2ZNWA

Crystal structure of scfv10 in complex with hen egg lysozyme
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
236
structure length
221
Chain Sequence
DIVLTQSPATLSVTPGNSVSLSCRASQSIGNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEITDIQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/hydrolase
molecule keywords ScFv10
publication title Specific fluorine labeling of the HyHEL10 antibody affects antigen binding and dynamics
pubmed doi rcsb
source organism Mus musculus
total genus 56
structure length 221
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2znwA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2znwA02
3BGMB 4FFWD 5KOMC 4FQ2L 3IAGC 1U8NB 5DRZA 2KQNA 4JDVA 5BS0B 3T0EA 2OQJA 2PN5A 4N1HB 1YPZA 5B8CA 4H1LB 3CFKB 1OTUC 1CQYA 1CXFA 3MRNA 5FFLA 4I2XE 1A6VL 4EN3B 3O2VL 4QRRE 3RKDD 2A6DB 3DVFA 4AEEA 5D72L 2CK0H 1N3NB 4Z78A 4KU1A 3G5YA 3RZWA 6FABL 2BJML 2C1OA 1FZOB 2P5WD 1F90L 2H8PA 5IQ7H 2JIXB 3O2DL 4JGJA 4POZC 4HXAL 4OLVH 4HT1L 5KSBA 3AB0C 3BMWA 2A74A 1R3KA 4G9DB 3NFPA 3X11B 2R1XB 1YNKL 1X4XA 4Z7VF 1NCAL 2H6PA 4DUVA 1QFWL 4NM4L 2ICEB 3IKCB 2I60L 2JCCE 4XP5L 2YPLA 3VMNA 3V4PH 8FABA 4OAWA 3AVEA 5K9QI 3DXAA 1D9KC 1MCQA 2VUYA 3MRJB 1HSBA 2A83A 5C07B 3LY6A 2R23B 5D8JL 1B0GB 1MLBB 4OQTL 3NIDF 2JB5H 4G43A 2BC4B 2PYFA 3T65A 3BZFB 5FYJL 3QQ9C 3S3SA 2C1PA 1A6ZA 2GSIA 2BCKB 3OKEA 3PL6C 1CLYL 2DLHA 3VFRA 3VMOA 5DMIL 1R3HA 1VSCA 5JHDE 4S1SH 3ALWA 1Q0XL 2YA2A 4ZSOA 4M5YH 1RZJH 3MV7E 1KLGA 3C6LD 2NNAB 1RULH 1A7BA 1WBYA 4CU7A 4JGMA 2VSDA 5ENWA 2GI7A 3CMOL 2BRRL 5ALCH 5AG9A 3QQNA 4I1NB 3BT2H 4KKNA 3GMOA 3S35X 1QFPA 2AQ1A 2FECI 3S34H 5HSFA 5D7KE 5HYQB 2UZYB 5E2WH 3SJVE 2MOVA 2ZJSH 3OR7B 1UKQA 3WMSA 5E9DE 3NPZB 1MSPA 4HF5H 4O2FA 1RZIB 1I1YB 4K2UL 1U93B 1VPOH 2FO4B 1WCQA 4YAQA 5EO0B 1W0WA 2VXTH 1FAKT 3VG9C 4ZOBA 4HDIB 4JM2F 1G9ML 1PQZA 2X9YA 4OGXL 4BH8A 4I2XA 5E1AA 4U1LB 4GW1B 4LLMA 1W72B 5HDOA 4QRRA 4PJGF 1UJ3A 3FKUS 5DMYA 4JY5H 4X4YB 4JO3H 3ARBC 3AC0A 4PB9H 3ALPA 4PTTB 3KPLA 1G0XA 2DQTL 5E5MB 1AFVL 1XZ0A 3RWEB 1MCOH 1P9MC 4M1DH 5DT1L 2Q86A 5FM8A 4ZFZA 1J05A 4JRYD 4NRXB 4PJCE 3EO0B 2DM2A 5F21B 4FQ1H 3O11B 3NFSL 4JREB 5KSUA 2PETA 4PJDB 5BO1L 3PWJB 4PJ5D 5EU7E 2JCCA 5KSAB 3MR9A 4JO2H 1R3IH 1HIMH 3PHOB 4HH8A 4P23B 4J3SA 1YECL 5JW4M 1E6OL 2DOCA 3QEGH 3CK0L 2IPKB 3WNPA 4JZJC 2V9RA 3QIWD 1MWAA 4N8CL 4NQDE 4TULL 4M62L 1GHFH 5JLZB 4ENED 2V7NB 3IDNA 4L3CA 3RIAK 3TJEL 2OP4H 2W91A 3O8XC 3OKLB 4K71B 5F7DA 3ARED 3E2HB 3OL2A 2IBZY 5EBLB 4FZEL 5JHDA 2VN4A 3FOMB 4MJ5B 1IGJB 1KTLB 2BXYA 4GUPA 3MV7A 5DD1H 2FSEB 4C54A 4HGWA 2F5AL 5J56B 2I9TB 5I15L 2Q6WB 3QISA 4IS6B 4ONGL 5C9JA 1E4XH 4J1UA 5DI8A 3VWKA 1OWWA 4JG1L 4MXVE 3BPNC 1PG7H 4PGZA 5FOBA 3E1F1 3SJVA 4OFKA 1A1OA 1YDPB 4LPTA 1IARB 5DD6A 4RMSA 2OJEB 3L5JA 1A7PL 3P40A 2DQGH 5E9DA 1SEQH 5SWQB 1LVEA 2GJ6E 3D18A 4ONHB 4LDEB 2VC2L 3QG7L 3LEVL 4L9DA 4P2OA 3MV8E 3NPSB 5A40E 4FXGB 4OIAA 4HD9A 2UY6A 3MZGB 3KYOA 5E2VL 3SY0B 4L8DB 1PZ5A 2YN5A 4L5FH 5T1LA 3EKCA 3UC0H 4AIOA 5C71A 1ZHLA 2AK1H 1UM4L 2YPLD 3WL9A 4X98B 1X5FA 3RZCA 3SEPA 2AGJL 3D5OF 2GK0B 3LKNA 4Y16A 2DL2A 1Z5LA 1S8DB 3KNBB 1M6OA 1ZWIB 3X14B 2B2XH 5I1GH 1JNNL 2CDGB 4WHTA 4ZFFA 1CDCA 2XWJA 4NP4H 4PJCA 1S9XA 4Q0XL 2FEDD 4LSRH 4M8QA 2YSSB 2M26A 1UVQA 1F45A 5JXED 4XVJH 5LQBL 1HH9B 2VQUA 4Y4FC 5IROC 4UOW1 3I02B 1FG2B 4FTVE 5CFHA 4N8VG 1T89A 2PR4H 4TTGA 1XCQB 4P5TD 2DQJL 4ZQKA 2CR3A 5BS0E 5EIVA 4RFEB 4NO3A 2IJ0C 4M6NH 3WXVL 4M43H 1MY7A 4LOUD 5DFVD 5IKCA 5I8KH 1BBJA 3HAEG 2NY4C 4XAWL 4WI7A 2ZPKH 3EYFA 1TZGL 3RY6A 5B4MC 4H88L 1TVHB 1MCSA 4RISL 3VE0B 5TF0A 2MJWA 1TVBA 2FCBA 1A02N 1YMHA 4JN2B 4FG6C 5GJSL 1FJ1A 2FRGP 3VXSB 1OM3H 3KPQB 4YE4L 4DVRH 3FAXA 4QWWC 1Z0NA 1CLZH 4RGMB 4M7KH 2ED7A 4KH2A 2BHUA 1FZMA 5FECA 1YJDH 4EVNA 5ACLA 1E27A 5HDLA 5BZWA 2OR9H 4Z7WB 4TOYL 4RNRA 2Y36H 3UTPE 4BZ1L 1INQA 4JDTL 5JORA 3MRGB 1G6RL 4QRTA 5EPMA 1BF2A 4JRXB 1FQ9C 3PWVB 4WJ5A 4G8IB 3K2UH 2GJ6A 2HRPL 1T03L 1OSPL 1GOFA 2W0KA 3BIKB 1AJ7L 3DV6A 4HUXA 4O5LH 4CU6A 4W4OA 4ODXA 2XIDA 5EWIH 4BJLA 1IQWL 3MV8A 3G08A 5DMJB 2FLBT 4XBPA 1N26A 1CDJA 3UJTL 4MCYA 2EDFA 3MRBB 4DOHE 4LARH 5D93C 4F2MB 2G60L 1IM9B 1NAKL 2AAVA 1J5OH 5E24E 4PGEB 4L8BB 3IDMB 2BY2A 4X5WA 3OJDB 3CSYA 3SDDA 4XP9H 4FFVC 4RMVA 5FAAA 3UJIH 4NNYB 1OSZA 3EYSL 3FJTA 2GSGB 2AJXH 2XY2A 4ZPTB 4PG9A 4MX7B 4ZS7L 4PV9B 4AL8H 3QH3A 4P3CL 3EDDA 4XP6H 3VFOB 1KF9B 1NEZB 2JE8A 3ULUL 3BJLA 3QNZB 2YS4A 1B2WL 4Z76B 4QHUA 3O2WL 3MV7D 2H9GB 3BGMA 4FTVA 2IPTL 3RVWD 1U8NA 4OF5A 1B4JL 4OZHF 5D1XB 3VG0H 3VWJB 3V0VB 3QPQD 1R24B 4H1LA 1XIWD 1YEKL 5GXBB 4ONOA 5CKGA 3SBWC 4EN3A 3OAUH 1T21B 1RZFL 3REWA 1T7VA 2P48B 3VW3L 1H3WM 1BBDL 2A6DA 3IFOB 3FFCB 1BVLB 1MJUH 1N3NA 2BVUA 5I30L 1QBLL 1CZ8L 3ZSTA 1BAFL 3RDTC 1DBMH 1E4JA 1FZOA 1UCTA 2V5MA 2JIXA 3FQTB 4P2OD 2X4OB 1JHLL 5L88H 2CJUH 3HAEA 3ARTA 4R90H 5TF1H 5F6HJ 4AYFA 4APQD 2BMKB 3X11A 3QT2A 3S4SG 4Q9QL 4XPAL 2XTLA 1W2KT 3HLAB 4DTGH 5FDWA 4PJDE 4F3FA 5T5NF 4WO4D 1I4FA 1YYLL 5IHZB 2XN9D 2WBWB 2HT2C 5FF6B 5E94B 4MJ2A 3GI9H 3QULB 5IESH 1K8DB 4G42B 5B3JF 3CXHK 4FXKB 2R23A 1T4KB 2ZCLL 1QSFD 1JNHB 1B0GA 3QWRD 4QHKJ 1MLBA 1QSEB 3OG4B 2BVPB 5GSRB 2P5WB 5FUCE 3BZFA 3OB0K 2VLKB 2BCKA 1A0QL 4NKQB 5D6CB 4WW2A 4WWKC 2WIIB 2J8UA 1UH2A 2D0FA 1QBMH 3BUTA 3KJ4C 2VDQH 4R4NC 1HHHA 3D0LB 3CMGA 4NPYB 2FGWH 4KVNH 4Y5XC 5B22A 4PJEE 4NFBA 1MFCL 1X6LA 4HUVB 5DO2C 5FHBH 3FB6A 1CFQA 3HMXH 3OR7A 3MLTB 4NO5B 5C6TH 1GC1L 1ND0A 3KPPB 2WINB 5HY9B 1RZIA 1I1YA 3ZDYE 4U1SB 3RUGE 4KKBD 1U93A 1UACH 4F9PC 2V9TA 4OGYL 3TIDB 5EO0A 5DSCB 3BPLB 3NTCL 4GRWB 3C6LB 4HDIA 5DWUL 2OTUB 1S9VB 2D7QA 4GW1A 1W72A 1CICB 4PGBB 4TUOB 1N0XH 4DUWA 4MXQD 4X4YA 2ESVB 4NHCH 2P24B 5C0RL 4DGVH 3MGTB 4F9LA 1ULVA 3SGJC 3K8KA 3WE6A 2EDLA 3PE9A 5E5MA 1NMCB 3X13B 2FEEL 3RWEA 1BX2B 1MCWW 3IFPB 4RZCB 4NRXA 4Z7UF 3D2UB 3FMGH 1QBBA 3EO0A 4TTDD 2Q8BH 2LTQB 3OAYH 1CGUA 4KXZH 1AHWB 4GAYB 1MFAL 2YMXL 3O11A 5ACMA 4BZ2L 3ULUF 3OX8B 3QCUL 2HYMA 4MSWA 1YPZF 3PWJA 4BFGA 3BD3A 1KB5A 1G7IB 2FH6A 4UOW0 1MWAL 4HKBA 4JZNA 3PHOA 1V7NH 4P23A 1ZMYA 4ESKA 4FZ8L 4EKXA 1L0YA 3A6CH 2IPKA 4HEPG 3SE9H 4R97B 4L9LB 5C0CB 1V7MH 1JFQH 1DANU 5D1ZB 3V6FB 1HHIA 4HIXH 2J4WH 5JLZA 4NDMA 4OBRA 4R8WL 2V7NA 4PRHD 3T3PE 3L3OB 2LABA 1HQRB 1TJHL 1RVFL 3OKLA 4JRYB 1C12B 5KSBF 3VFVB 2VNCA 1T83C 2NXYB 4NHUB 3GSQB 5EBLA 3MLPA 2XRAL 3UTZB 5SWSE 4GS7C 5SV4A 3VXSE 4QT5B 3MCLH 4M6AA 1OP3H 1TCRB 3ARYA 2I9TA 2DMBA 4CKVX 5HDBF 5HPMA 2FB4L 15C8L 3L3GB 4IS6A 4ONFL 2MWCA 5J12B 4UINL 1ZLUH 5DJZB 4XCFL 1IBGH 3W39A 2DBLH 4O9HL 1U8OB 5DQ9B 1A5FH 3MRKB 1J0JA 4PJEA 5CMAB 3IU4H 3OJ2C 3LMJH 5E95B 3V8OA 4Z7WE 1FL6B 4HH9B 3UX9B 4ZS6C 2XA8L 2J5LB 2OJEA 4PBXA 4IOFC 3B9VA 3TO4C 3I50H 4R6UA 3LS5H 4HWZB 2YUVA 4OLUL 5F9DC 4EOWH 4NM8H 4JRXE 2QQKL 3RUGA 3E8UH 2AJYH 4ONHA 4OLYH 5ETUB 4C56B 2EIZB 2C3VA 4DAGL 1D6EB 2DWEB 4WFHE 4JO1L 3EBAA 1MHPH 5DVNA 4MGXA 1H8SA 4FXGA 2VUOA 1PGRB 3C2SA 2I07B 3SY0A 1C5CH 3ULSB 3W2DH 1EO7A 4Y1AD 4L8DA 4EXKA 5HXMA 4IDJH 4JREC 1EO8H 4RFNC 1AC0A 3PXHA 3UJJH 4X98A 3GSVB 5D7LD 5KSAC 1YY9D 1F6FB 4U7SA 2GK0A 5IGXH 2CXKA 4R26L 3ARFC 1DL7H 4I4WA 4JPWL 3KNBA 2DQCL 4HPOL 1ZWIA 3X14A 2GHWB 3GSUB 3S7GA 2CDGA 3P3YA 4UIMB 3TCXA 4JFXB 4PGCB 2YSSA 4Z7NE 1XGYH 4YDLB 2NW3B 4A6YA 4N0CD 3LEXB 2DQDL 1P2CB 5DHVB 4U0RB 4ZXBB 2YK1L 1HDMB 4K71C 5TE7H 3I02A 4UT9H 3QO1B 1HWGB 3RWDB 3SCMA 5GRWA 5DK0B 4KK5D 4MXWH 4P99A 5C0BD 3GM0A 3MXVL 4LVNB 4P3DB 1A3RL 1MCPL 2E7MA 3JTTA 3DIFB 2DDQH 5HBBA 1MHEB 2Y25A 2XQYG 4HC1A 3VE0A 4QOKB 3FFCE 1MIML 1TFHA 2XG5A 4LRIA 1WFTA 4HPYL 2X10A 3ELAT 2ITCA 3ZDXE 5SWSA 2B1HH 2BVQB 3HFMH 3VXSA 3VXNB 1RU9H 5LBSH 3KPQA 4EBQL 5CIPH 1E6JH 2KDGA 2JCCF 1WTLA 3VDBA 4RGNE 1T1ZB 4U33A 2W0PA 3I6KB 2IC2A 1DVFC 1MRCL 4JKLA 4J3WA 4ZFOA 5HHVH 4BSJA 3RP1A 4PJ9B 5FGBA 1AIFB 2GUOA 1CDGA 1J1XL 2X44D 4Z7WA 1UXSB 2AEQL 1JPSL 4FQXD 5DVKA 5T3XH 4XC3L 1I9JH 4NN7C 2IANB 4ZTPL 3MRGA 1JZ5A 4KPHL 3CDCA 4JRXA 3TZVB 5HYSG 3PWVA 1NCCH 4Z77B 2IAMC 1O7VA 4OCYL 5C2UB 3BIKA 5GGVY 1QSEE 3AAZB 4FS0A 1QEWB 3GO1H 4F37K 1SJHB 3M8OH 1KELL 3TC9A 4LSTH 3P30L 4XPFL 3RIAF 3P0YL 3SKNB 1H0DB 1WZLA 3C09B 5T1MB 3W81A 3GSNH 3ARGB 4MHHG 2R0KL 5D9SB 5C08D 5ITFB 4LCWB 3MRBA 4LHUG 5MEOB 5CILL 1T66D 4ORGB 1IM9A 3BEVA 5F9JA 1ZTXL 4NQEB 5EZIH 1KN4L 3GSWA 3U7WH 5J0BA 3IDMA 3LVEA 5I75C 5BXFB 3QDGE 3TM6A 3DX9B 3BRFA 1F8TH 4QGTA 4ZPTA 1BZQK 4JR9L 1L7IL 2CUMA 1CL7L 4MX7A 1KBGL 3V95A 4PV9A 2J88H 4ZOEA 3VFOA 5HHQA 4MS8C 3BH9B 4P5KA 3EJZC 3RNKB 2NY1B 3V5KB 5ABDE 5IB2B 3ULVE 1SMOA 5ADPH 6CGTA 3ARSA 2YR3A 3QCTL 2VLME 5D1XA 4OM1H 2MCPH 3VWJA 3X3GL 1XF5B 5GRZA 3V0VA 4LLVA 5EC2B 1GJIA 1R24A 1IILE 3RWGB 2WLZA 4GRWE 5FOJA 3LPGA 1FC1A 3VXPB 2OK0L 4HJ0C 4WW1B 4DVBB 2XT1B 1JE6A 1T21A 1R6VA 1I7RB 1MFBH 3MYJB 3T2NH 3IVKB 1LHZA 1NFDE 4YHOL 3WLWD 3ZLQC 2ESVE 3FT4B 4K9EC 3SQOH 3IFOA 1BVLA 1GXEA 1SY6A 2WNGA 2BP3A 1QRND 4PJCF 5E1HB 1FFRA 1BWWA 3GJFH 4OKVA 4P0DA 2FBOJ 2XQYK 4LSVH 1NMBL 4K8RD 3HZVB 1R5VB 3TN0C 5KG9B 4JB9H 3V0WL 2VZOA 4UV7L 1S7VB 3FQTA 3RWHB 2JELL 2X4OA 3T0BA 2EIBA 3EOYG 4XH2A 1I1FB 3HLAA 1RIUH 1CR9H 4XAKE 2EXWD 4U1GC 2I26N 4M93B 1GGUA 4WTWA 1NBZB 4BQ9A 5ILTH 2W9DL 3SKJL 5FF6A 3I2CL 5E94A 3HTLX 1NGWA 3EDJA 1H3TA 3DO7B 1RHHA 4G42A 4RMQA 3EYUH 2R4SL 4H26A 4FXKA 1EA9C 1T4KA 4OGZA 5C0CE 3FHQA 5AWNH 1QSEA 5GSRA 1LE5B 2BVPA 2H26B 2OJZH 3HI5H 3QQ3B 5C2BL 4OZFH 5CGTA 5E2UL 5ERWA 3BKML 5D6CA 2AV1B 2BDNL 2HFGL 5GGTH 5SWZD 2WIIA 4AEFA 2QQLL 3TT1H 1Q38A 3BKCL 3T2PA 1DLFL 3KPOB 5HYSA 2MMXA 2AJVL 2WV3A 1PLGH 1TENA 5E2TH 5F9WB 4NPYA 3PDOB 2I5YH 3CFBB 4NZUH 4I5BB 3ZKXB 3QDGA 1KJ2H 1VGEH 3IS1X 4Y19D 2CDEB 4TUKL 5C0DA 3EYVB 2NMSA 3OHXB 5HD8D 3BXNB 4LHUA 3EGSB 1Z3GL 2FIRT 4NO5A 2WINA 5HY9A 5SWSD 3HN3A 2DQUH 3BP7B 4U1SA 1MQKL 3KPRD 3VDAA 5HVHB 1W72L 4G8GB 2VDML 3TIDA 4LCCC 4YFLI 3MBEB 4FFWC 5DSCA 4R0LC 5I76B 3Q5YA 3MNWB 3HZKB 4XPTL 2OTUA 1S9VA 3DSNA 1GCFA 1T7YA 4KQ4L 1NCTA 4MJIE 4PJ7B 1CICA 4U6TA 5ID0A 1U2CA 3L95B 3GSOB 4TUOA 3CFCH 5KAQG 1NLBH 2F9BT 1NFDA 2EKSA 2ESVA 4YDKH 2P24A 2H1PH 4KI5E 3MGTA 3QRGL 1DUZB 2VLJA 5IIEA 3K4ZA 5DR5L 3VGGA 3X13A 4PGJA 3CGTA 3RKDC 4TSCL 3A6BL 3FQWB 3IFPA 4RZCA 2XOTA 1KB5L 2BVOB 1MCBA 1YEEH 2DM4A 4GAYA 1HN1A 2OR7A 2VQ1B 3OX8A 1YEJL 2E7BA 4XPHH 5D96B 1T1WB 3ZSSA 3VJ6B 4GXVL 3QUYB 1AI1L 1EEZB 1YY8B 5AG8A 5HGHB 4BSVB 4NGHH 5GRJH 25C8L 4ZAKD 1J88A 1IT9L 1JPGB 2APTA 5C0CA 4JFDB 3DBXB 3U7AA 3CFEB 1T6VN 3MV9D 3NCYS 5EU5B 5D1ZA 2CRYA 3V6FA 1WWBX 4W6YB 4O02H 1Y18B 1G9NC 4H0GA 3L3OA 3JWDH 4MAUH 3QIUB 1FYTB 4QOKE 2O5YL 2ZUYA 3JWOL 3PDGA 1OLLA 4UNTA 4LHJB 3CXDH 3IDJB 4WI5A 4IRJB 1JL8A 4QT5A 4U1MB 1TCRA 4HZAA 5I71C 5J57B 3L3GA 3HI6L 5ICZA 5DJZA 2C3GA 1U8OA 5FA4B 5DQ9A 4IMKA 3C6LC 3FO9A 4U2YA 4YHPA 5CMAA 3WN5C 1FL6A 4MD4A 4UDUB 4WI2A 2BY3A 3WDJA 5E4EB 3IFNL 1FO0B 2HRLA 2IANE 1FDLL 4HWZA 4YC2B 1RMFH 4KHXH 5FKPB 4FABH 1A3LH 3IRZA 5DS8A 2BVYA 1D5IH 1AR1D 1FH5L 2DM7A 5ETUA 4WW2F 4CMHC 1NH6A 2BNQB 2EIZA 3BP6B 4D9QE 2EDTA 1D6EA 2DWEA 3WEXA 5FGSA 2J8UF 4RGND 3B8SA 1CGSL 4EDWH 2LTQC 3ULSA 4MJIA 1F4HA 4XI5D 3MCKA 4LCWE 3GSVA 3DURB 5E6ZA 5DZLA 1RUAL 5F96H 4OCXH 5BW7A 4KAQL 5HHXL 3NCMA 5GISH 4A6YL 4G5ZH 4S1RH 3GSUA 5LCVL 3MZTA 2DLEA 2YKLL 4L9LC 4QXUL 5DD5L 2A77L 2EDQA 4OIIL 3MLUH 5L6YL 1KC5L 2RGSA 4UIMA 1JCKA 2QHRH 1IQDB 4JFXA 4PGCA 3UZVB 2NW3A 5F88B 2Y6SD 3LEXA 2PCPB 3QDHA 5I66B 3HZMB 1PY9A 4ZXBA 2NW2A 4G8EB 1HDMA 3GNMH 4I0KA 3RWDA 3QO1A 5IW1A 2N4IA 1C16B 3DVGA 1FLRH 4G6JL 4M6OH 4QO1A 4F8QA 4M61B 1F4YL 4LPYA 1RJLA 1NGZA 3BWUC 4HX1B 4LU5L 5D7LB 1U92B 4P3DA 4HC1L 1JNJA 1NBVL 4CGTA 4O2CB 1XEDA 2H45A 2EYRB 4OTXH 4KUZL 4Q2ZB 5DMKA 3O6FD 1MHEA 2F19H 1D6VL 3MROB 4PTUB 5ITBH 2DL9A 3QIWC 2HN7A 4QOKA 3N0PB 3VRLF 4ZOAA 2OZ4H 1ZS8B 4HS8L 4ENEC 3L7FB 1NBYA 3WFHA 1P5VA 4ZFOL 2ZP0T 4B53A 4GG6B 1DBJH 3VXNA 2AQ3A 1KEML 3PNWB 3AREC 1U91A 4HGMA 2E8ZA 4DFHA 1EBAA 2BSTA 3FQNB 3I6KA 3MX0A 5C0BB 4MMZC 1MNUL 2Z31A 3NIFE 1NCDL 3MGAA 3G6DH 1IFHH 1Q94B 1AIFA 2NX5D 1LGVA 4B50A 3MLSL 4OV6F 2P45B 4PJ8D 2VLJD 3OPZL 1S7RB 3O9WB 2IANA 3WS3B 3OF6A 2X9XA 1T0MB 5EB9A 2E9BA 1NC4B 4AMKH 1NGPL 2HT4D 4ZFGL 4LGPB 2E9WA 2VDKL 1KJ3H 1XGQA 3EO1A 1DE4A 3AAZA 1QEWA 4TQEH 5IB3B 2E27H 5T1KB 4M7JL 2J7LA 3VA6A 1DR9A 2PW2B 4DGIL 1FL3B 5T1MA 4XAKD 4X7FC 5KTEH 1YNTB 2ADGB 2B4CL 5D9SA 4U0RC 4NUGH 5GHWL 5ITFA 4LCWA 1VGKB 5DUPH 3VD9A 3JVGC 4PJEF 4ORGA 1HYSD 2CKNA 1GYAA 4LPCA 1LNUB 1K4DB 5K93A 1JYVA 1F02I 2F5BL 3FT2B 3SDXB 3V4VH 4FQXB 1RJZB 4LVNC 4Y2DB 3O0RH 3DX9A 3MLZL 2IQAB 5EUKB 3WFBL 1DQTA 1JF5A 3ZDYF 1WIUA 3RUGF 1YN6A 2A38A 4OF7A 3E0GA 4L8SB 4PRPD 3BH9A 1OW0C 4F33B 5H35A 4XVTL 1FC2D 3RNKA 3CLFH 4M6MH 4LRNL 2F74B 4NKIH 5J1AA 5IB2A 2FEDC 2E7HA 5FM5O 1A7QL 5JXEC 4G8GE 3WFEL 5EA0H 5IJKA 2AJZB 2YD3A 2FX9H 4X6BB 2D2OA 3MJ6A 5EC2A 5FUOL 1F3DH 3CPLB 4DQOH 2XTJB 1C08A 1QFUH 4J3OC 4MA8H 4R7NB 1SY6L 2IWGA 4P5TC 1J1PH 1ZEAH 2VDPH 4WW1A 1YYML 1OCWH 4DVBA 4PJ7E 3STLB 1N5AB 2AJ3B 4LOUC 3BKJL 1I7RA 3MYJA 1KXVC 4PJ9C 1ZA3B 5DFVC 3IVKA 4I3RH 5L9DH 3U0WL 2F8OA 1UB5B 1NAMH 3QHTC 2X9WA 4GLRI 4LIQH 5T1DL 1MCRA 5HGGS 3TT3L 3BKYH 4N90D 1R5VA 3CUPB 3VXQB 1IGMH 2XNAB 4JAMB 1S7VA 3RWHA 3GK8L 1OL0A 5I16B 4NZTL 2JJUA 1KUMA 1N4XL 3TYGH 1KFAL 5A2JH 2NYYD 1I1FA 1ZOXA 1BWMA 4KVCL 2LAAA 4FQ2H 5EIIB 1BQLL 1K3ZA 3CFJA 1GC1C 1TIUA 3V7AE 2FR4A 3PWNB 1CDYA 3L3KB 4YHZH 3P9MB 35C8L 1QD0A 3FQXB 3L7EA 3T3PF 3STZA 1IGYB 1GZQA 4JFDE 1RJCA 3JV4B 3ET9F 1RZKC 1EXUA 1UWEH 2YRLA 1LE5A 2H26A 3K0WA 2C4FU 4F15B 3QQ3A 1A4KB 1CE1H 1BVZA 1X5YA 5CGYD 1FYTE 2OI9B 5B39G 3U4EB 1AO7B 2AV1A 4X6CB 3S36L 5BV7H 3GMLB 1L7TL 5F6IB 4YEEA 5DUMH 1IRAY 1GL4B 3QHZH 1ZANL 1FSKB 5E99L 2QQNL 4PJXE 4Z7WF 3PDOA 1HXYB 1NCAH 2G9HB 4XNXL 2I9LB 2DJUA 2DMCA 4QXWA 1NJ9A 5GGSA 3ULVL 5DD0L 3ZKMD 5C0EB 2CDEA 2X05A 5EBWB 4KGLA 4PJFE 4MNGB 1HI6A 1L0QA 3EGSA 2EDNA 2V2XB 4S1QH 3MLYH 3REVA 3RJQB 4E42B 5M7QA 1NL0L 4OQTH 1ZVSB 3BP7A 4U0QB 3IJSB 5FYJH 5SWZB 4G8GA 3WUWB 3O6KL 3LD8B 5CIPB 4X9FA 1CLYH 4F37F 3MBEA 3GHBL 4MHHI 5I76A 2Z31D 3HZKA 3RVWC 2QSCL 4NWUH 1QQDB 4PJ7A 5IG7B 3QPQC 4LGRB 3UO1L 3WIFB 5L2JA 1JNLL 2KL6A 3L95A 1P7QB 1XIWC 3P4NB 4OD3L 5DJYB 3IJHB 2NY2D 3CMOH 5F7KC 4DKEH 3OF6D 1DUZA 3B5TA 4NNPL 1FP5A 1HNFA 3FQWA 4JFOB 1TNNA 4D9QD 1OAQL 5F7MC 1EHAA 1YEGL 3SDAD 1B0RB 2QHLA 3H3PH 4U1KB 2BVOA 1PEWA 32C2B 4X99A 3G6JB 5I9QB 2VQ1A 4Q6YA 4JRWA 4P2OC 1NDGB 1M7XA 4LKCA 5KSVB 5CJQH 4APQC 3M17B 3QUYA 1EEZA 1T0NA 1I8IB 5HGHA 4BSVA 1U3HA 3TFKD 1I8MA 4QCIA 4X6DF 4WO4C 5C0AB 1TZHB 1YUHB 4S11A 5F9WC 4JFDA 3CFEA 2X1QA 3QUZD 4V1DD 2NY6D 3ZDXF 3KPSD 1Y18A 3LS4L 1GZPB 4U49A 3W0WD 4ZO7A 3TIEB 3QIUA 5DQDH 1FYTA 3HG1D 2YXMA 4X8JB 4CN4A 4NT6B 3KVQA 5EU3B 1F00I 3ZKND 4GG6E 3FRUB 3L9RB 1QR1A 4XNMB 3IDJA 4IRJA 4U1MA 5EU6B 4G6ML 3BWAB 3WHE1 2R39A 4PJXA 3NFSH 1QOKA 4MB4A 1P4LB 3BGAA 5BO1H 4XXCC 4RFOH 5T33H 2EH8L 3M07A 1A14H 2MQ0A 2CK0L 4ZAKB 2R0WH 4P49A 2WUBH 3DLQR 3BQUD 3MRMB 2EIEA 2XKNB 1E6OH 5IQ7L 4JEGB 5ESQA 1JWSB 1YMMB 2YA0A 3X17A 4PJFA 4OLVL 4UDUA 5ALBH 1DANT 1QLFB 2QKIB 4WGWB 2CPCA 4GG8A 1FCGA 4U6XB 5A3ID 3GJFB 4LSDA 5FKPA 3TA3A 4M62H 1A1NB 4JKPL 4R4BB 5C0JA 3C60D 3BP6A 2GT9B 4WVRA 5KVMC 4OIBA 4HMEA 3V4PL 5JIHA 4KKBC 3T77B 1DBAL 1FZKA 3B2VH 1EEUA 5GSVB 5HI3D 4N8PA 1PYWA 3DURA 1MCDA 5CEZH 2DRUA 2JB5L 1CWVA 1WQVT 5BMFH 4M02A 3SDXE 1X4ZA 4FMFA 2NLJB 4FQCL 4JCLA 4MXQC 1U8MB 4XPGL 5F7FA 1BECA 2DAVA 5CJXA 4S1SL 5IVOA 1BQHG 4M5YL 1RZJL 4OZFB 2NY3D 2IPUG 4Y4KD 4N0FB 1RULL 2PCPA 2B8OT 5GRUL 5I66A 5D5MB 4G8EA 4GRLD 3V52H 5CD5D 4PD4J 4TTDC 5I74C 3NBNA 5ALCL 4K3DH 4WV1B 1C16A 3HNVH 3BT2L 2OX5A 1ERNA 4NQXB 2DICA 4HX1A 1NFDF 5E2WL 1IGTB 2XTJE 4O2CA 5IWLA 3JWNC 2ZJSL 4GMTH 2MSPA 3ZYZA 3GMQA 5T3ZD 1SMAA 2EYRA 4HF5L 2CDFB 3B9EA 4WU7B 4Y4HB 3MUHL 3MROA 2FJFA 4PTUA 5CBEA 1VPOL 3HMXA 2HTLD 2W1NA 2VXTL 1JNNH 3B5HA 3IXAB 3L7FA 3PGDA 4UV4H 5EH1A 1F4AA 1T2XA 1VB9A 3VGAB 4GG6A 5CKAA 1A9EB 1U95B 1SYSA 3A0OA 4HBCH 3PNWA 1CXIA 4BUGA 1NANI 2NY0B 4JY5L 1KCSH 2OLDA 2X4PA 3FQNA 4JO3L 4LLYB 4AY0A 4PB9L 4JPVH 5F70A 3KXFB 2HKHL 1EGJH 1Q94A 5HHOB 2DQJH 1I9RH 1MCOL 4M1DL 1IC7H 3WXVH 1FVDB 2IFGA 1UZ6E 3OAYK 1IZJA 3O6FB 2HT3C 4XAWH 4OCSH 5F71A 1NC4A 4FQ1L 1P84J 1CDUA 5BQ7B 4OFPA 3OAZH 1CDBA 1PY4A 4PG2C 5IB3A 5T1KA 3ZMRA 2PXYB 3ARDD 3LAFA 2PW2A 43CAB 1FL3A 3CZJA 1B6DA 1YNTA 3QEGL 1AO7E 4X6CE 2ADGA 4Q9RL 4ZUVB 4N0YH 3FHAA 1FN4B 1VGKA 1OPGL 4JFHE 5FGCE 1A6WL 4OSUH 1GHFL 1JUFB 4HIJB 2IMNA 3FT2A 2D4FA 3SDXA 2EXYD 2OP4L 3AM8C 4PJ8B 1RJZA 4K7FB 5L2KD 4NYLB 3RPIB 1YY9C 4L4VD 2W65B 4DN3H 1LMKA 2IQAA 5EUKA 4XWOD 5DD1L 1C5BH 1M71B 4WGVB 4F33A 4MNGE 1ZLUK 1A22B 4U6YB 1AJ7H 1IEAA 1E4XL 2F74A 1OLZA 1JZ2A 3B6SB 4YPGA 3VFWA 4LVEA 1PEZA 2IPUK 2EH7H 3UAJD 2PYEB 4N0CC 4EUPH 2BNRB 2BNUA 1MOEA 4WW2C 1LDSA 1PG7L 1FCCA 4NBYB 4X6BA 4FNLH 3QAZC 1QR4A 5JOFB 2XZCH 4KK5C 1QLEH 4LMQE 1AKJA 1YZZA 1AGDB 3U9PH 1F3DJ 3STLA 1N5AA 4LLQB 2NQCA 3RWFB 1ZA3A 4NFDA 2ZG3A 4OF6A 5DZOA 4YHYC 3W9EB 4MVBD 2RR3A 5IHBA 1UB5A 2ICCA 5T3XE 3O9WC 5DHXB 3TA3D 2RFXA 4YBLC 2KKQA 5KAQF 4L5FL 3VXQA 4G6KL 5CSGA 2XNAA 1B0WA 1MCWM 4JAMA 4IRSB 2AK1L 5I16A 4HMDA 1WK0A 2VDLH 1B2WH 4Y5VB 3G6JE 2EE2A 3TYFA 3FB7A 4K7PL 3O2WH 1TTUA 2W38A 5EIIA 2IPTH 3CD4A 3WD5H 3VFMB 3RWIB 2B2XL 5I1GL 3S5LB 4DEPB 2Y72A 3LN4B 3L3KA 2B1AH 3UP1A 2NCMA 4NP4L 3FQXA 4LAJH 5C0AE 4YFEA 2B7DT 1OVZA 4FQXC 4XVJL 1RZFH 3J7HA 3JV4A 4Y2DC 3DSFH 4UDTB 1F4XH 1JN6B 3CVIH 5I30H 2GTWB 2R1WA 1CZ8H 3QJFA 3U4EA 1RUQH 1AO7A 4X6CA 4M6NL 4M43L 3TEUA 3BVNB 1ORSB 3GMLA 4JQXA 4KTYA 3GIZH 2XKSA 2VAAB 5I8KL 3SDCD 1FVCB 3VFUA 4Y2OA 5EU6E 2ZPKL 4PYGA 3KHQA 4F57H 2VWEE 3WHE0 4Z7QE 5TQ2H 1HXYA 1XF1A 3HPLB 3FTGB 1T66C 5LGJB 1TCMA 2PW1B 4LEXH 4DW2L 3B43A 5C0EA 3LRSB 3VDCA 5E7BA 1OM3L 1YMME 1QA9B 4KTDL 4MNGA 4DVRL 4I13B 2ZCLH 4XMLH 5KW9H 1CLZL 2V2XA 1MF2L 3U36B 3P77B 4X9HA 4E42A 1ZVSA 4FFYH 3MC0A 1NGYB 4P4KD 3IJSA 1VA9A 3SE8H 4GW5A 5MENB 5CIPA 3RI5K 3IDYB 1A0QH 4FHBD 4NQCB 2OR9L 4XNQA 3B9KD 2ID5A 2EC8A 4XP1H 3HRZB 2VDRL 2FATH 2Y36L 3D25B 3KLHD 5FYLH 3JWOC 2GYSA 1DQQB 1CTNA 3WIFA 2ED9A 5C70A 3RY5A 1NUFA 2BSSB 2GIYA 4YHKH 5H37H 2J8HA 3P4NA 4O5LL 5DJYA 4QF1A 3VD7A 4G7VH 5EWIL 4IIQB 4R9HA 1SBSL 2DQEL 4PYHA 4WUUB 1H3PH 5ELIA 3WLWC 3MRPB 1N64H 1VADB 1EK3A 3QUXD 1T5WB 4IJ3B 4U1KA 1WWAX 4GAJH 32C2A 4LARL 5JO5B 2GAZB 1FNAA 4K8RC 3G6JA 1J5OL 1I8LA 1OT2A 3QWQB 5JQ6L 3FN9A 3F8UB 2OI9C 3GSNA 4PY7B 5DJ0B 4E41B 5KSVA 3KAAA 3NCFB 4OGYH 4LPXA 1CXKA 3M17A 4XP9L 4JQVC 1I8IA 3UJIL 3BPOB 3EOAB 2AJXL 4R96B 1HEZB 2EXWC 5C0AA 3WKML 1TZHA 1YUHA 4AL8L 4XP6L 4XTRD 4MDJA 2J2ZA 1ZLWH 3TH4T 2HKFH 1UKSA 1SBBA 3R0NA 1QSZA 5TDOB 4Z7OE 3S37L 3HZYB 3E6FA 3ZHDA 3LEYH 4XC1L 1ZT7A 1F4WH 3TIEA 2RIKA 12E8H 1CN4A 1QVOA 3VG0L 4D0BB 3EOBB 2VMFA 4QYOB 3DOSA 5IFAL 3KWWB 4NT6A 1WC7B 4OFIA 3NIFF 3FRUA 3L9RA 4FQPA 4XNMA 1Y0LA 5EU6A 1IE5A 3BE1H 1KT2A 3BWAA 4GO6B 5GQBA 1A7RH 3OAUL 1MFAH 5AZ2H 5IQ9B 1P4LA 1WLHA 1X5AA 5IOPB 1T1YA 1MJUL 1U8PA 4M3JA 3VFNA 5BZDA 3GJFK 5FUZL 1MWAH 3KXFE 3MNZB 3CVHH 3MRMA 1DBML 1HHJB 2XKNA 5HHOE 2C26A 1CGYA 3GMMB 4OJFH 1ED3B 1YMMA 3UTOA 2VXQH 3MJ7B 1QLFA 5DJ8B 5LJYH 1NAMB 2CJUL 2QKIA 5D1QB 5L88L 4R90L 5TF1L 3SE3A 2EEDA 2IQ9H 4U6XA 3W0WB 4PV8B 3GJFA 3B4NA 1WUNT 3MUZ1 4B7LA 1PX3A 1ZHNB 1VERA 3HG1B 5TH2B 1A1NA 4DTGL 2NY7H 5HD8C 4R8WH 4JN1H 2Q8AL 4OZIE 4GQPH 1MVFA 2DKSA 4TN9A 2BOCA 1QACA 3GI9L 4G9FD 3ZDZE 4QRPD 5IESL 3ZKQD 5GSVA 3T3ME 3RTQD 2D03H 1AGBB 2XA3A 4P9HC 4XCFH 4HKJB 5D7SH 5GS2H 3BDYH 2HVKB 4X7SL 4XX1E 3TGXA 3RY4A 2ICWJ 1U8MA 5DFTA 3QFJD 2WWKO 2EO1A 2XA8H 1QBML 4OKDA 3C60B 1CD1A 4UOJA 1BFTA 1WTGT 3NCEB 4OZFA 1PSKH 1CK0H 2VDQL 3U7YH 2ITDB 4N0FA 3L5HA 1JYWA 5BV7B 2FGWL 1MRFH 5GGTA 1QKZH 4Q6IB 4WV1A 4K23H 1XAUA 4JO1H 4DCQA 3IXTB 1ZT4B 4NQXA 2Y5TB 2PYEE 1I85C 2BNRE 4G3YL 4PJ7F 4HV8A 4ZPVB 1I7ZA 5FHBL 2BXZA 3HMXL 2ZOKB 2OL3H 1KJ2A 3C8HA 5C6TL 1X5KA 2B4CC 3ARWA 4ZAKC 1A64A 4YX2L 1JWUA 4WU7A 4Y4HA 2ARWA 4R26H 1DCLA 1UACL 5IB5B 5CCKH 3MOBH 2BOBB 3V6OC 3AGVA 3MRCB 5E6IA 4RA3A 2X2YA 3IXAA 2NY3B 3TVMA 3O3BB 2FNBA 4E5XB 4Y4KB 2WUCH 5J89A 1A9EA 4IRZH 2DQIH 2X4TA 4JPKL 4I0PA 4PJBE 3LKSB 5GJTH 1N0XL 4NHCL 4LLYA 5IF0B 3VMPA 4DGVL 3D3VB 4QHMB 4RQQB 4ZOCA 3KXFA 1PDKA 5HHOA 2Y7QA 3MXVH 5F3HB 3S3JA 2H32H 4YDVB 1FVDA 2AQ2A 5DJCB 1A3RH 1MCPH 5DRXB 3FMGL 3SO5A 2Q8BL 5E8OB 3GSRA 3EYOB 1JGEB 2CRZA 5BQ7A 4QHLB 1DQMH 3R06B 4OZIA 1J0KA 1AGEB 1FL5A 3U0TB 3MA7B 1V7NL 1BIIB 2PXYA 43CAA 4M9PA 1AR1C 3QFDB 4FA8A 4JHWL 5JW4N 4K94C 1Q9LB 1DQJA 4PJXF 5GIRA 3A6CL 4RGNC 5DVLA 4ZUVA 4YBQD 4L29B 3MV11 1K85A 3VD5A 4EBQH 1V7ML 3S36X 4HFWB 1JFQL 1KYOJ 4WUKH 2J4WL 4HIJA 1AXTH 3HR5B 4WFED 3ARPA 4XI5C 4C83B 1DEEB 4PJFF 2LVEA 3F5WB 4YHNB 5GS1A 3RPIA 3C5JA 4EI5B 2AK4D 4WI9A 3WJLC 3FO1B 3HCVB 4XNUH 1ZA6B 4LSPH 5MHSD 1KPUB 3RBGA 5SV3A 4B5EA 1TQBC 2R0ZL 5FO7A 3MCLL 1M71A 5BJTB 7CGTA 3CLEH 4ACPA 1Y6NR 4F58H 4LCUB 4U6YA 1YEFH 2DLFH 3QXDA 1H8OA 2CK2A 2DBLL 2ATPB 2P8MA 2M2DA 2W0FB 3B6SA 1A5FL 2X42A 2Y6SC 2PYEA 1JGDB 2BNRA 1Z2KA 3IU4L 4XPFH 5EOCH 3LMJL 2X4UB 5MENE 4LVOB 4XCCH 3MBXH 2E8YA 1EVUA 5JOFA 1HH6B 5JOPE 3I50L 3JXAA 3LS5L 1W0VB 1UM5H 1JTTA 3E8UL 2AJYL 3RWFA 5M94B 2R2BA 4OLYL 4NSKA 3U2SB 1WZMA 3W9EA 3V6ZB 2IADA 1MHPL 2CKBB 4GBXD 4NJ9H 3O6FC 3FB8B 4WUUE 4JR9H 1KJVB 1CL7H 1D5XB 3EDEA 1EHNA 1CFBA 5CBAA 4IDJL 2GJZA 4IRSA 3VI4E 1A9BB 3IU3B 4M4RA 4PJBA 3UJJL 1IGFL 4U3HA 1AY1L 1BD2B 5TFSL 5IGXL 4F7TB 4BKLB 3UTTB 1DL7L 1QRKA 5JA8B 2EDOA 3MNVA 4PGDA 2V17H 3X3GH 3S5LA 2ICWB 5D7JA 3LSOB 4G80B 3PWUA 1HXMB 4PD4K 4HKXB 1NKRA 3KLAA 3DRQB 2PO6A 1XGYL 2B39A 3I3BA 4PJ8C 2JJSC 3V79C 5IB1B 3I6LD 3F6IA 4L4JA 5TE7L 3MGOB 4UT9L 3BSZL 3H0TB 4GG6F 3OKMB 3ESUF 2GTWA 2HT4C 3QDMD 4LFHG 4KRPB 3RQ3A 1M1SA 1ORSA 4ZUUB 4UV7H 3F58H 2VAAA 2JELH 1P5UA 1FVCA 2DDQL 5DRWB 1CXHA 4DK6A 4L4TD 3KPNB 1WT5A 4PLKC 3DMMB 5KZCB 3LQAC 2B0SL 2NY5C 1C5DB 1U58B 3FTGA 1HYSC 2QR0B 2PW1A 2P8LB 1GGYA 2W9DH 4KUCF 1A7NH 3G6AB 3LQMA 1QSVA 3QNYB 3UTSD 2B1HL 3LRSA 3DV4A 4AEIH 3N06B 5LBSL 1I7TB 4OZ4B 5DA4A 1E6JL 5CAYB 1EAJA 2OZ4A 2C4FT 4Y5YB 3TVMD 4WU5B 5EULV 1T2QH 5HHVL 5K33A 4I0PD 5MENA 4EXPX 3OQ3B 3WNOA 1S9WB 5JZ7D 3HRZA 3D25A 1VESA 4YR6A 2YPKB 5T3XL 1I9JL 1JYNA 1RPQA 4CAGA 1DLFH 1DQQA 4OI9A 4AK1A 1NCCL 1CFSB 2Q20A 3PUCA 2BSSA 2ZUUA 4F7MB 4YXHH 3GMNB 3VGFA 2YD8A 3ARUA 2RQ8A 2ENSA 4IIQA 2IGFH 3M8OL 1OAKH 3MLVH 1IC5H 1YC8A 2DBJA 4KTEH 4FXLA 4LSTL 4WUUA 3MRPA 3NFNA 1D7FA 4KI1A 5GZOD 3GSNL 2X5PA 1VADA 3P9WB 2AV7B 3FZUD 2FWOA 1IGIH 1T5WA 4K3EL 4X0KB 3STBA 1T22A 1ZSDB 4LL9A 5JO5A 3INUH 4OCLC 4JKMA 3LB6D 2RJMA 4HHAB 5EZIL 1QZ1A 3U7WL 3UBXB 1H8NA 2UYLB 1EAPB 1MCIA 2R29L 3ARRA 3CH1B 2NYYC 1F8TL 5IVXB 3EOAA 4BELD 4R96A 1F42A 1HEZA 4G6FD 5ESAB 2MQ3A 3QI9D 3Q1SL 1I1RA 1OT1A 2J88L 4C4KO 2GCYA 4KHTH 1E4KC 3BN3B 4I9WE 1TPXC 2ZKHH 5DMGD 4Z9KB 2PUQT 1EZVX 2CO7B 3WS6C 3AB0B 3BIBX 3HZYA 4NKDB 1DP0A 2ZSWB 4CDHA 3CDYA 5FKAA 5DR5H 3H2WA 1NCBH 3HA0A 3RU8H 3QUXB 2D7TH 4OM1L 2MCPL 1FFQA 1RSFA 4D0BA 3EOBA 2P4AB 3A6BH 4TSCH 4Y89A 3KWWA 1WC7A 1J8HB 2Q87A 4BH7A 5CGYC 3HC3H 2AW2A 1P53A 1D9KB 1ZHBB 4KDVA 3TPUB 5IQ9A 1MFBL 1YEDA 3T2NL 3IDYC 3EJYD 3SQOL 5IOPA 3D85B 1UZ6F 1MHHB 4HULB 3D3VE 1SHMA 3MNZA 1NBQA 3SKMB 3K4DA 4LSVL 3DPBA 1HHJA 4G7YH 1AD0B 1ED3A 1IT9H 2WBJB 3BDBA 1NAMA 5BCAA 1RK0B 2HMID 5D4QA 1EJ6A 3ZKMC 4DJMA 2OXHA 1ZHNA 5TH2A 3MCG1 4P57B 1RIUL 4X6CF 5K9KB 1CR9L 5FV2A 2VB5A 3MJ9H 1M7IA 3HE6A 3BD5A 3HUJF 1FVEB 4D94A 3EYUL 4I3SL 4BFIB 2VL5B 3MRLA 1MIEH 1WIOA 3EO9H 1AGBA 5AWNL 4L8CB 4NZRH 1VKXB 2OJZL 3HI5L 4HKJA 3BPOC 5KVDH 2HVKA 3K1KC 3QBTB 2IFFH 1LEIB 1K4CB 2EE6A 2R15A 4P2QD 2NY2C 3CJJA 4LASH 5JPMA 5GGTL 1II4E 3TT1L 3VG9B 5IEKB 5FYKH 3IFNH 5F89B 5DJ6B 1A2YB 1PLGL 5LAXB 3IS0X 1A8JH 3SDAC 2ORBH 1U8JA 2I5YL 4NZUL 1KJ2L 4MB3A 4GSDH 4Q6IA 3T2OA 1VGEL 1ZT4A 3ARBB 2Y5TA 3D39B 5ISZB 5HYIA 3RTQB 4JFEE 3L1OH 1IZKA 4N9GB 4DKDC 1KCVH 1N0LA 3ZT6A 3MLRL 3UYRL 1KEGH 2NR6D 5GRVL 4Z6AT 3TFKC 1T20B 1X7QB 1HCVA 1IC4H 2DQUL 4OD2B 4N0UB 3G5XB 3QFJB 5JIIA 2GEEA 2BOBA 3MRCA 3QUZC 2NY6C 1CFTB 3QHFH 4QXUH 5D1QC 1WF5A 3O3BA 1XGUB 4O58H 4E5XA 2BVTA 4M7LT 3CFCL 3ZKNC 2H1PL 3THMH 1BD2E 5IF0A 3D3VA 4QHMA 4AIZA 4EI6B 4E0RB 1JRHH 5JNYB 5DVOA 3UTTE 3FOLB 3IJYB 3Q5OA 1R5IB 4G6JH 4OZGB 2OBGA 3NCYP 1F4YH 2E9IA 5KS9B 3O8XB 4YDVA 2P8PA 4HIEA 5DRXA 3BQUC 3HMWH 1S7SB 1YEEL 2GITA 3SE4A 3X12B 3RRQA 1RZGB 1IAII 1ONQB 3EYOA 3QZWG 4KUZH 1JGEA 4UIKL 4Y8AA 4QHLA 1XH3B 1YQVL 4XPHL 1KGCE 3V5DB 2QV2A 3R06A 1Z9MA 5A3IC 1U8HB 3U0TA 3MA7A 1BIIA 2CGRH 2UWEE 3C60C 5C09D 3QFDA 4NGHL 1Q9LA 4Z7QF 2A6IB 1U3JA 3BPNB 2G5RA 4L29A 3SQBA 5ID1B 3MFFB 5D6DC 3VGDA 3QPXH 2DMKA 4HFWA 1TXKA 2V7HB 4K9EH 1S7TA 1A6TB 1V3KA 3HR5A 4O02L 1MNUH 5HI3C 1ZVYA 5I19H 1TMCB 2AJUH 3JWDL 5JDSB 4MAUL 2Z9TA 3F5WA 5AD0B 3PP3H 4EI5A 3FO1A 1LEKB 5JW5B 5T5NG 1RIHH 4H20H 5DXWA 5F44A 5HGDB 4LF3B 1MJJB 4LCUA 4NKMB 4NOFA 3LV3B 2W0FA 2NY3C 4OCNC 5CSZA 4Y4KC 1JGDA 5EG6C 4M7JH 4JFEA 3VD4A 2X4UA 4GRLC 5C7XH 5CD5C 4OB5H 4QTHB 5I18H 2MKWA 5EORH 4JFFE 3GSXB 2X89D 3QDAA 4ZO8A 3EFDH 1HH6A 4KROD 5EOCJ 4LFHD 8CGTA 1W0VA 4KHXL 3VFTA 1K5NB 4FABL 3D9AH 3FN3A 1YEHH 2AK4B 2YC1B 4X6FB 4W6XB 2F5BH 3C08H 4XRCB 1UQSB 4FRWA 2LVCA 2VLLB 3V6ZA 2F54B 3DHMA 2YZ8A 4EDWL 3WFBH 1KJVA 1D5XA 2Z0BA 3V2AR 1LD9B 2XG4A 2HTLC 1VFAB 1A9BA 2HG5B 5H94A 1X3DA 4TRPH 4YHIB 3RVXD 1BD2A 2D7OA 3PIQB 4F7TA 2NY4B 1MPAL 1VENA 5JW4R 4BKLA 4TPRH 1NGQH 2PKDA 3UTTA 1IEBB 3U48A 1H3UA 1A7QH 1RZ8A 2VXVH 5EZOH 4G5ZL 4S1RL 1YJDC 5AUMB 2ICWA 3LSOA 5FUOH 2Q76A 3MLUL 5IVXE 4Z7OF 1UT9A 5IBUB 4G80A 1HXMA 3DROB 4M1CC 4AG4H 2KUTA 5ESVB 2Z4QB 4HKXA 4NC1C 2QHRL 3TNNA 2R69H 2EYTB 4EUPG 3DRQA 1YYMH 4L3EB 2WQRA 3BI9X 4GMSH 3ZE2E 2R9HD 3GNML 1MVUB 5D7IE 5F1NB 3B83A 3LN5A 3VH8B 1FLRL 2UWEA 2J12B 4M6OL 4EJ1C 1JPTH 3RVUD 3M1BA 2WWKT 1MAJA 4ZUUA 4NO0B 1J8HE 3ARDC 4NZTH 4JM4L 5DRWA 2F53E 4OTXL 3KPNA 1AH1A 3DO3A 2F19L 3B3IA 3DMMA 1HSAB 5ITBL 1C5DA 2AJSH 2EDRA 2QR0A 2OZ4L 3JV6B 2P8LA 1NGXA 2FGZA 3MSPA 1J0ZA 2OSLB 2JJTC 4L1DA 2P5ED 4J23A 4OZIF 5J1SC 5FK9A 4OZ4A 1T6WA 4Y5YA 5DEGB 4RWYL 3QXAB 4WU5A 1TLKA 1MRDH 4XWOC 1I1AA 5D93B 5K9OA 5FYJD 3MLXL 3G6DL 5D2NC 3T3MF 4MYWB 5F7UA 4AQOA 1IFHL 1XT5A 2VLRB 2VABB 3ARVA 1FV1A 4J3UA 1BOYA 4JFFA 1S9WA 4JANB 4NC0B 4X7DC 3BZ4B 3CZFB 4F7EB 4L4TB 4FQIH 5GGVH 3UAJC 2YPKA 4J3VA 4OLWH 5FO9B 1AGFB 1EGJA 1CFSA 1G9NH 3OJVC 2FBJH 4XVUD 3OAZK 4KV5E 1J9CT 3U82B 5DQJA 3TBWB 1I9EA 2H32B 1KJ3L 1FIGL 3BP5B 3UTSB 4XNXH 1QNZH 4TQEL 2E27L 4MD0B 4D0DB 4PLNC 3DECA 3D0VB 1AQKL 2OXGA 3ULVH 5KTEL 4MVBC 2A9MH 1U3YA 3JUYA 2AV7A 4CADA 2XZZA 3DUSA 4M5ZH 4PRNA 4BQ6A 3NIGE 2P49B 3BESR 3MRIA 5DUPL 4CU8A 3KYNB 3GZKA 1NL0H 4GRWH 4OFVA 3MXWL 3BD4A 1BLNB 4PRBA 4RAVB 3UBXA 2UYLA 3RL1B 1EAPA 4X9BA 4MNQE 3CH1A 3D39E 5IVXA 4E9LA 5ISZE 4KK9D 3Q5TA 5ESAA 4NQVB 5FDYA 5CJOH 5MP6H 2X1WL 3RDTB 3I6GB 1N5YH 4ZNCD 4JY4B 5CWSB 1L9NA 4M6ML 5I1JH 2HJKB 4NKIL 5D7IA 5C0FA 2ZSWA 3IDXH 3QIBD 5FEBA 4KQ3H 1JGLH 3ZL4H 1DQLH 3RVTD 3SN6N 5LWYL 1ZGLM 5EA0L 4PJBF 2FX9L 5H37G 2EEBA 4DQOL 3LPWA 1J8HA 1OAQH 4MA8L 3L6FB 3LH2L 5JW3L 2W0LA 1X5IA 1D9KA 1J1PL 1ZHBA 2VDPL 3GMRB 4EUPA 2F53A 2AXFB 5GS0H 2M1KA 2WANA 4PREB 4I3RL 4NUJA 5L9DL 3SDCC 3D85A 1BJ8A 1FNSH 1NAML 4OBSA 3ROOB 4S2SB 2QJDA 2UZIL 5FYLE 2G2RB 5DGRA 3B9DA 3SKMA 2V2TB 4OZGE 3BKYL 3T4YB 1AD0A 3H9HB 4MAYD 1IGML 2NXZD 5IUSA 4HIIB 1QPXA 3PL6A 1MCJA 2P7TA 3V8CA 1VFBB 3NN8B 4WWKB 2YD6A 3TYGL 4YQXH 3LS4H 3DX8A 4ZDHB 3ROLB 3HE7D 1Z0MA 4JO4H 3VXRD 1EPFA 4P4KC 4Y5XB 3O4OB 3CC5B 4YHZL 4CVWA 1FVEA 1KIPB 2FJHB 3IF1A 4S0TD 4G6MH 3N1PC 5IMKA 3CCHB 3L5XL 1MH5B 2YUZA 3B9KC 4MA1C 3OKKB 2DLIA 5CEZD 1UWEL 3CX5J 3KLHC 5L7XH 2R2HB 1VKXA 1F3RB 1IKFH 2EH8H 1CE1L 1LK3H 3PWPB 5H8DA 1Q9WB 2W92A 4UILH 5BV7L 1XR8A 4TVSa 2Z8RA 1S7WB 4CMMB 5DUML 4X4ME 3QHZL 3TBVA 5DJAB 5LAXA 3QUXC 4JKPH 3RAJH 5I73B 5AZEH 4GAFB 2NPLX 4H25A 4RBPH 3D87B 4MNQA 5KANG 5BVPL 3D39A 5DJ2B 5ISZA 2IH1B 4N9GA 1DBAH 3WNNA 3AUVA 2AXJA 5IBLD 1H5BC 1RFDH 4OI7A 1P9MA 4P2CG 4TVPE 1X7QA 1DN0B 4S1QL 3MLYL 3VCLB 5H2BA 1S78C 3HC0A 4OD2A 2L4OA 3R8QA 4XTRC 2HFEB 7FABH 3G5XA 5B38B 3MV01 1GVIA 1RY7B 1X6NA 1A6UH 1A1MB 4FQCH 3VI4F 2E9JA 1J0IA 2WBJC 4XPGH 1CFTA 5DHVH 5DTFB 1I1AD 5FA3B 1XGUA 4ETQB 1QFWI 1KACB 5GGRB 3O45B 3TO2B 4NWUL 4WTZA 1Y6KR 3C5ZD 4JFFD 5DC0A 4H8WC 5GRUH 1HYRC 1OGTB 4PJHF 1EFXB 4JZJA 1FFNB 4DKEL 4EI6A 1K8IB 4KDWA 5JNYA 4LSUH 1KTRL 3FOLA 3IJYA 4XNYH 5GRXG 2OCFD 4OZGA 1C7SA 1RHFA 2DYPA 1UKTA 5GS3A 4WI4A 3O8XA 1QYGH 3O6MH 3BP4B 4IMLA 3H3PL 1ZLSH 3X12A 4U1JB 3QYCA 1RZGA 3CSBA 1R3LB 1ONQA 4LLDA 3I9GL 4GS7B 4L3EE 5CLWA 1XH3A 2EYSA 2D7PA 5T5FH 5CJQL 3TWCH 4Q97A 2Q1EA 1U8HA 3U30B 3QO0B 4XWGH 4NBZB 2FX7H 5IMLB 4Z7VB 4JQIL 2A6IA 1H15B 5BVJB 1S7QB 4FQHA 1OGAE 1L4IA 5JDJA 5ID1A 4GXUM 1FRGH 2V7HA 3RGVD 5FB8B 1A6TA 1OAUH 3TO4B 2V2WA 4HAFA 3RTQC 1B88A 2HKHH 5DQDL 5AD0A 3DX6B 3QEQD 2EDDA 1CGTA 2H3NB 1SYVB 5JW5A 4HZLB 1RUPH 1H3XA 1WAAE 3WHXA 4X4MA 3VXUB 5HYJB 4C4KT 2ARJB 3GB7B 4LNRB 3PQYB 1LP9F 1MJJA 3Q6FB 4WDIB 3W82A 1EEQA 1DFBH 5BRZB 3DGGB 4RFNB 3NCJH 1FFPB 1UA6H 5IB4B 4HS6A 3MTRA 4RFOL 1ZHKB 1WFOA 3LV3A 3VXMD 5T33L 1JZ3A 1A14L 4QRSB 3U6RB 2R0WL 1A6AA 2WUBL 1MJ8H 1CF8H 4P46D 4CJ1A 4Y8DC 3ARFB 4QTHA 3GSXA 1S9YB 5E8EB 4Q9RH 2AI0H 5ALBL 4CVXA 5HVGB 3DUUA 1RZKH 3F7YB 1PG7W 5A16B 4OD1L 1OPGH 5I1KH 1A6WH 1KJMB 3CVHA 3S96A 3T08A 1K5NA 2H41A 5HVWA 4XRCA 1UQSA 2BSED 4Y4FA 1F11B 5IROA 1G7QA 4DKAA 3B2VL 2FHCA 2UVFA 1BZ9A 1H9VA 1LD9A 1VFAA 3ULUD 2ZUTA 3O3DB 2HG5A 3T0ED 2YOCA 4JM2B 1H3VA 2W07A 2VE6B 3H42H 5CEZL 4FQJH 4I18C 5BMFL 4Q58C 1IEBA 2PTTB 4PJGB 1VDGA 1K9TA 4X5XB 1Z6JT 4KROB 1I75A 1MI5B 3FFDB 4LLWB 3VFPB 4YK4C 2ADJB 2CIIB 5ESVA 2Z4QA 4Z0BH 1Q72H 2EYTA 4C59B 3O4LE 1FGNH 4L3EA 4PP2B 3V52L 4P2RE 1MVUA 5F1NA 4K3DL 2VIRB 3HNVL 4ZYKB 4HKZA 3T09A 4D9RE 1DVFB 2XACC 2WZPD 2ZZUT 1FNEB 3K2MC 3FT3B 3KGRA 1G0YR 3O6LH 2WAHA 4G6KH 1UEMA 1OGAA 2A73A 2EDXA 4NO0A 4M7ZC 3W5MA 4GMTL 2VISA 3DXAD 5DURB 3I3DA 4NN7B 2FYYB 3AU1B 4YBQC 4K7PH 2CR6A 1KLUB 2F58H 1TZIA 2OL3A 2IAMB 2VL4A 1WJ3A 3LKRA 3AY4C 4Q7DA 3GJEA 3QCVH 4KKLD 4UV4L 4ODTH 4H1LG 1WAAA 4NKOB 2OSLA 3L3DB 4HBCL 3AMKA 5DEGA 2FLRT 1KCSL 3N85H 2P46B 4JPVL 1RJYB 3H7BB 1EGJL 3LCYA 2CQVA 4PS4H 4YXLL 2VABA 3V5HB 1MQ8A 1I9RL 4JANA 5I1CH 3F12A 5I75B 1IC7L 1U41A 3CZFA 1T3FB 5FO9A 4KC3B 4OCSL 4NQDA 1AGFA 2DYPD 5IM7B 3E3QC 1Z9OA 1MLCB 3TBWA 2HFFB 4NBXB 2H32A 5L8LB 3MA9H 3BP5A 2Z92A 4D0DA 2VZ3A 4DW2H 1CCZA 2HWZL 2BSRB 3PWPE 3W5NA 2N7BA 4GRMB 3RBSA 1OQOA 4GBXC 4KTDH 4N0YL 3QEHA 3NZ8B 1MAMH 4FQLH 4OSUL 3KYNA 1MF2H 3WUZA 2Z35B 1XGRA 4P5MB 3SBWA 3UPRB 3GFUA 4YHLH 4U1HB 1BLNA 4MA7H 4RAVA 2RCSH 4QRRD 2D7NA 3RL1A 4HUWB 1KXQE 5A2FA 3OKNB 4DN3L 3TF7C 1F13A 4NJAH 1JGVH 2VDRH 5GGRY 4NQVA 3H9SB 2EE9A 1ODAA 3RFZC 3RDTA 3HI1B 1S7UB 4S1DD 3I6GA 3O4LA 1C5BL 3PV6B 5C07E 3TN0B 5CWSA 5EOTA 1NPUA 2VZSA 3WFCH 4P2RA 2VR5A 3NCCB 1SBSH 2EH7L 1BQSA 2DQEH 3VRJB 4U1GB 4FNLL 3WYRA 1IL1B 1NSNH 1SM3H 2XZCL 4MJ4A 1QLEL 4ODUB 4BUHA 1TNMA 3GMRA 2AXFA 4PRIB 3U9PL 3B5GA 5E5UB 1MCNA 4MWFB 5CD3B 4PREA 4LSSH 5JQ6H 2NTSP 1JTPA 2VSCA 1QTYT 4G8FB 3SPVB 3DX7A 3EFFB 5TDPB 2CD0A 5HHNB 1D5ZA 1Q9KB 2G2RA 3DTXB 2Y1VA 5IV2B 2V2TA 3H9HA 3WKMH 2P47B 3CU7A 2FJGB 2QLVB 1VFBA 4X9IA 1KXTB 1Q9OB 4LAQL 2VDLL 3NN8A 4GKZA 3S8WA 4WWKA 1DLHB 3GUTA 2LFGA 3K1DA 5JHDD 4RAUB 1LDPH 2UWEF 1NDMA 3S37H 1E4WH 4XC1H 3MRFB 2V5TA 4ZDHA 2JJVA 3TVMC 3WD5L 3ROLA 5C86A 1NC2B 4U3CA 5BS0A 5IFAH 1U8KB 3VWKD 4Y5XA 5F1IB 3CC5A 2B1AL 3CFKA 1KNOB 4U31A 5L0QC 4I0PC 5GRYA 3VI3E 2FJHA 2C7UB 2WWMD 3QDJB 2ADIB 5JZ7C 1MH5A 2D9QB 5D7KD 1G0DA 3SJVD 2HTKD 3OKKA 1UZ8B 2YD4A 1L0XA 3DSFL 2D4DA 2IMMA 2R2HA 4N1EA 1F4XL 3EIFA 2OMBA 5HHMB 3CVIL 3U1SH 1FO0H 5E9DD 5FUZH 1CIUA 5EFIB 3PWPA 2GQHA 4F9PA 1RUQL 3WCYA 1Q9WA 2DKUA 3MMEB 4QWWD 1S7WA 3GIZL 4CMMA 1URLA 4LCCB 3VXUE 1PJ9A 4R0LB 1X5ZA 5E8DH 4G9DA 3OBAA 5GZOC 5DJAA 3PQYE 1YC7A 4F57L 2YBRB 2R1XA 3FZUC 3QG6B 4HSQA 3LKQB 2E7LC 5T1LD 4JJ5B 4KFZC 4OFYA 5TQ2L 2D3VA 1KG0B 5BRZE 2Q8AH 1MELA 2A6JB 2HJFB 4H5SB 1R5WB 2ICEA 3IKCA 4EEEA 3RZCD 2VERN 4LEXL 2C4XA 5EO1B 5DJ2A 3TCLB 2IH1A 3LB6C 3SGJA 3MRJA 4P4RB 3HRPA 4Y16D 2WP3O 2ENYA 5C07A 4YO0B 1V5JA 4ZUWB 1F6AB 4XMLL 3C8KB 5KW9L 1MREH 3OR6B 1TTFA 3QI9C 2IH3B 4FFYL 2EDWA 4JHAL 1BPVA 2HFEA 5B38A 3KLDA 2BC4A 5DMGC 3RKPA 3SE8L 4ODSH 4X7SH 3FN0H 3HB3D 5EO9B 3FL7A 5DTFA 2CMRH 4JCMA 4XP1L 2FATL 1KSRA 1X44A 1CQKA 5FYLL 3TO2A 2JJWA 3F7RA 5DEFB 2NNAA 1XF2B 2R8SH 2FHFA 4J3TA 4R4FH 4YHKL 1OGTA 5IVXF 3WV0A 4MD5B 4G7VL 1FFNA 1K8IA 3O4OC 5DD3L 4NQDD 3W9DB 1H3PL 3ZTJH 4G3YH 5IT2H 1N64L 3EJYC 3ILPB 5HYQA 3ZE2F 1MI5E 3IKKA 1BP3B 3BP4A 3FQRB 5D7IF 1T83A 3DRTB 1X5LA 5E56A 1D5BB 4GAJL 4GJTB 3G5ZB 4U1JA 1A47A 1R3LA 4ZUSB 4ZUTB 1R3JB 4YX2H 4UT7L 3MUY1 2ILLA 5I71B 1CFNB 2HMIC 2FO4A 5FYKE 4TUJB 5IVZB 3OB0H 2CLZB 2ZUWA 2MCG1 3NVQA 4U1LA 3WN5B 5I73C 2L0DA 2QADD 5MERB 4JPKH 2HKFL 4X7TB 4GKSB 4O2EB 2B5IC 2HVJB 3Q6GH 3SGKC 5FB8A 3TO4A 4N68A 2A2QT 4XPBH 4UU9B 3LEYL 1F4WL 3IDIB 4ZO6A 4PTTA 1MFDH 4RCAA 12E8L 2GJ6D 2X7LB 3DX6A 4CMHB 3DGCR 1SYVA 2YUXA 3MV8D 3VXUA 3OMZA 3BE1L 1GAFH 1VACB 1A7RL 4LNRA 3PQYA 2YRPA 5AZ2L 5C0GB 1I7UB 1WSST 4WDIA 5BRZA 3DGGA 1GIGH 1FFPA 4PJDA 3CFDB 2AXGB 5IB4A 4DKFL 1ZHKA 2XZQH 4NC2B 4QRSA 4TVPL 5KSAA 4LQFL 2FX8H 4IOSD 3CVHL 1JGUL 4JHWH 3ARFA 4KV5F 4OJFL 3A6OA 3T0WA 3RGVB 1KTDB 1S9YA 4NN5C 5E8EA 2VXQL 5DLMH 3SDDD 3F7YA 5A16A 2IQ9L 2WQ8A 5EN2B 5HYEA 3G5VB 2FEEI 2NY7L 2EDYA 3PWLB 2NR6C 1JIBA 1J0YA 4JN1L 2DTMH 3LHPL 4U4BA 4LSQL 4XHJD 2PNDA 5ICYB 4XBEH 3NIGF 1G6RB 4J2XA 3CX5K 1CBVH 4FTVD 3FOMA 4MJ5A 1IGJA 1KTLA 2R0ZH 2FSEA 2D03L 4PJ5B 3O3DA 3MJ9A 5BS0D 1U3ZA 2Q6WA 2E6PA 4ZMAT 4UTBL 1XR9B 3U30C 5F3BB 1CE6B 2YD7A 1U42A 4JFZH 4CNIB 5D7SL 1INEH 3BDYL 5IR1B 1LK2B 3BHBB 4U6HB 4EN3D 5KANI 2PTTA 1ZT1B 3WXWH 3QIWB 1J11A 1T7XA 1MI5A 4LLWA 4WWID 1YDPA 2CUIA 2JK5B 4M00A 3H9SE 5FXCH 2ADJA 2CIIA 4KK6D 1PSKL 1CK0L 2UVEA 3U7YL 2FD6H 5DUBB 5SWQA 3BX7C 2JIXD 4C57C 1LEGB 3AREB 1MRFL 4P59L 4Z7UB 5HI5D 3P0VH 1QKZL 4M48H 4K23L 2VIRA 3JZ7A 4ZYKA 3QRFM 4I48B 1DVFA 4QNPE 1HHGB 3WO4C 3FT3A 4JDVB 5B8CB 4QXTB 2LE9A 4CJ0A 4RMRA 1B9ZA 2OL3L 1NEZG 1IGFH 3O41B 1AY1H 4MLSA 1LQSR 5D71H 4PRIE 3UTPD 5TFSH 4BK4A 2FYYA 3AU1A 3QSKB 4OLXH 5CCKL 3MOBL 1S8DA 2IAMA 3NGBC 2IF7A 3G5YB 2HH0H 1MCLA 2I27N 2C1OB 4NKOA 2CRIA 2WUCL 4MNHB 4K8RH 4IRZL 2DQIL 3TBTB 2VZTA 3S3PA 1UB6B 4OF0A 5GJTL 1HH9A 2BFVH 1JWMB 1FG2A 3BSZH 1RJYA 3H7BA 2AP2A 1XCQA 3V5HA 2YPLB 3TP4A 5FHAL 4RFEA 4OAWB 2IALB 5HDQH 1T3FA 4JM2C 1HSBB 2KZ1B 4LCYB 3P11H 2YA1A 5CGMA 3QDJE 4DN4H 1S5IH 1MLCA 1MHCB 4Z8FL 1NCWH 3OGCB 1DQML 4KROC 2B0SH 1TVHA 4G43B 3OKOB 4D0CB 5IBTH 5HHME 2C1PB 4PJIB 1A6ZB 4WTXA 4JN2A 2BSRA 1GGBH 4ZODA 3IB4A 1CT8B 1HZHH 4GRMA 5JOEA 2OYPA 1BJ1H 1IAOB 1Q0YH 5E08H 3NZ8A 1KLGB 4WUKL 3ZHLA 1CXEA 2Z35A 2R2CA 4P5MA 3UPRA 4P5TB 1AXTL 2ADFH 4U1HA 1S9KC 5ENWB 4KJWD 4HUWA 3RVXC 4HJJL 1ITBB 4UUJB 3OKNA 3GMOB 3OXSB 4FOMA 3V9FA 4XNUL 2N7AA 4LSPL 3EZJB 1N7ML 3K46A 3H9SA 1I1CA 1T2JA 3C2AH 3PDDA 3HI1A 1S7UA 2J3SA 4QXGH 3NOIA 3TN0A 3CLEL 4G8IA 3RVVD 4F58L 1YEFL 2DLFL 4O2FB 2P5WE 4I77H 3BYTA 4O00A 5E8PB 5EOCL 3VRJA 2VLKE 3MQIA 1W0WB 2R9HC 4XCCL 4CVZB 3MBXL 5F93C 4JLRB 4JPIB 1KLFA 1IL1A 1PQZB 5KOVC 1V3LA 4K3EH 1KCUH 4OF8A 5EIQA 4J4PA 4LLMB 2NZIA 4P23D 4P9HH 2WK2A 4F2MA 1UM5L 4PRIA 5IK3B 3RVUC 4PLOB 5CD3A 1FPTL 4CRPA 2BRQA 4MDIB 4PGEA 1RUKH 4L8BA 1JI2A 3EFFA 5F8RC 4JG0H 3OJDA 2HLAB 3UZQA 4NJ9L 1Q9KA 2R29H 2QBWA 4NNYA 4UQ3B 3R0MA 5IV2A 2GSGA 5HTSA 3Q1SH 1J05B 1I3VA 2FJGA 3BUYB 5IJVB 1NEZA 2XI9A 1Q9OA 1DBBH 1DTUA 5DGQA 3QNZA 4RAUA 3WO3B 4Z76A 2CH8A 2H9GA 3MRFA 4HCRH 5DVMA 1OY3B 1NC2A 2JCCB 1TVDA 2V17L 3MR9B 3PHQB 4MZ3A 1U8KA 2Y06H 1YEIH 2VYRE 2W9EH 5F1IA 2DQHH 2ZUQC 2VR9A 1KNOA 4JHZA 5JIKA 2C7UA 3EDKA 3QDJA 2ADIA 4JVUA 1UZ8A 4OGAD 4JY6B 1CL7I 4HLZH 3CU1A 3BZEB 4XGZB 1WAAF 3FFCA 4RAHA 1IM3B 1OAZH 4XVUC 4IDLA 5F7DB 5I8EB 3SOBH 3PP4H 4BM7A 5FYKD 3F58L 4LCCA 1RD6A 3MV7B 5TQ0H 4PY8I 4R0LA 4HGWB 2BMKA 1WCBB 3E6HB 2YBRA 4HWBH 4J6RL 1KG0A 4J1UB 3F7VB 2HJFA 4H5SA 1XIWB 1R5WA 5IHZA 5AYQA 3F7QA 3TCLA 1A7NL 4R2GD 5J11C 4DFIA 3QULA 4P4RA 4AEIL 1K8DA 1A1OB 4I3SH 4K55A 4YO0A 1ACZA 4ZUWA 4AM0B 1F6AA 1G9MC 1JNHA 4KK9C 3UCRA 5I0DA 5E9DB 3OR6A 1T2QL 2IH3A 4HUMB 1QG3A 1JHKH 2P5WA 1WBXB 1KCRH 4KK8D 4K94H 2VLKA 1FAIH 4QRUB 4P2OB 4JRYE 4R7DB 4YBHA 5EO9A 3BGFB 4Y7MA 3DARA 3QIBC 4APQB 3SCMD 2BY1A 3RVTC 4URTB 4FN0A 1EEYB 4YZFE 1PZ5B 4MXVF 3U4BH 4WO4B 5DEFA 1OP9A 4PJ5E 4X5LA 1XF2A 5CSBA 3D0LA 4YXHL 2XN9B 2KPNA 4MD5A 1GOGA 2IGFL 4Y16B 1OAKL 3MLVL 1IC5L 4KTEL 3IRPX 3W9DA 4MQTB 1X5JA 2DD8H 4F7CB 3ALXA 1BM3L 1QSFB 4HUVA 3ILPA 1ACYH 1IGIL 2EDJA 4IM8A 3FQRA 3MLRH 3UYRH 4ZFFB 3DRTA 4PJCB 3TLRA 1D5BA 3AFLA 1LE9B 4M8QB 3G5ZA 2CIKB 3MLTA 1B90A 4MAYC 3KPPA 3T04D 4ZUTA 3INUL 1NFIB 3VXSD 3O3AB 1SJVA 3I75B 4Z7UE 4C56E 3CXHJ 5IVZA 2CLZA 3C6LA 2AVGA 4NO3B 3NH7H 3WN5A 3HE7C 2X4QB 4KHTL 2K1MA 5IKCB 2ZKHL 4PGBA 5MERA 1BBJB 3UTQB 4U7KA 5J13C 4JFPB 4X7TA 1V3MA 1N6QL 4P2YA 4I8DA 4UU9A 3MPCA 3RU8L 1NCBL 4JRXD 4YWGH 2IEPA 2D7TL 3WJJC 2X7LA 4F8TA 1YMHB 2M8XA 4GH7B 1BX2A 4Q9CA 4WFHD 4DGYH 1UXWB 3D2UA 3HC3L 2A9NL 2N56A 1AHWA 4RRPA 5C0GA 1I7UA 4UIKH 4KMQA 1YQVH 1G7IA 1E27B 4J12A 4J4PD 1KB9J 4YUEH 5EBGA 4PUBH 1IM9D 1ZAGA 2RAMA 4G7YL 3KR3L 5KVEH 1S7XB 2WW8A 1X4YA 1E28B 4L9LA 2QQQA 5JORB 4NNXB 2VXSL 2HAZA 3F65A 4RSVA 5EN2A 4OLZH 3G5VA 5IBLC 3BFOA 3PWLA 4U05A 3DV6B 1PKQB 4ODXB 5I6XC 1HQRA 1XGTB 4JRYA 3MJ9L 1C12A 3VFVA 1HHKB 5I74B 4NHUA 4XBPB 5JMOC 4PJIE 3QNXB 3GSQA 3UTZA 4MZ2A 5E00B 3UDWC 4XNZC 1WWWX 3TH3T 4MCYB 5D1XD 1MIEL 4PJ5A 3EO9L 3VWJD 3LQAH 1I1AC 2NY5H 1OTSD 4NZRL 3WDHA 1XR9A 1UENA 1W0YT 4PBVC 4CNIA 2ATKB 5IR1A 5KVDL 1LK2A 3BHBA 1IC1A 3C5ZC 3MRKA 4X5WB 2EIDA 2IFFL 3CSYB 5J6HB 4YIQB 3QIWA 4LASL 4QGYA 4HH9A 3FFCD 4PG9B 3IDGB 3C8DA 1T04B 5FYKL 4PRHB 5DUBA 2BY0A 4WEBH 5F1SA 4RBPK 1LEGA 1UH4A 3AREA 5ADOH 2ORBL 2YXFA 4WHCA 5E6YA 4NQUA 4C56A 4GSDL 4FTVB 3QR2A 3FRPG 4I48A 3S9DB 4JGUA 4XCEB 3L1OL 1HHGA 1IKNC 2I07A 1W8NA 1W8OA 1KCVL 4LLUB 4QXTA 2DWDB 1KEGL 2X1PA 3RA7L 3V7MA 3O41A 1RI8A 5IW6B 1IC4L 3REWB 4OQ1A 4YGAB 5D2LB 2GKIA 1MPAH 4NQEE 3T0VA 4GQ9H 2W59A 3RGVC 1EMTL 4N8VB 3QHFL 1QSED 3T1FB 2P42B 3HNTH 4O58L 4MNHA 2WP3T 2VLKD 3TBTA 3HAEB 1UB6A 1P2CA 5DHVA 3GIVB 1JWMA 3THML 3GI8H 5FDWB 3JVGA 4HWEL 4Y1AB 1JRHL 3VI3F 4F3FB 5DK0A 3BYYA 1I4FB 3BAEH 3U79A 5JUEH 1ZXQA 2IALA 3QDGD 1AP2B 4WEMB 2Z91B 3HMWL 3DIFA 4P46C 4F80A 5I1LB 4LCYA 4JM4H 3MACH 1KCLA 1N8ZB 1MHCA 2FECL 5I1EH 3OGCA 2MFNA 1OW0A 4LHUD 3O3UN 3OKOA 4D0CA 5DRNB 1WZ1H 2APFA 2CGRL 4PJIA 3ULVD 1C8PA 3T0DA 2BVQA 5JXEA 1CT8A 4QY8B 1NCNA 4D3CH 4WW2B 2VLMD 4PJDF 5FIEA 1JRHI 2J8UB 5E70A 4DOHB 1IAOA 3QPXL 2DQFB 3QAZB 4TSAL 1F2XK 4RWYH 4K9EL 1HHHB 1T1ZA 2Y5EA 4P5TA 1AD9B 3MODH 3ULUC 1BJ1J 4XVSH 3ZE1E 5DK3A 5I19L 3T0EC 2AJUL 2Y4SA 3MLXH 1CICD 5B8CC 4KJYB 3AXLB 4PJ9A 5J9PB 4YHYB 1WIPA 4UUJA 3OXSA 2ESVD 2VKXA 1UXSA 1NANH 5JXAH 1CU4H 1RIHL 3PXJA 3FB6B 1AXSB 4H20L 4YBLB 1CFQB 1NCUA 3BZDA 3QUMH 3TZVA 4L1HA 4Z77A 4WFFE 4YLQT 4AJ0A 1ND0B 3D2UD 1FIGH 5DEZA 4PBWD 2O61B 1U9KA 3N1QC 1SJHA 3ZE0E 5E8PA 5C7XL 1AQKH 1H0DA 3SKNA 4OB5L 5I18L 4CVZA 4HK0B 5EORL 4JLRA 4JPIA 3ARGA 4LCIH 3EFDL 3WFZA 3GBMH 2DI8A 2ERJC 5MEOA 5GS0D 1F5WA 5IK3A 1EHLH 5TJWK 3D9AL 2V6HA 1YEHL 3MXWH 4ZG1A 2XN9E 4LBEB 3C08L 4MDIA 3AROA 4NQEA 5C0CD 3IDUA 5BXFA 2HLAA 3FRPA 1FNGB 4KZEH 5D1ZD 3WE6B 4UQ3A 3C9NB 1DQDH 1JV5B 1QSFE 3GBNH 2G5BB 4CN6A 3BUYA 5IJVA 1XMWA 4KKLC 2NXYD 4TRPL 2J8OA 3V5KA 1LO4H 3SGDI 4KJPD 3T4AB 1ROWA 4MSWB 1NGQL 4N5UA 4TPRL 5HPOA 5LWYH 1KB5B 2VXVL 5EZOL 3WIIH 5C08B 1XF3B 1MFEH 4HKBB 4JZNB 1XF5A 3PHQA 2QSQA 4XMKL 1EBPA 3RWGA 4AG4L 3VXPA 3LH2H 5JW3H 1PZUB 2R69L 2V9QA 1ORQB 2VRAA 3C87A 2NZ9D 3EUUA 1QO3B 2VZVA 1P6FA 4GMSL 4JY6A 3S4SB 3P9LB 3BZEA 1HHIB 4POUB 3FT4A 4XGZA 5LVEA 4NDMB 1IM3A 1EH9A 2MKLC 2UZIH 3V7AG 3DI2B 5ACZB 4ELKB 1JPTL 3L5WB 3HZVA 3NABL 3ZYJA 5KG9A 4C56D 5I8EA 1QLRB 1UYWH 2PTUA 4OT1H 4XMPL 1WCBA 3E6HA 2RB8A 1UFUA 2ICES 5HPMB 4HK3J 1M05B 4MJID 3WIHH 3W39B 3F7VA 2AJSL 1XIWA 1A3QA 1NBZA 1PD6A 4PJEB 4UZGA 4KI5D 2H2PD 5MEPB 2DI9A 1RURH 5TGBB 5A43C 2YN3A 3DO7A 3WSQH 1RUMH 1UJ3C 4BSWB 3L5XH 3OZ9H 2UUDH 4AM0A 5KN5B 4UTAH 2P1YA 1QRNB 1ZV5A 1MRDL 1GGCH 3RUGB 1NUDA 5M95B 4S1DC 3V6BR 1PKQE 1WBXA 1WFNA 5CZVH 2C3VB 4OCRH 4QRUA 3NACH 4R7DA 1OD7A 1C7TA 4ZXBD 4NN6C 1U6AL 4APQA 4FQIL 5GGVL 4KDTA 1EEYA 1FNLA 4OLWL 3RWJB 5I8OH 4YEFA 3KPOA 3K4AA 2C3HA 4WO4A 1G9NL 2KH2B 2VTFA 2FBJL 1RZ7H 4BZYA 2XN9A 3HS0B 1TITA 2VH5H 3CFBA 4R2GB 1QNZL 4I5BA 4HIHB 5IHLB 3TV3L 4I4WB 5BVPH 1JPST 4F7CA 4ELMB 1QSFA 2A9ML 3BMVA 3EYVA 4QOKD 3QWRA 4D9LH 3OHXA 2GFBB 4K3JH 3RX5A 4M5ZL 2R2EB 3BXNA 4YDIH 1LE9A 4QNPF 4PRHE 2CIKA 4A6YB 1NFIA 1Q1JH 5SX4H 1CXLA 3O3AA 1BVKB 1J87A 3I75A 1RAMA 3SCMB 3LRHA 2BNQE 5DC4B 4XXCA 3PGFH 1YA5A 5J3HD 3MNWA 5CJOL 5CINH 5MP6L 2V5RA 4PJ9D 5F9AC 2X4QA 3JTTB 1N5YL 2FH8A 3GSOA 3UTQA 3VWKC 1FLTX 4JFPA 3EHBD 5I1JL 3NAAH 5T3ZH 3IDXL 2W60B 4Y19B 2IAND 2WWMC 5D2LE 4X6EB 3ZTNL 4KQ3L 1JGLL 3ZL4L 1DQLL 3TZVD 2D7MA 2HTKC 4Z7NF 4Y0GA 1G1YA 4NO2B 5C3LD 2ITCB 5SWSB 1UXWA 3DHJA 4FP8H 3KPRB 5GS0L 4RDQG 1ADQH 1KIUA 3ZTJG 3I9GH 3ARGD 4Y88A 3U9UB 3IFLH 3BGFC 4ZFOB 1T1WA 4LCWD 1FNSL 1IGCH 3VJ6A 4Y1AE 1YY8A 2GUOB 4JQIH 4NQED 5AAMA 1S7XA 1JPGA 3RZCC 5D7LE 1F58H 1E28A 2LU7A 3DBXA 1AE6L 2O5XL 4NNXA 3NZHH 3TBSB 5EU5A 4Y16C