4P5KB

Structural basis of chronic beryllium disease: bridging the gap between allergy and autoimmunity
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
212
structure length
198
Chain Sequence
NKFDTQLFHTITGGSSPENYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEERAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of chronic beryllium disease: linking allergic hypersensitivity and autoimmunity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
total genus 38
structure length 198
sequence length 212
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p5kB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p5kB01
4LHUA 5ANMA 1RPQA 4U1MB 2CKBB 3HUJF 1BBDH 2YXFA 4W4NA 4GRLC 2WBJB 4UAOC 1FGNH 4IHOB 3L6FA 2X5PA 1MHEB 2FSEA 1DBKL 2G9HA 5ISZB 1R3JA 1D5MA 1X5XA 3OL2A 2H1PL 4KKBC 4PJCF 3CX2A 3MLZH 2VE6A 1ZLSH 4R0LC 4N5UA 4K94L 1YMHB 1P9MC 4LMQI 1HDMB 3KPSD 3JTSB 1MJ7H 5B3JE 4MXQC 4X0KA 4XBPB 4WI4A 3TYGL 4HBCH 3U9PH 4PG9B 1JPSH 5C08B 1I1CA 4FG6C 4JO4L 2C4FU 1NDGA 4RAUB 5I1JL 1KC5L 3CLEH 3INUL 4ZQKB 3V4VH 1MHCB 3ARGA 4KMLB 3BKMH 5D1ZA 2GSIA 3BH9A 4O2EA 5DDHA 3U7WH 2UVEA 3P4OA 2IADA 4K8RH 4PG2C 2P8MA 2JLLA 3ILQD 5GS2D 4A6YA 1KLFA 3BW9B 3QEQA 4J23A 1FV1B 3M45A 2N1KA 4X99A 3E6FA 3P4NA 4LVHB 4U1NB 1CGSL 4JFYB 1YEKH 3NZHH 4NZRL 4JFFA 4FZEL 1HXMA 1HYSD 5CHNB 4UZGA 1EVUA 5FYLE 3OJ2C 5DHYB 1Q8MA 3WLBA 2R0ZL 2RBLA 2ZOKB 1SY6L 3BW9A 1S7VA 1MCFA 1SJHA 3VFUB 3QAZB 5A2IH 2FIKA 3HB3D 3MRQB 1N5YH 3HRZA 5FGCB 5E2UH 4EI6B 5GJTH 1I7RA 3OV6A 5E03A 5IJKC 5D2LB 1G7MA 4HPOH 4XC3H 4KK5D 4PG9A 2R23A 1JGDB 4YNYB 3QIWB 5EUOE 1NC2B 4RGNC 5D2LE 1IC5H 4RWYH 4YE4L 4U0RB 1WLHA 5KN5A 5J13B 1U3HC 1MY7A 1V3LA 5MEND 5E6IC 2V2WB 3FHAA 4Z7OE 1G9MH 4OBRA 4G3YH 5JIPA 3WD5L 1X6LA 4YHNA 1DBAH 1AD0A 3G5VA 3MV9E 5GGUB 1UGNA 1XGPB 1YQ2A 2C1PA 3Q5OA 4M93C 4WI5A 5HI3D 3AAZB 3RA7L 1X4ZA 3FFDB 2CK0L 1NC2A 2ZG3A 3F5WA 4KZEL 4LRIC 1U8OA 2X4UB 1NBVH 4I2XE 3TBWB 4AEFA 5ANMB 4BSJA 4MA7L 3PNWB 4HUUA 1FNSL 1FBIH 1RJYB 3AUVA 1YYLH 4LKCB 1IAIM 1B88A 1KIRB 2FECI 1JRHI 3RBGA 3IFOA 2VLKB 2HFEB 4G6MH 1T21A 4JFHE 1FFNA 5FK9B 3SCMC 3OKOB 2WM0A 1TITA 3AC0A 3UZQA 4LLQA 3NIFE 4BZ2L 1LE9B 4NUGH 1MPAL 1OAUH 1TENA 2Y7QB 4PTTA 2HWZL 5JA8B 1P7QA 4ELKB 5GXBB 4OQTL 1W72H 2OSLB 4DZ8B 2NYYC 1B90A 4PRIB 1RUKH 5FCSH 1RIVL 2IAND 4JRXE 1I8IB 4ZFGH 5E5MB 2NY0C 1EO8H 3I02A 2E6JA 3HC4H 5F7LB 3DI3B 4LNVA 3VH8B 1DQJA 4L1DA 5F7DB 4Y4HB 3QR2A 1KCSL 2ARJB 4OI8A 4WV1C 4H1LH 4BK5A 5ALCH 2EE2A 1BVKA 4WO4D 1W0WB 5CJOH 1KCVH 4OZHB 5LCVH 5J4MA 2CLRB 3S8WA 5BO1H 2MHAB 3KYKL 1JCKA 1ZT7A 4ZUUA 1RUPL 5SX5K 5E8NA 4YAQA 5A3ID 5IB2B 1AXTH 2DF3A 4OTXL 4P5KB 5JZ7D 2CDGB 3MLTB 1OP3H 4XVJH 1IGMH 2WV3A 5DK0B 2GAZB 3ME0A 1JBJA 3QI9C 4PJGE 2GY5A 2CDFA 3WUZA 3TNNB 3L5IA 4HIJB 2NY6C 4WENB 4PJEF 3VWJA 3CDGA 3DUUB 5DTFA 1T04A 3HZMB 2EDRA 4Y8AA 5CEYA 1TMCB 1X5GA 3HI6H 1AHWC 3QI9B 3W9DB 5D1ZD 1B2WH 5HPOA 2D7TH 2X4TA 1Q9KA 1QPXA 1DQDL 2AQ1A 4FZ8L 4AM0A 4JFQB 4EDWL 4ODHL 4K94H 4OZIB 3VGAB 5KS9A 4P2QD 2UUDH 1W0VB 4ZAKC 5EZLB 1IGFH 2AABL 2P8LB 5GGRA 5ITFB 4IMKC 4ETQA 5DR5H 3EYSH 2DQTH 5DRXA 1QPPA 2MTPA 5H35A 1EGJL 4TRPL 4AEIH 2WIMA 2ADJA 5B39G 1Q9WA 4X80L 1IEAB 2BK8A 4MA1C 1MNUL 1ZA3A 3T0XA 5CAYB 1FHGA 5E08L 2X6MA 2D31B 3MR9B 4HPOL 3TIDB 1PZ5A 3DRQA 1N26A 1K8DB 4DKFL 5DQDH 4KVNH 2DLFL 4G7YH 3ZO0A 4YHIA 2NY5C 1GH7A 2DQJH 4UT6L 4QYOA 3V6BR 1NPUA 2V7HA 1KNOB 4BSWB 1AGFA 1AHWA 1FO0L 1R5VB 2EDBA 3S35H 1KEGH 4OQTH 3CSGA 2GSIB 3BH9B 4JZOB 4O2EB 1FLRH 4S1RH 3AS3A 2UZXB 2F58L 3TN0D 3QUYC 1TQCC 2Q8BH 4Y2OA 1EZVY 2MCPH 5C6PB 3NFSH 5T5FH 2OMNA 2XACC 3SOBH 1MF2H 1NFIA 4QWWC 1A2YB 2CRIA 5C0AD 3BJ91 4OLWL 4KJQC 5I0DA 5E8OA 1C12A 4DK3A 2XZAL 5ALCL 1IQDA 3FT4A 3DX7A 5EOTA 3FQUB 3GHEH 1UXSA 1CL7H 2NLJB 3ILPA 4K3DH 1JGEB 2NY1B 4YK4B 1ZWIB 2ADGA 3QUYD 3I50L 1J0YA 3RWHB 3ZTJG 2BNQB 1NCBL 2NY2C 1B0WA 3HZVA 3NCMA 2BSED 1NMAL 1UM5L 2IWGA 3FOMA 3EJYD 3TVMA 2HFFA 5E4IA 4K7PY 3RIFK 4KHTH 1UWEH 4MQ7B 1K3IA 1QLEH 5DK2B 4FQQB 4HC1H 2VLME 4LARH 4ENEC 5T3ZE 4WHTA 3QUXD 5TDPA 1FNGB 2FX8L 5DT1H 1IZJA 3RL1B 3MA9H 2ZNXA 2DWDB 5IBUG 3PWUB 2CD0A 3MRNB 4Y5YC 1KT2A 2PUQT 3C5ZD 4K94C 3IRZA 4JFEB 5E4EC 3ZMRA 1ZHKA 3TPUB 3IS1X 2ZUWA 1YEHH 3SGKC 1KLUB 3QZWG 2ED7A 5F96L 3ZYIA 1AY1L 3ULVL 2Q6WB 4MA7H 3LEYH 2VN7A 5KSBF 3PP3H 2G5BB 2YR3A 3WFBH 3BSZH 2AV7A 4LAQL 3ARQA 3IB4A 1GC1H 1YNKH 1OWWA 2Q86A 4PJIF 5I1IL 2BVPB 5EOQL 4Z7VA 1LWRA 5DFVD 4HUWB 5AZ2H 2R29H 5KANG 3OJDA 4H26A 1UENA 3LV3B 2R1YB 4F7PA 2RIKA 1HQRB 4ONOA 2CLVB 1IC4L 1R3IL 3SE8H 4EEEA 1MCPH 3N0PB 5GGVH 1NSNH 3LS4L 3TO4A 5TF0A 2UY7A 3C5JB 2FH6A 2EE3A 5IV2A 2YSSB 3D85D 2FHCA 5IGXL 4HT1H 5HHVH 2OTPA 5AWNL 4YDJA 2P24B 1J1XH 2H2SD 1MRCH 2NTFA 3EYUH 1JZ5A 1OTTC 3VXPB 3MRIA 5FEBA 1BPVA 2AK4A 3VXME 3VFOA 5IOPA 2GK0A 1OSPH 5J6HA 1A14H 3RVVD 5IMMB 2PF6A 1OSZA 4OSUL 4KJPC 3I6KB 2W59A 3X12B 2BJML 3RI5K 1MREL 4JQVC 5JXAH 1VACB 1TJHL 3QHFH 1CT8A 3CVHL 2FYYB 4Q7DA 3QIUA 4PFEA 4MA3B 2BHUA 4Q0XH 4ZUTB 3ARDB 1JK8A 5I75B 3V0WH 3KYOA 2D4FA 3NH7H 1G7LB 4LLDB 3SDXE 1M05A 1TDQA 5J7CC 5IHUH 2R0KL 3VFOB 4TN9A 4YXLH 1TZGH 3MREA 3KPRB 1ED3B 3V4UH 2FR4A 2VLKE 3WDJA 3PWLA 3RBSA 1ERNA 1M1SA 2J8UE 3EDDA 5TH2B 3X11B 1HSAB 5J6GB 1QBML 1BF8A 1IC7L 2H3NA 4N5ED 1SMOA 4IIQA 4PJEA 3T0ED 5HHMD 3O6FD 4L4VD 5I6XC 2XY1A 4KGLA 3TCXA 4HS3B 4N90E 5E8EA 5E5RB 4Z7UE 5GS0L 2IBBA 1LO2L 4JFZH 3BJLA 5DUBB 3QT2A 5FYJU 4TTGA 4O9HL 1ZANH 2JB6B 5C0CA 4HZLA 2VSCA 4PB0L 4XTRD 1BD2B 3EOTL 1O7VA 3MA9L 4JFOB 4N0YL 4X5XA 1UB5B 4Y4FD 1AE6L 5FHAL 4RMTA 3O2WL 4E5XB 5EFIA 3TESA 4ODVH 1FO0H 1QVOB 2HAZA 3FO2A 5ERWB 4EVNA 4X7SL 1WF5A 4ZXBB 1ZXQA 5EB9A 4XPGH 1KCUH 3BRGC 2HT4D 2R4RH 5D7KD 1J7VR 4CVXB 3BZFA 1FFOA 4CW1B 2EO9A 1DZBA 1TETL 1YNKL 5DWUH 2P8PA 4U6XB 2CMRL 2J8UF 4K3JH 1JNHA 3D2UD 4F2MB 2X4PB 2R0LH 2GT9B 4ODTL 4UV7L 3JVGA 1IM9D 1RIVH 4FNLH 1I3GL 3GGWB 3TT1H 2HFFB 4IRJD 3C09B 2Z91A 3N1MC 3OR6B 4G5ZH 3HNSH 4MCYB 4BQCA 3WNKA 2ICWJ 3EUUA 3P40A 1C16A 5JUEH 4G8EA 3CXDH 4P3WA 1UWEL 1YY8A 5ICYB 2AQ3A 5IVZA 4CN1A 3WKMH 4MA8H 2X05A 1JYVA 5D1QC 5LAXB 2Y5EA 2ZKHH 1IQDB 4LSRL 3G5YA 1L7TL 2RCSL 3H9SE 1G9NL 1NGYA 3ET9F 4TUKL 2C3VA 5DVKA 3I6LE 1HZHL 5CUSH 1A4JB 3S3JA 4PGEA 4C54A 1G9EA 5DS8A 4HJJH 1DDHA 5GS1A 1IAIH 1TTUA 5TE7L 1O5DT 2YZ1A 3NGBC 3C5ZC 1B0RA 3FN0L 5FA3B 1NUNB 3QHZH 4NKIL 4NUJA 2JJVA 4OD3H 3O8XC 4LGSB 4CADB 3H42H 4LSVH 2AJZB 3DGGB 3ZE1E 4G9DB 4EZMA 4JN2B 5BJTA 1UKTA 1YA5A 2R2HA 4L4VE 3FB8A 1QLFA 4DFIA 3QFJB 5BOZG 2EXYC 1U92B 2RQ8A 3JWOC 12E8L 2NXZC 2R0WL 3CFCL 4K71C 1MIEH 3MUHL 3WYRA 5H37G 5T1KB 3RFZC 2V5TA 1QHOA 4GKOA 4KQ4L 4UINL 3Q6GH 1NL0H 3M07A 3U4BH 5C0IA 1QLEL 3A6CH 3SOBL 3Q2CA 5D6CA 4YZFE 5KSBE 3EAKA 4JO3L 4CAGA 5IBLD 4JG0H 4G9FD 3NFNA 5EU6A 1KIPB 5CJBA 1NMCC 4PJDA 5AUMA 1QFWI 1T2QH 1QO3A 2FATH 3VG9C 1UXWB 3ZYZA 3OB0K 3V52L 1S7WB 1OAKL 1R0AL 4JPKH 1JMXA 3O45B 1FG2B 3QXUA 5T3ZD 2DQTL 3MLWL 3M8OH 1BQSA 3BUYA 4HUMB 3QUZC 2JK5B 3MGTA 4JG1H 4YWGL 2AK4D 1MOEA 5JIKA 2G60L 1ADQH 5CKAA 2BVQA 1A6TB 1JFQL 3VGGA 5DEGB 4NO0D 4F37F 5LQBL 5IMKA 1R3HA 3A6BL 2X89D 1CDUA 5EOCL 3MNWB 5IHUL 3GSNL 1J5OH 2CRYA 3U4AA 3QA3A 2VLJD 2HJKB 2L4OA 1GGTA 4JZJB 2VXTH 4M00A 5D7KE 3SN6N 3MGOB 1FL3A 3IFNH 3L5XL 4TPRL 3MC0A 1OQXA 3O3UN 1XCTA 1JE6A 5I8CB 4G43A 3T0VA 3H9YA 3UPRB 4M6OH 3QJFB 5E95B 1RZKH 1URLA 3UTSA 3GRWH 2R1WA 4HCRA 2XZCH 2R1WB 2QQNL 2AK4B 3GJEB 2BY1A 3BOVA 3IXTA 5BXFB 2A73B 5JPMB 1NCBH 1QSEA 1F6LL 3WMSA 4OGAC 4NPYB 4WY7H 1A7QH 3RPIB 2AJXH 2F15A 4J1UB 1FPTH 5E5MA 4N8VB 5C92A 2FJHB 4X4YA 2Y07H 2J2ZA 1L0YA 5EZIH 2X1OA 2R1XA 1IC5L 5F6HI 4AK1A 2R1YA 3SKUD 3HUJE 4DVRH 1INQB 2R9HC 2V5SA 4KHXL 3QFDA 5EORL 1JJUA 1D6VH 4G9FB 2Z31D 1KPVB 3QWOA 3NACH 1XMWA 4IMKA 5IFHH 3IF1A 4BZ1H 3ZL4L 1HHIB 4CU7A 3QUZA 1A6UH 3GJFH 4G8FA 2ZUYA 3RA7H 3BYYA 3P9MA 2YA0A 2J6EH 1GOHA 5HYJA 3O4LA 5CEZD 1MI5B 2B4CH 5D72H 1I3UA 5BMFL 1HXYB 4JFXB 2HLFC 3N9GL 3WHXB 3WL9B 5IEHA 4AT6A 2XN9A 4XRCA 4X7DC 2Z0BA 2FO4A 3OKEB 3QIWD 5LXGL 1RZGA 4Z7QE 3VXSA 2ADFL 3ULSB 4XP1L 3D85A 4HS8L 4JFFE 3KPQB 4X7CC 1I1AD 4UB0L 2NY7H 1UWGH 2A6DA 4OM1L 5C0BE 4XMLH 2NX5B 4MD5A 4M02A 1MH5B 2YD8A 1XH3A 1A1OB 4AENA 1HHKB 3HPLA 3S4SG 3S5LA 3VD5A 5D2NC 3IDYC 5DD0L 3MJ9L 1TJGH 3ARFB 1YEGL 4NRXA 1UXSB 5D7SH 1JNLL 5DMIL 3PWNB 5I30L 1FZOB 4FG6D 2CPCA 1KFAL 2BNRE 1XZ0B 3MBXL 2IH3B 1PFCA 3MFFB 4PRBB 2Z31A 3M1BB 5FDWB 1B0RB 4XNXL 5KJRL 5CEZH 2V2XA 4Y1AE 3BKJH 4NQCD 1CVSC 1T1YB 3NCBB 4FQJH 3RWEA 4ODTH 4KK8D 4QHUB 4FFYH 5HY9A 2YEZA 5GJTL 4X98A 3B2UD 1OAZL 3KPOA 4MD4A 4X98B 3B5HA 4JPVH 3CFEA 5C08D 4LPVA 3KYKH 4G8IB 2HLFD 3V5HB 5DYOA 2CXGA 2HG5A 4F8QA 3QQNA 2IALB 4RWYL 3STBA 4KTYA 1OB1B 2WLZA 4D94A 2A77H 4NRYB 1ND0B 3ZKMD 3UBXB 4R6UA 1M7DB 3RZCD 5J0BA 4KHXH 5F7FA 1AE6H 4EDXB 3W5NA 3IFLH 2YWYA 3MCLL 3EYVA 4FQXC 5I66A 3GSOA 3O6FB 4L4VB 2P7TB 1MEXL 1A21A 2VWEC 3ZL4H 2NW3A 1W72L 1S7RA 4JGJA 1F45A 3ZE2E 2X70B 3ARZA 3VD3A 1Q9OA 1YEEH 3BHBA 5HHXL 3EJZD 1KULA 3VMPA 4IOFC 5JHLH 1S9VB 4JFFD 1HHIA 5HPMB 4HV8B 2HTKC 4HUXA 4BFBD 2PTTA 5GGTH 4FQHA 4GJTB 1DQQA 5DSCA 2FJFA 4D3CL 4P2RA 1H3TA 4X6BA 3S97C 5D96C 5KVGL 5T3XL 1A47A 3QBTB 2DM4A 2AGJH 3RVTD 5I8KL 3TZVD 2Q8AH 3WIHA 1QG3A 3VDAA 4U1GC 5DRZA 4PJ8C 4IHOA 2DI9A 3LH2L 1V7ML 5JIIA 4P5KA 5L7XH 2R4SL 2DAVA 5AG8A 4HQQL 2VR5A 1WBXB 5E8NB 2FX7L 4DGVH 1MVUA 4M9PA 3E2HC 2X40A 5JW5A 1YPZF 2X44D 1C1EH 5HXMA 3KPRA 1EUUA 1FYTD 3PUCA 1ZOXA 4PJFE 3DSNA 4PYHA 5FUOL 2WQRA 5ID0B 1YPZA 4YWGH 1A0QL 4OF0A 2FIRT 5BW7C 3MV7D 3BEWA 1F90L 3HR5A 5IHZA 4TQEL 3IS0X 2FYYA 2E9BA 4FQXD 4WTZA 2KQMA 4YBHA 1AJ7L 5IVXE 1NANH 4I18B 1GOFA 2N7AA 3FB5A 1A9BB 5I73C 3MCKA 1KJ3H 2EDNA 3HTLX 1YUHA 4JREB 1BQHB 1IBGL 2H8PA 4ZYKB 4QTHB 1CFTA 4NQUA 4G3YL 4G80A 1SEBA 4LNRB 1BM3H 2NTFB 4K8RD 4GSDL 1DLFL 4C58B 3SPVB 1VFBA 2VQ1A 5C09B 4KQ4H 4NQCA 4PTUA 2GSGA 3UTSB 4PV9A 1J8HB 3DIFA 4M3JA 1IEBA 2B1HH 4ZTPH 4KTEL 2CLVA 4NN6C 1U8HB 4RRPG 5EWIL 1WSST 1E6OL 4DVRL 5KG9A 5F72S 4FABL 1MAML 4P4KC 2ED8A 3GI8H 3QUXB 5DD1H 2O93L 4PS4H 2AQ2A 2YD7A 3VFPA 2UWEB 3MYJB 4IDJH 1LDPH 4PY8I 2EDQA 3BPOB 1F6AB 1YDPB 2GJJA 1WCBA 2IQ9H 3HE6A 2C7UB 4OUUA 2MKLC 4TNVF 4Q9CA 3D25B 2F53B 4WV1B 3IETA 2B0SH 4ZTOH 1N59B 1VDGA 2DD8H 1A6TA 2R2CA 3OKKB 1FAIH 4PJCB 2PR4H 1XGPA 4MNQD 4WW1A 3FO0H 2C3HA 4ZNEE 1J5OL 4UQ3A 4HUVB 2H41A 3HI5L 5J11C 2XZAH 3GEWB 3VXMB 4Y5XA 4ZD3H 5E2TL 3L3KA 1PKQE 1JRHL 1UWGL 2FBOJ 3QEQE 4P9HH 1KG0B 4M43H 1DQTA 4FQQA 3MUY1 3BZ4A 4ZO6A 5DD3L 5E5UB 2Q76A 1S9XA 32C2B 1NSNL 3LS4H 4DN3L 5ACLA 4G6KL 3ARED 5C0EB 3HZKB 3EFFA 4XC1L 4PB9H 1RMFL 2GQHA 1K4DB 1FVDA 4IBLT 4LCYA 1B3JA 4LCWE 2I9TB 5KSUB 4LRNL 1MUJB 3QUKB 2DLEA 3U0WH 2QADD 2XRAH 2D0HA 3UP1A 3DROB 4NO3B 1MLBA 3V5KA 3HNTL 4NYLA 2W60A 2VXVL 5E99H 4WHDA 3F7PC 1CGVA 1PDKA 1A4KB 3O3EB 5ESVB 3LQZA 1AXSB 2MCPL 4OCSL 1CD8A 1WT5A 2Z91B 3BKJL 4L3AA 4ZFFB 4CADA 4XWGH 2E7MA 1KIUA 5JR1L 4C56A 4FQJL 2AKRB 4U1NA 2PCPB 3QNXB 3V7AE 2BSSA 2R0KH 4V2CB 1BEYL 4OZHF 3V5KB 5C6TL 4QRPD 5DHXB 4LCUB 5HGAA 2JJSA 4JZNA 1LNUB 4NFCA 5IMLB 3EHBD 4KHTL 3MRFA 1YEJL 3JBG7 4X4MA 3MA7B 2EDOA 4YFEA 4YHOL 2IFFH 4PBWD 3ISWA 1A22B 3MUJA 4KQ3L 3IAPA 4KK8C 3DVGB 4EDWH 3MNZA 5FA4B 1UT9A 4L4TE 1JHTB 1J87A 2CQVA 1CWVA 5C7XH 4OCWL 2Q76B 4AG4L 4JM4L 2P43B 4WVRA 4WHYH 3C08H 4UTBH 4L3EA 3EYUL 5KSUA 3A67H 5T1DH 2E6PA 3VI3E 4I48B 4LCYB 4NO0A 4JDTH 3RL2A 3TYGH 4P2RD 2VN4A 3BYTA 1MHEA 4DN4H 4MDJA 5DUPH 3SGDH 5GS0D 3BPCA 2M26A 3GMNB 1CDYA 5AAWA 1NAMH 4PJ9C 4YHZL 3WIIH 4CVXA 2YRPA 5FAAA 1JL8A 1P7HL 5FYJE 3C2AH 3EYOA 2CKBA 5B3NA 4RNRB 3U83A 1T83C 1GPOL 3IETB 5AYUL 4POZD 4ZO9A 1KIQA 1H0DB 4HIJA 5A1AA 5I76A 3X3FL 1I9JH 4PJXA 3VXUB 3MBEC 3IDNA 1LK3L 1Q0YL 1FL5A 2W9DH 3D3VD 1JRHH 4X6CB 1M05B 1XF4A 3T3ME 3MLXL 3WFHB 3EO9L 2VLJB 1QSVA 4MA3A 4FQLL 2E8ZA 3S34H 3RU8L 1DVFD 1FGNL 2DKSA 4M62H 3E3QC 1U8HA 2EEDA 3NCFB 5D93C 3CH8A 3BDYH 4J6RH 3CUPB 2AK1L 2GJ6B 1VGEL 1EIBA 5JMOC 1DLHB 2DWEA 1Z6JT 1W0WA 3SE4C 4M1DH 2PTUA 4OZFG 3IKKA 4O00A 3VXTA 1HHJA 3GJFB 3ULUL 5D7JA 5MEQB 4P4RA 3UAJD 4PJCE 4LSTH 1IRAY 5L2JA 4NO5A 2DS4A 1V7MH 1F13A 5D7IB 4LVNB 5TQ2L 3VU2A 3B4NA 4M7LL 5L2KB 3RWCA 4Z76B 3ZYJA 2OX5A 1E6JH 2XWBA 2BVOA 1HQRA 3RHWF 5C70A 1S7SA 2FX8H 2X42A 5BRZD 4KJWD 4XVTL 3U1SH 3JV6B 2VDLL 4PRDB 5ALBL 2OYPA 5J11B 2WINB 5TDOA 4YH6A 1GYAA 1OSZB 1NCTA 4U31A 1YEHL 4GBXA 1CFQB 3WXWL 2XY2A 1DL7H 4R2GC 1YEEL 5HHXH 4Y5VC 5I17B 4RDQF 3I6GB 5EWIH 2C9AA 1XF3B 2Z31C 5IP4A 4NJ9L 3EOBA 5I1EH 3WFHA 4NKOB 4YQXL 2WBWB 4M4RA 5KSAB 5E2VH 3S3PA 3B5TA 4DAGH 1N0XH 2G2RB 3T65B 1NMBH 3O2VL 2FO1A 1IQWL 2IQAA 4OV6F 2PO6D 5J1SC 4TVPE 1HKFA 4LEOA 1KIQB 4UMGA 1G6RH 1KB5B 3QFJE 3EFDH 1BAFL 3ZKQD 2DBLL 1K6QH 1E4KA 5DJCA 4X5WB 4QNPE 4V2BA 4ZPTA 4FQPA 1NFDE 3EDFA 5JTWA 4DWHA 1JPFA 4WGWB 5DUPL 5F88A 4FP8L 5D7IF 3ARDC 3NA9L 3UJTL 4OCMC 4W6WB 5C8JB 2ICCA 5F9WC 1ZVSB 1TETH 2FX7H 2OQJB 1H15B 3CNKA 3JWOL 4M6MH 4EN3B 1RIHL 1VKXB 3U0TB 2GUOB 5TFSH 2OJZH 1KB9J 3RNQB 4UNTA 2A83A 1OL0A 4R2GB 5EG6C 1ZHKB 4S10A 2XTJE 3BDXA 5FUCE 1K9TA 4GKNA 3SDCA 3MRMB 4PJ5B 4G42B 1LK3H 1H9VA 4GAJL 4WFEE 2ORBL 4XNZC 4B7IA 2W0KA 5EBLB 4RQQA 4J7RA 5D2LA 1YEDB 3BWUC 2BVYA 3AMKA 3T3PF 3RJDA 3O6FA 2HVJB 4L4VA 4W6XB 5TDNA 4MNQB 2HTLD 4NQVB 1NGWA 4IRZL 1I9IL 5DD6A 4P23C 5C9JA 1RJLB 4ZD3L 4WWKD 2GJZB 3U79A 2V7HB 4Q9QL 3UCRA 2XZCL 5GRUH 4LQFL 1PX4A 4HWBL 5E6IA 1JGUH 1WWCA 5D1QD 3RJQB 3V4PH 3ZKXC 4HFUL 4AQ1B 4I3SH 2VDML 5F6IC 2MCG1 1QBMH 3DO3A 2I5YH 4D0DB 3BP4A 1CFBA 4OZGB 1IL1A 3SE9H 1HILA 1X4XA 4I77L 4Z0XA 1RZFL 4KWUA 4C55A 1INEH 3CLFL 1F3JB 4NO2B 3N85H 4N0CC 4Z7WF 4X99B 4P57B 4NYLB 4K3EH 4M7ZC 2AERT 1ADQL 3U4EB 3V0VA 1WC7B 4NO3A 2ZSWA 1ACYL 2DI8A 2J5LB 2IADB 2P45B 2VIRA 4F33B 4HKXB 4QYOB 3HC3H 1IT9H 3U30C 3MRCB 3T0AA 1CICB 1DE4A 2WW8A 1NDGB 3ARFA 4RQQB 1PD6A 2ZCKL 3BP5B 1LE5A 1EO8L 2E9IA 4M7JH 4DGYH 5L9DL 3BX7C 2BOCA 1CZ8L 1WAAF 3OX8B 2OLDA 2YC1A 4KUCF 4BUHA 2KL6A 4ORZC 2A0LC 4GW4B 5IK3A 5CBAB 1LO0L 2I07B 3KYNB 3L3JB 3P0YL 3IGAB 1YMMA 1S3KL 5KTEL 5DD6B 2P1YA 4I5BB 1JGVH 1SEQL 4QTIH 2AJXL 3NA9H 4LLMB 3PP4H 1I1AA 5DJCB 5EBLA 5IESH 3U30B 3C08L 4UTBL 5D7LE 5HYQA 3NCYP 4HUKB 1U95B 4JFPB 3C60A 4XH2B 1KB5H 3GMRA 2VDLH 2DIJA 2ZOLB 3QUXA 4XWOD 1EHAA 2OJEB 6FABH 1CICD 3IJHB 5B8CA 3TYFA 1GOGA 1MI5A 4MQTB 4XNUL 5DVLA 1ZGLM 1EA9C 4PJBF 2MPAL 1WWAX 3NIDE 4G8FB 3D39E 1TNNA 2P5EA 4XNXH 3QXTA 3KPSE 4K71B 5T5FL 2GCYA 1CLYL 1TVBB 3MV11 3ARYA 2AAVA 3KXFB 2QQNH 4XHJD 2CO7B 4YC2C 2IF7A 2BY2A 3AXLA 5KZCD 5E7FA 5C07A 1BVKB 5KS9F 3C5ZB 1P1ZB 1AGDA 4NP4L 1K85A 4EJ1C 3EOBB 4XNMB 1K2DA 4XP9L 1E28B 1FCCA 5DJ2A 5D7JB 4PJHA 5MEQA 1HHJB 4LCCC 2ZOLA 1U0QA 3D1MC 1EXUA 1GGIH 5GSRA 3WSQH 5IFJB 3Q1SH 3TFKD 3GMRB 5IFHL 3BEVA 4O02L 3CSYA 4PJFA 4RA0C 4RDQG 4FXGB 3JTTA 2NY4C 1JUFB 3HUJB 3HPJA 4X7TB 4ELKA 3QXDA 4JY6A 4M5ZH 2EDTA 5BV7C 3MRKA 5IMKB 1AIFB 3KXFA 4NNPL 4M5YL 3FQTB 4Y2DA 2X9XA 2LABA 3QXAB 3K3QA 4R2GD 3O3DB 4QHLA 4DAGL 3JV0A 4TSCH 3VGHA 1T66C 2AJVL 4MNGA 4Q2ZA 2EEAA 1XEDA 2UV3A 5L88L 1PG7W 2EZ0D 4UIKH 1EMTH 5EIQA 2I25N 3M17A 5E6ZA 1ZLVK 4U7KA 4ORGB 2A6IA 3LIZL 4DKDC 4ELMB 4GG6F 2UVFA 3MROA 1I3RA 3QEGL 4X4ZA 2XG5A 4AEHH 4LKCA 3HAEH 1EFQA 2I5YL 5B38A 1MWAH 3BE1L 4ZOBA 4K7FA 1OCWH 3RGHA 3T2QA 5IKCA 3RL2B 4JPIA 1TJGL 3QUYA 4UOW1 1C08B 4KTDL 3GRWL 3SQOL 3H2WA 5HHPA 4JDVA 3G6JA 2J3SA 2IANA 5CD3B 5MEOA 5I8EA 3K81A 1OSPL 4XNQB 1JHTA 3VA2C 3O3BA 4KUZL 1B0GA 4LSTL 4MDIA 1U92A 3MLPA 3FO9B 3B8YA 3UJTH 4BSVA 2BJMH 5IB3B 1HHGA 1INDL 5EUOA 1DBJH 4LBEA 4P2OD 2EC9U 2DQCL 5FDYA 3QJHA 1E4XI 2G5RA 2VAAB 1WFOA 1PJ9A 4JHBA 4M7KH 4B50A 5CS7A 1BWWA 5HVWA 5GS1B 2YEZB 1XFPA 1N7ML 3WNPA 1GZQA 3LHPL 4HG4J 4GKZA 4GSDH 5AZ2L 5BS0A 2H26B 2VXUH 1ODAA 1ORSB 2FIKB 3MRQA 5D1ZB 2ZSWB 4BFGA 2IAMB 4YBQD 4OQTA 2KZWA 1X5KA 1CE6A 3C8DA 3O6LL 4MB4A 2Z31B 1ZS8B 4RWHA 2EO1A 4H88L 3NN8A 3PL6A 1T4KA 4D0DA 1BIIB 3NIGE 2XXMB 3H7BB 1QEWA 4OLYL 4N8VG 4P3CH 5EU5A 5IF0A 1T6VN 1A9EB 3MRLA 4Q9BA 1MCEA 2A83B 1EEZA 1GIGL 3WO4C 5F96H 4HJ0C 3ZE0E 3PQYD 4FQIH 2FX9L 4Z0BL 2PCPA 5T33H 1NBYB 3LEYL 4PJ7A 1RJZA 1NGWB 1IAKA 4XNYL 2ICEB 3EO1A 3LRHA 3WHE0 1YEFH 4U6VH 3ARGB 2BVTA 3TO4C 3X3GL 4G8GD 4HWNA 4W81A 2EDWA 2GJ6D 2JCCF 2E7LC 2E8YA 5IG7A 3BGAA 4LEOB 1OAXL 1JNLH 5HGBB 5EZJB 5EU7E 1KXQE 4Y19E 4P2OC 4F37K 2EYTB 4YXLL 1OQOA 4G8GE 5CD3A 3BZFB 2Z92A 2IANB 4TSAH 2W1NA 5F7WC 3FTGA 1CS6A 3O0RH 3I75A 3D3VB 1XR8B 1EAJA 1PYWB 4R96B 1I4FB 4ZFZA 3G08B 1K4DA 4D0CA 2CIKB 4NQDE 2DM3A 3ZTJH 4EN3A 5EH1A 1NUGA 4P5MA 3SDYL 2HT2C 3SDDB 3BPNC 4QRRA 1AKJD 1WCBB 1CBVL 5ACZA 2W07A 5IT2L 1Z5LB 3VD9A 3RGVC 3VA6A 1CD9B 1QSEE 2VH5H 4N90D 5DUMH 3VJ6A 4EIGB 3HNTH 2LU4A 4JO2L 4PJCA 3D9AL 2G75A 4HS3A 3SEPA 1IEHA 2VLKD 4IIQB 4NKOA 2C3XA 3ARDA 5AAMA 3VXRD 2CLZA 5FKAA 4WDIB 2OMBA 3IU4L 4G80B 4HLZH 4PD4J 3RWIA 1ZGLB 3ARWA 4PJXF 3I3BA 4K3JL 5F1KC 1FZMA 3KS0J 3FCTB 1IT9L 2EDFA 2LAAA 3DTXB 1JK8B 1YJDC 1E4KC 5DZLA 3QG6A 2KKQA 3ALXA 1CLYH 4LFHD 3VG0H 4ODWB 4Z8FL 3GSQB 3RWCB 2DQIL 5HYJE 3QIBB 5CLWA 5LGHH 3DVNA 4GBXD 3VXSE 1IKNC 1BX2B 4NO5B 4PLNC 5E8PA 5T3XH 3WUWB 4HSQA 4FQXA 4V1DA 1WBXA 1VPOL 5D7LD 4GRWB 1HZHH 3IRPX 4KUZH 1KC5H 1KELL 4HJGB 1VEOA 4IDLA 4PBXA 4Y19D 5IVXB 3HMWH 3FT2B 5KAQF 5HHVL 2DQUL 1D6EA 4MNHB 3DMMA 1L0XA 3QEHA 4RFNB 2PYEE 4EQ2A 3QISA 3T2NH 1KN2H 3LD8B 3MV9B 3UZEA 4CRPA 4WTXA 1Y0LB 4P23A 4OGZA 4UV7H 5ACZB 4UV4L 4XXDA 1CDIA 4PJXB 3MRNA 4HEME 3VXUA 1BEYH 4FFZL 4XPTH 1O7SA 1CDGA 2HT4C 3LS5L 2X70A 4XCFL 3KLDA 4Q0XL 5D6CB 4OTXH 4FQLH 4KKAD 4KAQH 1OW0C 4QOKD 3CVIL 5CZXD 3ZKND 5KVMC 1LNUA 3KAAA 1RVFH 2EYTA 2DTSA 5MP6H 3GBML 4XP6H 1HINL 1F11A 4NFBA 1XIWA 3GM8A 4X6DB 4P46A 2VH5L 3MACL 1EEZB 5DUML 4MJ5A 4JPKL 5IW3A 1FE8L 4FQHB 5DK2A 3B3IB 3HKFA 1A7QL 3O81A 4M8VA 5ICXB 2ICEA 3HE6D 1E0OB 5ESQB 3FMGL 5KSVB 5MHSD 1MRDH 1U3YA 4Y4FB 5K9OB 2YKLH 4JHWL 5DO2D 4M03A 5CFHA 1B6DA 1K4CA 3FT3B 3S96B 2A9ML 1T7WA 3QDGA 12E8H 1MVFA 1MPAH 1U3HA 5CIPB 2CIIB 5EORH 2FEDD 3WV0A 3MV01 4OD1H 2IPTH 2VIRB 1MIEL 5SWZE 1EBPA 2BNRA 1RZKC 3EYVB 2RB8A 1GZPA 4Y4HC 1M4KA 1EGJA 1A7OL 4M7LT 3EOYG 1TNMA 1HQ4A 2IFFL 1MCJA 3BZEA 4NNYA 1HIMH 5HI5D 3HN3A 1FNSH 4OCWH 2H26A 4GAGL 1YYLL 1KG0A 1P7KB 4O4YL 4NM8H 2F74A 3O3EA 4MVBD 1JYWA 3QDJD 2A74A 3FRUA 1GIGH 4CMMA 3H9SB 4U1HA 4O5LL 3OKMA 1AGEB 3GB7A 3PHQB 4X9BA 3CX5J 3SO3C 2P48B 5H8DA 1CFVH 3UTZA 5HGHB 5L8KB 3DARA 2GJZA 3DROA 5K59E 2YRLA 5MEOB 2X09A 2VXQH 4GRMB 1YMME 1J1OH 3I2CH 3QB7C 4A6YH 3FQXB 3SCMB 3OGOE 2QADC 1SVCP 4U1KA 3DYOA 3FKUS 4NM4L 1OF2B 4YE4H 2VDQL 2YD3A 3MJ7B 3L9RA 4L8SA 3OWEA 2OJZL 3DJ9A 4WWID 1I3RB 1I1FA 3ESVF 3S35L 2GIYA 3H9HA 4GG6A 2NY6D 1CE1L 3W2DH 5C0CB 4E41D 3MOBH 3TZVB 4HX1B 3UJJL 2WUCH 4XC3L 2VDPL 1C5CH 1E4XH 2DQFA 3HC0A 4XCFH 3RX7A 3SDYH 4OCLC 3RY4A 2DQCH 2ICWA 2CSPA 3QI9A 3W9DA 2O61A 3THML 1LO5A 3PDOA 5EBGA 5C0FB 5B4MC 3RZCB 1HSBA 1BVLA 1SBSH 3RKPA 1OD9A 2FGWH 3QH3B 4ZPVA 2ICES 1FZKA 2EIDA 5D70H 3O41B 5DJ0B 2XZQH 3KPQA 3QXDB 5AYQA 4W6YB 2GFBA 1R3LB 4WY7L 1OAZH 4GAYB 2VDKL 2BHZA 4HWZB 3FB5B 3OKDB 3O4LE 3WIFA 4HXAH 4QHMA 3EYQC 3FQTA 1U8LB 4K2UL 4I77H 5IBUB 3VI4F 3CZJA 4JM2B 3UO1H 3VFNB 1E28A 3O4LB 4R26H 1CT8B 3MSPA 3I02B 1MFCH 3IXTB 3JTTB 5ID0A 5DZOA 5FKPB 2XWTA 4RMWA 3SDAD 2I9LA 4NQCB 4ZS6C 2VQ1B 2EDEA 4QOKB 5GIRB 3IDGB 3KPPB 1FFRA 3HI6L 5HHOD 4PP1D 3HI1B 3VXPA 2P47B 2B39A 1SMAA 5I30H 1I8MB 2JJSC 3DNKA 4YDJB 2D7TL 4LPXA 3G6DL 1WT5C 1VFUA 3NGBB 5EZOH 1P1ZA 1Q38A 4U6VL 3OHXA 4JM2F 5L2KA 2VZVA 2EC8A 3ZT6A 2E7BA 4Z7NF 4JQIL 3QPXL 2VTFA 4HT1L 5F1SA 4XMKH 5CZXC 4LASL 5FHBL 5C0DA 1BAFH 1SBBA 4HUWA 3RPKA 5CCKH 3NIGF 1U8PB 2XA3A 1W2KT 2K3TA 1T03L 1C7SA 4LF3B 3S9DB 5DD5L 4NQCE 4HK0B 4WHCA 2YD5A 2DQFB 2G5BA 3HC0B 4AIZA 1T5XA 4XAWL 3ETBF 3VFNA 1WIOA 4HX1A 4L5FH 2DLFH 1U8LA 3BAEL 2PYFB 4RFEA 4OZIF 2P7TA 1LEGB 3BD4A 1IGIH 4O58H 5HGDA 1ZT1A 3RP1A 5JW4Q 2NZ9D 4E0RA 1F3RB 1F4XL 1P9MA 4Q9RH 1FL5B 1RUAH 4JFPA 1IM3A 4WUUE 4WFHE 5B39B 1GGCL 3G5VB 1ZE3C 3Q0HA 3QCTH 1PVHA 4RBPK 5DJ0A 2FL5B 3NTCH 4JGUA 3MX0A 2V2WA 5F7KC 4U1KB 3W39B 1CLCA 1M71B 1HI6A 1NH6A 3MBED 1YECL 1CXFA 5EZIL 3RHWK 3QIWA 5DYOB 5K9QI 4ZUVB 1ZVHA 1NEUA 1KJ2A 1SBSL 3MNVA 3PL6C 3GHEL 4M1CC 4H0HB 2AS5M 4HWBH 3H9HB 4ELMF 2AABH 4GG6B 2QL1A 3QCVL 5LWYH 1PKQA 4WTWA 4F33A 3BKYH 1U8MA 1MY5A 2ZG2A 4LGPB 1F3DH 3SBWC 4YBLC 5D8JH 2HKHL 5E9DE 2GY7B 1NFIB 3QDJE 3ZKNC 4RX4D 4HLJA 3SKNB 4PJDB 3BP5A 3FN9A 5GPRA 2D03L 5ID1A 1P5UA 4RMVA 4YO0A 1T1ZB 4HGKC 3PQYA 4I18C 1P69B 1F4WH 4P59L 3ESUF 4LCIL 1WBYA 4X8JB 5DC4B 1DN2A 2A38A 4ZDHB 2ARWA 1CD0A 1FL6A 1II4E 2X4OA 1J1XL 4K8RL 4JEGB 2CIIA 5E8DH 3RVTC 1BWMA 3JUYA 3GB7B 3P4NB 4PJ5E 4U1HB 4BM7A 4Z77B 3FRPA 4K3HA 2AV1B 3WN5A 2H45A 1RJLA 1Q0XL 4NN5C 3SGKA 4Z0XB 3G5ZA 4PJAE 2CKNA 2F58H 3AU1A 5D6DC 1MREH 3U6RA 5JXAL 1G6VK 1QR4A 1X5AA 3UJJH 5J3HD 1ZVYA 2LAGB 3NCEB 2P5WE 4MJ5B 4M93B 4OCRL 1UYWL 4PJ8B 4K55A 4U1GB 5DC0A 4NQXB 1G7IA 2XQBH 4UV4H 2XV6B 1U8MB 2XXCB 1BOGB 5DDHB 3HA0A 4CKVX 4JQXC 1U3HB 4PRPB 4AM0B 4YHKH 1VCAA 2P44B 1WEJL 4L29B 4LGRB 4GXUN 4G8EB 1QA9A 1J11A 2XTJD 1WUNT 4JY5H 1XIWD 4ZUVA 4OCNC 1FGVL 4PB9L 4LIQH 3H42L 3X13A 1J1PH 4ZMAT 4XB7A 4MD5B 2O5XL 2OK0H 3GHBH 5DLML 3EIFA 2W9EL 1KJVB 3C2SA 3FAWA 3QWOB 3K2UL 3OKNB 3VXRA 4HFUH 4KKBD 4LIQE 2Y23A 1LDPL 5CUSL 1H15A 3CVHH 1MJ7L 5GZOD 4HIXH 1P4IL 1UM5H 2XN9B 5D5MA 3UYOD 4N8VA 5IVXF 1LEGA 1A7PH 1MHPL 3DECA 4KZEH 1JI2A 2Q7NA 4LHUD 5D96B 2X9YA 1YQVH 1ZT7B 2QHLA 5I17A 2XZQL 1S5IH 1EO5A 1OLZA 3L3DA 5T1MA 3GSWB 2CKBH 1YY9C 2AJSH 4OZHA 1ZHNB 1S9KC 1T7VA 1TFHA 3VRIB 1UEYA 4MXVE 1F6AA 1YDPA 1AKJA 4Z78B 4U3HA 2D7QA 4UILH 1FIEA 1Z9OA 3VFPB 3MV9A 4Y4HA 1UADC 2FBJH 5E6YA 4UINH 2WWKO 4MNHA 1BQLH 3C09C 3RUGB 3F12A 1CK0H 4QRRE 2HLAB 2XN9E 4G5ZL 4HFWB 5EOQH 4HH9A 4U1JB 1CFSA 5T5NF 4J1UA 3SPVA 4PJEB 5L2JB 1PLGL 4Y16D 4YX2H 4WUKH 7FABL 1J10A 5TQ0H 2A1WH 2V17L 3WUWA 3VXNA 4UNVA 1N5YL 4S2SA 4QTHA 5LVEA 3B9EA 2VL5A 4U2ZA 4NJAL 4GQPH 3RQ3A 4U6TA 1T1WA 4ZAKD 4R3SB 2MJWA 4LPTA 3QIUB 3ZE2F 2DQHL 4WFFD 1QFUH 3MZGB 4C59B 4GAFB 1FFNB 4PJIB 3C2AL 1I1AC 5GZOC 3SGJA 3O45A 3OKDA 4QY8A 3FJTA 5C07D 3QQ3B 5J12C 4Y4KC 1L0QA 3QZWA 4TNVK 1FZJB 4IRJA 1AQDB 3G6DH 2AW2A 4K7PL 3HS0A 1BZ9B 4POZC 2HH0H 4PJHF 3G9AB 2LQRA 3DV6A 2QSCH 4RZCA 2Z8RA 3BXNA 1PG7L 2WQ8A 1YEJH 3SE3A 4I4WA 4X6CA 1X3DA 3L3IB 4JLRB 3FOLA 5SX4I 4MDJB 4XPBH 1AFVL 3O4OB 3LV3A 3C60C 5JXED 1G7PA 3F65A 4I3RL 1FNGA 2VXVH 4YFLI 3PE9A 4QRRD 3MRRA 2VYRE 1UXWA 1N3NA 4P4KD 4XP4H 2XA8H 4X7SH 4PR5B 3S7GA 2YK1H 3D9AH 3MJ7A 2XTLA 1V05A 5DJ8B 2Z8VC 1O0VA 4XNYH 4UUJA 3GNML 3TGXA 4L8SC 3WO3B 1I7RB 4HHAB 1XR8A 4YBLB 1NAKH 1A4JA 3BISA 3SJVD 3H7BA 5MHSE 1KB9K 1DCLA 1EJ6A 2E27H 1REIA 4MJ2A 2R0LL 4KMTL 5I1CL 4NKMA 2WBJD 5DHYA 5IG7B 1JHKL 4NNPH 1I1RA 2AXFA 3UEZA 1I85C 1A6ZB 2C3WA 3KPRD 5F7YC 1EZVX 4NJ9H 5I1EL 4P59H 3O9WC 3QDMB 3L5JA 2MFNA 3V5HA 5L8JB 5LWYL 2OS7A 3HZVB 3PGFH 1FV1A 3HI5H 3MUGB 5GGSA 5D8JL 3BPOC 5EU7C 3TH3T 3FZUD 1EEQA 4OKVB 2VAAA 4ODSH 3W9EA 3R06A 1CTNA 4Z7WA 1BGXH 4XTRC 3P73A 2WAHA 1X44A 1YEFL 3QDGB 4OAWB 4N0UB 1HHGB 4PP1C 3FO9A 1RK0A 1VADA 5A3IC 4WEBL 2DQHH 2AXHA 5DJ8A 3RGVD 2J7LA 3MXWL 3ECBA 3DRTB 2EDKA 1AQKL 43C9A 3DBXA 3IU4H 4NQEE 2NY3B 4F9LA 4ONHA 2SEBB 5FYKE 4JFQA 3MLXH 2ENYA 5FXCH 1LP9B 4QRUA 3DX6A 3GBNL 3DWTA 3ZLQC 2P8PB 2O5YL 2R2EB 3IDIA 5JR1H 1JN6B 5HDBF 3F58L 2DM2A 4JRYE 4J3TA 2GTZB 4NBYB 4CGTA 4U6HA 5HI4D 2JIXB 1P53A 3O6MH 5IB3A 5C09E 2LU3A 3LSOA 4RX4A 3V52H 1QBLL 5GISL 2HKFL 4TSBL 4RFOL 2JJTA 2EE6A 2EH7L 3HE6B 2ZUSA 3D0LA 1U8NA 1D5ZA 2ADFH 4X5XB 2X1WL 2PYFA 4RFEB 5JW4N 1IGML 3QUYB 4WFGE 2QQKL 1DQMH 4JY6B 2VZUA 4JJHA 2MHAA 3O8XB 4L8DA 1D6VL 4MJIE 1ZLUH 4FMFA 5E0QA 5I1IH 5I19L 5B3JF 3MLRL 5FO9B 2YXMA 3NFPB 1T04B 3HZMA 5FGBA 3HNVL 3VXNB 4ODUA 1GCFA 4Y1AD 2BOBA 3GMLB 1ED3A 3TEUA 2MSPA 1GAFL 1UFUA 1J8HA 3DIFB 4MA1B 3HC4L 4PJAF 4AIXA 1W8OA 2HJLB 3U7AA 1IGYA 3KHQA 4PJGA 2AEWA 2FDBP 4AL8H 2M1KA 3PDDA 5ACMA 1SVZA 4RGMC 3RPIA 1JYNA 1KYOK 3OKLA 4XAKD 4HS8H 5D9SA 1IJ9A 3HI1A 1BFSA 5LBSH 2NX5D 5GRUL 3RWIB 4XMLL 5GSRB 5IFJA 5I8KH 3G04B 3IFNL 1CFNA 2Q3ZA 3CFBB 4FQ1H 1P4BH 5IVNA 4KPHH 4FQ2H 3VXSD 5BRZA 5KVEH 4Y16B 3WBDA 3WEXB 4LVHC 3WNLA 1M6OA 3RTQD 1XF2A 3MV8A 3EJYC 1YEGH 5CSGA 2EC9T 2HFEA 4JFDE 1CVRA 4TTDD 3OXSB 5E94A 3LVEA 4JZJA 2CO6B 3F6IA 4WGVB 2HJKA 2OSLA 1IE5A 3CMGA 1KB5L 3OGCA 4LSDA 5DA0B 3KS0H 2FJGB 1F58L 4HW6A 3GUTB 3ZE1F 1T0MB 1IGCL 4EXPX 3HC3L 4KROC 2BVQB 5JA9A 4YGAB 5L2KE 4M6NL 4XCNA 2MKWA 1AY1H 1RVFL 5K9JL 3BGFC 4JFZL 4QXGH 4P46D 4OKDA 3TZVA 4FFYL 3NCJL 3I75B 4ERSH 1ETZA 2OJEA 5GRVL 5BS0E 4PIRF 4N0YH 4AH2A 3FFCB 4JQXA 2VLRD 1DN0A 1MFEH 4TNWK 3IVKB 2XN9D 5KVGH 3ZHKA 2YK1L 4JGMA 1EGJH 4PJ8A 5D2NB 2BSTB 2FBJL 4R7DB 3PNWA 2C4FT 4NRYA 2EZ0C 1TZIA 1Q72H 3KJ6H 4Z7UA 2DD8L 3HMXL 4CMHC 3LH2H 1TVDA 4KK6C 1UC6A 4MWFA 5T3XE 3BQUD 4GRMA 1BF2A 4WHYG 2F9BT 4EDXA 4I3RH 5LGJB 1OTSC 5DMIH 4HAGA 2ZOKA 5E56A 3ZTNH 4GKSA 3WLBB 3CJJA 3KPOB 4MD4B 4WFGD 3WFCL 1S7TB 4MQSB 4QHUA 1QLFB 2HFGH 1A14L 4RAVA 3FQUA 4PV8B 1L4IA 4FTVE 3GIZH 2O5ZH 3WCYA 4YHPA 1L7IH 5GS2H 2BRRH 5E8OB 3TM6A 1Z9LA 1BLNA 3LKQA 1JV5B 1UH4A 4GW5B 5JLZA 4GAGH 1YEIH 4YO0B 4APQD 4WO4B 3ULVD 1KJ2H 3PABA 4LAJH 2YBRB 5DFWH 3MZTA 3MRCA 1JTTA 4HBQA 4A2LA 5GQBA 4MQXC 3K0WA 1JHKH 3KVQA 2I24N 1KJMB 4IS6A 5J1AA 1MCIA 2UZYB 1VESA 2EH7H 2PYED 2WANA 4M1CD 3P0VH 5AD0A 1ZA6A 2D9QB 2RHEA 1FG9C 5TF1H 1JF6A 3S5LB 1GC1C 5IESL 1H5BB 4YHMH 2HMIC 4LSSL 5F89A 1YYMH 3BVNA 2FD6H 5TE6L 4NHCH 3D48R 4OIAA 1QHPA 3S36L 3EOTH 4N0FA 1T3FA 3AS2A 3LKPB 1LD9B 3W11C 5E4EB 3VMOA 1GXEA 2P8MB 4BQ8A 3V5DB 3ELAT 4JDVB 5KS9B 1ZGLP 4ONFL 2Y36L 3CC5A 2AXGB 2FEDC 3U36B 3MOAH 2PXYA 3MXWH 2OR9L 1Q1JH 2ZZUT 5BVPH 2JJUA 4GS7C 3VRLE 4KQ3H 2C1OA 3UAJC 3DSFH 1P84J 1T5XB 2HKFH 2VERN 2N56A 4XCEA 5C7XL 1A7NL 3RDTC 4EQ3A 2DL2A 2FO4B 3OKEA 3ZT7A 3WHXA 3WL9A 5IEHB 4Y19A 3KLAA 1NGPL 2A6IB 3BKYL 3PG2A 1NUDA 4MCZA 4TUJA 4BH8A 4M48L 2BY3A 1D5MB 3P9MB 3IAQA 3MRDB 1T89A 1FO0B 5IW1A 2A0LD 3P30L 4NQSA 4LPCA 4MQXD 4KPHL 4MNGE 3IF1B 4WI6A 3V0AC 1BJMA 3T4YA 4L5FL 5GGTA 4Y2DB 3PGFL 2QV2A 3GUTA 2H3NB 1H3GA 3GMQA 4P3CL 3PHSA 3OGCB 3D0VA 4XI5D 3VWJC 5CSZA 4BK4A 3GJEA 3BEVB 1B9ZA 3BPLB 3TV3L 4QTIL 1EXUB 5HHQB 5KVDH 3RWFA 3D2UA 4PJ9B 3GSQA 2Z9TA 1EJOL 5DVOA 2VKWA 1ZA6B 2NW2A 4JKWA 2DLTA 1MCBA 2V9TA 2H32A 4OZFH 5MEPA 4DQOH 5K9JH 1A02N 3CZFA 4ZS7L 1NLDL 4JKLA 2F19L 4GRWH 4M1DL 1I9JL 4ERSL 3IFPB 3K1KC 5L8LB 1HEZB 1BBDL 4JVUA 3EZ8A 5TGBA 1IVLA 2JCCE 4N0RA 3WFDH 1XCTB 1NDMA 2YPLD 5I71B 1OGAD 2VZSA 4GG8A 3S34L 4NQDB 4IRSC 1TVBA 3T4AA 1R5WA 3Q6GL 5FO7B 4G6FD 5A2KH 4UTAL 1DBKH 4HCRL 3SDAB 3ULUE 1BREA 4RAVB 3UYRL 3OJMB 5CP7A 3NAAL 4F15C 5ISZD 2XTJC 1F4WL 3DETD 4P4RB 4TUKH 5FHAH 3MGAA 1VHPA 1X7QB 4QRTA 3GO1L 3PWPD 5FO9A 3RY6A 1UB6B 4YUEH 3KPNB 3P4LA 4LP5A 1ZK9A 3QRFM 2XFXB 4JO4H 4EXKA 3SDDA 5CP3H 1CD1A 3KJ4B 4KV5E 5MENA 4KVCL 1MAMH 4J3UA 4FZ8H 3D3VA 3H0TA 1FG2A 2ZCLL 4KY1L 5BMFH 5FGCE 4OCXL 3AAZA 2Z92B 3ARDD 2XKUA 1CXKA 4D8PB 5HD8D 3CPLA 2L0DA 4NCC2 1AGEA 3PHQA 4ISVB 3BH8B 4PJ7E 1UM4L 4GQ9L 4ALAL 4GRWF 4UB0H 2B2XH 2XOTA 4XHJC 4E41B 5C0CD 1N5AA 3O2DA 4QXUH 2R2HB 4WHTB 3P0GB 3MA7A 2CDEB 5TDPB 4H8WL 1J0ZA 3NPSB 3MQIA 5ADPH 5J8OA 3BRFA 1RJZB 2V9RA 5FA3A 1A5FH 2YMXL 4QT5A 3O2VH 3M8OL 2EDDA 3Q3GB 4IRSD 3MRLB 1KJMA 3MO1A 3S36H 2E7HA 3DX7B 3FL7A 5EOTB 5F7UA 3GMMA 1IFHL 2EDXA 3OPZL 5INCB 3I3DA 3RVWC 2DBJA 4IRSB 4NT6A 2D0GA 4TVSa 2IMMA 5FUZH 5GS0C 1NGXA 4HKBB 4FXLA 2DL9A 1NJ9A 4L9LA 3GI9H 5MERB 5KSVA 4E41E 3NCYS 5ICXA 3Q48A 3G5YB 4YHPB 5I0ZA 1NBZA 2HN7A 5DK3A 4KC3B 3F7VA 5GGQL 1U91A 5I8OL 2PXYD 1DP0A 3BGFB 3CH1B 1CCZA 4B7LA 1C16B 5D5ME 1F11B 2DDQH 3TVMC 3HZKA 3E3QE 2DLIA 4J12A 3KPSA 1VEPA 3TIDA 4EOWL 3K1DA 5GGVY 5GRXG 1FJ1A 5KOMC 1FLTX 4IJ3C 4AZ8A 2F53E 1MCNA 2CRZA 2NTSP 2YPVH 5FYKH 3E6HB 3K8KA 5HHNA 4YDIH 3O11A 3ULUC 1BQHG 1N5AB 2YRZA 5FF6B 2PW1B 4NGHH 3VDCA 1EFXD 3LKSA 3CPLB 4NNXB 5HI5C 2PN5A 4R90H 5GGRB 4CW1A 7CGTA 3FFCA 2ATPA 3DV4B 1K5NA 4LCCB 2OR7A 4JG1L 2DTMH 4JRXA 3ULUD 3QPQD 2ZUVA 3PWPB 5D71H 4NWTH 4YDLC 2G60H 5DUBA 3MLSL 5JHLL 2YKLL 4JHWH 3KG5A 1Y18B 5DRWB 3STLA 4HS6A 2ZJSH 2OZ4H 1BVZA 3RWGA 4G6FB 2R56H 4EI5C 3GSNH 5DO2C 1CDHA 4P49A 4YR6A 2HJFB 4HEPG 1XGTA 1UACL 3E2HB 4U6HB 3E6HA 4GAJH 1FN4B 3HCVA 3CFJB 2EICA 4XVSH 4AIOA 5J1TC 4LL9A 4R4NC 1RI8A 3TBVB 1F8TL 2CR6A 4EI5D 4OLEA 3UTTE 5DQ9B 4PY7A 4DGYL 5CEZL 5IB2A 1QSFE 2IPUK 4JY4B 1U8QA 2VZ3A 3VI3F 3VWKA 3LMJL 5ELIA 5IMOB 3VXUE 2CLRA 2DBLH 4R0LA 3WKNA 4FXGA 1FNEA 5BO1L 2WINA 5D7LB 5DMKB 4XX1E 1VADB 1MNUH 4LVOB 4IMLB 3QXVA 2MPAH 3ARBC 4CU6A 5CMAA 1I8KA 4P2QA 2HJLA 5KW9L 4G7YL 3NMEA 4HC1L 35C8L 4Y2DD 2O5XH 2OK0L 1ES0B 4XVTH 5K59F 2GK0B 4X9IA 3LQMA 1CI5A 1V3JA 4H1LB 1WBZA 4JFDA 4F57H 2ILLA 1ITCA 2AEPL 2EIEA 4YK4C 4ZUWA 5JZ7C 2DQEL 1FVEB 2HYMA 4C4KO 3D6GA 1KPUB 2IPTL 2MMXA 1KF9B 3SDXB 3WXVL 5GS1C 2VRAA 4HH9B 5L0QB 4TTDC 1AO7D 2WK2A 4I2XB 1RHHA 4XAKE 3NFSL 4EOWH 3OZ9H 1JHLL 4QXTA 2AI0L 1FDLH 3DO7A 3MRDA 4N1HB 5MP6L 1E6OH 4ODHH 4WI7A 4YDIL 4FABH 3VWKC 1I4FA 3QUML 4ZFZB 2EYRA 2VO5A 1R3KA 3H3PL 4PG2A 3RWJB 1DVFC 1OM3L 3TWCH 1U8NB 5D1XC 4XP1H 2VLKA 5GRZA 2GK2A 1G7JA 3H3KA 1BFOA 4J4PC 1PBYA 3DX8A 4L4TB 1YC8A 1U95A 5JW5B 1QSFD 1T66D 5IQ7L 1Q9OB 4N0UE 4FP8H 5BRZE 2QHRL 4MLIA 2FWOA 1CD1B 1AD9B 3WS6C 4I0PB 4UT9L 1RIHH 4JO1H 1F00I 3GMNA 1S9YA 1BBJB 4FTVB 1Z0MA 5IB1B 4OFDA 1M7XA 1UKQA 1MRCL 2DQJL 3L3OA 4UT6H 5DEZA 4MD0B 4X6BB 5CP7B 2NLJA 1OB1A 4FQCH 3FB6A 3MFGB 3PWVA 3UJIH 1OVZA 4CNIA 4WWKA 4LSUH 2W0LA 4F7TA 4KY1H 1MIMH 4O4YH 4LDLB 3T2OA 2BNQA 1A6WL 4OZGE 4M3KB 3Q5YA 2W65B 4UOW0 4FTVD 4JANA 4DUWA 1X5YA 5F7EH 3TN0A 1I1YB 4MAUL 1ZLUK 3NH7L 1ZEAH 4O5LH 5IMLA 1V3KA 1BMGA 3EYFA 1XGRA 1HK6A 4DCQB 1LO3L 1N64L 4UIKL 1G7IB 1EK3A 4AQOA 4IOSD 1CXHA 3VFSA 3B2VL 5E9DA 1F97A 1MWAA 4K3GA 5EU4B 5T3XD 1UJ3A 1YN6A 2OCFD 4HPYH 3U4EA 1FNFA 5L6YL 1A1NA 4MZ2A 3N1QC 4X6FB 1RULL 1UJTA 2F5BL 2XQYG 4Y16C 4PRBA 4JRYA 1VA9A 4MSWA 4Z7UF 2QR0A 3CFKA 3MMEA 5JDSA 3DXAE 3Q6FB 2F8XC 1HILB 3SE3C 1JZ3A 3DHJA 1AGFB 2YD2A 2ADJB 5FM5M 5ADOL 2D7OA 2QTEA 1WK0A 2RFXB 4P3DA 3CFEB 3GI8L 4XCCL 3UBXI 1KTDB 5F97E 3SY0B 3MOBL 3WNMA 1GGCH 1FE8H 1PZ5B 3DRQB 4WI3A 2D7NA 4ZS6D 4D8PA 3IDJB 3T4YB 1HYSC 4RGMB 2WUCL 1DANU 5EO1B 1ZA3B 1RIUH 3UC0L 1UACH 5EBWB 2I9TA 1FO0A 4KKLD 3ARBB 5F7NC 1KCKA 3KDMA 4L8CA 4F9PA 1F4HA 5MENB 4X6EB 3MFFA 1S7QA 2QKIB 1CZ8H 4OF5A 1S9XB 3CSPA 3I3EA 4DEPC 4ESKA 2O26U 1TQBB 4RFOH 5C0GA 1L9NA 1NC4D 4F15B 2AJVH 1DN0B 1CGXA 3VRIA 3MRRB 4KMTH 3JTSA 3PWNA 1P4LB 3GIVA 1YPZE 3EO0B 4WI9A 3UTTD 3VWJB 4MXWL 1ZSDA 2VXSH 2GTWA 5GJSH 1WZMA 2V5MA 4TOYL 4RGND 4WW1B 4U1IB 3L95B 3C60D 1QBBA 1XH3B 2CGRH 2IPUG 4RMQA 3QXAA 3UTPD 2CDGA 4RZCB 1N6UA 5C0BB 5I1DA 3TF7C 4YDKH 2D4DA 1KPVA 5T1LA 5GRJL 2A2QT 3TT3H 1EV2E 5DRNB 5B39A 3HPJB 1YNTA 4L3EE 1PG7X 5FUOH 4UDUA 5I1KH 1XAUA 3OXSA 4TSAL 4F58L 1WWBX 3DVIA 1AR2A 1PW3A 2O5ZL 4U1IA 4GT7A 3JV5A 2R8SL 2E3VA 1MFAL 1FAIL 2OBGA 3F6LA 4F3FB 4DGIL 4RISH 4WFHD 1A6WH 1J0HA 4AIZB 1P4LA 1YECH 3BI9X 1DR9A 2V5YA 2R2BA 3MODH 3Q5TA 2X9WA 2XKSA 3GFUA 5C0RH 5F9JA 3QO1B 5GGQH 5SWQB 5JNYA 4XMPH 4PRDA 2VLMD 3AXLB 4G9FA 5CWSA 2KZ1B 2F53D 1DBAL 4MJIB 1GGYA 2EH8L 2OP4H 3CDCA 5DJYA 3JV4A 3CXHJ 4UIMA 2K9UA 4YEEA 1A9BA 4Z76A 2ZSVB 4JPWH 5IW6B 3O9WA 1PKOA 4XVJL 2LVEA 1G1YA 4LLQB 1F4AA 2QBWA 2APXA 2YA1A 1MRFL 1NCNA 1UA6H 1WTLA 3GSRB 2H1PH 3RTQC 1E27B 3AS1A 1UG9A 3RDTB 4NHCL 3TYFB 5BXFA 2ESVB 5LGJA 3NTCL 3KLHD 4RMUA 5SX4H 5DEGA 4XB8A 5E99L 3IDGA 1TVHB 4ODVL 4XCYA 5BZDA 5CEXA 1CU4H 5JOFA 3CFKB 3R8QA 5JDSB 1JZ7A 3K4DA 5GHWH 3BMWA 3N1PC 2J6EL 5ID1B 2CXKA 4Y4FC 4FXKB 2PKDA 4XVUD 3U36A 3U9UB 4WO4C 4LCWA 1FL3B 4JJ5A 5TJWK 4L9LC 3D87B 3TO4D 3B6SA 3EYFB 1C7TA 1QO3B 3KYMB 3WIHL 3OXRB 2I07A 1S9WB 5T1LB 4M43L 5EU6B 3VXQB 4KRLB 1FZKB 2YD6A 5IK3B 1KJVA 5EIVA 3ZDYE 3FQNB 4OFYD 1BVLB 1KENH 1RUKL 2PTTB 1MHHA 2D3VA 1BIHA 1MHHB 3HR6A 1EHLL 2F5BH 4LPWA 5GGUA 1ZLWH 2DQIH 2FJGA 1ZLWK 1OARH 2FL5A 1ITBB 3MGTB 1DTUA 5FOBA 3E8UH 3GIVB 2BMKB 1BFTA 1U6AH 3LIZH 5E94B 5KN5B 2DJUA 2FX9H 4Z0BH 5T33L 1VFMA 3T0WA 3K2UH 1DBBH 3UJIL 4XXCC 3B9KB 2VZOA 3PWJB 1YN7A 2CK2A 2FWOB 4XAWH 4YHYB 4LKXA 1QSED 4ONFH 1DDHB 4WO4A 1U41A 1B2WL 3QDJB 5DJZB 4S1QH 4PJDE 5IIEB 3ARUA 1MF2L 1FH5L 2IALA 1NAMB 3HAEA 4NQEA 5D2NE 1E6JL 2HG5B 4JFFB 4FOMA 2ESVA 4GG6E 3DSFL 5J12B 1S7VB 4JFYA 4CVWA 1T22A 3SY0A 3OKMB 5FYLD 2D2OA 5C71A 5HDQH 1E27A 3ZDZE 3IYLW 3PP3K 1CTOA 2RFXA 3EO9H 4OGXL 1U58A 5I16A 2F74B 1Z2KA 2DQDL 3QDMA 1MIML 3PJSA 2A6KA 3L7FB 3RVUC 1I8LC 2HVJA 1JWSB 4HD9A 3N85L 1I8MA 4YXKH 4Z7VE 3B9KC 1VENA 1D7FA 5C0NC 4R7DA 5LCVL 1EH9A 2IH3A 2H9GA 1OGAB 5HVGB 3MRHB 4GBXC 1LK2B 4P4KB 2HTKD 3FN3A 4P5TC 1ZT4B 4X6CF 5HI4C 1D3CA 1T6WA 3RNQA 1IC1A 5DFTA 4JM2A 2G9HB 1QVOA 1S5IL 5ADOH 4WWKB 2QSVA 5KS9E 4A2MA 2OM5A 4XHQA 1HH6A 2HVKA 3UTSE 5DA4A 1YMHA 3A6BH 3MJ9H 2Z8WC 3KPTA 5IMOA 3VWKB 4JFOA 3W39A 4LP4A 4Y5XB 3G6JF 3WFCH 3ULSA 5BQ7A 5C0BA 4KKLC 4AY0A 2AGJL 1JVKA 4ALAH 2BRRL 3ZDXF 2ZUQB 2FH8A 4F7EA 2GHWB 4L8BA 3L7EA 4JVWA 1U8KB 3L7EB 5C2BH 4Y5VA 3T0BA 2WBJA 3CXHK 5I18H 1J8HE 3HG1E 4OV5A 4M61A 1PX3A 3VMNA 4JFHD 5CIPH 3DX6B 3PGDA 4DKEL 3LAFA 4UTAH 4KH2A 5TQ0L 3DMMC 2W38A 1LO3H 1N64H 2EIZB 1EDQA 1Q9LB 4HC1A 1GVIA 3DRTA 4MXWH 4OB5L 4QOKE 4G6AD 1CL7L 1T0NA 2XPGB 4HGWA 3VW3L 3JV6A 3MACH 4MYWB 3UTTB 3VWJD 1KOAA 4HZLB 4PD4K 3DMMB 3QEHB 3ALPA 4J3WA 1WQVT 2PW2B 1L6ZA 3ARGC 5FUZL 4QLRA 1VFAA 1QBAA 3BMVA 3C5SA 1BHGA 4QGYA 1VFBB 3S4SB 2VL5B 2ZUQC 4YLQT 1WFTA 2XZZA 2IPKA 3FRUB 1CXEA 4B41A 5HYJD 4XPTL 3T77A 2FR4B 2DOCA 4PRHE 4LHJB 4YIQB 1NFDA 1YUHB 1IC7H 4HFWA 4N0CD 2GJ6A 2QR0B 3P2TA 3VFGL 4QXUL 1DUYA 4XPHL 5FYJH 3TBTB 3ULVH 3TN0C 2F8OA 4H8WH 4X7FC 5F8RC 1W8NA 4XPBL 5C0RL 4O9HH 5FB8B 4ZNEA 1TCRA 2VLJA 1DUZB 5ETUA 4HWZA 1A5FL 2EKJA 4GXUM 4Z78A 4HH8A 3B9DA 3VD7A 5C2UB 4R90L 4PGZA 2GFBB 4PLOB 4YHLH 4KXZH 1HKLL 1NGXB 4HKBA 1T0PB 5FKAB 3C9NA 2JIXA 3RZCA 4JAMA 1QFOA 3GMMB 2ICWB 5DMYA 1RUQH 1YJDL 5LGHL 2XIDA 1ONQA 1KN4H 3MLYL 5DRZB 1MFCL 3BKML 4PRPE 1HCVA 4WEBH 4EUPG 5AWNH 1LEKA 4F7PB 1NCDL 1IILE 1NGZB 1XIWB 5E2WL 3L3OB 1X4YA 3JVGC 3OJDB 5J9PA 3HNVH 2UZIH 2X4SB 1OHQA 4UDTA 2ITCB 4M8QB 3V9FA 2VOTA 2NCMA 4HV8A 4FNLL 4HUXB 1EHXA 2JB5L 2PXYC 2YUWA 1QRNE 5FYKU 2DQDH 2Q8BL 1TPXB 4G6KH 1OF2A 3V6FB 1RK0B 3ABZA 2EYSA 1S9WA 3IDMB 25C8H 1KLUA 5EN2B 3F7YB 2R29L 3ULVF 4ZS7H 5IR1A 1CGYA 1UCTA 3U0PB 1G7HB 5I1GL 3U0WL 4YXHH 3UTZB 5D4QA 5DFVC 3LKSB 1RFDH 4JKKA 3S88L 5FF6A 3PV7A 2BC4B 4Z7VF 5IGXH 4R3SA 3O4OC 3J8F7 1IGTB 2Y06L 3JWDL 1JMZA 3UPAA 3ZZ1A 3SQBA 1RY7B 3QPQC 2Q7YB 1UB6A 4NNYB 1C1EL 4PJ7B 1MCWM 3BQUB 5JO5B 2ZP0T 3MLSH 1U8JA 3LN5B 4QGTA 5FYLH 1HQ4B 1A4KA 1KPUA 5TPWL 4PB0H 1XF5B 2YUVA 4Q6IB 2VLLB 3ARTA 3BP6B 1IKFH 3GSNB 4NDMA 3C5SB 4LU5L 2RGSA 2IQ9L 3AY4C 1NCCL 3UTOA 4GG8B 4PJDF 2VDNH 3C6LA 5ICYA 4KRMB 5DJZA 1ZS8A 5EBMA 1FH5H 3VFGH 2B0SL 1FFPB 4QHNA 3TCLA 2D7MA 3OR6A 4NC2B 5D7LA 3V4UL 2YN5A 4OZ4A 5CJ5A 32C2A 1MCHA 2NY4D 3GGWA 4D9RE 4AG4H 1W0VA 2Q20A 4AL8L 5I15L 1F5WA 3R1GH 4PPTA 3MV7A 4X9FA 3SGEI 3F7RA 4XZUA 2H32B 4HBCL 2BMKA 1GHFH 2I60L 4LSRH 4ACPA 2Q8AL 1X5LA 2KH2B 4F3FA 1FYTE 1KJ2B 2Z4QB 2X4TB 1EHNA 5I1JH 4ZSOE 3LY6A 2VLRA 3BDBA 4Y5VB 1JGLH 5IQ9A 5DI8A 1U8KA 3DXAA 3TT1L 1MCCA 4L9DA 5C08E 4RIRA 2NX5A 5CJXC 3MXVH 4NZUH 1WZLA 3DOSA 3S35X 3DV6B 4UNUA 5DRXB 3S37L 3D25A 3GMQB 1RK1B 3VXSB 4IRJB 1IM3B 4XRCB 1F4YL 3W2DL 1HH6B 3NOIA 3ZKMC 5DRWA 2H2SC 2QQQA 1D5BA 3CK0L 1HXYA 4XPGL 3TH2T 3RUGF 4WJ5A 3VXMD 3C8KB 1IGCH 1ZSDB 1J0KA 4DFHA 5DWUL 2VDQH 4KXZI 1J0IA 4OGAD 2WWMC 3DUHA 4LASH 1LO4H 3WHE1 5DMJB 5A2LH 4JG0L 1KEML 1QQDA 1BOGA 5FCUL 4XCYB 4HIEA 5LBSL 5CEYB 3G5XB 4V1DB 1T03H 1YEKL 2NY1C 1OM3H 2WIIA 1SQ2N 3UMTA 3O11B 1N4XH 4DN3H 4NHUB 1A3LL 3MRBB 4I13B 3U48A 3KLSA 3T8XA 5IW6A 1NANI 4NQDA 1TQCB 1SY6A 2EXYD 2AV1A 3WN5B 1PEZA 4LIQL 1BD2D 4NOBA 1TJIL 3KNBA 4YAQB 3BEWB 3HR5B 4NKQB 1G9NH 4OFIA 1VACA 4NZJA 5FUCC 5AZEH 4PTTB 1DSFH 3VG9B 3VRJB 4DVBA 2FGZA 3FCTA 3ARXA 1IKFL 1J8HD 5ENWA 5IMMA 2VDKH 1WBYB 4X8JA 1NAMA 1H3UA 3HAEB 2VABB 2YWZA 4DW2L 1NCWH 4M5ZL 2VWEE 1B6UA 4HXAL 3MRIB 3V6OA 1NCCH 5DEFA 1SYSA 2NXYB 5DJ2B 3LQAC 1NBVL 1MVUB 1HN1A 2CLZB 3V4VL 2AJUH 1AR1D 1AC0A 2OR9H 3RNKA 2YSSA 3B9KA 5E70A 1EAPB 3CFDA 5I9QB 3MGOA 2JIXD 4LLUA 4DZBA 2NY2D 1A6AA 3AROA 5HHME 1QP1A 3QA3B 4NQTA 1UYWH 4HIHA 4BKLB 5EIIA 4KROD 1J8KA 5LKNA 2W65A 5I1GH 4NN7B 2ICWI 5CILL 1U8OB 2X4UA 4R7NB 2JCCA 3QJHB 3ARFC 4AEIL 3PDOB 1SHMA 5C0FA 1RUMH 4K8RC 1XGYL 3JWNC 2C1PB 4P5MB 1CK0L 1BJ1H 5TF1L 2Z35A 5IUSA 1IGIL 4O58L 4XNZB 1I7UB 4LRNH 4BYHA 1S7RB 3X14B 2NW3B 1LGVA 4OLVH 3T09A 4KKAC 5E2UL 1LMKA 1OAQH 4XT1C 4E0RB 4HKJB 3PWUA 1FFQA 4XCEB 4JFDD 4D9LL 5HYQB 3UBXA 4X4ME 2ADIA 2GITB 1KJ2L 4FFVC 1F2XK 3EW3B 3ARBA 3DX8B 4L4TA 3P9LB 5DJ6A 2E7LA 2ZUTA 4E9LA 3MODL 3M17B 4QCIA 1AD0B 2EYRB 1JI1A 3KYNA 4LQFH 1V3MA 2FNBA 4K23L 4BH7B 2HKHH 3MRJA 1QEWB 1NGPH 2NPLX 5EU5B 1OP5H 1P7KA 3UDWA 3O9WB 5CZVL 4KI1A 1T89C 3ARVA 2X1XR 1A2YA 2KQNA 3HZYB 5EO0B 1G9MC 3PGCB 5CWSB 5SV4A 5FDWA 1U3JA 4OIIH 5SWQA 1UZ8B 3KPPA 5I2IA 3RGVA 43CAB 5GIRA 5LXGH 4U05A 3GO1H 5FKPA 1GZQB 4XPFH 5CZKA 2B1AH 3PIQA 3KLHC 4LOUD 5IJKA 15C8L 3HE7C 4X4XB 4CNIB 3GK8H 5TPWH 2WZPD 1J86A 1XCQA 3TJHD 1RD6A 3T0EE 4GAYA 2MQCA 4OCRH 4BFIB 5JW4M 2BRQA 4J3OC 3TLRA 4UILL 1KN2L 1A6UL 4HMEA 3QO0B 1CLOH 4WW2B 5JIHA 3QDME 5HHPB 2DLHA 1FFOB 4W4OC 3NIFF 1PAMA 4CDGC 4YQXH 5HD8C 5FM4A 2P42B 5E2VL 4JR9L 5IKCB 3KR3L 4KVNL 3U7YH 4BQBA 4M6AA 5C0BD 1TCMA 3BN9D 3IJHA 5J89A 3EO0A 1DEEB 2AP2A 1CQYA 1MSPA 4KRNA 3IVKA 2AJ3B 2ATKA 4PJFF 3T04D 3BD3A 5T3ZH 5C0GB 1OGTA 4AH2B 4N8PA 4TRPH 4C56D 2ZUXA 3D69B 1PQZA 2DIBA 1S8DA 4PGDB 3V4PL 1BD2A 1JGLL 4YGVB 2VDMH 2AJYH 3SDDC 1X5HA 2DKMA 1I1AB 1INQA 4JVPA 4NKDA 4P2QE 1OY3B 4MNGB 3FZUC 4Y1AA 3BIKB 1OLLA 3QRGH 2VQTA 4CL7A 5E8EB 1NC4B 5F1IB 3THMH 3SGDI 2RR3A 2DJ4A 5DLMH 1EEYA 4KU1A 4ZPTB 2GEEA 2IG2H 4GMTL 2BHYA 4LHUB 5C3LD 5CBAA 3O6KL 2NXZB 3BKCH 5JOPD 1ULVA 2DLGA 3PHOA 4B53A 3QWRD 3WIHH 1XCQB 1H3XA 1ES0A 2Y36H 1MI5E 3Q6FA 4J3SA 1UJ3C 1QKZL 1MEXH 3KYOB 4LLDA 3SE8L 2DKUA 3D39B 4ZNCD 4Y16A 1KPRA 3PIQB 1MRFH 2B4CL 4PRNA 3CVHA 1DQML 5C0JB 3LKNA 5DJAA 5E9DB 3CFBA 4I8DA 2ENSA 3N9GH 2QQLL 3WJLA 4OIIL 2VR9A 43C9B 4OGYH 4PRIA 2X4NA 3O2WH 3FQWB 1I1YA 3OKLB 1MJJA 4XPFL 4P57A 4KMQA 1C5DA 5IJVB 2YPKA 4X80H 5DHVH 4GW5A 3L3HB 5JLZB 2QQKH 4KFZC 4WWKC 1GC1L 4Z7WB 4PGJA 3BP4B 4IJ3B 3ZDXE 4TVPH 3ALWA 2R4SH 4OJFH 1S7TA 1HHHA 3VJ6B 3J7HA 3MUGA 5GGSB 1P5VA 1RHFA 1KFAH 4OQ1A 5I1KL 1RZ8B 4K7PH 1MQKL 2HA1A 2BDNL 1IAOB 4K23H 5C0AE 4QRSA 3RVVC 4FZEH 1RJYA 5AUMB 1MFAH 3AY4A 2BZDA 1RJCA 1TZIB 3T3PE 4FQ2L 2VDOL 4DGIH 1P7QD 1YNLH 3NFNB 1BOYA 3C8HA 3FFDA 4XP5H 3VH8G 3FTGB 4I5BA 4I0PD 4NBZB 4MX7B 4OSUH 1AO7E 3MBEA 3QULB 2ZKHL 5SWZA 2KUTA 4XBEH 3MRPA 3P9WB 1CR9H 4CMMB 1J9CT 1DLFH 3WFDL 4GW4A 1NMAH 5IVXA 2BOCB 4TVPD 1N3NB 4DJMA 1FJ1B 2VITA 4LARL 2X4RB 4YDVB 5DJDB 4LHUG 5F6IB 1A8JH 2K7PA 4OLVL 1KCUL 3SKOB 3DURB 3L5WB 5DVMA 4HMDA 5FV2A 2APFA 2SEBA 4Z7QF 5I19H 2CMRH 1A0QH 1OD7A 5F1NB 4ONGH 5DJXA 2R0WH 2P5ED 1AGBB 3PV6B 1C12B 1E4XL 1SJHB 1T4KB 3B9VA 3T4AB 3L3HA 3C6SB 1U93B 1LO2H 1BJ1J 4NN6B 1MJ8H 3I6GA 1F6FB 4WCYL 2LFGA 1JPGB 3DUSA 1EBAA 3TFKC 3QQ4B 1F8TH 1YMMD 1I7TA 4B5EA 1AGCB 5I18L 2IAMA 1IL1B 5SWSD 1HXMB 1UVQB 5H2BB 4QY8B 5BS0B 4LCUA 4PJXE 1A6VH 3KWWA 3NPZB 1KNOA 5F7MC 4EI5A 1IC4H 1R3IH 3QNXA 1JNHB 4NWTL 2XWBB 4PGCB 2MWCA 4A6YL 1LEIA 4JRWA 4C56B 5IM7B 3QDAA 1BZQK 3SHSA 3TBVA 4MAYA 1MHCA 1QSFA 3ILQC 3HCVB 3OSKA 5ESAB 5KVEL 1OCWL 3D0VB 3T77B 1FAKT 5HYIA 4PJ7F 4F7MA 4KTDH 3LD8C 5HDOA 4NC1E 4UT7H 1QTYT 1RUAL 1KCRL 5FGBC 2A6JB 4PJIE 3WJJA 2VXTL 4MB5A 4D9LH 1D9KC 2VE6B 1IGJB 4Y1AB 3C8KA 4KDTA 4NKDB 4D9QD 2DI7A 5HHOB 4TUJB 4BH8B 4CJ1A 1AI1H 1UWXK 4JRXB 5HYSG 1EFXA 2IANE 1IARB 5L88H 3DV4A 1X5FA 1JPFB 4H0IA 5HVFB 5CJOL 4ORGA 5FOJA 4QRTB 4JM2D 5CJQH 3RVUD 3TPKA 3VXMA 3VW3H 4Y5YB 2Y4SA 1KXTB 3L3GB 1OAKH 1SM3H 2YZ8A 5E8PB 5C6TH 3AB0C 3S88H 1MFDL 2WWMD 3V6OC 2YUXA 4ODBD 5EPMB 1VFOA 3KPSB 1EFXB 1JF1A 3BPNB 2Z4QA 1N59A 5E6ID 2APTA 3TZVC 4QRUB 2Y6SC 4JDZA 4P5TD 1BZ9A 3LB6D 3F7VB 4U6YA 2VUOA 3KWWB 1QNZL 1FZJA 2OTWB 4MAYD 4KI5C 4WUUB 1UVQA 1CF8L 1NUFA 4H20H 2HRPH 1NL0L 5SX5H 2UZIL 2HFGL 4PBVC 4U0QB 5CBEA 2VDNL 3S36X 2P49B 1A3QA 3UX9B 2P24A 5F3HA 4YZFF 5DF0A 4MGXA 4PRPA 4HULB 3RWFB 4P4KA 1ZKAA 3WIIL 3PV6A 3X3GH 3DVFA 5DJXB 3RGVB 43CAA 3FAXA 4H5SA 2LV4A 4MHHG 1A6VL 4O2FB 4CN6A 1MAKA 2J5LC 3PABB 3WE6B 1SJXA 3OMZA 1QYGL 1U8JB 1NCUA 3HHRB 2Q7YA 1JWSA 3LEXB 5F1OB 5K93A 2GCYB 2NYYD 4C83A 4LSQL 1H8SA 5EUOB 5ESVA 1FYTB 5IW1B 1U58B 3MRJB 1H5BC 4ZSOB 4HDIB 4Z5RB 4Z6AT 4D0CB 3TBSA 5K9KA 5HYSB 4OM0H 4P9HC 1L7TH 3QULA 5GRJH 1KLGA 1MQKH 4WEMB 3KLAB 2E6QA 3CCHA 1T1ZA 3H9ZA 2C26A 2HMID 1OW0A 4PJAB 1MCSA 3QUMB 4KI5D 4LLMA 1Z3GH 2AXGA 3WO4B 25C8L 3I6LD 4DTGL 5DC9B 1T1XA 3EO1B 5GZNC 3QG7H 5IFAH 4YXHL 4HJ0D 2CJUL 2R15A 5BCAA 1G7PB 4KDWA 1N7MH 4UBDD 2KPNA 4HUVA 2NY3C 3LKPA 3EJJX 1I7UA 4KJWC 2ESVE 1VB9A 2H6PA 2IGFL 2FJFB 1JGEA 3EOAA 2P5WD 1A9EA 1SM3L 5DR5L 1KTLA 3SJVA 5BVJB 1QKZH 2E7CA 5I1LA 1I85A 1UH2A 4XP4L 3MJ6A 5FO7A 3SE9L 3GRWA 1H5BA 2JCCB 4PGBA 3MOQA 4IEFB 4P5TB 4L3CB 5F9DC 1J88A 1HEZA 4NFDA 4D2NA 3EDEA 1WITA 5JQHC 5DMGC 3MRGA 3KYMA 3TA3B 1DSFL 3FFCE 3DI2B 2I27N 2UWEA 1I9RL 4XGZA 3HRZB 2YPLB 1S7UA 5MEPB 3UC0H 3OG4B 3W82A 4LPUA 5EO9A 4KK6D 2BNUA 5FO8A 5KG9B 4M7LH 1KPRB 2OR8A 2EXWD 5BVPL 1KELH 5C07B 4CU8A 4JB9L 4YIQA 1A1MB 3PHOB 3VRJA 4DVBB 1KACB