VD4A 3TPUA 4LQ1A 1R3LA 3HFML 4GW4A 4O9HL 5I1GL 3U46A 4NRYB 2GCYA 3LEXA 5FK9A 4ORGA 4PJ8C 3QT2A 3PWJA 3ES6A 3B5TA 4WFHE 2MHAA 3NCJL 3OKMB 2ZUTA 4GRLD 2WAHA 5FUZL 3CSYB 3FRPG 5CBEA 2LTQC 3S6CA 2DM4A 5J8OA 4ZUWA 1H3WM 4FQHB 1AJ7L 4MJ5B 5DZNA 4CAGA 3MLXH 2Y36H 3FB8B 5EPMB 2GTWA 4LFHD 5BS0A 4TOYL 1EMTH 1OPGH 4XVTL 3WE6B 4ZFOL 2R2EA 4PJAA 3DETD 4O02L 1KNOA 4CU7A 4I4WB 1NGXA 2H1PL 3QUXB 4DAGH 2ERJC 1KNOB 1J8HE 1B0GB 1GOHA 1IBGH 2XQBL 5HHXL 4TULL 3U36B 5GGRY 4XP1L 1N59A 1OGAD 3OPZL 4BQ9A 5TPWH 5D5MA 4PJHF 5EUKA 2ILLA 2ITCB 3NA4A 3H9HA 4KPHL 5C0FA 5I1KL 3PABB 3WFDL 5D5MB 1Q72H 3OTTA 3MV9A 2X1QA 4R4FL 5HHOB 2D7NA 5IF0A 4RWHA 5DRXA 4B0MM 3EYSL 2QQKL 1C8PA 5I0ZA 4PRAB 3TCXA 5I73B 2VLMD 5F3HA 1A7NH 4PRAA 1MCPL 4FQ2H 3PXJA 5FDWA 4GAJH 3HZYA 4PJBA 3NPZB 4X8JB 5GS2H 4JRYA 3TJHD 4P4KD 1T5XB 3KPNB 1UG9A 2VSCA 3HHRB 4WFEE 1YMMD 1JF1A 3PWNB 3WHE0 2MMXA 4NNXB 1KCSL 1RFDH 2A6DA 2FZ3A 1D5ZA 3CDCA 3MBXL 4O51B 4IRSB 4HZAA 2VABB 15C8L 4ZUWB 2CIKB 1FZOA 1FIGH 4JCMA 3PGFL 2BVPB 1RIUH 2I27N 3BJ91 1RUAH 5F9OL 5E2VH 4IOFC 5IG7B 4JFED 5E9DA 1KENH 4L8SA 5IBUB 3MRBB 5JPMB 5CCKL 1H3GA 3DI3B 1QFUL 1UM5L 1LP9E 2H8PB 1EHLH 1GHFL 1J1PL 4LCIH 5FO7A 5JMOC 5I2IB 3S37H 1XGRB 5JTWA 3JWDH 2VAAB 1ZEAH 5MEPB 1UWXH 3KNBB 3JBG7 4ETQA 1DN2A 2VXVH 5D1ZB 2Y5TA 1B2WL 5KW9L 3OGOE 1YNTB 4LSUH 3LZFH 1WT5A 1QQDB 5FF6B 3BP5A 1YYLH 5B8CB 5E8DH 1M71B 3EO0A 4X99B 4LLYA 4E42A 1VSCA 1CGVA 1N0XH 2D7TH 5EUOF 2P49B 1K4CA 1UM4H 2VLME 1INDL 2FLRT 1WCBA 3E6HA 2OZ4A 1TCMA 4FQJL 2A77H 4RGMB 2HG5B 3NIDE 2V17H 1T2JA 2HN7B 5IR1A 5EU4A 5HVFB 3M1BB 4LEOA 5D4QA 1I8MB 4G8GE 2N1KA 1UEYA 1A7QH 1A1MB 1SY6A 3NFSL 2XNAB 2VIRB 4U1JB 4RGNC 4YHMH 2ADFL 5F7UA 3MBEB 5HYJA 5GHWL 3TN0D 5CEXA 1C1EL 2YPLA 1C16A 3V52H 1WBXA 3BOVA 2O5ZH 1BHGA 1YY9D 1P4IH 1S7VB 3DGCR 4LSVL 3X3FL 1DEDA 1BQHG 1A7PL 1EAPB 2V17L 3RVXD 5FECB 1J1XH 1QSZA 5CJOH 4XAWH 4JRYB 3GIZL 2YEZA 2XOTA 3IDXL 2NX5E 2VISB 3GRWL 3O3EB 4NO3B 3H6JA 2HJFB 4PJAB 1NGZB 4ONHA 3UMTA 3QHTC 5MHSE 1G7HB 2NZ9D 4JPVL 5TQ0H 3ZKSD 4I5BB 4JKMA 5MENB 4JDVA 1FFPA 4AK1A 1KB5L 1IKNA 1LILA 1A5FH 2UZXB 4PIRF 4WO4C 5DJXB 25C8L 4OZ4A 4QRRB 1YC7A 1NEZB 5DMJB 3HPLB 3PL6D 43CAA 4X9HA 5F8RC 4ZDHB 1ZVYA 1IAIL 1MCQA 3MRCA 2W0KA 3F6LA 4HF5H 1BEYH 1NGQL 1WIOA 2R2EB 3KPOA 2Q76B 5HI4C 3MLTB 4YFEA 5JORB 3HI6H 4WEBL 1U8JB 3R0MA 4XTRD 4NQXA 4TUKH 3TPUB 3KHQA 3QQ9D 4N68A 1FLRH 4APQC 4XP9L 5BV7H 1KN2L 1YECH 2DQFB 1OTTD 1WBZB 4GKZB 5EZJA 1LO5B 2E9BA 3D3VE 3T0XA 1NANH 3PP3K 4MB5A 1CLZL 4P46D 4OLVH 1DBKH 4PJDB 1KCVH 2AABL 4WNQA 1T7YA 5I16B 4E41D 3VXQA 4M02A 4NO0B 4NNYB 1WZ1L 1ZT1B 32C2A 5DJ8B 2DIBA 4HEPG 1Q9OB 4XNQB 1LHZA 4AQOA 4PV8A 3MRRA 2I5YL 1N7ML 2YZ1A 4JJ5B 4N8CL 4FFVC 4IMKC 2XZAH 4P4RB 3MLRL 3CSGA 1NLDL 5EN2B 4JPKL 3VXSD 3DYMA 5EN2A 3RVVC 4CN4A 1E0OB 2C3XA 2FATH 1P4BH 2HH0H 4X7EC 4YX2H 1CFBA 3LKNB 4WWKD 5FHBH 2MWCA 2VLJD 3FOMA 3VE0A 5L6YH 1E4KC 3HNVL 4FNLH 1N4XL 3IFOA 1MUJA 5KVGH 4IOIA 1U8LB 1VB9A 3FN3A 3NFNB 4YO0B 1VACB 2B1AH 2HVKB 1ED3A 1OAYL 2C26A 2A9MH 2XKNB 4H20H 1ZLUK 3FTGB 4E9LA 2FB4L 3RP1A 4YBQD 4WGVB 2YN3A 1N3NB 1X5ZA 4N0CD 1AO7E 1KFAL 3AXLB 4Y4HD 4TVPD 4KHXH 3ARBA 4NWUL 3UBXI 4YQXH 1MVUA 4MQ7B 4Q6YA 3ZMRA 1G9NC 4PGDB 2A6IB 3VXNA 4E41B 3WN5C 1WF5A 1DLFL 4W68A 4HBCH 5MI0C 3VJ6B 3QPQD 3I2CH 1OB1B 3DUSA 3PHOB 3ARFB 4HFUH 3QDJD 3C5SB 1SYVB 4RMTA 1DVFB 5ID0B 2FJHA 3RX5A 4G80A 4R4BB 5DGQA 5KS9B 1NAMB 3S5LA 4QXGH 2YRLA 2VWEE 1EUTA 5TH2A 4UQ3A 1YUHA 4YXLL 4PYHA 5FXCH 4JFFB 3MRDA 4PJCA 1OSPL 1LNUA 1B0RA 1QFWM 5DD5L 1I8IA 4GW1B 3RIFF 4JFDB 1YQ2A 4X4MA 5FYLD 2IAMC 3OAYK 2DBLH 3PHOA 4TVSa 5GIRA 1NAMH 3UP1A 12E8L 5I1CL 4OZGE 3OR6B 3QPQC 4NIKB 5IVOA 1XCQA 2L0DA 4CVXA 1U3HD 5D70H 5E56A 1LP9F 4YXLH 4UAOC 4W70A 1N4XH 3IB4A 1LE5B 3PG2A 4ONHB 3OHXB 2E6JA 1KPVA 4ODHL 5F7LB 1WZKA 1A22B 3M1BA 1UWGL 1MF2L 2UVEA 1CQKA 1ORQA 5CSGA 4MA3A 4BELD 4JM4L 4Y4HC 3REWA 5FOBA 4NJ9H 4PTUA 2VITB 2QADC 4OFKA 2EDOA 2UWEA 4YBQC 1ZS8A 4EQ3A 4GXVL 4XMLL 2LVEA 3C6LD 3VFWB 4Z7UB 4NZDA 2QHLA 3SKJH 3ULUL 1BBJB 1CFVH 4C56E 4XAKE 4D9RD 1MWAB 3PGFH 1IEHA 1G7JB 4UB0H 1ETZA 3MLVL 1T1WB 3KPRB 4CJ1A 5KTEL 5HHQB 1P7KA 5F9OH 4FQQB 4ZXBA 2D0GA 1HYSC 4WUUB 1XGYL 5CEZE 4FG6D 4C4KO 1S9WB 4ODSH 4WUUA 5D2LF 5KSAC 3PIQB 4YHIB 1PKOA 5DSCB 4ELKA 5JOFA 2Q86B 1RUQL 5JO5A 4FMFA 3KPQB 1LP9B 2IAMB 2N4IA 2LAGB 4MJ4A 4P23A 1KTDB 1MLCA 4YNYA 5TF0A 3BGFB 5DRNB 4O00A 3T77A 1F4WL 1NLBH 4OCMC 1FBIL 2PYEE 5EOTA 5SWSA 2JCCA 3K2UH 4FQLH 1MCOL 3J7HA 4KUCF 3MC0A 5MI0B 3W81A 4QRPB 5C0AB 2XFXB 3ARGB 4I1NB 5F9WC 5D6DA 3EYSH 1XGPA 3BMWA 4Y0GA 3BP6B 1ZLVH 4HJGA 4J6RH 4L3ED 2FBJH 3GJEB 5CGMA 4DOHE 3JTSB 1UJ3C 4OCXL 4KXZI 1EDQA 2YMXL 4C54A 1NDGB 1KBGL 1LQSR 4FABH 1X7QB 1OAXH 3L95A 4HIXL 4U6HA 1U3ZA 5INDA 2P5EE 5GGQH 1OGTA 1CVRA 1JF1B 3PWNA 5FGSA 3P0VH 2YSSB 2ESVE 4HFWB 1FH5H 3D0VB 3WNOA 1PX4A 4JG1H 1IMHC 3H9SE 4HKJB 5GGUA 5KSBF 4HGWB 1JGEA 3KPPA 5J1AB 5HGGS 5MERA 5GRVK 4PJAF 4C55A 4U6YA 1OPGL 3GNML 5FDWB 4MJ6A 3QFDB 5D7IF 3VMPA 4HDIA 3EFDL 2CK0L 4X6CB 5HI3C 5LCVH 4F9PC 3DV4B 1P7QA 1ZEAL 1ZLWK 1A7BA 2X41A 2D9CA 3WLWD 3FT3A 3GK8H 3QUYA 5D1XD 2NXZD 3BN9C 1A8JH 5JZ7C 2P24B 3ZKMC 2IEPA 4QTIL 4PJDF 5CJQH 4JRWA 5BS0E 1JMZA 5E70A 4I0PA 1EBAA 5EOQL 3LKQB 5L88L 1KGCE 2HFGL 1D3CA 1OARH 1UEMA 5SWZE 1RZ7H 3FB8A 1GZQA 5GSRB 3KPSB 1RUMH 1NC4D 2GYSA 1CIDA 4L4VB 2W9DL 3FQUA 4MAYD 5DR5H 4Y4FB 5H94A 2AEQL 5IMOB 4PJ7F 5EBLB 1SY6H 2F19L 3P4NA 2VISA 4YLQT 4RMQA 1NDMA 5TJWK 3PXHA 1E4XL 2EDXA 1B0GA 4NQEA 2C1PB 5F44A 5C7XH 4GW4B 2MKLC 1MCNA 1XF3A 2DYPB 3IXAB 2ERJB 4MNQE 4NM4H 1NGYB 3HAEA 4PRHE 1IKFH 5C0BB 3SDDC 3UYOD 4G8EB 1SYSB 1OQOA 3LV3B 1QSEB 2EDRA 4MAYC 1NSNH 4AT6B 3P4LA 5IV2A 1GHFH 3CFEB 5E00B 2GITB 2JJSA 3KAAA 5DWUH 4PS4H 3QIBD 4XZUB 1CU4H 4DCQB 2AJUL 3F7YB 3VMNA 3BH8A 3FQWB 1NCUA 5FK9B 4OF3A 5A2KH 3KNBA 2DQHL 1AXTH 1D9KC 4QKXB 2A1WH 1CFQA 4GAGH 1YZZA 1Z9LA 5CHNB 4PJ9C 5D1XC 3BYYA 1D5XA 3BRFA 1T89A 4R0LC 4JFQB 4P5MB 2DKSA 4OI8A 3F65A 3RY6C 2IC2A 4EEEA 3VU2A 3WHXA 3D0LA 5A2IH 1FL6B 5HHNB 4Y4FD 1NFIB 1RAMA 5JW4N 4KI1A 3O6FD 3VWKA 2X09A 5C0IA 3FFCB 4ZQKB 1J8KA 2GUOA 2J6EH 2QQLH 3HN3A 4AQ1B 1MVFA 2PTTB 4XWGL 2NY5L 3P9MA 5FO7B 4ZSOE 1LO0H 1CDBA 1D5BB 3GSNL 1YDPB 2SEBB 5EU6B 1WIPA 5E1HB 3SGJA 1DL7L 2VDPL 3T2QA 4JRXA 4TUKL 2IFGA 5EU7E 4PLJC 3U79A 3REWB 3TC9A 1JPSL 4FZEL 4J1UA 1E27A 2R2HB 3WS3B 1HHGA 2BVEA 1R6VA 3TJHC 3V7AE 4MXVE 4ESKA 1OLZA 4HT1H 1S8DA 4K2UH 4KJYA 5T3XL 2X10A 4KJWC 5DJAA 5HI4D 3DX7B 3MUHL 1FV1A 3KPSA 3HNSL 5DI8A 5I19L 4LHUD 3T65B 3WUWB 1U3JA 3BZDA 1F3JA 3QB7C 4EXKA 1Q8MA 4HUUB 1I7TB 5ERWB 2WQ8A 3HPJA 2BNQE 1BD2D 1G84A 2OJZH 2W0FA 4AIXA 3QWOA 4OQTH 3K81A 4PJ5E 2EKSA 3O2DA 3ZE1F 3P11H 5HHMB 1T22B 3SE9H 3GMMA 3KLAB 2VAJA 4M7ZC 3LDBC 5TDPB 2I26N 3FFDA 3BKYL 3C6SB 2VDOL 3W2DH 4OZFG 4JM2C 3HZKB 4Y2DC 2H6PB 3NBNA 2V7NB 5JNYA 2HJKB 3S3JA 4U1NB 2ORBL 1EHNA 5ADOH 4PRIE 4U1HA 4XVUD 4LKXB 1ONQB 5DMGD 3QNXB 5EU6D 4P2OB 4EN3C 3NIDF 3TN0B 4XCCL 3HG1A 4IJ3B 2WINB 2PO6D 3WSQL 4ZG1A 4WW1A 4A2LA 4W6YB 3MJ7B 4PJCB 1AJ7H 3BSZL 4UT9L 3FQNB 4M48L 1OGTB 4YHLL 5IMMB 3VE0B 1KCUH 1M1SA 4NQDD 3REVB 1QSEE 5C0CD 3HC3H 3Q48A 4D2NA 1UZ8B 2VN7A 4OIBA 1WEJH 1JFQL 4PJ8A 4HPYH 3L3DB 4TNWF 3RNKA 4OFYD 2AXFB 3NFPB 4TUOA 2ZPKL 3T0EB 4FTVB 1T03L 4XP4L 1CD1B 4P9HC 5I1AB 4PB0L 1RU9H 4YE4H 5D8JL 5FM8A 3RGVB 5BRZB 4FQXC 3CDYA 3WKML 3A6BH 1JHKL 1BOGA 4XBGA 1CDHA 1MWAL 2FX7H 2XZQH 4KKCD 5DD0H 3WNPA 5EIIA 3RFZC 4IEFB 5D7LA 4PJHE 4YDKH 2MJWA 2B5IC 5T3XD 5E2UH 5DFWH 2IH3A 5CJ5A 2E7HA 5EBWA 3BQUD 4MHHG 1GC1C 4OB5H 2LU7A 4ZSOB 3F7VA 1U8LA 1KOAA 2OXGA 3A6CH 6FABH 2HJKA 1T1WA 1BWWA 2NY3B 4XNQA 5DDHB 2DLIA 3DX6A 3MBXH 4WHTB 4P46B 5EU6E 4Q0XL 3K80A 3RUGA 4LIQL 4WW1B 4G9FD 2VDLL 1HH6A 1RZJL 1JGUL 5C07D 3TA3D 5T1LB 3I75A 1A7OL 4NQUA 1J7VR 5IGXL 3LIZH 1GGBL 4QRRA 1EERB 1UZ8A 4LGSB 4PRIA 5BZDB 3PABA 3IDMB 4PJ8B 2X70A 2W9EL 1INEL 3B43A 5LBSL 4Z8FH 2C1OA 4QHMA 3HZKA 1KN4H 2H3NA 2LU4A 2DWEA 1NBQA 2C3HA 3RGHA 1AI1L 3H3KA 1QVOB 2OL3L 4KROD 5ANMA 4IHOA 2FR4A 1A6PA 3CNKA 3K4ZA 5FV1L 2OLDA 1L7TL 4Y19B 4M3KB 1JNNH 1WBZA 4GKZA 4WFGD 1YEJL 5ERWA 1X5HA 4LSTH 3FRPA 3T3MF 1NQBA 4M3JA 3LEVH 1AGEB 3WNLA 4QRRE 4Q9RH 3D18B 1UT9A 5AZEL 2OI9C 5DK2A 4KJYB 1KCKA 2F9BT 3VDAA 5D7LD 5A2FA 4JFXB 1RU9L 3VFTB 2GSGB 5FHBL 1NCTA 4NNPL 2HT4C 4G6AC 2P5WE 4I0CC 1U9KA 2M26A 4K3JL 4PG9B 1LEKB 1I7TA 2XQYK 3FT3B 1F11B 1SJXA 3P9MB 5F88A 3RA7H 2X4UA 4PRBB 2YD1A 5HSFA 2D7MA 4QGTA 2NY6D 5CGTA 3L5IA 4FXKA 2OJEB 5AWNL 4JQIH 2IWGA 3AU1B 3RZCD 4NC1E 3GJFK 5ISZB 4PJ8D 4U1KB 1A1NB 2YRPA 5FAAA 1H8OA 1XGTA 4MMXC 5C0AA 3V95A 2VXQL 1J05B 1J5OH 4GW5A 4MS8D 4F7MB 1DFBL 2ICWI 5DEFA 3DSFL 4MHHI 4JREC 4Q6IC 3QG7L 4EOWH 1A7OH 3MJ8A 4HFUL 1JPST 4RISH 2ZG2A 4JN2A 1ZSDA 4YHIA 5JXED 3RWJB 4R3SA 5GSVA 5HBBA 3DVGB 4GS7C 3QWRA 2F54E 4NUJB 4EJ1C 2DYPA 3IXAA 4BSVA 4DZ8A 1FRGL 5EWIH 4UILL 4NQTA 5FGRA 2HT3D 2HWZH 4WI4A 4AEEA 4L4JA 3C08H 3BP7B 4TPRL 4U0QB 1I4FB 1FZOB 1U93B 1BF2A 4K94C 1GZPB 5KAQG 2GSIB 3WCYA 2ZSWA 2OCFD 3CPLB 1PZ5B 2AEQH 2PXYB 1ZA6A 3MODL 3T3ME 1B88A 2DMCA 1DVFD 5BJTA 4TULH 1E4XH 2Z91B 4PD4K 2WBJD 2ZWLT 1QSFD 2IMMA 2VXTH 2CDEA 2OBGA 4XVSL 3ARDD 4WENB 4GMSH 4JHBA 3BXNA 4YEEA 3QQ4B 3QNYA 3QCVL 4ZPVB 4MX7B 2FX7L 2XZQL 4PJGB 3ULVL 5ESAB 3SQBA 1AGEA 3V5DA 1PD6A 4FFZH 1KTLA 3PGDA 4OD1L 3DMMA 3O41B 3FONA 4QHNA 4WRLA 5DJDB 1KJVB 1XZ0A 3LV3A 4OLWH 3RPKA 1MCRA 2ZPKH 1KG0A 1OAKH 1DVFA 1A6UL 4PBXA 4N8CH 2HKHH 3I84A 3PF2A 4F9LC 5IB4A 5CKAA 3CAFA 3JWDC 2AW2A 3CK0L 1PEZA 4NQVA 4J3WA 3N1PC 1YUHB 1MRFL 1DQLL 5JHDA 2ARJB 4GG8A 5F88B 5EO1B 1CE6A 4YK4B 3VXRB 5KVDH 4UIKH 4XBEL 3WFBH 2F53A 2MSPA 2JELL 3ARGD 4S1DD 4H8WL 1MY7A 4TVPE 3H9HB 4U2ZA 1ZK9A 4HKZA 1FE8H 3AAZA 3O8XB 3D3VD 4MQXD 5GGVH 5JUEL 5TGBA 4DTGL 4K9EC 1OAYH 1BPVA 3E8UH 4Z7VE 2BVOB 4O58H 4K7PH 1JIBA 5IFHL 5T3ZH 5FFLA 4WU7B 2ED9A 1X9QA 5F3HB 5D1QA 3H9YA 3MJ9A 4MS8C 4PJDE 3BWAA 3W2DL 1FPTH 7CGTA 1VKXB 1HKFA 2WNGA 4DEPC 2Z91A 3O11A 3S97C 2EDNA 4BH7A 1NCDL 1TJIH 2V2XB 1XIWB 3IF1B 5D96C 2ORBH 5HD8C 4M61B 2P5EA 5TF1H 3RZCA 1FO0L 4OGYH 3H7LA 3VXOA 3MOQA 5CBEB 1TPXB 3QDHA 1TJGL 2AQ3A 4IBLT 2J4WH 2EYTB 4X6DF 4U7SA 3BKML 3P73B 3VXUD 2DQUL 1S5HA 4MDIB 4L1DA 3KLHD 4NCDA 1PBYA 3NGBB 4P59L 3LH2L 3MV8B 1ND0A 3IDIA 3HNSH 4UOW0 5BVJA 3EJZC 4ZAKC 4FS0A 1E4JA 2BVQB 1BFSA 1D5IH 5D6CB 1RK1B 3HE6C 4P2YA 5BCAA 1TTUA 3BDBA 1NDGA 4PJFF 3B2UD 3QDMD 1X7QA 3CH1B 3TLRA 3VA2C 2VUOA 1YEEL 5FGBA 3BXNB 3TBSB 1DANT 4HKJA 5DF0A 4HIHB 1Q0YL 3TV3H 3EUUA 1CFSA 1V3JA 1PSKH 4C83A 3FFDB 5FGCB 4XNXL 3T2NH 3UTQB 4MJIA 4IDJH 4PJDA 1I7UB 4AENA 4ZFZB 4XC1H 4BFIA 2XACC 1SVCP 4I3RL 4PJXA 4MNHB 3CXDL 4C56A 3T0EA 5EIVA 2KUTA 3FQXB 2YD9A 4HJJL 4X80L 3TCLB 5D1XA 1C12B 2YKLL 2EEBA 3AFLA 4DN3H 4A6YA 1W0VA 2ENYA 1JYNA 5DRZB 1QSED 3AROA 3CFJA 2ATPA 2K3TA 4S10A 3O6ML 3RVWC 2Q87A 4JO4L 2E7LA 2OJEA 3MJ7A 5L0QB 2EYSA 5IBLD 4KMQA 3RJDA 2R56H 3ARDA 1LMKA 2P42B 3QEGH 5DVKA 4EVNB 2DQHH 4UB0L 5KOMC 5HVWA 3UO1H 5KTEH 4JFYB 3HI1B 1FC1A 2AV7A 3QA3B 5FYLE 1WFUA 1IT9L 1BGXH 4DVRL 3QA3A 4X83A 4K3DH 3PV6A 1TVBA 1YMME 3T09A 3QDMB 3K46A 1FO0H 3MUZ1 4OGYL 3VRLE 2AJZB 3AB0B 2ICES 3BQUA 2HP4A 5EUOB 2YA1A 2X4PA 2X7LB 3PWPD 5I17B 5ISZE 4P3DB 5F1IB 4UQ3B 3V6OE 3IXTA 2QEJA 1I1FB 4XPBH 1GSMA 2EH7H 1D6EB 4PGEB 2HA1A 4MGXA 3RKDC 1OP5H 3EOBA 3EO1B 1GGIL 2XIDA 4FQXD 4P2QA 4AEIH 5H2BA 3HMWL 2I25N 4PJEE 5J6HB 1C16B 3HCVA 5CD3A 4FG6C 4X6DB 1IARB 1UZ6F 3QFJB 4G3YH 5GGRB 4KKAC 5LG1A 2A77L 5C9JA 3KYKH 5B3JE 2VZ1A 1U91B 4M62H 1TVDA 1CVSC 5BZWA 4P3DA 4H1LB 4WUKH 3BYTA 1FO0B 1X5IA 5FYJE 1N8ZB 3SJVA 4CVUA 5ID1B 2YEZB 4WHDA 1FRGH 5EWIL 3LZFL 1GGIH 5LGJB 5A2JH 4LAJH 1JGDA 3DSNA 4Y2DA 4WWKB 2VOTA 3NH7L 3ILPA 3DX8B 2AK4B 1YNKH 2H2SC 4MNGE 3MRPB 2YPLB 3HG1D 1XIWC 2XKSA 3TGXA 4KDTC 1UH4A 4YDIL 4XP4H 2VDRL 4JFDD 5HGDA 3VG0L 5MEQA 1CGXA 3PWVB 1T2QL 5SWZD 4L8SB 4F80A 4Y1AB 35C8L 2C3VB 4KK6D 5TDNA 4LVEA 4XNUL 1U8MB 3Q1SL 3C60C 2R23B 2BY3A 1ZVSB 1XAUA 4OAWA 4QXTA 5CZXC 3OSKA 3KPLA 5MEPA 1MLBA 2Q8BL 5CHNA 4FQXB 5T5NF 1AY1H 5GZOD 3LHPH 4XPGH 2R0WH 4W4NA 5INCB 3N0PB 2YMXH 2DQIH 3TZVA 4M1CC 3EOTL 3R06B 1G1YA 5CMAB 5C0BA 2Z8RA 4JPIB 4BJLA 5HYEA 1NUDA 3P0VL 1L0QA 2P5WA 4UILH 3L3GA 4WFFD 5HGHB 3WJJC 1JUFA 3GM8A 4LU5L 2Q1EA 1AGBB 3VRJA 4ZTPH 1LK3L 4D0BB 2ZCKL 1U3HB 2VB5A 1S7QB 1IFHH 2YBRA 3NFPA 1L7IL 1K2DB 3RIAF 4RMSA 4FQ2L 5DLMH 5C0CB 3V8OA 4XB7A 2VDQL 3B4NA 5MEOB 5CP3H 3C6LC 4ELMA 1CBVL 3OXSB 5DUBB 1JE6A 1CICB 2GJJA 4FN0A 2EIEA 4PLJD 3P11L 4ZO6A 5KSBB 1TZIA 3V2AR 5GPRA 1HXYA 3TBYA 3VFGH 1LDPH 2F8VA 5KVMC 3K8KA 2EO9A 3P4OB 4RWYH 3ZO0A 4M9OA 1JPTH 3IJSB 2DQDH 3CVIH 1PKQB 4DVBB 4ODBD 1KIRA 4BYHA 2FO4A 3O6FA 1KV3A 1L7TH 4LF3B 1EAPA 3QUML 3QNXA 1A4JA 5TDNB 1MHHB 3WHE1 1GZQB 5GSRA 3CJJA 4DW2L 5H35B 3AREB 1AP2B 4LGRB 4J12A 5CEZL 5IUSA 1T20B 4NOBA 5IJKC 1HN1A 1NFDE 3MOBH 3WDIA 5LXGH 2C7UA 4WWKC 4UUJA 3CVHL 1I3UA 2PXYD 4O9HH 5I1GH 1LO3H 4M03A 3RVVD 2VO5A 4M8VA 3THMH 2YR3A 4XNYH 3MV7E 1GPOH 2D3VA 2P7TB 3ESUF 3VD3A 3VXUA 4N90D 4F58L 5T33L 1QLRB 5GGVL 1FV1B 4Z7WF 4KZDL 4LCWA 4HX1B 4MA1B 3PHSA 3KPOB 1H5BC 3EDDA 4CADB 2FIKB 3VH8G 3QCUH 4GKSB 2IPKB 2DQIL 3QXAA 3BRGC 5J56B 1NFDB 1Q9WB 1JV5B 5GS0H 3OG6B 5GGTL 4PP1D 2AK4E 4LLMB 1D5MA 5ACLA 1UYWH 4QTHB 3MXWH 5D1QD 4I48B 5TDOA 5KVFL 1TITA 4NRXA 2GSIA 1P1ZB 2QHRL 5IJVB 1YECL 3NCJH 4KZDH 2XRAL 1VADA 3GSNB 4HIJA 1YY8A 3LCYA 3MLWL 1R24A 3MLUH 4JHZA 2V9RA 4YAQB 2Z31B 2APBA 4S2SB 3BKYH 2J8UA 2YHGA 4DCQA 5C6TH 3DWTA 4Y5XB 3ZE2E 3BD4A 5C7XL 1IQWH 5JW4M 1NCBL 3NAAH 3DXAA 3ZHLA 4CNIA 2VL5B 1HQRA 1JYWA 1FYTB 3QEUA 1XCTA 4GUPB 3O45B 2X4UB 4OZHE 1KLUB 3ZKMD 5ITBL 5E94B 3RVUD 3UPCA 2IQAA 3T0EE 4PTTA 1KLUA 1D5XB 3QUZA 1MFNA 1X5KA 3M45A 5CEZH 2P47B 3PL6A 4RSVA 1T04A 3CLFL 4S1DC 3HAEB 1T83C 5C08A 4WIQA 4X99A 4WI7A 3FT2A 3C09B 3KPSD 1QBBA 2F53D 1V5JA 4LVHC 3P3YA 4GQ9H 4R97C 4HUWB 4KVCL 3FCTB 1QSFA 3ZSTA 3CXDH 4QXWA 5EU3B 4BH7B 1LEKA 5ACZA 1DBMH 4HXBL 4P5TA 1L4IA 2VITA 3LS4H 4MXWL 4KQ4H 5ILTH 4ONOA 4GRMB 2GKIA 2BNQA 4ODWB 5JIPA 5DUPL 3QI9C 4YE4L 5D8JH 1G9MH 5IQ9A 4P5TD 3HB3D 3QFJE 1MREH 4NZJA 2EYRA 3BP4B 1WC7A 1V3KA 4BZ1L 3MRNB 2YK1L 5F7FA 1UYWL 1YPZE 2DJSA 4LPCA 5CSZB 1A6VH 2D7QA 1AGCB 4HZLB 3FN9A 5DJ0B 5L8JB 1UKSA 5EOCH 3RBGA 2QSCL 4RAHA 5EC2A 2HMIC 3RWDB 5HYFA 3ZL4H 4HLJA 4RBPK 4XI5D 3EOTH 3FFCD 1TPXC 4M1DL 3H7BA 1JZ4A 5C6WH 4P23D 1CYGA 1ZVHA 1T21A 2AJUH 3VI3E 5F1SA 1U8IA 1I8IB 1IILE 4RA3A 4NOFA 2ARJQ 2APXA 2CKNA 3HLAB 5ICZB 2FHBA 2WBJB 4ENED 1Q0YH 1RURH 4QHNB 5SV3A 5JPNA 4HZLA 1DQMH 5DJZB 5JPNB 4YEFA 2DIJA 3JWOC 5JQHC 4H0GA 2Q8AH 2HVJB 4X8JA 5JXEA 1S7QA 4PJXF 4FOMA 1XFPA 5E5MA 1FZKA 4IOFD 3U7AA 1ZMYA 3FO2B 3V6ZA 1HHKA 1QHPA 2P8PB 3OXSA 3AS3A 3D0VA 5IK3B 4LHJB 1J0YA 3VGAB 2AJXL 3ZDYE 3V0VA 3ZKQD 5AUMB 4L4TA 4PRHB 2XPGA 1CE1L 1OF2A 5J7CC 4MCYA 1KUMA 1QBLL 4YNYB 5FYKU 5DZOA 4PP1C 2V7HA 1J0HA 5IW6B 3HMXH 2AXHA 5E2JA 3VDBA 3HC0A 2NXYB 5E6YA 1A3RL 1F6FB 4JO3L 3M8OL 2FX9L 3L9RA 3DROA 4LLWB 1TCRA 2A83B 4X9IA 5FKPA 1EH9A 4W81A 1NCWH 2CR3A 5EZIL 2J8UB 2CLZB 3FOLB 2GCYB 4R6UA 3O81A 3H42L 5ACZB 2IADB 2QR0A 4ODUA 2NY3C 1FYTA 5E2WH 4YUEH 4OD1H 3V5DB 3HMXL 2VC2L 3JSSA 1D9KA 1KTDA 3QI9B 1KJ2B 2Z92A 4HPOH 4KTEL 1U58A 4OLZH 12E8H 5SX4H 1GC1H 5ESVB 1OD7A 4M9PA 3TO4D 4DUVA 5FYJU 4L4TE 3CLEH 1FGVH 4LHUB 4YAQA 3OAUL 3ME0A 5GRYA 4ZTOL 3QDJA 3QCUL 3OB0K 5I74B 2AI0L 5K9QG 3MOAL 5GS0L 4R9HA 5K9OB 1UVQA 2HJLA 3UZVB 2DQEH 2ZP0T 4LVHB 4ZD3L 1MEXL 5I1AA 4UNUA 4U0RB 4LKCB 4PRPE 5L88H 4DKAA 5H2BB 5SWZB 2NY1B 1VGEH 2PW2A 4G5ZL 3DGGB 5GZND 2DQFA 3O8XD 1YNKL 1CT8B 5CCKH 3MLSH 5DEGB 5IB1A 2EEDA 4G8IB 1FFNB 4PS4L 3DURB 3RTQB 1UKQA 3EW3B 4WHCA 4P2OD 3UYRL 4N9GB 1NGPH 3DURA 3UAJD 3B2VL 3LN9A 1WICA 2VXUH 2R1WA 4BZ2H 4GRWE 2VR4A 4HPYL 1HZHH 4XPHL 5JA9A 1KXTB 3EFDH 1EBPA 4WWKA 5EZOL 3MREA 4NM4L 2W0FB 2BOBA 2F53E 3KDMA 1RMFH 1G9NH 4X4ZA 2SEBA 4H20L 5AYQA 4ONFH 4HULB 3EYUH 4UDTB 4J8RB 5CSBA 1HEZA 5EULV 3GMMB 4ZS6C 2D0FA 2GAZB 3IETB 1CLCA 1U92B 5F7NC 3BZFA 4FTVD 4DGYH 4KJPC 3LDBB 1F3RB 5GGTA 3RWHB 3WFHA 4L4TD 5CJ8A 1ZANL 4R90L 1M6OB 2Z35A 4FQLL 4OCXH 3VXME 5SWSE 2HFGH 1PJ9A 2DOCA 4IDJL 2E6QA 5EG6C 4P46C 4PRDA 4KKLC 2IG2L 4KQ3H 3I85A 1ZLUH 1LVEA 4PJ7E 2FNBA 4OKDA 1YEGL 2VE6A 1LO4H 3HS0A 1ZGLM 4Y1AE 4OLXL 3L3HA 4YXKL 3GMPA 3U4EB 3O2DH 1AHWC 1NGWB 2F5AH 2OJZL 4JFOA 3LKNA 3O6KH 1I3VA 1VCAA 2DQJH 3PE9A 1CT8A 3CFKA 4IMLA 3RIAK 5KSUA 3EYVA 2EE2A 1N6UA 4HIEB 3MLVH 4MD0B 2CIKA 3VRJB 4BFIB 1M05B 5C0EA 5GRZA 3HE7D 3HI1A 3CCHB 3S96B 1VACA 2R39A 1P84K 2R0ZH 2ICCA 3I6KB 2A74B 3EDJA 3U2SB 4LASL 2PO6A 2WP3O 2K7QA 4LVNB 1MFDL 1QBML 4Y19D 2ZKHH 1CZ8L 3TM6A 1KIUA 1JPSH 4FZEH 5IK3A 4FQXA 4P2QD 2OQJB 5H8DA 4XCEB 2CR6A 4N8VB 3FAXA 5JHLH 3AS2A 3EJJX 4OFVA 3DLQR 3JV0A 3E3QE 3GMOA 1ZHBA 4MA7H 4ZS7H 1DQML 2MTPA 1T3FB 4LDOB 1AE6L 5I66B 3RX7A 3LS5L 4OT1L 4QHLB 4L3AA 1IGJA 3NFSH 1SYSA 4WEBH 2VDNH 4I0KA 1C5CL 1T0PB 1UQSB 2CLRA 6CGTA 3IU3A 2AK4D 5FV2A 4JY4A 2COQA 4IJ3C 4ZO8A 2FL5B 1MPAH 4TUOB 2WINA 3ARVA 5D1ZA 2DDQL 2E9IA 4NQEB 4XCFH 1OSPH 1BX2A 1U42A 4DKEH 1KC5H 2A2QT 5ESQA 4R2GC 4XRCA 4Y1AD 3P9WB 4Y2DB 1OAQH 2DQDL 3WFCH 5E03A 1AFVH 2UZYB 4CW1A 1KEGH 3QJHA 2GK0B 1NANI 3WXWL 1U92A 4M7ZB 5TE6H 4NZUL 1HWGB 3CSYA 4B41A 1FIEA 1TJHL 4PREA 4C56D 5IHUL 1RHHB 1NSNL 1ZE3C 5J6GB 1EXUA 3T8XB 5DJYB 1IQDB 5DURB 1KJMB 3HC4L 4GAFB 4LPTA 1U8MA 3VXRA 3KWWB 2X2YA 2OZ4H 4HH9B 4PPTA 4P2QE 1ITCA 1RUAL 2MCG1 3U36A 4RISL 1ZGLB 3JV6A 1O0VA 1T22A 3CFBA 3QNZA 1X4YA 3NVQA 4FRWA 5D2LE 1KYOJ 5D71L 3O6MH 2GFBA 4K07A 4QYOA 4RA0C 2B1AL 4F7TA 4YBLB 3GSXA 4YK4C 5DR5L 4PJIB 2EDLA 4XBPB 1RHHA 3NA9H 3OB0H 4PJ7B 2E6PA 4HMCA 3FT2B 2FB4H 3BUYA 5SWSB 2HFFB 3FMGL 5L2KD 5C86A 1KTKE 1DLHB 4KAQH 4NQED 3E6HB 4OCNC 1B2WH 3U0TB 4G43B 2XN9E 5C3LD 1D5BA 3SPVB 1CXFA 3WUWA 3GJEA 1BLNB 4XVJH 5GS3A 3CMGA 1AQKL 3GHBH 3U30B 4QRQA 4U6VH 5ESQB 1NC4A 3O3AB 4NFBA 5I8EA 5D2LB 5AAWA 4J3VA 3LD8B 4HUVB 1HHGB 4NBXB 4V1DB 2CRMA 4PUBL 2MQCA 4JKPL 1ZLSL 4EIGB 1NUNB 4N0UE 1QOKA 3Q6GH 5JOEA 1UA6H 5FHAL 3T65A 2YPLE 4ZFZA 1BZQK 4OFDA 3IDJA 2O61A 2YC1A 5L9DL 3MV9D 4KGLA 2PXYC 4MCZB 4X0KB 1XGQB 2DMKA 4QRSB 4KRPD 5GSVB 3GSWB 3C8HA 4H88H 3QDGE 4BSVB 4DZ8B 4YHYB 1G6RH 2NXZC 3BN9D 4JN1L 3STZA 1MLCB 2E5EA 3ARSA 3DETC 1MIML 2HTLC 3P30L 4W4OA 3EDEA 4KFZC 2ZSWB 1BWMA 3DVNB 4UAOB 3BWUC 5B8CA 3VXUB 2OSLA 4P9MH 25C8H 5LVEA 3O6LH 4Y5XA 3OGCA 1FNSH 3OX8B 4IRSC 3RWCB 5L2KE 1OSZB 1QEWB 1U95A 1XIWD 3P9LB 3T08A 4X6BA 5FIEA 4ETQB 4Q9QH 4GOSA 4EOWL 1FG9C 4WJ5A 4G8FB 1RZKL 4Y89A 4XHJC 3O3AA 4X5WB 3TVMC 2Z31D 4FZ8H 4MWFA 3TA3A 4OFPA 4NNXA 1S7WA 4BUHA 3G04B 2DWDB 5EFIA 1IEAA 2L7JA 4Y5VC 1B0WA 2XWJB 2DTSA 4HAGA 4OD3H 2NQCA 1BMGA 4GW5B 1A4KA 4PRPB 4UI2A 4OCYH 4QNPF 5D7KE 1SJEA 5GRUL 1S9XA 4KKAD 5HGBB 4HKBA 2C3GA 2IBBA 3U7WL 2BSRA 2APFA 5E5MB 1CCZA 3T0WA 4CADA 4Z8FL 3RZWA 4DGVL 1NGPL 4KRPB 1NDMB 3B6SA 2CDGB 4N0YH 5C0RH 1I75A 4WUUD 5CUSH 1MCKA 5HVHC 1DDHA 4D3CH 3S5LB 3QHZH 5C09B 4M5ZL 1ZOXA 1OF2B 4F8TA 1JHLH 3U4BL 2XV6B 1FNEA 3WKMH 3U9UB 2GJ6E 3MJ6A 1HH6B 3Q3GB 3E2HB 2I9TB 3V9FA 4NM8H 5KVEL 4ETYA 1YN6B 3P4OA 3GUTB 2NNAA 4LNRB 5A2LH 4L9LB 4LMQE 4QOKA 2RIKA 2UY7A 3MOAH 1CQYA 3SE4A 3KVQA 2DQEL 1KG0B 3EFFB 4XCNB 4PGBA 4YHKH 1A6TB 5JLZB 1VEMA 3X13B 3K1DA 1S7XA 3V6FB 5F97E 5C09A 3AREA 3S37X 4UIMA 4IS6B 1IC4H 4NUGL 2VLRE 1BFVL 1JRHI 1N3NA 3GIZH 3IFNL 3TIDB 4M8QB 1BX2B 3BJLA 4PJGA 2B8OT 2MHAB 5EORH 3T2NL 1WAAF 2DIAA 3CZJA 2ADJB 1Q0XL 3BH9A 4N8VG 4G7YH 3UYRH 3ROOB 1MRCL 4FXGA 3V5HB 4KI5E 4AM0A 5IHUH 4MDJB 2GK0A 3ULVD 3MRQA 3S9DB 2D7OA 5F70A 4YXHH 5HGDB 1ADQL 3UJJH 1FL5A 5KS9F 3GSUB 3VW3L 5JXAL 2VLKE 1F97A 5JW5A 3RQ3A 3T2PA 1R5VA 3ARXA 4ZAKA 1U3HC 5CSZA 2DLEA 3H42H 3S35X 3VXTA 2DKUA 2FEDC 3OMZA 4RX4D 3V4UH 1KT2A 3TFKD 4WO4B 1MJUL 3DSFH 3LPWA 3DJ9A 2BCKB 3WDJA 4D9LH 1J88A 5C3TA 1U3YA 2EKJA 1YEHL 5KSBA 1RUPL 1Z5LA 3FQRA 4NZRH 5IFHH 4J4PA 4PRNA 3UC0H 3DMMB 4OV5A 1EPFA 4OSUH 1Z3GL 3NABH 2FEDD 2J5LC 4DJMA 2AJSL 3IU4H 4OZHA 4D0BA 4LLVB 1YC8A 4Y4KD 2HTKC 5H37H 3GIVA 2V7NA 1FZMA 4F7PA 3QO1A 2JKXA 3D9AH 2BVYA 3X11B 2D4FA 3PDGA 2CGRH 3GI8H 4PLNC 3IDNA 5I75B 2R8SH 1N5YL 4JE4B 4DN4H 4GBXC 5DRNA 3T77B 3ESVF 5L8KB 1UB6A 3OAZH 1TETL 4Z6AT 3CFKB 1JWUB 4MD5A 4OF6A 4HIEA 1IM3B 1I9JL 5DD3H 4DAGL 3DV6A 1XEDA 1KBGH 2VLKD 3VXSA 5I8CA 3G5XA 3X13A 4J3OC 4XT1C 5JORA 3D48R 4GKNA 4MQXC 3C2SA 5GGQL 1OAZL 5F7MC 3VG0H 2ZNWA 2R0KH 1ZHNA 3ARPA 2DN7A 4ZNCD 2PW1A 3RWGB 2ATPB 3QBTB 4UDTA 3SKJL 4HHAA 3E0GA 4HSQA 4Z0BH 3TEUA 1RHFA 3BESR 1JWUA 5ALBL 1A4KB 4DK3A 5IFAH 3LQAH 3BO8A 4K7PY 4H26B 4QLRA 2AEIT 2HWZL 3MBEA 3O6LL 3MLYL 3K4DA 3G5XB 2ZJSL 4OJFH 4KHTH 2QKIA 3KLHC 3L7FB 3L1OL 2N7AA 1V7NH 5E4EB 2F8OA 2FLBT 4I8DA 3CFJB 4ZUVA 2X05A 1KFAH 4GS7B 3GMNA 1TMCB 3MRFA 4CMMB 4OZGF 1KJ3L 1JN6A 3BZ4A 3W11D 4HHAB 2NY0D 3BZEA 3L6FA 5EOCL 3I6GB 5J4MA 3RUGB 3QQ9C 3MRHA 5JA8B 1UB6B 2CKBA 4X7CC 5CILH 2JK5B 1T1YB 4YHPB 5IOPA 3MO1B 4RAVA 3UTTD 4C83B 3QDJB 4KDTA 1ND0B 1I1AC 1TVBB 1A6WL 5HGAA 1C1EH 5JIIA 4K8RD 4F57L 5E08H 1OP9A 2UVFA 4LCCA 1EIBA 2J8UE 1A6UH 1DQLH 1CICD 4LSVH 1QFOA 1UCTA 3U9PH 2EEAA 4KU1A 1ZLVK 4ENEC 3KXFA 1VGEL 2OQJA 3MYJA 1AGDB 3SGDI 5EIIB 4U1GC 1ZAGA 3U0WL 3ZHKA 1MJJB 2DBLL 4NQCA 2ED8A 2E27L 3ROOA 2EXYD 4HK3N 2ZOLB 1BD2A 4DVRH 3MRQB 2D7TL 3K3QA 5C0BE 3RVXC 3MRMA 4WFED 2RJMA 3JV4B 2GITA 3KYKL 3S3PA 5IHBA 2NY4B 4K8RC 1XR9B 1UKTA 4PJXB 4OZIB 2KBGA 2VRAA 4EI5D 2ICEB 1KELH 3HZMA 2UWEE 35C8H 4HG4J 4OIIH 1FG2B 5JQ6H 1X5GA 3THML 1TXKA 1T7XA 3PWLB 1XF3B 5C0JA 4RDQF 3EBAA 4K71B 2BC4A 3JWDL 3LRGA 1GGYA 1IJ9A 3SDDB 4YGAB 3UJJL 4IMKA 5D2LA 3GSXB 2OTPA 4KKLD 3ULUE 1EEUA 4U4BA 4OZFA 4MNGA 4NQDB 2CJUH 2XY2A 4JO2L 3MV9B 4C57C 1NCWL 3WNNA 5DD1H 4HCRA 3RWHA 3WFHB 3EYFB 3LQMA 2MCPH 3Q0HA 2VUYA 1I3GL 3C2AL 4G43A 5CJXC 2I5YH 3L7FA 5DJZA 3RX8A 1FVEB 4HBCL 1UXWB 2EXWD 1RZIA 2BJMH 4U1GB 3NTCH 3LRSA 4OF5A 5FYJL 1MCHA 2J88L 5D7IE 1FCGA 3WJLC 3WFEL 5J13C 1T21B 1XMWA 4KGJA 4POUB 3D1MC 4F37K 1BVKB 2BERA 5GGUB 3TT1H 1OAXL 2XN9B 2XG5A 5IF0B 5F9JB 1K6QL 2AJXH 4NC1C 1TZHB 5C0DB 4FQHA 1R3JB 5DK0A 4EUPH 2FATL 3ZDZE 5GGVY 3QIBA 3NN8A 4N9GA 3SE8L 2CMRH 4DWHA 3V6OA 4DVBA 4O5LL 4U1IA 3K8MA 3DUUA 3ORJA 4FNLL 4JZOB 4LLQA 3RUGE 1CBVH 3ULVC 3QIWA 4YHNA 5BJTB 2HG5A 2FL5A 3DVGA 1NAKH 1K6QH 1TENA 4Q58C 3VCLA 3IGAA 5SWQA 1B90A 4O02H 4ODHH 4F7EA 3IVKA 3WEXB 2DWDA 4QHLA 1GZPA 2JCCF 3GB7B 1QO3B 3TIEA 1FFOA 4GRLB 4FP8L 4D0DB 3TJEL 1M71A 5I1HL 3C5JA 4KY1L 1H3VA 5HDLA 1U8OA 4JANA 1YMMA 4L4VD 1NUGA 3BQUC 2VDRH 2NLJA 2VXSH 4NQSB 3HZMB 3PGCB 4NHCH 3MJ8B 3UJIL 1BEYL 4NQSA 5A1AA 4JRYD 2ZCHH 3O45A 1S3KH 3D39A 4L3CB 3G04A 5JIHA 4F7EB 3IVKB 1WITA 5BS0D 5HYSG 5I71C 5E94A 1H3UA 2AKRB 3FT4A 4M6ML 2BZDA 3QEHB 4PTUB 5FDYA 1WTGT 3CDGB 3HR5B 1J9CT 1ZS8B 1JWMA 5I30H 3JWNC 5IKCA 3O2VL 4PRID 5A16B 4ZFOA 2BVTA 1UM6L 3C5JB 3CFEA 3LAFA 5E00A 4NZRL 2GJZA 4KRMB 4U1SA 3GSNA 4HIJB 3O3DB 1BJ1J 4MB4A 4U1IB 1NMCB 2V2WA 3SO5A 2XI9A 5B4MD 3L5XL 5DMIL 4OQTL 5K93A 2OX5A 3ZYJA 3NA9L 4HWBH 2AJSH 3IU4L 4NRZB 2W38A 4ALAL 4C58B 4MQTB 1RZ8A 5I1IL 5DFVD 4AY0A 3V8CA 3F7QA 3EHBD 3GJFB 3PIQA 3U0TA 5TDOB 1NMBH 3MV7D 2FH6A 3BKCL 3WS6C 1BQLH 4JQVA 4NKOB 1EHAA 3MGTA 3MYZA 3JXAA 2R69L 4YDLB 4XCYB 3CC5A 1VADB 2X1OA 2W92A 4YWGL 1P84J 1JCKA 2OI9B 4GRLA 5C6TL 2HH0L 3RL2B 1G6VK 3SEPA 4JVWA 3TBVB 3UEZA 1W8NA 3AMLA 5L6YL 2WWMC 1MHPL 2DQGH 2DB8A 1M6OA 4JJHA 3F7YA 1KF9B 4IHOB 2FR4B 2FX9H 2NY2B 4NN7B 4QRUA 5I8EB 1GRWA 1D6EA 2QHRH 4NN5C 1IGCH 3U9UA 3QNZB 1Q9LA 5A43C 4BH8A 2VXTL 1CTOA 1CGYA 2VZ3A 4I9WD 3PP3H 5FA3B 1DBKL 2X70B 4HW6A 2YSSA 2XKUA 5AWNH 5DVNA 1IGFH 1NBZA 3LB6C 1G6RB 1P6FA 1MPAL 2R56L 3QFDA 1S5IL 3P4MB 1R3JA 5DK0B 4BQCA 2RB8A 4G9FE 5ANMB 4LLVA 1PKQA 4KVNH 3T8XA 2R1WB 2XTJC 3RNQB 5IIEB 4R7DB 3VFSA 3WE6A 4F3FA 1J8HB 5EBGA 1BM3H 4PP2B 2FWOA 2ICWB 2GJ6A 1IGMH 3NPSB 5DUPH 1TZIB 4IRJA 3QI9D 4DGVH 4M6NL 4XBGB 3IDNB 3IAQA 3QUYB 1F6AA 2H2SD 3TO4B 3G6JE 3BIAX 4GJTB 2GW5A 1DQDL 4XNXH 2HKFL 1RIVH 3TVMD 1U93A 1F4HA 1B4RA 1EUUA 4MJ6B 2CK0H 4OTXL 4JDTL 4PJCF 1MEXH 1HQ4B 2GTZA 2VYRE 3O6FC 5JW5B 1MUJB 1VFUA 3IDGA 3IYLW 5C08E 5JDSB 5D9SA 1OHQA 1KCRH 3FL7A 3VWJA 2XA8H 4KI5F 5J3HC 1T1XB 5D96B 3TO4C 1KB5A 1Q94A 2F5AL 4PJIF 5F1OB 5DWUL 5AD0A 1FL3B 5HPOA 1J86A 2DQJL 1NPUA 5EA0H 4KRPC 3C5ZC 1RIVL 2OL3H 4OGAD 5E8PB 4PGCB 5EZJB 2VLRA 3QUMB 5FM5O 2F74B 1TVHB 4ZPTA 3SE8H 3HKFA 3SCMA 3UTZB 4CVZB 1NMAL 3M07A 4HGWA 5J1AA 3QG6B 1F3DJ 3HNTH 2GT9A 5I16A 4YGVB 3BFOA 1RJYA 4Y16B 4GG6E 2YUVA 4UT7L 4NGHH 2OYPA 3RL1B 4QOKE 4DK6A 2E9JA 4J3SA 3RNQA 5IIEA 2Q76A 5D2NE 1TCRB 3MGAA 2D03H 2NPLX 3TN0A 3KXFB 1JPGA 4KPHH 3GMNB 1YPZF 3MRFB 1D5MB 5KOVC 1OGAE 3QWOB 1LO2L 3GKWH 1JN6B 2ICWJ 1H3PL 3S4SB 4EDWL 3EO1A 3EOBB 5FOBB 4JR9H 2WMPA 3CIQA 3DPBA 2CK2A 3Q6GL 1FZJA 3V0WL 3KJ6H 4YIQB 5EH1A 3OQ3B 4I5BA 1S78C 4RZCA 3MUGA 4OLUH 3WXVH 3RI5F 3DX9B 3MO1A 2OR9L 2BNRE 5JW3H 4ODVL 1J11A 4X6EB 4JB9H 1NEZA 5BW7A 1K85A 4P9HL 5J89A 3F58L 3LKRB 3NIGE 1B9ZA 3QAZB 1S9WA 4PR5B 3BPLC 3UZEA 4JZNA 1Z0MA 1E28A 3G5VA 1G7HA 3MQIA 2O5XH 3STBA 4IRJB 2HFEA 3O2WL 1UM5H 1KPVB 4FFZL 5F9DC 4NQXB 1UJ3B 4G7VL 3TA3B 3C5ZD 4OF8A 5T1LD 3VG9C 5IOPB 1F4YL 1W72B 4RZCB 4EDXA 4QRUB 4HMEA 5JZ7D 2FH8A 1E4WL 5E8EB 1I1YB 3DGGA 3G5ZA 3IDMA 4X4XA 4OM0L 4Q6IA 5A16A 3MZGB 3OR6A 4YH6A 4PG2A 2XT1B 2OP4H 4HBQA 3EJYC 4ALAH 3QIWC 1V05A 1RY7B 1K3IA 1RZFL 3ZYIA 1HINL 5GGTH 5AZ2H 4YJZL 1MJUH 3RBSA 1WCBB 4HJ0D 3KXFD 5D6DC 4KROB 4G9FB 3IJHA 1DQQA 1MJ7H 5ICYB 4P46A 1UJ3A 2XWBA 2CXKA 3F7RA 1W72A 3FB6A 3TBWA 4F2MA 3QQ4A 4U1MB 3TBSA 3VXRE 1KLFA 4JHWH 1I9IL 1JI2A 4U49A 5C1MB 5CZVH 4AG4H 4O2FB 1AHWA 2F74A 1A6WH 3B9KD 3GMLB 1AO7A 3MMEA 2YD2A 2JCCE 3MTRA 4NYLA 2PYEA 4OZHB 1DANU 3WFDH 1LK3H 3WFZA 3QRGH 3TV3L 5C0RL 3SE3A 1OAQL 3AVEA 1EVUA 2CUIA 2YD6A 1V8HA 2BRRH 1WEJL 2D7PA 1T1ZA 4M7KL 2FO1A 2CDFB 5BV7B 2E7MA 5BO1H 1EFQA 4JO3H 3T0VA 2LVCA 4JY6A 3OX8A 3FN0L 3PWPB 4WFGE 1R0AH 5LCVL 4LGPB 4X5LA 5K33A 1KEGL 1RZGA 3PJSA 3CH1A 1J1OH 1IZKA 4UV7H 2IAND 5T1LA 3D39E 4HLZH 4N1CA 3S4SA 1LGVA 3GMOB 3ARRA 4JM2A 1JL8A 1D9KB 4P2RB 2XYCA 5E8OA 1UA6L 5JR1H 3J8F7 3TWCH 3IFOB 3AC0A 3MX0A 3REVA 5T5FH 4TUJA 1U2HA 4K3JH 3MRBA 4MLSA 4Y5VA 4HK3J 1ZT1A 4AJ0A 5D9SB 3D69B 4LP5A 1J10A 3W9DA 3W5MA 5T1KB 2X1PA 4F58H 4JZOA 3O3UN 4LLQB 4NCC1 5J57B 1KT2B 2YC1B 3HUJB 3WS6A 4HV8B 1X44A 2R29L 1FAIL 3SO3B 3D39B 3RZCB 3UPRB 4Z0BL 3LSOA 4LCIL 5IHZB 4NKDA 3L5WA 2VLLB 1ZT7B 2NY5C 1DEEB 5T1MA 3MV7A 2W9LA 5DA0B 3FQRB 5EA0L 4D0CB 3SJVE 2P7TA 5SWSD 4LFHG 2EDWA 4GBXD 1S5HB 4G6AD 1HDMA 1VGKB 2RFXA 1ES0A 3C6SA 5I0DA 4G9DA 1YNLH 2YZ8A 1CGWA 4FMKA 3L9RB 4LLWA 2Y72A 3MA7A 2GSGA 3TNMB 3VGHA 4NKIH 5F1KC 2DQUH 3CXHJ 4HS3B 5L7XL 1RZIB 2Q3AA 4JY5L 4LKXA 2WP3T 1KN4L 4K71C 2V2XA 3VCLB 1YEIL 1HI6B 3L5WB 3KWWA 4PBWD 5DVLA 1CU4L 5EO0A 1MCEA 2YS4A 1L7IH 4MX7A 1OP5K 4MWFB 1F4XL 1UADC 3CC5B 5DHXB 3HE6A 3WJJA 2B2XL 4LNRA 2GFBB 4QYOB 3C8KA 1T89C 1YJDH 5DT1H 3N85L 5DYOB 4J4PD 5EBMA 2R9HC 3N06B 3NN8B 2C5DC 3V0AC 3V4VL 4Y19E 2LU3A 4TUJB 1SJEB 4L4VA 5D5MF 1J12A 3FO1B 2GTWB 3O4LA 2R1YA 4QF1A 4RFEB 5IVXA 4MA8H 1FVEA 3RGVC 4EBQH 1VFAA 1HI6A 4LIQH 5FM4A 3IXTB 4HC1A 4B53A 1E6JL 1O5DT 1VDGA 5D72H 5KS9E 5DJYA 1W72L 1R3HB 2F5BL 4FQCH 3QDAA 1ZV5A 2J1KA 1YYML 4X7SH 3Q1SH 4FFYH 3RVWD 4OLYL 1WFOA 3FJTA 1PEWA 5E8DL 2R2HA 3WS3A 1EAJA 4Z95L 5DD3L 2BNQB 4JG0L 4ELME 5KANG 4N1HB 2YA0A 4DQOH 4JFQA 1GGBH 1A1OA 2R4SH 5F6HJ 1OGAB 4J4PC 3UJIH 1NBYA 1E6OH 2OK0L 3RHWF 3W9DB 4YZFE 1AC0A 3S35H 4LU5H 5C0IB 5FB8A 4MCZA 4X0KA 3ARED 4A6YB 5C09D 3HI6L 1C7SA 2ZUUA 4X6CF 4F2MB 3GSWA 3QDGB 4MB3A 3KJ6L 2BMKB 4QXUH 1AFVL 1GAFH 43C9B 4UNTA 3RHWK 4YHOL 1JWMB 2BY1A 3TZVB 3S4SG 2DLHA 5HPMB 3S34H 4KUZH 1I1CA 4XAKD 2WUBL 5HPMA 1A1OB 4Z7UE 1CE1H 2GJZB 1J05A 1NCAL 4PJBF 1DLHA 3ARQA 3EYVB 4XP6H 3L3KB 5T1DL 1ZA3B 2CDFA 3S36L 2Q7NA 2EH7L 4PJBB 1BLNA 2FHCA 1GGTA 1N8ZA 3SJVB 4G7VH 4K3EL 1R3HA 1FNFA 3HB3C 3CDFA 2VE6B 5DQDL 1S7RA 4L3CA 4NKMB 2W91A 3LKSA 4NHUB 1UZ6E 4AL8H 3V5KA 3TH2T 3MLUL 2FGZA 3TA3C 5DVMA 1WFTA 5KSUB 2FIRT 5CKGA 5KAQF 1DFBH 2JJTC 1FHGA 4EI5A 4LL9A 2WW8A 4NP4H 1ULVA 2EECA 2Y07H 3NCFB 3HZYB 1AXSA 3DUUB 4RFOH 1EJ6A 1H8NA 2J7LA 3WXWH 4F9PA 3L5JA 4GKNB 4LEXL 4S0SD 4RNRB 8FABB 4WO4D 4NN6C 1XIWA 1A0QH 3IF1A 5H35A 2BOBB 4PJEA 5F93C 4X9FA 1Q1JL 3DO7A 2GEEA 5K59E 2B0SL 1N0LA 1TNNA 3H9SD 3HI5H 3LEYH 2C7UB 2C1PA 4I0PB 4KJQD 3VW3H 5F9AC 2YWZA 5GRJH 5I76B 5CP3A 3LQAC 4Z7UF 5I71B 4CVWA 3FZUD 4NNPH 4G6MH 4HS8H 5MERB 1MCPH 2QLVB 3B9KA 4L8BA 3QJHB 1ZTXH 1HHIA 2X9YA 5I30L 3GRWA 4PJ9B 2GT9B 4LARH 3AUVA 5HTSA 5IVNA 5EPMA 2HMID 4OIIL 4XMPL 1DBML 3EO9H 3FRUA 3DMMC 1K3ZA 1UXWA 4FQPA 1K2DA 5GXBB 4TSCL 1UC6A 1MFCH 1LEGB 5D1ZC 3KLSA 1IC5H 4K7FA 4HUNB 1NCNA 1HSBB 4NQVB 5IMLB 2BNRD 3U46B 2XY1A 3SDCB 2PTVA 3D2UA 2BSSA 5DJ6B 3RI5K 4PLOB 3IDYC 1NUFA 3EDKA 4EIZC 2PYED 3WFEH 4D0CA 4DFHA 2WBJC 1NFKA 4NQCB 3VXNB 4J3UA 3QIWD 2AAVA 3L3OA 4YR6A 1IM9B 5EC1B 1MAKA 1PZ5A 3BI9X 3VH8A 1T2XA 3HAEH 4QXGL 1OB1A 3DUSB 2IBZY 4L3EE 3VXTB 1J18A 4PJXE 4WFHD 3TH3T 1IEBB 4AL8L 4Z77B 4WI5A 2DICA 3JVGA 3HZVA 4Z0XB 3F12A 4UIMB 1FL3A 4TRPL 1HE7A 4UT6H 4KVCH 1RJCA 4X9GA 2EE3A 5L2KA 3H9SA 3FQNA 1EFXD 1NCCH 4QT5A 3AY4C 1W0YT 4FFYL 4R0LA 3LS4L 4MXWH 4CVZA 4P99A 4NYLB 2B0SH 1EO7A 1U8QB 2YWYA 1YN7A 3G6JA 3EGSA 4N5ED 2VLKA 3B9EA 3SGDH 3C5ZA 1X5FA 3ZHDA 4OI7A 5EZOH 5C0AE 1YYMH 5JDSA 3SDYH 1IBGL 3QXDB 3MRRB 3F7PC 3DIFA 3CFDB 2BNRB 3VWJB 1HINH 2B4CH 1FO0A 4ERSL 7FABL 1LE5A 1JWSA 3FAWA 2A9ML 5KVEH 2C4XA 1E4XI 3SDCA 3UROR 4XMKH 2J6EA 4I48A 4BSWA 3MNVA 3T1WA 1WZMA 1SMAA 3ULUH 5F21B 5M94B 3LKPA 1JP5A 3UTTB 3HPLA 1IM9D 2ZCHL 1CDCA 3L1OH 4P4KC 1AO7B 1B3JA 4QWWD 3TBVA 1T03H 2F54D 2VZOA 4XNZB 3SE9L 1OVZA 3RWEA 5JDJA 2EC9T 3KYMA 4CMHB 4XCNA 4NC2B 5C9KA 1MWAA 2IANB 5JHDE 5ALCH 2B39A 1J8HA 3MRJB 5BZWB 3CU7A 4LVOC 1IT9H 3MRJA 1A9EA 3TT3H 2VLJB 5KVFH 3AS0A 1QFUH 1QEWA 4AIZA 4LEOB 5FYKH 3SKNB 2QL1A 4ONGH 2AK4A 1YMHB 1AIFA 1PYWB 2R1XB 3I3BA 3ARGC 4LSQH 1MJ8L 4JREB 1KPRA 1RULL 1NBZB 3GKWL 2UYLB 3DYPA 3IFLL 5DJXA 1S7WB 3C60D 4M6OL 3MUGB 2KDGA 4KK6C 1FVCA 1DZBA 4FQ1H 5C71A 3I6LD 4ZMAT 1P7HL 3WL9A 2E27H 3MBEC 1BVLA 3MRCB 4JAMB 5DJAB 5FO8B 1YJDL 2J8HA 1W0WA 3HNTL 1OSZA 1U95B 2VDNL 4XVJL 3QJFA 4PYGA 4OZGA 3PV6B 4XP9H 5BV7L 2DL9A 1S7TB 1K4CB 4Y19A 4GBXB 4OZGB 1CF8H 4P48A 3FHAA 5GJTH 1CD8A 2JLLA 4H0HB 2EIDA 4UTBH 3KG5A 3GKZA 3LKSB 3ARFD 4C59B 2XWJA 1I1FA 4OZHF 1DP0A 3PV7A 1MHCB 1NEZG 1XF4A 3CVIL 1I85A 4OCSL 1QPPA 3N1FC 4OLYH 1P6AB 3KYAA 1CG9A 1MAML 4Y8DC 1IGIH 4EI5B 3LQZA 3SGEH 1OW0C 5IEHA 2EZ0D 2UZIL 2WZPD 4OCYL 4ZOCA 3C5ZB 5DTFB 4CGTA 3SQOH 1RMFL 1FZMB 1WTLA 1AXIB 2VDKL 3WO3B 1REIA 4Z5RB 5DD6B 4W6WB 1G7MB 3PQYD 2BP3A 3NCMA 3BGMB 1SJVA 1RK0A 4KZEL 3JV5A 1RUKL 1LDPL 1A1MA 2BJML 3V4UL 4XWOD 4CRPA 2QBWA 4EQ2A 3STZB 1ODAA 3MJ9L 5BOZG 2KZWA 3RA7L 4ZFOB 4RGNE 4Z7VF 5JW4Q 3TO2A 5E99H 3WHXB 2A73B 3SE4C 1CFTB 3RWFB 3D3VB 3CSPA 3U7YH 1U8QA 4N0UA 1IGML 3NFNA 1UCBH 2C3WA 4KK9C 5IW1B 2OL3A 4LSSH 3BEVA 3HE7C 5DQ9B 4J2XA 1I8LA 4FTVE 3NIFF 2VXQH 1FJ1A 2NLJB 3C6LB 1Y0LB 2B1HL 1EEQA 2W0LA 5F6IB 5E2TH 2XN9D 3MRKB 3G6DL 4K8RL 4KI5C 1DUZA 1BFVH 1EEYA 1FGNH 4MSWB 3RZCC 4GLRH 3CFBB 4R7NB 3OG4B 2EYTA 3CLEL 4APQB 1OARL 3RDTB 1CL7H 4HKZB 4JZJC 2ARWA 2AK1H 1DTUA 3NGBC 4HKXA 3IT8D 4QF1B 3L3JA 3H0TB 4ZS7L 4P4KB 4XNUH 3VXMB 2IAMD 4XGZA 4JKPH 2AVGA 4YDIH 3GMQA 3MV8D 2Y6SC 1U8JA 2APWA 4H5SA 5DS8B 2HTLD 2VQTA 5D7IB 3TYFB 5MP6H 5D7IA 1DUZB 4MSWA 3TYFA 4F3FB 5IM7A 1ZWIA 3RWDA 3ULSB 3QUXC 3N9GL 3MCKA 1IL1B 4GAYB 1K8IB 1LO5A 3QUYC 3SDAD 1YA5A 1UH2A 3VA6A 2V2TB 1JFQH 2AS5M 3DVIA 3TO4A 3P0YH 1LO2H 1NCAH 4L3EB 3LPFA 3FONB 1EZVY 3OKDB 4BSJA 5M7QA 4KUZL 4WUKL 5IEKB 4X4YA 4ZAKD 1KLGB 3S3SA 2IALA 1DSFH 4X4YB 4R7DA