2ZNWA

Crystal structure of scfv10 in complex with hen egg lysozyme
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
236
structure length
221
Chain Sequence
DIVLTQSPATLSVTPGNSVSLSCRASQSIGNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEITDIQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ScFv10
publication title Specific fluorine labeling of the HyHEL10 antibody affects antigen binding and dynamics
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
total genus 56
structure length 221
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2znwA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2znwA02
4YXLL 5TDOB 3VFUA 1W72A 3BE1L 3HE7C 3KG5A 5IFHH 4XPBL 5E0QA 4MZ3A 2WBJA 5HI3D 1OP5H 4YC2B 4QRRD 3NH7H 3IXAA 4PGJA 3ALPA 1W0WB 3N9GL 5BZWB 3ZDYE 2J6EL 5F7DA 4MXVF 5CJBA 4EDXA 3OKEA 3FQWB 3OV6A 3PWUB 1SY6A 4O4YL 4KK6C 3U1SH 5J12B 5F89A 1UCBH 2W92A 3TVMD 3G6JB 4WW2B 4GXVH 4H20L 4H0GA 2E3VA 3IXTA 1AI1H 2M8XA 5E00A 4NN6B 5E2WL 5FYKD 3UTOA 4ZFOB 4MSWB 3HI1A 5MENE 3KLHC 4MQSB 4JQXC 3E6FA 4BSVA 2XRAH 3NCJH 4FRWA 1KGCD 5GRJL 1HKFA 4XBPB 2APTA 4JM4H 1M6OA 4JN1H 4FZ8H 1U8QB 2VLKA 7CGTA 1IEBB 1BZ9A 3W9EB 3LRHA 4PG9B 3GMLB 4HIIA 1JHLL 4OQ1A 1JNLL 1NGWA 4LHJB 2EXWC 4OGYH 4KUZH 4IRJB 2HT2D 1YMMA 1U8NB 4CDGC 4FTVE 4KRNA 4KVCH 1K2DB 3H8NA 2DL9A 1P4IH 3BIKB 4X6DB 4ODWA 4FZEL 3DMMC 2KZWA 3L5XL 5DGRA 3WFHB 2HJLB 1J9CT 2BXYA 3FRPG 1KN4L 1KF9B 4K7PL 4LPVA 4NJAH 4G6FB 3WN5B 1FCGA 4NC2B 1J0ZA 2EH7L 5I8EB 4GRMB 4BZ2H 2HFEB 4OZFH 3WJLA 3R1GL 2IBZY 1YNTA 4PJDF 3EDKA 5IQ7H 4LLYA 3RDTD 5B39G 4TUKH 4QEGA 1I7TA 2QHRH 5IBLC 5E9DA 2AJSH 1IILE 1WBZB 4WW1A 3RWJA 2YZ1A 2DQTL 4LLQB 1I7ZA 1MHCA 1MUJB 1IM3B 3KHOA 5DWUL 3HCVA 4HPYL 1CFTB 1TNNA 4OGAD 3JV6B 1INQA 2Q8BL 4EI5A 2QKIB 4OCRH 4XI5D 5KVDH 5HGHB 3CFCL 1RZIB 5DD0L 1KG0B 5GZOD 3D3VB 3QEUA 35C8H 5IVXE 2GAZA 2ZPKH 1X4YA 4CW1B 2BERA 4JFEE 4HMEA 1Y6KR 4IMLB 3C5SA 1IGTA 1NCTA 4KI5F 5JIIA 4X4ZA 2D31A 1FORL 1FFOB 4IJ3C 4QXUH 5CBAB 1XMWA 1SJHA 5I73B 4R6UA 3U7AA 4X7FC 3PGDB 1OM3L 3MA7A 5C6TH 4B7IA 2F9BT 3F62A 3VGAB 4RGMB 3NVQA 1FL3B 3UTSE 5HHNB 3MRBA 2DAVA 5KS9E 2VDPL 3ZZ1A 2Y36L 4X6FA 4P4KD 4IDJL 2F53A 1CFSB 3DX8A 2R1YB 4R2GC 3DURB 2OL3H 5DQDL 5J11B 5D7LB 3MBEA 4U3CA 3P0YL 5DFVD 4E41D 4J4PD 2BHZA 4CVZA 2GCYB 1BVLA 5EG6C 2BJMH 3WLBA 3QNXA 4PFEA 4D2NA 2EEAA 5EZJA 1TPXC 2OYPA 2I25N 4NQCE 2A73A 2BNQE 3PQYA 1OLZA 3MV8D 4KFZC 4O58L 1S7XA 4HPOH 2KPNA 1S7QA 4HIXH 5J57B 2D7TL 1XGPB 2W9EL 3VD7A 1EHLH 2J2ZA 5IMMB 3LRSB 1CIUA 3QIBA 5IGXH 2E8ZA 3LOWA 1A3QA 2JK5B 5FUCC 3HE6B 3MLTB 1IGJB 5C0CA 4H1LG 5KANG 2BNRA 2P8MA 4RBPH 5GS0D 5DJ6A 3WIIL 3PWLB 3FOMB 2E9JA 2ADFL 3F6IA 1PZUB 4DAGL 1NLBH 2FGWL 1H3WM 1JPSL 3G9AB 4N90E 1KLGB 5M94B 3DV4A 4IS6B 1KFAH 1QFWM 1G7QA 4P9ML 3JV4A 3OF6A 4X9GA 1CGSL 1AQKL 3DJ9A 3EYUH 2LFGA 2OLDA 4MS8C 4HWUA 1P1ZB 3RY4A 3V0WL 5B39B 3TNNA 1N64H 3ROLB 2E7CA 1E27A 3MRJA 3PDGA 1OB1A 1MF2H 5EBGA 1A7QH 3CSYB 3LKNA 1DEEB 5I66A 1UWEH 4Y16D 4ZAKB 4WV1B 1E0OB 3MACH 3C8KB 3M1BB 4LSQL 5KSAD 4FHBD 1C12A 4OZIA 3VRJA 1NC4A 5JO5A 4NCC2 1DLFL 2QV2A 2Z91A 3EAKA 1T0PB 4IOIB 5DFTA 4Q9RH 3GSNL 4JRXE 5A40E 3I75B 2Z4QB 4PJGB 5DRWA 1L9MA 3NAAH 1GGUA 3K2UH 3TH2T 4U1LA 2JELL 1BX2B 1QP1A 5GGSA 2FWOB 1U58B 3FN9A 5FUOL 1I7RB 1MELA 1ZS8A 4OCSH 1ZT4B 1EH9A 3MLXL 4O02H 2NCMA 4W68A 5GQBA 2OI9C 2D2OA 5F70A 4QGTA 3D25A 2C1OA 4L8SA 4MAUL 4U1HA 2M26A 3WNKA 3WD5L 4R3SB 5IW1B 3RL2A 3W2DH 1CXIA 1Z6JT 2VDLL 1XFPA 3L6FA 3ULUF 3AB0C 4WRLA 5DMIH 4FQXA 1F4HA 1PW3A 4MJ6B 1EEZB 1DFBH 4OFVA 1MRCL 1MCOH 1L7IH 2JJWA 2X89A 4Z0XB 3WBDA 3WXVH 4ZFZB 1NKOA 3OGOE 4UU9B 3ARXA 3MNWA 1A1OB 4GW4B 1BREA 4M02A 4D0CB 2AJVH 1ZHNB 3G5VA 5T1MB 1B2WH 4HWNA 4ELMA 1GJIA 5ISZB 2ZUWA 2GSGB 2LU7A 4H0HB 3QNYA 4HKBB 3UTQA 4HK3J 4CDHA 4U0RB 5C08D 1U8IB 3ARDA 3LEVH 4NN5B 2EEDA 4JKPL 4H1LB 4OIBA 2RJMA 5IMOA 1FPTH 3GGWA 4Q58C 4QTHA 4PJDB 4DKAA 4YDVB 3EO0A 4U2ZA 4UV4L 3S37X 5TDOA 3VFSB 1P7KA 3CGTA 2P5EB 4MDJA 3MLRH 3CX5J 1PQZB 4J3TA 4G3YL 1J1PL 2XG4A 4WUUB 5HHOE 1RJYA 1DUYB 2VXQH 2PW1B 2P45B 4I4WB 1HH6B 4F2MB 5DMJB 1LO5B 5B4MD 2ZWLT 5BV7B 2DI7A 3FQWA 2N7AA 1AE6L 1N8ZA 2DQEH 4KC3B 2DM7A 2LQRA 4IRSA 4PJAE 5ENWB 1X5LA 2HT3D 3TT1L 1QKZH 2BDNL 4XVJH 1KJMB 2FBOJ 4NN7B 3G6JA 4WW2A 1EO5A 2XTJC 2R2BA 3O0RL 1RPQA 1IBGH 4MSWA 4HBCH 1G1CA 4LQFH 4PJ8B 4BM7A 1IAII 5DXWA 4QXTB 5E5MB 3JSSA 4JFDB 3ULSB 1ED3A 5C1MB 3NFPA 1U8QA 3GSXB 3VW3L 3W9EA 3SJVB 3GMLA 3BQUD 4C56A 4OFIA 4JVWA 5T33H 5FYLL 3VFTB 4IRJA 5KG9B 4PLKD 1U8NA 2AS5M 3ALXA 1TETH 4ZO6A 1INEH 1MCDA 1UVQA 1CR9H 3W5NA 1EFXA 4NKIH 4WIQA 1K2DA 4X6DA 2D0HA 2NYYD 2RCSL 3HN3A 3IS1X 5CJ5A 1BOGA 3H3PH 3THML 3RVUD 2FIKA 5L6YL 2AXFB 4X7TB 5D1QC 2ESVA 1E6JH 2OJEA 3WN5A 1XGYH 2CRZA 5DJAB 4GRMA 4D3CL 1F3RB 1DANT 1RK1B 2QADB 5JPNB 5FDYA 4I2XB 2EDNA 2F5BH 2CXKA 4K2UL 3VXNB 1L4IA 2Z31B 1X5GA 4TSAH 2BC4A 3BKML 4LLQA 4OGZA 5E5UB 3I50H 5FUCE 5FF6A 2AJYH 1QOKA 3ILQC 3P9LA 3MJ9L 4YHYC 2W9DL 5I1CL 1U91B 1CFTA 3MRMA 2QKIA 4LLMA 3DXAA 1KG0A 5DJXA 3D3VA 3JWNC 4QHUA 5L7XH 4EN3B 3TBSA 4ZS6C 5C0EA 4JREB 1J8HE 3MO1B 5AWNL 2DBLH 5IK3A 5IBUG 3EJZC 3TVMB 4B5EA 1JRHL 3MQIA 1HDMB 1NMAH 1J0KA 5L8KB 3WFDL 1EGJL 1FO0B 5GGQH 2EIZB 5FCUH 1EBAA 5JTWA 1FL3A 3HI5H 4ZSOE 4YBLC 3SOBL 5A2JH 4YO0B 5HHNA 3QRGL 3TJHD 4H26A 2OZ4H 4HXAL 2EKSB 2YS4A 5HVHB 5JIKA 5I19L 3U4BH 3VG9B 1QLEH 4JDVA 1U3HD 2R1YA 4O2EB 1HXMA 3IVKA 4WO4C 5TH2B 3VXMD 3CX2A 5IFHL 5DYOA 1VFOA 3GSWB 5DJZB 5KAQF 4GMSH 5IHZB 4TUJB 2ADJB 2GCYA 2NW3B 3NH7L 3BVNA 3M07A 4CMMA 4LCYB 3GO1H 3WJJC 2Q86B 5HYQA 1EO7A 4JG1H 1F90H 2QLVB 4P3CH 3BESR 1L0XA 1XGPA 4Q74A 4LFHG 3IDGB 2YK1H 4PP2A 1P7QB 5LAXB 5D2NB 5IMMA 3U1SL 3BEVA 4U0QB 1UCBL 3WS6C 2R39A 4GXVL 3BAEH 2RR3A 4NPYA 1EZVX 1AI1L 3HE6A 1F4YH 3MLTA 1HE7A 1IGJA 1S9XA 3HG1D 3IDUA 3TN0D 4HH9B 1QQDA 2EC8A 3JBG7 5K9OB 4WNQA 1U3YA 2DMCA 2W0PA 1QBAA 1LK3H 2O26U 5DJDA 2XRAL 5HD8C 1WZMA 2H6PA 5LKNA 1NMCC 3C2AH 1UH4A 3FRPA 4JM4L 1S9VB 4JN1L 4FP8H 3DVGB 1KLGA 4FZ8L 5FYLE 3SDXF 3V6ZB 5E03A 4IS6A 1L9NA 4RIRB 1RZKH 4Y5XB 2O61B 4P5TC 4ERSH 5E6ID 3B9AA 4OGYL 3UJIL 4KUZL 4XNQA 3BP6B 4XCNB 5CEXA 5I18H 5B39A 4KVCL 1I1AD 3ROLA 6CGTA 1NBVH 1P4IL 4Z7UB 5EBMB 1TMCB 2XN9B 1U0QA 5D6CB 2W60A 1BFVH 3PP3H 4Z7VF 5HYEA 4EI6B 5D5ME 4LRIA 2YPLA 4PJFE 4XWGH 4ZAKA 4NJAL 4WV1A 1CDBA 1TFHA 3QFDB 3C8KA 1RUKH 5GGVH 4DN3H 4PG2C 2PXYD 4PJ7E 4QRUA 5KTEH 4U33A 5C0JB 3I6LD 2A9MH 3BKYH 1K8IB 2W59A 5IQ7L 5D96C 4TUKL 1XGUB 3B3IA 3F7YB 5KSVA 2ATPB 2AJSL 4MD5B 3WIHA 1GHFH 1HIML 5IBUB 3I85A 4Z7NF 2L7UA 2VLRD 5TDPB 1BX2A 3KWWB 2GIYA 5DHYA 1WCBA 2HN7B 2YD7A 4PJIF 3MR9B 1FGNH 1KCRH 1ZT4A 4OCRL 5KVDL 1Q9LA 3FFDB 1P4LB 2BK8A 5JMRA 4ZUVB 2ZOKA 3RY6C 2YEZA 3KXFD 3OR6B 2ZPKL 3DLQR 3OKMA 3KPSB 2H32H 1WC7A 3LDBC 5J0BA 1I3RA 1A2YA 4AT6A 4BSWB 4R3SA 5IW1A 3MCG1 3SDAD 4QXUL 2N7BA 2CRMA 3EW3B 1UWXK 2W0FB 3HNSH 5EORH 1CFQA 1NC2D 1NCDH 1EEZA 1ND0B 2R1WB 5ESVB 3MUY1 2UZIH 3MRPA 4YIQA 5C6TL 3VWKD 1X9QA 4L4VE 1A1OA 5CCKH 1XF1A 4CU8A 2E7LC 5T1MA 5DJ8B 4N8VB 5DRNA 3S36X 5IEKB 1FVCA 2UYLA 5F1NA 2RB8A 3O4LE 4P2QD 2OL3L 4R90H 1EHNA 5C0BB 1U95B 4JDTH 1U8IA 4UMGA 4N8PA 2NXZD 2P5WD 3QQ3A 3SQOL 2WIIB 4HUNB 5GGRY 2BJML 3PG2A 1OD9A 1MWAB 4H1LA 3TF7C 4XBEH 1QBLH 1NUFA 4KV5E 2OJZL 4Y16B 1JNJA 4GBXD 3BPLC 4U7KA 5KSAB 3O2VH 2WV3A 4HPOL 5H2BA 1CXHA 2Z93B 4OD1H 4HIXL 5DGQA 2RIKA 3G6DH 4RX4A 3TO2A 4X4XB 1EHLL 2PTUA 4HD9A 3NCCB 1DUYA 4OV6F 5IGXL 2PW1A 4P46C 1ZVSA 5F6IB 5IW6A 2ZKHH 3PL6C 5D7KE 3UTTB 3R8QA 4EUPH 2R56H 3EFFA 2VLMD 1NDGB 1WFUA 2C3XA 5ALCH 5AG8A 1NLBL 2GYSA 1MVFA 3MRKB 5EWIH 3MRNA 3VJ6B 1KJMA 4P2RE 1KFAL 5JDSB 2F8VA 3V6OA 2FLRT 1JZ6A 3VXSA 4CVWA 1BIHA 1A02N 5F97E 5A43C 5JXEC 2PTTA 4PJ8A 5GRVL 4XGZB 1H3VA 1H8OA 1N64L 4QXTA 1BJ1H 5E5MA 3RIAF 1RK0B 1X5AA 5HYJE 4JFDA 2IJ0C 3L5WB 1U8OA 1HYRC 1MF2L 1A7QL 2ESVE 3GSXA 4OF7A 3WFCH 3SJVA 1UWEL 1NQBA 2DKUA 3MACL 4KKAC 4ZG1A 3VI3E 4CNIB 5KG9A 5IM7B 4G9FE 4M6OH 4NQXB 3TO4D 1GSMA 2DF3A 3T0EB 4JKLA 3QEQD 2NY2C 2VL5B 2IBBA 3G08B 4QT5B 4R4ND 4AEEA 4Q9RL 3MTRA 1Q72H 4W70A 2AXFA 4TSBH 3NAAL 1KIPA 5C09D 4PJBE 1G6RB 2BVQA 1LNUA 4K8RC 4RZCA 2VLLB 1A9EB 5CAYB 4X9HA 1OF2B 2CUMA 1WTLA 3G6AA 4OCSL 3DXAE 3EHBC 4X7DC 4TNWK 2HFTA 3ZKXC 4CJ1A 2OK0L 4Y8AA 4O02L 5JPNA 5DUBA 1OARH 5T5NF 4I2XA 2IADB 5GS1C 5K93A 1UJ3A 5CWSB 1MY5A 4X6CB 3K7UA 3LB6D 2Z31A 5C07A 4PLOB 1E4KA 1FZJB 3FT2B 5C3TA 4PJCB 1E4XI 3W2DL 1U91A 1HK6A 5DS8A 2J5LC 5D2LE 1SMAA 5DMIL 1C5DA 1DR9A 2VKXA 3C5ZC 3GSVB 3HPJA 1G7PA 2F54E 5F3HB 1RU9H 2A6IB 1DFBL 3MV7A 2VZ3A 1TLKA 3UXFA 5HHPA 2A83B 3MV9A 4MD0A 5GRYA 3MLVH 2ZSVB 4U6TA 1D5IH 3WXVL 2X4QB 4WI6A 2G60H 3CC5A 3HE7D 2FHBA 2AJVL 5I75B 1B2WL 5FGBC 4F8QA 3MLWH 1G9MH 1GZQA 1BHGA 4MA3A 5IQ9A 3TPKA 3ZE2F 1A4JB 2BP3A 2R2EA 1B4JH 5I1AA 4Z7VB 1MFBH 2EIZA 3BN3B 3VRLF 1CDGA 4PJXF 5DEFB 5IROA 3LEVL 3L1OH 1T1ZB 4LPWA 4YXHH 3N1QC 3T04D 3V5KB 4ODHH 4QTIH 4YO0A 2XQBH 5T1LB 4QY8A 2EKSA 2HFGH 3OB0K 1CDJA 1FPTL 1MCNA 1CD8A 1NH6A 4R97C 3QEHA 5JQ6H 3L7EB 1V05A 1E4XH 5TH2A 4KDTA 3KLHD 5C9KA 2ZZUT 3MLRL 3QIWC 3C6LA 1UACH 1VFBB 5DJZA 2X4SB 3CMOH 5IHZA 2NW3A 4KQ4H 4OI8A 2VXQL 5CSGA 3IDIB 5DEGA 4DJMA 3O8XC 4LCYA 4PJHA 3Q5YA 1GGYA 3AROA 3FT4B 4K8RL 1IZJA 3VXQB 1KIQA 1ZTXH 2Q86A 4FQIH 3VRIB 2EXWD 5ALBH 2D7NA 4JPVL 1GGIH 4MA7H 3S96A 3VD3A 5CJOH 2DQEL 5CSBA 1P7QA 5ICZA 3ALWA 3X3GH 1AXSB 4XVJL 3QWQB 5C0IB 4LPTA 3DMMD 1P6AB 3QAZB 5BS0E 1SM3H 1CLYH 2NX5E 4B50A 3OSKA 4IIQB 4AK1A 1IBGL 1ORQA 3HUJB 4HBCL 5K9OA 1EJ6A 1XR8B 2HKHH 4PY8J 5HDBE 3GUTB 2GTZB 4WFHE 3WNNA 2DM2A 1MI5D 4XX1G 2IAND 3EO1B 1S9VA 4K23H 3CU1A 2YPLE 4I0PA 1JWSA 5KS9F 5IBLD 4Y4KA 4Y5XA 1HHIB 5HBBA 5T33L 3FQTB 1Z9MA 5E8PB 3NZ8A 1TETL 1INEL 4XCNA 1CR9L 4PV9B 4ODXA 4NKIL 4JFFD 4NSKA 3QFJE 4V2BA 5EBMA 2R0WH 3GB7B 1KELH 3LKSB 3H3PL 4M93B 3KPQA 4EI6A 3QUYC 3VXOA 3ARTA 2LABA 1E6JL 5GGTA 2XV6B 3VG0H 1XGYL 1NFKA 2LTQC 5J1AA 1JGDB 1YYLH 5C0JA 4QOKA 4RAVB 2APFA 2GHWB 1K8IA 5GGUB 3IFOB 2IPKB 5IEHB 4U7SA 4ZO8A 3OKDA 4RQQA 3QXVA 2F5BL 1U3HB 1IAIL 2ATPA 2OR9H 4UNTA 4MD5A 3U9PH 5GGSY 1FNFA 4TSAL 3VXMB 3I50L 3FOLB 2AJYL 5TDPA 4LCWD 3NA4A 5T3ZE 3KWWA 3KJ4C 1TVHB 3D69A 3SE4C 1BFSA 4XB7A 5HHMD 3FHQA 4F7CA 1T21A 3FTGB 3WIFB 3FFDA 1P4LA 1T5WA 1MRDH 3OWEA 3OR6A 3FMGH 3KPSA 4R2GD 2E8YA 4HKZA 5FO9B 5L7XL 1RZKC 4QHNA 3T1FA 1ZT1B 5JW4M 2D4DA 3DUHA 3CDGB 5D1ZC 3AAZA 5L2JB 1T89A 2DBLL 2BNUA 4BSWA 4RCAA 3HZVA 4UQ3A 1I1FB 4HKJB 1GOGA 1NMAL 1BM3H 4YDLC 2W0FA 1NFDA 2PF6A 1VHPA 1J0HA 3TN0B 1CGWA 3QUKB 1WLHA 4MNGB 4ONFH 5GGQL 2NMSA 1G7LA 1H9VA 3P77B 5FCUL 1S7WA 1CXEA 1TENA 1OP3H 4P57A 2NZ9C 5CBEB 3HI5L 3WFEH 3QDME 3QUZA 3AREC 2APVA 1AKJA 1PSKH 2OZ4L 1VGKB 4Y19D 3ZKNC 3U4BL 1QLEL 2E7HA 5LGHH 5IEKA 4R96B 3O3AB 2Y9RT 4M4PA 2PCPA 4XRCB 4KWUA 4GMSL 2X4RB 4F7PB 2GFBA 1MAJA 5FOBB 2WIIA 1ACZA 1RJLA 3B2UC 1IM9A 3EDDA 1T04B 2IBGA 1UZ6E 1V7NH 3GO1L 3KLAA 1NEZA 1BBJA 4JG1L 2PXYB 3ZHKA 2A1WH 4M43H 2Z93A 4P3CL 4MS8D 4MVBC 4X4XA 4UAOB 2YK1L 4NKQB 3MFFB 2A74B 3MOQA 1U3ZA 2H26B 1T83A 2YHGA 3BAEL 4HG4J 1B4RA 5L8JB 3MMEB 1MCPH 1F4YL 4FQ2H 1KIRA 1FL6A 2VLRB 3UTTA 3BEWB 1LK3L 2XXCB 4I3RH 4MMZC 2NY0B 3EOBB 4YPGB 3RWIA 5BVJB 1RZGB 3RVTC 4RA3A 2FJFB 3ARPA 4WWKA 3VJ6A 5E24E 3QIUA 4D0BB 1CE1H 1RZKL 1UXSA 4ERSL 2FJHA 3IB4A 1HWGB 1EAPB 3OAZK 1A21A 4XGZA 5I18L 1ZVYA 1S5HB 1BGXH 1NBVL 1WWWX 2GJZB 1RK0A 4HQQH 4P23C 4JRYA 4PJXB 1BFVL 2X70B 4G80B 5F3BA 5J1TC 4XWGL 5I76B 3FB8A 4AIXA 5E8OB 1RUKL 1KCLA 4M5YH 5GGVL 3ZYJA 4DN3L 2VWEC 5KTEL 4F9PA 2VXVH 5CP3A 3TNMB 4NQXA 2A9ML 3BKYL 5TGBB 3T0EA 3V6FB 3X3FH 2CJUH 2VL5A 2R2CA 4QT5A 5D8JH 5HVWA 3TA3C 3T4YA 5E2TH 5E1HB 1GHFL 1G6RA 1YC8A 4UIKH 2VLLA 5ANMA 1ERNA 2NXZB 2P5WB 4OLUH 1FGNL 1KCRL 1EO8H 4NT6A 4M8QB 3O45B 5K9QI 4PB0H 4PJAF 1DE4B 3GSOA 3MV9E 4GBXB 3STBA 2DRUA 3MJ8A 4C57C 5I0ZA 1Z0NA 4JHBA 4X6CA 1A6WH 2GITA 4OJFH 3RUGB 4X80H 1NPUA 3L5IA 1FZJA 1S5IH 4M1CD 5HDOA 3FT2A 4YDJB 3BGMB 4PJCA 1JPTH 1CS6A 4NO5A 3ARFC 5AZ2L 5DQ9B 3HNSL 3GSVA 5EORL 4YHPB 1NCDL 1O5DT 5F3HA 3ULVH 3CLFH 2UZIL 4R0LA 4WVRA 2A83A 3M17B 3MV01 3LKQB 5I8CB 2X4QA 2VYRE 2WBJC 1XZ0B 4F8TA 5CCKL 2FH8A 1DVFD 4KKCD 3RQ3A 4MAYC 4P59H 2A6DA 1ZHKB 1F45A 4JGMA 4NRZB 3I3DA 4WI5A 3BXNB 1A6PA 1A4JA 4R90L 2FR4B 2YD1A 1U8JB 3WLWC 2YKLH 4PJEA 4JDTL 4M7LH 3L9RA 1PVHA 1T1ZA 3V5KA 1GOFA 1I7UB 3CFJA 3D5OF 4G8GD 3MYZA 4JHWH 4XBEL 5CP7B 4ONOA 5T1LA 1QBLL 2V9TA 4DTGH 1VADB 1XF5A 2DICA 3L7EA 2GKIA 1YEJH 2XTJD 2FO1A 3O2VL 2LU4A 4OD1L 2BFVH 3G6DL 1CN4A 3K81A 4KRPC 1MFCH 3PF2A 1IFHH 2ZKHL 3OBAA 2A6JB 2NXYB 4HUUA 3FT4A 4UZGA 4XP5H 3VXQA 3QULA 3VRIA 2R56L 5ALCL 3PJSA 2UY6A 4A6YB 5EWIL 4L3CB 1NGXB 3QBTB 1AXSA 3PWJA 5C0IA 1ZXQA 3RVWC 4R8WH 5JHDA 3RVVD 4MJID 1CXLA 1G9MC 3GMRB 4XP1H 5KN5A 4IIQA 3MLPA 5D1QD 3HUJA 3LVEA 5F9JB 2AP2A 4Z0BL 2XACC 3GUTA 1PBYA 5JW4Q 3MFGB 3QI9B 1JYWA 2BSSA 1J1XH 4NCDA 4Y1AD 4ODUA 3MCKA 4Y5VA 3WFCL 3U46B 3ZYZA 4LK4A 5E94B 4Z18A 1E4JA 3FQTA 4RGNC 5L8LB 1IAOA 3PWPD 4M6OL 2V7NA 3ZYOA 5LBSH 3SGEI 3ILQD 2AK4E 4JGJA 1EDQA 3RX5A 4DEPB 3GB7A 1MJ7H 4HFUH 2CR3A 5TFSH 4EVNB 3PHQA 3VXRE 1Q72L 4V1DE 4TSBL 4Y0GA 1SJEB 4EXPX 1AGDB 1YPZB 4ZS6D 1JGDA 2GJ6D 5MHSD 5C70A 2HWZH 5GGUA 3IFOA 4MA8H 3K1KC 2XY2A 1RZFH 3LQZA 1RUQH 3EJZD 1CQYA 2EYSB 4S2SB 4NQDE 2F15A 3VI4F 4LPYA 4YEEA 2LE9A 4NIKB 2R1XA 1TJHH 4O2FB 1P84K 3R8BB 3LH2L 1V7MH 2UWEB 4TVPE 4F3FA 2EDFA 1YN6A 2OQJB 1GXEA 1AP2A 25C8H 1WWCA 3KPRE 1N6UA 4XAWH 1RIVH 2IGFH 3WIFA 4K71C 5IB2A 1R3LB 4PREB 5EZOH 3NOIA 1RU9L 3SGEH 5I8KH 3BD4A 2Z8VC 3ARZA 2PR4H 5L2KD 3MLVL 3SBWC 1D5IL 4HLJA 1PG7H 4WO4D 4H5SA 4P49A 1ZT1A 2G60L 5L2JA 2CRYA 2J8UF 1CE6B 1I9JH 5E1AB 1WUNT 2FO4A 1ZAGA 2R4SH 2HAZA 1I1FA 3MLWL 1G9ML 3IRZA 2IWGA 4HS6A 5LXGH 4YZFE 4GS7B 4PUBH 1B4JL 1X5XA 1WIPA 5DDHB 4LPUA 4ZYKA 3MC0A 3L1OL 4MXWH 1MI5B 4YXHL 4XNZC 2IANB 3H9SD 4PJ7F 4ODHL 4DKFH 5ADPH 2VWEE 4QTIL 3RJQB 4WFFD 4G6AC 2XQBL 1IJ9A 2HFGL 5JQ6L 1A4KB 1E4XL 1IAKB 3FB7A 1U8LA 3JUZA 5FHAL 2JCCB 4UT6H 1OW0C 4XRCA 4P2OB 2VQUA 4I18C 4P2YA 1UACL 1B90A 5HD8D 2X4RA 3QDGB 4KQ4L 4F7PA 4W4NA 3JTSA 4NRXB 3DRTB 2PUQT 1KC5H 3IDYB 1T04A 5KANI 5DVLA 3O6FB 3P4MA 1ZTXL 4P5TD 4K7PX 4XVUC 1NUNB 3U30B 5I1HH 1UYWH 1GGIL 4MA7L 4E42B 4ISVA 3DX7A 5CJOL 3FQRA 2VDQH 1F11B 5A3ID 1J5OH 4OCYH 3X3GL 1MCIA 4WHTB 2HLFC 4PJ9B 3B5TA 3X14B 3UTZA 4FQQA 4OZHA 4J3OC 5FDWB 1JF5A 2XT1B 1CLYL 3MMEA 5F1SA 2X1XR 2KDGA 3CMGA 3QG7H 1BD2E 3DECA 5A16B 3BEWA 4LCWB 4Z7QF 1AJ7H 1EV2E 4JRYE 3ZDZF 3EOBA 5FFLA 5DR5H 5HHMB 1HH9B 5BVJA 1RZGA 4K23L 3NIGE 2FJFA 2VJXA 5DD5H 1J0JA 3V0VA 1GC1H 4D0BA 1YY8B 4NQTA 1M05A 1JFQL 3BN9C 1H15A 1R3HA 1YQVL 2ZOLA 1ZLVH 4M61A 1EAPA 2NTFB 5C0AE 4XWOC 3IGAA 4NO0D 4LSTL 3ZO0A 3TBTA 2R0WL 4LL9A 1KELL 4PGEA 2JIXD 3RWHA 1HQ4B 3SGJA 5I76A 2IAMB 3VG0L 4M9OA 1Q8MA 1PZ5A 2HG5B 4MZ2A 4UV7H 3EDEA 1YYLL 1XF2B 4M7KH 2R9HD 4QF1A 3V6FA 1TJGH 3VXUE 4Y2OA 1FDLH 4FQXC 2OTWB 5KVMC 4RWYH 1N3NA 2OR9L 4MWFB 3UZVB 3GSQA 4L3ED 3U9PL 4KK9D 5BV7H 4EEEA 1GAFH 4BFBD 4J6RH 1S7TA 1YNKL 2E27H 5GSRA 2FBJL 4YR6B 4LARL 2PYEA 1AC6A 2A38A 4LVEA 5EUOA 3RAJH 4M8QA 4ETQA 3O45A 5IOPB 1MRDL 1QBMH 4KJYA 4ZXBC 1DE4A 3GRWH 5FM5M 4GG8B 3BSZH 3LKRB 1FFRA 2D0GA 3RUGA 3IJHB 1MCKA 5SWZD 1EEQA 1NEUA 4X5WA 1ZGLA 5ID0A 5KSBE 1WITA 1HHKA 4YDJA 3BGMA 3QDHA 5IUSA 4MNQD 1J88A 5DQ9A 4L4TA 3LS5L 4OQTH 1FYTB 1KJVA 4B0MM 4ONFL 4UILH 2JJSA 4I0CC 3M17A 3LKQA 2Q76A 4KPHH 4RMSA 3WFEL 1MCQA 1NMBH 3NCEB 1XZ0A 4YC2C 5T5FH 5FGRA 1PSKL 4TPRH 1R6VA 2KKQA 4QCIB 4MJ2A 2X40A 3GMMB 3DO7B 4ZUSB 4KMQA 4P46D 1K3IA 2XFXB 5LGHL 4ZFGH 4S1DC 5B8CB 3DIFB 3B8SA 3BXNA 1ZV5A 2MKWA 3D0LA 1U8JA 5FM5O 3RZCB 4XH2B 1WTGT 5DSCB 2K1MA 3JTTA 4PJBF 2BMKB 1TXKA 5J12C 3PWNA 4F9LC 5EN2B 1AR1C 3STZB 2CKBB 3BDYH 4Z7WE 5IVZB 3H6JA 4M4RA 4WW2C 1V7NL 2YSSA 3MRHA 4NN6C 4PRNB 3JV5A 3QXAB 2DKMA 4JZJB 3RGVB 3TJEH 2A1WL 4M43L 3O6LH 3SCMD 5IG7A 3W0WA 1NLDH 5F7KC 3GHBH 3TH4T 5JHDE 1JN6B 1O7SA 3FFCA 3CFKB 4PD4J 1A6VH 4ONHB 5KVGL 3D85B 2WINB 4FQ2L 3ECBB 3QJFB 4IRJC 5CD3B 5CIPB 4I3RL 3WO3B 2FEDC 3GSRB 1BBDH 2KH2B 4A6YA 1N7MH 4P9HH 1YEIH 2NY2D 4X83A 1T2JA 3QDAA 1CE1L 1FO0H 1Y0LA 1JHTA 5C3LD 4MA1B 4YAQA 3GMRA 3WN5C 1NGYB 5F9JA 1A7NH 1P53A 1R3KB 1FNSH 4CU6A 4K8RD 3HZYB 2N4IA 2X7LA 1AGFA 3UTPE 1BGXL 5FIEA 3PGCB 2A77H 5EO1A 1NAMB 2YXMA 4HQQL 4Q6IB 3QI9A 1B0WA 5J13B 2VDMH 4K3EH 4HULB 3U46A 1JTOA 5E94A 3SKNA 4M5YL 2C3VA 2VTFA 2VXVL 4PRPE 1DVFB 2HJFB 2CJUL 5I1DA 1F6FB 3S36H 5D8JL 1XIWB 4JB9L 4DZBA 5I8OH 3TP4A 3B5GA 3C5ZD 5E2TL 2QSTA 4YHNB 3ZT5A 4GUPB 4MHHI 4Y4FB 1SJEA 3OAYK 1BLNB 2C4FU 3Q3GB 5CEYB 1YPZA 4UIKL 1FL5A 4OLUL 3BWAB 3I3EA 5MEPB 3UPAA 1EO8L 3MZTA 4G8GB 4JM2D 4NP4H 4PB0L 15C8H 1LE5B 1B6DA 4ZFOL 4OCXH 4S2SA 5CLTA 1A6WL 1I8KB 1DQTA 3LD8B 5D7JB 4GG6E 4OJFL 5A2FA 4X80L 4OCWH 4LVNB 1CICA 3VGAC 4RGMC 4O2FA 4HAGA 3V5HB 1S5IL 5TE7H 4A2LA 1JPTL 3QJHB 3FQNB 4XMPH 1AD0B 3OAUH 3IFPA 4XC1L 1TIUA 3ARUA 4X9IA 2PN5A 3KPOB 2NW2B 4PREA 4Q6YA 1ZOXA 5F9AC 3CLFL 5CZKA 4Q9BA 5J11C 5EU5B 2KUTA 3O3UN 2AW2A 3MNVA 5CGYC 3QIWD 2G5RA 2AEWA 1RIUL 3H9HA 4L8BA 3SDCB 4BFEA 5E1AA 4P59L 4PTUB 4OZGB 4YHOL 4MJIB 5C8JB 3O8XD 3IT8D 4J8RB 3BP5B 2YKLL 3BPCA 4WTZG 1KTLB 5FM8A 4M7LL 3WUWG 1DN0B 3T0DA 4Y1AB 4OFKA 4JHWL 2HMID 3SY0B 5K59F 1C16B 4U1SA 3JXAA 3HE6C 5ITFB 3U79A 3S9DB 1A4KA 4PJ5A 3PWPB 3O6MH 1IAKA 4K94C 2BFVL 3QA3A 4NNYB 4QRPD 1R5WA 2EDYA 2CMRH 2QSVA 4P2OA 3FQUB 2Y5TA 3QDGA 4OZHE 1MFCL 2W1NA 2X4OA 4FQJH 1IFHL 4KAQH 4UB0L 2VITB 5DUMH 4RMWA 4G8FA 4XP5L 3FZUC 5EBWA 3O6FA 1YJDH 5KSUB 3VFOB 5HYIA 4E42A 3V6BR 2YD3A 1WIOA 3F7VA 4R8WL 5GS0H 3N50A 1A14H 5FDWA 1IEAA 4ZAKC 4WV1C 4XP1L 4LHQB 4X6BB 2GW5A 2WZPD 3RGHA 2DIJA 2FB4H 3L3JB 4LBEB 2P1YA 2RHEA 5JW5B 4WFGD 1J1XL 1D6EB 4AH2A 3EYOB 2AERT 1YY8A 4I48B 1NGPH 5L2KB 1DSFH 3FHAA 2UV3A 5K33A 1TTFA 4KKLD 1TTUA 4NKDB 5INCA 5LBSL 1MWAH 2E5EA 3MLZH 1H0DB 1WAAF 1MJ7L 3BT2H 5TFSL 4DW2L 4KTEH 1MLCA 1Q9WB 4LHUD 1NCCH 1HQ4A 3TBVB 2ADGA 2X2YA 2ZUYA 4PRHB 2IAMA 5C92A 2IQ9H 4ZTOH 2HG5A 5EUOE 2BVYA 3P9MB 2HWZL 1MCWW 4KGJA 1RZFL 1RUQL 1QZ1A 2K7QA 1YMHB 3L3DA 1T1XA 4WTWA 1JUFB 1TJHL 1V7ML 2E9WA 3CSBA 3Q1SH 4NZUH 4J3XA 3ULVE 1G6VK 4YR6A 25C8L 5EU7C 4XAWL 1QPPA 2PKDA 1RIVL 2IGFL 3ARED 4MDIB 4TTDC 3ZKND 1GC1C 2PR4L 5GPRA 1XF4B 3K8KA 3WUWB 1PG7L 3IJHA 4U0RC 5BRZD 2P7TB 5D7IB 1H3UA 2DM3A 4NN5C 5EB9A 2H2SD 1I9JL 1WCQA 1S7RB 4DFHA 2R4SL 1Q94A 5EU6D 2EE9A 5LXGL 2R23B 32C2B 1XGRB 3ZE0F 3E8UH 1FYTA 2AKRA 4PUBL 5CP3H 2A6KB 2D7QA 5F72S 5CFHA 4MXWL 2BSTB 5ADPL 5IWLA 4DKFL 4MVBD 4UQ2B 3RTQA 4NBXB 1S8DA 4D9QD 4QCIA 3DO7A 3QNZB 1G6RH 2MFNA 2FJGB 4ZQKB 3W0WE 5C86A 3UPRB 4UT6L 5BV7C 3RZCA 2VLJA 2DYPD 1HI6B 4NO0B 3S3SA 2BMKA 1BF8A 3U6RA 4NKOA 2JIXB 1TVBA 3VXPB 5EN2A 1KC5L 4NN7C 5IVZA 3H2WA 4HFWB 4LMQI 4PRNA 4PRIA 3QXAA 1WBXA 3P4NB 4XAKD 4JZJA 5ACLA 5I1HL 4PJ8C 1QSED 1UYWL 5SWSD 5FKPA 2V2XB 4OM0H 2DTML 1J5OL 3H7LA 4OCYL 5I1EH 5J6HA 5JW3H 3AS3A 4XCEB 3SE8H 3CFKA 4L3EB 4ONHA 2AV7B 2WINA 3D85A 3LEYH 3ECBA 3QG7L 3IKCA 5HPMB 1H5BB 5CIPA 4W6WB 1AJ7L 3GSRA 2E6PA 5DR5L 5SX5H 4OD2B 43C9B 3P2TA 4BA8A 1QLRB 5AYQA 1XCQB 1LO0H 5DD5L 3PDDA 1GC1L 3BYTA 1OGAA 1U6AH 3FQXB 4HZLA 2ZG1A 3UBXG 5K9KA 1UM5H 2D7PA 4JY6B 4L3AA 4MQ7A 2JJVA 1P7HL 1NDMB 3HZYA 3QYCA 4R4FH 2I27N 5EZLB 5CINH 2QADC 1NAMA 1MHEA 3UC0H 4Q6IA 3HB3D 3LEXA 3VXTA 4NQED 2Z31C 3MRLA 1SVZA 4HCRH 2DOCA 1G84A 2NY4D 3CFDB 2V6HA 4ODBD 4UV7L 3TCLA 2XWBA 4M7KL 3R0NA 4N5EC 1MCJA 2HJFA 4X8JB 1T22B 2IBZX 1FDLL 3MUGB 3OL2A 4RWYL 3ARFD 4B7LA 4YHNA 1K4CB 4GUPA 5BV7L 2FL5B 1GAFL 4Y4FA 4YNYB 4EN3C 4J6RL 1FG2A 3Q3GA 5CEYA 3CU7A 2E27L 4JREC 4S1RH 2CIIA 1KPRB 3M45A 1MVUB 2WBJD 3OXRA 2ZNWA 3BWAA 1MCEA 3RAJL 1PD6A 3TVMC 4OF0A 2D7MA 4JLRB 1QBML 4NC1C 1LE5A 3GRWL 1KTKE 2VABB 3BSZL 4GFTB 4ZOEA 1I8KA 3EYVB 3WE6B 3OJDA 4R4BB 3SCMB 4I9WE 1JE6A 1CWVA 4NO3B 3QUMB 5IROC 2A0LC 5F9OL 2AQ3A 2DL2A 3QJHA 2X1PA 5ADOH 5DURB 1G9NH 5HVHC 4OQTL 2GQHA 4HJJH 3UZQA 3VG9C 2NW2A 3Q6GH 3D39E 1FZKB 4UILL 2YD5A 4ZPVB 5TDNB 3KYMB 5F6HJ 3DYOA 1T0NA 5EU5A 1XGQB 2WQ8A 3ROOB 4KPHL 1PEWA 1NMBL 5DUPH 4YBHA 4KRPD 3SDCA 5I2IA 2R0LH 2QQQA 1OLLA 4PTUA 4OZGA 2CPCA 2Y07H 2VLKD 4MXVE 3QDJE 3BZDA 4RISH 4ZFGL 1R5VA 3RKPA 5L88H 3FT3B 4J8RA 5GS3A 4U6XB 1YMMD 3RZWA 3IDXH 4HLZH 5EIIA 5D2NC 1DN0A 4N0YH 3BDYL 3TZVB 1JZ7A 3RVWD 4OKDA 4JO2H 4GRLB 2I9LB 5DRZA 4HXBL 3TJEL 3O6LL 1DQDH 2WP3T 4P5MB 5ETUB 1NGZA 3N1FC 1NLDL 5EBLB 1WWAX 3GHBL 3FQUA 3RVXD 2ICES 4NYLA 2DQFB 4FS0A 3UBXB 1A6VL 1TQBB 3FONA 2AVGA 4HUMB 4JJHA 4Y5XC 5E9DD 2VITA 4KJQC 4QRSB 4KRLB 4LLVB 4UOW1 5ISZE 1RURH 2EDWA 1W8OA 3GMPB 1ZANH 3NCMA 4RGND 5KSUA 2ITCB 4CVXA 1N7ML 2BHUA 1S7VA 1YEIL 3BZ4B 4JM2B 4EI5D 1FO0L 1VKXB 4WI2A 1QSFB 1U9KA 4CBPA 1RJZA 3CVHH 4MGXA 4LHUG 4YZFF 4MB5A 4X6BA 5HGDB 1VPOH 1MFEH 1A7NL 3U36A 4D9LH 1FNSL 4PJDE 1T03H 1T1WB 4WU5B 4BELD 5F88B 5FGCE 2A77L 3KS0H 4GXUN 2YUWA 2P5EE 2VDML 1YEHH 2YRZA 4K3EL 1F97A 5C0FA 4WUUE 2J3SA 5IJVA 4I48A 2EC9U 5DFVC 5F21B 4JJ5B 4NKDA 4J4PC 3FRUA 3T08A 3AM8A 1ZT7A 2GUOA 1H0DA 1T1YB 4X5XB 2QQKH 3S36L 4P48A 5I8OL 2H2PC 1Q9WA 2GT9B 1QRNE 3TBVA 4PRHA 1LP9A 2HYMA 2JJUA 5GJTH 4E0RA 3N0PB 5IB4A 3TYFB 2X4PB 4Y2DA 1T89C 3D9AH 3FB5B 5J7CC 1YJDC 1WZKA 3BW9A 2Q3AA 1BQSA 3GIVA 3WSQH 2ICEB 4PLNC 4KDWA 4LLWA 4NP4L 5I74B 15C8L 3QISA 2BVTA 3EYFB 3VWJB 3QQNA 4OCXL 4M62H 4DZ8B 3TFKC 4HX1A 3LPWA 4QRPB 3PQYD 4OCWL 5D71H 1JUFA 1AD9B 1UENA 3F6LA 5GIRB 1KB5H 1JIBA 5TE7L 3ES6A 1PG7W 4XMPL 3OAUL 4LCCB 3QIBD 4G6AD 2E9BA 1KACB 4WTZA 3KPTA 3MBXH 5C0CD 1XF4A 1OTTD 2BNRD 1FC1A 3WUWA 4G6ML 2P7TA 5D7IA 3MUZ1 4L5FH 3QB7C 1GH7A 3PXJA 3RHWF 2WW8A 4NO2B 4XP9H 3EJJX 4Y16C 3RRQA 3SGKA 32C2A 2OXHA 3U4EB 3OF6D 5KSAC 1F4AA 1MHHB 2VLJE 2A6KA 4U6HB 3K46A 4TNVK 1G7JB 2AXGB 1NSNH 1SEBA 3DNKA 3KPMA 3PHOB 3UROR 2PW2A 1GIGH 2HLFD 4QRRE 5C08A 1T83C 4I13B 4PRAB 1K3ZA 5F6IC 2VXTH 4DCQB 1T2QH 3O6ML 5IVXB 4TUOA 4PR5B 3EOAB 2CMRL 1BOYA 4LCUB 4AMKH 1QRKA 2XPGA 2YA1A 1HI6A 1NC4D 2LV4A 3S88H 4JN2B 1Q0XH 3DX9B 1R0AH 1QR4A 4HIHA 4Q2ZB 4LHUB 1OQXA 4FQJL 1CD1B 2CK0L 4KAQL 5DUML 5IV2B 5DHVA 4PRDB 3BN9D 4NC1E 5I1GH 3AXLB 1YJDL 3D2UB 4GKZA 5FYKE 1BPVA 2V2XA 2R0KH 4KK5D 2DLFH 2LAGB 4ZUTB 4XWOD 5KSBF 5JA9A 1J8KA 3CSGA 1KGCE 1G7MB 4P4RB 3UTSB 3SDXA 4OAWA 4XCEA 5GS0L 1A14L 4I1NB 4C59B 3FAWA 2AV7A 4YHKH 4S0TD 4WI9A 4NUGH 2ZCKH 5CSZA 1D7FA 1YZZA 5HPMA 4F9PC 1H5BA 2NY3B 2W91A 3HPLA 3T0EC 3B43A 4JEGB 3QXWA 4OD2A 4JFYB 1QLRA 2FZ3B 1XCQA 4FQXD 4QLRA 4M9PA 4L9LB 3ARGB 1MSPA 1NGPL 4JZOA 2CDGB 1DSFL 1EUUA 5D70H 5J9PB 2QBWA 1J11A 5BQ7A 1KIUA 3IYLW 1MWAL 3MRQB 3OR7B 4O4YH 1MCBA 5EU6B 3BT2L 1P5VA 1PKQE 4DOHE 4KTEL 1FSKB 4NRYA 1NCCL 2V2TB 5D2NE 2X6MA 1HSAA 4ZXBD 3WDIA 4Z7WF 1CT8B 1RUMH 3GMNA 4Z5RB 4KJPD 4XP6H 2IQ9L 3I3BA 4G8IB 4ZTOL 3NN8B 3QHTC 3CFDA 4FNLH 1UM4H 1QLFB 5IMLB 3ARDD 3Q2CA 5HI5C 1BF2A 3R4DA 4PJIA 4BJLA 4X8JA 1T22A 2EDXA 1MOEA 1AGBB 1KUMA 1JV5B 4XPAH 3IETB 3RWEB 1OTUD 1K4CA 4QRQB 3EUUA 3P40A 5SV4A 4NGHH 4TQEH 4L8CB 1UEMA 4F33B 2DYPB 3Q1SL 4NZUL 1KPRA 2HT3C 3GZKA 3PIQB 1MVUA 4JR9H 3KYKH 3T77B 5I75C 3RWFB 3QPQC 1DQQB 2IH1B 4GRWB 2VABA 5EH1A 2H9GB 4K7PH 4GAYA 2HRLA 4S1DD 3EYVA 5SWSB 2EH7H 3QUMA 1OAZH 1A7PH 1I9RH 2H41A 1V3MA 3P30H 1X6NA 3PWVB 4IRSD 2Z92A 4CADB 3REVB 3BHBB 4U1KB 1BJMA 1BZ7A 2VDRH 4X98B 1Q38A 3E8UL 5TQ0H 1FZKA 1OOAA 5TDNA 3C87A 1VERA 3KYMA 3OKNB 4PLKC 2Y25A 5FAAA 1XGQA 4RFEB 3B9KB 1TQCB 5DWUH 4DGIH 2ICWB 5BW7A 3CH1A 4E41E 5BJTB 3MRIA 4MXQD 4FQCH 5LQBH 3CFCH 3RVUC 5DD0H 1HILB 1G6RL 3ZKMD 3BZEA 4C56D 4HIJB 2EIBA 4XNUH 1BIIA 3WEXA 4IRJD 1A6AA 1EXUB 3MV8E 4IHOA 4X4YB 2DLTA 1I8LA 1EFXD 2NY6D 1WF5A 4JKKA 4Z77B 1XGTA 3DI2B 4MD4A 3MRCB 2IQAB 3QAZC 4G42A 1MFAH 1OWRM 1EVUA 1XEDA 1AXIB 1UQSA 5BXFB 4IIQC 4GRLA 4KRMB 4Y5YB 2NY4B 4G6FD 4U1IB 2V17H 4P5MA 3AS2A 4PB9H 4GMTL 5TF1H 5I1EL 4OBRA 5C2BL 3BD5A 3SEPA 3MGTB 5JW3L 1CG9B 1DQJB 4OZIF 2DQFA 2JTDA 3SE8L 5LGJA 5GGRB 4IDJH 2BVEA 5DC9B 3UBXA 5B3JF 4EZMA 1G9NC 3MOBH 3LEYL 5DTFB 2JE8A 4LLVA 3VFUB 1W2KT 3T65B 2IALA 3GMPA 5KJRH 1GVIA 2PO6A 4NNXA 5H8DA 3LN4A 3QQ9D 3MJ7A 3PABB 1LK2B 1MCRA 5C0BE 3BZ4A 4WU7A 1LO0L 4E9LA 3ZSSA 4M93C 1AO7A 1HEZA 4CVUA 1U6AL 1LE9A 3D3VD 1QSFA 1RI8A 1RUAH 2WUBH 1UM5L 4C55A 4C83B 5HGDA 1NANH 3CZFA 3OKEB 1I85A 4OFYA 1U8HB 4R4FL 5D1XA 4WU5A 5F88A 5D4QA 5CINL 3TJHC 5E6IA 4NM8H 1J05B 3S5LG 5F89B 3UC0L 1FNGB 2YC1B 4S1QL 1U3HC 4KK8C 1I1AA 5E00B 3G9VA 3HI1B 3VE0A 5ABDE 4HCRL 1CI5A 1AGCA 4JJ5A 3E6FB 4UOW0 4BSVB 4LAQH 3BP4A 3P9WB 4QHLA 1M6OB 3MUHL 3H7BA 1FVDB 3WHXB 3S97C 2GTWA 2EO1A 4U6VL 4X5XA 4GOSA 1BZ9B 3DV6A 4HIIB 4AYFA 4JRWA 4S10A 2IPTH 5GJSH 4LNVA 1YMMB 2HTKC 3CK0H 2F74B 5D7LD 4S1RL 1Z5LA 3L3IA 4M7ZB 3OJMB 4RMTA 4YE4H 2D03H 5MENA 3GBNH 4OLZL 5CGYD 1HOCA 5DLML 2VUOA 2ICEA 4ODWB 2J12B 1FLTX 3EYFA 5FV2A 3TN0C 4DZ8A 2UZXB 1EHAA 1CU4H 2V2WA 4KJWD 3RFZC 1AD9A 3QQ4B 1QUNA 1YNTB 2DQIH 5I1IH 4EDWH 1HNFA 4F37K 4FTVA 1PX3A 4XNMA 4LCCA 5ADOL 1G9NL 4HC1A 5E9DB 1GGTA 4HJJL 3Q6GL 1CVRA 3GMOA 3HE6D 4WW1B 3SDAA 1LD9A 1FAKT 1MHCB 3QH3A 5J89A 5HPOA 5DUPL 1E6OH 3DGCR 1INQB 5C08E 4EI5B 2R0LL 4O9HH 3UYRH 2Y07L 3QHZH 3SO3B 4RISL 1LO2H 1TZHA 3U4EA 5IBTH 5DJYA 5AAWA 5L88L 1VCAA 2EXYC 2PXYC 4KTDH 3S4SG 3WS3B 1IGTB 4M1GH 2E6JA 4S0SD 4BFIB 3G6JF 2D31B 3IDXL 4UAOC 4WW2F 4UT7H 1WT5A 4P2QA 1ORSA 3PHOA 4N0YL 4F7TB 3N1PC 1DUZA 1SJHB 1CXKA 3DRQB 4JO2L 4X9FA 1OY3B 1CDCA 1N26A 1WVZA 3MA7B 4ZAKD 4KROB 1ZKAA 5IVXA 1DQDL 4HAFA 3EOAA 4JFEA 4LCUA 4TSCH 2NY0C 3ZT6A 3DGGA 1J8HB 3MRBB 3VFWB 4OT1H 4Q2ZA 4F57H 5HI4D 3X12A 2F53B 3DX8B 5IV2A 1RURL 1KJ2B 4K3JH 3MBEB 4X6DF 2R69H 1ZANL 3AXLA 4BH8A 2YWZA 3GJEA 3S5LB 2PNDA 4KY1H 1BVLB 3GFUA 3TGXA 4Z7VE 3WLBB 4ZD3H 4YDKH 4HWBH 2JLLA 5H94A 1J10A 4ZFFB 4ZSOB 5HGBA 4Q0XH 5EZJB 1I1RA 2CKNA 5KS9A 4P5KB 3CVHL 1IC7H 1S7XB 1VPOL 1MJJB 4D9LL 4D9RD 1T03L 2ZJSH 2C3HA 1A6ZA 1BQUA 3HMWH 3HMXA 1YC7A 4XXCA 3QIBB 5JZ7C 1YEHL 4UNUA 4JKMA 3KPPA 3CVIH 4Z7NE 4HHAA 2BNRB 2P8MB 2Z35B 4W81A 1QVOA 4LVHB 4NQCA 2BNQA 2NXZC 1LO3H 3I9GH 2BOBA 2CKBH 3MRQA 3OR7A 1ZGLP 3LQAH 3DV4B 4KQ3H 2QQKL 5JUEH 3ZKSD 4JVPA 1G7QB 4GBXC 1ZLUK 1M7XA 3JV4B 2V2TA 1CDYA 4TTDD 4K9EC 1M7IA 5GJTL 1H3GA 4HWEH 4WDIB 3D9AL 3TNNB 1QLFA 1E27B 3WSQL 1NBZB 1UADC 4X7CC 1OB1B 2XZCH 1AGBA 1JV5A 4M62L 1AH1A 5I66B 3IETA 4OFPA 5ERWA 2EO9A 3O81A 3O9WB 1C12B 4OZIB 3QXDA 5D71L 3OX8B 4L8CA 5GS2H 1KB5L 3RNQB 1NC4B 2COQA 2I60H 2ZSWA 4RX4D 5EO9B 3PIQA 2VN4A 5L9DH 3RWFA 2RCSH 1S7UB 2DLEA 2B1AH 3S4SB 3THMH 2CLZA 1UWXH 1Z9OA 2D0FA 2VQTA 5L6YH 1HXYA 3MBXL 5D5MB 5DZNA 4PJFB 4HWZB 5GGSB 1K4DA 1N59B 4L5FL 3K1DA 1ZS8B 5D9SA 2M2DA 4NM4L 3PWVA 4CADA 2YOCA 4XP9L 5DRXA 3REVA 3K4ZA 5JXAH 2C5DC 4Z9KB 1QHOA 4L8SB 4JRXA 1SMOA 3OKLA 3QG6A 4U1HB 3QSKB 3LMJH 1NSNL 4PJ8D 3IDNB 3B9KA 2DJ4A 4JG0H 1C5BH 4OZFG 3RL2B 3VXME 2OP4H 4JFDD 1TCRA 4M6NH 1Q1JH 1VEOA 2NXYC 2VXTL 3SJVD 1T2QL 3IFNH 3A6BH 1TDQA 1P9MA 4AMKL 1CFNB 1EXUA 1YY9C 3LS4H 3MNWB 2HFFB 3S88L 1N4XH 1Q0XL 1R0AL 5F9DC 4ELMB 2XICA 3H42H 4JPIB 1JZ3A 2D9CA 3RL1B 2IQAA 4JQXA 3LB6C 3QNYB 3UTQB 5BXFA 5I1GL 2EIDA 4Y5YA 2G75A 4EIZC 5HYSG 3HG1E 1BJ1J 2EDRA 3ARDB 4MNGE 3NCBB 5JR1H 2DLFL 2CRIA 1OPGH 4L4VB 2V5MA 4AG4L 4BYHA 3QI9C 5H35A 5IMOB 3GGWB 4MQXD 1U93A 3EO0B 4NUGL 5F1KC 3NBNA 2ZCKL 4U1NB 2Z31D 1P7KB 3HAEA 3O4LB 3T65A 4MDJB 5C07D 3DMMA 1LVEA 2V9QA 4DEPC 1CF8H 1T3FA 3PABA 4PJGF 1LK2A 1RJYB 4N5ED 1OL0A 4LU5H 5E2UH 3ZL4H 1BQLH 3OGCB 4ZDHB 3KYOA 4DUXA 3MV7D 5FB8B 3EO9H 5D70L 3WHE1 4C83A 4EN3D 2BCKB 4UDUA 1N8ZB 1U8HA 1S9YA 3DTXA 4IRSB 5DZLA 2NNAA 4JFPB 4XX1E 1L6ZA 5H37G 1TZIA 1AIFB 1J05A 3I6LE 1FNGA 2YC1A 4FXGA 2ZUUA 5HHOA 3V4UH 4LSUH 2R2BB 1RUML 4HMDA 3BD3A 5DO2C 4XP6L 3I02B 3MSPA 1T0MB 5IJKC 3ILPA 4FNLL 1UM4L 2EDJA 3G04A 2VLRE 2A0LD 4N0CC 1ED3B 1FVDA 3WHXA 4AIZB 3NFPB 4DVBB 4XHJD 4FG6C 1M71B 1FBIL 1NCUA 4PJAA 4XPAL 3BGAA 4G43A 4C56B 1HHJA 4YGVA 4P2RB 4BZYA 1P2CB 2EIEA 1F4WH 1OAQH 3KXFE 4NGHL 3UJIH 4TQEL 4A6YL 3UYPA 2F74A 2QR0A 1UVQB 5E08L 1ZVHA 1EFXB 2NY6B 3C6LD 4JR9L 3KYKL 3OG4B 1HNGA 2G2RA 3HS0A 1BOGB 1D9KB 3X13A 3ZE2E 5HYFA 5HYJB 3LQMA 2FIKB 3ELAT 1OHQA 2DLIA 2XWTB 4GS7C 2ESVB 2G9HA 3VRLE 4PJXE 2OJEB 5DK3A 4OZFB 3QQ4A 1OAZL 1A7PL 3GJFA 1I9RL 5B21A 3P30L 2DQDH 4NBYB 1P7QD 2IMMA 3GSNA 5EU3A 4XNYL 2WWMD 5DHXB 2VDRL 5TQ0L 2X42A 1W8NA 2BC4B 1HIMH 5FF6B 3P9LB 4P2QE 4P2OC 1OAYH 3A0OA 2BY3A 4DGIL 3MRMB 1X4ZA 4JO4H 4LLMB 4FQCL 5LQBL 2P5WE 3DXAB 2HTLD 3IDYC 5F7FA 4I0PD 5DJXB 2B8OT 1U2CA 5HYSB 2BVUA 3KLSA 3OB0H 4QHUB 3O6FC 4Y4KD 4OV5B 4XNUL 4KJQD 4TNVF 3MXWH 3TBSB 3U30C 3WS3A 5C0EB 4OCLC 4BFIA 2XZZA 3RBSA 5IK3B 4PJ9C 4RMVA 2HA1A 4F7TA 2XN9D 1QA9A 1FZOA 1ZHLA 1MFAL 3DRQA 5D2LB 4H8WH 4RDQG 2V17L 4GKNB 4PB9L 3HR6A 5TF1L 2MWCA 5CLWA 2VLME 4QOKD 1J8HA 3VFWA 4H26B 2OL3B 4JDVB 1FV1A 1OGTB 1HXMB 3CX5K 3MOBL 1DDHA 4ZODA 3IVKB 1KJ2A 5JLZB 3SN6N 5KJRL 5DYOB 3S5LA 2DTSA 3NIFF 3BVNB 1N5AB 3SQOH 4X7SH 3T3PE 4ORGB 4CMMB 4ZFFA 4ZSOA 4NZTH 3ZT7A 2OJZH 2OM5A 2H2PD 5EDXA 1RUAL 4P5KA 2WUBL 2IAMC 5HYQB 1JI1A 3KPSD 5MI0B 3UJTH 4QYOB 3T0BA 3WMSA 1MJJA 1SQ2N 2X9XA 2Q3ZA 1IC1A 2WK2A 2OR8A 5KOMC 4FFZL 2Y5EA 4PP2B 5F1IB 3BEVB 1S78D 4NM8L 3QWRA 3QEQE 3B6SA 4NPYB 1X7QB 1S9XB 1QQDB 4YWGH 5T1DH 3TFKD 3EBAA 2Z35A 4WNQB 2NY1D 1T7XA 2V7HB 3QXTA 4XCCH 5DJDB 2DI9A 5C09E 2H6PB 4N8CH 4LAQL 1LGVA 4HS8H 4CU7A 5E7FA 4DGYH 1AKJD 3DOSA 3I84A 4PY7B 2IPTL 1MAML 4LDEB 5GJSL 4XNQB 3WL9B 1JGEA 3CK0L 4LCIH 4FFYH 3NFNB 4LFHD 2JJTA 5CEXB 4YE4L 5C0BD 4WDIA 2D03L 3GBNL 5I6XB 2CIKB 2DIBA 1NBZA 2W60B 1IM9D 4G6KH 3ZSTA 1U92A 2YPLB 4RA0C 5CUSH 4MCZB 2ED8A 1SYSB 1CU4L 4MYWB 5F9WB 2CXGA 3O9WA 4ZO9A 1IRAY 4QRUB 5FCSH 3OX8A 2P49B 1HCVA 3RNQA 4HUKB 4OI9A 2B4CC 1WBYA 2DQIL 4EDWL 5I1IL 5EO9A 3VGEA 4FQPA 3FN0H 3FJTA 4HF5H 3C09B 3B3IB 1S7UA 3S4SA 5KSVB 1E28B 4LVOB 5F7MC 5B8CC 1FFNA 1M7DA 5M95B 2AXHA 3ME0A 4YH6A 5D5MA 4NFCA 1NBQA 1EJOL 4JY4B 4PJFA 3RZCC 4HWZA 3UTTD 1EAJA 2UZYB 4PJHF 1E6OL 2Q6WB 5DHYB 1N59A 1WCBB 3BPOB 1Y18B 2EDTA 4DGVH 4PJ7A 5T1KB 3P0VH 4O9HL 2OK0H 1Q9LB 3UYRL 2YXFA 2ZOKB 3QHZL 4WWKD 1BWWA 2YEZB 3BH9A 3LQAC 3QIUD 3OKMB 1LO2L 2XKNB 2FCBA 2VAAA 5IBTL 1WC7B 4JZJC 2ADIA 4KTDL 3RGVC 4HSQA 4M1GL 1I3RB 1A2YB 3ARYA 3MJ9A 4BK5A 4AT6B 1A7RH 4UT7L 3IDNA 3QO0A 4DVRH 1CDIA 4OF3A 1KEMH 2DI8A 2HVKA 3SDDB 3A67H 1QTYT 3FO9B 3ARQA 1CFQB 4ELKA 2YUXA 4YIQB 3MRPB 1O7VA 2VNCA 2GY7B 4TSCL 1CFNA 2HFFA 3REWB 1GGBH 3T0ED 4OT1L 4IRZH 4F57L 2W0KA 3QCUH 4JPIA 5DRNB 1QNZH 1EGJA 3RL1A 1FVCB 2UYLB 3A6CH 4LLUA 5F1NB 3DYPA 4MA1C 3VGDA 1GZPA 4K3JL 4Z7UF 4N68A 2R69L 1IC5H 1F02I 4M3JA 2P24B 3LV3B 1YEFH 2GSIA 4M1CC 4KY1L 4MMXC 5DJ0B 3QQ3B 5FHBH 4L4VA 4P2CG 4ZD3L 1DEDA 4YDKL 4HWBL 4N9OB 4Q6IC 5J13C 4C4KO 1MI5E 4Q0XL 2IANE 3O2WH 5DD1H 3UBXI 4Z76B 1IC7L 5MP6L 5H2BB 4ONGH 4U1NA 3ZKQD 3O4LA 2ZJSL 1I75A 3OAZH 3TO2B 3DSNA 1DVFC 4KKCC 3G5ZA 3HMWL 5AAMA 5D1QA 5HI5D 1URLA 4JFFE 5C6PB 1XIWC 2VQ1A 3AY4C 1ZVSB 3CVIL 5IW6B 3OGCA 4ZDHA 4JGUA 4OCMC 4OIIH 1IKNA 4K8RH 4OF5A 4Y4FC 5FB8A 1UB6B 2H8PB 3KVQA 5J56B 3EFFB 4QRTA 1LO3L 1HQRA 1PG7X 3I9GL 4JPVH 2BCKA 2CLRB 3E0GA 3W81A 5IB1B 2CKBL 3MRNB 3LQAL 4JFPA 4DFIA 4KQ3L 5JUEL 1AIFA 2BSRA 3MRFA 5AUMA 3QPQD 1KV3A 1F3DJ 5B22A 3LD8C 5D7JC 4APQB 3E3QC 3VXSB 3I02A 2PTTB 4LVNC 4HWEL 1T0MA 3N1MC 3BH8A 4O2CB 3JVGA 2A9NH 3W11C 3STLB 4MB3A 4LCWE 4BH7A 1U8OB 4AIZA 4DVBA 2XZCL 5T1LD 1M71A 5HHME 1CVSC 3X11B 2GJ6A 4P2RA 2W38A 3SE3C 1P2CA 1IC4H 3BRDA 5JQHC 3MUJA 4FA8A 2I60L 2BY2A 3WHE0 1R3JB 3AS1A 3SDCC 2IFGA 2CK2A 1G7HB 5L9DL 4LNRB 3UDWC 2B1AL 1D9KA 2WAHA 4LIQH 3RVVC 5E7BA 5HYJA 2Y06H 2EYRA 3FB6A 2XWTA 5FGSA 2R29L 4HUVA 4ZNEE 1KIPB 2C9AA 4RZCB 2BVQB 1LNUB 4OZFA 3SKJH 1G9EA 2EYTA 3CXHJ 3G6AB 1DANU 4RRPG 4F37F 4G9FA 5DUBB 4WO4A 1UJ3B 1RFDH 5JXAL 3DSFL 5F8QC 1IAIH 1BQHG 4Y19E 3OKKB 5GRWA 5C07B 3LMJL 4ZUUA 1DP0A 4PJBA 4JG0L 1C5BL 1ETZA 5DS8B 2OP4L 3WJJA 2VZSA 2AI0H 1TITA 1C5DB 4M6NL 4XNXH 5FA4B 3HPJB 1G7PB 1BJ8A 2YN5A 1NJ9A 1Q1JL 3MV7B 5HYSA 5HHPB 3AMLA 3MV9B 3K3QA 3IFNL 4MD0B 4OV5A 3A6BL 1EEYA 3HZMB 1ULVA 3LS4L 3VMOA 3CC5B 1ADQH 3WS6A 1N4XL 4PGDA 3T1WA 3GM0A 3H42L 4HMCA 3GKWH 3KNBA 1GZQB 4NBZB 3MYJA 4LLAA 4MA3B 5D2LA 3DARA 5IQ9B 1KCUL 2R2EB 1HHGA 2F54A 5I1AB 2YD9A 3NIDE 1I3UA 3OJ2C 4GKNA 4DK3A 4WGVB 2L4OA 5JR1L 1OPGL 4IOFC 4P5TA 4QY8B 3KGRA 3KJ6H 3JWDC 1I1YB 3QEHB 2OL3A 1PLGH 4KK8D 1OGTA 3SKMA 1A64A 3BGFB 1U8PA 1UKSA 1VGEH 4JCLA 5JLZA 1U36A 5EOTA 3C6LB 1CF8L 4HGMA 1II4E 1N5AA 2P8LB 3D87B 4LU5L 5E2UL 2UY7A 4GKSA 4ORGA 5DEGB 3ZL4L 2GK0A 2EDLA 3HFMH 4PG2A 5AG9A 1BQLL 3QEGH 4PJHB 1NFIA 1YN7B 1EBPA 2Y23A 4WENB 2C7UA 1YUHA 4NZRH 3EO9L 1KIQB 4QYOA 5MEOA 4HJ0C 3MGOB 1A9BA 2HTKD 3F5WA 3S96B 5EZIL 4M5ZH 2Q1EA 3U48A 4X6CF 4YXKH 5ICZB 4J1UB 3VFMA 5F1IA 3ARSA 3V4UL 2YBRB 4LSUL 3VI4E 5HY9B 1OCWH 1X7QA 1ORQB 4PJCF 1JYXA 4HIEB 5TE4H 4H8WC 2V7HA 4AEFA 3MRGA 2VB5A 1NEZG 1NL0H 3RY6A 2I9TB 3EKCA 4I0PB 1JWSB 1CGVA 1BZQK 1A1NA 4PY7A 4Y4KB 3DYMA 3AS0A 4N5UA 5DF0A 1F4WL 1OAQL 5BS0A 5ELIA 2XA3A 3ESUF 3WL9A 3NZ8B 2NX5A 3VD4A 3NFNA 2J8UE 4U6YA 4ODXB 5A3IC 4ZPTB 5E6ZA 1SBSH 4NSKB 1JCKA 3TWCH 1IGCH 2CIKA 3ZLQC 4XVTH 5KZCD 3B9DA 4JPKH 1JPFA 3KPQB 1UEYA 3VXOB 3T8XA 4EJ1C 4MCZA 1SYSA 1X4XA 4LP4A 2E7LA 2EXYD 5J1AB 1CGXA 4QOKB 4P3DA 3WUZA 2DQDL 3BKJH 4UI2A 4PGCB 3OKDB 3MGAA 4RQQB 4UDTA 3MLUL 3QFJA 1JJUA 4N0FB 3WKNA 3NPSB 1FCCA 1E28A 1Z3GL 3FO1A 3G5XA 3VXRB 1LEIA 4LSDA 4JY4A 1OAYL 2VXSH 2Q6WA 4UOJA 3D69B 2NY0D 1Y18A 4RGOH 4F7CB 2F19H 4JO4L 5T1KA 5A2IH 1T21B 2C1PA 1T5WB 2H32B 2VDOH 5E8EA 2AEQH 2K9UA 1F8TH 5FECA 1M1SA 3QO1A 4G8GE 2XKNA 4HKZB 3S8WA 1GRWA 3MXWL 3HRZA 4QHNB 3T1FB 2XTJE 3AAZB 3K0WA 1KYOJ 1DLHB 2R9HC 2BNUB 3K8MA 5CILH 3ZYIA 3HZVB 4UQ3B 3FKUS 3BPNB 1EUTA 2ICWI 2VDNH 3HUJF 3PL6A 1JMZA 3SDDA 5AZ2H 1NFDB 1CGTA 1JHKH 1SJXA 3FO9A 4H8WL 3KPNB 4KK9C 2OSLA 1D3CA 1G7LB 1JI2A 1ZEAH 2NY1B 1S7WB 4Z7QE 3X17A 1H5BC 3ZDZE 2I26N 1SYVA 4BQ6A 2BHYA 4P57B 2VN7A 4X4ME 3QUZB 3ZDXE 3REWA 1AKJB 1E4WH 2JKXA 4GRWH 5I17B 5JZ7D 5JOFB 5JXEA 2UUDK 2AJUH 3VFRA 1YDPA 1M4KA 2PCPB 4MJIE 2P24A 3LV3A 4JANA 2HRPH 5DJ0A 4QWWC 2GFBB 4X7SL 1RJLB 12E8H 1L0QA 1IM9B 1ZHBA 3QDMA 1DBMH 4NZTL 5EIVA 3KLAB 4EKXA 4Y1AE 1T66C 1KXVC 1NEZB 3UJTL 4Z76A 1BBJB 4BK4A 3T3MF 2D9QB 1A5FH 4M6AA 4QXWA 3PWPE 4ZO7A 5IIEA 1OWWA 1MJ8H 3G5YA 3IKKA 4U4BA 4L4TD 4YK4B 4PGBB 4TTGA 1KIRB 4YWGL 5T1DL 1FL6B 4LGPB 1UB6A 2H8PA 4XCCL 4LEOB 4OLYH 2XG5A 1PKOA 4N8CL 5GS1A 4R9HA 2CLRA 1K5NB 4HS8L 3RWIB 5IB1A 4JFZH 3V7AE 4DGYL 4WWKB 2GJ6E 5MHSE 1YA5A 4X99A 3QIUB 1WFOA 1RULH 5HHVH 1XAUA 1UXSB 2FJHB 1IGYA 3VMNA 4APQA 3SCMC 3UPCA 4LCIL 4FFYL 1F4XH 3U0PB 3BOVA 4O2CA 5DZOA 4Z0BH 3C5ZA 2X1QA 3STLA 5ECJE 2C3WA 4JRYB 1A1MB 3BJ91 4G6KL 1EVTC 4ESKA 1W72H 4MNHB 5CUSL 5F3BB 3X11A 4D0DA 3FB8B 3HZKB 3MZGB 3L95B 4POUB 1QFWI 2VDKH 4HW6A 3RU8H 1PFCA 2PTVA 5FGBA 3EYSH 1FIEA 2MMXA 5L2KE 5BW7C 1ZA3A 5C0AB 1R3JA 5KVEH 3FN0L 4HF5L 1G7HA 3UYOD 4YHIA 4LNRA 3V4VH 4HUWA 5C0DA 3FFCD 3RWCA 3T4YB 1JWUA 1LHZA 1IGFH 4GLRI 2FYYB 5FV1L 2M1KA 2NXYD 1MHPH 4NZDA 1SY6H 5JW4N 1JP5A 5ANMB 1O0VA 3GK8H 4DGVL 1YY9D 2DQCH 4BZ1H 3P0VL 2XWJB 4NT6B 3TZVC 3S3JA 3H9SE 2XIDA 3GSOB 4P99A 1L7TH 4WFFE 3MJ8B 3VXUB 2BVOB 4FXLA 3QIWA 4GRLC 2GITB 4UINL 1IAMA 3OKKA 1VFUA 3BI9X 5LCVH 4LRNH 3LH2H 3NCYS 1A7RL 3V79C 5BOZG 5DK2A 4DVRL 4N1HB 4DWHA 1QFWH 1KEML 2W07A 1CFVH 4NO5B 3QI9D 1FIGH 4Y4HB 3A67L 4HDIB 4WFED 1TQBC 5FA4A 3MRDA 4XT1C 1KB9J 4R0LB 2YPKB 5M7QA 1JF6A 3NFSH 4CAGA 1LEKB 5AD0A 4EBQH 3HZMA 4XPTL 3SKOA 1GGBL 4GLRH 5D6DC 4JM2C 3ARBB 3IRPX 4IRZL 4JO3H 2A6DB 3BRFA 3QCUL 1QNZL 1F5WA 1D5MA 3A6CL 5GISH 1VSCA 5EFIB 3QUML 1KT2B 4PJEB 1IC5L 2CO7B 3D1MC 1YEFL 1IQWH 3L9RB 4ENED 5FHBL 2OZ4A 1OAKH 2QQNH 3CFJB 3WKML 1NAKH 2WLZA 3EYQD 2XNAA 1I1YA 2YUVA 2L7JA 3O2WL 2VRAA 3LSOA 5DD1L 3QXUA 1XF5B 2ERJB 4N1EA 5E8NA 5FO7A 5BCAA 3EOTL 2B5IB 4ONGL 5DO2D 5FHAH 1CICD 5BVPH 4HUXB 5C71A 5IP4A 4HG4K 5C9JA 2IC2A 3QUYA 1HYSC 2P8LA 1OQOA 4N0CD 5IFJA 3RWDB 4FG6D 1YN7A 4OD3H 4OIIL 4HUUB 3QULB 3K4AA 2FSEA 5MERA 1JPST 3MGOA 1JGUH 3PJSB 2EDDA 4U1JB 5KW9H 1JGVH 4YQXH 4J1UA 2HMIC 3RUGF 5I74C 3PWJB 1CLCA 3VWJC 5JHDB 2YBRA 5HY9A 1T20A 4DKDC 5KN5B 3OMZA 1Q9KB 3NABH 5E2VH 4HIEA 3SE4A 4YBQC 5F7WC 4L3EE 4RMQA 3OAYH 2A9NL 1MREH 2J88H 4S1SH 3TV3H 5DMGD 4AENA 2BSSB 4R7NA 5ICYB 2I9TA 4LCCC 4ODUB 3MCKB 4Y5VB 1KJ2H 2FECI 3RNKB 1VACA 4ZOCA 4EXKA 5D1ZA 1JFQH 3DBXA 4GSDH 1IC4L 1YQVH 3PP4H 1T7WA 4PJ5D 1IAOB 4ZS7H 5CEZD 5IHLB 4G9DB 4RRPA 2V7NB 3T2QA 4P2OD 4ZPTA 5SWZE 1NCBH 2IPUG 4LSTH 2CGRH 3QDGD 4WCYH 4EOWL 1BQHA 1ZA6A 3OKOA 3PHQB 4LIQL 3T3PF 5CGTA 2Y06L 4MB4A 5ESAA 4MNQE 4XP4H 5DJCB 4M8VA 2FDBP 3O6FD 3SKJL 4JE4B 1UT9A 5K59E 1KPUA 5ITBH 4PRPB 4PGCA 2C26A 1IAIM 2AK4A 3LQZB 4PJ9D 5JOPD 1RFDL 2HVJA 4N0FA 5IVOA 5BRZA 4LF3A 1MJUH 4Z7OE 3VXRA 3GI8L 4KKLC 1UKQA 4V1DA 2R1XB 4X0KA 4F58H 1JGLH 3LCYA 2DQJH 1YNKH 4F3FB 2FBJH 1YN6B 4C4KT 1AP2B 4LARH 4XZUB 2AI0L 4XNXL 2BVPB 5IB2B 2H32A 1BEYH 1PAMA 2DQUH 1ZSDA 1XCTA 2AK1H 5I16A 1KLUA 4OM1H 4AQOA 4NQDA 4H5SB 1JNHA 4GG6B 1ADQL 1DLHA 2FO4B 3IU4H 3GKWL 4HS6B 3KPRA 3LS5H 5EIQA 3VFPB 2D3VA 3KPNA 1N6QH 5EO0A 1VENA 4GH7B 2IAMD 1FRGH 3DROB 2NY3C 4ZYKB 9CGTA 4LOUC 3CPLA 3K2MC 4O5LL 5EULV 3UJJH 4HC1L 3PXHA 3KJ6L 5I17A 3WNOA 5JOFA 3W9DA 2BSED 4L9LC 1PLGL 3ARGC 2RFXA 1VGEL 3FB7B 1U8LB 4ODSH 3C60B 4P23A 5FO8A 2H2SC 1WAAE 4KI5D 1CTNA 5KZCB 3JTSB 2R4RH 2X1WL 3HFML 1FSKC 1YPZF 4TYUA 3QEGL 4NOBA 5T3XD 4NZRL 3P4MB 1U42A 3JV0A 4FQ1H 2VH5H 4ISVB 3DX7B 3FQRB 5K9QG 4M5ZL 4OKVB 3D0VA 3PV6B 3TA3A 4YXKL 3I6GA 5TJWK 1DBAH 3EZJB 3U0WH 3DO3A 3UTZB 4FQQB 4OZHB 1OT1A 3RX8A 5ICXA 2UWEF 5EC2A 1OCWL 3AU1A 2R8SH 5KVGH 1FYTD 4PGBA 4EUPA 1IGMH 5TE4L 2ZUVA 4HS3B 4LEOA 1NL0L 4HV8B 2B39A 1K5NA 2DMKA 3RTQD 3V0VB 5IR1A 1TJIH 2X4NA 1M05B 5E70A 1H15B 1R3HB 2ZOLB 4JAMA 4M61B 1JZ4A 1ZLWK 3U0PA 3RZCD 2O5XH 2WIMA 1SBSL 3IGAB 1TCMA 1BD2A 4NWTH 1IGCL 3TBTB 3TWCL 3LN5A 4XVTL 2YPVL 4PGEB 4JPKL 3RWHB 1A1MA 3ZE0E 2P43B 2ZUTA 5JIHA 4KTYA 5HDLA 4MNHA 3HZKA 3L95A 4PRID 1PZ5B 4JQVA 4MAYA 3RGVD 3HMXL 3O4OB 1ONQA 5JHLH 3B9KC 1TQCC 4QF1B 5C0AA 3BKJL 3PNWA 2B2XH 2ARJA 4JHZA 1LDSA 2JCCF 4JB9H 1N3NB 4XB8A 3GSQB 1A3RH 2FYYA 3D85D 1S7TB 1J87A 1P9MC 4L8DA 2VXSL 5GSRB 4RGOL 1YECL 2PYEB 5IESH 2KL6A 5EUOB 3HB3C 4HH8A 2F19L 2XWJA 5GS2D 4UT9H 4U2YA 4ETQB 4N0UA 2VDOL 4KJYB 2AEQL 1F8TL 4L1DA 3VXUA 1OGAD 2BVOA 3CCHA 1FJ1B 4Y5YC 3ZE1F 1F3DH 3RIAK 2NY4C 4LSSH 5ACZB 4X5WB 5FYJD 1ZGLB 5ID0B 1HHKB 4QRPE 5CILL 2DKSA 3GBMH 2VDNL 4XC1H 4Y4HA 4HDIA 3D18A 1JHKL 2VIRA 4L4TB 4I8DA 1KJVB 5GXBB 4CMHB 1ZEAL 2YPKA 1LEKA 1W0VB 4TULH 2Q76B 3P0GB 2J4WH 3DUSA 1EIBA 1KTDA 5F71A 1RIUH 1E4WL 4JFXA 4X5LA 3ARBA 5JOEA 5KSBA 4YHOH 4Z6AT 3INUH 1XIWD 2AJUL 4G7VH 2BOCA 5DD6A 3D0LB 5EFIA 1KT2A 4Y4FD 1JNNH 2X9WA 4FQHA 1J0YA 5INDB 3UO1H 3JTTB 2HRPL 3VGHA 1CXFA 4JFQA 4L29B 1QYGH 4UTAH 4P0DA 3PWNB 4QHKI 2XQYG 12E8L 5FKAB 4U1MB 4Z8FH 3ULUD 1DBML 4WFGE 2YSSB 3MRHB 1JL8A 3RP1A 5D7JD 1A5FL 4Z78A 1MQ8A 4YFLI 5IG7B 3W0WB 4HUXA 1D5ZB 1JWMB 2FX9H 3W11D 3FFCB 4KDVA 1MJ8L 1RZ8A 3RWDA 1A22B 2XTLA 4UB0H 1V3LA 3GSUA 4Z7WA 3TM6A 4U49A 2NR6D 4OLYL 4M7ZC 2J8HA 4U1JA 3UX9B 3HC4H 4JFZL 3VFNA 1FH5H 3SDCD 4RAHA 5EOQL 5EOCL 1Y0LB 4M6MH 1RULL 5HHVL 3P73B 3W82A 1JHTB 1BFOA 4YAQB 3RPIB 1J1OL 4GW5B 1Q9KA 1F4XL 1K9TA 3OXSA 2X7LB 1AGFB 3NIDF 1KPVA 5DVOA 3WJLC 1NCAH 5EO1B 3RVXC 1X3DA 1I9EA 5ICYA 3SBWA 3B9EA 1W72L 3RNKA 3AVEA 2GY5A 5H37H 3SKNB 2VDKL 3RU8L 5A1AA 1MLBA 2C3VB 2AABH 3EYSL 4G9DA 4PIRF 3V2AR 1AHWB 3LKOA 3B8YA 4OUUA 5KVEL 5I1DB 1MH5B 4EI5C 5BRZE 2MCPH 3RA7H 3V4VL 4DW2H 4DZBB 3QUXA 3HHRB 4Q9CA 8FABA 3SO3C 2DN7A 1IGFL 3WV0A 1F3JB 5EU6E 4POZD 5DJCA 5D72H 1MHPL 1SY6L 1YYMH 3MRRB 1FL5B 5CJQH 5J4MA 4PLJC 3GK8L 2MPAH 2DQCL 3PDOB 4BZ1L 1KJ3H 1A3LH 2XY1A 3GMQB 4PRPA 4G5ZH 3EZ8A 1L7TL 3ETBF 1IE5A 1OW0A 2W0LA 4I18A 4K94H 4NKMA 5F7LB 4D9QE 1T6VN 5MEQB 2E6QA 4J3SA 4KROC 1A6TA 1CICB 4LRNL 1U8MA 5LCVL 3WCYA 5JMOC 4NHUB 4Q9QH 3H9ZA 1QFWL 1CFVL 4IOFD 4XZUA 3IFPB 1FIGL 2BVPA 4F15B 3NFSL 3MBEC 5FA3B 4GRWE 4EBQL 3MNVB 4GG6A 4PRBB 4BQ9A 4XAKE 4G7YH 5IKCB 3Q0HA 4N9GB 1QSEE 3H9HB 4L8BB 5DD3H 5SWSE 4JO3L 3OG6B 2WQRA 4PBXA 2UVEA 1A7BA 3TBWA 5GISL 1F6AA 4KMLB 3VFPA 2QL1A 1QHPA 5LWYH 4PRHD 3BPCB 3AMKA 3D39B 3DROA 2CDEB 3KS0J 3NPZB 4HJ0D 1IQWL 4Y2DD 1FZMA 3TIEB 1OAKL 2QQNL 5ACMA 3I6KA 3QIBC 1NAKL 1B3JA 4WJ5B 3WIHH 4U7MA 2AQ2A 4QNPE 4U1SB 1QSVA 4PJ5B 1OTTC 1KEGL 3QDJB 4PP1D 2EH8H 4LVHC 3QA3B 1R5WB 3C60A 5BVPL 1RHFA 1WFNA 5JNYB 4PD4K 2Y5TB 4K3HA 1I3GH 3IAQA 2X4OB 4JKWA 1S9WB 1AGEA 3MV11 4OD3L 1AR2A 4G8FB 3FO2B 5DQJA 4HK3N 5EBWB 1P4BH 2JB6B 4F7EB 4NQEE 2JJTC 1JGUL 1GPOH 5T3ZH 2CH8A 2BX5A 4LKXA 2DTMH 1JGVL 4OKVA 5KW9L 3F7VB 3L3OB 3PV6A 4YQXL 4YGAB 1PGRB 1VDGA 2DM4A 2EDHA 3EGSA 3NZHH 3O11B 4ORZC 2NY5H 1IEAB 5EUKB 4CKVX 3CXDH 3NABL 5E2VL 3O9WC 3IJYA 4E5XB 4HS3A 2HH0H 1MREL 4X9BA 4AEHH 2J88L 2R2HB 4S1SL 1N5YH 3TV3L 4HV8A 4XXDA 4ZXBA 2C3GA 2IH3A 4UBDC 3ZDXF 4AH2B 1VA9A 1KJ2L 1I9IL 1Q9OB 1BVKA 1UB5A 3OHXB 4GSDL 3PP4L 2OTUA 4ZS7L 4G8EB 5INCB 4HK0A 4K7FB 4OZGF 1S3KH 4KK5C 2VZOA 1ZWIA 2AEPH 2OX5A 1NCBL 4H1LH 1XH3A 2CGRL 4Y8DC 4WCYL 1A0QL 3B2VH 5FGCB 2RGSA 1MLCB 1HKLH 2ADGB 1GYAA 4XP4L 2FNBA 4L8SC 4U1GB 4PYHA 1WFTA 3C5JB 3S34H 1W0WA 4N0UE 5BZWA 5ITBL 5IMKB 5E2JA 1UJTA 4H0IA 4YHLH 1MJUL 1T7VA 1MCWM 3PWUA 3L3DB 1T1XB 2VLKE 1QRNB 3OB8A 5CD5C 3R06B 4F9LA 4F58L 1JGLL 2DQJL 4YHMH 2FECL 4J7RA 4TNWF 1YMME 3IDMB 4OZ4B 2CQVA 4ZFOA 1NCWH 1BEYL 2DQUL 4KJPC 2AK1L 4YUEH 3HKFA 4GAFB 2DMBA 1FJ1A 1X5YA 4XBPA 4OM1L 1U8KB 3F7PC