4P5KB

Structural basis of chronic beryllium disease: bridging the gap between allergy and autoimmunity
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
212
structure length
198
Chain Sequence
NKFDTQLFHTITGGSSPENYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEERAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
publication title Structural basis of chronic beryllium disease: linking allergic hypersensitivity and autoimmunity.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 198
sequence length 212
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p5kB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p5kB01
3DVNA 4DZ8A 5IVXE 3ARED 2LQRA 4NQDB 4IRSD 4LHUB 2B5IC 5CJBA 5AUMA 4NKQB 4BSJA 1S9WA 2GW5A 4QTIH 2V9RA 2O5ZH 1B0GB 2GK0A 5I1KL 1X4YA 5E6IB 2B4CL 4M1CD 4XPHH 3B4NA 5CBAA 3VXUE 4IDJH 1F58L 4WI6A 1X5IA 2IC2A 4U6VH 3QO1B 3EDKA 4GAYB 2Y36L 4WI5A 5FGBC 3HAEH 2BVTA 3NZ8A 5FGCE 2WBJB 4HV8A 1N2RB 2R0ZL 4BZ2L 2R8SL 3MXWL 3WS6A 1Q9WA 1FIGL 4HPOL 3BIKB 2Y9RT 4MAYD 1RPQA 1NFDA 2FL5B 5EG6C 3V4PL 2DQGH 3L6FB 2QSCH 1EZVX 1F4XH 3MBEB 1EA9C 5CJQL 1S7UB 5LXGH 2ZJSL 4ZODA 4E0RA 3TWCL 4E42B 3D0LA 1QFUH 1RZJH 1KOAA 3VJ6A 5T1DL 3AB0C 1QSEE 4XZUA 4KJWD 1OAXH 3EDFA 5C0CB 3D9AL 5C0IB 4ZS7L 1RULL 2FECL 2IGFH 2P5EE 5DK2B 1P2CB 2F53D 2FD6L 4MSWA 1CE6A 5F9OL 3SCMD 4H20H 5KS9B 3MCKB 4NO2B 1K8DA 3PGFH 4HS3A 1MLCA 3FT4A 3NA4A 4NN6C 1T1ZA 1Q0YH 2ZZUT 3O3DA 4G9FA 2XZAL 1G84A 4YUEH 1CQYA 2XWTA 3L5XH 1KXVC 1LDSA 3O81A 3EAKA 4FFZL 1MHEB 1R3LB 4XCFL 3WIHH 4GT7A 3PV6B 3AAZA 2NXYB 4UT9H 1AI1H 4NC1E 2QQLH 3O2WL 4FTVE 3G6DL 4QCIA 3KPRE 4NQXB 5IEKB 2FLRT 4A2MA 3S37X 4MX7B 5D71H 3EJYD 1NC2D 5IROC 5EU6A 4PJ5D 4Z0XA 1W72B 5TE4L 5D1XA 5K9JH 4WUKL 4K7PX 4EDWH 1KBGH 3HZYB 4ORZC 3SGKA 1WCQA 2YD4A 3W0WE 5LBSL 4FP8H 4JAMB 1QSZA 1YECH 1VFAB 3P9LA 5DEFA 4JPVL 4R2GC 2F5BH 3TV3L 5I9QC 2KQMA 5IB5B 1QZ1A 1A7NL 3ZKSD 4HT1H 1G6RH 3IKCB 3QG6B 3DI2B 3S37H 4CN4A 2D4FA 2XRAL 1EPFA 1CLYL 2G75A 3G9AB 2EDOA 4K7PH 3TBVB 2ENYA 2DMCA 3OKEA 3JTTA 4GBXC 1YNTB 5FEBA 2LVEA 4TOYH 2ADIA 3C2AH 1GIGL 1TTFA 4YDIL 1BWWA 4LCWA 4Q9QL 4ETQB 3UBXG 4QHLA 4Z7UA 4HEME 1ZK9A 1JHKL 4LRNH 5F9AC 1EGJH 3DROB 4MNGE 5ITFB 4WFGD 4YX2H 1IGTB 3NFSH 1YEHH 4W4NA 1QLRA 4ZMAT 1JGDA 4HXBH 2VXTH 4QHKI 2DWEB 3AUVA 5HI4D 1T20B 3VXSA 3HI6L 4QHMA 1LEIA 4L3CA 5TPWH 3G6JE 3ARPA 3QIBD 3IU4L 4FABH 5IMKB 3C60D 4UTBL 3STZA 4I4WB 4M6ML 1FZOB 3QJFA 4PJAF 1XCQB 4LNRB 2P8PA 4L4TE 2CIKA 4NP4L 5INCA 2A6IB 1XIWD 3MRCA 3UTQB 4X6EA 2JTDA 2KL6A 5LGHL 4HFUH 4MNQA 1QUNA 1GGCL 3L3GB 4PJ9B 5E8OB 5DQ9A 3B83A 2E7BA 1P9MA 5FYJE 3TBSB 4ZAKD 3DO3A 5I76A 2YPKA 3BWUC 3G5YA 5F9WB 2HJLB 4JFZL 4HBQA 5B4MD 3RWJA 4OCRH 4H1LG 3RDTC 2AEWA 1N0XL 1CDIA 5F97E 3LB6D 2HFEB 5KSUB 3QDGE 1YDPA 1YMME 5HGHB 4XXDB 1XR9B 4LLUB 1UC6A 3AMLA 5B39A 3WEXB 1A4JA 2BXYA 4U6XA 4QRPE 4OF5A 3RAJH 5JZ7D 1MREL 2QJDA 3VD4A 1MWAA 3BPNC 2MQCA 4JRYA 1UM4H 2C9AA 4HDIA 3F58H 4LAQH 4HG4J 4X7TB 3X11B 5IQ7H 4M3JA 3WN5C 1VADA 5FYLE 3DHMA 3U36B 3ARTA 5B22A 1CGSH 2XY1A 3EFFA 1F00I 4M43H 5FO9B 2MPAL 5EN2A 1NCUA 1MCQA 5IKCB 4PJ7B 4GLRI 1KJVB 1WFOA 4PJCB 1IGFL 3OV6A 3EW3B 1OD9A 2NW2A 1HOCB 1TPXC 3UBXB 3QNXA 3TN0D 2CUIA 4ZDHA 5CKAA 5LAXB 5IOPA 4K2UL 4PS4L 3TO2B 2VH5L 5E9DE 4JO4H 3ZKNC 1MEXH 5B21A 3U0WH 4WU7A 2PO6A 4ELKA 4HAGA 4PR5A 3QCUL 5DK0A 1BQHA 4WO4A 5D72H 2EDLA 5I15H 3HPJB 5L2KD 4O2CA 4R97B 3TESA 4R96B 5IT2H 1INEL 3BPOB 4KKBD 4P2RA 1RUPH 2BZDA 4GJTB 4JG0L 5EC1A 4YDJA 5JQ6L 5GS0C 2HTKC 2FJHB 1RUML 1D5XB 1IAII 4GW4B 2BERA 2ZOKA 3H0TB 1G7LB 2SEBA 4ZPTA 1KFAL 2X44D 3BP5A 4GS7B 1VGKB 4I0PC 1BZ9A 1HSAB 3LY6A 1AE6L 2Z31B 3QUYC 5D2LF 4OGAC 2ENSA 4OAWA 3O11A 1NBYA 4XTRC 1BD2E 2ITDA 2NXZC 1OGAD 3IAQA 1ZLUH 2UZXB 1A1NB 3M45A 4MWFB 1Q9LA 2Q8BL 1WAAA 3OR7A 2X4TB 1MCJA 2FJFB 4PRBB 3MR9A 3V0WL 4FQJH 4OSUL 4P9ML 3N85H 2JIXB 4D0BA 5L88H 3AM8C 3HMXL 1YJDH 2DLHA 1E4KC 4W81A 3T0XA 2A6KA 3VWKC 3F65A 4OZ4A 2WIIA 4OLXL 5ESVA 5D5MA 1TVBA 2IH1A 4IDLA 4UMGA 3E6HB 5FM5M 4BJLA 3QUZA 2E8ZA 5KAQF 3Q1SH 5F71A 3ARGA 5SWSE 1K4CA 3VXRB 4QYOA 2ZUXA 5DMIH 2F9BT 5HHPA 2PXYA 3FQTB 4QRRA 4JQIL 5C0FB 3RWFA 1YEEL 4U4BA 2A74A 2EDTA 3WS3B 3KXFD 1Z3GL 1YEFH 4NSKB 2YMXL 3U79A 4UU9A 1G7IA 5JOFB 3VXNA 2VITB 1X4XA 1U92B 3L95A 1I9RH 4YBLB 5BMFH 5E1AA 4OJFL 1WIUA 5JPMA 5FGRA 4PJDA 5FKAB 5FHBH 4PJIA 5EIIB 3IGAB 2NZ9C 1C1EL 1BBJB 1KG0B 3CLEH 5KVEL 1FO0B 3BEWA 3CFCL 4FQXB 4FFYH 4YGVA 5I66B 1ZAGA 3FQRB 4S1QL 3H9HA 3R06A 4UDUA 2APVA 2JELL 4XNQB 5CHNA 1CICD 4LKCB 3HUJF 1A1MA 1S7TA 2NY2D 5SWZD 3HAEG 3MOBH 4PRDB 3PWUB 5D1QA 4Y19B 2EC8A 5KSAB 5C0GA 5DRZB 3FCTB 2IG2H 3QQ3B 1EH9A 5DJ0B 4L4JA 4A6YL 2E9JA 5IM7B 4P23D 2CQVA 3ZMRA 1F2QA 1HHGB 4PGBA 3PIQB 5DD3H 4MD0B 5T3XH 2GY5A 3FQWB 4PJBB 1S7WA 2NY1C 3TZVC 3P4LA 3HR5B 3FQUB 3CFBB 3TNNB 5ALBH 5CGTA 4KQ4H 4XWGH 4NRZB 5C6TH 43CAB 2AEQH 1FRGL 2NY3C 3MLWH 2B0SH 4JHZA 3GI8L 3V5KB 1V3LA 1QFWI 1QO3A 2GCYB 3H8NA 2OR9H 3RY6C 4MJ6B 2IH3B 3GMOA 2OS7A 1IQWH 4IHOA 4JFDD 1NAML 3UYRH 4PJHF 4ZUUB 4PJAE 3NA9L 1HQ4B 4P5MA 4PV9A 4R7DA 2YXFA 4G80B 4PGJA 4IOFC 4DKEH 4HLJA 3QNZB 2I5YH 3FQXB 1JFQL 4X99B 3V6OE 1RUAH 2LU3A 5E6IC 4LP4A 3RZCD 4MAUH 4BZ1H 3TIDA 2FR4A 2IQ9H 2VDML 1T22A 4M7KH 1ZLSL 2L7JA 1OTTD 1WBYB 3VI3F 3WNMA 4PJXB 4P3WA 5GRYA 5E08L 1J7VR 2F5AL 1S7SB 4R8WL 4WUUB 1BFVL 1P1ZB 5TE6H 2WBJC 4TNVK 1OSZA 4I48B 4U1JB 1TJGL 1FLRH 3W9EB 3MUGA 4C54A 3LRSB 3S88L 3SDDA 2W60B 3IFLH 3MRBA 5IQ9B 4JO1H 4NN7C 3A6OA 2EDEA 1I3UA 1K3ZA 4N9OB 1XAUA 1P4LB 1FORH 3VWJC 4Y5XC 3MGOB 4XNMB 1DEEB 3SDYL 4FQHA 2CDGB 4AEIH 2VXVH 2HLFC 4DN4L 4JE4B 1FL5A 1EFXB 1DDHA 1FH5H 3IDUA 2PUQT 2LU4A 1JZ5A 4MJ4A 4UTAL 3V95A 5C0JB 1X5YA 5FK9A 5GGQL 3VFSB 3TH4T 4X6DE 2EH8L 3ZKMC 4XP9H 2QHRL 3GMNA 3O9WC 4I1NB 3T65B 5SWQB 4JFFD 4RBPK 3BH8A 2VLLA 1HE7A 3PQYA 5J6GB 1FE8H 3MTRA 3E6FA 4CMMA 5CEZD 2IAMD 2EXYD 5KANG 1MIMH 4NPYB 3DX6B 2IFFL 2Q87A 3OKOB 3QA3A 3OR6A 2X4QB 5CEXA 3MGAA 4HUUB 3ESUF 5FHAL 5MEOA 3UYOD 2XZQL 3MUZ1 2FO4B 1A6PA 2QHLA 3QHFL 1AD0A 5JOPE 1KT2B 4K3EL 4KQ3H 5CJOL 5I1HH 4HW6A 3UDWC 3MLRH 4XVSL 3T2PA 1N3NA 1M71A 4ODHL 5KBNC 5I2IA 2HN7A 4G6MH 5EPMA 3SPVA 1SJEB 3NCYS 1Z6JT 3G08A 1A4KB 4HCRL 1MI5E 1IGJA 3R8QA 5F1IA 5D2LE 2H45A 3PGCA 4U2YA 4F7CA 5ABDE 3OB0H 4WV1A 4F37F 2NYYD 1IGCL 5MP6H 4FN0A 1QSFE 4XP6H 5I8OH 3L3DB 3R1GH 4JPIB 3WLBA 3ARSA 4AH2A 3A67H 4WEBH 2DDQH 1KIQB 1IT9L 2ZCLH 1IJ9A 1P7QB 4XC1H 5GGTA 1TVHB 4A2LA 2OLDA 1NANI 3VFWA 1LO4L 1O0VA 1H3XA 1CG9A 1QHPA 1YEKH 1RUKL 4U6YB 1A3LL 1YEDA 3SCMA 5TFSL 1I8MB 2YC1B 4HUKB 1MJUH 1NLDH 1VHPA 1G6RB 2DQIH 4GMSL 1ADQL 2B2XL 4HMEA 5HI3C 1MY5A 3L3HA 4IOIB 1HCFX 3UC0L 3NCFB 1M7DA 1BQSA 2EYSB 2DLTA 1UKTA 3EOTL 1KYOK 1VACA 1PQZA 4POYA 3KLAB 4ETYA 4HF5H 4RX4D 4S1DC 1RJLA 1U8OA 1CDJA 1FVDA 4RMSA 2CXGA 1JV5A 2OXHA 3BDYL 4GKSB 4RGNC 2GKIA 1I1YB 4GXVL 3EKCA 1OAKL 8CGTA 5I1KH 1CXKA 4DKAA 2B4CH 5ANME 4AMKH 1F58H 1IM9D 4RDQG 3P4MA 2H6PA 5DC0A 3P11L 1I1RA 5D7JA 5L8LB 4JFOA 1SM3L 3W9DA 2UVFA 4YXKL 1PSKL 5F9JA 1R3HB 1RV6X 2R0ZH 4QHUB 3MXWH 4YBHA 4BZ2H 5I1DB 2R8SH 3GSUB 1UCTA 1FIGH 4HPOH 3GMPB 3E2HB 1PEWA 4Y4KD 3D3VD 3V4PH 1NEUA 2D9QB 2UZIL 1T21A 4OD3H 3HUJE 4EI5B 1JZ8A 5C0BE 3PP4L 2MQ3A 3TVMB 4TULH 5CJQH 1YY8A 2ZJSH 3AGVA 3ZT7A 5IFHL 4ISVB 2R15A 4K94L 3TWCH 3MYJA 1C16A 3KYMA 3F7YA 1A6ZB 1CVSC 1MHCB 5T1DH 3TM6A 3BGMA 1NFKA 1ZKAA 4PY7A 4WWKA 1CD1A 3RFZC 3D9AH 3DGGB 3CDGB 4ZS7H 1SJHA 4HQQL 5FM5O 4P5TA 3FKUS 2FD6H 4MA8L 2XQBL 1EDQA 1T1XA 4WW2C 5F9OH 2AJUH 1DTUA 5JHLL 3HN3A 1GGIH 1DN2A 4HS8L 4NFCA 3F5WB 2R2CA 3KPRA 3L3IB 4JO3L 3LKQA 3O3AA 4JANB 1T80A 2MKWA 4Y5VB 5K59E 4R4FL 3PG2A 4ELMA 2XZAH 5BJTA 3PWPB 1QRND 1XIWA 4UOJA 1M6OA 3VXOB 3W0WA 3MRPB 1MQKL 4PJHE 3S34L 3H9SD 4FFZH 4XCFH 5DD6B 1A0QL 3O2WH 4JM2A 3G6DH 2BSTB 4ZAKA 3I6LE 3FN0L 3LKRB 5EU7C 3QDMD 1AQDB 5FO8A 4WUKH 2VAJA 1QLEL 4J2XA 3MNVB 2BVEA 2MWCA 3VI3E 5LBSH 4GS7C 5T1LD 3B43A 3BUTA 3H6JA 1QPPA 3EYOB 1ETZA 3BN3B 4M1GL 5I18L 2Z31C 3LSOB 4WFFD 2XWBB 4JPVH 3TV3H 4L8SC 4PLKC 4GFTB 1G7MB 1F3JA 1NBVL 2F74A 2N4IA 2DJSA 2EYTB 4M5YH 5EBWA 1XR8B 4RGMC 2NY6D 5FIEA 2XRAH 1JMXA 3MV7E 1DN0B 4MQ7B 1WTLA 1CLYH 3ZKQD 4MNGA 4LP5A 1JBJA 1H5BA 2OTUB 4OQTL 1CFVL 5DJDA 3FOMA 3TFKC 3BPCA 5DD0L 1C08B 4APQB 4E5XA 1RZKL 1T2QL 2OMBA 4M02A 1BJMA 1GIGH 3MJ7A 4YDIH 4Q9QH 1IRAY 3MRGB 5B3NA 2Q76A 4JCMA 2VZ1A 1JHKH 3IJYA 5GGUA 2X1XR 5HVHC 4KUZL 5BQ7A 1I1AA 3U1SL 4Z7WB 5BOZG 4L4TA 4NGHL 3AXLB 2BMKA 2CRIA 4ZXBD 4OCMC 5DQDL 5B8CA 1VSCA 2XV6B 4KPHL 2ARJQ 4H5SA 4CU8A 5HHNB 3RWHA 3AS2A 3KLHD 4LVNB 3HI6H 3MRNA 1JWMA 3IU4H 2JCCA 4UTBH 3HLAA 3GSRB 5ID0A 1GRWA 2EIZA 4M6MH 3HZVB 4NBZB 5EZJB 1H0DA 1NMBL 4NP4H 5LGHH 5HYJD 5F7DA 1DBJL 2EH7L 4M1CC 4P2QD 3DVFA 3LPGA 1GGCH 2VDKL 5CEZL 4TYUA 2MHAA 4Z78B 2PNDA 5F21B 2M1KA 1BF2A 2BJML 3BZ4A 3QUXD 4QRPA 3HZKA 3NFPB 4F7PB 5J11C 3O3BA 2OI9C 1F4YL 1T3FA 4PJEA 3U6RA 3LV3A 1N0XH 1EJ6A 4HAFA 2XG4A 3RVWD 5CP7B 1OGAA 4JPKH 2I60L 2YUZA 4JDZB 5AYQA 1A47A 3BEVB 3MREA 4UBDD 1AD9B 4MA7L 3ABZA 4PRIB 1B9ZA 2DD8L 1WF5A 3K74B 1AC0A 1PY4A 1T5WB 4ZO6A 1XF5A 3VGAB 5CSGA 5JOEA 4Y4HA 3VXQB 4Z8FL 4JZJC 4CN6A 3T4YB 2CRMA 4M8QA 2E6PA 2BVQB 5FA3B 4PGEA 2MPAH 5KTEL 5E9DA 3DVNB 3SEPA 2PYFA 5AUMB 3RTQB 5EBGA 1IGFH 3NGBB 2VDRL 1OW0C 5DGQA 4D0CA 2GK0B 3BPLB 5CJXC 2OM5A 2WM0A 3P40A 2CK0L 5CBAB 5EBMA 4DUXA 5KSBF 1PY9A 5LWYL 4K2UH 3Q5OA 1J18A 2VH5H 5GXBB 1FFRA 2E6JA 1KCLA 5F1NA 4KKCC 4OBRA 1PAMA 2RQ8A 2UWEF 3O6FA 1IKNC 3QCUH 4HV8B 4DZBA 2DYPD 1UM5L 3GJFA 1Q9WB 3I02A 2EKSA 1INEH 3H7BA 4N90D 4HIEB 4U1SA 5HDOA 3U7YL 4PYHA 1NC4A 1BD2A 4J1UB 4JG0H 5JQ6H 3BP6A 3QWOB 1RUMH 4V1DD 1DVFC 4AL8L 3UZVB 3BESR 4L4VA 1KFAH 4E0RB 5T1KA 5BS0E 2Q20A 5TE7L 5DVLA 3AC0A 4MD4A 1AE6H 2H32H 3VJ6B 2AV7A 3BZDA 3O2DL 4WFHD 3TEUA 4XZUB 1K9TA 4Q6IA 1CFNB 4LOUC 4WHDA 5GJSL 5JLZA 1ORSA 1KPUB 4MSWB 1IGYA 2YPLD 4LEOA 5JW4M 2Q8BH 3BKJL 4I13B 1O7SA 5ESQA 1CD9B 4X8XA 1AJ7L 4KJYB 3IS1X 5E03A 4NHUA 1NLBL 1K8DB 1WC7A 1YMHB 4HS3B 3V0WH 4OSUH 4P9MH 1FN4A 3HMXH 1RIHL 3O3DB 4G9FB 3DETD 1SY6A 4FXGA 1KTDA 4Q9CA 5SWSA 5BW7C 3JVGC 4P49A 4OLXH 1A7PH 1ITBB 1OSPL 3AAZB 4P46A 3RU8L 3FO9B 4H26A 2GJ6D 5CGYD 1YN7A 2NY7H 4F58L 1IC1A 1R5IA 4Z0XB 1ZMYA 5D1XB 3DXAE 4LMQE 1JF5A 1CFBA 1OF2A 1I85C 2WIMA 1FYHB 1MNUH 3X12A 4F9LC 4JQIH 1YEEH 4EQ3A 1Z3GH 4TUOA 5DEFB 2HG5A 5KS9F 2YMXH 1LO5B 1KELH 2LFGA 5DLML 1X5JA 5DUBA 1OAYL 5DJZA 2AJ3B 5E4EC 4D9QE 4OJFH 2G75B 4K8RC 1YZZA 4DAGL 1FCCA 2DICA 4AQOA 4MHHG 5GISL 2YD9A 3DRQA 4ONFL 4XNYL 3V2AR 5ID1A 1BQLL 3OKEB 4TPRL 3RA7L 2XPGA 1EEQA 5IB2A 1C1EH 3QQ4A 5BRZE 1U2CA 3LB6C 5KVEH 3IVKA 4ZO8A 4LCWB 3CFCH 4XP1L 4XC3L 5SV3A 5T33L 4PIRF 1E4XL 4QHLB 2R23A 3EBAA 4XP5L 5FDWA 1S7XA 1WGOA 4S1QH 2JELH 3KVQA 4OUUA 1TZHB 3T2NH 3HFML 5MEND 4DW2H 4S2SA 2QR0A 5AWNL 1QLRB 3MJ8B 3QEUA 1JGDB 3U83A 3U4AA 1UB6A 1U6AL 4Y1AE 3VXSB 3U0PA 3GK8L 4EIZC 4JZOA 3UAJC 3DVIA 1JGEA 3EHBD 2RBLA 5SV4A 4ZYKA 3STZB 4U1IA 1U3HD 3O6LL 4PB0L 4A6YH 3LEYL 3S5LA 3ILQD 3QJFB 4RFEA 3KPSD 5DD5L 3O4LD 3MV11 1FCGA 5F1SA 2CIKB 4CKVX 1LGVA 3D39D 3MRCB 2XXCB 3LH2L 4X6EB 5EO0A 4C58B 4X9BA 4PJAA 1B4JL 3K8MA 4RQQA 5J12C 2Q8AL 4MNQB 3QT2A 4U3CA 4JZNA 2DLGA 1GC1C 3IDYB 1FRGH 3GI8H 3BT2L 3P2TA 1TETL 5I76B 3I3BA 3G5YB 1BBDL 3L7FB 3RWJB 2J88H 1FC2D 2OR8A 2ED9A 4XX1G 3F7RA 1M4KA 3MLYL 1NAMH 3CVHA 3NA9H 3HPLA 2VZUA 1YDPB 2C3HA 4XNXL 5J3HD 1JFQH 2FIRT 3D18B 2QQKL 4YFLI 2V2TA 1L6XA 4U6XB 3LOWA 3MLVL 1J05B 2VL5A 1ZLSH 2R9HC 3KPPA 4JRYB 4HDIB 4KXZI 1OARL 5E1HB 3ZSSA 1CFSB 1VADB 2CLRA 2F5AH 1NFIA 3LHPH 4R8WH 1BFVH 3RUGF 3B6SB 3ARFC 3EFFB 5D4QA 5EN2B 1D9KB 3UO1L 3S88H 3FRPA 3ZTJH 1HHIB 2CPCA 4JGMA 4KAQH 4M7LT 2WANA 2NW2B 3JV6A 1KTKE 4HKZA 3QPQC 4Y16B 3SDYH 4R3SA 3TIEA 4DN4H 4ZDHB 3I75A 5IOPB 4DOHB 4PTTA 2X7LA 3PHQB 2DQDL 4WU7B 4TSBL 4ELKB 1A6WL 5E99H 1BQHB 3EO0B 5DZLA 4UTAH 3QULA 1HQRA 3GHEL 5GGQH 2EC9U 2ICEA 5IW6A 2EH8H 5AEAA 2QHRH 4P2RB 2B8OT 3T0ED 4JFEB 2ICES 4J3XA 4QXTB 1Z9SA 3DWTA 5D7LD 2V7NA 5CSBA 5D2NC 5DO2C 4F7EA 2JJUA 4BA8A 4O2EA 4YDJB 1TQCB 1XMWA 2YWZA 2PYED 4X98A 2HMID 1XFPA 5KSBE 2ZOKB 3BO8A 1HH6A 2SEBB 4PJ7F 4RBPH 4ZPTB 3SKMA 2IFFH 4RX4A 2ZUQB 1MCWM 1BZ9B 5I30L 3V6BR 4NO3A 1P84K 5EC2A 5FHAH 2IJ0C 2X70A 2XZQH 1XT5A 3RWIA 3O11B 1NBYB 3EIFA 1MI5A 3QHFH 4NQEB 4UNUA 3BX7C 5EU3A 1EBPA 4K3EH 5CJOH 3IFOB 5D2LA 1P5VA 4XVSH 4OLWL 4ODHH 3NCJL 1Q9LB 3D69A 1XGTB 3FB8A 3FRUB 2P5ED 2F8XC 1DBMH 1T83A 1QSFA 4QRSB 3QEHA 3RNQA 4NQDE 3MR9B 4D0BB 4K94C 2FJGA 4HCRH 3DECA 2VLKD 4DKFL 2BHZA 4MZ3A 3RKDC 2A6KB 4EN3B 4OZ4B 2WIIB 1QBML 4XPTL 3CXHK 1UXWA 2NQCA 4C83A 3I3DA 5A16A 1IGCH 5D5MB 1TVBB 4JGJA 4L29B 2DTML 4ZFFA 2J4WL 3KG5A 3S35L 3QFJD 1EBAA 1EAPB 1LQSR 1J12A 4ZOCA 1G7JA 4P4KB 1R24A 3O4OB 1BREA 5I0ZA 1QFOA 5IMOB 4RAUA 5FV1L 5HHPB 3RWFB 1IAMA 4BQ6A 2A74B 5DJ2B 3RWDA 4UU9B 1G7IB 1RUKH 2EDJA 4OCNC 1A3LH 3LQAL 5TFSH 3WNLA 4XPBL 4G6JL 3QXVA 4GMSH 1ADQH 2B2XH 5TGBA 3PL6A 4TVPH 3UC0H 2RB8A 4PJDB 1AKJD 4KRPD 1ZSDA 5I1AA 5C0CE 4TRPL 4PJIB 1QRNA 5HI5D 3EOTH 2WP3O 1WWAX 3BEWB 1A3RL 3UPCA 3K8LA 3OJDA 4YGVB 2BY1A 3CX2A 1Y0LA 5KS9E 1YNKL 3W5NA 3H9HB 3RZCC 5I1IL 4UDUB 3BDYH 1J0JA 5CHNB 1U8IA 1U2HA 4GXVH 2ZUTA 1OAKH 3QI9A 4HGWA 4ZD3H 1A1MB 4OKDA 1JNLL 4XPFL 1S7TB 3L1OL 2D03L 3O8XD 3JUYA 3QIWD 4P2YA 5B38A 3HUJA 3Q48A 2BX5A 2EDWA 3P11H 1MJJA 1N6UA 5CIPA 3B9EA 1SM3H 1WT5C 3QISA 1P7HL 5DRWA 4YXKH 1FNLA 1ZHBB 4WHTB 2VLJD 4JLRA 1U58B 1FZJA 3QUKA 2J6EA 4PGBB 5IGXL 5DURD 1YN6A 1F6AA 3VW3L 1KF9B 2B1HL 3RHWK 3RL1A 5CEYA 2UZIH 3TT3L 4AG4L 3C5ZD 3TA3A 2MJWA 2LAGB 1XF4B 2H3NA 4O4YL 3PP4H 4KK9C 1JIBA 1A6TB 3MA9L 5IFHH 4K94H 3Q6FA 1PZ5A 5TDNA 4ACPA 4CJ0A 2AK4E 1T6VN 4NM4L 5HPMB 4Q2ZA 1Y18A 4HQQH 1T7YA 4MA8H 2XQBH 5HY9A 1IQDA 4PJHA 1NGQL 2W9DL 3SGDI 1DCLA 3TIDB 2FR4B 4LCUA 2P5WD 2VJXA 4HS8H 4CNIB 1T22B 2IADA 3IJSB 3NACL 5K33A 5I75B 4EUPH 4JO3H 4R4FH 4HJJL 5JUEL 4JB9L 2VUOA 5JMOC 4HSQA 4MA1C 3OWEA 3LRGA 2Y6SC 2D7PA 1IL1A 1OSZB 2DLIA 1MQKH 3S34H 5D96B 4YWGL 3FTGB 4FZ8L 3SDDB 5HXMA 3VFMB 3H2WA 3MRBB 4ZUSA 1VDGA 2ZNXA 3K2MC 5IB4A 3FN0H 3GSOA 3QB7C 4HKXB 1K85A 3VA6A 1RSFA 5E2WH 1CL7L 5J1TC 3MV7A 3OGCA 3FB5A 1QLEH 2FIKB 4FQHB 1OLLA 1TNNA 4GRWB 3U2SB 1FL5B 4WI2A 2NX5D 4HBCL 1DDHB 4LHJB 4M1GH 4B53A 5I18H 1WK0A 5JDSA 1VESA 2Z35A 3VDBA 1NBVH 4KUCD 2IPKA 3ZDYF 2OTWA 5D8JL 1BIIA 4P48A 3G6AA 2XWJA 4PJXF 5C0AA 1C8PA 1PX4A 4HUXA 4HK0A 2FBJL 1KPRA 1MH5A 4FS0A 4LVOC 4OQTH 1CFVH 3PQYB 3IJHA 1QFWH 5DD0H 3E6FB 5EOCL 4CMMB 5CP3H 1RZKH 1T2QH 2IBZX 1RHHA 1QNZL 3QA3B 3OBAA 3AREB 3OR6B 4HHAA 5A2JH 4NNXA 3IU3A 4IRSB 5CEXB 5ETUB 4JVWA 4JRXD 5MEOB 4KVCH 4Z76A 3QAZC 4KUZH 3U1SH 2XNAA 1AD0B 3ROOA 1WZLA 5DQDH 1LHZA 1MFAL 3BH9A 1M71B 1FAIL 1HINL 2HN7B 5AZ2L 4OZFH 1G7QB 5EPMB 3SPVB 5MHSD 2CR6A 4JQVA 3B9KA 1H3TA 4LEXL 3SGKC 3K1DA 5C3LD 3G08B 5J57B 2HH0L 4YLQT 4PJ7E 2DWDA 1MHHA 3V8CA 2XOTA 1BAFL 3C08H 3GKWL 1IGJB 4G6AC 2Y5EA 1NMBH 5F7HA 5GS1A 2W0FA 5F1IB 1UGNA 1PBYA 4MAYB 3HG1E 4AEEA 1K2DB 3N1MC 1HSBB 2VL4A 5CKGA 3QIUC 4F7CB 2PF6A 1DBJH 2EH7H 4PLOB 3S4SA 3TH2T 1RZIA 3CCHB 1ZHLA 2VDKH 1AGCB 1FNGA 4LPXA 4V1DA 3SO3C 5C0EB 5CEZH 2ATKA 2BJMH 3PUCA 2A6JA 2FX7L 2DMBA 2A9ML 4G6FD 2A6DA 3BD4A 3WLBB 1BMGA 2IWGA 4AH2B 1F4YH 4PBXA 3EJZC 4KI5D 4TSCL 4PRHD 1EFQA 3INUL 4NO0D 3L5IA 2O93L 2XTJC 4LQFL 4B7LA 4PRAA 1H8SA 1K3IA 1YEDB 4MA7H 3SCMB 4TTDC 5FUCE 3S98A 2UVEA 2OXGA 3BKCL 4FA8A 1V3KA 2O5XL 5DVOA 5EZLA 1CF8L 2YKLL 4PP2A 3MNWA 1KLUA 1MVUA 1M7DB 1II4E 4Z8FH 3DMMA 4G8GE 1X6NA 1F90L 3ZTJG 3QNYA 4XI5D 1JF6A 1VACB 4LU5L 3E8UH 5KTEH 2JKXA 1RJLB 5C8JB 1UQSA 1ZA6A 5KZCD 1UG9A 4KVNL 1JV5B 5FGCB 3TBYA 4HIIB 4KDTA 2VDRH 3MLSL 3HE6D 1P9MC 3GSNA 1JPGA 2CK0H 2H6PB 1UJTA 1AHWC 4NT6A 3VD3A 5M94B 5LWYH 1QKZL 2AERT 1OCWL 2FB4L 5D7JB 3CDFA 5L0QB 5ICZA 5DRXB 3NN8B 1KNOA 3G5XB 1K4DA 1S9XB 1ED3A 3NCMA 1LK3L 3W9DB 1RUQL 3BI9X 2MCG1 3OGOE 4C56D 1NGYA 1UM5H 1ZT1A 1TQBB 3HNVL 2DLEA 1IAIM 4JKWA 5DFWH 5SX5K 4XPGL 1T21B 3U7YH 1BHGA 1LVEA 2ZG3A 2H2SC 4PLJD 3VXRE 5HHQB 1MCHA 1MRCH 2N7BA 1YY8B 4AL8H 5HGBA 1GJIA 4NQSB 3IFPA 3MO1A 3MYJB 1AH1A 3KYMB 5TE7H 2CO6B 1Z5LA 5T3ZD 1F6LL 5L7XL 3BGMB 5D9SA 2WINA 4PY7B 4TUJA 1CD1B 1N8ZA 5IB1A 4Y8AA 1XH3B 4MVBD 3GIZL 1SJHB 5GJSH 1RJCA 5JXAL 3MOQA 1T1XB 5DSCA 1JRHL 4RSVA 3BKJH 4K3HA 2AI0L 3QIBB 2KDGA 3KPRB 1NLBH 3C60B 3LKQB 4LIQE 3LAFA 2P42B 5BV7L 1RIHH 3KPSA 4ELMB 2PO6C 3DXAA 5BJTB 4ODTL 5TJWK 4LLQA 4YHYC 2N1KA 4XPAL 1C5DA 1XIWB 2C4FT 1D5ZA 1M6OB 4WO4C 2HJFA 4X83A 3SE4C 3OKNB 1BZQK 3CGTA 1OSPH 3X13B 1U8JA 3LN4A 2V17L 5HD8D 4G7VH 3RU8H 1BM3L 3LPFA 3MRHA 1HXMA 4OF8A 4ZAKB 4PJGF 3SDCD 2VSDA 5FF6A 4KZEL 5F88A 4F58H 3VXPB 5ENWA 5GJTL 5FO8B 1SJXA 3PHSA 5C0ND 4GRLD 2EXWD 1FDLL 5F44A 1BOYA 3I50L 1KB5A 2ZUQC 4ZFGH 3VRLF 2DL2A 3JSSA 1CS6A 1ZT7B 4FG6D 1FIEA 5BRZA 1D5MA 1F3JB 2F74B 3W82A 5EBWB 5DLMH 1B2WL 1EMTL 4HS6A 2OJEB 2WLZA 1OAYH 5L8JB 3CC5A 4EQ2A 2D7TL 4DAGH 2X10A 5C09D 1S9YA 4ONFH 1D5BA 4R26H 4U1NB 4TPRH 5DJDB 2YZ8A 3FOMB 4KJQC 3RA7H 3BPCB 3WFHA 4E5XB 3G5ZA 2C26A 3MJ7B 4LQ1A 4Y1AA 5JHDE 2KZWA 3O41A 4XC3H 4XP1H 5T33H 5FFLA 1E4XH 3ULVD 5C9KA 4XP5H 3DVGB 2IBGA 4UBDC 4FXKB 1BPVA 1JWUA 5HPOA 3IJYB 1OOAA 5GGUB 2D7QA 1XGPA 3ZDYE 3FO0L 5MERA 3CDYA 1IM3A 1I8LA 2BMKB 4PJXE 3HFMH 3WKML 5B8CB 2QKIA 5AWNH 1ZGLP 3QUZC 3TO4A 4H5SB 1A9EA 3TN0B 4WUUE 2FWOA 3RWHB 1U6AH 3F6LA 2EDYA 3GK8H 3MRNB 4RDQF 3KGRA 2AP2A 2IQAA 4XBPA 3ARGC 2JCCB 4UIKL 2BC4A 3HLAB 3O6LH 4PB0H 2CO7B 5ID0B 2EIZB 2PXYC 3LEYH 4X5XB 5DD5H 4WEMB 1QFWM 1CXHA 1MCLA 3LH2H 4XCEA 1J86A 1B4JH 2Q8AH 4KZDL 3X14B 1T0NA 4J4PD 1FL6B 1IAOB 2MHAB 4U0RC 4BSVB 1BJ8A 3BT2H 3G5VA 3MC0A 4IRJD 1TETH 4K9EL 4M9OA 5IUSA 3BZ4B 4OD2A 4QRPB 1XGYL 1OM3L 1BBDH 1T3FB 4PJEB 1CLZL 2GSGA 1ERNA 4Z7WF 3U6RB 3LV3B 4JFYA 1BFTA 3MLYH 4BKLB 2FH6A 1GXEA 2AJYL 3P4NA 3WV0A 1OGAB 3MROA 3C6LA 2VERN 1P7KB 3OKKB 2YD6A 4EUPG 1RVFL 2QQKH 5DEZA 1HWHB 2I27N 3FT3A 3MLVH 4DVBB 3DV6A 5D1QC 1OARH 1Q9KA 4CMHB 1XF5B 1TMCB 1M7IB 3CFIC 1MFCL 4WVRA 2O61A 1ZANL 4M8QB 5D6CA 3PF2A 1V7ML 4N5EC 1OP3K 4PGEB 4G5ZL 4N0FA 4XMLL 3T3PF 1CDGA 2XT1B 4ZFOB 3UO1H 1S78D 3VRIA 4Z5RA 4OFIA 4M00A 2DM7A 1NJ9A 1J1OL 1AO7E 2QEJA 2WLYA 3SKNA 5K9QI 1WBXB 5EBMB 1SYSA 4YPGA 3DETC 3S3PA 3N06B 4GQ9L 3IDGB 3FFCD 4Y4FA 3SQOH 2DQDH 3KXFB 4TSBH 1A6WH 4P2OC 5KSBA 3O6FB 2I26N 3HR6A 5DUPL 5GSRA 3GJFB 1R3JA 3I02B 3GHEH 2PR4L 5CGYC 2YOCA 1CE1L 3MV9D 2UWEA 3H7BB 3WIFB 2B7DT 4OV5B 1NC4B 1BD2B 2L4OA 4HFWA 3W5MA 3BP6B 2EE2A 2ADFL 2VC2L 4XHJC 3HB3C 1KIRA 4JO2L 2XFXA 1I8IA 4L4VB 3RGVA 2DRUA 5T1KB 2VDOL 1HXYA 4LFHG 3EYFA 5I30H 3CH8A 2C3XA 4KK8D 4NQDA 3IDJB 4LHUA 1WJ3A 3FO2B 1CICB 4OZFG 5E4IA 5HTSA 4Q6IB 1K8IA 1ORSB 1B0GA 4HJ0D 1CFQA 1IGYB 4OLWH 5SWZB 1T0MA 3NCJH 4LCCA 4WNQB 3QO1A 4JDVA 1ACZA 4LSSL 2ITCB 4RNRA 1WC7B 3S35X 4L1DA 4JM4L 3UTTD 4EUPB 2ZG1A 1FN4B 4P23B 1N2RA 4GW1B 4DKFH 3CU7A 4WI8A 4LKXA 4NKIL 1DBAL 1KTDB 4WHYH 2QTEA 1QBMH 4XPTH 3PDGA 5IBTH 4EI6A 3I85A 3DV4A 3ULUD 3QRFM 3H3PL 3MBEA 1OAQL 3S35H 1X5XA 3QEQD 1S7UA 3EHBC 5TDOA 1R5IB 2YBRB 3TP4A 4E42A 1EXUA 1WZMA 1OF2B 3L5JA 3QXTA 1A6VL 5BZDA 1DL7L 3X12B 1XEDA 4MXQC 3ZE2F 5CD5D 4U1HA 5F7KC 4XAKE 4XPBH 4G6JH 5DUBB 5DJZB 4KMLB 4PJGE 3MCLL 3JUZA 3DRQB 5ID1B 1NDMA 4TRPH 2XPGB 2V5SA 1TENA 5IB2B 3QQ4B 1GAFH 3B5TA 4C55A 3IVKB 5KSVA 1R0AH 3RVUD 5EOTA 1A3RH 3VRLE 4K3DH 5EWIL 2KQNA 2ESVD 1MHEA 4H0GA 5C86A 4X6CF 4CU7A 4HD9A 1S7XB 3PV6A 3RL2B 3SHSA 1EIBA 5I1IH 5CSZA 4WV1C 4U1GC 4OUUB 2H8PA 1XF3B 3QZWB 4CDHA 1RIUH 4MX7A 4DGYL 4S2SB 4P59L 1JNLH 2AAVA 2DQJL 3L1OH 5ICXA 1W72A 2D03H 3PWPE 1UB6B 5C92A 1UZ8B 3U0PB 2NX5A 4XXCC 1JGLL 4JZOB 3CXDL 1JGEB 1IZJA 4MQTB 2A38A 5JDJA 4U1IB 3CH1A 1VFAA 3S5LB 5H37H 5IB5A 4RFEB 1PYWB 3QWQB 2AK4A 5GSVA 5FM4A 5IGXH 2VDNL 3IKCA 5A43C 3QG6A 4OFKA 3VW3H 2B1HH 2AJSL 3M17B 1CXEA 3TT3H 4AG4H 2PCPB 5EA0L 3L5HA 4DCQA 3U30B 4O4YH 4YHLH 1YC8A 1X5ZA 3MA9H 1W8OA 2EEBA 2HT2C 3GNML 1A7BA 2RAMA 4NM4H 4ETQA 4AENA 3FAXA 1A64A 2OL3L 1NGZA 3N50A 3CVHB 1LEKA 4M7ZB 5ITFA 3HPLB 1NGQH 2W9DH 4QLRA 2V2TB 3PWJB 4KKLC 1T20A 4PRPD 4O58L 3GSQA 5DQJB 2VL5B 2XY2A 3KPPB 3NACH 2EC9T 3VFRB 5IMKA 5EUOF 5L0QC 4ZQKA 4JB9H 1H8NA 2GIYA 4I4WA 1NFIB 3BSZH 4LNRA 3GI9L 3BDBA 4Z7WE 2O5YL 2V6HA 4R2GD 3RUGA 1QBLL 4FZ8H 5K93A 4CVZB 5E8OA 2B39A 4GO6B 4Q9RL 2UUDK 4IJ3B 3IF1A 1MRDL 3DTXA 2PN5A 1CL7H 2HJLA 4HKZB 1ZLVH 4R3SB 3TIEB 4PRHA 3I75B 3DIFB 4GBXD 4HBCH 5CINL 4PTTB 5GRUL 4NRXB 4WWKC 2OYPA 4M6OL 4M8VA 5IV2A 4LLUA 3T3PE 5D8JH 4P5TC 4XVJL 2ADJA 2ICEB 5IW6B 4OTXL 3MNZB 3EYQC 1YPZA 2FBJH 2D2OA 4NC1C 5I1CL 5EU4A 4O2EB 2CIIB 2PTUA 1DFBL 4X7TA 2AS5M 3X11A 1T03L 2P8LB 3O6KL 5EOCH 3U36A 1CDCA 5B39G 3GMMA 1HH6B 3CK0L 1QNZH 3SKMB 1QEWB 4PJ8C 5T5FL 2XA3A 5EC2B 4PRIE 2X70B 4LLYA 4MJID 1WWWX 2ARJA 3RWIB 1KJVA 3HE6A 5E5RB 4ZNEE 5EU3B 4JM2C 4QTIL 3HG1A 5D2LB 1IM9B 1MFAH 2I9TA 3MV8A 3UBXA 1I75A 4KRPC 3EDEA 1FAIH 3D69B 1HINH 2OZ4L 5D6DA 3J8F7 4PY8J 5AZ2H 3FB8B 4JQXC 4LARL 2VLRD 3QCTL 4LEXH 3WHXA 4LMQI 2VDPL 3RNQB 2HH0H 2VXUL 4RMWA 4OV6F 2CKBA 5T5NF 2FJGB 3CFKB 1LE5B 3RDTD 5IEHA 1BAFH 3GKWH 3BIBX 3C9NB 1PJ9A 4XT1C 4CRPA 2CSPA 4X4XB 5E8DL 2J2ZA 1UXWB 5A16B 4JY6A 5HHOD 4Y5YA 4OIBA 1JTOA 4QGTA 3ES6A 4MGXA 4ZFFB 1U42A 1LE9A 1K6QL 2FJHA 9CGTA 1RAMA 2FX7H 5IVZB 1H5BC 5D7KE 2A9MH 3H0TA 2IEPA 2EDHA 2APFA 1G7JB 4FMKA 4PG2A 1RZJL 1OWWA 3NMEA 3OQ3B 5BV7C 3PHOA 2AEPL 3INUH 4G8GA 1WIOA 5LGJA 4RMQA 3RWDB 4B5EA 4LQFH 1I1AC 1Z9MA 2UV3A 3HE7A 3OPZL 3EO1B 1NKOA 1H3VA 1I9IL 4H1LA 4I5BA 5B8CC 3DX7A 3BKCH 3MRQA 4NQCD 5CFHA 2O5XH 2X4TA 1UJ3A 1CF8H 4ORGB 5TGBB 2YKLH 2HT3C 2P24A 4N0RA 2VWEE 1ZSDB 2JIXA 5JORA 1BVLB 1QRNB 1IAKA 3UPRA 1CT8A 5D5MF 5EBLB 4LU5H 3ZKND 1XF2B 3OJDB 3ULUL 3HHRB 2BOBB 3WIHL 3ZE2E 1HI6A 4W6WB 1QOKA 1Y0LB 3WFEH 4KVNH 4L9LC 1BWMA 1UKSA 1U8IB 3E6HA 3OL2A 1GGYA 3MLSH 1R5VA 3R4DA 4HGWB 1KEGH 1HK6A 4YAQB 2X1WL 4G9FE 1A2YA 4JHWL 4EDWL 3HUJB 5GS0D 2HTKD 1QKZH 1G0XA 1P4BL 1OCWH 1W0YT 2FB4H 3VXRA 3PWVB 2V2WB 2VKWA 3KDMA 1N64L 5BVPL 5J13C 1LK3H 3WS3A 1RUQH 2ORBL 4JLRB 1FZJB 4I0PD 4U1MB 3QUKB 1ZLWH 1PLGL 4O51B 2NY6B 3QUYD 3ZO0A 4JFHD 1F6AB 3HNVH 4X6CE 5JOFA 4OGAD 2R29L 4PJDF 2VITA 1JZ2A 5FV2A 4XTRD 5HJ3B 5CEYB 4XPGH 3VFGH 2NXZD 5T3XD 2LTQC 2H3NB 5FKAA 4D9RD 4WJ5B 5EIIA 3IGAA 4BM7A 4Y4HC 2UZYB 4K7FB 4KI1A 3Q6FB 5AAMA 5TDNB 4YHOL 2Y5TA 4FQXA 3DOSA 4IM8A 4TSAL 5L7XH 1ITCA 3LKSA 2CUHA 3GIZH 3VXMD 1Y18B 3MFFB 4ZXBB 1WICA 1NCWL 1EZVY 5JXAH 1N7MH 4XP4L 1IQDB 4PJHB 1JRHH 3OSKA 2V7HA 1RQ5A 4MCYB 1I3RA 3PWUA 2AI0H 5KSAA 2IADB 5TPWL 3AS0A 3FCTA 4FABL 2BVPB 1YC7A 4X4YA 3MA7B 5BV7H 5HBBA 4OGYL 2W0KA 5JXEA 3BGFC 4LLWB 25C8L 4XPAH 1HHGA 4UDTA 1IL1B 5F6HJ 4J8RA 4DFHA 5MI0B 3TNNA 2V17H 5IG7A 5HYIA 5GGSB 1BM3H 2BNRD 2GTWA 5FYKE 5IB4B 2Y72A 4KZEH 4EXKA 1KUMA 5ESAB 5GJTH 4F15B 1KYOJ 1GOHA 5IW3A 4ZUWA 3MV7B 3OGCB 4MJ6A 5H2BB 3FB5B 3BN9C 1WZ1L 4RRPA 4Y2OA 5EUOE 3I50H 1G0DA 1I8KA 2Z8RA 3B3IA 2NZ9D 4ZUUA 3TCLB 3B2VL 1HQ4A 5JDSB 1IE5A 3ARRA 3CZFB 2Z35B 3WLWC 5JHDA 1KB9K 4NYLA 3VDCA 1B2WH 2IPKB 4F37K 1EMTH 2IF7A 2OTWB 3SOBH 3G6AB 2BSRB 4X9FA 1IMHC 5C0AB 3BDXA 3LS5L 3RAJL 2D7TH 4HK0B 1KPRB 4AM0B 1MH5B 1L7TH 2OMNA 3SGEI 2W0PA 4PJXA 1PD6A 4LAQL 4NOBA 5IQ7L 2QQNH 5AYUL 2RFXA 3IJHB 1S7SA 4WUUA 4Z7OF 1P1ZA 1OTSC 1RHHB 4HHAB 3CSGA 5TQ2L 3IU3B 4OLVL 1GOFA 5IQ9A 4Z76B 1PG7L 3P9MA 2CGRL 1GGUA 2ZUWA 5DEGB 4JRYE 4M3KB 4P46C 12E8L 4NO5B 2NY0C 3NZHL 3ROOB 5CD3B 4GRWF 1JZ6A 2NY1D 3TZVD 4IS6A 4X4ME 1ZHNA 3SGDH 3BH9B 1SHMA 2HTLC 4ODWA 1DEEA 2CDGA 4G43A 5H37G 3FFCA 1HNGA 3B9KB 3WSQL 1EFXA 2G60L 2VN4A 2FZ3A 4R0LB 4UIKH 4M93B 2DWDB 3JV0A 5GRJL 2YHGA 3HAEA 3GRWA 3PGDA 5GS1B 3LIZL 4XCYB 5C0JA 4KTDL 3VFSA 1WTGT 3QDJD 4IOFD 3ZT6A 5SWQA 4KZDH 2YA1A 3S4SB 4TVSa 2W1NA 4M4RA 3GSNL 1KCRL 4V1DB 1FNGB 4DOHE 2ATKB 4P57B 4O00A 4YDLC 5E6ID 2A6JB 3T0WA 3NPSC 3O45A 1ZVHA 2A6DB 2F54E 3DX6A 1XGYH 1OM3H 2DM3A 3OKOA 3WNKA 2K3TA 1GZQA 1CLZH 4X7DC 5I1LA 1SQ2N 2X4QA 4E9LA 1RURL 1IBGL 4P2RE 2AJYH 4JFEE 4FQCL 1B0WA 1F11A 2WBJD 3BYYA 4I0CC 4RFNB 1KT2A 2YPLB 1J11A 2L7UA 2CLZA 1RVFH 3QUML 4PLJC 4FFVD 43C9A 1SJEA 2VQUA 5EZLB 5E6ZA 3UTTA 3VWJD 3MNWB 4NN5B 1KLUB 1AO7A 1MVUB 5LCVL 1MFCH 2HLFD 3ZKXB 1ZANH 3PE9A 4MYWB 4NQEE 1V7MH 2BDNL 2BNUA 2Z92B 5ADOL 2DQHL 3HCVB 4G5ZH 4XMLH 5EUKA 4XX1E 4QRQA 4FZEL 1ZA6B 4IMKC 2MOVA 2GJ6B 3HNSL 1OP3H 3TBYB 1WFTA 3ZKMD 1J1OH 1Y6MR 3L3DA 3O9WD 4ZOEA 3DBXA 3V6OC 3WNNA 3Q1SL 2GAZB 4NT6B 5E5MA 4GQ9H 5CLTA 1KTRL 3WUZA 4Z77B 1KNOB 5DMIL 1K4DB 1KXTB 1ED3B 1UEMA 5D5ME 1DBKL 1EHXA 5DUPH 1IGML 1R3IL 3JZ7A 2IALB 5F6IC 2E7HA 4U6YA 1U9KA 1TNMA 2PR4H 2YC1A 3HI1B 1CE1H 1G6RA 5EIVA 5F7EL 5DWUL 3CAFA 2R1XA 5LGKA 4HWBL 1JK8B 2VTFA 3C5SB 3OF6D 4GRLC 4GKZA 4GXUM 1AGEB 1JL8A 4OFYA 3PNWB 2VC2H 1CDHA 4HH9B 1X4ZA 3K80A 2EYSA 2FDBP 4JO2H 4JR9H 2VDOH 3RNKA 3IFPB 3MO1B 3KLAA 4QXGL 4FFYL 2E27H 5D9SB 2WINB 4TUJB 1N8ZB 5IB1B 5AAWA 1CIUA 1EGJA 1I1YA 5MENB 1J88A 4B50A 4PJDE 1KJ2L 2JB6A 5DSCB 4IJ3C 5GS0L 3IRZA 4HC1L 1U93A 1PKQB 1NCDL 4LSSH 2Q7NA 4JM4H 1JPFB 1U3HB 2IG2L 5HYQA 5GRVL 2VZVA 3KPSB 1AP2B 3BD3A 3D2UA 3O4LB 4QHUA 1TITA 3V7AE 3GSUA 4LLQB 4OLZL 4LPWA 4NKIH 4OZIA 1DBAH 1C7SA 2OP4H 3HC3H 1IC7L 4GH7B 3KYNA 3LQMA 2CR3A 3MRHB 4KQ4L 3JWNC 5C07E 3H3PH 5FF6B 1OAQH 1KPVA 5F88B 3TVMA 4ODVL 1ONQB 5ENWB 5HI3D 2HLAB 3EO9L 4ISVA 4PJGA 1A6ZA 1Z9OA 5DMJB 3LKNA 1KB5B 1A6VH 3GFUA 1V3MA 5C9JA 1DL7H 4PP1C 1BX2A 3DGGA 3CDGA 2AK1H 3VD7A 4RIRB 1D5MB 4DQOL 2I5YL 4S1DD 3A0OA 3QP3A 1CFTB 1SMOA 4DGIL 2P4AB 4MAUL 2ZOLB 1ND0A 2EDBA 2X40A 3F5WA 3MCLH 2M2DA 4M7KL 5IROA 3TJHD 2YUVA 5DMYA 3L3IA 3T0AA 3UTPD 4MMZC 1X3DA 4X5WB 1BF8A 2W9LA 5M7QA 3G5ZB 3PWPA 4Y1AB 1FNSL 3O41B 5EWIH 5JA9A 3WO4C 1HKLL 2X9YA 1ZEAL 2BSTA 3UBXI 3GMLB 5MERB 1IM3B 4YJZL 4BH7A 1VFOA 1FORL 1AQDA 2QKIB 2G5BA 2DQJH 3PJSB 3TO4B 1A9EB 3WDJA 4YIQB 5FOBA 2FWOB 3EZJB 4AEIL 1UADC 4EEEA 1JGLH 2BVYA 4JY5L 1ZE3C 4Z7OE 3LSOA 1FH5L 5ITBL 1A5FL 5GIRA 1G7MA 4ZG1A 2HVKA 3ARWA 3NTCL 2VDNH 1MSPA 4P3CL 1EO7A 3T0EB 4XCEB 3U9PL 2AJSH 5EA0H 2J8UA 1T0NB 4GRWE 1X5HA 1EVUA 2VZOA 4XBGB 2PYEB 4ODBD 4CDGC 3PL6C 5ICYB 1AQKL 3G5VB 4ALAL 3ORJA 1J8HA 4OD2B 3V6FA 3BQUC 3GNMH 2VLME 1FPTL 4MJIA 2GSGB 2OL3H 5HVFB 4U2ZA 4JFYB 4G8IB 3AU1A 4XRCA 5I74B 1RZGA 2BHYA 3MROB 3C6LB 4OCSL 3RJDA 1OL0A 4D2NA 3RX8A 4QNPF 4Z7NF 2G5RA 5DFVC 3QI9C 2JCCF 5DI8A 4O58H 3DV6B 3R0MA 2E7LA 3C5JA 1NKRA 3V9FA 2C7UB 3GI9H 2O61B 4I18B 1IILE 2O5YH 3KLDA 3V5DA 5D1ZA 2Z31D 3MSPA 3QWRD 4N0FB 4OFDA 4PLKD 1QBLH 1WITA 3VRIB 3KR3L 4K23L 4U6TA 1ZTXL 2FLBT 4LPYA 1NJ9B 1FVEA 3TA3C 4Q9RH 5E70A 4PJEF 1HILA 2UY7A 4HPYL 5HDQL 5DHVH 1CGUA 3R1GL 4F7PA 2NZIA 1SYSB 1B4RA 1I3GL 5DJ8B 3WN5A 2ZUVA 4UAOC 4BK5A 1T1WA 1T7VA 4Y4FB 1E6OL 5CINH 3SJVD 1CGYA 2ERJB 5KSBB 1W0VA 3AY4A 4M6OH 5ACLA 1OVZA 3MRDB 4WDIB 1R3JB 2VR4A 4XVJH 4HKBB 1MJUL 4PRIA 4NQCA 4OTXH 2UWEB 2EDFA 4ZPVB 5E00A 3ZE1F 4Z0BL 5AZEL 3S7GA 3OG6B 5I1CH 1AKJB 1DFBH 1VKXA 3L9RB 3O6KH 1T03H 4XNZB 4OLYH 1KIRB 2JJTC 2GFBA 2XFXB 1I8IB 3CK0H 3WXVL 1E6JL 1HXYB 1JF1B 3IDIA 5EORL 5T5FH 3EYFB 3U7WL 3MRKA 4U49A 3RTQA 1K8IB 3PWNA 1RZFH 1F4WL 3U46B 1CFQB 1T0MB 4AMKL 3BYTA 2EEDA 2OZ4H 4LCCB 5DS8A 4JDVB 4FQ2L 4LARH 3AROA 4WI3A 3QCTH 2UYLB 4TTGA 4RNRB 1YYLL 3RVUC 2VDPH 2FBOJ 1JTPA 3DNKA 2VXUH 5ACZB 5E2TL 3MACL 5E8NB 3BKYL 4LKXB 2XN9D 5C0DA 4PJ5E 4F8TA 2VR9A 1YYML 3DHJA 5E8DH 3C5ZB 4HIEA 5SX4H 5IWLA 2DI8A 4EI6B 4OD3L 1E27A 4JREC 5C1MB 4J1UA 3DV4B 4N8VG 1K6QH 3QWOA 1AGFA 2X89D 4TULL 5I73B 5TDOB 5CIPH 2GK2A 2QADC 4Y19D 1EXUB 2VISB 5DRNB 1KJ3L 1E4KA 2EEAA 3BWAB 5BZDB 2AEPH 3WIIL 3A6BL 3VWKA 4F9PA 1ZGLM 1Q9OB 1MCEA 2YZ1A 1CFNA 3W11C 4OF6A 1MF2L 4U1HB 1KPUA 3OPZH 1I9IH 2MSPA 3E3QE 2D0FA 2AJUL 3QFDA 2P5WB 1GGIL 4KHTL 4KJYA 4LGPB 2K7QA 1N5YL 5IMMA 1YMHA 3B9KC 3QEGL 1B6DA 2E6QA 1NDMB 4UB0L 4WFGE 4M93C 2WNGA 4YDKL 3UTSA 2YD8A 5JR1L 5KSVB 1GPOH 4NIKB 5EOTB 5GS1C 4JFPA 3ULUH 5CWSB 4KKCD 3MOAL 5GRZA 4HIJA 2AKRB 4KHXH 1TFHA 3U48A 3FO9A 5CSZB 2H8PB 4X6CA 4E41D 5ICXB 1UXSA 2ADGA 4ELME 3FHQA 5JTWA 1NEZG 3CZJA 4JHWH 1I3VA 4H0IA 1P84J 3LKPA 1P4BH 2NX5B 1DVFD 2EZ0D 1QD0A 4UOW0 1N64H 1UENA 5BVPH 4OT1L 4AQ1B 3CH1B 2ORBH 1LO5A 3WJJC 1PLGH 2AK4B 4M5YL 5GSVB 3GBNL 2R29H 4L8BB 1MVFA 1QG3A 2AJ3A 4LOUD 4U05A 3GB7A 2VIRB 1D6VL 1T5XB 4DCQB 4R4NC 2R39A 1MIEH 3DMMC 4LPCA 2QV2A 5GGRA 4YHOH 3CXHJ 3V6ZB 3EDJA 4LLVB 4AENB 2D7NA 4JRXB 5E2UL 4TSAH 1NGZB 1MCWW 1G1YA 1X5AA 4K55A 5LQBH 4WFED 1LEKB 1T7XA 3MZTA 1TZHA 4NZRL 3TZVA 4ZSOE 1FGVL 1NCWH 5F9DC 3OKLA 4XP4H 3O0RL 3TNMB 1PDKA 3MJ8A 3X3GL 4LLAA 3CPLA 3GSQB 4HWZB 1JYWA 5HYEA 3T8XA 4ZOAA 4L3ED 5GRWA 4ZQKB 4YQXL 1A6AB 4OGYH 3RRQA 25C8H 2LE9A 3ARBC 3ARDA 5IHBA 5EUOA 2BFVL 3C2SA 3QDJA 4R9HA 1F45A 1OGTA 2Y07L 3P73A 4LSTL 4GAJH 4YBQC 3VH8G 3RUGB 5KVGL 3ZL4L 4QNPE 1FBIL 4Z7NE 4X5LA 3LN9A 2E9BA 3L3OA 1NMAH 2X41A 2F58L 4ZO9A 1U3JA 3IF1B 2JCCE 4G6FB 2DOCA 3DTXB 1EV2E 4ZFZB 3F7PC 4K8RD 3U4EB 1WZ1H 5L2KE 3L7FA 4PRHB 1G1CA 4KTEL 2R1YB 3VFNA 3B2VH 1D5IL 4X7SL 1RK0A 4JPKL 3QG7L 5IV2B 1KLGA 3L5WA 3HKFA 3D18A 2ADJB 2YRPA 1PG7X 3LS5H 1YPZB 1J05A 1OY3B 3VWJA 2OQJB 4PJEE 2QQQA 4Y5XA 2EE6A 5EU4B 5I71C 3ESVF 3CFJB 2FHFA 4X4MA 5AYUH 1CFSA 5EO1A 3SDAA 1OGAE 1U8MB 4WCYL 3HZMA 3B6SA 3GMMB 5BCAA 3UAJD 1MJ8H 3PP3K 1D9KA 5TQ2H 5KANI 4RA0C 4OLVH 3S9DB 1NMCC 1P7QD 3OKYA 4LLYB 2ARJB 1UACL 5I19H 1PG7H 2L0DA 1HHIA 2CGRH 5EH1A 3HE6B 12E8H 1WEJL 3NZHH 3WE6A 4YK4C 3HG1B 3DUSB 4L8CA 2H9GA 3ZE1E 2I9TB 3MV8B 1MY7A 4Y16A 2Y1VA 3GJEB 4GXUN 4X7FC 3WSQH 2G60H 2XYCA 4WTZA 3WHXB 5ALCH 1KC5L 1UH4A 3PHQA 3BW9A 5J1SC 5GRJH 1IEAA 1FL3A 2CKBB 1YEGL 2F54A 3WDHA 5IEHB 3EO0A 3BXNA 3LIZH 5I17A 2NNAB 4KTDH 3UJIL 1BIHA 1QTYT 4NUGH 3OF6A 2VAAB 1LDPL 4JFEA 2X6MA 4HGKC 4JY6B 4QXTA 4Y5YB 3GSNH 1KCRH 3ES6B 2BNQD 3ECBB 5DHXB 1LE9B 1CGVA 2C1PB 2LABA 4LCIL 3VFOA 2A1WL 3KXFE 5EZOH 2HFGL 5F7FA 1AR2A 5FYJU 1TCRB 1HYRC 2R9HD 3VH8B 1V8HA 5A2IH 1C5BL 1U8QA 5F7LB 4YHNA 1O7VA 1RURH 4X9IA 3UTOA 4CU6A 3PHOB 1G7HB 1IBGH 4FQCH 4G8GB 5C08D 4DEPB 4S0TD 3ARFD 4NQEA 5LGJB 2JJWA 1QPXA 4J7RA 2WSKA 3IFOA 2HRLA 3HE7B 3M07A 4H1LB 3QUMH 5KOVC 4I5BB 4U3XA 3DX7B 4L4VE 1XGTA 3TO4C 3MRQB 3FRUA 4S1RL 2Y7QB 1UJ3B 4R7NB 2WAHA 3HC0B 4QRSA 2P24B 1FO0L 5LCVH 3QPQD 1V7NL 5JORB 4TVPD 2CH8A 1IAKB 4LIQL 1CT8B 1E0OB 3UPRB 2BDNH 4EN3A 5ADOH 2DQHH 1KCKA 5EOCJ 5SWZE 5IR1A 1CU4L 1JPST 4FZEH 1A7PL 1OQOA 1FLTX 1HI6B 3JV4A 3PXJA 1OWRM 4L29A 3SDCB 3HNSH 4M62L 4URTB 3BGAA 1R5VB 1UCBL 2NY7L 3U9UA 2NY4B 2YA2A 1HHKA 1EAPA 4Y2DA 5DO2D 1A2YB 2YA0A 4P4KA 3KPOB 1B90A 4XCNA 5F1OB 5IMOA 3KDMB 1MNUL 4QOKA 1ROWA 1DBKH 5DJ2A 1IGMH 1R3IH 1KELL 4YC2C 2DL9A 3UP1A 1KEML 3EJJX 3K1KC 5F7EH 5DWUH 4X6BA 5KAQG 4HWBH 5JIIA 4JFDE 4YNYB 2JJSC 4YHIA 1FG9C 4HKJB 2R2BA 3FB6B 2P1YA 5MEQA 1IARB 1IC4L 1B0RA 4N1EA 4QXGH 1ZT4A 2Y5TB 4LVHB 2AXGB 4N1HB 3LKSB 5ISZD 1QYGH 3RKDD 2HJKA 3T2NL 4NBXB 1KJ2H 2I25N 4DW2L 1NH6A 1RZ8A 5GS0H 4HC1H 3RI5F 2V7HB 5IFAL 4R4BA 3D0VA 1I3RB 1NCDH 4HWUA 2Q6WA 2XI9A 5F3BA 3WD5L 2WWMC 5C07A 5I6XC 1QRKA 1ZHBA 4X4YB 1T89C 4WHTA 1U58A 2ERJC 3ZT5A 4BUGA 4OLZH 1DLFL 1OP9A 4HLZH 4UDTB 2YEZA 5IHLB 2LAAA 5HGDA 4KK5C 1IC7H 1KSRA 4J8RB 1Q0XL 2FEEI 5IG7B 4WW2A 2GTWB 4DK6A 1XF1A 1XF4A 4IRJB 1A6TA 2IAND 4ODVH 3VGFA 1NCBL 3EO9H 5F89B 4ZUWB 1A22B 4TQEL 5DHVB 1JNHB 3RGVC 3V5HA 4AK1A 2J88L 1TLKA 3VDAA 2P48B 4LRIA 4MCZA 1I8KB 8FABA 4RGOH 2HRPL 5HPMA 3B3IB 4KJPC 4MB3A 5E2JA 2R56L 3LD8B 1AC6A 3MJGX 3JWDC 2YD5A 3C09B 4DQOH 3ZE0F 4V2CB 5JHDB 2A83B 4NYLB 1I1FB 4PYGA 3VA2C 2P44B 4DGIH 1TTGA 2B20A 1HHJB 2Q1EA 4CNIA 4LCCC 3WUWG 1IC5L 5HHXL 2AQ3A 3IJSA 4YR6A 5CZXC 2RFXB 5DHYA 1CI5A 1U91B 3LHPL 3HC4L 4UUJB 1FNSH 4L8SA 5LG1A 1CQKA 1HKLH 3FTGA 4FFVC 1ZEAH 4KMTL 3VFMA 4D8PA 3BRGC 3P9MB 4KAQL 4AIZA 1U8NB 4HKXA 2EIBA 4K8RL 4IS6B 3MBEC 4PTUA 1ZHNB 4LFHD 4XNUL 4ODWB 3AFLA 2FIKA 4G43B 4PBVC 3U2SA 3FFCB 4KK9D 4QWWC 4ODUA 4JY5H 4UIMB 4IOSD 4V2BA 3IETA 1FNHA 2FZ3B 4U31A 4YH6A 5ITBH 1A5FH 5E99L 3HAEB 4DTGL 3NTCH 3PGDB 4P3CH 1CLOL 1UWGL 3U9PH 1MCBA 4ENEC 1CTOA 4Y0GA 3RIFF 1AQKH 4ALAH 4HMDA 1T1YA 3O45B 5E5UB 4Z7VB 3B8SA 5A2LH 3TT1L 1FPTH 3KNBB 1GZQB 1J8KA 5KVFL 3AREA 5I1LB 4PGZA 2DKUA 2OK0L 4IRSA 5ETUA 1GCFA 2XKSA 2H32A 3IDNB 3OTTA 2GSIB 2Y6SD 1F11B 2NXYC 4OCSH 3LZFL 2BRRL 1OHQA 2DAVA 4LSRL 1DANT 1JMZA 2CLZB 1GC1L 1WIPA 3EOYG 1G7QA 5LVEA 43C9B 2OSLB 1DBML 2AABL 3UTTB 3LMJL 4BQBA 1AO7B 5E7FA 2X9WA 1FV1B 3HMXA 4MDIB 4K71B 1M7XA 3DURB 2BNUB 4MAYA 4W4OA 1K2DA 2W92A 3WUWB 5EUKB 1HSBA 1KJMA 2Q7YB 4QRQB 1VA9A 4PD4J 3TPKA 4J3WA 3KJ6L 3KR3H 2LVCA 4K23H 4OM0L 3EFDL 2R69L 1ZTXH 3CCHA 3MJ9L 3GHBL 1AGCA 2BSSA 3CLFL 5C0EA 3QEQB 2VMFA 2D7OA 4HPYH 5HDQH 5K9OA 3DBXB 1G0YR 1I3GH 4OZHF 3OXSB 3ILPA 5E5MB 3VGHA 1E6OH 4M48L 2HA1A 1NCTA 1ZHKA 4G9FD 2AJVL 2F53A 3QCVL 3DO7B 3ARXA 2GITA 2B5IB 1QFHA 3T2OA 1OW0A 1U8KA 4Y7MA 2R1XB 3BP4B 4Z0BH 2VXQH 5AZEH 5CJXA 4LSVL 4GKZB 4TVPL 4MQSB 2J5LB 2JB5L 3P0GB 5EU6D 1UB5B 1IAIL 5HSFA 5I8EA 3WXVH 4PV8B 1E6JH 3RNKB 1FFOB 2ESVB 5EORH 1NQBA 2QSVA 3U7WH 2ZPKH 4JG1L 1IKNA 2HFTA 4U7SA 3VFUA 5C8JA 5DDHB 1P53A 3BP7B 4RISL 1FGNL 4G6AD 1LEGA 4HIIA 4OCYL 1F4WH 2FRGP 3QXDA 5EZIH 4PJ9C 1NC2A 5DMGC 3TJHC 4ZD3L 4OI8A 4PJ5A 4D0DA 3QIUD 2JB6B 2XQYG 1X7QB 5TF0A 1U93B 1QRNE 3FZUC 3MLUL 3W39A 1RY7B 5CCKL 4YE4L 4FQ2H 5F9WC 4LPVA 2VABB 4YHZL 3RPKA 3H3BC 3KS0H 5J0BA 5DRXA 1YYLH 3NN8A 3G5XA 3IRPX 1S9XA 4BH8A 5HYQB 1TDQA 1CXFA 5E2TH 3MACH 3D2UB 3AB0B 3EJZD 5DFTA 4A6YA 3BKYH 5DJ6B 3QDME 1P6AB 4OZIB 3VMNA 5HYSG 4LCWD 5E8PA 1YYMH 1TJIL 3BZFB 2NCMA 3RHWF 2YN3A 1WBZA 2XTJD 3KYNB 4TTDD 3LN5B 4WFFE 5HHQA 1KPVB 3WFZA 2R4SL 4LVEA 3MXVL 4DJMA 2Q3ZA 1M05B 3FN3A 5HDBF 3C6SB 4NQSA 4PJGB 3VXSD 2DB8A 1KJ3H 1F3RB 3LKNB 3ROLB 3L3KA 3MLXL 4F8QA 5C9JB 1EUUA 4WHCA 3WIIH 3A6BH 1XH3A 1BX2B 3RIAK 3GGWB 5DT1L 3JVGA 3ZTNL 1MF2H 1X5FA 1CZ8L 2FNBA 3DUUB 4PRPB 4OQ1A 3K0WA 4OCXH 4Z7QF 4MNQD 5D6DC 4KHTH 1ND0B 3QIBA 2YR3A 1N5YH 3ALWA 3C60A 3QEGH 3UTZB 4S1SL 4UB0H 4YDKH 4MHHI 4HIXH 5JR1H 1FYTD 1LMKA 5I9QB 3OKNA 3NFNB 4R97C 3MOAH 3X13A 3BPOC 3ZE0E 4WGWB 2E3VA 4TUKL 2WK2A 4DVRL 3D6GA 4QXUH 4FQQA 3VXPA 1JZ4A 4BH7B 3PDOB 5E2WL 4I77L 1S7VA 4KKAD 3KPQA 2G5BB 4R90L 4J3UA 4JPWL 5FUCC 5FOBB 2H2SD 4GBXB 5F7MC 4JRYD 5HYJE 4IMLB 3VE0A 4AYFA 4I9WD 4P2QE 4KY1H 4YDVA 5DZNA 4LNVA 4OT1H 4AJ0A 1ZT7A 3S3SA 5GIRB 4DEPC 3GSWA 2HVKB 1FZMA 3GBNH 3MLPA 1I1CA 2OJEA 3K2UL 3U82B 3OKDA 3EYVB 3M1BB 4GQPH 2J8UB 4EDXA 5KJRH 3P4OB 1D6VH 5IMLB 4ZSOA 2C4FU 5JNYB 2F15A 4U1NA 2Y4SA 4MLIA 1QFWL 1J8HB 2XKNB 3V6FB 3JBG7 1AFVL 2N56A 5E2UH 4MJIB 3IFNL 2EDKA 3DVGA 3HI5L 4FXKA 2FECI 3AU1B 4XRCB 5C0AE 2NLJA 2PO6D 4KVCL 2V2XA 5JPNA 1RZGB 4NZRH 4WO4D 4U6HA 3REVB 3BRDA 4FQIH 4FQPA 1FGVH 2YUWA 2BVOB 3O0RH 2BP3A 3OAZK 1X9QA 4Q58C 3TN0A 4P2RD 3X3GH 3QQ9D 2VLRB 5DI8B 4ZNCD 4NNYB 3D25A 4HLZG 2DKSA 1CD0A 4YQXH 3C5JB 4XVTL 2FX8H 2XACC 1TZIB 4X5XA 1DUYA 3C08L 5L2KA 1BVKB 2X4SB 2BFVH 3V5DB 5D1ZB 2Y07H 4LSTH 5HHOB 5F70A 3AVEA 4YBLC 3X14A 5KVGH 3ZL4H 1FBIH 1FL6A 1IAOA 4CVWA 2F58H 1FVEB 4BSVA 2EDRA 4JFQB 1HILB 1TJHL 1QBAA 2R0WL 3ZYOA 2MKLC 3FB7A 1UM6H 2H1PL 3C8DA 1JPSL 4MA3A 3ZYZA 5F8RC 4OBSA 4ZUTA 3WN5B 4JVUA 5JQHC 4YHPA 4GRMA 1T1WB 1Q1JL 4KTEH 4KJQD 4N90E 4BKLA 4FQXC 5EOQL 3UXFA 1DQLL 3VD5A 4M9PA 1D5IH 4X7SH 2GUOA 1W0VB 2DJ4A 3QG7H 1P7KA 3OKKA 4V1DE 3F7VA 3FMGL 4N8PA 1NDGA 4XHQA 4QGYA 2XA8H 3DLQR 4NQCB 1EX0A 4FQLH 5E00B 1JYXA 1A7OL 4DVBA 3PV7A 2G2RA 1KCVH 4X8JA 1ADQA 1TPXB 4WFHE 5J8OA 5KSAC 3QUZD 1VKXB 2A2QT 1M7IA 4JKPL 4JJ5A 3CFEB 4OZHE 5D70L 1IGIL 4WCYH 2GFBB 1CDYA 5TH2A 2LU7A 2YPLE 5JXEC 3IDIB 4XMKL 3E8UL 3ARGD 3MRKB 4ZFOA 4O02L 2PXYD 4QRRD 1T66C 1UACH 3PP3H 1S7RA 1WEJH 3PWNB 2F19L 3S96B 1KGCD 4HWEL 1WBXA 5DS8B 1C12A 1BVZA 1MHPL 3IDGA 1BFOA 4NBYB 1WUNT 1KC5H 3F8UB 2PTTA 3KXFA 1YEGH 1U8LA 4YEFA 1AY1L 2GJ6E 5IESH 5FA4A 3QUYB 4O9HL 3KPNA 3VI4F 5C0DB 3UJIH 1QBBA 1JHTA 4ZS6D 1W2KT 1A14L 2NXZB 1LDPH 1FAKT 5JIHA 3PABA 3WIFA 5ERWB 3V4VL 4OV5A 1E27B 2VYRE 2WUCL 4ONOA 2DN7A 2DS4A 1AGFB 5IVNA 4LCIH 1WVZA 1D3CA 2A1WH 1MRCL 2EZ0C 2HFGH 3MRJB 1T6WA 1REIA 5F1KC 5D1QD 3RX7A 1C5BH 2HKFL 3LKOA 4M1DL 2Z8VC 3IDJA 5ISZA 4JHBA 3VXMB 3FO2A 1CICA 2Z4QB 3VWKB 3WCYA 4N5ED 1GVIA 2NTFA 5GZNC 5SWZA 3RVXC 4Q6YA 1HKFA 3QFDB 1YY9C 4WNQA 1NCAL 4P4RA 1HWGB 4S1RH 3RJQB 2ITCA 5IMMB 2CDEB 3B2UC 5C0RH 1JZ3A 4LF3A 1FO0H 4EUPA 1V7NH 4P23A 4WU5B 5HDBE 4UZGA 4GW1A 3UTSB 4LIQH 1OTUD 5MENE 3SE3C 1CU4H 4CW1A 4JFPB 4P2OD 2IPTL 2ZKHL 2BNRB 1PKQE 2C3WA 3M8OL 4HIJB 2VZSA 4G7VL 2D0HA 4M62H 3SO5A 5CMAA 1UCBH 4DKDC 4X6CB 4Z7QE 5FYKL 1UXSB 2ADGB 1ZV5A 3KPSE 2YBRA 1UYWL 3O4LE 2DQUL 3D39E 3LKPB 2VE6A 4JFDA 2GTZB 4XHJD 3OX8B 4ZFGL 3HB3D 4G9DB 4OUOA 3UYPA 4NUJA 4GOSA 1YUHA 5DTFB 2R0LL 1KEMH 2Z91A 3RZCA 4MXWL 1SJVA 2JK5B 1G7PA 4ESKA 5JW5A 1Q94A 4WI4A 1FFPA 4EIGB 4LSPL 3GB7B 5FB8B 5GZOC 5DVKA 5H8DA 4R26L 3SY0B 1I9EA 1KV3A 4OQTA 1IC4H 5JIPA 1EEYA 5CP3A 5GGRB 3ULSA 1Z9LA 2DMKA 2CDFA 1N6QH 4LASL 3RL2A 5BO1L 3TBWA 4J3OC 3TLRA 3I3EA 1XF3A 2NY1B 3TZVB 3ZDXF 2P47B 3QZWA 4HUVA 3KAAA 4CADB 3LEXA 2CLVA 3OKLB 4KGLA 3OHXA 1YEJL 1MWAL 1MLBB 4HUMB 3WMSA 2K9UA 4RAVA 5IFAH 1J1XL 2NY3B 4NQTA 3CPLB 3U0TA 1UZ8A 5E56A 3WD5H 4YGAB 3T8XB 3PQYD 4BSWB 2C1OB 4K3GA 2H2PC 1DLFH 1PYWA 1QVOB 5EIQA 3ARDB 5EUOB 1S7QB 3QDJB 4OCWH 1OGTB 1Q0XH 3P73B 4JFFA 3M17A 3IT8D 4MXQD 2PCPA 1BEYL 4OI9A 3L3OB 1UT9A 2IAMA 2J5LC 1T4KB 4HXAH 4MDJB 5ILTL 1NCBH 3R8BB 4KROB 3H9ZA 5HHMD 4TQEH 4F33B 1E28A 5HYFA 2QBWA 5DA4A 2HRPH 3T0EE 3GRWH 4LGSB 3VFNB 5D7LE 2R56H 4NKOB 2I9LB 1RK0B 1DQTA 4OGZA 1DBBL 2PYEE 1KLGB 3L5WB 4NN7B 3PWJA 4MXVF 5L2JB 5DQJA 2BCKA 1IC5H 3VWJB 4Y5XB 5HHXH 2ID5A 3VFRA 4NKDA 2AV1A 4G6KL 1QLFA 5EO1B 4MB5A 3SDAB 3HC4H 1SVZA 3HZMB 4JN1L 3E2HC 2AW2A 3GZKA 4KMTH 2FGZA 4CVZA 1CR9L 3DI3B 3VFTA 4EI5C 4KI5F 3WE6B 5KN5A 4K8RH 3QQNA 3NOIA 3O9WB 1YNLL 1AIFB 4L8CB 2H9GB 2VLKE 4XNUH 3TVMC 3CDCA 3F62A 3U4BL 1N4XH 3DIFA 4PB9L 2R2HB 3SQOL 3FQNA 1MCOL 3BW9B 4NRXA 1IEAB 3VXUD 2PW2A 1FL3B 3VG0L 4F3FB 1B88A 2F54B 2HT2D 3THML 1YPZF 4M5ZL 4DTGH 3BXNB 1CLOH 1UWGH 3QFJE 5I17B 4POZC 1GYAA 3I84A 5IJKC 4L5FH 2EKJA 3MNZA 3MLTA 1F4AA 3C87A 4N0UB 2CIIA 2P8LA 3HMWL 3BZEA 3VFOB 4KKLD 5IB3A 4UV7L 1AGDB 3KWWB 4Y5VC 4I3RL 3T09A 3BAEL 3OAUL 4UT7L 1QEWA 3FOLB 3TT1H 5KVFH 1U8QB 3SN6N 1MCCA 5D7JD 4YHNB 2OK0H 1ZVSB 1A21A 4QO1A 2UWEE 4LSUL 3ME0A 1J9CT 4PY8I 3O2DA 5C70A 1ULVA 2WV3A 3VI4E 3LZFH 3SDXF 2BRRH 2ICWJ 3QIUA 4LSRH 1IM9A 2VDLH 3GBML 1GC1H 1QSED 1R5WA 4MJ2A 4P3DA 3ETBF 2EYRA 5DYOA 3SGJA 4HUWA 2KZ1B 4WRLA 1Z2KA 4NZDA 1X5KA 3JXAA 3WFDL 2AABH 3MCG1 3LMJH 4PJFB 1Q72L 4J3SA 1KB9J 3CFKA 1LE5A 4KV5F 3C9NA 3B5HA 1QSVA 4Y4KA 4RFOL 3D3VA 35C8L 4X4XA 5IR1B 5GGSY 4WWKD 5IBTL 3V79C 3NCYP 3KJ6H 4GLRH 4OM0H 3JV4B 3EFDH 2R69H 4MQXC 4GMTL 1ZWIB 3GHBH 3MJ9H 4P5TD 3CLFH 5IVZA 4KFZC 2YD7A 3U9UB 2VLJE 4RMUA 3EYQD 2W59A 5GPRA 1HHKB 1S8DB 4Y2DB 4APQC 3MRLA 4FTVD 4P9HL 3KPRD 4JRWA 2J7LA 5EU5A 4XCNB 4PGCB 4M48H 1LNUA 4QOKB 2V5MA 3CIQA 3FL7A 3WL9A 2AJVH 1TCMA 3PWLA 3QCVH 4PJ8D 3W0WD 3EO1A 1HHHA 4M6NL 2X4NB 4RGNB 4I3SL 4X6BB 4JM2D 4ORGA 4LSVH 3FONA 1ZS8A 4LVNC 4XH2B 4WENB 2JB5H 4OZGA 5FOJA 1AHWA 4YHIB 2K7PA 1DQDL 2APXA 2R2BB 5MEQB 2AJXL 1BVLA 1IAIH 1B0RB 1GAFL 5J9PB 1VFBA 2E7LC 2HVJA 5EBLA 1FYTA 1R0AL 4J12A 3H9SA 1XF2A 1YJDC 4JG1H 1ZT4B 4K3DL 3WXWL 3K4DA 2J12B 2BOBA 1XGQA 5D1ZC 2P5WE 4RISH 2MTPA 1FGNH 1RD6A 1UKQA 4OCYH 2HJKB 3QDMA 1RIUL 2DQTL 1RZ8B 4YAQA 3MLUH 5T1LA 4R4BB 5CCKH 4YE4H 3D0VB 2DQEL 5L8KB 3DYMA 3HRZB 4YHZH 2Q6WB 5F3BB 1UVQA 4JKMA 3PWVA 2V2WA 5C07B 4N5UA 1JGVH 2PKDA 4Y88A 3FO1B 4J3VA 4U1MA 4J3TA 4QXWA 4O51A 3AY4C 1FZKB 4MJ5A 4ODXB 2YEZB 1JN6B 1TJIH 5HGDB 2WZPD 4X6DF 5DJXB 5HJ3A 1CIDA 4NRYB 2WW8A 3ZDXE 4ODSL 4WW2B 1I1AD 2NX5E 1AGBB 4L4TD 4CVXA 3ULVF 1PW3A 1A7RL 2X4RA 4WJ5A 4YHLL 1TTUA 4MLSA 5GHWH 3VGAC 2R4SH 5IVOA 3MXVH 5BVJB 4K7FA 5CBEA 2HT3D 3VXTA 3DX9B 3V5HB 4MCZB 8FABB 5FYJD 3MLXH 5L6YL 1MAJA 3MFFA 5DT1H 5J6HB 4ZXBA 3ZTNH 3SE4A 3RTQC 3I6GA 3NGBC 1CZ8H 2ZCKL 3G04A 4MMXC 2D31A 3BPLC 1I7UB 4LGRB 4MCYA 1H3PL 4HUNB 3QDGD 6CGTA 4S11A 1YMMD 5F6HI 5DGRA 4YR6B 4X6FB 4JRXE 3RZWA 2BVPA 4XBEL 1N59A 1QHOA 2HKHL 4S1SH 5E0QA 3MA7A 5DHYB 4QRPD 1JVKA 1LO3L 4LLWA 3BSZL 4GAFB 4XWOC 5HYJA 3WS6C 4L8SB 3IXAA 3E0GA 4P2QA 2WWKT 4NCDA 5DA0B 3B9VA 5MHSE 5FYLD 1D6EA 2VZTA 1IEBA 5GGSA 4D8PB 5I16A 3LS4L 5IWLC 3VGEA 4RGMB 4TUKH 1A9BB 4DVRH 4AIZB 4MXVE 3QUXA 5AG9A 4I77H 5ESAA 4PTUB 4R90H 3D5OF 5H2BA 4GG8A 4JPWH 1L6ZA 1MCSA 1FQ9C 3SJVB 4ODUB 4I8DA 1JCKA 3IETB 4RZCB 2D4DA 4Y4HD 3TCLA 4F7MB 1PKOA 3RUGE 2VWEC 3CZFA 1JWSA 4F9PC 1QA9B 3ARUA 1MFEL 4BK4A 5GGVY 4LLMB 5HVHB 2BSRA 5E9DD 4RRPG 3K2UH 1HYSC 1EHAA 1CN4A 4NZTH 4KI5E 4X80L 4AM0A 2ZSVA 1LD9B 3C8HA 3OJVC 4PRHE 4UQ3A 3WNOA 1BFSA 4LLDB 3RY4A 4IRZH 1T1YB 1DLHA 1G9EA 3DRTB 1T0PB 1AFVH 1EUTA 5GGTL 3BJLA 3IFNH 2QL1A 3HI5H 1EHLL 2H32B 1YPZE 3O6FD 5DEGA 5B3JF 5CD3A 4NO5A 4MS8C 4K07A 4NKMB 4Q9BA 1OQXA 1S9VB 3K8KA 2A0LC 5D1XC 1NC4D 1BD2D 2HT4C 4ZTOL 2KH2B 1F5WA 3OAZH 4R0LA 5J11B 2OI9B 1HZHL 1YEIL 2DYPA 3BN9D 4XVTH 4L4VD 5T1KD 1DQJB 2XN9B 2Q86B 1INQA 4XCYA 4GKNB 2AJZB 3MV8E 1KJMB 1KCUL 3NCCB 3SDXE 3WLWD 1DQQB 4Z7VF 2BSSB 4P57A 5JW4N 1TJHH 5K9OB 2R0WH 4C56E 2IPUK 2H1PH 1JPSH 4GAGL 2OR7A 4OIIL 4JZJB 3ILPB 3KJ4B 1Q1JH 2X4PB 5EOQH 5CUSL 1CBVL 1DQLH 4PREA 4OZHA 1OTSD 4KV5E 1ZHKB 2F53B 2YPLA 3FMGH 2GITB 1FP5A 5SWSD 2DLFL 2M26A 3NIGF 1A7OH 1U8KB 4P46D 2NY0D 1J1PL 5T3ZE 4KK6C 2WMPA 2HTLD 2W65A 4WGVB 5K59F 4JKPH 2DJUA 5D70H 4CAGA 1IGIH 5I8EB 3ULUF 4YXHL 15C8L 4NFDA 2Z92A