4P5KB

Structural basis of chronic beryllium disease: bridging the gap between allergy and autoimmunity
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
212
structure length
198
Chain Sequence
NKFDTQLFHTITGGSSPENYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEERAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of chronic beryllium disease: linking allergic hypersensitivity and autoimmunity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
total genus 38
structure length 198
sequence length 212
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p5kB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p5kB01
4YO0A 5C9JA 4F9PC 4KMTH 3QDJD 5D70H 3OV6A 1X5KA 5C0FB 3ZTNL 2IFFH 1ORQB 43CAA 2H8PA 4UNVA 4NP4L 5DD1L 3RPIB 2DMKA 4Y1AB 3EYUH 5DRZB 4D9RE 5CEZH 4G3YL 3BEVB 4OLUH 2ICWB 5TQ0L 1E4WH 1UFUA 2J8UE 2VL5A 1XH3A 3OR7A 4WO4D 1I7RB 4OV5A 4WU7A 3THML 1INEH 2EKSA 4MB4A 5FYLE 4EQ3A 4LSQH 1UZ6F 2FZ3A 2XZQL 4UAOC 2R23B 4JFDB 4NCC1 4LPVA 4MCZB 3CX2A 3WJLC 4C54A 3TJEL 3TIEA 2BZDA 3ARFC 5GSVB 4JFXA 2EZ0D 2X4QB 2V2TB 1V7MH 3HNTH 4IRSA 3T0WA 3LKSB 1KB5H 2AJYH 4Z7QF 4JG0L 4LDLB 2CIIB 2OP4H 5K59F 3T4YB 3QEQB 2B5IB 5F9WB 2J4WH 3U9UA 1PEZA 1SYSA 4OM0H 3X13B 4DKEL 1PAMA 3F58H 1INQA 4HH9A 3S36X 3TNNA 5DR5L 5A1AA 3ULVH 1N64L 1ZHKB 4JFZL 3L3DB 3GSXB 5IVXB 5TE4H 5FO9B 4JFQB 3GZKA 4WU7B 1AGDB 3MLZL 4D3CL 5L8LB 5AZ2L 3MYZA 1WIOA 4X5XB 5DJCA 2CD0A 4ZS6C 1J0YA 2A6KB 3BP7A 3LRHA 3D85D 2BC4A 4I0CC 5IMLA 4W81A 2A74A 2EXYC 2VXUL 3WKML 4M7LL 4POZD 4PY7A 4RRPA 5D7KD 1HQRA 3DV4B 3QIWB 4F9PA 1RMFL 4TSCH 5IR1A 2IBZX 3INUL 2CXGA 5DEGB 4FZEH 4FG6C 5T1KD 2E7LC 1D5ZB 4PJFE 2DKSA 4LRNH 4ZSOB 1J8HE 4C83A 3UXFA 4S2SA 5C0CB 3V6OE 4OFVA 1F4XH 1WBYB 2JIXA 4PJGF 4PB9H 4JKPH 3U0PA 1LK3L 2X89A 4TVPE 3TYGL 4J6RL 4GG6E 1I8IA 2QHLA 1REIA 1LO0H 2VN4A 1MCBA 2ZP0T 3RTQA 3SEPA 1RJLB 3E6HB 1TTGA 4KDWA 5GS1B 4LOUC 1HKFA 1HCVA 5L88L 1T6VN 3LD8C 1ZA6A 1GGCH 2VDLH 1F6LL 4NKMA 2AW2A 2C4XA 5CP3A 3U7YL 1BGXL 1ES0A 5C0GB 4PY7B 3CC5A 3IJYB 4ZG1A 4GS7C 3SDCA 4TTDC 4NZUL 2GY5A 4G3YH 1FPTL 3SPVA 4OGXH 1WZ1H 1HIML 1IC4H 3QO0B 1J05A 2YUXA 1F97A 3A6OA 3HR5A 1ETZB 2E3VA 4N0YH 5JQ6L 3ZMRA 4YX2H 2ATKB 3WE6A 3OAYH 5IFAL 1MI5A 3GDBA 2R2CA 1ZS8B 3TBVA 4NPYB 3IF1A 5JA9A 1CDBA 3W82A 5AUMA 3RVUC 2WBJD 3VD3A 5DLML 4UBDD 4FQIL 3CMOH 4O2FB 1WT5A 2Z31C 3MRPA 4QHKJ 3HZMB 3MRMA 4GKOA 4LKXA 5J12C 3ARVA 2H1PH 4OGAD 1HOCB 3U4EB 4P5TD 3PWLA 1VSCA 3SE4C 1KB5L 1QBAA 3OKEA 5I8OL 5I1LA 4GFTB 5DJYB 1LDSA 5HYSG 5A2FA 3NBNA 3D85B 1NDGB 5EZJA 3HAEB 1IQWL 3NMEA 3UMTA 4NN7C 1E4KA 2WWMD 1GH7A 4DCQA 1KJ3H 3NABL 3BJ91 4XP1L 3I6KB 2H2SC 5J13C 1CZ8L 5IJKC 2QSCL 2IWGA 3QQ4A 1BVKB 3OKNA 4MSWA 1C1EL 1FG2B 1C08B 4LSUL 1P4LA 3MGAA 5BZWB 1QRNA 1IM3A 1ZHBA 5CZKA 5FDYA 4PJBF 4NBXB 3ZYOA 3Q48A 3GHEH 1VPOL 4QRPD 5INDA 4ALAH 1JPSH 3BOVA 1BQHG 5DF0A 4K3EL 2GJZA 3S35X 5TQ2H 1UZ8B 2CKNA 5KN5B 5KSBB 5GSRB 3KJ6H 1JZ2A 4CVUA 1MCWW 5FUOH 1J7VR 2IQ9L 1RVFL 1WFOA 1XF3B 5HHOA 1JZ3A 1KEGL 4ZTPL 1IC7L 5BZDB 4R2GB 3BIKB 2Q76A 1G6RA 2JCCA 4UDUA 1H15B 2DIJA 3QDMA 1NGPL 1A6VH 1JPTL 2NXZC 1XIWC 1F4HA 1FQ9C 3QDGD 1BIIA 2KDGA 3VFSB 3GMRA 4JVUA 4JO4L 4GQPH 5FV1L 2VLRD 3OKDB 4LAQH 5L2KB 4LOUD 4Y8DC 5SWZB 3MLUL 4TYUA 2DKMA 1JGDB 2P5WA 1BHGA 5BV7C 2OJZL 4NO2A 4UTAH 1SEBA 1L7IH 5IP4A 2OXGA 4HK3J 4YHKH 3WIIH 4HHAB 4OFYD 1S7SB 1S7UB 2R2HA 1VHPA 2DIBA 5GGTH 3ZLQC 6FABL 1P84J 4XNXH 4LLYA 3I84A 4M9PA 4PJHB 2VERN 4OQTA 4XBGB 1RHHA 4KKCC 5I75B 2JJVA 2AK4B 3CDCA 3SBWA 5HDBF 5E9DA 1RSFA 4QNPF 1GL4B 5MENB 3PL6D 3O3BB 5E9DE 1QPPA 1M7XA 5JORB 1XR9A 4XWGH 1M6OA 1YYLL 2WINB 3ARTA 4JB9L 3U4AA 5KS9A 2AXGA 1ZEAH 2IANE 3ILPB 1EJ6A 4U1LB 2BSRB 1A6TA 3HI5H 4NHUA 3IXAB 5IQ7L 1UCBH 4QRUA 5DMIH 1OAKL 4LCIL 4OM1L 4POZC 2HT3C 3SDDC 1X7QA 4BZ2H 5HYIA 4EDXB 3P40A 1NCDH 4GG6B 3QO1A 1F3RB 5J3HD 1IEBA 1WBZB 3HNVL 2C7UB 1JTOA 1FVDA 2DDQH 3VH8B 3KDMB 4ODWB 3D3VD 5TF1L 3HE7A 3NCYS 3A0OA 3T0AA 5LGKA 2R4RL 2XRAL 1OAKH 3E2HB 5E2TH 7FABL 3O9WD 3IFOA 5IB5A 4WI2A 1FGVL 3H7LA 3G5XA 4HG4J 1FE8H 1KB5A 2F74B 4QRRE 4IHOA 3AVEA 5AZEH 3BD5A 5GS2H 3ARDB 1Q9WB 1KJ2B 1A2YA 2VWEC 1EO8H 2G60H 4M7LT 2D0FA 1Q0XH 2DLFH 1MJ8L 2PTTA 1ORSA 1P69B 5E6ID 3GMPA 4EIGB 1R24B 3MBXH 1Z9SA 3BWAB 5E6IB 4A2LA 5HTSA 1NCWL 4H20H 3IAQA 5DD0L 5FO7B 3ZKXC 5I73C 4HV8A 3BKMH 3OKNB 4OCWL 5EU6A 5DVOA 1TTUA 1OHQA 2FO4B 5DEFB 1CLYH 1XIWD 3KPRB 3TM6A 1QO3A 3SE3A 4DUXA 3ARDD 1B0RA 2BERA 4IMLA 3RNKA 4OCLC 1DN0A 4F3FB 1MUJA 3TFKD 5BS0E 3QULA 5E95B 4HFWA 1IVLA 5LGJB 3GSQB 3EOBB 2WLYA 2ZUQC 3SOBH 3UJJH 2DBLH 1MIML 2ADIB 3MSPA 1VEMA 5TH2A 4ODXA 1Z6JT 3UYOD 2LV4A 3ULUC 2IPUK 3HFML 4MDIA 4OZHF 2NY4B 2Q7YB 1KTLA 3WMSA 4M5YH 5DJ0B 1FSKC 3DXAA 3KPRE 1TJGH 3HFMH 4EUPG 1DSFH 5E6IA 4XGZA 1NCCH 3H9SA 3C60C 4OI9A 4CBPA 1N3NA 2MPAH 4GMSH 3VFTB 4GKSB 4P2OC 4TPRH 32C2A 2OZ4L 3QNXB 4YC2C 3D0LA 5HPOA 3TVMC 5HGBA 4PJEF 3QZWA 3WXVH 1BECA 3RNKB 4TQEH 3OJDB 1S7VA 4PJ5B 3QULB 5K33A 5TJWK 4U1GC 3WFCL 4ODUB 1FO0B 3GSWA 3K8LA 3ARBA 1A6PA 3DMMD 2CSPA 4C58B 4QYOA 4TTGA 2OL3A 5J1AB 5K9OB 1DANT 1T2JA 4UUJB 2QSQA 1IQDA 3P0GB 4OQTH 2AJYL 3S4SG 3U82B 1S7TB 3FRUB 1C16B 2C3GA 5CWSA 4KRPD 1RVFH 4PJEB 1KN4L 5F88B 1RZ7L 5AZ2H 4FQ2H 5HI4D 2NZ9D 4LHJB 5F1IA 3HLAB 3WLBB 4DAGH 3P0VH 4JFZH 4R7NB 1ZVHA 1GPOL 4HS3A 3VFTA 5EH1A 4UV4L 4UMGA 2QSTA 3H9ZA 1R5WA 3MLWH 1BBJB 2C7UA 1VA9A 3W0WE 4DEPC 2E27H 1UT9A 5BOZG 3B5HA 3N50A 5AWNH 4ZFFA 4WUUB 4XXDB 4IM8A 5EUOA 4J1UA 4BH7A 5J12B 3VXRE 4OCMC 4JQXA 3NH7H 5EU7C 4AH2A 3D87B 3L3OB 2HTLD 4N0CC 5I8KH 4LMQE 3VXUE 3NFNA 3S98A 4EBQL 2HH0H 5BJTB 1DJSA 2APFA 2QHRH 1KCUL 3GJFH 4I5BB 2VABA 1BOGB 5L6YH 2BNRA 1FIEA 1WJ3A 4OLUL 4L8CA 2J8UF 1NCBH 2I60H 4MYWB 4NDMA 5B3JF 4K9EC 1NJ9B 1PGRB 4JB9H 4JM2D 1I1AA 1UJ3C 1H5BC 4RZCB 1K4DA 1MAJA 1NC2D 5KW9H 2BVOB 3EOYG 5GRJL 4L9LB 2GCYA 4JY5H 1W72B 4AT6A 2I07B 1NGWA 3I3DA 4TSCL 1JP5A 4GUPA 5GJTH 5EOQH 4GW4A 2GFBB 3L3OA 5J9PA 2AXFB 5I1JL 3MLYH 4X6BB 3UJTH 4H0HB 4F15C 1ZSDA 2A0LC 2UY6A 4HUWB 4I3RL 1CE6B 4NFBA 3Q6GL 3OJ2C 2YWYA 2LVEA 1CLYL 4MXWH 2X70B 2CLRB 4L8CB 2APVA 1CD0A 2CGRL 4KK5C 4KQ3L 5IM7B 4XCYA 4NKOA 4YDKH 3V4PL 1I9JL 1JPTH 5F6IC 3MJ9H 1OAYL 2R1XA 4OBSA 4OZGA 4WTXA 2G5BB 3BKYL 3WEXB 4OZGE 3PL6B 4JHWL 1F8TL 4PJ7F 1X5YA 4Y89A 3KLDA 5KSUB 5L6YL 5IB2A 2AEPH 5ABDE 2AXJA 1FNAA 4XC1H 3T0DA 2NW3A 3QXAA 1IC1A 1BQLH 3DOSA 4RMUA 4HIHA 4QXGL 3LQMA 1LDPH 5C0CE 1L0QA 3ZKSD 1WTLA 3TBTA 4XNMA 1IT9L 3MLXL 2YPLE 4GRLB 5DJ2A 1ZSDB 1FGVH 3D3VE 3CXHJ 3JUZA 5D1XB 2BOBA 4QYOB 4ZSOA 3QQ3B 5J1AA 2DYPA 3P3YA 1IQDB 3U4BL 3QDGB 3W2DL 4NO5B 5FYKL 5I1CH 4D3CH 3MV7D 2IH3B 2HT4D 2QQNL 1FP5A 5F88A 15C8H 4LCWD 3VW3L 5B39G 2Z9TA 3DX7A 1IQWH 3WHE0 2HVJB 5EN2B 3PWVA 1SJXA 1P1ZB 4XI5D 4CMHC 3NPSB 4G42B 4XPFH 3UO1H 1KN2H 1CBVL 43C9B 4A2MA 4Y5XA 5DUML 3VRIA 4Z0XB 3O6LL 4XPFL 1BBJA 4W68A 5IIEA 3AM8C 5CKAA 1LQSR 4KUCF 3GBML 3ULUF 2UYLA 5FOBA 2ATKA 2GJ6D 4NQEA 2FWOA 3IT8D 4TUJA 3EBAA 5FUCE 5HHOD 4NWTL 5E8PB 1A4JB 4U6HB 4EVNB 3GBMH 1UH4A 2Y4SA 3DNKA 4Y4FD 1HWGB 4QLRA 1IAKA 3SKUD 4F8QA 4G8GD 1I9RH 1XCQB 5BJTA 4L4TE 2F5BH 3VXSA 4L29A 3BW9B 3L1OL 4CGTA 1AQKH 1DBAL 4OKVB 5D1ZB 3OJMB 3O3EA 2ZUWA 1GHFH 3NOIA 3SDDA 2APBA 4FFVD 3G6AB 1JYVA 2P4AB 1NLDL 1RJYB 1OCWH 3CSPA 1P7QB 3D39A 4QXTA 4Y0GA 4ZXBB 1HHKB 3NA9L 3HI5L 3FFDB 5SV3A 5I74C 4G8GA 1PLGL 2UYLB 5FOBB 4K71C 3V0WH 3ILPA 1MLBA 5ESQA 5E9DD 2GUOA 4JR9L 3RWEA 3IXAA 4Z7NE 1RZIB 2D03H 1JNHB 4BA8A 1U8LB 2DM2A 3REVA 5FV2A 4KTDL 2XWJB 3L3GB 2BVUA 1C5DA 4LCWA 1MCSA 2V17H 3O3DB 2B0SH 3D9AH 2Q86A 3BUYA 2HFEB 4TULH 5EOTB 1KYOJ 3DXAD 4QHNB 5IV2B 3MMEA 5FUCC 2YZ1A 4LF3B 1D5IH 3N1QC 4BQ8A 1FZJB 1IEAB 2CDFA 4XCEA 1FVDB 4NO0B 4Q6IB 4U1SA 3HC3H 3S37H 1L7IL 3ME0A 4NFCA 1KIPB 4F9LC 1KJVA 1DDHA 2J7LA 3BESR 1T1ZA 4O5LH 3MLTB 4EI6A 3CCHB 4ZFOL 2O93L 4YDKL 5I30L 1MLCB 2JCCB 4RGNC 5C0AA 1TFHA 5DJAB 5C9KA 1AGCA 4DK6A 3GI8L 4XHQA 3MV7A 2PYEA 5IKCB 3UEZA 3ETBF 1ES0B 1D5MB 1V5JA 4AG4H 3H3BC 3FTGA 4WUUD 4L4VA 3BZ4A 4PJ9D 1JL8A 2P49B 4R26H 1S7WA 3OHXA 4NQDB 4F37K 1R24A 5T1KB 2BOBB 1U58B 5HY9B 3EJZC 2P8MB 2JB6B 1OWWA 4RX4A 2BNQD 4LF3A 4YGVA 5F9JB 2HKFH 3O8XD 4PRHD 4P46D 4JVWA 1HEZB 1EO8L 5A43C 5BXFA 1AXSA 1QD0A 4R7DA 3DX8A 4XBGA 1QFWI 1A4KA 4JZOA 2VDPL 3MOAL 4LKXB 1B3JA 2YBRA 1DFBH 5JORA 3BE1L 4X98A 2FB4L 1KELL 3M1BB 5FGBC 2EDLA 1A8JH 5E2TL 1AGCB 3LOWA 1PSKL 3DLQR 3E2HC 5I1LB 4KV5E 3FQNA 3IETA 4BK4A 1X5GA 4ODSL 3VFRB 3SCMA 3KJ4B 3MX0A 1UB5B 3D85A 2SEBB 3ZL4H 5JW3H 2PYFB 4U3XA 4XPBL 4ODTL 1J0ZA 1IILE 3UTTA 4QRRA 4MA3A 3O8XC 5DD5H 3CVHA 1ND0A 5E8DL 5HY9A 3EOAA 4YK4B 2DJ4A 1N6QL 3SKJL 1A9BB 1A0QH 1RZ7H 1UA6L 2F19L 3BP5A 4OFKA 4LPCA 2L0DA 5J89A 2NXZB 1IM3B 1A0QL 4P0DA 3G9VA 3MLUH 1GGIL 4JHAH 4UT7L 4WI3A 4UV4H 5DMJB 4JKKA 2BVQB 2G75A 5D1QB 5L0QC 5IB4A 3X12B 1I3RA 3DWTA 3G6AA 3GMOB 2KBGA 2DQDL 3LN9A 3BPCB 4JRXB 4NQEE 3RZCD 1I4FA 3E3QC 2BDNH 2CDEB 3DI2B 1OY3B 5EFIA 3GSNL 5HYJE 3I02A 5D1QD 1BJ1J 3UYPA 3O2DH 4HAGA 5KAQG 3EJYC 3FRPA 5HDLA 3L7FA 3B6SA 4MD0B 1MCOH 2NYYC 1PFCA 1IT9H 2H8PB 2KQNA 3U30C 3NGBB 1U8LA 1KFAH 3REVB 2LQRA 2ICCA 4AIZB 2MFNA 2CDGB 4GBXC 5JOPE 3O0RH 2ILLA 3DMMB 2J4WL 1U0QA 3H9HA 5FGBA 1T1XA 4XP4H 1A3LL 2FATH 5CZVL 2CO7B 1PLGH 1S7QB 1OSZA 1EO7A 2OZ4H 3CVIL 3NABH 4XP1H 4ONGH 3BQUA 4JCMA 1RZKC 4RWYL 3B9KC 4MNQA 1YPZA 4G7VH 4ONHA 1TJIL 2FGWH 1DBBL 2ADIA 3QHZL 1JPSL 1AIFB 5JNYB 2DM4A 3BIAX 1UQSA 3MR9B 3WSQH 1KTDA 3GJEB 3I02B 4M3KB 1YNLH 5DJAA 5JIPA 4Q7DA 4NWUH 3HNSH 5I1KL 2AAVA 5BV7H 4LNRB 2A9NH 4HXBL 4L9LC 4QHKI 2NY2C 4L8DA 1T7WA 3IJSA 3GM0A 4PG9B 3D39E 1CGTA 1TVHB 3WD5H 2E9JA 3TNNB 5JW4Q 1PG7H 4X4ME 2AP2A 2E9BA 3U0TB 1G84A 4NN5B 5B4MC 5J6GB 3DVGA 3QQ9D 4ODHL 1GC1C 1Q9KB 1OP3H 4NZTH 1Y18A 1GYAA 3QQNA 3LKNB 5IQ9B 1A1MA 3UTQB 4UT6L 4HSQA 4P3DB 3QISA 2VSCA 2A74B 2BVEA 3BD4A 1CT8A 4DN4L 1OQOA 4N9GB 2H1PL 2X4RA 4MX7B 5JMRA 3WV0A 4YK4C 3ZT6A 2FL5A 5JR1H 5E6ZA 1HH6A 1GAFH 4WW2F 3FQNB 3IETB 5F21B 4EBQH 1Z3GH 5D6CB 4JFED 1WBYA 2BNRD 2JIXB 1RIUL 4OZHB 3WNMA 4ODHH 3FB7B 3BSZH 5EU3A 3V0VB 1R5VB 5C0RL 5FCUH 5B38B 3EYVB 3KPNA 4NRXA 4KI5D 2X4SA 5KOVC 1DZBA 4YXLL 3B5TA 4JRYB 1FCCA 3BWAA 2CKBA 1A9BA 1CTNA 4L4VE 1H3TA 2H45A 5EZIL 4QTHA 3CVHH 3T1FA 4PRHE 4QHUB 4ZFZB 2NW3B 3TA3B 5D71H 5GHWL 3WSQL 5A3IC 3DURA 4OAWB 4HLJA 4X7DC 4MD4A 1FSKB 1MI5E 5CKGA 1P53A 1U8HA 3FT3A 3L95A 4QGYA 4XNMB 2X4QA 3RFZC 2I24N 3IRPX 4MJ5B 2ZZUT 3OX8A 4QOKD 3U30B 3NFPB 3O6LH 3MA9H 2X9YA 5DO2C 2WV3A 1YC8A 1A7NL 4Z7VE 1OLZA 5IMOA 3PG2A 2X7LB 1EX0A 3KPQA 1PQZA 3MRLA 1D3CA 4NDMB 1QFHA 2ESVD 4R4BB 3JVGA 2QQQA 4X4YB 3ARQA 4OGYH 1R6VA 4GG6F 5JUEL 3E1F1 1YEJL 3NIFF 4NM8H 4FOMA 3UJTL 1U8QB 4XGZB 4QGTA 3TT3L 3WKMH 1P1ZA 5BOPA 4I0PD 2GCYB 2MQ3A 1F90L 5I1DB 1MQKL 3V5KB 5HHNB 1CXIA 1NC2A 5EUOE 4HBCH 3CDYA 4GH7B 3X3FH 2VLJD 1KTKE 1ACZA 3TZVC 5L2JB 4PJDB 4Y2DB 3QDAA 5I75C 1IGFH 4NNXA 3HAEA 4P4KD 1TITA 4HPOH 3ULUH 1D5ZA 1MCEA 4HJJH 5B4MD 1L7TL 5KBNC 5J57B 3FB8B 4N5ED 5D71L 5BS0B 5E8EA 4UUJA 4LQ1A 4OIIL 1NGZB 5IM7A 4PYHA 4I0PA 2D7OA 3CVIH 3RI5F 3I3BA 4FFWC 3BW9A 1JTTA 1W0YT 3J7HA 1CN4A 3L5XL 4HPYL 3RDTB 3KJ6L 2R0LL 4PJDE 4HK0B 3C5ZC 1DBML 5JPMB 4K07A 1EAJA 3OR6B 3TH4T 2VO5A 3JTTB 1JPST 3NFSH 3NAAH 2YOCA 1YQVL 5J6GA 3T3MF 1UXWA 4XC3L 5J1SC 1G7IB 4MQ7B 2DB8A 5LBSH 1FG9C 2NZIA 4OV6F 4U33A 5MEND 4PRIE 1NAML 4EN3B 5CSGA 1H15A 4WI8A 1SVZA 4LSTH 3LPGA 4PRIA 4JPWL 2OS7A 4JZNB 4F9LA 2F8OA 3OGCB 4Z7OE 3BZFA 2XKUA 3EYUL 4JDVB 3OKOB 2E9IA 3OPZL 5I1AA 1JNHA 3TIEB 1BREA 5BS0A 5D5ME 1FORH 1SBBA 2JKXA 2EH7L 3VXQA 1EIBA 3RJQB 3MRFA 4FFYL 2XKSA 3RGVD 5JW5B 5CCKL 2H32H 1FL3A 4L8BB 4AEIL 1IKFL 2VC2L 3T4YA 2FJFB 1FE8L 4NBYB 5I8OH 3VG0H 1AGEB 5LCVH 4X8XA 4NCC2 4LAJH 4LSRH 5IT2H 3ECBA 4KMLB 4K8RH 1RHHB 1KJ2H 5I66B 2D7MA 1LWRA 3MUGB 5DUPH 2YD3A 2H3NB 3IDJA 4ZNEE 2H26B 1TQCC 1ZE3C 2AV7A 3LEVL 1MLCA 5CJBA 4PGJA 3FFCE 4WFEE 1MFDL 4M5ZL 4R96A 3WN5B 1X5IA 4ENEC 1UH2A 2W0FB 2WBJB 4P5KA 4FQJH 4U05A 4ZOCA 4PRDB 4MSWB 1Q0YH 3IS1X 1LK2B 5IESL 2W9DL 1IMHC 2Q87A 3RX8A 1BMGA 5CJOH 4TOYH 4IRJA 4N0UA 1PKOA 2OZ4A 4R4FH 3SGJA 1YNKL 4ORZC 3RVXC 2FJFA 4U0RB 1MPAL 1A3RH 4BH8A 3QUML 2XPGB 2Z4QA 1MY7A 1F3JA 3BH9B 4R7DB 1TXKA 3QIBD 5GSRA 1T5WA 1D6VH 5DRNB 1JNJA 3QCUL 2AV1A 5I9QC 5J6HA 4S10A 1BF8A 5ANME 1YEKH 5CAYB 1LE9A 3FKUS 1F4XL 3P0YH 3BGFC 5CJXC 5EORL 4FXLA 3WN5A 1D5IL 4KQ3H 2WP3T 2WBJA 4D0CB 1T03L 5HJ3B 1MCRA 3IJYA 3OXRA 4MHHG 1HKLH 3PJSB 3MBEA 1FZMA 2PW2B 1CL7H 4PRBA 3OWEA 4GRLA 5I1EL 1KC5L 3HC4L 4HZAA 4TQEL 3MODL 5EIVA 2XWTA 4QHNA 1FO0H 1MI5B 1U8KB 2MHAA 1YJDL 1G9NC 2ZCLL 3DETD 4KROC 1DVFD 1S8DB 5DHXB 2VAJA 1C5BH 4Y1AD 3BH9A 3DJ9A 3RUGA 2NY0D 4XP9L 4LSPL 5FGCB 4PLJD 5KANI 1YEEH 5B3NA 2CJUH 5GGRA 2XV6B 3KAAA 1BD2A 1K3ZA 4NKIH 3WNOA 4HFWB 3PF2A 5JO5A 1Z9LA 4AIXA 2VDKL 4OD3H 2LABA 3H7BB 4PR5A 3ALXA 5L8JB 4XBEH 5EZIH 2LE9A 2ED7A 2JCCE 3D2UA 3V4UL 3Q1SH 1KCUH 3W0WA 4JY4A 4ETYA 1OTSC 3V5HA 4EDXA 1EJOH 4I18B 2RGSA 4OCRH 4FTVB 4MD0A 1MAMH 4S1SH 1U58A 1X6LA 4XBPB 3T77B 4M6OL 3VFMA 2IQAA 4BM7A 4PJIF 5IEHA 3BJLA 4LPWA 1KLUB 4LPYA 4WNQA 5JW5A 4YHIA 3LEXA 3O3EB 5FIEA 1BVLA 1S7QA 3H0TA 3QJHA 5DTFA 3M1BA 3TCLA 1DE4A 2EDNA 2ZCLH 1FFQA 1KB5B 2WBJC 4OCXL 3C60D 1R3KB 1GGBH 1KXVC 4K2UH 2YD7A 3TYFA 1KCRL 4JO1H 3N0PB 1L0XA 3QEHB 4QTIL 1RZ8B 1P7QA 5DLMH 3KPOB 3WO4B 1X5FA 4LHUB 3BQUD 4Q6IC 1P4IH 1W8NA 4L3CA 2YN5A 1AXTL 2X4NA 4QRRB 3HMXL 1SEQH 3RWCB 3CVHB 2D0HA 1MLBB 4N1EA 3HPLB 4PREA 5DDHB 3TO2B 1ZGLM 3DECA 4P5KB 5MI0B 2IQAB 4HV8B 4M7JH 5I1GL 3KYKL 3RPIA 3T4AA 2VIRB 4Q0XH 3DSFL 4WEMB 1F3DH 2GIYA 1DN2A 3U0TA 4WFED 3V6BR 3RBSA 1HHGB 3KPRA 1AD0B 4K8RC 4BZYA 1JE6A 2VL5B 4PJGE 5BW7C 1XF4B 4HDIA 4XPHL 2YD6A 3ARSA 5GISH 3P9LB 2FCBA 2FIKA 3NIGE 1GZPA 1K4CA 4I3RH 5HVHC 2CMRH 1DP0A 6CGTA 1IC7H 2VITB 4J1UB 4ZUUA 2HJFA 1YEGL 1DDHB 3LQAH 3MFFA 4ONFL 2JJTA 3EDJA 3P4LA 2NLJB 2DAVA 3B8SA 1UADC 3N1MC 4ZOAA 3RTQD 1AD9B 1ED3A 1JJUA 4H8WH 4MDIB 1M6OB 1VPOH 2VDOH 4DKFH 2LTQB 2V6HA 5C92A 1HHJB 2H9GB 3W5MA 3P4NB 5L0QB 4YHML 4PJGB 3EFFB 1MEXL 3CVHL 1HHIA 4TUKH 4P2RA 3I75B 3BHBB 3VXTA 4AIZA 1DQQB 3FB7A 5JW4R 3L3DA 4XP5H 1S5IH 4KZEL 3KPNB 4ZFGL 5GQBA 4GG6A 4Z0BL 5FYLH 4G5ZL 1BFVL 5D8JL 4TSBH 3EZJB 4JGJA 4KZDH 4Z6AT 4XVUC 3VXMB 4YGVB 1A14H 3F7YA 4M1GL 4F7CA 3NCMA 1T89C 1HQ4B 4QHLB 1FO0A 2M1KA 3GSWB 1W72A 4HUNB 5F7WC 3Q5TA 4H0GA 3QFJD 1F4YL 3ULUE 3L9RB 3OKLB 2YBRB 2ZJSH 2X4TA 4PJ5E 4JY6B 4OD1H 5C9JB 3PHSA 4LSRL 4P2RD 4Q2ZA 5IT2L 1XGQB 3U2SA 1JZ7A 1CQYA 4R7NA 5IUSA 4WFGE 5F44A 1FC1A 2EC8A 5FGCE 2BOCA 4YBQD 2ICWA 1LILA 3AAZA 3GRWH 4ALAL 1F5WA 1FGNL 1ZHNA 4FTVA 4K3GA 3SE3C 1ND0B 4JM2A 4XPBH 1JNLL 1IAOA 4BKLB 5FO7A 2FZ3B 4EKXA 5J8OA 1T20A 1FBIH 1F58H 4WUUA 4XXDA 1QACA 2ZSVB 3V4UH 5JHDD 2OBGA 5F1NB 3OJVC 4CJ0A 1FL6B 2V5RA 2EEBA 4LGSB 5JXAL 2DDQL 4NWUL 5KS9E 3EHBD 3VXPB 4RGNB 3QCVL 1OP3K 4OZFG 2HG5A 2MCG1 1DE4B 1J86A 4MX7A 2DLEA 1XT5A 5IFJB 5A2LH 3OG4B 3KYMA 2FL5B 5C8JB 5MI0C 4MS8C 1HINH 2YD2A 4PTUA 3CGTA 4N0CD 1HYSD 3ZHDA 3VMNA 4APQD 3ZKXB 4RMQA 4NGHL 4I0PB 3MCKA 3QT2A 1F8TH 3V6FA 2F8XC 2BCKB 1F2QA 1CDCA 1YYLH 2J5LB 3CSYA 1T89A 1NH6A 5CD5D 2HMID 1HILB 1YUHB 5BO1H 1NLBL 2XKNA 2YS4A 4HUXB 4DFIA 4KK8C 5C3LD 5IMMB 3H9YA 4FG6D 4FTVE 2P48B 2FX9H 4J12A 1EAPB 2F54E 1T1XB 1JF6A 1G7IA 4MQ7A 4G9FB 4O02H 1A3QA 3KWWB 3DUUB 5HYQA 4P23A 3GGWA 3UTPD 2RHEA 4MA1B 2NY3C 4WFHE 1FYTA 3B9AA 3PDOA 2W0LA 3AXLA 4FQPA 4F2MA 5L7XL 1D9KD 3HC3L 1A4JA 4U6HA 3S37L 3QQ4B 3TA3D 1IGML 5I1IH 2EYTB 3UTTE 2VZ1A 2X7LA 5HI4C 3V6FB 2VE6A 1NGQL 1ZHBB 2R8SH 1R3JA 2XWBB 5F7EH 5F1IB 2DBLL 1YUHA 1ORQA 1T7XA 5INDB 3K80A 2IQ9H 4Z7WF 5I1DA 1WFNA 1RQ5A 3OL2A 2FRGP 4X0KB 3QEUA 1DSFL 5E2UL 4WI9A 2P24B 2VDML 5E94B 1TQBC 4L3EB 3SGJC 3WLWD 4UOJA 2FLBT 3KXFD 4KY1L 2ICES 1MFDH 3SPVB 1YY9C 1JGVL 2FECI 4YPGB 4XNUH 3FFDA 3PQYE 2ADJA 2DTSA 2F54A 3FONA 4PJAF 1D5BB 5T3ZD 4P2QD 3AXLB 4JPKH 2NY1B 2YSSA 1XCTA 2XXCB 3IDGA 3VXUD 3L3KA 2FBJL 4NC2B 5GGVY 4HS6B 3MROB 1P9MA 5AUMB 3OKDA 3BVNA 1MJJA 4K8RL 2YPLB 5T5NG 5E4EC 5CJXA 4XCCL 2CLVA 3HZMA 1T66C 3MMEB 1JHLL 1I1AC 1K8IA 1UJ3A 2OL3H 3MBEC 4U1IA 5KVGH 1FV1B 1NEZG 5D6CA 1F3JB 2A6DB 4HH9B 3SJVD 3K4DA 1T3FA 3W9DB 4JAMA 1KG0A 2ZG1A 2WZPD 5F8QC 4I0KA 4HC1H 1DCLA 4JE4B 1EUUA 1FFPB 1MJ8H 5ICXA 3MRNB 3JBG7 4JZNA 3HMXA 4LVEA 5JTWA 2EE9A 1HYSC 3I6KA 1DLHB 4HIJA 3IGAA 1BVKA 5D1ZD 5F7MC 4KK6D 5IB1A 3DROB 3QAZB 1GRWA 5M95B 5E2JA 3GJFK 3ARRA 4H88H 1F11A 3B3IB 2MJWA 3TEUA 4U1IB 4AEHL 1CS6A 1HEZA 4DW2L 3QNZA 2DQFA 2Y7QA 2K3TA 3Q6FA 1AP2A 1UZ8A 5F96L 1WVZA 5GRZA 1BOYA 1E4XH 4LAQL 2XA8H 5F7UA 1UCTA 3D9AL 2G5BA 3EO1B 3FT4B 4X4MA 1KNOB 1E4XL 4U1KB 3G6DL 3BPLC 4XNZB 2X9WA 4C56E 1Q9WA 5E56A 2MCPL 3N9GL 2BVYA 1MH5B 4PGCB 3ARFB 4NO3B 4DZ8B 5HVFB 5IF0A 2GK0A 1U8OA 1MCJA 4XAWL 4LCWB 1SBSH 3KGRA 3MYJB 4PJBB 1ETZA 4OFDA 4D0DA 3T2OA 3HN3A 2EDOA 4HHAA 5T1LB 1AGFA 2ZNWA 1EHLL 5B21A 1MCPL 2HYMA 5ALBH 2Q6WA 1KIQA 3CFJA 2EIDA 3O45B 1H3PH 4MJIA 2JB5H 4QRTA 1UM4L 5GZNC 4GRLD 1KJVB 3QDHA 1QO3B 3PWPD 2DQEH 3BP6A 3TPUB 4J4PD 5I1JH 3KPTA 4O2EA 3SDAB 4LLMA 1NFDE 3GMOA 4Y7MA 2WINA 5HVGB 5IBUB 1QFUH 4WCYH 3EYQD 1FHGA 5A40E 1OQXA 4ODXB 5EBMB 3VXMD 4S1RH 4FFZL 3VRIB 3UZEA 2RBLA 1YNKH 2IPKB 1CLOL 5DMGD 1I3GL 4OLWH 4X5WA 5DJ0A 1WBZA 3BZFB 3F12B 3QWRD 3RUGF 1U91A 2VLKA 3K2UL 1XCTB 4WY7H 3BI9X 2B4CC 3MRGA 4NQXB 3LQZA 4MAUH 2C4FT 1SVCP 1CE1L 3NCCB 4GXUN 4O2CA 4QOKB 5FK9A 3U7WL 4LGRB 2YPLA 3UTTD 5I19H 2Z0BA 2WWMC 3EDFA 4H25A 4OZIF 3BP6B 3TPUA 4P59L 1QEWB 3VH8G 4JFFD 2PO6C 3QWOB 1BQHA 1JV5B 1E4JA 4FQLH 4O58H 2PW1A 4ZUSB 4LVHC 1BM3H 1HI6A 1T21B 4M8QA 5FF6B 2A77L 4FP8L 1SY6H 5HSFA 4HKXB 3EO0B 4QXTB 3FAWA 3Q3GA 2IC2A 1GCFA 4WV1A 5D9SB 3DYMA 2IPKA 3BYYA 3MJ7A 3MRNA 4RAVA 4QXGH 4KPHH 2DQJL 5GGSA 4K94C 2ZPKH 3RWEB 3QEGH 1KYOK 3EOAB 3O9WA 1WQVT 5C0JA 1NMAH 5DHVH 4JFYA 5C2UB 4IS6B 4S1DD 3HRZA 4KK8D 1OTUC 4NQXA 4FZ8L 5DQDH 2YEZA 3BZEB 4PRNB 1FPTH 4WNQB 5EOTA 4HWBL 1SEBB 2QTEA 3ET9F 4Y5VA 1LO4L 2JJSC 3LKNA 1HQ4A 2H32A 1NMCB 4Y16D 1N5YH 4Y4FA 4PB0L 1RZKL 5I73B 1EHLH 2PW1B 4K71B 2B0SL 4L3EE 5EIQA 2UWEE 3L3JB 2CDEA 3J8F7 5DGRA 4YX2L 5EOCJ 1BJ1H 3CX5K 1W0VB 2BRRH 2Q3AA 4OGAC 1NFDA 3STLA 2V5SA 4DGYL 3CDGB 1FFOB 2AGJH 4GKNA 1ADQL 1KTLB 2APTA 3T8XB 4FMKA 4MAYB 2VZOA 1JK8B 3GI9L 4HD9A 1F4AA 4J8RA 4JM4L 1DQLL 2GK0B 2G9HB 3X13A 4OLVL 4QNPE 5TQ2L 1XF1A 4KRPB 5D7LA 2Z92B 3V2AR 1AD0A 4D0DB 1KSRA 4HJGB 1FH5L 1U8KA 3WCYA 5A16A 4KHTL 3OKYA 2P44B 3LKOB 3P30L 2MWCA 2Q6WB 1L9NA 3BGMA 1J1OL 3CPLB 3UPCA 4Y4FB 5CEZE 3HE7B 4O9HH 1EFXB 3W9EB 5HGDA 4C56A 3I50H 5INCA 1QR4A 4RMTA 3DV4A 3QIWA 3G5XB 4JQVC 5J9PB 1N7MH 4OLYL 5EBLB 1N26A 1F6AB 4LCWE 4HWNA 4NM4H 4L8SC 4NHCH 5B22A 1FFOA 3O6FB 4GKNB 2YXFA 4EN3D 5D7SL 1MCQA 5GS0D 4E0RA 2W65B 3GSVB 3KR3L 3RWIA 4HQQL 5SX5K 3SDDD 3DV6A 1A21A 1G9NH 5JXAH 3LS5L 2DM3A 5IMOB 1J0JA 4ZS6D 1AQKL 3U0PB 4P23C 2D31B 3U1SL 3FO2B 4Q9RH 3UO1L 3MA7A 1HXMB 2NY4D 5ETUA 5D7LB 2IPTL 2KKQA 5DA4A 4FFZH 2PETA 4HC1A 4HJGA 5HHMB 5SX4H 2AJ3A 5LGHH 4D9QE 2VLKB 3RIAK 4ZMAT 5IQ9A 4S11A 1T1WB 3RL1A 5DQ9A 1G0YR 1JGUH 3CFEA 5FECA 4GQ9L 3QCVH 3QXAB 3JVGC 5FXCH 3QA3B 4PGEB 1N0XH 1Q9OB 3ZDXE 1P4BL 3OTTA 5KSAD 4IMLB 4KKAD 5C07A 4HJ0C 1CR9H 5HYQB 1FYHB 3RI5K 3TYFB 1IGIH 1L0YA 3PDOB 2VXVL 2DYPB 5H37H 3AREA 1OM3H 2EYSA 2B4CH 5I74B 4DQOH 3HNVH 5T3ZE 1ACYH 4XCNB 4JFEE 4RX4D 3B6SB 4X7FC 1HSAA 1WCBA 1GSMA 3ULVE 3RDTA 2HFGL 3MGOA 3H9SB 3KXFE 1UYWL 3R0MA 4OZIE 2ZUVA 5F3HB 2VXQL 5DMIL 1T1WA 2MKLC 1AHWC 2QV2A 2XQBL 5IHUL 4WHDA 2NY5C 5KOMC 4JRYE 5E08L 2BY2A 2DWDA 1XF4A 1CF8L 3OF6A 2QADC 3SE8H 4S0TD 3Q6GH 1MFBL 3BX7C 3DTXA 1LEGB 3QZWG 1JRHH 1GZPB 1MCKA 4MJ5A 3EZ8A 2NXYC 4K3JL 4IEFB 3U9PL 4YJZL 2VITA 4Z5RB 3Q5YA 2LU4A 5K9OA 3G08B 1YYML 1QG3A 3MROA 4HS6A 3WIFA 4K94L 4YBQC 5DFVD 3QIBC 4ZAKD 3EJJX 5CMAB 5C08E 1QQDA 5BZWA 1ONQA 3RGVB 3S4SA 1C12A 1LEKA 4IRZL 4PV8A 1JK8A 1X4XA 4FQHA 1N5YL 1VEPA 3PV6B 4YFLF 5C2BH 2FX9L 2NY1D 4IRZH 1EEZB 3CAFA 4OI8A 3LEYL 1XZ0B 4M3JA 5IMMA 1FFRA 4MA7H 1CU4H 1RJZA 3SDYL 2JIXD 3TLRA 4DKAA 5MHSE 5EULV 1RK0B 3JXAA 3HRPA 3BKJH 2I25N 1A6VL 4RWYH 4HIHB 5DQDL 1GZQA 2W59A 4LASL 4P2CG 1N4XH 1V7ML 4GMTH 3QDMB 5GZOD 5DJ2B 2QHRL 4XP4L 4EZMA 5JIIA 4P3DA 5EUOB 4XPHH 4U3HA 1UWEH 2V2XA 1LD9B 3K4AA 3QUMH 3HTLX 5E00A 1CT8B 4TULL 5C7XL 1FYTD 3B9VA 2NY4C 5CD3B 2OTWA 3GIZL 4WU5A 1C12B 3TPKA 3K74B 4PP1D 5CS7A 4OB5H 4DOHB 3T04D 1S3KH 3RJDA 4XBEL 3P9MB 2BDNL 4I4WA 1E28B 1VFUA 5JPMA 1QPXA 3X3GL 5K9QI 5ETUB 4LMQI 1UXWB 2AV1B 4YH6A 1NBYA 4KVCH 4FXGA 3DXAE 4NQED 5IBTH 1KCRH 2HLFD 3TBSA 5J6HB 3HZYB 4G6KL 3EFDH 3O3AA 5T1DH 4RDQG 4U1KA 4RFOL 4Z7QE 1OT1A 1CCZA 3D0VA 1ZWIA 2WUBH 2V2XB 4XZUA 1VENA 4GUPB 2HWZH 1ZLVH 2F5AL 5CEXB 4RIRA 4UT9H 1YNTB 3OHXB 4NQDA 3K1KC 3HHRB 4XPAL 1BFOA 2XFXB 1UZ6E 3WFCH 1U3YA 3WFDH 1W0WB 3QJFB 2P47B 2VUYA 5EBGA 5FEBA 4U6XA 1A7BA 4Z18A 3V52H 3QG7H 1H3UA 4CVXA 4ODWA 2DKUA 4J3SA 1DVFC 4XCYB 3W9DA 2R1YA 1RJYA 4G80B 4Q9BA 4R4BA 3PHOA 3AUVA 5IB5B 1QHOA 3LS5H 4NQUA 3HNSL 5I1KH 1WZ1L 3N1GC 2J88H 4M1DH 2MQCA 2XZAL 1NFDF 4JANA 5F9AC 1EHAA 5H2BA 4POUB 1YY9D 4ERSH 1W8OA 3MXWL 1DLHA 4G9FA 2VH5H 1H8NA 3RL2B 1G1CA 1VFMA 4IRJD 3SBWC 4HG4K 2E7CA 2WWKO 2DQCL 4Z9KB 2V2WB 2HFEA 1SJEB 4MZ2A 1NFKA 3P30H 4ZXBC 4NYLB 4WHCA 3ZE2F 3SN6N 1LK3H 3S37X 5IOPB 4W4OC 3GSRA 3VWJA 4WV1C 3C5ZA 2Z31D 2ZKHL 3RVXD 2W9EL 2IH1A 3MXWH 3PGCA 2PXYC 4DVRL 2AJXH 5DO2D 4LSUH 1KTRL 2DN7A 5CSBA 1I85A 3TCLB 1RUQH 5C0AB 1AC0A 2FNBA 2P5ED 5EN2A 1D6EA 4QO1A 2FD6H 4M7LH 4OLZL 4EXKA 1OTSD 2JJSA 3CFKA 5FB8B 1Q0YL 4GAGH 3O11B 2GITB 5IBUG 4L3EA 2GSIB 3TN0C 5CSZA 5EC1A 1FGNH 4OF3A 1FIGL 1U3ZA 4KJPD 4L3CB 3CFDB 2VJXA 5FDWB 1UWGL 2F54B 4P3CH 1FDLH 4TUJB 4X80H 4HX1B 3W11C 3O9WB 1LNUA 4MNGB 3QUXC 2FBOJ 5E8PA 3HRZB 3EDEA 3GEWB 1X5ZA 3MA9L 7FABH 2CDGA 3E6FA 3BPOC 3RUGB 4YXKH 5GGRB 4JPWH 3RWGB 3RPKA 3QUMB 3TP4A 3NZ8B 5BCAA 1TENA 1QP1A 2DJUA 4FQ1H 1NGXA 1JHLH 1YEIL 4JO2H 4M6OH 1A14L 4CU6A 1XGYH 2W07A 4OJFL 1P5UA 4MAUL 4JFHE 4U1NA 5JZ7C 1NBYB 3RIAF 1KJ2L 4F7PB 2Q76B 5DD3L 5E7BA 4I2XE 5TPWL 1INDH 1CK0H 3V5HB 1QR1A 2F58L 4PRPD 3JV6A 3L3HA 2VB5A 4IIQC 4TUKL 1EXUA 2R39A 4X9IA 3TWCL 2YN3A 2D7PA 5CEZL 4XWGL 5CJ5A 4CAGA 1G9EA 5TDPB 3GMRB 5DUBB 5A2IH 3MNZA 1U8IA 4XC3H 4HIJB 5JHDE 2I9LA 1HDMB 3E6FB 3DROA 1OSPL 3SDAD 3LIZH 2XN9B 3BUYB 1YNTA 4M62L 4NO2B 3I9GH 1I85C 5E0QA 2ZOLB 1J9CT 3H0TB 3QJFA 3NGBC 1T1YB 3K8KA 2WIIB 2GJ6E 1J8HD 3X12A 2J2ZA 4P3WA 4H1LA 4RGOH 1TZHA 5LQBH 1S78C 4PRPA 3WN5C 3IDIB 3QXWA 2XNAB 4XVTL 4PJ7A 2XY2A 4HKXA 3QG6A 4I77L 5T33L 3S34H 3WHXB 3TVMA 1ZLUK 1QR1B 4MQXC 3L7FB 1OD7A 3HI1A 4M7JL 4XNXL 4R2GD 3WD5L 3WXVL 4BSWB 5I1GH 1HN1A 4AMKH 4PD4J 2WM0A 5HJ3A 3ZE1F 5GGVL 1J87A 3LPWA 1MQ8A 1BFVH 2C3VB 3N9GH 5D8JH 4O02L 3U0WH 5FUOL 1Q38A 4KHTH 1AY1H 3EYVA 1CLZH 2FX8H 5IROA 4HCRH 3QI9B 3GM8A 2UWEB 4JGUA 4KFZC 5IOPA 2BVOA 4PPTA 3EUUA 2EDXA 3BDXA 3FO1A 1WWAX 3VGAB 1ZOXA 4QHUA 5T3XD 2NX5E 4PRPB 1ZTXH 5LXGL 1SBSL 1SYVB 5IJVA 2FGZA 3O6KL 4ORGB 3RDTC 4TOYL 3VXNB 1J1OH 3DGCR 1G0XA 4NT6B 3EHBC 3PWPB 3QPQC 1BPVA 4JQIL 1ZVYA 3MLSH 5C0ND 4UOW0 5C8JA 2NY0B 3PWUB 3RWDB 3BAEH 1RZFH 4MMZC 3QXDB 1OGTA 3FQWA 1MWAL 5MHSD 2XA8L 5CSZB 5T1LD 1U3JA 3NTCL 3TZVB 2J88L 2DS4A 1LO4H 4NQSA 4NFDA 1LE5A 3JWDH 2BHZA 2BMKB 5GS0H 2W0KA 3F7QA 1IGIL 1PBYA 2K7PA 3WUWB 3MC0A 2L7UA 3QIBA 2I27N 4H88L 5EOQL 3S5LG 4HMCA 3CPLA 3UJIH 4RFNC 4UILH 2EEAA 2G60L 1MCHA 4D0BA 4W4NA 1J5OH 2ENSA 4WWID 5E03A 5EBLA 5AYUH 4QF1A 5D72H 1YPZF 5DD0H 3T65B 2NMSA 1FYTB 4NBZB 1R3HA 2XQBH 3C8KB 3Q2CA 4LL9A 1W2KT 5C09E 4M8QB 3O9WC 4BFBD 2IPTH 4ELKA 4GRWE 2NY5L 2V9TA 1YEHL 5IBTL 3K8MA 4O00A 3JV6B 2C5DC 2X4SB 1VKXB 2YRPA 2GYSA 3HPLA 2B4CL 4JRYA 4PREB 1HH9A 3TO2A 4AEEA 2GAZB 3OAZH 4P2OD 1A6WH 4P9HH 3G04A 1EEZA 3NH7L 4IMKC 5IFAH 4GKZB 1GOFA 5B38G 1SY6L 1RIVH 4PJ9C 2XN9A 4BQ9A 3FMGH 2C3HA 1D5XB 4KRLB 2CPCA 2DQUL 1CR9L 43C9A 4XNQA 1YPZE 4OLWL 4FQXD 4GOSA 1MFEH 3DRTB 1ZLUH 4EN3A 1T1YA 2AVGA 4LLQB 4ZAKB 2HFFB 2AK1L 2FIKB 4GRWB 4J3OC 2R8SL 4N9OB 2AJXL 4K7FB 1EEQA 3RGVC 1IJ9A 4ONHB 1KB9K 3EYSH 3JUYA 3UDWC 3MFFB 2W9EH 5ID1A 1ZV5A 1RU9H 5E00B 4XX1E 2DF3A 4PJ7B 3BEWA 3VXQB 1I1FB 1DBBH 5IW1A 1AFVL 5E99H 4G8IA 3BGFB 3S36H 4XCNA 4XRCA 2N56A 3CDGA 1T0NB 1ZT4B 4ONGL 4PLKD 1HHJA 3M8OL 3RWFB 3MTRA 1Q72H 1NAKL 4MNGE 3HLAA 3S3JA 2J8UA 5IBLD 5HYJA 4XVJL 4I2XB 1YEFH 4M5ZH 1MFNA 3MLVH 4I4WB 4P2QB 4PP2A 3T0EC 3HC0B 4U1GB 4NQCE 5I66A 5KVFL 1QLEH 3DUSA 1XF2A 1IKNC 3QUZB 1DVFA 1I7RA 4XNQB 3VFPB 1FNHA 1LGVA 1JYNA 1TJIH 4RQQA 4XTRD 1IC5H 1EEUA 1UWXH 3SQBA 1Y6KR 4LVHB 5ESQB 1NAKH 1JF5A 5HHVH 4MJ2A 1A6ZB 5E4IA 1F3DJ 1J8HA 2ZUXA 3RZWA 5DRXB 1EPFA 1JHTA 2RR3A 5KVEL 5EO1A 2XWJA 2F53E 2X4RB 3SKMA 3O3DA 4XHJC 4JN1L 5ISZD 1JN6A 2NX5D 1J1PL 2EDHA 1BFSA 5IWLA 3MRBB 1EZVY 2IMMA 3QEQA 3U2SB 4WO4B 1FZJA 1IEAA 3JSSA 4KPHL 2OR9L 4DZBB 2ICWJ 1G9MH 4Z7UE 3GI9H 3RIFF 3JTTA 5D1XD 3MA7B 2BSTA 3SHSA 1RJZB 5ISZB 1CZ8H 1NAMH 1AE6H 3GIVB 4JHBA 1P7HL 1I75A 5T5FH 2ARJA 1IEHA 1J0KA 4F15B 2Y07L 2AJ3B 3VWJC 4DQOL 5C0RH 4WTWA 4IRJC 1LE9B 1DUZA 2EYRB 3TZVD 5EO0A 1R5IB 2PYEB 5IKCA 1U3HB 2UV3A 5IMLB 1KJMA 3KHOA 3TA3A 4D0CA 1E4XI 3W81A 4UQ3B 3GSOA 3AGVA 2XZCL 3QHFL 3H9SD 3RVTD 2DICA 2CUMA 3SGDI 2WBKA 2F19H 3TN0A 2ZG2A 1S9YB 3QYCA 3O4OB 1RUPL 1MVUB 3VFNB 4GQ9H 2YK1H 1BFTA 1CG9B 5C0CA 3NIDF 4I1NB 3GSRB 2QBWA 1A9EA 4WI7A 3OAYK 4HJJL 1FDLL 3KPLA 3DX8B 2H41A 5IHZB 1AHWA 5EG6C 1YDPA 4C55A 4N8VA 2PYEE 3KPPB 4RCAA 4MLSA 3R06B 1X6NA 1SMOA 1A22B 3U1SH 1QFUL 5HHVL 3WEXA 3MZGB 1FFPA 1I7ZA 1ZA3B 1V3LA 5LG1A 2W1NA 4YXKL 3F8UB 5DHVB 1G9NL 5HHQA 4V1DD 2DQGL 3BN3B 3IFNL 1UG9A 1CGSH 2A1WH 3CFKB 5D2LE 4LSVH 2MTPA 2ATPB 4GXVL 1KC5H 2GSIA 1FVEB 4JRXD 1MCDA 1PG7W 5D7JB 1VFBA 5EPMB 3D2UB 2PTUA 4DVRH 2JB5L 3DRTA 1GOGA 2PO6A 4JY4B 2ITDB 4ELMB 4RISL 3GKWL 4YDJA 4YHPA 5D96B 4KY1H 5GXBB 2X1WL 3WS6A 2J5LC 3QQ3A 4CMHB 4J4PC 5EOCH 5SWQB 3WIFB 2DQFB 3MRJA 4Q97A 3FO9B 4O5LL 5MEOA 3G6JF 1S9VB 5ITFA 1FYTE 1T0MB 4P2RE 2Y5TA 4BSJA 1DBJH 4Z8FH 4M48H 4XVSH 4GRWH 1LO5A 3HUJB 1I8KA 3MRMB 3KPPA 1N5AB 3JWNC 4KRPC 1ZT7B 4ZS7H 3IYLW 1DQJA 4NRYB 5KZCB 4M9OA 3UBXG 4XX1G 1IAIL 5D1XC 3LV3B 3LRGA 3KYKH 4CDGC 3FN3A 4PYGA 4AENA 3KPOA 2ZCHL 3VCLB 2I26N 1AXIB 3AU1A 4PRBB 2ITDA 4IRSC 2DLIA 5DC9B 2VLLB 1YY8A 3U79A 3NA4A 1TIUA 4RAVB 3X3FL 4AEHH 3HE6D 4YHPB 3CUPA 4JRWA 2MHAB 1U93B 1H3PL 2YSSB 3IDGB 3FN9A 1JHTB 1J0HA 1HSBB 3ZE0E 2I9LB 4PV9B 1V8HA 2WAHA 2YD1A 4KXZI 2CK0H 3DVNB 4PJIA 1HHGA 4JDTL 4WU5B 2CLVB 2VAAB 1FL3B 4OLXL 1OSZB 1NBVL 5BRZB 1CBVH 5FYKU 2CRIA 1KIRB 2VC2H 3NIDE 1T2QL 3DI3B 4WFFE 1T3FB 4HUVA 4WUUE 1P4IL 1WUNT 3GNML 3V4VL 1FZKB 1U9KA 2FYYA 3C08H 4Y4HA 4CVWA 3RQ3A 1NFDB 3STLB 4LDOB 4W6YB 15C8L 3VW3H 5GS3A 1U8JB 2GTZA 4R96B 2VXQH 1JWMA 3KVQA 2HJLB 2KZ1B 3W2DH 1G6RL 5HYSA 4N0FA 4PG9A 2WP3O 4XCCH 2F58H 2C1PA 1XEDA 5JW4M 4UIKL 3TFKC 3CK0L 3KR3H 2O26U 3EKCA 1M7IB 4XCFL 5T1DL 4WWKA 4U7KA 4X9GA 3L5IA 4Z7UF 1NUGA 4EJ1C 3LB6C 4NO0A 4U1SB 2L7JA 3F65A 3EO9L 1BWMA 4JFPA 1T83C 5FGRA 2MSPA 1INEL 1EFXA 2XG5A 3MV9A 5D7JC 1KXTB 1YDPB 1K85A 5HXMA 4WHTA 1C5BL 3IDUA 3RKDD 4XWOD 4N9GA 5K93A 1G9ML 1XF5A 4LVOB 5D9SA 2ICWI 3QSKB 4X6EB 4FFVC 1LVEA 1U8JA 2GTZB 5E1HB 1F00I 4O4YH 5GJSL 4N5UA 5AD0A 4Q2ZB 3ZTNH 3LEYH 5H2BB 2R4SL 5AYUL 1QYGL 1RFDL 1QTYT 3MNZB 3V4VH 4MZ3A 6FABH 1VFBB 3DUHA 2J8HA 4HEPG 1FVCA 1JPFA 3WDHA 2LTQC 5L9DL 1HHHA 3EJZD 3O81A 1M7IA 3HZVA 2J6EH 3TO4B 1RJCA 3WUWA 2ESVA 1AGFB 4XH2A 3JTSB 1CGXA 3FZUC 2IBZY 4OD1L 2EDWA 3HKFA 3KDMA 3CFJB 3O45A 4X6DB 2Y5TB 2WIMA 5T33H 1FL6A 3BZDA 3MNWB 4JZOB 3C2AL 1YNLL 4ZUWA 2EXWD 4OD2A 1B0GA 4B50A 1NGYA 4IOFC 4QF1B 5ANMA 3PL6C 3WFEH 3SGDH 4TSBL 1X5AA 4OFPA 1KJ2A 1UYWH 3LV3A 3LMJH 3HCVA 3KNBB 1QSFA 1TETH 3G6DH 3SCMB 3BKCL 4NQVB 2FJHA 2X1QA 2AJZA 4OIBA 4BJLA 3CXDL 1B6DA 1IGJA 4RFNB 4KI5C 1MCWM 4AIOA 3H8NA 4QRQA 1PJ9A 5ID0B 3T77A 1CGUA 3MGOB 3VXUA 1KIUA 4GXVH 5T5NF 3D69A 2BHUA 5DMKA 3SOBL 1Z0MA 4YDLC 3B5GA 5D7IB 2CR6A 5HHNA 4ZTOH 1KELH 4B0MM 1MRFH 3Q5OA 4H25B 1FL5A 3GSNH 4L5FH 4ZOEA 5KSAA 4JFOA 3WXWL 1PY9A 4LLQA 2LU7A 5IB4B 3F62A 1HNFA 3GGWB 3RVWD 4XPGL 3EOBA 4R3SB 2MKWA 4Z5RA 1RV6X 4Z78B 1I4FB 4JJ5B 3RA7H 5C09D 1A6UL 4Q74A 4XPAH 1AI1L 3DGGA 4NQVA 3TZVA 5IW1B 4NNYB 4DN3L 3AMLA 5CMAA 4TSAH 2BOCB 2VMFA 1K8DB 2FJGA 3C5JB 3RWCA 1BJ8A 1R3JB 2XWBA 4R6UA 1A7PL 4WW2A 2P42B 2HJLA 3FRPG 4WW1B 4PJCA 5DUBA 5IWLC 2ENYA 3EYOA 4M03A 5I18L 2CO6B 3P4OB 3F7VB 4ZO7A 3TF7C 4YEEA 1L4IA 5D7LE 3IJHA 3DMMA 3HZKA 3MRRA 1QYGH 4PRNA 1ZLSL 1XF2B 4LVOC 4NM4L 1GPOH 2YA0A 4HUUB 1M71A 5HHME 2C1OB 1TJHL 4KQ4H 3RUGE 4G8EB 4RQQB 4V2CB 5DFVC 1UVQA 2FBJH 5IFJA 3ZT7A 1Z2KA 2A0LD 4HIIA 1EVUA 3MLWL 3CIQA 1RIHH 2OMBA 3LKPB 4ZUUB 3B4NA 3SJVB 3EDKA 1D9KB 3IDIA 1RD6A 5DD1H 2BVTA 4P5TA 1VACA 4QRPB 1RI8A 1KLGB 4PBVC 1B88A 1WSST 4XPTH 2VR5A 3S6CA 1UC6A 1XGYL 4P4KB 4ZD3L 4NKIL 3TA3C 3P0VL 1E0OB 5IROC 1N7ML 4NQTA 1RY7B 4R4NC 4G7VL 1G7HA 3CH8A 1YEEL 4CL7A 1MCIA 2G9HA 4FRWA 4EEEA 5F3HA 4HS3B 3V0WL 3UJJL 3L6FA 3TCXA 1P9MC 2VUOA 3UROR 1C5CH 4G7YL 2Z92A 3LMJL 4JFEB 5IB3B 2ZG3A 2ZUUA 4X6CE 1XGUA 5JQHC 2IAMD 3B9EA 2ADGB 3RWJA 4X9FA 1OARH 2FSEA 5MENE 4X7CC 2CK0L 1U8NA 1QSFD 3O3AB 1BZ9A 3DUUA 3NPSC 1MIEH 1RUMH 3D0VB 2IALB 4JFDE 1MCOL 3IU3A 5GRYA 1U36A 2GQHA 4BH7B 1SYVA 4WEBL 4XVJH 3GSOB 3IAPA 5E24E 4LLDB 4UNUA 4H1LH 3RDTD 3S3SA 2YRZA 2EIZB 4GW1A 4HWBH 4NNPL 4IJ3C 1ZT4A 4YUEL 4OLZH 4JDZA 5EO9A 4XNZC 3RWDA 2IAMA 4WDIB 1I7UB 2AI0H 2J8UB 4P48A 3L5WA 4JY5L 1E6OH 1INQB 1E4KC 2W60B 1VGEL 5I16A 5GRWA 2EDYA 1GGIH 4UT7H 2R1YB 1Z5LA 2AABL 2FDBP 2CH8A 3DUSB 1R5VA 1RFDH 4BSVB 1NJ9A 1WZLA 1RK1B 1ZHNB 3MUY1 3WFBH 1CWVA 2FSEB 4HJ0D 1CDJA 3EO1A 2IFGA 3VXRB 2CKBB 4LK4A 4I8DA 4ODVL 2D03L 3MREA 2VLJB 2F53B 5DQ9B 4EIZC 4TUOA 5E8DH 4GAJL 2N4IA 4PJ8D 3BSZL 4LPTA 3MCLH 1A6WL 3LIZL 4ZD3H 1XGRB 3MV7E 3BVNB 4OT1L 3LPFA 4Z95L 1NDMA 3X3GH 3K4ZA 4D2NA 2HG5B 5JHLH 2A2QT 2CRMA 2R29H 3UYRH 3G9AB 2R23A 3GSNA 4OZFA 2XWTB 1C1EH 4C83B 4PTUB 4YFEA 4K7PY 3F5WA 4X6DF 3UPAA 4MCZA 4G6FD 2C26A 1XR8A 5GS0C 1BQSA 1A1OB 3MV8E 2X1OA 1BD2E 4ELKB 1KB9J 3QWRA 3TBWB 4MJIB 4ODBD 4QRTB 1I8IB 1FJ1A 1VDGA 2IANA 3CSYB 4PJCF 3O41B 1CFNB 1B90A 3SDCD 4JHZA 1UWEL 2YKLH 1M4KA 4YWGH 3VXSD 5D1ZC 5SX4I 5JO5B 2B1AL 5LGHL 2QADD 1NANH 2FR4B 5FO9A 4PJDA 4Y2DA 4OFYA 5CZXD 1T2QH 3VCLA 2EZ0C 5F7FA 4NNXB 3ZKQD 5C70A 1BD2D 3PHQB 5C6PB 4CJ1A 2WSKA 1NBZA 2RIKA 3WE6B 5FM4A 3GFUA 3SJVA 3RAJH 3VFMB 2NXZD 1S7RB 1RZJH 2XACC 4NO5A 1TDQA 1AP2B 4LLVB 2FGWL 4KZDL 1KLUA 4NOFA 4PLOB 3C9NA 5TF0A 4E9LA 5EUKB 1LEKB 5AG8A 5GGTL 3IU4H 1CGWA 1NFIB 4GRMA 2ZSWB 5EORH 2A73A 2QR0B 3DVFA 1UM6H 3U4EA 4DTGH 3QH3B 3QI9C 1KENL 2FEDD 2UZIH 4P2QA 3FB5B 4PJFA 2ZCHH 4M8VA 4X0KA 3SE8L 3NTCH 4PUBL 1MCPH 5CFHA 3MLXH 1O5DT 5IF0B 4DZ8A 4U1MB 5DXWA 2FHCA 1U8OB 2QL1A 5KJRL 1I8LC 4LU5H 1ZGLB 4Y4HB 3Q3GB 3BN9C 1ZLWH 2ZOKA 4MXQC 1BZ9B 4Y8AA 3MJ7B 1CLZL 2R0LH 4KDTC 5IVOA 1A3RL 1SJEA 1NBZB 3FFCA 4ZS7L 1UM6L 4MNHB 4L4TA 4OCSL 1AO7E 2YC1B 4LCUB 4ZO9A 4JVPA 4LLDA 3FO9A 4XXCA 3C6LA 3C5ZB 4XAKD 2Q1EA 5FM8A 4PJXA 4KQ4L 2R0ZL 4JFFB 1HCFX 3WKNA 3BXNB 4P46B 2E7MA 1T6WA 3K3QA 2VXSH 2N7AA 2DQHH 5KJRH 3O4LE 5EO9B 4OKVA 5D1ZA 1NFIA 2X09A 4GRMB 4YE4H 2UUDH 1CD8A 3MPCA 3SDDB 3IKCB 4PJ9B 4MCYB 4HLZH 3O8XA 4PRHA 3FFCD 2Q20A 3GIVA 3WNKA 3TC9A 2EKJA 1K3IA 1F2XK 2PO6D 3EW3B 1X5HA 3QG6B 4PG2C 1W0VA 4UDUB 4YDLB 4LNVA 3FL7A 5TE4L 3I9GL 4NWTH 1OD9A 4AEIH 1CDUA 3PIQB 2PXYB 3OG6B 2YKLL 1MFBH 4L4TB 4YWGL 4JZJC 3VG9B 4Y4FC 1QFPA 5KW9L 4FFYH 3HG1B 3P11H 4IBLT 3LQZB 3DX9A 1FVCB 1JPFB 1U3HD 5E08H 4WUKH 5E2WH 5L2KE 5LQBL 5L9DH 2F53D 3DVNA 2AQ3A 1LK2A 1G9MC 4FP8H 4G43B 2A83B 2GW5A 2WWKT 2XXMB 5JXEC 5DD3H 3QI9A 3B3IA 3QUMA 4QRSA 3S36L 3F7YB 4YHZH 5HGHA 2CDFB 1A9EB 2CUHA 2R2HB 3QNZB 5D2NB 2B5IC 3PWJB 4PJHA 3WNLA 2BXYA 2CIKA 1KIPA 2BHYA 3N06B 2AK4A 4GBXD 1ZKAA 2BNQB 3NCFB 5GGRY 4HKBB 1JGVH 2HH0L 4EI6B 3LRSB 3E8UL 5E6IC 4AJ0A 1B2WH 4G6AD 4N0UE 5GIRB 1OM3L 4JREB 2IGFL 4KWUA 2OJEA 1MRDL 4KJWD 4CVZA 2D4FA 3VJ6B 5ICZB 1LO0L 3PWPA 3O6FA 4ZQKA 3RHWF 1IGYA 2HT4C 2NY7L 3JV5A 2BSRA 2JTDA 3CLEH 2FB4H 3BQUC 4TNWF 2LFGA 3WS3A 1OGTB 3WS6C 4PGCA 2FR4A 5LCVL 4JFYB 1ODAA 3LN4B 1Q9LB 1WICA 1VEOA 3DX9B 5ECJE 2B7DT 1PX3A 3BMVA 3V6OA 3ROOB 4Y16C 4Y1AE 2H2SD 3SKOA 1ITBB 4X83A 3SDXA 4NYLA 3INUH 2KUTA 2P8MA 3CU7A 5I30H 3MCLL 5F9JA 3HI6L 3QIBB 2BVPB 1UWXK 1KIQB 5D6DC 3G6JB 1TETL 1EMTH 2IG2H 4HZLA 1NUFA 5DK3A 4F80A 1CICC 5FECB 4NN5C 2IH1B 1BLNA 4Y5XC 4PB9L 1CDIA 2V5YA 4D0BB 4F57H 3HC4H 4HWUA 5JOEA 3BYTA 3VFVA 5GIRA 5HDQL 5LWYH 1HK6A 4JFOB 1CL7L 5FHBH 4CVZB 4UAOB 3VXOA 2VLJE 1NGQH 4UDTA 4C4KT 1CL7I 4MXWL 5GS1C 3KYMB 2CK2A 5DURB 3I2CH 4OZGF 2DD8L 2AK4E 5GRUH 4H5SA 5IJKA 2GITA 1JWSB 5IVZB 4YBLC 4EN3C 1CDHA 2P8PA 2ZNXA 1MF2H 4Z0BH 2EYSB 1ZGLA 2R69L 3AU1B 2HKHL 3MCKB 3QDGE 5AAMA 2V9QA 3CFCL 2OK0L 4M6NH 4GLRI 3HI6H 1VKXA 1KGCE 2VZ3A 4YDIL 3A6CL 2FATL 5CZVH 4HX1A 5A16B 5HI5C 1WV7T 1P6FA 4WEBH 4QRUB 5GRJH 3MRGB 1B4JL 3TJEH 1H8OA 3V0AC 2PUQT 1AKJD 4LARL 4OUUB 3WO4C 1RU9L 4HKZA 4H8WL 3DIFB 3BXNA 4P46A 4FQQB 1T0PB 2XZQH 5KSVA 2VAAA 4E5XB 5ACZB 4OCXH 1HXYB 1OAUL 2APXA 2NTSP 2NY7H 3DETC 4KROD 2GSGB 4J3VA 5T1MA 3BPLB 1MSPA 2G2RB 5FM5O 1UVQB 3A6CH 4ZDHA 4DW2H 4PJ9A 4MLIA 5CGYC 3GBLA 4K7PH 3S88L 3BPCA 4JRXA 1OPGL 3GSVA 5F7YC 5SWSD 2AXHA 4F7MA 3DARA 4YC2B 5TH2B 3JWOC 1ZT1A 1Y0LA 4HT1L 1EEYB 2R0WL 5E1AA 2M2DA 5B3JE 1YEJH 1ZLSH 4HS8H 3FQXB 3VD7A 3C08L 4XRCB 3C6SB 4XVTH 1LE5B 2AJUL 1RURL 4PV8B 3IFNH 1G7HB 1SJHB 2DL2A 5BQ7A 3DSNA 3B9DA 4I9WE 5C0JB 2GEEA 2E27L 5JW4N 4I2XA 5HYFA 3RL1B 1BZQK 4PS4H 3G5YB 4POYA 3MJ8B 5D7IA 1T83A 4CNIA 3P11L 5IB3A 3H9HB 1Q9OA 5C0CD 3D1MC 2ADGA 1YEDB 1BVZA 5ACZA 2DQDH 4KU1A 5CEYA 4KXZH 1K4CB 5IGXL 1OP5H 5EU5B 3ZYZA 1RUKL 2R1WB 1IAMA 3DO7A 3TJHD 2DQTL 4KJYB 4Y19B 3DGGB 2DQEL 4HFUL 1LP9A 3FRUA 1NCAH 5FGSA 4GW1B 2IADB 4ZFGH 4M7ZB 1MUJB 1CICD 1JN6B 3R8QA 1JI2A 4N1CA 2NXYB 4LHUG 5ALBL 1EVTC 4TRPH 3HI1B 1M7DB 1KOAA 2Q8AH 3C6LD 2GAZA 2EE2A 1K5NA 2FEDC 2HN7B 2X10A 5IMKA 5DJZB 3PP4H 4P2YA 4P4KC 3S3PA 4JFFE 1P6AB 2AJVL 3AB0B 1KG0B 2NXYD 2YZ8A 4M1GH 4ZFOB 1FNFA 3QEQD 3IRZA 3LQAC 3TO4A 3W39B 1WC7A 2WUCH 3HMWL 3KHQA 4KJQC 4IOSD 2ESVB 4Z76B 2VR9A 4QRPE 3LKOA 5C0NC 4G6JH 5ESVA 4H8WC 2PYED 3WNNA 1ZWIB 2FHFA 5BMFH 5INCB 3D0LB 1MFCL 1A7QL 5F1KC 2VDRH 4U49A 4RMVA 4EOWH 5F96H 4NRZA 4N68A 4Y2DC 2AI0L 4TN9A 1YMMB 1QFWL 3F7RA 2QSCH 1MVUA 4LASH 4OF6A 1I1AD 1XGQA 4FNLL 1R3IH 1GC1H 1XR8B 4U6VL 5JPNB 3QEQE 5DVKA 4L9DA 3OKKB 4GBXB 3FN0H 5HDBE 3IAGC 5DJ8A 4M6ML 2AJZB 3N1FC 1IL1A 2HRPH 1QBML 2YPKB 4TNWK 4A6YA 1ZVSB 3FT2A 3K7UA 4NQSB 5DT1L 4ZUTA 4J4PA 4EOWL 5KSBE 1AGDA 4JM2B 4QRQB 5C0FA 4WI5A 1FIGH 4ZUVA 3RWHB 3VD9A 3WLBA 5DHVA 4HIXH 1QLRB 1FCGA 5D1QC 2J6EA 4H0IA 3IU3B 1MHPL 3AY4C 3AS0A 3DRQB 2VZTA 2B8OT 1EMTL 2J6EL 2DLFL 3UPRA 2IF7A 2VQTA 5CD3A 2V2WA 1LP9F 2DMCA 1OTTC 1JFQH 2JK5B 5CLWA 1TQBB 2WMPA 5HGGS 1T4KB 4GSDH 4TNVK 1I7UA 4LIQH 1G7LA 3AREB 2UWEF 4KDTA 3QP3A 4NKOB 1Z5LB 2X44D 3LVEA 3MGTB 5E8NA 4G8FA 4P99A 5DZOA 3T2NL 3QIUB 2H2PC 2XTJC 3LKSA 2NY1C 3VDBA 4M93C 5IW6A 3C6LC 4V1DE 2DQCH 1DLFL 1BJMA 3R4DA 3SDAA 1N0XL 3G04B 4RA3A 2XZCH 4PJFB 1DBKL 4GXUM 1DL7L 4NKMB 1GAFL 4KRMB 4YAQB 4PRAA 1EAPA 4NQCD 4HGWA 1J1PH 4M7ZC 2C1OA 4KMTL 3ZDXF 4AYFA 4QY8B 5CEXA 1MAML 2VLLA 2AS5M 3DTXB 3K2UH 3T0ED 2PN5A 5GRVK 1MJ7L 1SHMA 2XFXA 3FQRB 4DVBA 4X9HA 1JZ5A 1W0WA 1Z0NA 4R97B 3VG0L 2YC1A 2VOTA 3CZJA 3H42L 3AB0C 4KJYA 4XB7A 4QT5B 1HQRB 4Y19A 5E8EB 5GGTA 3UTSA 1I1FA 2YWZA 5I0ZA 1IBGH 3VFGH 25C8H 2J1KA 3VFWA 4HT1H 4D8PA 2R9HD 3ZL4L 1DL7H 1F42A 1XIWA 4KKNA 3MV8B 4WI6A 3VWKA 5HHPA 2DYPD 2DIAA 1PY4A 1XZ0A 3QUXA 5CP7B 1Q72L 5DMGC 1BQHB 4MCYA 5GPRA 1WEJH 1OAXL 3LDBB 4PRAB 3CDFA 4V1DA 4NUGL 4ZFOA 2FYYB 4U1NB 2D4DA 5EPMA 4RAHA 1FO0L 1IZJA 4LEOB 3GRWA 4JDTH 4LEXH 3ARGB 3FOLB 5JOFA 4YIQA 3ZDZF 5I9QB 3P2TA 4LHUD 4U2YA 2DQHL 3BPNC 3MRHB 4DKEH 3FQRA 4UOW1 3MCG1 5IEKB 5HYSB 2R0ZH 1OWRM 3WJJC 1CVSC 3EAKA 3HG1A 3HAEG 4Y4HC 5EO1B 4XC1L 4O9HL 5EU6D 1T0MA 1CFTB 3TGXA 3O6KH 4IIQA 3BKYH 2DQUH 3MRCA 5LKNA 5IG7A 3VXSB 4R90L 4L8BA 3O0RL 1AFVH 4NKDA 4C4KO 3NIFE 1E6JH 3QH3A 4HWEH 1SMAA 3AFLA 1QNZL 2UVFA 3NCBB 4DFHA 3O2VH 4E41E 1A47A 4JAMB 4OLVH 5HD8C 3MRPB 4AENB 5I1IL 3D39B 3WJLA 3KPSB 2V5TA 4Z77B 5D6DA 4KUCD 1BP3B 2ZOKB 3WHXA 5FYJD 5ICXB 1YY8B 1EFXD 5F3BB 4NP4H 3CUPB 4OCNC 2IFFL 1WEJL 2VLME 3O4LB 2JJUA 1OTUD 4HEME 3IGAB 5GRXG 5I8EB 4PJXB 2M26A 1KBGH 4K9EL 1NDMB 3ARBD 4Z0XA 5EZJB 4JHAL 3LH2L 5GRVL 3ROOA 1A7QH 5I18H 3HZVB 3TBYB 2P45B 3VXRD 3BKML 3RWGA 1F11B 1MCFA 2R15A 4YZFE 1S7UA 5JZ7D 5BRZA 4KI5F 2XPGA 2Z4QB 1T5XA 1RUPH 3DVIA 3FO1B 4EVNA 3NCJL 1CIUA 4HZLB 5HD8D 3KPLB 1NGXB 2F5AH 4NC1E 4XHJD 2IBGA 5ESAA 3ARZA 3O8XB 4PRHB 3ZTJH 5H37G 5B39B 4WVRA 2Y6SD 3RY5A 2EDTA 5F7HA 4RA0C 3O3BA 1DEEA 1NUDA 3DYPA 2IJ0C 1KACB 2Y06H 2AXGB 4Y16B 3LY6A 4PJDF 3ES6A 1OOAA 5K9QG 4YAQA 4U6YA 4AQOA 4BZ2L 3V5DA 2OI9B 3RVUD 4MB3A 1EGJH 3LZFH 3PJSA 5BZDA 3FO2A 2R4RH 3L7EA 3R0NA 4K3HA 3QFDA 4Q9QL 4LCCA 5TQ0H 5FYJL 3C2SA 5I15L 2BMKA 4HULB 5E5UB 2XTJB 3MBED 1LEIB 4KKLC 3MQIA 4UV7H 1FAIL 3HG1E 3O2VL 1M1SA 3JV0A 3NAAL 4EI5A 1S7RA 4AL8H 4RMWA 2AJSH 4QRRD 4IOIB 3DIFA 2P5WB 3HUJA 1T7ZA 5FCSH 3STBA 1BD2B 2DQIL 1DEEB 3GO1L 2ZUTA 1VERA 3BPNB 5HHXL 2DLHA 3AM8A 1UGNA 5F7DB 1AE6L 2DM7A 3QXVA 1PKQA 2IPUG 3DMMC 3WFBL 4AZ8A 4X80L 1PDKA 2HVKA 4ZQKB 5AD0B 2BSSB 2R69H 2OM5A 5DK0B 1GGYA 4LHQB 3O11A 1T7YA 3LH2H 5E9DB 3MODH 2N7BA 3T08A 5EBMA 1UB5A 3LHPH 5E1AB 1OW0C 1ZHLA 3WLWC 2C3VA 1YECH 2W92A 2PYFA 4CRPA 1CI5A 4LCCB 4ZXBD 3CFDA 5FYJE 3PV7A 4KAQL 4X4XA 2W38A 4HMDA 4QHMB 4YHOH 1IGFL 2BY0A 5GGSY 3H6JA 4BK5A 4YFLI 4K7PL 1U91B 3S88H 4NHUB 1OAXH 4G6ML 5FYKE 4WRLA 1HSBA 2VSDA 4EI5B 4GKZA 1II4E 1VADA 4O2CB 4QOKA 3BZ4B 3IJHB 5KG9A 4RNRB 3VRLE 1P7KB 3O6ML 2A9ML 4WTZA 3VI3E 2VL4A 3RY6C 1CFQA 3TJHC 1RUAH 2YD5A 4PJXF 1S9KC 1IBGL 1U8MA 4G8EA 4UDTB 4UV7L 2VQ1B 1R3KA 1KIRA 1G7MB 1FC2D 3U48A 4LQFH 4M00A 1NSNH 3QB7C 5IVXE 3ILQC 4HF5H 5ID1B 1SQ2N 1HI6B 5FF6A 3KNBA 2UZYB 2OK0H 4ZSOE 1WFUA 4CN4A 4YR6B 1B6UA 5KVMC 1AJ7L 1N6QH 4U6TA 2HFGH 1ONQB 3RGVA 1I9JH 3S4SB 4X4XB 3L3HB 1ZLWK 3QUXD 4BYHA 4AL8L 4LEXL 1WTGT 3GKWH 3O4LA 4Z7VF 1K5NB 2HN7A 4U1HA 5DZLA 1OAQH 2E6JA 3T4AB 3QUYC 2I9TB 3K81A 3SKNA 3D25A 5EWIH 3U6RB 4LP5A 2Q8BH 4PJCE 3K0WA 1CK0L 4Y5VB 1F58L 1VFAB 4HDIB 5KANG 1CGSL 3CLFL 3RIFK 2PR4L 1MHHA 2NTFA 1JGLH 3CFIC 3RX5A 4ZDHB 1TZHB 5ESAB 1UKQA 3QEGL 1LD9A 4JJ5A 1HYRC 2QQKL 4D94A 3B43A 5IGXH 4Y5YC 1Y0LB 3HB3D 4NNYA 5DI8A 1AD9A 4Q9CA 1CD1B 4X6FA 1K8DA 5FFLA 4MA1C 1ZK9A 4PJEA 3AY4A 4DAGL 4I3SH 4K23L 4MAYA 1UA6H 3CFBB 2H9GA 3BO8B 4J8RB 2EDDA 3IJSB 1NAMB 3B2UD 2E6PA 3TV3H 3UBXI 1B0WA 2Q8BL 5F6HJ 1E28A 5KTEH 1DQQA 2J3SA 2YMXH 4KVCL 5TE7L 3MJ8A 3VFUB 1IL1B 4JFHD 2HLAA 1EGJA 4HUUA 4UI2A 4OT1H 4Z95H 3L3IB 5M94B 1NCNA 1T80A 3TO4D 5DEZA 1LEIA 1JVKA 5E70A 3IDXL 3K1DA 4C57C 2NTFB 3ZHKA 5EO0B 1OTTD 4X6DA 1RZGB 5AEAA 4YZFF 3L5XH 4GKSA 1KJMB 2R1WA 4KK9D 3W9EA 4C56B 4OGXL 1BQUA 2AKRB 4ORGA 1WAAE 1MRCH 5D2NE 1QFWH 1Q94B 4G8IB 1CD1A 4GSDL 3W0WD 3SGEH 5GS2D 3WFHA 2YR3A 3QXDA 2HKFL 3DV6B 3QFJA 4NOBA 4KTEH 2AEPL 4XWOC 2VDMH 3CZFB 4CVXB 2LAGB 1GGTA 4YPJA 3T2QA 2VXUH 5JA8B 5IHZA 1HXMA 3IDYC 5KVEH 1C16A 4PJEE 4ODVH 1JPGB 1DQTA 1SY6A 2KL6A 3W39A 2VLRA 4B7IA 3CFCH 4JN2B 4M6AA 4DGYH 3QRFM 4LRNL 4QTHB 3T1FB 4Q58C 3B83A 4RNRA 1YECL 2ZCKL 1NCTA 2AKRA 2NY6D 3PE9A 2ZUQB 4OM0L 35C8H 3DVGB 3O2WL 3T09A 4OV5B 1WT5C 1WWCA 3OAUH 3VXPA 3BRDA 1L6XA 2GSGA 3FT3B 3O6MH 5T1MB 4L3ED 5C07B 1LHZA 3HS0A 4RFEB 2PF6A 5CZXC 3EOTL 4IDJH 1CE6A 4NGHH 5HHXH 4CKVX 2FX7L 4WO4A 5I2IB 12E8L 1HZHH 1RPQA 3DO3A 1QFWM 4LLVA 1KEMH 1YMME 2W9LA 2FJGB 5D2LA 4X4YA 5ICYA 4IRSB 3VFWB 1DBKH 1CD9B 5AZEL 2VABB 3U9UB 4JR9H 1QSEE 5I15H 5IB2B 4KDVA 5SWZE 2F53A 1E4WL 3ZKMC 1R5IA 4RWHA 5DS8B 1E27B 2JJTC 2HLFC 1OAZH 3MRIA 3O2DA 4ZNEA 5B38A 1XGRA 5KS9F 3D5OF 1RIVL 2AJUH 2ARJQ 2G5RA 4LEOA 3JWOH 4U7MA 4JREC 2A6KA 3BP7B 5D1XA 2XIDA 5H35A 3F5WB 4NQDE 4F2MB 1D9KA 2BY1A 3UTOA 3MRDB 4P5MB 5I19L 1CDYA 1G7LB 1I8LA 3U46A 5DJ6A 1RIHL 4PY8I 1FN4B 1QBLL 1JF1B 3EYFA 4JFFA 3QUYB 4G8FB 5ICYB 3QIUA 3KPSD 3OX8B 1DFBL 4KHXL 3NZ8A 5DQJB 5I8CA 2HVJA 2D9QB 5HYJB 1QSVA 3PQYA 4XNYL 5IMKB 3FCTA 4MMXC 1YN7A 4S1RL 1NEZB 5I1HL 12E8H 1HZHL 4P57B 4HUVB 1J5OL 2R56H 4MNQD 4ZOBA 4XNYH 2NR6D 2R0KL 4M6MH 4QY8A 4X7SH 4OZGB 4NJ9H 4PRIB 4HQQH 2O5ZH 4XT1C 1YC7A 1QBLH 1RUQL 3W11D 5EWIL 1KCSH 1EBAA 5C0GA 2C1PB 4PG2A 2EO9A 5MEOB 3C87A 5CINL 1QNZH 2EIZA 3MJGX 4JKLA 4PRID 3MO1A 2OL3L 5BVJA 1O0VA 1GJIA 4Y4HD 2A83A 1E6JL 5HDQH 5LWYL 1N5AA 2OTUA 4D8PB 4TPRL 1XIWB 3KPRD 2X89D 1YEKL 5H8DA 5JPNA 3TYGH 4ONFH 4MJ6B 4LCCC 1IGCL 2Z93B 2YUWA 2XYCA 1BZ7A 2IH3A 4JPKL 5EZOL 5LJYH 3IKKA 4BSVA 4LBEB 4G9DB 3FHAA 4O2FA 5FHAH 3A6BL 1BBDH 4OIIH 4FTVD 4NZDA 3PP4L 1XF5B 1K6QL 4EI5C 1TZIA 2NZ9C 4D9QD 1EH9A 3CXDH 4BELD 4JM4H 4HUMB 4JPIB 5TE6L 5MERB 3MRHA 3SO3B 2QJDA 4EUPH 4XMLL 1A7OH 1G6VK 1S5HB 3OKEB 1EFQA 4LPUA 4NJAH 4LFHD 5FUZH 3HE7C 4J6RH 2ED8A 5E2VH 1DBAH 5IB1B 3MNVA 2WUCL 2E7HA 3HMWH 2CKBH 3L7EB 4YHKL 5MP6H 3AS3A 1GXEA 2EE3A 4MVBD 3GSNB 3MLZH 2P5EE 3MV11 2VZUA 2P7TA 3BDYH 3JTSA 1MIEL 1A1OA 4Q6IA 3G6JA 3KPMA 4O4YL 5GJSH 5T3XH 3SE9H 1IAKB 3QUZC 4G80A 5E8NB 1T5WB 1XCQA 2DOCA 1S7XA 5B8CB 3ARGD 5C6TH 5E5MA 4GAFB 3VFVB 5K9KA 5EZLB 3KYAA 1V7NH 1C5CL 4GJTB 5F7DA 3OB0H 2F5BL 5ANMB 1R0AH 4P46C 1A1NA 4E41B 1H9VA 1S5HA 2RAMA 3PIQA 4ACPA 4H5SB 2EDQA 3LAFA 2B1AH 4L4VB 3UJIL 2E7LA 4FQIH 1MCCA 1PZUB