4P5KB

Structural basis of chronic beryllium disease: bridging the gap between allergy and autoimmunity
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
212
structure length
198
Chain Sequence
NKFDTQLFHTITGGSSPENYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEERAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
publication title Structural basis of chronic beryllium disease: linking allergic hypersensitivity and autoimmunity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 198
sequence length 212
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p5kB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p5kB01
5HGBB 3V5KB 3HMXL 3MJ7B 3LPFA 1MJ7H 4H0GA 1KPUB 4CADA 4X6FA 3TO4B 4I77H 4OCLC 3OG4B 4JG0H 5E08L 1RUAH 2X4SA 3KYAA 2GTZB 2EH7H 5F9DC 1TJIL 5GGUA 1P4LA 3D5OF 1I3GL 5EU3B 3V0VB 4FXKB 4FA8A 2OXHA 3HZYB 3RY6A 4WWID 1R3JB 4JFEA 3I9GH 4JN1H 2A38A 1PKQA 2ZSVA 1UWXH 3W81A 3NFNB 4NPYB 1N8ZA 4LSTL 4PJIB 2Z35A 4QHKJ 4RWYL 3OR7B 1DN0B 4LCCB 2NY4C 4BELD 5HHQB 3KHOA 3FMGH 3SDCC 1JZ8A 2UYLA 1F3DH 4P4RA 4F7MB 5A43C 5D1ZC 4OGXL 2XZCL 2PW1B 4KKCD 3QPXL 1Y18A 5CEZH 1FE8L 1YN7A 2BK8A 4M62L 4PRIA 5JUEL 2H41A 3QEGH 4WFHE 3K81A 4NCC1 1DUZA 3QIUB 4U1KB 1JMZA 3LRSA 1G9NL 1MI5E 3ILPA 2BZDA 2APXA 1LEKB 5I1DB 1JUFA 1JRHL 1P1ZA 1TTGA 1XGYL 1J7VR 4XP1L 1JTPA 2ZPKL 4G8IB 3FB7A 1X4XA 2APFA 1IGFH 1T5XA 5DO2C 1DQDH 1FFQA 3S96B 3RVVD 4EDXA 2FZ3A 3D0LA 4BH7B 4PG9B 3RWIA 4NT6A 4Z78A 4K8RD 2KZWA 2OTUB 3UDWA 2MCPL 3QIWC 5JMOC 3ROOA 4ODHL 3T0WA 5MI0C 1KLGA 2F53E 3B3IA 4ODSL 4URTB 1OP3H 5DS8B 4YLQT 2LU7A 4KI5E 4UTBH 2PYEA 4MSWA 5FUZH 3OAZK 4K8RL 4HEME 3ALPA 3MA7B 5FYKH 4OZIF 3FQXA 4JJ5B 2I9LB 3C60A 5HXMA 4DKFL 2UY6A 4L3CB 4NYLB 3LEVH 1EA9C 5ABDE 5I1HH 4Q0XL 3MJ9A 3MRIA 4JZJB 1KPRA 2XZAH 4NRXB 4FN0A 5KAQF 4I2XE 2YRPA 3FN0H 2PXYB 3UZEA 1CGSH 1UWGL 4YHKH 3O0RL 5D7JC 1F58L 3DX9B 4GRWE 5JW4R 2BSTB 5DA4A 1J1PH 3KPMA 4LRNH 5IVOA 2GI7A 2DYPD 1NCCL 4BZ2L 5KJRH 2VERN 2CLVA 4EN3D 1G7IB 2MSPA 1EFXA 2IPUG 3V7MA 5A16A 3H7BA 3Q5YA 3IDGA 1MWAA 4P3CH 1ADQA 4K23H 4GW1B 2V7NB 5C09A 1WBZA 5I18H 5EZIH 1A1OA 4HX1A 3DWTA 2HFGH 3VRLE 1K8IA 5LWYH 3SDDB 3MBXH 5H94A 2VDNH 1WIOA 3UC0H 5J8OA 4UBDD 4JVWA 1T20B 1SEQH 1VGEH 2L0DA 4K3DL 5BO1H 5L88H 3RY5A 4UT7H 4QLRA 3GSOA 4HH8A 4LQFL 1LK2B 2V9TA 2A73B 2DYPB 4KZEH 1L0YA 1CGXA 2FWOB 5C08A 4U6XA 2Z4QA 3LN9A 3LRHA 3PQYB 2FX9H 3X11B 1S7RB 3HRPA 5DHVB 4FOMA 1XGTB 3FQWB 1YYMH 4NBYB 2CKBH 4R90L 1MOEA 3L5XH 4Y2DC 2FNBA 5LQBH 4L29B 4G43B 5E9DD 5J3HD 1UCBL 3HB3C 5J06A 1URLA 3EOTH 5KSBB 4L8SA 1QSEE 4KQ3L 4HGKC 2FLRT 5DDHA 4FTVD 2F5AH 3LN5B 1OHQA 1A64A 2ICWB 4RQQA 3RVTD 1GHFL 4QRQA 5LVEA 3W5NA 3MLZH 4UDTA 1F2XK 5TDOA 3RGVD 5IBLC 5C6TH 1BMGA 2OS7A 2A74B 3MCLL 4H8WL 2BNRA 2VXUL 4JO1H 4WRLA 2NY0D 2CRZA 3STZA 1C5BH 3GFUA 2FJGB 5DZOA 2XRAL 5GRUH 4GKSA 3UTSE 2BNQA 3IAQA 4BFGA 2IH1B 3BWUC 1NMCB 2VDPH 4LCYB 3GHBH 2ZUXA 4TNWK 3QYCA 5HTSA 1ZS8B 4EZMA 3GSUA 3CFEB 4FTVB 1O0VA 3T0ED 1N0LA 3UJTL 4YHPA 3U36B 4JDTH 3TYGH 4GG6A 1A3LL 5FO8A 5D7IA 1MRCH 4TUKH 3ZL4L 1SBBA 2WNGA 1Y6KR 5F7EH 4PJAE 1FQ9C 2XKNA 3CJJA 4DQOL 3AMLA 4RA3A 2EIEA 4JM4H 1WFUA 3V4VH 3L3HB 2W38A 4YBQC 3TJEL 2RB8A 4N8PA 1ACYH 1BGXH 4NJAH 2W92A 5LAXA 4J4PA 4GQ9L 4MZ2A 3EBAA 2BCKB 4IRJD 3Q6GL 5EPMB 5CIPB 5T5NG 1BZ9A 5I19H 3ARZA 3ECBA 4KMQA 2G2RA 4HIJA 4B0MM 5TE4H 1K4DB 2QQQA 1P7KA 3A6BL 4F8QA 4H88H 3T1FA 2H2SC 5AZ2L 3NFPA 4KDTC 2P24A 3QUYA 2MQCA 4XXDA 1LEGA 2R2CA 3PL6D 5MEND 1AGEA 3MR9A 4PGBA 5DMYA 4GRMB 3HNVH 5EWIL 1JZ4A 2I07B 2HFFB 5HDQH 3C5SA 2LFGA 5I16A 1JPSH 5EORL 4IRJB 4OQ1A 4NQEA 3KPLB 1YNTA 2ITCB 4DGIH 3S6CA 1QSFD 4PV9A 5B38A 4APQA 1P7HL 1RUKL 4HKXB 1UXSA 3UO1H 2CDFA 5CKGA 5ID1A 3S36L 4YXHL 1KJ2H 2ARJB 1HQ4B 3PL6B 4X5XB 5F1OB 4Z7WB 5MENB 4QRTA 1D6EA 3TN0D 1OOAA 4OGYL 1IAIL 2L4OA 4HIXL 3FO0L 5KN5B 1BQLL 4M7ZB 4I0KA 1F45A 1YQVL 5I1GH 4ALAH 5I9QC 4UU9B 4HLZH 3BUTA 1XGUB 1GPOL 4ETQB 3ARFD 3OV6A 4F58H 4M1DL 4ZS7L 5HD8D 2PUQT 2YN3A 3O3BB 4BFEA 4NQCA 3K4AA 3PDGA 4I77L 2PO6D 4MMZC 1E27A 4NM4L 4JG0L 4XRCB 5AEAA 5D1QA 1JF6A 5ADOH 5F1NB 2G75B 2BSRB 1CG9A 1HKFA 3CSPA 1K3ZA 3TN0B 5DC4B 1KJVA 2CIIB 1SY6L 1TQBB 3LPWA 4Q74A 1QBMH 3VXRD 5KS9E 2AJVL 4PJ5A 5IOPA 1ZGLP 3TIDA 5INCB 2DQTH 4OD3H 2QQLL 3HC0B 4O02L 3MJGX 3WFHB 3QHZH 4ZPTB 4OSUH 1XH3A 4OLVH 4M6NH 4QNPE 1D6VL 1HHGA 4LNVA 2QR0A 4PJDF 5E5MB 3HUJF 2A6IB 2FJHA 4HIIB 4WHYH 2PO6B 4XPFH 2VLRD 4AM0B 2O61A 4ODTH 2YKLH 3CDFA 4WUUA 4U0RC 5FHAH 5DEGA 5EIQA 3SGDH 4P2QD 4NNPL 2IPUK 2VDRH 3P4MB 3IFLH 3L3JB 1OAQL 3NIFE 4O5LH 1QSZA 4TUJA 3CLEL 5GGRB 4F37F 1WITA 5AYUL 4OT1H 4HLZG 1A7OH 3MFFA 2IH3B 5HHOA 1LO2H 3K8KA 1AGDA 4ZUUA 4PG2C 4PB9H 5DI8A 3MV11 1U8OA 4F7EA 5C0NC 1KN4H 2UVEA 1MY5A 2DWEA 4Y4HD 4CADB 1INDH 4X6FB 3NA4A 5CEYA 4HJGA 2P49B 5C0RL 4P2QB 1CR9H 4KTDH 2B2XH 3IU4H 2X4SB 1Q0XL 1XF5A 1ZKAA 3E3QC 5GGUB 2UVFA 1P4LB 2Y07L 2JIXA 3D3VE 1KPVA 5LBSL 3SE4C 5HDOA 1HH9A 3KS0J 1SEBA 4FQJH 2GEEA 3HNSH 5FYKL 2VL5B 5ISZD 3SOBL 1T7VA 1PSKH 4KTYA 1PKQB 2ZSVB 1GGCH 1WLHA 1QLFB 2WBJA 1N8ZB 2Z35B 1NUNB 5I1HL 5DUML 4GT7A 4LLMB 3TBTB 3Q5OA 2UYLB 4WHYG 4Y4FA 2EO1A 3GJFA 4FABH 5B8CA 4P4RB 1UM6H 4S1QL 5J0BA 4CW1A 3KPSE 5IG7A 5BV7L 3H3PL 3HI6H 3VWKC 4C54A 1Y18B 3THML 4PJFE 1YN7B 2R1XA 3L5IA 4XT1C 3I2CL 2NXYC 4DKDC 3BW9A 3TWCL 4JGMA 5GZNC 4P3CL 1DUZB 2ZCLH 3LRSB 3DXAE 3ILPB 3DETD 3S5LB 4MNQA 1JUFB 2Z0BA 1P1ZB 2HFGL 2Y9RT 1QTYT 5EA0H 3C60D 4WI5A 3QP3A 2BVOA 3FB7B 4Y4KD 4KRLB 1JIBA 1HHHA 5IFAH 2FZ3B 3D0LB 3O4LA 4FQPA 2HT2C 3RWIB 5E1HB 4B41A 3U9UA 4UT7L 3HAEA 4XTRC 4UIKH 4PJ7E 3QZWB 4KZEL 3FT4A 4OF8A 3ROOB 2PETA 5C0AE 1KLGB 3B3IB 3RQ3A 1CL7I 4UT6H 3H9YA 1DN2A 3SEPA 4CVZA 4HGWA 5D1XA 3PWPD 2J8UE 1ZLVH 3OSKA 2PYEB 3MJ9L 1AGBA 2ZP0T 5BS0D 5LQBL 2B39A 5EFIB 4K9EC 1EFXD 3FQXB 2IJ0C 3C60B 4Y5VC 4Y4KB 4NC1C 5C09D 2R0KL 4HT1L 1MCCA 4YUEH 4OD1L 4WFHD 4NFBA 2VLKA 1TTUA 3MRIB 4NKMA 5EBGA 3CSGA 1QPXA 5IT2L 2GAZA 3FZUC 3KPOA 5KSAC 3IXTB 1JGVL 3KJ6H 3KPMB 3KHQA 5D93B 2G5BA 4X7EC 1C5BL 5DQ9A 3WFCH 4XBGA 3LKOA 2CLVB 4XWOC 1KCKA 3M8OH 5F9OL 4GMTH 1EFXB 3G6DH 3WFDL 4OCRL 5A16B 3VG9C 1DBKL 5GS2D 3IDGB 1MWAB 4MJ5A 2F53D 2DQDH 4NQDA 4XP5L 5C09B 1WBZB 1F2QA 1A1OB 4HX1B 2NNAB 1AR2A 1K8IB 3G5ZA 3IKCA 4G6KH 5H94B 2FLBT 1I9RH 3C09B 4CKVX 5C0CE 4RIRA 1TVBA 1FG2A 1NEZG 2EDLA 3SJVE 3GSOB 2GSIA 3HTLX 4MD0A 1A14H 2DLFL 2AKRA 4V2CB 4ELMF 1W8NA 3FN9A 3H3KA 5C08B 4OFYD 4Y5YA 1BJ8A 5CJXA 4D9RD 3QG7L 4NCC2 2BNRD 5BRZE 4LGRB 2ED9A 1I1FA 2ICEA 3RA7L 1HYSD 4U0QB 1AQKH 1VDGA 5T1KA 2BOCA 3ZYOA 1JNHA 2A6KA 2BNQD 1PD6A 1S9YA 1EVUA 4UV4L 3RFZC 1LWRA 3ARBA 5DDHB 4Q9RH 4HIEA 5I8OL 5GJSH 4NRYB 4Z0XA 4RQQB 1U3ZA 3SBWA 4NUJB 4UDTB 5TDOB 5BW7A 2E8ZA 2JJSA 4M00A 3HPLB 2VMFA 3MCG1 3PNWA 3C2AL 2BNRB 4GQPH 3HNVL 4JM2F 2E9IA 3B43A 2R4RH 2F8VA 3STZB 4PFEA 5L9DL 2B1AL 4BM7A 3HRZA 4GKSB 4LRIC 5DRNA 3SDXF 2R69H 3MBEC 2BNQB 1CIUA 4PJXF 2ZUQB 3KXFA 3MX0A 3MZGB 2DLGA 1ZLWK 3VI4E 4X5WA 5AG9A 3GSUB 3CFIC 4IBLT 1JNNH 3BZFA 1WFOA 3GGWA 4YHPB 4P4KA 5EOQL 4AZ8A 1G0YR 1KJ2L 4PPTA 5E8DL 5IEKA 1MFBH 3CAFA 4GG6B 4JFYB 3P77A 5FO8B 4UINH 5F7HA 1LP9F 5D7IB 3MXWH 5F88A 2DD8H 3ZKQD 2Q3AA 3EYUL 4MD4A 4UNUA 1EV2E 1OAKL 2XKNB 2Q8AH 4XAKE 3EDKA 1YMME 3VA2C 5HGGS 3A0OA 2IFFL 3D25A 1NH6A 5LAXB 2F9BT 3NCBB 5D5MA 1SYSA 2YBRA 3IS0X 4NQED 4OIAA 3F7VA 2VZTA 1BZ9B 2RCSH 4JM2C 3LB6D 4IS6A 4KK9C 3ECBB 1RURL 2G2RB 3SO3C 3RUGF 5I0ZA 2FEEI 2V2XB 2F74A 1IMHC 1T7XA 4P23A 4JHBA 5HJ3A 4P3DA 5DD5H 3EUUA 1P7KB 2HKHL 4Z76A 2Q6WA 2A0LC 2NXZD 4PREB 4PRPE 3CIQA 1FBIL 3T1FB 2X4RA 3NFPB 2J2ZA 1GGBL 2P24B 3QUYB 4XXDB 1LEGB 4NQTA 4WY7L 5T5FL 2VC2H 1AGEB 3MR9B 3OWEA 4PGBB 4OD3L 4BQ6A 1MCWW 3BKYH 1UKTA 1WSST 3C5SB 3QHZL 3UJJH 1ZEAH 3SDAD 4EUPA 3PQYE 3UPRA 3IJHA 1FYHB 2WBWB 4M7JL 4YDLB 4NQEB 4JHAL 1YNTB 1JF1A 5TE6L 3BE1H 3P4NA 1H8SA 1FL5A 3UBXA 1RUML 1GL4B 4PV9B 5B38B 2VQTA 4G6AD 4APQB 1MCPH 3QUZA 1UXSB 2V9QA 5F6IB 3PWJA 2R29H 3GI8L 4U1MA 3C5JA 3MRNA 4K3JH 3AGVA 1SBSH 2C3VA 4QRTB 1D6EB 1E4XL 1XZ0B 1A6AA 4XVTH 4GRLA 4MNGA 3VE0B 4XXCA 4O5LL 3TT1H 3SDAB 1MHEA 12E8H 5EO1A 1HIMH 1QBLH 1CZ8H 3G5VA 5IWLA 4P2RA 4JJHA 2VIRA 4JQXA 1LHZA 4LVHB 5T3ZD 1EBPA 4JN2B 4PJBE 5ANMA 4NQCB 2YPKA 1MRDH 2X40A 1FPTH 1UKSA 4POUB 1E27B 2X9XA 3MREA 3UXFA 5D1QB 3CFBA 4KTDL 1JHLH 4P5KA 3J7HA 3VMNA 1CG9B 2ZG2A 1MEXL 1UH3A 4LQ1A 1VGKA 4G7YL 4MGXA 1KT2B 5T3ZL 3MNWA 2FJFA 5DD0L 5IOPB 1PSKL 3TIDB 5CZXD 2OI9B 4KPHH 3DVFA 3BD5A 3KPNA 4G8GA 2X4TA 1FNSL 1B0GA 2CR6A 2NX5A 3O8XA 1XIWC 1MCOH 4JHZA 1IVLA 1XH3B 4X6DA 1IGTA 2JK5A 3ULVF 3KNBA 1HHGB 2QR0B 4BFBD 2FJHB 4OCXH 3NIGF 4DVBA 4FABL 2IBBA 1UM6L 2EO9A 2O61B 2AJUL 4XZUA 4QF1A 4WUUB 4MJ6A 2BJMH 4OZGB 5DEGB 1N59A 2ADGA 4IHOA 4L3EA 3BGFC 2GUOA 1DANU 1QFWI 1EZVX 4LPXA 3N85H 4OZHA 1EAPA 5FUCE 5F9WB 2LE9A 5I8EA 1L0XA 4BK4A 4HWBA 4OM1H 5JHLL 2XWTA 4TUJB 3T2OA 1K5NA 5E03A 1HINL 5ELIA 4UQ2A 1F3JA 5D7LE 3W11D 1U0QA 4F15B 1WICA 1S8DA 3L5JA 2DAVA 5HHOB 5DMGC 5IFAL 3OJVC 4X5LA 4UOW1 1QFWM 3QCTH 4ZUUB 5DI8B 3TF7C 4UIKL 1ZTXL 4F7EB 4W4NA 5JW4Q 5F8QC 2AJYL 2DWEB 1NUDA 2C4XA 4NCDA 5CEYB 4HJGB 2CDGA 2W59A 4DN4H 2VLLA 4ONGL 3ULVC 3S37X 1XF5B 3P0VH 4Z5RA 3CNKA 2I24N 1KPVB 5IF0A 1MJ8H 3Q3GA 2EEBA 1LO5A 1HH9B 1SEBB 3ARGC 3MCKA 4ONHA 5GS1A 4HF5L 2HWZL 4S1DC 2JTDA 4N1HB 2WBJB 4HW6A 1V3LA 5CUSL 2YUWA 3VD5A 4YUEL 5DHVH 5BZWB 4MNQD 4P57A 4PJIF 1HYRC 2EZ0D 4I18A 4MJID 4XP6L 3WD5H 3FT3A 5GPRA 2P5EE 4GW4A 4ORGA 4Y4FB 3GJFB 5B8CB 3O4LD 4YO0A 4CW1B 4MQXD 5IG7B 3U6RA 4ZD3L 3RGHA 3QI9A 4HH9A 5K33A 2R0ZL 3DRTA 3IF1A 3N1MC 3BW9B 1MH5A 2X89A 3I3EA 2BVYA 4HS3B 1TVHA 2DQDL 3O2VL 1S78C 3U0PA 2OL3H 4M7LL 4MNQB 2EDKA 3SGEI 1X7QA 3PV6A 5CD5C 4PRAA 2BVOB 1OWRM 5CAYB 4Y8DC 4LMQE 3EZJB 3ZDZE 3O4LB 3RWFA 5F1IB 1DDHB 5JQ6H 3K1DA 3U9UB 3X12A 2FECL 3HAEB 1G7HA 2DM3A 2QQKH 5LG1A 5A2FA 4RZCA 1WT5C 3FT4B 2FSEA 1KB5A 5FA3A 4O4YL 1S7VA 1U3HA 1MCNA 4CVZB 3OJ2C 3NCMA 5LGHL 5FOBA 1QR4A 1RU9H 1AGBB 2VWEE 3MRGA 1AJ7L 4XP9H 2R39A 1EHNA 3WYRA 2XZQL 5E4EB 4Q9RL 4YBLC 3P3YA 5GJSL 4YPJA 4LSRL 2FDBP 2VLKB 5J12B 3DXAD 4NKMB 5CJ8A 3X3FH 4Y16D 2DIJA 2P8PA 4NKQB 5CIPH 3BVNA 5I75C 1FNLA 2ED8A 2GAZB 3QDJD 3RZCA 4BK5A 4PJHE 4JHWL 4XPBL 5DVOA 3ELAT 3SGKC 2R4RL 2G5BB 4JRXE 1MUJA 5DQ9B 4XBGB 3LKOB 3V4UL 4FFVC 3CXHK 4PLNC 4FFYH 2R69L 4MXWL 4QRSA 1G9NC 5K9JH 1FGVH 1MQKH 3PGCA 4C55A 2D4FA 4NQDB 4JFEE 5CFHA 5GS0C 3HC4H 5MEPA 2YRZA 1JRHI 1U8PA 3ZE0E 1QSVA 1G6RA 3G5ZB 3IKCB 2J4WH 1UM4L 3KJ4B 3ESUF 4WNQA 1GAFH 1J8HD 3QDJB 4QGYA 3UTZA 4LU5H 4RIRB 1X6LA 6FABL 3ARBD 3WXWL 3BX7C 4TRPL 3NCYP 1FG2B 3ISWA 3MXWL 5IHZB 1NCBL 2GSIB 4MD0B 2GT9A 2VAAA 1ZHKA 2Y7QA 2AKRB 1CQYA 4X8XA 4Y5YB 3TZVD 1AHWC 1BX2A 4Q6IA 2E7HA 1BZQK 5ECJE 1I1FB 2ICEB 1YECL 4K8RC 4PRIE 2AEQH 1PX4A 5HHVL 4IIQC 2G60L 2BOCB 1JNHB 2A6KB 1EAJA 1S9YB 5DJ6A 1MHHA 1KCUH 3NCEB 4M5ZL 1MY7A 5DEZA 5GRWA 1J8HB 4M93B 5FDWA 5KSBF 3ARBB 4HIEB 2ADJA 4Z0XB 2UWEA 1QRNA 3W0WA 3O3DA 2N7AA 1EGJA 2XN9A 1M1SA 1RZGA 3E6HA 4HXBH 5E4IA 3PNWB 4UUJA 3TZVB 2DKUA 3QEQE 5EO0A 1QRKA 4XC1L 1CFVH 3BKYL 2JCCE 4QHMA 3T2PA 4NZJA 4G6FD 1QACA 1U36A 3S88L 3CXDH 5CCKL 3HI5L 4XB7A 3D48R 1D5BB 1BVKA 3BE1L 1JWMA 4Y1AA 1OB1A 2PYEE 4NKDA 3KXFB 1V3KA 4X6CA 4F8TA 3TVMA 5FF6A 2RAMA 5BRZD 4X5WB 3MV01 1B0WA 3OX8A 3QAZC 3BZFB 5TJWK 4UTAH 2F58L 2DQUH 3GGWB 3O6MH 4EN3C 2R29L 3K4DA 4LSPL 5IEKB 3SN6N 4PJ8A 1FNFA 3P77B 1KFAL 2N56A 4ZSOE 4P5TA 1F02I 1NBVH 1PVHA 3QIBA 4TNWF 3H2WA 3TT1L 4L4TA 7FABH 4MD4B 4H5SA 1CLZL 3GSNL 4UBDC 1BQSA 3HE7D 4YE4H 4AG4L 1P6AB 3DMMD 1EO5A 2DQEH 4XBPA 2RJMA 3D25B 4EDWL 1P84K 3VCLB 1NMBL 5D5MB 1SYSB 1Z5LB 2YBRB 2BHUA 3NCJL 4OLYH 3T2QA 3C2SA 4TVSa 1FPTL 5ITFB 2F74B 2NQCA 2BSSA 4P23B 4WO4C 5HJ3B 4HK3J 4QYOA 1IM9D 3HFMH 4Z76B 3QUZD 2GQHA 5SX4H 1UH2A 2Q6WB 1N6QL 2I5YL 1HQRA 4G9DA 3ETBF 1GGTA 3CUPA 2X4RB 1IC5L 2BDNL 5JHDA 1NC2A 5DRZB 4H8WC 3ARVA 3AUVA 1NGZA 4M43L 3SHSA 5C08E 2YPLA 3ARYA 3LS5H 4EUPB 3S35H 3UPRB 3IJHB 2VR4A 4TOYL 4HK3N 1SMOA 3RGVC 3QDMA 1JF1B 1CFSA 1RULL 3P4NB 1FL5B 3FQUA 1M7XA 4Q97A 5CSBA 5KVDL 3RVXD 3UBXB 2P5WD 2NY0C 3QXAB 2NR6D 3EYQD 3QUZB 5EOCH 1S7TA 2BVQA 4XNMA 1Z0NA 2CRIA 3PWJB 2R15A 1RAMA 2HRPH 1QHPA 4U1MB 4LNRB 4XC3H 3C5JB 3DV6A 3MRNB 2OR9H 5CD3A 1IKNA 5EIVA 3N85L 2C3VB 2YPVL 2GW5A 1A6AB 4GRLB 1XGPA 2DQFA 4MNGB 1DVFA 2IC2A 2QQNL 3T0EC 1FRGH 2H1PH 3CVHL 4KJWD 4POYA 1HEZA 1HHIA 4FMKA 1MHEB 5EO1B 3I6KA 3QRGL 5E99H 3G5VB 3D39A 3C08H 2XA8L 3I50L 3BRDA 1FN4B 4P2RB 2VIRB 4HWUA 3O8XD 3QCTL 5HI5C 2P5WB 5HGAB 5INDA 1FVEB 1WWCA 3LVEA 1M71A 4OLEA 5ANMB 3SO5A 4ZFOA 1NCDL 2YPKB 3LIZL 5E70A 1L4IA 4DN4L 3WFEL 3RWJA 3MREB 1YEKL 3QWOA 1KELH 1C7SA 2XY2A 4P5KB 5DC0A 4U1GB 5C0DA 1H3UA 1RVFL 3VI3E 3BDYH 1VGKB 2MQ3A 2NTSP 3TJHC 2J3SA 3QWRA 2EEDA 4G9FA 3SE9H 1OTUD 3MNWB 3W2DH 4L3ED 4I8DA 2FX8H 2HJKA 3KPNB 4G8GB 4GS7C 1B0GB 3DROA 4FP8L 2NX5B 3BJLA 1Z2KA 1UFUA 5IR1A 3O8XB 4X6DB 1IGTB 2JK5B 3WD5L 2CD0A 3KNBB 4WUKL 1YEJH 4GXVH 4QKXB 1UB5A 5C8JA 4DVBB 4XHJD 2CRMA 4QHUA 1MJJA 3O9WD 1N6UA 4XZUB 4QF1B 4MJ6B 1GCFA 2HMID 2ADGB 3G5YA 4K3EH 4IHOB 4L3EB 2GUOB 4W70A 1GZQA 5D71L 1CICA 5I8EB 3WSQH 4LK4A 3C9NA 5I1KH 2XWTB 3CDGA 3MLUH 5JW3L 4Z95L 1K5NB 4CAGA 2V6HA 2Q7YA 1HKLH 1CD1A 4UQ2B 4ERSH 1F3JB 2HFEA 4LIQE 3OF6D 2BXZA 3EJYD 1S8DB 3NGBB 4OF6A 5D2NC 1MWAH 2I9TA 1ADQH 2YXMA 5IQ7H 3LEYH 3O9WB 3MTRA 3GMLA 1IAIM 4QHLA 1WVZA 4OCNC 2NY3C 3JWOL 4YGAB 2ORBL 4O2FA 2BNUA 2CDGB 4X9IA 3PUCA 4A6YL 2VLLB 2VUYA 3JTSA 5EOTB 2X41A 3QI9D 4Z5RB 3ARFC 4HFWB 5IF0B 3P30L 5CINL 3Q3GB 3OR6A 1LO5B 1X5HA 5HD8C 4ONHB 2P46B 3AREC 3MCKB 5GS1B 2EDOA 1PZ5B 5KANI 3ZKSD 2LVCA 3K8LA 4JPVH 3PF2A 3HZMA 3L95A 4P57B 4XP4L 4MA1C 3FT3B 3ZKXC 1KV3A 1X5KA 2AVGA 2X4PB 3K74B 2YS4A 3JV4A 4GW4B 2V17H 4UAOC 3BWAB 4WV1C 4DK3A 3WIHA 5D7LD 5C92A 4YO0B 2FB4L 4NQCE 3QI9B 4LLQA 3IVKA 3WNLA 4HH9B 1WWAX 1Q9KB 3DRTB 3IF1B 5HHXH 5F3BA 3PDDA 1MH5B 2VXTH 3GIZL 1A21A 1T2XA 25C8H 2OTWA 1W72H 5T3XE 1FGVL 3BJ91 3GUTA 1MQKL 3TH2T 2R2HA 1NC4D 5L0QC 4PJ5E 3MRMA 5EC2A 4Z7UE 4BUHA 1HH6A 4NHUA 3GM8A 4PGZA 4I0PC 3PV6B 5E2WH 3LV3B 4PRAB 1QNZH 4TN9A 3L7FA 4RDQF 3RWFB 2WWMD 2B4CH 3X12B 1I7ZA 1G7HB 3BQUD 4RZCB 1NFDE 1WAAA 3PHQA 2FSEB 1KB5B 4KXZH 5DT1H 3RU8H 1S7VB 1U3HB 2P5ED 1EO8L 4WUUE 3P73A 1JPGA 1OP5K 3WE6A 4Z0BH 4LVOC 4RFOL 3S34L 5DFVD 1A5FL 4Y4HC 4YHOH 4AL8H 5K59E 1MELA 4ZS6D 1YEFL 1IARB 4N1EA 1J0ZA 2DMCA 4HUNB 3BQUB 2P8PB 4BFIA 1U8LA 3BVNB 2ATPA 1P4BL 3SDCA 3RZCB 4OIBA 5BV7C 4PR5A 5A3ID 5DYOA 1A1NA 4BH8A 1HHJA 5D1ZA 1MUJB 2MWCA 4KU1A 4D0BA 1FORL 1T2QL 4DEPB 4XNYH 4PLOB 4QRSB 3MNZA 1MAML 4X0KA 1KXQE 4XVSH 2C5DC 3WO4C 3PGCB 3MV9A 1K8DA 1D5MA 4QXWA 4X7FC 2HT3D 5MEPB 1WJ3A 1U8PB 4UTAL 4ELKA 1G6RB 1LO3H 1JGDA 4UILL 3V5HA 4FS0A 3LS4L 4WNQB 4M6OL 3UTZB 1CGVA 1KCVH 5F6HJ 4KK5D 3DETC 3RWGA 4NOBA 1I8MA 1WIUA 3RHWK 3EJJX 2GT9B 1GGUA 3QR2A 3VWJC 4JLRA 1ZHKB 5DUPL 1MHPL 2Y7QB 2MJWA 2H9GA 3QIWA 1BX2B 4Q6IB 3RJQB 3GBNL 1IZJA 3R0NA 3FJTA 1RJYA 5LGKA 1MIMH 1X44A 4WEBH 1A7NL 1IAMA 2Q87A 3KDMA 5AG8A 5C0FA 3O3UN 2J8HA 3H7LA 5IW3A 4CNIA 1UYWL 3C6SA 3DJ9A 3OB8A 3GIVA 1LDPH 4JRXD 4ZOEA 4AIZA 5DJ6B 3O41A 1MHHB 5BMFH 3T3ME 4PRHE 3B5TA 5ID0A 4NJ9L 4MLSA 2EXWC 1DBBL 4BSVA 4OJFH 2VJXA 5E8OA 2UWEB 4C56E 4KDWA 3W0WB 1FHGA 3O3DB 4LPYA 2XN9B 4DUWA 1MCBA 1RZGB 1ND0A 3KYMA 3E6HB 1AD0A 1OLLA 1QFOA 1ZHBA 1ZMYA 2DLHA 3EDDA 4UUJB 3TPKA 2UUDH 4KRMB 1LILA 3RY4A 1CIDA 4JFZH 4HQQH 4X4MA 2HVJA 3ZT5A 5D7JA 1K6QH 3WMSA 2UY7A 1WFTA 3S35L 5T3XH 1BVKB 1JWMB 4LVNB 4GRWF 5FDYA 4Y1AB 1OB1B 4JFDA 4LSDA 4NKDB 2Q76A 4X6CB 2GITB 3TVMB 5FF6B 1VEPA 5EOCL 3OX8B 4YXLL 3EYOA 4FQ2H 4LGSB 4PUBH 4ZFZB 2ZUVA 4GFTB 4QTIH 4WI6A 4ZTPH 4OKVA 3O3AA 2JELL 1D5IH 1J1XL 5D6DC 2VLKE 4PJ8B 5AZEH 3VRLF 1QYGL 4KROC 4A2LA 4KI5C 3QIBB 1JPTL 1EHLL 1FRGL 3DPBA 2DMBA 5D6CB 4L4TB 5D7IF 1OT2A 4GUPA 1NC2D 4H5SB 1OAXH 3MRQB 4RGNB 5E99L 1YJDL 5HYSA 4PJCA 2DQCH 5TF1H 3R8QA 4NGHL 3D85D 3NZHH 3P0GB 4JVPA 5C6WH 4YK4B 1T03L 3GO1H 2Z31A 4IRZL 4Y2DA 5JR1H 4HJ0D 1GGIH 3VXMA 5IMMA 3BXNA 2BSSB 4ZNEA 3F65A 4QYOB 4YXKH 4FFZH 3T4YA 1KLFA 1N4XH 1H0DB 1HQRB 4G9DB 3CUPB 5JHDB 1NC2B 3WKNA 3QUKA 3EO1A 4U6TA 2OX5A 4DGVL 4JB9L 5MEQA 1ZE3C 2ZNWA 2E3VA 3MOQA 4DTGH 3QDMB 1CFSB 1FYTD 5C7XH 4OLZH 1RIUH 3MOBH 3VMPA 3LKPA 1OPGH 1S5IL 4ZUSA 3BKCL 4PBWD 1JK8A 5DK0B 5CSGA 1S7TB 2BVQB 5JPNB 4XNMB 3FQTA 4RMSA 3BYTA 3NA9H 4MA8H 1H5BA 2YHGA 3DV6B 3DX7A 4KFZC 4F7PA 4QWWC 5CD3B 3AU1A 3GJFH 1JHTA 1H3VA 4W6WB 1MCFA 1XGPB 2EH8H 2DQFB 4M3JA 1DVFB 5DJ0A 1WTLA 1HEZB 1HHIB 3WUZA 2HA1A 1SJXA 1YEGL 1TJGL 3I6KB 4FRWA 4KKLC 1OAUL 3D39B 4OQTL 4HMEA 3KVQA 5CMAB 2QTEA 3E2HC 5BVJA 5INDB 1M71B 4HCRL 3T3PF 3VFNA 3NFSH 5IW1B 4ZFOB 5T33L 1J8KA 3RWJB 2NY5L 3IDNA 2Q8BL 3QWOB 3MRJA 4AEHH 5DD3L 3KPRD 4GSDL 5E2TH 4LSVL 5ALBL 1DBMH 5H37H 3HAEH 2BHYA 1QA9A 4G9FB 2OZ4A 2DQJH 2W9EL 35C8L 4NO3A 3DUUA 3U48A 1U93A 1UEYA 2HJKB 1FCGA 3DROB 5IR1B 3R06A 2R9HC 5CGYC 2NXZC 1ORSA 1IGCH 1KEGH 1S7UA 4PGEA 1UB5B 4XMKH 5BVPH 2OJZH 2RIKA 4JKPL 4QHUB 1MJJB 4KAQH 3VG0H 1AO7D 3KPRB 5FHBL 4GXUM 3BH8A 5DJAA 2WUBH 1NFKA 1Q38A 2ADFL 4KK8D 3G5YB 4OZGF 4LFHD 4X9BA 4KJPD 4WTXA 1W72L 1GZQB 1M7IA 4N0UA 1E4XI 4G6AC 5T1LA 4X83A 3RIAK 1CICB 4HWEL 3SE8H 3LAFA 2ILLA 1BHGA 1DQTA 3ULUE 3IFOA 2Q7YB 5GQBA 1CD1B 1VENA 2HFEB 1QNZL 1WWWX 5HVHB 2IWGA 4MQSB 3WUWA 2RFXB 4NNXA 3UTTA 1FO0L 4KC3B 2D31A 3MLWL 4L5FL 4ZXBC 1AO7B 3GMLB 3GBML 4JGUA 4QHLB 2O5YL 3S7GA 5DF0A 5EZOH 1DQMH 4L4VA 1RZFL 4O2FB 4AEIH 5DHYA 2CO6B 1A6VL 3RI5K 4EXPX 3JTSB 1FO0B 4G5ZL 4JFXA 5H37G 3HAEG 4O9HL 3GMNA 2LAGB 3OR6B 3WKML 4Z7VE 3T08A 5C2UB 1FVDA 1Z9LA 2Q3ZA 3ZSTA 3AC0A 3OKYA 4NO0D 5D7SH 2E6QA 4JREC 1Z6JT 3WIIL 5HHME 5HHPA 5I1EH 3L95B 3OJMB 1A1MB 3TM6A 4GAGH 5I8KH 4XNXL 3JV4B 2BC4A 1RUQH 3NN8A 2BVTA 3H3BC 1NBQA 4PGCA 3VD4A 3B2VL 3Q1SH 5F96H 3FFCD 4QNPF 4LLQB 3IVKB 5JOPE 2W0FA 5I15L 5F3BB 2C1PA 2O26U 2OTWB 5DWUH 2E7LC 3GUTB 1BFTA 3TA3D 2R2HB 4HFUL 4LIQL 5EC2B 4UT9H 1HH6B 4J23A 4NHUB 2XWBB 4Y19D 2Z92A 4PYGA 4FQIH 2NX5E 3TT3H 4TVPE 4FG6C 3NIFF 1KCVL 1XCTA 2VAJA 1X5FA 1I7ZB 4LARH 4PG2A 3MLRH 2NY4D 4JQIH 5L8JB 2C1OA 3PHQB 5FECA 2B20A 2O5XL 4U1NB 5BZDA 2VDLH 3PWVA 4WHCA 4Y8AA 1WQVT 1KYOJ 3BIBX 1ZVYA 4EBQL 4JGJA 4J3XA 3U1SH 2OLDA 4RGMC 1JPGB 1S7QB 1IFHH 3WE6B 2IBZY 4M1GL 1ZHNA 3BN3B 3Q2CA 4PJDA 2EEAA 3SE4A 2A77L 3B9KD 3P0YH 4F57L 4OZHE 5GGTL 1TFHA 4Y19B 5DURB 5L7XH 5BMFL 1I9JH 4X6EA 3MV9D 1G0DA 1JGLH 1TZIA 5C0EA 1L0QA 3T77A 1MIEH 1RJLA 4IRSD 2FX7H 4WU5B 5MP6H 1U8LB 2NY4B 3I6LE 4YQXH 2ATPB 3TGXA 3SDCB 4HUXA 1IC7H 3CC5A 4FMFA 3AM8C 5DYOB 4OI7A 5DO2D 4MCZA 1MLCA 3OZ9L 4N68A 4BH8B 1MJUL 5EULV 1TNNA 5D1ZB 3IDUA 3TCXA 1NSNH 5DJZB 3NTCH 3BIAX 3VWKA 3QIWD 3U9PH 3V79C 4M02A 4P2OD 4R26H 4I3SL 3UPAA 4RAUA 3ULUH 3MV9B 3RAJH 1DQQA 2MKWA 1D5MB 4JCMA 4ZO7A 1R3HA 1B0RB 4ELKB 3FHQA 4UZGA 1CBVH 1JGDB 5GISL 3V5HB 1RPQA 3INUL 3JWDL 4LOUC 4QRPD 3GMOA 1R3IL 1NGQH 1YA5A 2EE3A 4WEUD 3HLAA 4OUUB 5GGSY 4UOJA 3QFJA 1G0XA 2FECI 4JLRB 4O58L 3DX8B 4M5YL 4PJEA 3F5WB 2H9GB 3QIWB 5HI3D 1Z3GL 3ZYJA 5MI0B 1SQ2N 3MNVA 2FGWH 4G6JL 5D7JD 4X4YA 3NZHL 4PJ7F 5GRZA 2B0SH 1YEEL 2RGSA 1Y6MR 2YMXL 3JV6A 2BMKB 5C0FB 4CNIB 1FFPB 3GO1L 1MFCH 1LGVA 3GIVB 5FCUH 4NFDA 4AIZB 1CTOA 1GGIL 2EDQA 3O41B 3O45A 4JFDD 4WI2A 5D4QA 2O93L 2J8UF 1UZ8B 4X98A 1F11B 5ID0B 4NZRH 4Y5VA 3CH1A 2C26A 4BSVB 3EGSA 1KCLA 5FYLE 4YXKL 3EDFA 4E41E 1N4XL 5FV2A 5E8OB 3MJ8A 5J4MA 4JPWH 2HLFC 3HI1A 5FUOL 1KJ3H 1U6AH 1ND0B 1JPST 3KYMB 1AD0B 3OJDA 2GTWB 2H2PD 2OJEA 2CUHA 1XF3A 3SGJC 5CILH 5D7JB 1HE7A 4TPRH 5KSAA 1ZGLB 4Y16C 4GJTB 3KJ4C 1F4WL 4JFDB 5ESQA 4MAUL 2Q76B 1OPGL 3O2DL 3C8HA 1X5YA 3RVUC 4TVPH 2EDJA 3EYOB 1RZKH 2B1HL 4Y2DD 5FKAA 5TF0A 4HS8H 1LNUA 5IIEA 3O3AB 4TSAL 1NL0L 5IVXA 3RBSA 4MS8C 2Z93A 3PWNA 2R4SL 3UBXG 3LZFH 4Z6AT 1VSCA 4GMSL 1MPAH 4PRHD 4KVNL 3TBSA 2W9LA 3KR3H 4GUPB 1OCWH 5GRJL 4OKDA 4TULH 2D0HA 1QKZL 4FQXD 4GOSA 3NBNA 4JO3H 2FBJH 3DGGA 4X8JA 3BD4A 5HYSB 5IBLD 4OIIL 1CQKA 4PJCB 5IHUH 2BFVH 1MCLA 3MV8D 1IEBA 2IANA 4HWBH 3V0WH 5BQ7A 5GGQL 2CXKA 4HIHA 1EPFA 4Y2DB 5D5MF 4X99A 4XPAH 3QHFL 1BVZA 4WTZA 3QQNA 3VXMB 5IMMB 4DN3H 4NN7C 3BXNB 2E7MA 4OLUL 2VXQH 2VOTA 3T4YB 3WXVL 4BKLA 1MFDL 1FSKC 4XNUH 5FYJD 2IQ9H 1JYNA 3MC0A 4FQXB 3QUKB 3EO1B 4FFWC 5DMIH 4NQVA 3MV8B 5I74C 5MEQB 2NW2B 4KMTL 2YEZA 5D2LF 2R56L 2VABA 3K2MC 4LRIA 4YHNA 2X5PA 3MBEA 4O51A 2A9ML 2AK1H 4AIXA 4ZUSB 3ZZ1A 3GBLA 1A7RL 1JK8B 4ELMA 2VN4A 3FQTB 1BIIB 3C6LD 4MHHI 3VI4F 2KBGA 5IP4A 3DX7B 4F7PB 2UWEE 1QRNE 3AU1B 2C3WA 2VDKL 3HE6D 3O3EA 2XN9E 4I3RH 4U33A 3SE8L 4OD2B 5DJ0B 4PYHA 3TC9A 3D0VA 2FHFA 2XWJA 3GK8H 4DK6A 1MFEL 4UMGA 5SWZA 1DSFH 1RFDL 5ITBH 1N6VA 1EMTH 2ENSA 1L7TL 1NLDL 1MCSA 1D9KC 2J6EL 5BVJB 5I1AA 3H9SA 1ONQA 3DSFL 2DQIH 5FYLH 4OUOA 3HE7C 1C5CH 5TDPA 3FO9A 3QSKB 1RIHH 3DMMC 3IDNB 4JM2A 3MRJB 1NCAH 4D9LH 1KACB 5DQDL 1A7QH 3CCHA 5TQ0H 1I7UA 1QA9B 4IDJL 1BJMA 3SDXA 2KUTA 5K9KB 2AGJH 1KIPB 4PJXA 3WNOA 3FQNA 4NO3B 1KB5H 3DUUB 5D7SL 1FDLL 1OTTD 3PGFL 4OB5H 1U93B 1QFUL 2VLJA 4L4TE 1IT9H 3H8NA 3R06B 4PTTA 3CFKB 1ORSB 4KHTL 3QCUH 1GSMA 4ZFFB 2R8SL 1A0QH 5I8KL 1S7UB 4ZMAT 2DQHL 4ISVA 4PGEB 3RPIA 3QG6A 1U92A 1I1YA 1LP9A 3LN4A 3KYNB 4JANA 2SEBA 3QQ3A 4JFQA 4NN6C 1OLZA 2E27H 3WN5C 1S9WB 3BH8B 5DMJB 3MRPA 4GO6B 5DJAB 4KVCH 5TPWH 2FGZA 5EUOA 3L3DA 1T0MA 3G6JB 4R4BA 4YH6A 4QRRD 3RVXC 1M7IB 4N0UB 3RNQA 4F9LA 2X1XR 1X5GA 5T1LB 1I1AD 5F97E 1BECA 4NWUH 3RUGA 3IFOB 4G80A 4V1DD 2GHWB 1IILE 4RMUA 1BLNA 2YPLE 1R3KA 5I9QB 4HG4J 3WUWB 2BRRH 3ILQC 4J3VA 4NNXB 1JGEA 4O2CB 3UTTB 4JRYA 1KG0A 3MUHL 3ARTA 4HAGA 1JBJA 1B6UA 4WI7A 1G6RH 3FQRA 4L4VB 2VDLL 1G7QA 4BZ1L 4QRRB 3EJZC 4NZTL 4JFXB 1I1AB 3GMNB 1FVDB 4S0TD 5IW6A 2K7QA 1T89C 4OCWH 2J8OA 5TDNA 4N8VA 5HHPB 2CPCA 1GIGH 3OHXA 3V6FA 1K4CA 1KSRA 4GW5A 4P0DA 2YD3A 1OTUC 1XIWA 5MP6L 2AV7A 1F8TH 4CBPA 3QDGE 3NN8B 2M26A 2ADIB 5D96C 5C6PB 3L3GA 4PGCB 4TSBL 4HK0A 4RX4D 5FGCE 3BAEL 3ZDYE 1II4E 5FK9A 4U6VH 3DO7A 4Z7OE 2W0FB 1J1OL 3O6LH 2VH5H 1ZVSA 1EGJH 4U0RB 1KBGH 4XHJC 2C1PB 4X6BA 1XR9A 3WFZA 2OCFD 4GKNA 4YEFA 3IDXL 3RAJL 4YHZL 5I0DA 5ESVA 3MYZA 2QADD 1JNLL 3DYPA 2HMIC 5I1CH 1CBVL 2Z92B 4M61A 1WC7A 1N5YH 1XCTB 4ZUVA 1BD2D 1FZKA 5DHXB 3I75A 4L8CA 3PJSA 4NM8H 3VXOA 3HG1A 3JWOC 4H20L 4HBCL 2C1OB 1QFPA 5FECB 3KYOA 4QOKA 1DCLA 5BZDB 1QLEH 3PWVB 5C1MB 3EYVA 4AEFA 1OVZA 3S36X 3GMQA 1ROWA 3LOWA 1ZHNB 1NCNA 1UJ3B 4M48H 1TETL 1MFCL 5FCUL 3ARGA 1R0AH 1XGQA 2NXYD 5DC9B 4X6EB 5GZND 1TZIB 4TQEH 4EQ2A 2MOVA 1BD2B 1QLRA 1YEDA 3QXUA 4WGWB 4Z7QE 5I6XC 1IQWL 1NAMH 4PD4J 1NAKH 3SDYL 2OQJA 4B50A 1KJ3L 1U6AL 3U7WL 1F4YH 5KVGL 1SM3H 3CC5B 4OTXH 3GJEA 1SHMA 2R0WH 4MCZB 1MLCB 5JLZA 2FD6H 5FUCC 4JDVA 4XTRD 1U58A 3VWKB 4TNVF 3MJ6A 1PJ9A 2NXYB 3TP4A 2CK0H 4RAUB 3V5KA 3UJIH 1DQQB 3G9VA 1R3HB 1NBZA 1RZKL 4NHCH 1FAIL 2IG2L 1DQJA 3GMOB 3OKEA 3P11L 3HLAB 3LZFL 5CP7A 4YHIA 1FLRL 1MPAL 3OAUL 1BZ7A 3HMXA 2HJFA 3QFJB 1TQCC 3FONA 5DD6A 5F3HA 1OT1A 4PJEB 1S3KH 5LGJA 1WT5A 3BEWA 2DQGL 2ZJSL 3I6LD 3FZUD 2BFVL 4I13B 3MNVB 5JTWA 4YDIL 2WWMC 5KSAD 1I3RA 3JV6B 4X7SL 5HHQA 1VPOL 1A4KB 2J5LC 5F1KC 3RHWF 5EUKA 3O45B 4N5EC 2DDQL 4GBXD 4X98B 1BFVL 4HC1L 4CMHC 4LPWA 3BT2H 4RWHA 4Y5VB 3CH1B 4F7MA 3EGSB 4P2YA 3NAAH 2W1NA 2PW1A 2VXSL 3MJ8B 4JKMA 4N9GA 2AI0H 5DFVC 5E00B 2DF3A 1TTFA 1T2JA 2VXVL 2IQ9L 3HI1B 4C58B 4ZFGH 3OGCB 2NY1D 2QLVB 5KVEH 4NWTH 3OJDB 2OJEB 5I1LA 4DGYL 4WCYH 1BF2A 4RNRA 1XF3B 3FB6A 3LKQA 5KSAB 1WTGT 5I1DA 1IBGH 5J11C 3SGKA 4YFDB 2FHCA 4KHXH 4G8IA 1YY9D 4D8PA 5C3LD 5ESQB 5A3IC 4FQ1H 2QSCL 3VXUD 1P4IL 4PG9A 3VG9B 4XX1G 1PLGL 2ICWJ 3A6CL 5F7MC 4LMQI 1A6WH 2Z8RA 5FKAB 3HNTH 1LNUB 4QRUA 5I73B 5IIEB 2OK0L 1IKFH 3HS0A 4JPKH 5IVXB 2OXGA 2Z93B 1SYVA 4I3RL 3TBSB 5H35A 3PHOA 5J1AA 1NGYA 5ACZA 4FXLA 3QNXA 5J6GA 2XXCB 4E41D 5JMRA 4RBPH 3GK8L 3S37H 4PLJD 5E2UH 4MQTB 4X8JB 4QGTA 3DGGB 2YD9A 1A6ZB 4S1RH 4KK5C 5I1JH 4ZTOL 1AHWA 2OR8A 1IEBB 3LPGA 4B7IA 2IANB 4GKZA 5BQ7B 3ZMRA 4HIHB 5EU6D 4IIQA 2EYSA 4X99B 4I48A 3KYKH 4XNQA 3FOLA 3MO1A 1NCAL 4D9LL 1KC5H 1Q8MA 5DJCA 3MQIA 3VFWA 4LKXA 4IJ3C 5IFJA 1DBJL 4BKLB 4ZAKC 2QSTA 5HDBE 5HDLA 4CN6A 1G7IA 3T0DA 4OI9A 5JXAL 2D2OA 1J5OH 2MQ0A 5IGXH 1SMAA 4OB5L 5HVWA 4DFHA 4M7KH 2QKIA 4JY4A 1CDCA 4NQVB 2Q20A 4WGVB 2XFXA 2C3XA 1PG7X 4HHAA 1Q72L 2EE9A 3B8SA 2HTKC 2LU3A 2YEZB 3P40A 5L2KE 4DW2L 4KQ4L 2JCCF 5FAAA 4YHNB 4XBEH 3MBEB 4O51B 4KV5F 4LP4A 8CGTA 1CF8H 3GKWH 4KKNA 2HKFL 3RWCA 4IMKC 4ELMB 1OGAD 4KVCL 5CJQH 2OSLB 4NO5B 3MRLA 3BP6A 4EN3A 4KK9D 2ED7A 5JIHA 2QL1A 3O3EB 3CX5J 3WIHH 3EOBA 3DRQA 4TUOB 4KZDH 4NWUL 4R4ND 1MF2L 1YJDC 3D0VB 3K1KC 1MRFH 5SWZB 2KKQA 1A02N 1N2RA 4B7LA 5C0BD 1Q1JL 4F9PC 5I1AB 4MA3A 3LN5A 4RGOH 4YDKH 4Z7NF 3H9SB 1U8KA 3SKOA 3MGAA 1I9EA 1ONQB 4HV8A 1J11A 5C07A 5TDPB 4DKAA 3ZTJH 1YNKH 4XMLH 4JM2B 5C0IA 4HKJA 3SO3B 1N7ML 4WO4A 2YK1H 1M6OB 3CCHB 4KTEL 1I7UB 2FJGA 1RMFL 4HJ0C 4PJXB 3FQNB 3QUML 5E9DA 1DL7H 3E8UL 2F15A 1E4WH 4OZIE 4OCSL 2VLJB 1JI2A 1PX3A 2F5BL 3BP5A 5GIRA 4XCCH 1RY7B 3QHTC 1FV1A 1ZS8A 1GIGL 4PTTB 4FTVA 1UB6A 3GNMH 1NCWH 4K7PL 3LQAL 3QUMB 4PP2A 5FIEA 5E5UB 4EOWH 3RPIB 3U36A 4I4WB 3RGVA 1U92B 1I1YB 1LP9B 3LN4B 1DLHA 1UXWA 1YEIH 4JANB 2SEBB 3QQ3B 4JFQB 4XAWL 2W91A 2WP3T 3MRPB 4XPTH 3VXME 3OBAA 3RDTC 3TCLA 1VFUA 1BREA 1TXKA 5GJTL 4HJJL 5EUOB 3L3DB 1T0MB 3HR5A 1AE6H 5E7BA 2FH6A 2BVUA 3BSZL 3RNQB 3VJ6A 1JFQH 4FQCH 2GK0B 2GJ6E 5GGVH 3GI9L 4Z77A 3NH7H 3T0EA 2QSVA 3RUGB 2A6JA 5C2BL 1JGUL 4G80B 3VH8A 4ODUA 1BLNB 3U0WL 1R3KB 4ODBD 2FATL 3RWEA 1JGEB 4JFFE 4JRYB 4NM8L 1KG0B 4QHKI 1J0KA 3RIAF 4S1SH 2NY5C 4P9HL 3BPNC 3ZTJG 3FQRB 4FHBD 1AXTH 1G7QB 2CLRB 3D9AL 3NACL 3NCCB 3U2SA 4XVJL 2ZUTA 4UV7H 1A3RH 3O2WL 3REWA 3IAGC 5IJVB 5IW6B 1A6PA 1WZ1H 5ALCL 1CN4A 2D7TL 4MA7H 4E5XA 3VU2A 4N8VB 3OHXB 5IM7A 3RI5F 1K4CB 3V6FB 1Q0YL 1NAML 4GW5B 2FIKA 1NAKL 1XIWB 3WJJC 2AV7B 1T1XB 3EO9H 4L8SC 1TENA 1CLYL 4S10A 1FNGA 3L3GB 4MVBC 4HK0B 5DMGD 5HI4D 2BSED 1BBDL 1G7JA 2AXGA 4LPTA 5FK9B 5KN5A 3U0TA 3DO7B 1B2WH 3OB0K 1F4XL 1F6FB 2XPGA 1FLTX 5A2LH 5D70L 3VGBA 4X6BB 1XR9B 1HSBB 3BGFB 1QSFA 4XPGH 2GCYA 5KG9B 4Y2OA 4ETQA 5BOPA 5CBAA 5DR5H 5ESVB 4ONFH 4AMKH 1U91A 4LDEB 3O81A 4M61B 4S1DD 4YIQA 5IFHH 2B4CC 1WC7B 2Y5TA 4ZUVB 2BSRA 3S3SA 1FZKB 3OKOA 1W0YT 3RNKA 4L8CB 3PJSB 3X3GL 3VXOB 5D2NA 3HG1B 2HVKA 3GKZA 1DEDA 1T4KA 3KYOB 4QOKB 3V4PH 4KXZI 5INCA 3EYVB 4LEXL 3QDGD 3CFCL 3J8F7 4NO2A 1IGIL 2H26B 1SY6A 1G7PA 1EO7A 2XQBL 4R97C 3ARFA 3DUSA 3DTXA 1CU4H 3ARGB 3AREA 5IBUG 5TQ2L 2AQ2A 3RWHA 1XGQB 4DUXA 4LF3B 3BT2L 1UACL 1NKOA 4GAJL 3OKNA 2MPAL 1PAMA 1QLRB 1YEDB 2P8MA 4P9ML 1FZOA 2K3TA 1OF2A 2NLJA 1AIFA 2R23A 5A2JH 2F8XC 2D9CA 2WBKA 3VXRA 4IOSD 3MV7E 3IJSA 5CD5D 2WK2A 4ZFGL 3UTTE 3RJDA 1CK0H 1KUMA 2ZCHH 3GJEB 1MCIA 1F42A 5JLZB 4Z18A 4L1HA 1SJEA 1U3YA 4WV1A 2VR9A 5CZKA 4JDVB 4JR9L 2NTFA 4DKEL 2JB5L 2H6PA 1U58B 5KW9H 3D2UD 2XTJE 1ZLSH 3I02B 5C71A 4PRNB 1KGCE 5E7FA 5HHNA 4YC2C 2VLRA 4D94A 1G1CA 3ARDD 5JW4M 1NBZB 1VESA 4ZDHB 4KJQC 4G6ML 1IKFL 4I0PA 3TLRA 2VN7A 1DQJB 2W0LA 3OKEB 4P2QA 1VACA 4Z7UF 3TA3C 5CP7B 4YHIB 3ZYIA 1BZ7B 2HJFB 4ZO6A 3FONB 5DUBA 4RBPK 5DD6B 1DFBL 5F3HB 2AERT 4X4XA 3TBYA 1CXKA 2VL5A 5E2UL 5LGJB 2AXFA 2H45A 5FYJH 3BEWB 1INEL 2B5IC 1A7BA 1QLFA 2O5ZH 3GSXA 3NPSC 1NCTA 2F19H 2GIYA 1JZ2A 1WISA 1I3RB 1NFDF 2YUVA 3GRWL 4DJMA 4LLMA 3TBTA 3V6BR 2D7QA 3WDHA 1L6XA 4FFVD 4Y4HA 5EUKB 2WAHA 5HYSG 2YA0A 4WFEE 1AP2A 3TYFA 3W82A 4R6UA 5KAQG 1DLFH 4N9GB 3B9KC 5GS0D 4YBLB 5KOVC 2KDGA 2HLAA 5DK3A 5K59F 4NZUH 4E0RA 2VB5A 5ISZA 5D8JH 5I1LB 5I75B 1BAFH 4ESKA 4RNRB 3FB6B 3LKQB 3RTQC 3WLWC 3EYSH 3S5LA 1PFCA 2PYFA 4IRSC 3MA9H 2QJDA 5IESL 5M94B 1B9ZA 4RFNC 5GS0L 5CKAA 5E8NA 4D8PB 1EERB 4LCIL 4LLYA 1EJOH 4PJDE 2XNAA 3HUJE 3F6LA 3GKWL 3T1WA 2A2QT 3JWDC 3QZWA 5CJQL 3BO8A 3SKNA 4QRUB 3VGDA 3HS0B 2A9NL 4P2OC 4AH2B 2ZWLT 3QBTB 1LE5A 3T4AA 1SYVB 1PGRB 2E6JA 5H35B 1QQDA 3PHOB 5J1AB 5HYJD 1NGYB 5ACZB 3QNXB 2BY2A 5J6GB 5EFIA 3LHPL 4BZYA 4Y4KA 1WUNT 1E28B 1AHWB 5F8RC 4ODVL 2D0FA 4PJCF 5EZJA 1WK0A 4CL7A 4GKZB 4WU7A 4Q7DA 2DMKA 1C7TA 3STBA 4IIQB 2EYSB 2ENYA 5HI3C 4I48B 1NANI 3MODH 2MNUA 2P4AB 3FOLB 4XNQB 3MO1B 5ETUA 3IXTA 4JO2H 5DJCB 3VFWB 4LKXB 3PWPA 5IFJB 3LDBC 3T3MF 5FGRA 4NQSA 5BS0A 1TZGL 1UJTA 3LMJH 1PEWA 4G42A 4UOW0 3MSPA 3SCMD 1KCRH 3H42L 1G9ML 4MXQD 4XCCL 4XMPH 3CMGA 2QKIB 4JY4B 4LPVA 3GNML 2NNAA 1NCWL 2XFXB 4HHAB 9CGTA 2ESVE 1AKJD 2JJTC 1ZGLM 4EOWL 2AJSL 2H2PC 2K1MA 3GSVA 2I60H 4OBRA 1FC2D 2ZCKH 4RMTA 4K7PY 4YX2H 1P69B 4IOFC 3ZTNL 3RWCB 1N0XH 2PR4H 4XWGH 3QAZB 5C07D 4K2UL 1HZHH 3MRLB 3BP6B 1X5LA 4EN3B 1JYVA 4Z8FL 1B6DA 3HR6A 2WIIA 5KTEH 5D6DA 4WO4D 2QHRH 1JFQL 3EOBB 1U8IA 1AXIB 2F53A 3DRQB 3FB8A 5CGMA 4XCFL 4HDIA 1RZJL 3NH7L 1AR1C 2P44B 1A8JH 4R3SA 1AKJB 1N2RB 2C3GA 3F6IA 1LVEA 1YN6A 5ICYA 5E6IC 4NRYA 3FL7A 4MA3B 5FKPA 4S1SL 1U8KB 2EC9T 4RMVA 4HV8B 3SKOB 4FQXC 5IUSA 3WFBL 3CZFA 4NUJA 1T21A 2FYYA 5C07B 2JB6A 3HPLA 4OFYA 1FZMA 4BSJA 3WUWG 5L2KD 1C5DA 5C0IB 4YHMH 4HKJB 4I2XA 5I2IA 3F12A 3WNPA 1ETZA 2AK4E 1MREH 1FH5H 3WNNA 4WO4B 1A3RL 3PWUA 4NUGH 1OARH 2C4FT 4OV6F 1VKXA 4R0LC 3K46A 4PGJA 1T1WB 4EI5D 2P43B 5E9DB 1H3TA 4M8QA 3L1OL 5D1XC 4MA7L 3EDJA 4LCWE 3BP5B 5GIRB 1FV1B 2AEPL 15C8L 4BYHA 3QB7C 1C1EH 2J88H 1UB6B 2YD1A 1CE1L 3UYRL 4PP2B 4ZO9A 3F58H 4UIMA 5JO5B 3RGVB 4XI5C 2IANE 1DLHB 3ABZA 1UXWB 4JFYA 1F6AA 3OAYK 5DJXA 1OY3B 2F54D 4KRPD 5HI5D 3UTPE 4ZYKA 1MNUL 4DVRH 2MHAA 2NY0B 3TCLB 1KJ2A 1XR8A 1AFVL 5JW5A 3HR5B 4F2MA 3BRFA 4JRWA 3G6JF 5MHSE 1FL3A 2Y1VA 1FIGH 3VJ6B 1KTRL 1CDGA 3TJHD 3HC3H 4YDJA 4Z77B 3T0EB 3V2AR 1TJHH 2A6JB 3C6LC 3VH8B 1T66D 4ODUB 5A2IH 5IFHL 3VFRA 2V2XA 5TH2B 3KLHC 1A22B 3HE6C 3DX6A 2FR4A 3RWEB 2AABH 3N1PC 2F54B 4OM0H 2PTVA 3R1GL 4HMDA 4PREA 3MLYH 4UB0L 2IF7A 1F90H 3IDIA 2WW8A 2Y36H 5KZCD 2L7UA 4AJ0A 4ELME 4TSCH 5E24E 3MACH 3U2SB 4NRZA 3V52H 2OBGA 5IB3A 1NGPL 4DAGL 3U82B 1EBAA 2Y6SC 3REWB 5J13C 4MJ4A 5CJXC 1A4JA 1CU4L 2E9JA 1EHAA 4N0CD 1YEHL 3ARWA 4QXUL 4JFOA 4LSSH 1PZUB 1CL7H 3MOAH 1DQLL 1CGTA 1PY4A 4E5XB 3UTSA 1REIA 1A3QA 5IM7B 3MRRA 4GS7B 4NP4L 2FL5A 3ARRA 2FIKB 1T0PB 1UWEL 3BRGC 5CZVH 1FNGB 1OTTC 2HT4C 4P46D 5ILTH 2OP4H 4BQ9A 1S7WA 3CVIL 4K9EH 4MXVE 1XZ0A 1OM3L 1G7JB 2AXGB 1DE4A 1DBAL 3VE0A 3U0TB 3QDAA 4C4KO 2IPTH 2XPGB 3SDAA 4YAQA 2NY3D 4R2GD 4FNLH 3PWLA 5DTFA 3SDXE 3U7YH 1QSFB 1YPZF 1EZVY 2DLIA 2GCYB 4PV8A 4S11A 2FIRT 4FQQA 4PBXA 1A6TA 5CBAB 4Y5XC 4JN2A 5KSUA 1MJ7L 3SKJH 2FBOJ 1V7NH 1U91B 2VLJE 3ARED 3SKMB 4YIQB 3MPCA 1RUAL 2Y5TB 1I1AC 2EH7L 3OKOB 3RNKB 4AEEA 5D2NB 2HVKB 3KAAA 4P4KC 5E94B 4JFHD 4K3GA 4ZXBA 5BCAA 1KT2A 1FP5A 1T4KB 3B5HA 5HPOA 3I9GL 2HH0H 4JN1L 1UWXK 2NY3B 1KN2H 3MLVH 2O5ZL 1HN1A 4NO2B 2F19L 3LH2H 1IQDA 1G7PB 1TVDA 5CEZD 4W4OC 3ARFB 3DUSB 3FMGL 1KULA 3DTXB 3AREB 2E7CA 3RWHB 1J0JA 4U7MA 4LL9A 4KK6C 3OKNB 4HXAH 2NY7H 3V5DA 2P8MB 1FZOB 5FM5M 1OF2B 2NLJB 1AIFB 2R23B 4OZGA 5CEZL 4P59H 2YN5A 3VXRB 4YEEA 4I0PD 3IJSB 4MA1B 3TFKC 3ZKXB 1MQ8A 3QEGL 3IAPA 4UAOB 1D3CA 3KPPA 1SJEB 4WV1B 5IMLA 2NTFB 3HMWH 3JSSA 3MA9L 2H6PB 1B88A 4KY1H 2WINA 1IGFL 1DQDL 5HHNB 2VLRB 3QJHA 2E7LA 4OGZA 2X09A 5L0QB 1DUYA 1IGMH 5FYKD 4OCMC 2OMBA 1V8HA 1U2CA 5DRXA 3NABH 1Q94A 1OP3K 5LXGH 4I0PB 1CFBA 1VACB 4D9QD 4YHLH 1UJ3C 4JO4H 1TLKA 2W9DH 2YD4A 2QADC 4UTBL 5DUBB 5SWSD 5FUZL 1JI1A 1UCTA 3LD8C 5FOJA 4X4XB 3TBYB 4UNTA 2AXFB 1FFNB 1KIRA 2IGFH 4PJEF 3MV7D 2W07A 3LKNA 3RZWA 3GSXB 4XXCC 3LEVL 5F7FA 32C2A 5ERWA 5BZWA 1CDJA 2E9BA 3PDOA 2XZAL 4PLKC 1WCQA 4QTHA 4LVOB 3EDEA 3FN0L 4IDLA 4Y4HB 1ZLUH 4KUZH 4QHNB 4OI8A 1CGSL 1N64H 5EN2B 4YHKL 1BBJA 1AP2B 3KG5A 1KGCD 2PTTB 1P53A 1J1PL 3TYFB 1JL8A 4LRNL 4G8EA 1L7IH 5KJRL 2HLAB 3DLQR 2WWKT 3I3BA 4E0RB 3VMOA 5ISZB 2VR5A 4HS3A 1GJIA 1KCRL 4K23L 3V6ZA 5BV7B 1U42A 4QOKE 2R0LH 3AM8A 4NC2B 5DJ2A 5GSVA 5I18L 5EZIL 2PYFB 4RISH 3VWJD 4M8VA 4MJIA 5LWYL 3BD3A 3MBXL 5E8NB 2VDNL 4LASH 3UC0L 2IMMA 2PKDA 4U4BA 8FABA 4LLYB 1NGWB 5BO1L 1SEQL 1VGEL 1JV5A 2XNAB 5L88L 5F1IA 1RZKC 4R7NB 1DDHA 3WO4B 4JG1H 4FZ8H 1J05A 2BOBB 1VHPA 3U46A 1PY9A 3T04D 3BO8B 4V2BA 3SKNB 1RIVH 1HZHL 1U95A 4NOFA 4OV5B 3ZT6A 5FV1L 3V9FA 1KCSH 1LE5B 2DBLH 2FX9L 3T4AB 2EXWD 2QHRL 5IVXF 4F3FA 1AI1H 1HILA 1YYML 1QQDB 3MROB 2CKBL 3L5XL 4KRNA 3D1MC 3VWJB 1QOKA 1TPXC 3D3VA 1ZHLA 3EOTL 3VXSE 5IVZA 1BM3H 1FGNH 4J3TA 2CKBB 2YWYA 5EZJB 2F5AL 2WZPD 1LO4H 4OCYH 1JN6A 4WU7B 1MI5D 3MLZL 2EYRB 3DBXA 4ZUWA 4M7LT 1F13A 4PB0H 5C6TL 2A1WH 4LHUG 2H3NA 5ENWB 5ETUB 2WUCH 1CLOH 4JO1L 1T22A 3PWPB 5ADPH 4NUGL 4WWKD 3SQOH 4NQSB 5BS0B 5GRUL 4G42B 1ULVA 4GBXC 4OLWH 4HPYH 4HWNA 2VDPL 3KLAB 3GHBL 4QCIA 5JA9A 3CX2A 3WNMA 2DTSA 4KROD 1C1EL 4KI5D 3SGJA 5I73C 3HKFA 3PGDA 3DXAA 1MI5B 4Y16A 3KWWA 1MLBA 3IXAA 4PJIE 2NY1C 5TGBA 2YD6A 3AB0C 3JUYA 4JDTL 3GSVB 1RQ5A 3TYGL 2D0GA 3QDJA 5F7YC 3EZ8A 4CU8A 1PYWA 4I18C 5IHZA 1MRCL 4TUKL 3W9EA 5F7EL 3DGCR 2OR7A 1YY8A 2WANA 1YY9C 4JM4L 2EKSA 3V4VL 4PJ7A 2WIIB 1ACYL 4DZBA 5C0AA 1BGXL 4PTUA 1U8IB 2F53B 4NJAL 4QXGH 3FB8B 3QUXC 4HDIB 3V6OE 3X13A 4KROB 3SPVA 2EE6A 1WIPA 2J8UA 1GOHA 5I19L 5LJYH 1Q9LA 3U4BH 4R3SB 3DNKA 3MZTA 3ALXA 1QFWH 1J8HA 1EDQA 4HUUA 5TE4L 1N26A 1YN6B 5ICYB 1CVRA 4OM0L 5EU4A 1YYLH 2LU4A 4H88L 5FKPB 1YDPA 4PLJC 3CZFB 5JZ7C 1T21B 2FYYB 2VKXA 1KB9J 2JB6B 4PRDB 5CSZA 1FZMB 2VISA 4LLDA 3TZVA 5HYQA 1C5DB 4I2XB 5DQJA 5I2IB 3F12B 1ETZB 2EXYC 4HLJA 5HDQL 1CXFA 1UKQA 3PWUB 1B4JH 1JPSL 1HXYB 3JV5A 1JZ7A 1VEMA 4GRWB 4I5BA 1K9TA 1D5BA 1VKXB 4DGIL 1JZ6A 4M8QB 2XY1A 2Y4SA 3MOAL 4LAQH 2IBZX 4QWWD 4ZPVB 5JIIA 3ULVH 4PS4H 2M2DA 3UO1L 3UCRA 5SX5H 4UIMB 3M45A 4KKLD 5ILTL 1F6AB 3ZE1E 1UA6H 4N8VG 5DJXB 1QSED 3CDYA 4JDZA 4MJ2A 4ZYKB 3JTTA 5C0CA 1J86A 2MHAB 3UYOD 5I1GL 4U1LA 1KJ2B 1IAOA 1XR8B 3SJVA 4ALAL 3G5XA 5JW5B 5A40E 4F2MB 1KYOK 5EUOF 4ODWB 5I71C 3N50A 1FL3B 1MFAH 4U6YB 3VCLA 4F58L 1Z5LA 5BRZA 4YDJB 4GKOA 3GSNA 4J3UA 4CMMA 3FAWA 2DWDA 1UG9A 4LHQB 3VFRB 5ITFA 3UTSD 4G3YH 5ADOL 3DX6B 2A6DA 2FR4B 4U1SB 5I1IH 5IV2B 2EECA 2NMSA 3T2NH 4R4NC 2R9HD 5CGYD 1QBML 1WZKA 1CD8A 5IBTH 3SGEH 4RMWA 3CDCA 3E2HB 3IDIB 3IFPA 2HH0L 2WP3O 5DRZA 1FNHA 3OPZH 2DQTL 3HE7A 4RA0C 3DMMA 4NRZB 3KPQA 3LH2L 5IB3B 3HMXH 4OSUL 4OLVL 2EIDA 4M6NL 2VNCA 5D2LA 1CGWA 3UTPD 1A4JB 4LCUA 2R1WA 1GOFA 1X4YA 1Z9MA 4JFOB 5E08H 4XPFL 3TO2A 3UTSB 4HXAL 3LQAC 4ODTL 3QXAA 1IM9A 3MRRB 5T1MA 2YKLL 5KSBE 3IU3A 2FL5B 5FHAL 2NXZB 4HS6A 5AWNH 3EYFA 2P47B 4LNRA 3ZE2F 2VDRL 1S7WB 5IMOA 4LHJB 3IFLL 4RWYH 1DE4B 4ZXBD 1CFNA 3WN5A 4YAQB 4OT1L 4S2SA 3GMMA 1A7OL 1FNEA 3PWLB 4HUWA 5DTFB 4BQ8A 1LO2L 1FN4A 5JORA 3PIQA 4OGXH 2XZCH 1VADA 4PV8B 4FQQB 4PB9L 1YMMA 1A6TB 2P5WA 3CVHA 3QPXH 1VA9A 4M4PA 4BUGA 5HGAA 5KSUB 1FVEA 3VGAC 1KN4L 2YD5A 3NABL 3JUZA 1INDL 2VDQH 3L7EA 5JUEH 4FTVE 1CR9L 2AV1A 2B2XL 3IU4L 4GAYA 1G9NH 2W9DL 1WBYA 3IETA 3ZLQC 4P9HC 2L7JA 1JRHH 3PXHA 4FQJL 4ZXBB 3HNSL 4NQXA 3MLPA 4XP1H 1P2CA 2ZPKH 2IGFL 1GGCL 4RAVA 4P5TC 2G9HA 4U6HA 1PQZB 1IQDB 2NZIA 2MCPH 1ZLUK 4ODHH 4ODSH 2MMXA 4KUZL 5BJTA 5JXED 1T89A 4JREB 3V5DB 3HI6L 1L7IL 2YSSA 4K8RH 3BGMA 2D7PA 1VFMA 4DKFH 4FG6D 1J0YA 2ZCLL 3KPPB 3GSWA 1U3JA 4Q0XH 5E1AA 5IMLB 1CDHA 2C9AA 4ZUTA 4NBXB 5AUMA 5EA0L 4PP1D 2VZ1A 1NGXA 3ZDYF 2WINB 3O0RH 5HI4C 5J57B 2C3HA 4ETYA 4Z7OF 3QJHB 4YR6A 2GJZA 1AQDA 3O9WA 5F7WC 2C4FU 1NCCH 1DUYB 3VXNA 5DRXB 5FO9A 1Q94B 1CXHA 1ZT7A 3WLBA 4O00A 4UT6L 2DBLL 3H9ZA 5EOTA 1ZLVK 2CQVA 4HFWA 1ZSDA 4Z7WE 3V7AG 5A2KH 5MENE 1PZ5A 4WW2F 3QQ4B 4N1CA 1KIRB 3H9HA 4A6YA 3LKNB 4K3DH 5KS9B 3OF6A 1C12A 1FGNL 32C2B 5ERWB 3BGAA 4RGMB 3PDOB 4LQFH 1PKOA 3M07A 3VRJA 4MDJA 4QTHB 1MCEA 1QSFE 2DKMA 2X4PA 3BMWA 4PB0L 4YJZL 4YDVA 4RRPA 3BWAA 1BBJB 2VZ3A 4MX7A 3KJ6L 4R90H 4G8EB 1KLUB 4IMLA 3WFCL 1Q9KA 5FGBC 1X6NA 1UCBH 5FO7A 3T0XA 1IEAA 3M8OL 5DLMH 4GMTL 4LOUD 5FA4B 3G6DL 3G08A 4Z7QF 4CRPA 3S4SA 2VITB 2Y06H 3V6ZB 5DJ2B 5GSVB 1S7SA 5GRVK 3Q6FA 3ALWA 3AFLA 1GHFH 3D3VD 4MJIB 2K9UA 3WHE1 4G6KL 3LV3A 1IGYB 3M1BA 8FABB 1I9RL 1W0VA 1JV5B 3MCLH 4H8WH 2VXUH 3NIDF 2NY2C 1IEHA 5D7LA 1CFQA 1J05B 2XKSA 3OXSA 2Z91A 4WW2C 1R5WA 3WS6C 1CCZA 1CDUA 3U46B 2NY6C 5EBWA 1A14L 2CKNA 1BWWA 4KJYA 3EKCA 1U95B 1DEEA 2M8XA 3VXRE 3JV0A 4F3FB 1HILB 1NC4A 1AQKL 3ARDC 3KPSD 2HTLD 4R7DA 4H25A 3UJTH 2J7LA 3D3VB 2HLFD 2Y5EA 3U4BL 1ZHLB 1A3LH 4WFFE 5IVZB 1BEYH 3V95A 4WHTA 4RMRA 2AJ3A 2DLTA 3ZL4H 1OSZA 1JN6B 3BQUA 3DVNA 1ACZA 2HAZA 3RKDD 3ET9F 4DQOH 3DBXB 4ZUWB 4RAHA 4QY8A 1AXSA 4JVUA 2H3NB 2P5EA 3TJEH 1HWHB 4U1HA 1H8NA 1T22B 4GQ9H 4PBVC 3RVUD 5IHLB 3RX5A 2EDNA 3Q6GH 4P2QE 4KGLA 5M95B 5C0AD 4QCIB 4MS8D 43C9A 3A6BH 4WI8A 3IDYC 4J8RA 4J6RH 2IAMD 2X05A 1JNNL 2YRLA 1PKQE 3IKKA 3PGDB 5AZ2H 3DXAB 5KVMC 4Y16B 3KWWB 1MLBB 3GMRA 1TDQA 3IXAB 3P9MA 5CWSA 5TGBB 1NUGA 1MFBL 4UINL 3IGAA 4HG4K 1PYWB 3VXSD 4OFVA 1T7YA 4QXTB 4X4ZA 1JMXA 2DD8L 3W9EB 2LTQC 2VDOH 3BN9C 1YY8B 2GFBA 5DVNA 2Q8AL 1T83A 4EVNA 3L5WA 2EKSB 4PJ7B 4DZBB 5C0AB 1U2HA 4PTUB 4L4JA 5ISZE 5B21A 3FFDA 4QO1A 3X13B 1HWGB 2IAMB 3SPVB 2J8UB 3TO4D 3S36H 2XZZA 1Q9LB 2RCSL 2HRLA 3D87B 4YXHH 2WM0A 5E6ZA 4OFIA 3VXTB 5AYQA 4HUUB 1GH7A 5DD5L 5I1IL 1IAIH 4HIXH 4TTDD 3FO0H 4FFWD 3T2NL 5EU4B 4EQ3A 1YDPB 5DFTA 2X42A 5AAMA 4JKWA 3VH8G 4MDIA 5CSZB 2VC2L 4LLDB 2VISB 5HYQB 5DGRA 4C57C 2X4QA 1GPOH 5DQJB 4NN7B 5C0CD 4PJHA 3UJJL 1ZEAL 4M1DH 4ZS7H 4L8BA 4I5BB 3HCVA 3SJVD 4ZAKA 1FSKB 1G9MC 4JRXA 3B9AA 2Y25A 4NM4H 4KKBD 4NQUA 4NDMA 2GITA 1V7MH 5HDBF 1SY6H 1MCPL 2VQ1A 4ZFZA 5I74B 2AJVH 4YZFF 5AWNL 2DTMH 4K3JL 3SCMC 2Q7NA 3QIUD 1SBSL 4MXQC 1F5WA 4L3AA 2QQLH 4O02H 2XIDA 4XVTL 4PY8J 4JDZB 4JCLA 5C0CB 1BQHA 3JTTB 4G6FB 5GGSA 1D9KD 1MCWM 5D6CA 4IMKA 1D6VH 4R96A 4U1LB 4CDHA 12E8L 3MRQA 1IAOB 4Y88A 5EU5A 3SJVB 1HIML 3FKUS 3G5XB 1QBLL 1CZ8L 3PWPE 3S98A 3T0AA 2IPKB 1RZJC 5BS0E 1T6WA 3MRKA 5BRZB 3R0MA 3GSNB 4OFPA 4WI3A 4CMMB 1MRDL 5HGDA 5C09E 2DWDB 2VDQL 4NNPH 1A9EA 3P2TA 1UGNA 1JHLL 2A6DB 1OAQH 2BERA 4PJ9C 3EFDH 2X1WL 4YFEA 1H0DA 3OKDA 3CLEH 4PD4K 1D9KB 4F9PA 2Z8WC 2YC1A 3IFPB 5AYUH 3BP7B 5AD0B 3GZKA 4KPHL 3HE7B 1AD9A 3DMMB 3DURA 4OF5A 3KPQB 5CEXA 3D85A 1MCOL 2YA2A 2XTLA 5C70A 3QEQA 5D2LB 1UZ6F 2JCCA 4LCUB 2PXYD 2V2WA 2R1WB 4OCXL 5C0RH 2CSPA 3TO2B 3N1GC 1CT8B 4XAKD 1Q0XH 4NN5C 1YMMD 3MRBA 2Y07H 5LBSH 3MLTB 1IM9B 5T1MB 5DK0A 3IU3B 5I66A 4GLRI 4PGDA 5JPNA 2BJML 5KANG 1VFBA 4EI5C 3SOBH 3CPLA 3AAZA 4HS6B 4XGZA 3EYFB 5F71A 2BP3A 5IMOB 4OF3A 3ILQD 4OM1L 5DUMH 5K9QG 4NN6B 1CFNB 3SDDD 3WN5B 4ZSOA 4D9RE 3F7RA 2BNRE 3RDTA 4S2SB 3GMMB 4PRPD 1FYTA 1FNEB 3UMTA 4HUWB 2X6MA 4S1QH 3PIQB 5JORB 3HA0A 1I3VA 1VADB 4KRPC 4LP5A 5CMAA 5I8CA 3EJZD 5BV7H 3H3PH 1YMMB 3CVHB 2BNQE 3TIEA 3THMH 3OKMA 5IW1A 3PQYD 3I2CH 3VDCA 3L7EB 2EYTA 3TWCH 4JPIA 4OQTA 1WFNA 4U1IA 2AV1B 3F7YB 4GAYB 2COQA 4Q9QH 3P0VL 1WBYB 3IETB 4HBQA 1MJ8L 4HCRA 1D5ZA 4GG6E 2X44D 4NQXB 4YBHA 1P2CB 1VFAA 1T66C 5E2VH 4UQ3A 5D7IE 4EIZC 4PJGF 4U2YA 4PRPB 4RAVB 2G9HB 1P9MA 4U6HB 1A9BB 1R3LA 3MGTA 1S7XB 1DTUA 5EIIA 5BJTB 3O6FC 1OP9A 2CDEA 2ERJC 3O6KH 1KXTB 1PG7H 3I6GA 3VFTA 1H8OA 3KPRA 3BPOC 2Z31C 2YSSB 3MJ9H 5JW4N 3LSOA 4DZ8A 3BGMB 3ZHLA 4N0CC 3WJJA 1H9VA 5DLML 3IRZA 3X14A 4U49A 1DANT 5F44A 2R0KH 2Y06L 4HT1H 1KNOA 2P8LA 3P4OA 5D96B 3ROLA 3GSWB 4OD1H 5E1AB 2IADA 5F6HI 4ZUTB 5F7NC 2OL3L 5C9JA 5BOZG 5AUMB 5IT2H 2ID5A 1W72A 4P46C 1NGXB 4F80A 3NZ8A 4EIGB 3BOVA 4NQEE 2RFXA 5JQ6L 1JGVH 4YR6B 3S5LG 2GJZB 1AQDB 2OL3B 1AO7A 2UZYB 3CMOH 4HKZA 3VXNB 2QQKL 4G7VH 5FO9B 4RDQG 2NYYD 5L8KB 1ZT7B 4R2GC 5F9OH 3WLBB 3L9RA 3WFDH 4PJBB 4OCRH 2HG5A 1DBKH 3S97C 5EBMA 1FO0A 4XP5H 3B2UD 3CK0H 2DB8A 3MYJA 1RU9L 1ZSDB 3QZWG 1H5BC 3WBDA 4ENED 4XP9L 4ZODA 3FT2A 3H9HB 4A6YB 3EO0A 1BEYL 1LEIA 1C12B 4X80H 1O5DT 5GS2H 4ODXA 3VD3A 1A1MA 5CLWA 1SVCP 3X3FL 3VRJB 1MCQA 2DLFH 2EDBA 4JY6A 4MDJB 1XAUA 4J2XA 5FCSH 3T3PE 3QG7H 3FB5B 4YDVB 2N4IA 2DI7A 3RA7H 4ZNCD 4MX7B 4IMLB 3RIFK 4R8WH 3UEZA 5I6XB 2YD7A 5FO7B 1IEAB 4FFYL 2Y23A 5K9JL 3G08B 4NO0A 3I85A 3E6FA 4UV4H 3D6GA 3S4SB 5T1DH 5I8OH 3CX5K 4LLAA 4F33A 1S7SB 3HC4L 3Q6FB 4J6RL 4Q9BA 5GXBB 2JKXA 2XWBA 2HJLA 4GRWH 1ZA6A 3M1BB 1CXEA 2DM7A 2J4WL 1GAFL 1W0VB 4LU5L 5T3ZE 3C2AH 3FN3A 4HEPG 3QT2A 5DEFA 5D7LB 1CFQB 3OXSB 4PY7B 3FFCA 2Z91B 2EE2A 1J0HA 1R5WB 2VDOL 5L9DH 1H3XA 2B1AH 4K71C 2FO1A 5EBWB 1I8LC 4KJYB 2GKIA 2IFGA 4L9LC 4U1NA 1DEEB 3W9DA 4N5ED 2WWKO 4OZGE 4J7RA 4CVWA 2LQRA 1S7QA 3TA3A 1NC4B 1ZLWH 3L6FA 2AEQL 3C8KB 4R7DB 1TQCB 4H25B 2GK2A 4WIQA 1JPFB 4ONOA 5EOQH 4Y19A 5E8DH 1KCUL 3AS1A 3VRIA 3FO1A 1I85C 4WHTB 4YGVB 2AJ3B 4WTWA 1OSZB 5C9KA 3DVNB 5GGTA 4WU5A 3FTGA 5HHOE 3EYUH 1OAKH 2JJVA 4QY8B 1AXSB 2APWA 4HXBL 5T5NF 1ZVHA 2J5LB 2BRQA 2FH8A 5I76A 2P5EB 2X4OB 3WIFA 2IFFH 1CFVL 4U1HB 2ZUYA 4CMHB 2C7UB 5CJOH 1XFPA 4AIOA 3EIFA 3CXDL 5DJZA 3K80A 3B9KA 1GC1H 5DK2A 1HDMA 1FNAA 1XMWA 1RURH 5HVGB 2XTJC 4BSWB 3WCYA 1BFSA 1V7ML 2VSDA 43C9B 2HKHH 2ZKHH 3QNZB 4J8RB 3ZKMD 1B0RA 3RTQA 1FBIH 2DQUL 1LDSA 5DXWA 4IRSA 1GGBH 3O6ML 3GMRB 3P9MB 5CWSB 5J11B 4WY7H 4Z7UA 5T5FH 3S3JA 2DTML 1RI8A 2XICA 1X3DA 3W5MA 2AEWA 3IGAB 3OKKA 4OUUA 4WFFD 4Z9KB 1NBVL 3BZEA 3QEUA 3S3PA 4M7JH 4D3CH 3DX8A 4YHYC 7FABL 4JHAH 5TE6H 3F5WA 2GFBB 1MCKA 4EVNB 3L5WB 1OSPH 4YE4L 3U30C 1NFDA 3UYPA 2DQEL 2DOCA 1RUMH 2HN7A 2DI8A 2V5TA 4P2OA 3IYLW 1LD9A 2BMKA 3FFDB 1TCMA 2ITDA 3VXPA 4OLYL 3U4AA 1FFPA 4ZAKD 2YOCA 3TNMB 3GI8H 4KI5F 1UZ8A 1YZZA 1F11A 4MNQE 4QRPA 4J3OC 1E4XH 2YR3A 4MJIE 3HFML 3K2UH 1TMCB 2FHBA 3EFDL 5JDSA 4JFED 3CZJA 2AEIT 3O4LE 2HTKD 1HCVA 4MDIB 2GTWA 5DMKA 2X4QB 4H1LA 5MEOA 3LCYA 4PJHB 3O11A 3LS5L 3LY6A 1ZGLA 3ARUA 1K85A 4IJ3B 4L8BB