1YJDH

Crystal structure of human cd28 in complex with the fab fragment of a mitogenic antibody (5.11a1)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
217
structure length
217
Chain Sequence
VQLQQSGPELVKPGTSVRISCEASGYTFTSYYIHWVKQRPGQGLEWIGCIYPGNVNTNYNEKFKDKATLIVDTSSNTAYMQLSRMTSEDSAVYFCTRSHYGLDWNFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a soluble CD28-Fab complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/signaling protein
molecule keywords Fab fragment of 5.11A1 antibody light chain
total genus 37
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2005-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yjdH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yjdH02
3CFDB 4G7YH 2CKBL 4XPHH 4JM2B 2NXYB 1Z9SA 4LMQI 2GK2A 1JI1A 4QY8B 1DBKL 4BKLB 4YO0B 1CICD 2J12B 1NC2D 1RHHA 4OZHE 3PP3K 5CGYD 2YD1A 4K8RL 3U82B 4N0YH 5CSZA 4QNPE 5J56B 1WWCA 5JQHC 1OARL 1XH3A 3VXNA 2ATKA 3H6JA 4X4XB 4JVUA 2NXYD 1WBZB 1QP1A 5HVFB 3GNMH 4YNYB 1ORQA 3FQWA 1RK1B 2APVA 3BP7A 2WZPD 5EOCJ 1SYVB 2UY7A 3H7BB 2FB4L 4CU6A 3IFLL 5FYKU 1E4XL 4OCRH 2A83B 3CXHK 3I50L 2B4CL 1VFUA 2W9LA 4JHAL 2R9HD 3QIWB 5DR5H 1YEIL 5GGRA 3T4YB 2XRAL 3ILPB 4OZGE 4UU9B 5CSGA 4LK4A 3QCTL 4MXQC 5C2BL 2XZCH 5HHPA 2RFXA 5EBGA 3MR9B 1MHCA 2MMXA 3R1GL 1S9YB 1XF2A 1BIIB 1GZQA 2BNRB 3FO0H 1J11A 3WL9A 3GMQA 4HS3A 4F57H 2BSSB 5T1LB 7FABL 5KVMC 4JGJA 4MJ6B 3T09A 2BX5A 5I8EA 4AYFA 1JMZA 2Z93A 5KSBA 3EO1B 1U91A 4NGHH 4PB9L 2DJSA 4JG1H 3KLHD 5JPMA 2P8PB 1WBZA 5I1IL 4U6XB 1YC8A 4DFIA 2NX5B 1D5IL 1CDUA 2OL3H 4O9HL 4ZFOB 4LHUD 4JFDB 5BJTA 1L0QA 1NFIA 4RNRA 1NC2A 3CX5K 1A6AB 3E6FB 4KU1A 2YA0A 3I6LD 5DFVD 4TSAH 4X9FA 1KV3A 2CRYA 3LMJL 2I07A 5FCSH 3O2WH 5F89A 2QHRL 4WV1B 1MCEA 4ZUVB 3ARRA 2BVQA 4QT5A 1CXLA 5L7XL 3PL6B 5D72L 4X5WB 4M1DH 4MXQD 5E9DE 1INQA 5EOQL 5I8CA 2Y06H 4KKBC 4UAOB 1W0YT 3GMOB 3QZWB 4X4ZA 4N5EC 4MQTB 1GC1H 3CLFH 2C3HA 5SWSD 2HFGH 4QWWD 4NN7B 2GJ6E 2OP4H 3RGVB 3SDXF 3QPQC 4A6YB 2GJ6A 4YGVB 5FECA 3DETC 3G6DH 5T3XE 3HNVL 1F2XK 3O4LA 5T33L 3QXTA 5E95B 1F4YL 3AROA 5JA9A 2NXYC 2E9JA 2BP3A 2X05A 4Z0XA 1KJVB 2EDQA 1J1XL 1JPSH 5JW3H 2UWEF 4NN6C 3PDGA 1QTYT 5JHDA 5BVJA 1A3LL 2R2EB 4HPYH 4NQXB 4GBXC 3SY0B 1A21A 2PYEE 3FO9B 1RJLA 5DUBB 1BFSA 1J8HB 5IOPA 5HYIA 4JFYB 4PGBA 5ERWA 1UFUA 1MCCA 2NY6D 4HJ0D 5DMGC 2CDGB 4FFYH 1KPUB 5FDWA 15C8L 4YAQB 1G7HB 1I7ZB 1RUAH 2XA3A 3IGAA 2IALA 5E08L 2J4WH 4XPFL 2ESVB 4YHKL 1F6AB 4ZPVB 1FLRL 4A2MA 3MROA 2X1XR 4G7VL 1A6TB 4LAQH 1T22A 1SY6A 4IMLA 1HSBB 3B83A 5D93B 5T1KD 1DUZA 4H5SA 1VFMA 1A7QH 4HIIA 2AXFA 2PO6C 4K7FB 2M8XA 4M1CD 2BOCA 4L3AA 4KAQH 4PRPD 3D69A 1ADQH 3B6SA 3BZEA 3I6KB 4CMMA 4M7LL 1K8IA 3L3OB 4N9GB 2P5EB 3AB0C 5DEGA 5SWZD 3HCVB 4Z7VF 1IKFL 3UPAA 3PWLB 4AT6A 4OQ1A 2XQBH 3JTSB 5CLTA 5FYLL 5J4MA 3MOAL 1OY3B 2QSVA 5IB5B 1G7PA 3SDCB 5L6YL 2H2SD 3VMPA 4D9LH 3D87B 3VRIB 3QDJA 4NJ9H 4KJWD 3WLWD 4YXKL 3WS6A 3V4VL 1U8OA 2AK4E 3BESR 3T2PA 1SY6H 2V2WB 3W9EB 1XCTB 5IK3A 5FO7B 4UQ3A 5T3ZE 4KMTH 4UTAH 1FQ9C 4YBQC 2YD3A 3FQTA 4JFDE 3RAJL 3P2TA 2Z31D 1FZOA 3VXRD 4PJGB 5DI8A 1NCTA 2C9AA 5DJ6A 1WT5C 4E5XA 4Y2DA 4CKVX 3EKCA 2DIJA 5ITBH 5FCUH 1NFDE 5H37H 2FHFA 1Y6NR 4K9EC 4ORGB 3WUWG 5TE7L 2NY2C 5C0AB 4PJEF 2F5AH 1RD6A 5D70L 1IILE 1WBXA 3QWRD 3OX8A 1NGYB 4GBXB 3WFEH 4NKIL 3M1BA 4LLAA 2Z31B 5HHMD 2YD9A 5HGHB 5E2TH 4U4BA 3W11D 3HPJB 1AKJA 5ETUA 1G84A 3GBLA 3MREA 3O6ML 5I1DB 3DMMB 1BJ8A 2XICA 3CFEA 4NC2B 3MXWH 4ELMA 3LEYH 4Q2ZB 2J8UB 1KB5A 1QLRA 4RAHA 1AJ7L 1JV5B 2CLZA 2IQ9H 5HHME 4NN7C 4OGAD 1F97A 5F1NB 4L3CA 5MERA 2F54D 2GYSA 1JWMA 3BPOC 4WI9A 5HHNA 4KFZC 3DLQR 5HY9A 4CVXA 4QKXB 1MUJB 2ZG1A 2BOBB 2P8PA 4QHLA 2RCSH 5FF6A 4BZYA 1T2QL 2ZSWB 5F1IA 1IC1A 4G6KL 4Z7UA 3RHWF 5EU4A 4JFEE 2Z35A 4H20H 2F54B 4JLRB 4DAGL 3PABA 3MGTB 3OB0H 5IVXB 5TPWH 2L7UA 3ES6A 5C0GB 3IDGB 3N1MC 3HC3H 3A6CH 4BSVB 5DQJA 1Y6MR 1WAAE 5ADOL 3VWKA 3WJJA 4OLXH 2H2SC 5DQ9B 5EDXA 2A9ML 3QIWA 4DGVL 1AP2A 3GSUA 1OB1A 4YHPB 1C16B 1KF9B 1QEWB 4G80B 2UVEA 3GB7A 4L8BA 4HBQA 3GBNH 5CD3B 2R8SH 2DOCA 3RI5K 4LCUA 1RFDL 3JBG7 4N1HB 5E03A 1LEGB 2BHZA 1U3JA 2OSLB 4NHUA 3LEXB 3WIIL 3WO4B 3W0WD 4R26L 2ZG2A 1LK2A 4PB9H 3CK0L 4Y5YA 1SQ2N 5I66A 2OK0H 1JTPA 5KSAD 3BJLA 3C60A 3O3BA 1K4CB 2CRZA 3D3VB 3HI6H 4NQVB 2NZIA 4KHXH 4HZAA 4LIQE 3CLEL 2PF6A 4PY8J 2ZZUT 2GK0B 3QIWC 4L4TB 4PYHA 5KVFH 5D5MB 1T21A 1J8HA 1VKXA 3M17B 2YEZB 2QADD 2EDHA 5LAXA 3VXSA 3MMEA 3W11C 3GSOA 4RGNE 2XXMB 1N6QL 3D3VD 3VDCA 1U8NA 4CAGA 3MA7B 3X11A 4OCSL 4KPHH 5EZJA 2R0LL 5D9SB 4DWHA 1KPVA 4JVWA 5DRNB 5F9OH 5EO0A 2FBJH 2QSTA 3MRNB 4RMQA 5D71L 3R8QA 3EJZC 3DIFA 4WO4D 1QBLH 4BZ1H 3UEZA 3UJIH 2G2RA 8FABA 1REIA 2CRIA 1NCCH 1RZKC 3VFUA 4Y88A 5J13C 4K3EH 5GS2H 1GPOH 3ZE1F 3GSVA 1ACYH 4X9IA 3C5ZA 5BRZB 4XPGL 3BP6A 5MENA 3HS0A 3EFFB 5JNYA 2A74B 3CFKB 1T03L 5C0CA 1RVFH 3TPKA 2Y72A 2YC1B 5CSBA 4K9EH 3MV9A 1I1AC 1FC2D 2HRPL 5K9KA 3LKPB 4UBDD 4CBPA 3D2UD 3PWVA 1XGYL 5AUMB 1VEMA 1FFOA 3JWDH 3EHBD 2OMNA 1NBVL 2LQRA 2C1OA 2YSSA 5ID0A 1U8LB 2CDGA 4M7KL 3EYFB 1FNFA 1H5BB 15C8H 3I3DA 5C07A 1TNNA 1NSNH 2F8VA 1U3YA 2A6IB 4KROC 1KLUA 1QKZL 3E8UH 4KTDL 2R2EA 4NQXA 2WWKO 3U4EB 2YD5A 4PRBA 5D7LD 4NPYB 5C3LD 5LG1A 1BEYL 3DUSA 4PJFE 3BIKA 3VGHA 4HJJL 1O7VA 3MXVL 5KSVA 2DI7A 1TDQA 3C8DA 3JVGA 5SX4I 3O2DL 1HINH 3ULVD 3W0WB 3GFUA 1AGFB 2HFEA 3HE7C 4GAJL 1VA9A 5JXEC 2FGWH 3P0GB 1YDPA 1D6VL 3MOAH 1JMXA 4ODTH 2AS5M 3MJ9A 1QRNE 5KSUB 3EO0B 5JIKA 1VKXB 1BMGA 1KG0B 2QV2A 2ZCLH 1UJ3B 3FHQA 4Y5XB 2EYRA 2VLMD 1B2WH 4R2GD 4N0UA 3VI3F 1HIMH 4XVUC 4HKBA 1ZKAA 4U1IB 2FEDD 3LB6C 5JIIA 1J5OH 2D7OA 2ENYA 3FO2A 3T2OA 1JIBA 4JJHA 5LWYL 3H9SB 3GZKA 2AJYH 2BSED 1P84J 4Y4FA 1ZT4B 3ZT5A 2OR9H 4GRWH 3T0EA 3ZSSA 3U1SL 4ISVB 5JTWA 1LDPL 4H88L 2VC2H 3MLVL 1SBBA 2LTQB 5DC0A 1A6UH 2V7HB 1IGTA 3DVIA 1NC2B 2OJZL 1G9NC 3UAJD 3K8MA 1YNKL 4L8BB 3GB7B 1S9WA 3I2CH 1A4JB 4HW6A 3ELAT 1QR4A 5J57B 2D2OA 1R5VB 2NY6C 4KRMB 5DQ9A 2V5YA 3SJVB 2Z4QB 4M5YH 4R0LA 5CEZD 5DLML 3VXUA 3U0WH 2DB8A 3GIZH 1MFEL 1AGCA 3OKMA 3KR3H 1KIPB 4HMDA 5DSCA 3DV6A 4PRAA 1RQ5A 2BMKA 4DZ8B 1FHGA 1V5JA 5ANMA 4K3GA 3LOWA 3LKOA 2DQTH 3V6ZB 1CFSA 3IDIB 3BRDA 1NAKL 4A6YL 5KVDL 3VFRA 1FDLH 5BRZE 1R0AH 1CG9B 1NCUA 4Y19B 1D5BA 1IGIH 3VXQB 1G6RB 1NJ9B 1JNNH 1ODAA 3LSOA 1SBSL 2X1PA 3NACH 5DF0A 5GJTH 5E2WL 1SVZA 1JGVL 1KELL 1UYWL 3KWWB 2VB5A 4RBPH 1AO7A 1T2JA 3P0VH 4WO4C 5FOBB 1MJUH 4X99B 2DN7A 4QRPE 3FB7B 1J0YA 2QEJA 5I2IB 4O2FA 1JHKL 2ENSA 3M8OH 1W72L 1VFBB 2EEDA 4XAWH 4Z7UB 3FB6B 1N5YH 4ODUB 1UM6L 3V5KA 2NY3B 2XKUA 3ETBF 3NA9L 3L3IA 4YPGB 2ZOLB 2NNAB 1CFVL 1EERB 1TQCC 5HI3D 3QH3B 4KI5D 4NQEA 5F7WC 2FJFB 2Q8AH 2BZDA 4QXUL 2HT2C 2COQA 3AM8C 4YE4H 5A2JH 1EGJL 3C9NB 3TN0B 2FCBA 4L4TE 2HT3D 3H42L 4R8WH 1AQKH 1R6VA 3MOQA 4J4PA 3L7FB 3QDJD 1UB6B 4ZOEA 3HNSL 4PJCA 1ZLUH 2CUMA 4ELMB 2RJMA 3V52L 3OGCA 5J6GA 3PP4H 5DVNA 2YMXH 4UIKH 3QRGL 1Q9OB 3CK0H 5FGCB 3IDJA 1WFOA 2OL3B 3VXTB 4PJFB 5F9WC 3ULUH 5JOFB 5SX5H 2CGRH 5AYUL 2Y23A 5F70A 5EOCH 4J3WA 1OF2B 1QA9B 3H0TB 3QXAB 1IGJA 3VU2A 1CTOA 5KVGH 3S96B 1M05A 4QHUB 2X41A 3QEUA 1LO5A 2YUZA 3LKSB 5I74C 3TN0C 2E7BA 1KGCD 4KJYA 3ULVC 4U49A 1YY9D 4ZUSA 4NZRL 3HE7D 1TVDA 3ORJA 2UV3A 3PWUB 5DXWA 3HG1B 4OCSH 3RWCA 4TVPD 2CJUL 4BUHA 3VWJB 5JORA 3FFCE 4D0CA 3QG7L 4OCYH 5IMOA 1TJHH 5F96H 2DLTA 1NGZA 1YYML 5T5FL 3JWOL 1DUZB 1ERNA 3K4ZA 3MV9D 2C5DC 1P7HL 1YMMB 4XBEL 1FPTL 3GMMA 1KTDB 4XVTL 5GRJH 4DGIL 5INDB 1NDGA 1MIEL 3OPZL 2H6PA 3F7YA 4DTGH 1KPRB 1TIUA 5ADPL 3VXMA 5B3NA 1FVCA 4XPGH 2UZYB 2R1WB 1FIEA 1MRFH 3TO4C 1AGDB 3H9SD 2ZPKH 1YMMD 5FUCE 3ARWA 2EDTA 3REVA 3RWDB 4FP8H 1HXYB 1KCUH 4Z7UE 3TPUA 1UXSB 2CIKA 2UYLA 3WLBA 1CTNA 3TA3A 1JYNA 3DRQA 4Y5VA 3MUJA 1S7WB 5F7EL 4G8EA 5DK0B 4DZBA 1IT9L 2X4SB 1LHZA 1K4DB 3GI8L 4KGLA 1C5BH 3VFVA 3RVVD 4XCNB 3ROLB 3MRMB 2C1PA 1RMFH 1OWWA 1GAFL 5CEYB 2AEQH 3GMNA 3FRPA 2V5RA 3TEUA 1FNSL 1NAMA 1EK3A 4ZD3H 3D9AL 3EO9H 3TBWB 5ACZB 1TETL 2V2TB 5D96B 4YHMH 1DVFC 3ALXA 4Z78A 3TYGH 3CMOL 5D7JC 2FGWL 1MELA 5KN5B 4EXKA 3HHRB 1BJ1H 1F90L 3IKCB 1ZLUK 3QHZH 2A0LD 3ULVF 5IIEA 2AK1L 4PJAA 5HI4D 3PV7A 2A77L 1C5CL 4PJDF 4N8VG 2FJHB 2RB8A 1QQDA 1XF5A 4P46B 4P2OB 5I75C 5DMYA 1DE4A 4GLRH 5E6IA 3L3IB 3Q5YA 5F9WB 5CINH 4M43L 2P8LB 4NSKA 1LDPH 1JWUB 2VC2L 4H88H 5D7KE 2BFVH 5CD5C 4UDTA 3G5XB 3K0WA 3ZL4H 4WU5A 3LSOB 1JRHH 1LO2H 4QLRA 1NBQA 3E0GA 4M6NL 5D1XA 4RNRB 1EDQA 4MDJA 5C3TA 5L88H 4ODUA 5EU5A 4UV4H 3E2HC 2D03H 1ES0B 1CLZH 1IEAA 3SKOB 2MTPA 2L0DA 2ITCB 3NFNA 3UMTA 3GMQB 5C0IB 1G0XA 3BOVA 3U6RB 5GGRB 1BVLA 3T4YA 1ZHBA 4RCAA 4WFEE 2RFXB 2VLKB 3W39B 5F44A 5E99H 2DQUL 2V7NB 3V6ZA 4M6MH 1OOAA 5DJ8A 4JG0L 1X4XA 4MCYB 2SEBA 1KIPA 2FO4B 4L8SB 1AGCB 3KS0H 1QRND 3O6KL 3H3KA 3TT1H 3ZO0A 1LVEA 4WO4B 2ORBH 4DGYL 5CFHA 3DX6B 5CSZB 4KKLC 5TF1H 4CN6A 4WU5B 2UUDK 3KXFE 2WWKT 1VADB 5CMAB 2IPTH 1M6OB 5HVHC 3TCLA 4FS0A 2X5PA 1ULVA 5ITFA 4PY8I 5GSVB 3BP7B 3F6IA 2W1NA 1E27A 4WJ5B 3VWJD 1F4WH 2X4TB 2BJMH 5EC1B 5GGUA 3OR7B 3L7EB 4QY8A 1CLOH 1BOGA 1S7TB 3I02A 3OZ9H 4QXTA 3O9WA 4X6FB 5GGVL 3QUZA 5T3XL 3BN9D 3DMMD 2Z8WC 4OLEA 4RWHA 2WANA 4KROD 1INEH 5H2BB 5I15H 1WFNA 2P24B 4LFHD 4GKSA 2O5ZH 4U6VH 2R4SH 2EE6A 4IRJD 4X6CF 2BCKA 1TCRA 4OGXH 2NX5E 4RAUA 1QSEA 3QUZD 4P5TD 4PJFF 1H15B 2DL2A 1SM3L 2DWEB 2X4RA 2EH7L 4RZCB 4ODHH 1JFQL 4NKDB 5DJZA 5JXED 4AEIH 3QQNA 1HQRA 3MRJA 1X5IA 2JB5H 3ZDXE 5FO9B 3FQNA 3HMWH 3KNBB 3RNKB 3TJHC 4LSSL 4G42B 4BFGA 1CN4A 3BZDA 4G6MH 4MAUL 4JR9L 5D7SL 4GG8B 2E9IA 5T1KA 5IQ7H 4FQ2L 4Y4KD 1FFOB 1J0HA 1TFHA 1KUMA 1N6UA 4MQXD 4PRPA 2IADB 4G8GA 1EFQA 3UO1L 2R39A 2VZ3A 1U58A 2XA8L 3IJHB 5E4EC 4U1NA 1BBDL 2FHBA 1EZVY 1T83C 4LBEA 2VLKD 4PG2A 3TIEA 1VEOA 4D0DB 1FBIL 1WWBX 4WIQA 4PJAB 5KTEH 4ZS7H 1T0NB 1L6ZA 1R24B 4QF1A 3LPFA 1MCIA 4JEGB 2APBA 5A3IC 2DM2A 4HUVB 5ADPH 3L6FA 1U36A 1QYGL 4Z7OF 1NGXB 1HOCA 1F2QA 5GRZA 5HI5D 2ZUVA 3VMOA 3LZFL 1HK6A 1UT9A 4PJEE 4R90H 2HMID 1IL1A 3BPOB 1R3IL 5KSBE 1BVKA 1VSCA 1G6VK 5CILH 4OLYL 3MLYL 5E4IA 3VGEA 1JK8B 1VGKB 5FXCH 1CCZA 2VLRA 1NUDA 2VH5H 3NPSB 5AZ2H 3UTTB 5T1LD 4J23A 6FABH 4W6YB 2GW5A 3NBNA 1MJJA 4F9LC 2R15A 3OXRA 1CI5A 3QPQD 2W92A 5K9QG 3MCLL 2HH0L 4I9WE 3QPXH 3LN4B 4XCYB 1A3QA 1YEKL 3DRQB 3MV7E 5E00A 4BFIB 1R3KA 4HXBL 5KS9B 4P57A 1GH7A 4I5BB 5I6XB 2Q7NA 3JWDC 5IJVB 2ADIA 4NUGH 3WKMH 3MLTB 3ARDD 4EI5D 3V0AC 4JFQB 4Y16A 4XVJH 2G75A 4LPUA 4YHLL 1F8TH 5I30H 1QHOA 4ZUTA 2YPLA 3BZ4B 3RZCB 4KK5D 1MQKL 3FOMB 3AMLA 4XP6L 3LEXA 4L3ED 4PTTB 4YFLF 1F90H 4HWBA 4NFBA 4LDEB 3HC4H 1AFVL 4QWWC 2JJVA 2P47B 2P44B 3NCCB 4HUUA 4Y5YB 4LL9A 3QUXD 2OP4L 3B5TA 5DO2D 1HYSD 3L3GA 2FJGA 4MMZC 4ZDHB 1RI8A 2XQYK 4E41D 2PO6D 5E70A 1J0KA 1I9RL 5C0DB 2J8HA 5DJ8B 1B0GB 3Q1SL 2FX9L 2R4RH 2XWJA 4HGKC 3NOIA 4OZIA 3RVTD 5GRXG 1J1XH 4LKCA 2DI9A 2ZSWA 5F1IB 3RVWD 5FF6B 4G6AD 4ALAH 1UXWB 2YUVA 1M4KA 5BS0B 1LO5B 5D93C 1NBYA 1IEAB 2A9NL 1CFQA 2EIZA 1U3HA 4HEPG 2I60L 3V6BR 2FB4H 1NKRA 4NZDA 5L88L 3MLXH 3IDGA 1E4XH 2C7UB 5IBLD 1RAMA 1Q1JH 1CLZL 5I76A 2AV1A 5TDPB 4PTUB 1KJ2A 5BO1L 5IB4A 4NZTL 2LABA 5J9PB 3RWIB 4AIOA 3GJEB 2CRMA 5GGRY 4PRDA 2MQ3A 1CBVH 4CW1A 4FQQB 1ORSA 4O00A 2FJGB 3BKJL 4KDWA 4MNGB 4NNXA 4UMGA 1KSRA 5IMLA 1CDCA 2CLZB 4P5KA 4Q6YA 2Z91A 4X4MA 4XWOD 3M1BB 5GJSH 1T20A 5TGBA 3RPIA 2B2XL 3GBMH 3QJFB 4WWID 1HDMB 3QA3B 1UCBH 4FZ8L 5F1NA 1BGXL 5FYJH 3SDDC 4U1JB 3QNZA 1Q72H 1QLRB 1KB5B 2P5ED 4XC3H 5SWZB 5IVOA 3EOTH 3T0BA 4BQBA 4I5BA 2FSEA 1JF6A 2WM0A 5EUOA 1X5ZA 4XP4L 4XI5D 4L5FH 4NQCB 4QEGA 3WNNA 3DMMA 5BQ7B 1I4FA 3MLTA 1CICA 3VD9A 4O9HH 4P5MB 5CP3A 3FQRA 1RIVH 1N59B 3IB4A 5I2IA 3BKML 1ZMYA 3C6LB 4LVOC 1I9JL 5GISL 4B0MM 2AI0L 5H94A 5B39B 3GMLB 4LPXA 4EI6B 1Q9KB 4RFOH 3GJEA 4RWYL 3S7GA 1BJ1J 4QRUB 3OZ9L 2V17H 5GGVH 4U1HA 4JRYD 3L3JB 1LP9B 1XGTA 4IDJH 3L5XL 3MRGA 4MX7B 4ONHB 5D5MF 3TBYA 3LIZH 1WIOA 1NEUA 2PR4L 1HOCB 2R4SL 5C0CD 3LRSA 4ZXBB 1X5FA 5HD8C 3WO3B 1K6QH 1UZ8A 1YEDA 4PJBA 1HCFX 3BH8B 4JVPA 5GS1B 5IV2B 2D3VA 2X4UB 4LSVH 3LEVL 4PJHE 2VKXA 4JRYB 5KSBF 4F8TA 2WBJB 5DQDL 2X4PB 3PHQA 4P2RE 1CGTA 4FXKB 3WUWB 4CMMB 5B38B 1YYLH 3QUYD 2OJEB 3NTCL 3PGFH 1B0GA 4ENED 3VD4A 3O8XA 4J4PD 5JO5B 2FECL 3TBTB 1G7IB 1JN6B 3S5LA 3HZKB 3D48R 5DJAB 1PX4A 3VXRA 5JQ6H 1DLFH 4G9DB 2OQJB 3QWOB 43C9B 4R97C 4WY7L 5A2KH 2D4FA 1DUYA 3STBA 3GSRB 1A64A 4UQ2B 2XA8H 4FFYL 4Y4FB 2KUTA 4EDXB 1IC7L 4HIEA 3D0VA 2OYPA 4LBEB 1JUFA 4KXZH 1TQBB 5IVXF 3A67L 4U3CA 4GG8A 3AREB 1TNMA 3V79C 3MV8D 3QEGL 2GJ6B 5C0BE 5IEKA 3GHEL 1DP0A 4HHAB 1FE8H 4GKOA 3TV3L 3S35L 5HD8D 3EO0A 2EDBA 5C6PB 5HGBA 3BKYL 3MRNA 2GSIB 4OB5L 3LZFH 1N26A 3QDME 3GBNL 4E42B 3FTGB 5EU3B 1M71A 4RGOH 4BQ8A 1KFAH 1XT5A 5EZJB 3BQUD 4D9LL 2VDPL 4Q6IA 3ZTNL 2DD8H 3VFNB 5GIRA 5IROA 1EHNA 3EYSL 4CMHB 1OLZA 3BEVB 2BVEA 3QNYB 4PG9B 1MFDH 1U93B 5CBAB 3AFLA 4U2ZA 3KS0J 1FSKB 5JZ7D 1U8IA 4PRNA 1VGEL 2HKHH 1ZHNA 3GUTB 4JFDA 2YS4A 1FV1B 2MKLC 1PKQB 2B1AH 3HUJE 4KTEL 4DQOH 4M8QB 5FHBL 4HXBH 2QADC 1EBAA 1AR1D 3FOLB 4XWGL 4GMSL 4JFEB 5C0FA 3WJJC 5F89B 4Q7DA 3IFPB 4NBZB 4MJ5B 4HC1L 2MFNA 1JPFB 4NWUL 5IT2L 3L7EA 4XVJL 4KVCL 2O61B 1A6WH 1KLGB 4L8DB 5J1AB 3DVNB 1CR9H 3KXFA 4PJXF 3PL6C 3V4UH 3BN9C 3VDBA 1XF2B 2WLYA 5HVGB 4P3DA 5EFIA 3MR9A 5IJKC 1U8JB 4XGZA 4QCIB 3MV8A 1P7KA 4I0PD 3SGJA 3O2VL 1LILA 2BSSA 3O0RL 2HWZH 3VI4E 1OSPH 4NRXA 2IQ9L 2BCKB 3REWA 3ROOA 1U91B 4M4RA 35C8L 3NAAL 3Q3GA 5E0QA 2Z93B 1OTTD 1WC7A 1VACB 2VLJA 3D0LA 3H8NA 4HPOH 4QTIL 1PY4A 3PHSA 2VITA 3PWPD 3MGOA 4N0RA 4L3EE 1T6VN 4OBRA 4X7FC 2P8LA 3B3IB 4JRYE 5MEQB 1H15A 2Q86A 2ATKB 3G5VB 4JFFB 4LQ1A 4Y1AE 4OZ4A 1P7QD 3DVNA 1UM4L 4OLUH 4XB8A 3MBED 5HHOE 5TPWL 5F6HI 3SKOA 1KCVL 2ZNXA 4P3DB 5EFIB 3A6CL 1FYHB 1JWSB 4GH7B 1SYVA 1UQSA 2AV7A 5BO1H 4HIJA 2VUOA 3GJFB 4R4FL 2CXGA 4OF8A 5D8JH 3V6FB 1CLYL 4JKPH 1SEBB 2ZCHL 3UTSA 1EJOL 3SDYH 2SEBB 5CJQH 1ZA6B 5ENWA 1FYTD 1U8KB 5CD3A 4K94H 4WW1A 2V9RA 5DMGD 2XT1B 1QQDB 3UZEA 1KIRB 3Q2CA 5JW4N 1AH1A 3BO8B 2BERA 3RY4A 1QFWH 1NMBL 3SKJH 3HMXA 4FG6C 3HE6A 2BHYA 3D18B 3RWIA 4PG9A 2ZCLL 1RUMH 1FYTA 2IPKA 3VFNA 2DIAA 4NN5B 4ZAKC 5CEYA 2P5WE 3MRLB 1MHEB 5C08B 4J3VA 3KLDA 4WUUD 4NRZA 2CUHA 4WW2A 5KSAA 2X1QA 2AJYL 4R2GC 1FSKC 3OKKB 4R4NC 1CYGA 2NY7H 3OJDA 3ARBB 2BXYA 3MBEC 5TH2A 2N4IA 1RZGB 1S7WA 4HK3J 1BVLB 3WIFB 4LP5A 1DBBL 2XZQL 1KN2H 2IBGA 3KPSE 3H9YA 2KQMA 1XR9A 1Y0LB 1QFUL 2AGJH 4KRPB 3BKCL 4NDMB 4ZSOE 1DANT 3QFJE 1W8NA 1F42A 3BP5A 3T0WA 3X3GH 5E8DL 5BRZD 3MNVB 2PXYB 3PDDA 4AIZA 1RIHL 4S0TD 3ZHDA 3RBSA 4F37F 3LKQA 2FZ3A 2KZWA 1JZ6A 3HAEB 4FXKA 2QQNH 3HKFA 4G5ZH 2J6EH 1GPOL 2BVYA 3NGBC 3ZDZF 3ZDYE 3GK8L 1YYLL 5C86A 2H26B 2Z31A 5BRZA 3FN0L 1X4YA 1T03H 2G75B 3CFJA 4G9DA 1HEZA 5MHSE 4A6YH 2D0GA 3G5ZA 3BW9A 2CO7B 2F8XC 3QB7C 2GSGB 4M93C 3UTPE 4L3EB 4EVNA 3SHSA 1A6PA 3QUYB 3NACL 5GJTL 5I16A 4BZ2L 3IF1A 2R56H 1RJLB 3MRKB 1KELH 3PHQB 3PWJA 2IQAB 1OVZA 3MA9L 1FH5L 3QULA 4G8EB 3X17A 4C56E 2Y4SA 4JPWL 3OJDB 4U1LB 5K9JH 1FNEB 1EHLL 4OFKA 3V95A 3LKSA 3VXUD 3DURB 4YDKH 2EE2A 3STLA 4XAWL 1HH6A 5IVNA 5I8OL 4KZEL 4NKOB 1NDMB 4Z76A 2WIIB 1IEHA 2ED8A 5C0ND 3K8LA 1K8DB 3UZVB 1HINL 3T3PF 5LGHH 3O6FC 4OFDA 5GS1C 4KRPC 2YZ1A 3ZDYF 4FQXB 2O5YL 5E94A 1U3HC 4WW1B 1QFOA 3R8BB 3ARBC 4N5ED 2BNRE 2Q76B 1HXYA 3CU1A 4JKKA 4CU8A 3EYSH 1CD1B 3PXJA 3TBTA 3WDHA 1MFDL 4LCUB 5I0ZA 4K71B 4QGTA 3VXSE 4E0RB 4ODWA 1ZGLB 5C09B 3BSZL 1JWSA 1PDKA 4L9LA 2B1AL 4FFWC 4YQXL 1OCWH 1CXIA 3MV9E 4TVSa 4B7IA 1OP9A 1TZGH 3MUGB 3FFCD 4O51B 2XFXB 3MRCB 3S96A 5TH2B 3BIAX 4OFIA 3QG6B 2UWEA 1ZWIB 1YECL 4PJBE 3SO5A 3JUZA 5ESVA 4N8VA 4H26B 4HGWA 1JHTA 1TJHL 4LARL 3JWOH 4I2XE 4FXGB 1S5IH 5DRXB 2JK5A 2KKQA 1AQDB 1U8KA 5HHOB 3DV6B 1DL7L 2VKWA 1ZT7A 3QR2A 1MF2L 5D1ZD 2DYPB 1HZHH 5HHMB 2X7LA 3MV7A 1FDLL 3K80A 1OHQA 1AGBB 5GZNC 1I75A 2WUCL 4KZDL 4HF5H 3WMSA 2F19L 2EDOA 3WFDL 2BRRL 1Q94B 1D6EB 1IGTB 4LHJB 4NP4H 2NY0D 5C7XH 2H32A 4NJAL 4HWNA 3AS2A 1S9WB 1BOGB 4HWEL 4LGSB 4P48A 3T8XB 4Z7VA 2YRLA 4X8JA 5JR1L 4PR5A 4WI6A 2Z8VC 4FXLA 4LRIA 5DS8A 1XF4A 4PJIF 1QO3A 1JHKH 1RUKH 4PGJA 1KOAA 3WHE1 1AD9A 2APFA 1A4JA 1M7DB 5D2NC 2AJZB 2VJXA 1IKNA 2BVTA 5J9PA 2EIDA 1C5BL 1B90A 2GT9A 1EO8H 1XCQB 4ZUWB 4D8PB 1UQSB 1YY8A 3HRZB 1WT5A 3C60D 1MAML 4LSUL 4HUNB 2QSCH 1WC7B 4BH8B 4R7NB 4PLKC 4DZ8A 4MJIA 1OAZL 1LE9A 4TVPH 2GIYA 2AXGB 3B2VL 2EXYC 3OJVC 3SCMA 2XNAB 4I48A 4I3RL 3W39A 3SKJL 1U6AH 4PJ7B 1MWAB 2DWDA 5EC2B 5I16B 2X70A 4OCWL 3GHBH 1J88A 5DURD 2N1KA 1G9EA 2VL4A 3VG9B 4JM2C 4MD5A 5JIPA 3BW9B 1JHLH 1CE6B 3CFCH 4KHTH 5DJCA 3OAZK 3KPMA 5C9JB 2VIRA 1NMAH 9CGTA 1U8LA 1GYAA 1N5AA 3IU4L 1B0RA 1T0MA 5CWSA 3KPPB 3V5DA 3MCKB 2MHAB 4NZRH 3DSNA 3S88L 3STZB 5DK2A 1RZJH 3NPSC 5KZCD 1MJ7L 1J05B 3IFOB 2YSSB 2XZQH 4XNXL 3TH2T 1G9NL 3MOBL 1EFXD 5HPOA 3QNYA 4AH2A 1SJVA 1A7RH 1DQML 1DVFA 1WBYA 2D03L 1DBKH 5IJVA 1G7MA 4OFVA 5C09E 2IADA 4G8GB 1QBML 3PGCB 1BF8A 1UJ3A 3DOSA 4LNVA 5ISZE 3L5IA 1ZGLP 2IBBA 3AU1A 2DQJL 3AREC 3B8YA 1YDPB 2J6EL 1MSPA 4K3JH 4MNGE 3SCMB 4HSQA 2XI9A 1AD0B 2VABA 1DFBL 4JG0H 4HDIB 5GRYA 3NPZB 2DTSA 1M71B 1CDHA 2XIDA 1MHEA 2B20A 1KBGL 4UINH 4NNPL 1R3HA 3G08B 3C6LD 4GKSB 5E2VL 4GG6E 3DBXB 1KCUL 2HVKA 3QDJE 3BD4A 3Q6GL 5GHWH 2VDNL 4PG2C 3VGAC 3UC0L 5KVEL 1OGAA 3MRJB 2ZUXA 3AC0A 4PBVC 3EAKA 1HSAB 2A73B 4P3CH 4GRLB 5F7MC 4WEMB 4JFZH 3NFPA 3OSKA 3S98A 5T3ZL 5SV4A 5LAXB 1YPZE 1SEQH 1BREA 3QWQB 1EHLH 3SDAA 1D5MA 3BVNB 3QIWD 5DS8B 4MJIB 1U8NB 2BJML 2EEBA 4TTGA 2RAMA 3L9RA 1P9MA 1NANI 2X4TA 5DJ0B 3TVMA 4WJ5A 4DUVA 5DEFB 2G5RA 2GT9B 2DQHH 1FVEA 3CCHB 5C07B 3RJQB 5GGSB 3TCXA 3VGBA 3VRLE 2LVCA 2O5YH 1KN4L 1C16A 2R0WH 5BZWB 4Y4HC 5DURB 1JN6A 1DBJH 3ZHLA 4O2CB 3OAYK 4OGXL 1EEUA 2AJVH 5HHOA 1BD2A 1YY9C 1R5IB 5I8KH 2IANB 3OL2A 5AWNL 2VDLL 1C5CH 1DLHA 4PGZA 3T8XA 4OD1L 4D0BA 5DRNA 2QHRH 3G6DL 3NCJH 2G9HB 3C6LC 1FAIL 1F4AA 3KNBA 3VFPB 5MI0C 4OD3H 4P5TC 1D6EA 3RIAK 1RZ7H 2P5WA 3NABH 1CE6A 5DJCB 2HT3C 5HDQL 3FN9A 5DD1H 4KH2A 5EOQH 1A3LH 4HPYL 1Q9KA 3G04A 4M6AA 3TBYB 3UROR 5TE4L 1T21B 5TJWK 4NO0B 3G5XA 3O9WC 4PJBB 2H2PD 3DX8B 3HE6C 2X4NA 4IRJA 1M7DA 2W0LA 2BY0A 4LDLB 3VFSB 5IGXH 4QRRD 1HHJA 1RUAL 3FQWB 4KQ4L 4ZUWA 2J4WL 2CR3A 2Y9RT 4R96B 2FDBP 1ND0B 1JZ8A 1ZTXL 2W65A 4Q2ZA 3QG6A 3QAZB 3CDGB 3TO2B 1BFOA 1LWRA 2Z8RA 2C4FT 1SJXA 1QPPA 2BSRB 4BFBD 1JZ5A 2YWZA 5IIEB 5SWZA 2G60L 4HS8L 3FB5B 2EIBA 4UOW0 1CF8L 1P69B 2ZUUA 3TF7C 4WHTB 2I26N 2AJXL 5DRWA 2XQBL 3HE7A 3WFCH 5IHBA 3RVXC 5TE6L 1JF5A 1A9EA 4H25B 5BVPH 4P5KB 3QNZB 5TF1L 1T5WA 3QBTB 3BGMB 1AGBA 1V3LA 3MQIA 2IAMC 2MWCA 4Y2DC 3GDBA 5F7DB 4KAQL 4K3DL 3FB8A 3MRMA 1QNZL 2M1KA 3TC9A 3WEXA 1F6LL 2IJ0C 5LGKA 5DK0A 1ZHKB 2F53D 1WIPA 1ZLSH 2C7UA 4IRJB 3V6OA 3P9MA 1VFOA 5CHNA 2GJZA 1HE7A 2C1PB 4C56D 1DJSA 2GHWB 4HHAA 3QQ4B 3QUYA 1ZWIA 4NUGL 1INDH 2VXQH 1I1AA 1IKNC 2DTMH 3V4VH 3BQUC 3UJJH 4HX1B 4XC1L 3D25A 1OW0C 4GAFB 3IJYA 3MLUL 5A43C 2AEIT 5EBWB 1UH2A 1WAAF 2CIKB 2FBOJ 1H3PL 1CVRA 4PTTA 2EDDA 3NA4A 4D0BB 3S8WA 1L0YA 4PLJC 2PN5A 4OCWH 1AGDA 2IWGA 5IHUL 2H45A 1GGUA 3RVXD 3ZKMC 2GFBA 4DUWA 4IRZL 4TSCH 3TPUB 4WCYL 3QFDA 4I13B 5DJAA 5F7UA 4NQSA 4XH2A 3KLSA 2P46B 5EA0H 1AXIB 3QRFM 2Y36L 4QOKB 5HYJE 1A1MA 2MKWA 5IBUB 1BZQK 3RL2B 2NLJB 3RWJA 1KPUA 3WIFA 4QRQB 3W2DH 5I1JL 4GW4B 3KPSD 3ZZ1A 1F02I 5BVJB 1MJ7H 2CDEB 1JBJA 3LEYL 3SJVE 1G9NH 3ISWA 5C0BB 4H8WL 3TLRA 4Z0XB 2ESVA 3QDGE 2VL5B 3U46A 2I60H 1EGJA 2ZKHL 3RPKA 4DJMA 4FQJL 4PUBH 4MYWB 4X83A 4LFHG 4NZTH 4LSDA 4OLXL 4GSDL 1U95B 5L2KE 3RNKA 1MCNA 5CJOL 3MJ8A 5HI3C 2ESVD 4JKWA 4AT6B 4QTHB 5E2UL 3L6FB 3EZ8A 5I1GH 5FUZH 5BXFB 3QQ3A 4JO3H 1NFDF 3DPBA 3MRQA 3PJSA 3BZEB 5IR1B 1XIWD 1PY9A 2OI9C 2R8SL 2ICCA 2EDJA 1R3IH 1NCDH 3VWJC 2DQEL 2OL3A 5IHZB 2AP2A 4J1UA 5CILL 3BN3B 4W4NA 1INQB 4AL8H 5D1QB 3FMGL 5HBBA 1A47A 1Q8MA 2P5EE 4LCWE 4MCZA 5KVEH 2EH8L 3RA7H 3SDCA 5IB5A 1CD9B 3I75A 3LRGA 3MX0A 1A4KB 2XN9E 3L1OH 3KGRA 5C2UB 3PWLA 4LPYA 4ZO7A 1U58B 3FT4B 3SKMB 4LEOB 3P0YH 2NY1C 1XGPA 4OM1H 1MLCB 2JCCA 1A6AA 3E6FA 3VE0A 4JFFA 1IEBA 3TO2A 4EN3C 1MCQA 1I3RB 4QYOA 3V5KB 4MD0A 2FIKB 5MENE 3DWTA 1WQVT 1MCPL 1F6AA 3QO1A 3U79A 3IJYB 3QNXA 3K4DA 4WI2A 4HIJB 1JJUA 1U8HB 3K3QA 5L8LB 1NFIB 3KJ4C 2WIMA 1TTGA 2PR4H 4I2XA 4WO4A 2VZOA 5E6ID 5I19H 3OV6A 3I3BA 3ARDA 2NW3B 2FD6L 3U0PA 5F3BB 1EEYA 5KVFL 4IHOB 4Y0GA 5FUCC 2RQ8A 2BNRA 2E7HA 2HTKD 1MQ8A 5IFJA 4LSQH 2V7NA 4PJ5B 4OD1H 3MRRA 4QHKI 3VXSD 1FAIH 4F7PB 2NYYC 1TVBA 1HYRC 4L9DA 4NUJB 1RZ7L 4AEHH 4GMTL 2G9HA 2CR6A 4X6FA 4KRLB 2FATH 2BNRD 3WN5B 1QG3A 2W9DL 3ME0A 3RGVD 4H1LB 5KW9L 5EC1A 3BMWA 3RTQB 3HUJB 5E9DD 4ACPA 3NH7H 2B7DT 4XAKE 4YNYA 4F58H 3RRQA 2A9NH 3O9WB 1S7TA 2Q7YB 5ITFB 1A6VL 3MLXL 3UPRA 2Q3AA 3C5JA 5LBSH 1Z0MA 4CN4A 1ZA6A 5ENWB 2B1HL 5DFTA 2P1YA 1E28B 3A67H 1HWHB 3F7VA 1BFOB 2GQHA 3CDGA 4MNHB 1A1OB 1J7VR 2X4QB 4NQEE 5T3ZD 4OZIE 4Z7WB 2W9EH 3H9HA 4R96A 4JQIL 3TH4T 1BX2A 4KJQC 4YHZL 5GJSL 2NY3D 4NUJA 1ZSDA 3LQAC 1AGEA 2FEDC 3BKYH 1RIUL 1I3UA 1S78C 3N50A 3ARED 1YQVL 4Q9RH 1FZJA 2HTKC 1VACA 1RZFH 2VLJB 1QEWA 3D0LB 4L8SA 1M6OA 4JPVH 4G8GD 4KUZH 3MJGX 2GEEA 4RFEA 4C56A 1NUFA 3QCVH 1N3NA 4LSPL 4V2CB 1RY7B 2HTLD 2JB6A 1L0XA 2Z0BA 2FH6A 4XNZC 3AS1A 1OTSD 4LHUG 1E4WH 3MCG1 5GISH 2QKIB 4UDTB 2E6QA 2D7MA 5FM4A 1FVDA 1MPAL 3LV3A 3P4NB 3TBSB 4LNRB 5ID1A 3U1SH 1S8DA 2Y6SD 3EYVB 3FZUC 4DKDC 1A6UL 4Q0XH 2ITCA 1JYWA 4J2XA 1OQOA 3MO1B 2ZOKA 1JPFA 4HG4K 3KPTA 1DVFB 2H2PC 3CSYB 1HXMB 4CDGC 4P2QA 4GS7C 2NYYD 4X6BB 1RK0A 1XGRB 3LKRB 3SPVB 4LSVL 3T0AA 5AG9A 5FM8A 2BK8A 2E7CA 4PS4H 4XT1C 5D7JD 5D1QD 1F58L 1GGBL 1OGAD 2QQLH 1HH9A 2J5LB 3ECBA 4UT7H 1GOFA 1OW0A 5DK3A 3K2UL 3MREB 4ZO8A 5BOZG 3MLVH 3HS0B 4XMLL 5IHZA 5JNYB 3FT3A 2D31B 3BHBB 3R0MA 5T1KB 2ICEB 1FZKA 1F3RB 4X5XB 1QR1A 3T3PE 1YNKH 3Q5OA 1FCGA 5KVDH 4E41E 3BAEH 2C3XA 4CN1A 4PJ8B 3I75B 4HCRL 5DJZB 4YBLB 2E9WA 2YD6A 1IAOA 3WJLC 1S7XA 1TZIA 3MRBB 3GSVB 4LOUD 4ZOBA 4MB5A 4UOJA 2B0SH 3FQTB 3RL1B 5DRZB 4RIRA 4TULH 1UM4H 3DURA 4LGRB 3PHOA 3DIFB 4NKQB 4I1NB 1KIQA 4C4KO 5KG9A 3B9KB 3QEGH 4PJBF 5FOJA 2AJ3A 1LE5A 1KLUB 4I9WD 5F21B 5GSRB 2FLRT 2VLJD 1FIGL 4FTVD 3IFNH 1PEZA 1LD9A 5SV3A 3JTSA 3IU3A 3MRPA 5FHAL 4W6WB 3CZFB 1D7FA 5DMIL 5DEZA 4HLJA 1NCDL 5IUSA 4MA7H 2OXGA 3D85A 4L4VB 4OQTH 1X7QB 3QFJB 5ILTL 5I1EL 4G6JL 2VDPH 4NQDB 1T1YA 2WSKA 1EV2E 3PP4L 4G8FB 4HV8B 2OSLA 5MENB 2JJWA 4D2NA 1CXKA 1MRCH 4L8CB 3EDKA 2BVPB 3UJTH 5AZEH 2H32H 5FDWB 1IGYB 4Q9QL 1YQ2A 1DQJB 2X6MA 2GTZB 3WFHA 4RRPA 3UTTD 1KCRH 1B4JH 4J3SA 3U7YH 5F6HJ 4K07A 4I0PB 3FQXA 2NY1B 5SWQB 1OP3H 5HHQB 4PP1D 1KIUA 2DQDL 1MCPH 1I8IB 3WO4C 3MRHA 4XHJD 2KQNA 2D9QB 3HG1A 4Z6AT 2AV1B 1S3KL 3GM0A 1J1PH 1OSZB 2F53B 4KKCD 3IDXH 1TQCB 1I1RA 4AEEA 4NQUA 4MXVE 4XMKH 4K8RH 4P9MH 3A0OA 1LP9A 1MVUA 1XGTB 3KJ6H 4X0KA 1OAYH 5F1OB 2VQ1A 35C8H 2NTSP 3F7PC 3EYQC 2E7LC 2X9WA 4KK9D 4PRID 4ZYKB 4DOHE 1IGJB 2O93L 5H94B 5B39A 1IFHH 2YPLB 3BZ4A 4JGUA 5BCAA 1IGFH 5EUOB 1UG9A 1MUJA 5JOFA 3LS5L 3HR6A 3RY6C 5C0DA 1D5XA 5F96L 4Q9CA 4OF3A 2VERN 3S4SG 1PQZB 3P77A 5JPNB 5KW9H 2FSEB 2ZUYA 4HH8A 3MLWH 4O2FB 3O45A 1DZBA 1DQLL 1OGTB 1S9XA 4PTUA 3WDJA 4FTVE 1YEJH 3B43A 1FH5H 5C0AD 3TNNB 4IDLA 3CX5J 3O6FA 3CSBA 1IT9H 3LVEA 4NQEB 4APQA 2QR0B 1CZ8H 1KJ2B 1YEHL 2AK4B 2A6DA 4LLUA 2AEQL 3UZQA 1AO7B 2BNQA 3GMNB 5HI4C 3S34H 2OTWB 3NIDF 1JGLH 3GSQB 3STLB 5I18H 5CEZH 4YBQD 2CQVA 4JPIB 5GRVK 3WL9B 5IBTL 3VFPA 2KBGA 4ZPTA 1RZFL 3OKMB 1F3JA 4I8DA 1IGYA 3SGEH 1U8MA 4YHYC 5E6IC 3I6KA 3BD5A 3TA3B 2EDRA 1IBGL 4ODXB 3EHBC 1FNSH 1A02N 3O2WL 4P99A 3L3GB 4ZDHA 3P30H 3EO9L 1I7TA 3PWNB 1HEZB 3S9DB 3T0ED 4P2RD 5GGVY 4GXUN 1N0XL 1PZ5B 2IALB 2O61A 1HHIB 3QUML 5ERWB 3GKWL 1ZT4A 3MLSH 4G6FD 4X7TB 3QHZL 1TZGL 4JFEA 5J8OA 4NIKB 2VISA 2BOCB 4Q0XL 5EU6E 1G7HA 1I7ZA 3BKCH 3G6JE 2X44D 2OR7A 4GG6B 3IU3B 3MRPB 4XPHL 3SDCC 5IMOB 4M9OA 4UV7L 5F1SA 5GGSA 3V5HB 2O5XH 4QRTB 4Z77A 4JE4B 4Y2DB 3HUJF 5GSRA 5DEFA 1JPSL 2R29L 5FA4A 4CADB 5D2NE 5E1AB 4F33A 4KDVA 3K2UH 5A40E 5IKCA 3LN9A 2HFEB 1QRKA 3U36B 4JFOA 4M6ML 1LEIB 3ZL4L 4PRIE 3SBWA 3RX8A 4HDIA 4Y2DD 1JPTL 1CGVA 5EU6A 4D9RD 2ADFH 3I50H 1EH9A 3O6KH 3RGVA 3GRWH 3VRIA 4YK4C 5GRUL 3TT1L 4BH7A 2YZ8A 2ORBL 3RNQB 4DGYH 1H8NA 5ICZB 3BGAA 4NP4L 2BVUA 3QHFH 1Q9OA 1ZVYA 4IOIA 3T0EC 1FO0B 4LLQA 3MTRA 2GTWA 1H5BA 3MA9H 3M45A 4JGMA 3MUZ1 2YWYA 2GUOA 1SYSB 4OGAC 2A6IA 4C59B 4O2EA 1KT2B 5CUSH 3WJLA 4YDKL 3HI5L 1RUKL 4EDXA 4ZFOA 2DM7A 2ICWJ 2W0PA 1CLOL 1WBYB 2I07B 2IBZY 2HVJA 4UQ2A 1QRNA 3AU1B 5FGSA 3WNMA 1C12B 4OIIH 4HK3N 5CWSB 5T3XH 2NNAA 3QUZB 1M7IB 2IH1B 4YPGA 3RU8L 1I1FA 5I1IH 5EBLB 3DUHA 2DM3A 3CVHH 3TWCL 1BBJB 3EFFA 3OTTA 2NY5H 4F2MB 5DVMA 1L4IA 5GGSY 1ETZA 1CGYA 4YDVB 1YPZB 3KYNB 2YUWA 2A6KB 3TCLB 3BPLC 5DJ2B 2X4RB 2GKIA 2A1WH 2C3GA 1JFQH 4Y4HB 4AEIL 1LK3L 3FAWA 1I3GL 3GHBL 2JB5L 3IETB 2EDWA 5C9JA 1YNLL 4RAVB 1PG7L 5GS0D 1JYVA 2HTLC 4R7DA 3QI9C 2AERT 4LU5L 5F7YC 4DN4L 1XZ0A 1ZVSB 3AAZB 1GC1L 2PW1B 3RWEA 2DMCA 2X1WL 5IHLB 4ODSL 4XMPL 1HNGA 5HYSB 5CZVH 5D9SA 2YEZA 3MOBH 4OIBA 1BBDH 5JXEA 5GSVA 1JNHA 4ZAKA 3VDAA 1BOYA 4G6ML 1GGIL 4MAUH 3WS3B 3JV6A 3TNNA 1A1OA 4WW2C 1EFXB 5IQ7L 4D8PA 2JJUA 2AJSH 4TTDD 5KTEL 1RJYB 2NY0B 4M1GH 1CU4H 1P7QA 1EO7A 4Y8AA 2RCSL 1MHHA 2HP4A 3BE1L 1IARB 3IKKA 2MNUA 1A3RH 2X7LB 1MFBH 4NHUB 4RBPK 3T0EE 5I1DA 2NY5C 1IGFL 4C58B 4K8RD 4LPVA 2BRRH 1KBGH 1Q9WA 4WFHE 1BQLH 2PW2A 5C7XL 1K3ZA 3CSPA 2HLFC 4LAQL 4Z7NE 2VLKA 4CRPA 5IP4A 3QQ9C 1OAXH 4N0FA 2C4FU 2PTTB 3MLWL 4M62H 1KJ3H 3BISA 1H3XA 1JGEB 2AW2A 4WWKA 1RUQH 5TF0A 4Y16C 3TBVB 2IPUK 1F00I 2ID5A 4YX2L 4KRPD 4S1QL 2EDLA 3PIQB 3ULVE 5IF0B 3ES6B 5C0GA 1YEEL 1A9BB 4J8RB 4R90L 2DBJA 4RDQG 4XBPB 2YA1A 5FDYA 2V6HA 1B6DA 2FR4A 2Z35B 1LNUB 4WTZG 2OTWA 3U4AA 4PY7B 4NM8L 3KYNA 4M1CC 1CFTA 2QSCL 3QIBC 4RX4A 1KULA 2VH5L 3DHMA 2NY2B 4I77H 4MA1C 3V0VB 1ES0A 4LASH 3VRJA 2EDYA 3RAJH 4XP6H 4YK4B 3VGFA 4PREA 4GAYB 1AIFA 4RGNC 3QUXA 5DHVA 1DANU 4WTZA 1IBGH 5DZLA 3WLWC 5I8KL 3W5MA 3IKCA 2IGFL 3RWHB 4NOFA 3RWGB 5EN2B 1CS6A 4NQTA 3CFEB 4OJFL 5TQ0L 2MCG1 2W0KA 4WENB 1JHLL 4BFEA 5MERB 4M02A 5C0NC 4O2EB 4EN3D 4ZSOB 3RJDA 2NY4C 3FJTA 3ZKXB 2R0LH 1MVFA 5I30L 3FONB 2I27N 1I8MB 4XPTH 4JY6B 1TQBC 4OT1L 3S88H 2VZ1A 4ZODA 2DKMA 1ZK9A 1P4LB 5D2NB 1IZKA 3QIUD 1IC5L 3PG2A 1R3KB 5KS9A 3VWKD 3TVMC 3DGCR 1FNEA 5DA0B 1H3WM 1KTLA 4K3EL 3IDNA 1YJDH 3B9KA 5KJRL 4H1LG 3QXVA 3BPNC 4NKOA 2EEAA 1HHGA 3QIUB 4K9EL 4V2BA 3JSSA 3UTTE 1FL5B 1GOGA 2GCYA 4DN3H 1WIUA 2BNUB 5A2FA 1P2CB 4MNQB 1U9KA 4U1KB 3B9KD 5D1XC 2G60H 1BVKB 3DO7A 2X1OA 4KJPC 4DK3A 1PAMA 2GJ6D 4UINL 4YEFA 1MRDL 5CJ5A 4LKXA 2IFFH 1P4IH 3WFCL 1FNHA 1T22B 4Z8FH 5BVPL 4RMWA 4XC3L 4L8CA 1PJ9A 1QKZH 3E8UL 2FL5A 1OAQH 3V8CA 4GW4A 1S9VB 3NVQA 4QRQA 1MWAL 1XR8B 4O02L 2X9YA 1N4XH 2DJ4A 1D9KC 4PJXB 3HG1D 3KYKH 3BKMH 1T1XB 4U7SA 4J7RA 4LF3B 4LSTH 3KPRB 2EYTB 4X99A 1NFKA 4P2QB 4RFNC 3IJHA 4RFOL 3VWKC 4OSUH 2QLVB 4G9FA 2V17L 3HNTH 5IFHL 2M26A 2OK0L 4KK8D 4UB0H 4NOBA 3J7HA 2AJUL 4NZUH 1INDL 2ITDA 4N1CA 5K59E 1QUNA 3BFOA 4K2UH 4PJIE 3WIHH 1EX0A 3DRTB 1T7YA 4WGVB 1YJDC 5GQBA 1KENH 3UTPD 1P2CA 4MNQA 3RVUC 4K3HA 4PJ9B 5IW6A 3MZGB 2BSTA 3QEUB 2F8OA 2QQKH 4MHHG 4ZNCD 5D2LB 5DJDA 4Y5VC 5IHUH 3L5XH 1WWAX 2YXMA 4KPHL 4QHUA 3IDJB 2XWTB 3HA0A 2IMMA 3IDNB 4XXCC 4ZG1A 3QP3A 1XEDA 5LGJB 3DUUB 5DTFB 1IM3A 4PRIB 4F9PC 1NCBH 4HUUB 3CVIL 5JDSA 2CK2A 3F62A 1WJ3A 5EO9A 3GIZL 4O5LL 3BRGC 4WUKH 1JPST 5C8JB 1IC7H 1MJ8H 4EJ1C 3X12B 4RMSA 1S7RB 3MJ7B 5E8OA 3MFGB 5JW4Q 2RHEA 1E4KC 1NCAL 3HZYA 4CW1B 3RY5A 1DLFL 5CJXA 5EIIB 1HKLH 4HQQH 1AR2A 1P7QB 5DMJB 1FO0L 1EHXA 2BSRA 4DVBB 1C1EH 2HT4C 1BIIA 1TMCB 3FO1A 1E6OH 3VRJB 2BC4B 5J12C 1T89A 2AJXH 5JZ7C 3ZKMD 1CFSB 4JFXB 5HYQA 5LQBL 4U6XA 5DHVH 1VENA 2DJUA 4MDIA 4FNLH 4MJ4A 1NSNL 3A6BL 2N56A 1W72H 4KTDH 2RR3A 1MHCB 5KSBB 3OKDB 3KWWA 3BYYA 2DD8L 3W5NA 3MRRB 4IM8A 1EA9C 1OAXL 4CUCA 4Y4FD 4M62L 4Z7QE 3S35H 1KG0A 4ZTOL 1XIWB 4FQIL 1B0WA 5CZXC 2ADGA 5IF0A 4YGAB 4YJZL 1EHAA 3IDIA 4GAJH 3L3KA 2VN4A 2YKLH 1S7QB 3MZTA 3SE8L 3VXNB 3ZT6A 4XRCB 3B9KC 5D1XD 5FHBH 5C0AE 3VD7A 5IEHB 3VFMB 2V7HA 3HNSH 1OP3K 1CT8A 4XBGB 2VXQL 3T0EB 2DLHA 4EEEA 3V52H 3OKLA 2DTML 3K2MC 4I18A 5B8CB 3HZYB 4GW5B 1XH3B 5JXAH 4ZAKB 1A6WL 4ZPVA 1BD2B 3CCHA 3U4BL 3VE0B 4N68A 3SN6N 1NUGA 2CGRL 3DROA 5AYUH 3QDMB 4Y16B 5LWYH 1XF5B 4P46A 1H3PH 5KVGL 3RWFA 4PJ8C 3QEQE 4XP9L 4CVZB 3PWPB 3NIDE 1MFCH 2K9UA 3IXAA 4NNYA 4HH9A 4PJDE 5EU3A 1EFXA 2DAVA 2OJZH 1DR9A 4X6CE 2HVKB 4FQ1H 3V4PL 4HC1H 2VYRE 3QUXC 3TFKD 4QHKJ 5CCKL 2VO5A 3BUYA 4J1UB 5FB8A 2G5BA 3DGGB 4Y4FC 3FTGA 4LVNC 3QG7H 4OCYL 5T5FH 1YYMH 5DLMH 4X9BA 2W9DH 3NZHL 4JPKL 3Q6FA 4YDLC 1BM3L 5EZLA 4YXLL 5CEXB 3JV4B 4PJ8A 4G6AC 8FABB 5CBEA 1H3GA 1D5ZB 2X4SA 1CGWA 3ARFD 4LCCA 3S36L 2DQFA 2H41A 2ICWI 1NAKH 4HPOL 4QTIH 1R3LB 4X7DC 2DQGL 2MCPL 4PJEA 1KC5H 4M7JL 4KWUA 1DDHA 4HKJB 1C12A 4XPAH 4NNYB 1QLEH 5K9KB 3PGCA 3UTSD 1HH9B 4JJ5A 5EO1B 3QI9B 1VPOL 3I6LE 2ZCHH 1J9CT 2C1OB 1MLBA 5ID0B 2W0FB 4XNYH 3T04D 1FJ1B 3BRFA 2F5BL 5CP7A 4Z18A 2OQJA 3FQUB 5F7EH 2EXYD 1P4IL 3FMGH 3WD5L 5DD3L 1QFWL 2YD4A 4QHNA 4K7PY 2PKDA 4TSBH 4KY1L 1XIWA 5IEHA 5J11C 2X70B 5H35A 3WUWA 1GAFH 2Q8AL 4YE4L 3OKLB 3ULUE 3MPCA 3NCFB 3KLAB 3NIGE 5B4MD 1CIUA 1PKQE 1Z5LA 5CJQL 5IVXA 4P4RA 4HMCA 4JLRA 4XP5H 3UTSE 4NCC2 3TYGL 5MEOA 4NT6A 2JCCE 2NXZB 4B50A 4MZ3A 4U0RC 4GRLD 3SO3C 5KS9F 3WIHA 5HVHB 4HKZA 3X11B 7CGTA 1NLDL 4NZUL 5D5MA 3L3JA 2QR0A 2VMFA 3CAFA 1N59A 4OZGA 5EIIA 1BP3B 5EO0B 5EOCL 5I19L 2XN9A 3VD5A 5L8KB 5E8DH 4ELKA 5M7QA 4GW1B 4POUB 3DI3B 4IOSD 2HYMA 4U1HB 4I0CC 1F58H 1GGBH 3O8XD 2BC4A 3RWFB 3K74B 4Y1AB 2E27L 1QLFA 3QA3A 1HDMA 3GO1H 3HPJA 1Z9OA 2F15A 3V9FA 1A1MB 3EOYG 3ARYA 1ZXQA 3JV0A 3ARVA 2VLME 5C92A 3IFLH 1PBYA 4LLDB 3B5GA 4D3CL 2B4CH 4PYGA 1RIHH 3QEHB 2Y07H 4PJAF 3SDCD 3C09C 1NL0L 5CAYB 4JDZA 1WZKA 3RTQA 4LCWA 4OLVL 4IEFB 3QUKB 3DUUA 4HWZA 5E5RB 3OPZH 2Y6SC 3FZUD 2CKBA 4HT1H 5HI5C 1T5XB 3QCUH 4WUKL 2R2HA 5K9JL 3LHPH 4EN3B 3DSFH 2JE8A 4LDOB 3IDUA 1JCKA 5EU4B 4HFUL 3D25B 3LD8B 4RA3A 4C55A 3BI9X 3PE9A 1AXSB 4PJ5A 3O3EA 5FYJU 5HHQA 2R2BA 1ZT7B 2DLEA 4KZEH 2ITDB 1PZUB 4OFPA 4I3SH 4FHBD 1WITA 5DJDB 5DQJB 5F9JB 3LAFA 2ARJQ 2VXUL 1X5GA 2F53A 4MDJB 5IB3A 2OL3L 5LQBH 3MUHL 4PJ9A 5IW6B 1CGSH 5C07D 4X6DA 4POZD 2IEPA 3OKEB 3GI8H 5FYJE 3FB8B 3D69B 3QEQB 1OAUL 5MHSD 5D4QA 5D96C 1PQZA 5DUPH 2FH8A 1TTFA 4ODVL 1T5WB 4X6CB 3UTQA 1C08B 2ZUTA 3FT4A 2EYSB 3SKMA 4J3OC 1EZVX 4HV8A 1UADC 4TUKL 4AY0A 3T77B 3SE8H 2CKBB 1KB5L 2VZVA 4PBWD 5HGDA 1G6RL 1ONQA 4JN1L 3CFIC 3HRPA 3MJ9L 5LGJA 3U7YL 1SM3H 3QXWA 1TPXB 1BQHB 4WI3A 4ODHL 1L7IL 5T33H 3HC0B 3E3QE 4PJIA 2XKNA 1TPXC 1JGDB 3N0PB 1I1CA 4GBXA 2XZAL 3AUVA 1WBXB 4PJGA 5DI8B 2AJ3B 4I18C 3O4LB 1HH6B 2X4NB 3SDDB 1T66D 1OCWL 3MJ8B 1S5IL 1MFCL 2P5WD 5C0JA 3SKNA 4U1KA 2AEWA 4Z76B 3GI9H 5SWSE 2C4XA 4XZUA 32C2B 1N2RA 1UENA 4QRSA 1FFPB 5EG6C 1NEZB 4HF5L 3BZFB 2GITB 2IF7A 4AENB 4KV5E 5FO8B 4MQ7A 5H8DA 4HUXA 1YN7B 1TTUA 1WLHA 1GL4B 3BUYB 2BVQB 5FB8B 4LMQE 1XAUA 1MH5B 4HWEH 2J2ZA 1HN1A 3DYMA 1MAKA 3MROB 4WEBH 2NCMA 4XPBL 3SPVA 4OLZH 1DQJA 5I8CB 3B9DA 1Z6JT 3R4DA 3EOAA 3ECBB 2Y1VA 5E2JA 3CSYA 1UWEL 4KZDH 4M7JH 1HQ4A 3V0VA 4XNZB 2VQUA 5FYLH 3WFDH 2BNQE 1UKQA 4X6BA 4XPAL 2CDFA 1XGQB 4LCCC 3MV01 4GAYA 4F9PA 2FEEI 4UT9L 3C08H 4Y1AD 5KOVC 1MCJA 2J88L 3U30C 3KYMB 5I8EB 4P2QD 4LPTA 4XBGA 4GRWB 1CXEA 3O11B 5CP7B 6FABL 4XCEA 1W0WA 1H3UA 1BQSA 3VCLA 2N7AA 1MLBB 4KQ3H 4PJDB 1GZQB 3V0WL 3C5ZB 5DUMH 4MS8C 2DKSA 4I3RH 1AY1H 2VWEE 5E8PA 2JTDA 2FIRT 2X40A 1J8HD 3Q6FB 1EVTC 2G2RB 2YBRA 3U7AA 1INEL 4CVWA 5L2KD 1QA9A 1W0VB 3UP1A 3P30L 4QGYA 4EDWL 3WXVH 2IPKB 2O5ZL 1CVSC 4RDQF 3OKDA 4U6VL 1NMAL 1U42A 3GSXA 1MCHA 4YHLH 3FQNB 4MMXC 2LV4A 4J8RA 1B4JL 1F4XL 3H9HB 2PO6A 1LO0H 5FK9B 1RZJL 1L6XA 1U6AL 4LEXH 3BDBA 4XNXH 4R0LB 1MCLA 5J6HA 3VG0H 3ZTJH 1G9MH 3ILPA 4KI5F 4PJHA 4NM4L 2AV7B 4WUUB 1FG9C 1J1PL 4QRTA 4KHTL 4WFGE 3JV6B 1GGCL 3BT2H 5E1HB 5F93C 4Z77B 3LPGA 2NXZD 4U0RB 3F7VB 2Y25A 4YBLC 3T1FA 4LLYB 3HTLX 1G7JB 2VDMH 4Z7WA 5L0QC 4TUJB 5MI0B 4K3JL 5JOEA 3GO1L 5ALCL 4GXUM 3UXFA 1DFBH 3LKNA 5HXMA 3ZE0E 3FCTA 3B2UD 1JNLL 2CMRH 5CGMA 5MEQA 3NCYP 3RDTC 3MV7B 3GRWL 1W0VA 3ZSTA 3Q6GH 5GHWL 2VDNH 2NR6C 4PJ5D 1A14H 5D7IF 5ADOH 4XBPA 1YEGH 2EXWD 4ZS7L 3VXPA 3NFNB 4IRSC 3P4NA 3LB6D 3TBSA 5C6TL 1CBVL 4JFZL 3PIQA 5DJ2A 4RAVA 1BZ7A 1EJ6A 4MJ6A 2ATPB 2QKIA 1SEQL 2MQCA 3LHPL 2VDKH 3PNWB 5CUSL 1IQWH 2EKSA 3HI5H 3KLAA 5M94B 1P7KB 4YHNA 4HZLB 2BNQB 4WDIB 2XFXA 3UAJC 4DVBA 5HDBE 1XGQA 4GRLC 3RU8H 2FX7L 4WTWA 2HVJB 3BMVA 1Q0XH 2VXUH 4M61A 3MCLH 4YDLB 1RHFA 2WINB 2JJSA 1ZSDB 2F54E 1I1FB 1U8IB 3ARTA 3OG6B 4P2RB 5I1LA 4EI5B 1RJYA 4BK5A 2WMPA 4XX1G 4TUOB 1QVOA 3I6GA 4N0CD 1YMME 1T7XA 2I9LA 2J8UA 1IM3B 4PRIA 4EIGB 4HXAL 5T1DH 2L4OA 1FYTE 4ELMF 2XTLA 1N64H 4JZOB 1GGTA 4OCMC 4QRPB 4DUXA 1FCCA 3THML 2EDEA 1D5MB 4WRLA 1YN7A 3IDYC 4U1IA 5DZNA 5CJBA 4M8QA 1F8TL 5GS0C 2I25N 1EEZB 1MHPH 5D1QA 5F9OL 2XYCA 3O3AB 4GRLA 3LCYA 4AG4H 5I1KL 3C5SA 1QBLL 1HHKB 5TE4H 5L0QB 4XCNA 3ROLA 1I85A 1HHHB 4U0QB 2NQCA 1ZA3A 5HDOA 5I9QB 4Z7UF 5K9OA 2R9HC 1MH5A 1L7IH 3L3DA 4UV7H 3NCJL 3TO4B 3Q48A 5B8CC 4KQ4H 4OD3L 3EDEA 2MOVA 3B9VA 3BXNB 5CZKA 3VRLF 5E5UB 4DK6A 2P42B 3HC0A 5DD0L 5E8PB 3TH3T 1I3RA 4QYOB 2HJLA 2F9BT 3CXDL 4BSJA 4MSWA 4O51A 4X9GA 2AJSL 4TQEL 3C60C 2CLRA 4S2SA 1EUUA 1CU4L 1CICC 3VFWB 3WBDA 1JPTH 4KVNH 4UTBH 1V7MH 3K8KA 1NLBL 2H6PB 1QSFE 4YXHL 1EMTH 12E8H 3FONA 3NZ8B 3E3QC 3WE6B 1U41A 1BQLL 2OJEA 3B6SB 4LP4A 3V7AE 2UYLB 1LMKA 1XR8A 3LH2H 4ZFFA 3D6GA 1T0MB 2LAGB 5J12B 1G7LB 4IRJC 2BHUA 4OLZL 2A6JA 2BVOB 1N8ZA 5IBLC 3L95B 2B2XH 3PWUA 4KI5E 5C0RH 4K23H 4FG6D 3MODL 1NCWL 5TE6H 1OD7A 2JF1A 2ZSVA 3CDYA 1UACL 3GEWB 3W82A 3LQAL 2H9GA 4S1DC 3N85L 2N7BA 1N0LA 4FZEH 1J1OL 2CLRB 4S2SB 5TFSH 4JFDD 1MREH 3H3BC 5I75B 4OIAA 4PLKD 1LE5B 1P4BL 4P2OC 5J1SC 4XC1H 1JZ7A 4K3DH 3SCMD 4ODXA 3CH1B 4MWFB 1ITBB 3BZFA 4WFFE 2AI0H 4G43A 2B8OT 3UYRL 2GCYB 1IJ9A 1LO3H 5F9JA 4PIRF 2CK0L 4R4BB 4QOKD 2WBWB 1C7SA 2PETA 3GJFH 1A1NA 5D7JB 3UDWA 1P1ZB 1PFCA 2XPGA 4GMSH 4X80H 4ZNEA 1A9EB 1F11B 5I1CL 1KXQE 5ESQB 4U6TA 4HKXB 3H0TA 3QXAA 3O3AA 3QFDB 4NQVA 4LLDA 2WUBH 1V7NH 5EN2A 5C0BD 3F65A 4U1GC 1OGTA 1DQQA 5AD0A 4GXVL 2VLRE 3FT3B 1BLNA 3LEVH 4KGJA 4HWUA 1U8QA 1CIDA 1YNTA 5IM7A 4TVPE 3BUTA 4P23C 4Z0BH 3U0WL 5FAAA 4LEXL 5BZDB 4OUUA 3P4MA 1M7XA 2ED7A 1PW3A 2HWZL 3GJFA 1A2YA 2PXYA 1CQKA 3QT2A 4WI7A 4WCYH 4NCDA 3GSUB 1KB9K 5LCVH 4PUBL 2DLIA 4IIQA 4P5TB 4AMKH 3O4OB 3E6HB 3MRFB 1ND0A 4N0YL 5DJ6B 4CU7A 1TJGH 1SBSH 5EORL 1DBML 1ZLWH 1CG9A 3BE1H 4JM2D 2OLDA 3G9VA 4LKCB 5ALCH 5E2UH 5F88A 1ZGLM 1CFQB 2AABH 4KK8C 4DCQB 4H8WH 3K46A 3MC0A 1MRDH 5C6WH 2ZKHH 3S3PA 2XOTA 5JMOC 5FYKH 1QFPA 1U3HB 1ZOXA 3AXLB 5BV7B 1N6VA 3KYOB 4P49A 4EI5C 1DLHB 5DR5L 2P5WB 2IANA 4YZFF 1UEMA 3VXPB 4H25A 4P0DA 5DJXA 2YR3A 4DOHB 3L3HA 3OWEA 1BQHG 4YX2H 4ZOCA 5KANG 4AIXA 4KV5F 4F3FA 4P46D 5DD5L 3FO0L 2DM4A 4IRSA 1KFAL 3HB3D 3QO0B 4MGXA 4TOYH 1O7SA 3NIGF 1RJZA 4NM8H 5EIQA 2K1MA 4DKEL 2FYYB 5E7BA 1IZJA 2UWEE 3QRGH 3D39E 2X9XA 4P4KB 3ULUD 1G7QA 4M5ZL 5CIPA 3FOLA 3CSGA 3DTXB 2UZIH 3TVMB 4HKJA 1R5VA 3HE7B 3VFOA 2P48B 1VGEH 2OZ4L 4LVNB 4W81A 1KTRL 4HKXA 2XWBA 5KG9B 2FD6H 3NIFE 4PGBB 3EJJX 3P0YL 4E5XB 1JF1B 2PYEA 3CC5B 2BDNL 4LLWB 4TSAL 1GRWA 5C0EB 2W0FA 3RI5F 2QQKL 1SYSA 2VLRB 4OJFH 5TQ0H 1LD9B 3UYPA 3B8SA 5SWSA 2HRLA 2VDOH 5MEOB 3G08A 4EUPA 4YFEA 1FO0A 1XZ0B 4IOIB 1S7VB 1CR9L 1Z5LB 2AGJL 1OGAB 4AK1A 2V2WA 3MLPA 2P8MA 5D7IE 4XCYA 1T1WA 4M1DL 4OZGF 3D39A 1VGKA 5D7IA 2VDQL 5JDJA 3ARBD 5JUEL 1RZKH 2E8YA 2Y06L 2QJDA 2H9GB 3WFHB 4YHIB 5CEXA 1TVHA 4F58L 3WXWH 5KS9E 2Q8BL 3G04B 3C5SB 1P9MC 5JW5B 4HD9A 3NAAH 3TYFA 4LRIC 3CFBA 4NPYA 1DTUA 2VQTA 1JNJA 4FQHA 3TIEB 5EBLA 3BGFC 4ZO9A 4ZUUB 3V6OC 1M7IA 2IH1A 4P2YA 1FJ1A 4JREB 4FFWD 2Q3ZA 3QNXB 2YD7A 4TPRL 1NGXA 5J13B 4XI5C 3QI9A 3CXDH 3WUZA 3SO3B 4MJID 1ETZB 2W9EL 3GSRA 2AVGA 1NAMH 3KPNA 2HLAB 4OLUL 5ESAB 2PCPA 1Z0NA 2YD8A 1I7RB 4JJ5B 3VFWA 5KSAC 5HGAA 4JB9H 4ESKA 4KUZL 12E8L 3GSNB 1QSZA 2J8UF 1WCQA 4TNVF 4PLNC 1URLA 1MFAH 4ODBD 3N1PC 2HJLB 3C5ZC 5D8JL 4OZIF 3B2UC 4LSPH 4ZD3L 1A7QL 2NY6B 1N3NB 2ZOKB 2CIIA 2V5MA 4G42A 1ADQL 1BQUA 2A74A 5CGTA 3UTOA 1IM9D 3U30B 4KUCF 4ZUUA 1ADQA 1T0PB 3I9GL 2GUOB 2X89D 2VLJE 4K23L 4BH8A 4M7ZC 1S7QA 1MPAH 2ZCKL 3TT3L 1HHHA 1JGEA 2DLFH 4WWKB 1LEKA 5L6YH 4LRNH 4UB0L 2AK1H 2AJUH 3EYOB 2X4QA 1FZJB 1SY6L 3INUL 1QR1B 4BYHA 1XCQA 3PGDA 3DROB 2VL5A 3U46B 1BX2B 1A7BA 3DTXA 4MD4B 1BHGA 4PJ7E 1UJ3C 4LIQH 2ARJB 4WWKD 1SEBA 3BSZH 1WVZA 4TUJA 2P45B 4APQC 4M43H 2Y5TB 1LEGA 3QDMA 3ABZA 3ZYOA 3RDTA 1BD2D 4XMLH 5F7NC 1Q94A 5BJTB 1ONQB 4OZFH 1RHHB 4MHHI 3KPOB 4M61B 2F5AL 4UV4L 1T6WA 4HAFA 4Q6IC 1F45A 1FNGA 1P6FA 3O3BB 3QDHA 2W07A 4U1SB 3P4OB 1BJMA 4XP1H 4MXWH 3CJJA 1J05A 5ABDE 3OF6D 4F3FB 2QQNL 4N9OB 1FVDB 1FFRA 3NZHH 3AXLA 3VW3L 1QFWM 1H5BC 3U6RA 4TULL 4JN2A 1S5HB 3MYZA 1KXVC 4NHCL 3MSPA 5ESVB 1PLGH 4R7NA 1K2DA 1WTGT 3LRSB 1RSFA 4MLSA 5I76B 4GKNB 1X44A 5IB3B 4X4YA 1DEDA 1JHTB 1MFNA 4N90D 1K5NA 4L4VD 1AQDA 4M8VA 1MWAA 2ICWB 3SQOH 1FGVL 4YDIH 3V7AG 4NJAH 2AQ3A 1T2QH 3ARDB 4OCXL 3HAEH 4JRWA 2Z31C 3O3EB 3EGSB 3MRDA 4KDTC 2AK4D 1WK0A 3ARZA 1TXKA 1OPGL 2X09A 4UIMA 5EPMA 2Q6WA 3A6BH 2VZSA 4NSKB 4IIQB 4S1SL 5F88B 4JQVA 5FYKL 4OGYL 1B6UA 3CZJA 4U7KA 5EO9B 5F6IB 1U8PA 1KEGH 5D1XB 1YNTB 5DDHB 5TDNA 4H0HB 2EICA 3PQYD 3X12A 4LCWB 3K1DA 3UJTL 3P4MB 1WZMA 1YEFH 5IW1B 3HMXH 5LGHL 2W60A 1FV1A 3IAQA 3O6LH 4L9LB 5FHAH 4PRPE 2XTJD 4YFLI 3CPLA 3VXOA 2H1PH 5EBMA 4E0RA 3MBEA 5B3JE 4NQCD 5HHXH 3BEVA 1MVUB 3LDBC 5E8EA 4OUUB 4S1RH 5C0AA 3JV5A 4LLQB 4JHBA 4PB0L 4PRHB 1QBBA 1RZ8B 4UNTA 2O26U 1UH3A 4M93B 1FZMA 2FHCA 3U4BH 1NLDH 2V2TA 4GAGL 4PFEA 4KHXL 3CLEH 1OSZA 4HCRA 4MLIA 5DVKA 4JR9H 2R69L 4OZGB 4XMKL 5CGYC 2JK5B 3C6SA 2K7QA 5F1KC 1EEYB 5F3BA 3W9EA 5ISZB 3JUYA 2J1KA 4FQ1L 1DSFH 2E27H 1X6NA 3T1WA 4MAYA 4YLQT 2IG2H 4XCFH 5DEGB 3KPRA 4V1DA 4HJGA 1FG2A 2BVPA 1FL3A 3CH1A 1D9KA 1OT2A 4G9FB 1T1ZB 1CD1A 1DQMH 5JUEH 4Y5VB 4BZ1L 4YHYB 1WGOA 4OI9A 4P9ML 1NCCL 1T7ZA 3BQUA 3TZVA 4NN6B 3P73A 4H0GA 1YEJL 4WHYH 3S36H 3EOAB 4R2GB 3RX7A 4GQ9H 1HZHL 3REVB 3RWDA 2DQIH 1HSBA 1MEXH 1IFHL 3ARXA 3ULSA 1KCSL 3LS5H 2GAZA 1ZEAH 2OM5A 4ZTPL 4NN5C 4XWOC 4M4PA 1FP5A 2R0ZL 3C8KB 4JO4H 4AQ1B 2XTJE 1A6TA 3CNKA 4N0UE 4OD2B 3GSNL 1XGYH 1U0QA 4PP2A 4Y7MA 4TTDC 5FGBA 3QFJA 5AZ2L 3GMMB 4J6RL 4F80A 2F5BH 2R0KH 3H2WA 2XQYG 3N1GC 1FFPA 4JM2F 4PJXE 32C2A 2EO9A 5C07E 3WD5H 3PWJB 4ETYA 4MX7A 1HHGB 2IH3B 3TNMA 5CLWA 2VAJA 3SKNB 3ZE0F 4KMLB 2DF3A 3ULVL 2BNUA 1NGWA 3P9MB 5CHNB 1HHKA 1BEYH 4YGVA 1AC0A 3BO8A 1JGLL 4JY6A 3BGMA 3MXVH 1N7ML 1UB6A 1OM3L 5CEZL 4APQB 4WW2B 2DI8A 4WHYG 4ZSOA 4PRHD 5JOPD 1MQKH 1D6VH 2B4CC 4AQOA 4ODTL 1SJHA 2P24A 3WSQH 3S3JA 3OAYH 3HC4L 3MJ9H 4EI5A 4MXVF 3HLAA 2ZOLA 5L9DH 4JRXA 2X42A 4JRXE 4FABH 2VSDA 3MO1A 3QUMA 5HYJB 1I9RH 5DD6A 4AH2B 2FX9H 5I1LB 1MNUL 2DQCL 1HXMA 4JHZA 1S8DB 5E5MB 2R29H 2YXFA 5IVXE 5C08E 1W72B 1SJEB 4GJTB 5T1MA 2PTVA 5HHVL 4JQVC 2VRAA 3KPQB 4DKAA 4P9HH 4F9LA 4X0KB 3BH9A 4QXGL 3LDBB 5MEPA 3KYAA 3G5VA 4ZOAA 1W2KT 4HIHB 2NY4B 3WN5A 1A6ZA 1O5DT 2VXTL 4OF7A 3GSWB 1FGNL 5GRUH 4M5YL 2GJZB 5DSCB 4M3JA 2DQJH 4X7EC 2Q86B 4UT6L 2E7MA 1BZ7B 4YHNB 4F7CB 1SMOA 3KR3L 4S10A 2YPKB 3OKNA 3DX9A 4M7LT 4NHCH 1U3HD 3S5LG 3OAUL 3HPLB 1D5BB 1X5AA 3VXQA 2VTFA 3SDXE 4OI8A 1NGPH 4NNPH 1IGMH 2ADFL 5E2VH 4OFYA 4XVUD 3BPCB 3IFPA 1BGXH 1IGIL 2HFFA 3WNOA 1J18A 3T3ME 5BMFH 1Q72L 4RA0C 5J1AA 4KK6D 4OV6F 3U2SA 3PQYA 4P3CL 3ZT7A 2XN9D 4WHTA 3L9RB 1AI1L 4Y4HD 2CO6B 2PW2B 2VDRH 1MJUL 2FNBA 4MB4A 5C0FB 5BS0E 1FVEB 3VGGA 1C7TA 1F3DH 1FNGB 1S7SB 4YWGH 3RVUD 3CZFA 1OAUH 5DUML 5BZWA 4YDJB 1BWMA 1ZLSL 2DBLL 4UAOC 1KEGL 3ILQD 4JM2A 4ONGH 1CL7L 5EZIL 4RWYH 3GRWA 1IQDB 1ED3B 1OD9A 4PJ9D 4U1MA 3TIDB 4ONFH 2YRPA 4Y89A 6CGTA 1VFAA 4ORZC 4OQTA 1PG7X 3O6LL 1V3JA 3DBXA 4MCZB 3C5ZD 3HZMB 4Q6IB 3OXRB 4WV1C 1FRGL 3U9UA 3FO2B 2YBRB 4G9FE 2NY5L 1UA6H 2YPLE 2NZ9C 2BY2A 4F8QA 3IAPA 4Z7VE 4M48L 1DQTA 1F4XH 1YMHB 5F3HB 3O8XC 1XF3B 3DV4B 4MNQD 2F58H 4R97B 4I2XB 4C57C 1RPQA 3PUCA 4P4RB 4NO0D 4IRSD 4KJWC 2LVEA 4G7YL 2B5IB 2CKBH 5ANME 4F7PA 4K8RC 5D6CA 3OKOB 4YHOL 1GGCH 1GHFH 1YNLH 2A6KA 3HR5A 3UYOD 4PJGE 5JQ6L 3W0WA 4MJ2A 5H35B 4PJ5E 1EVUA 5D6DC 3GM8A 2I24N 3O3UN 3IXAB 4WY7H 4ZFZA 2VZUA 5DHXB 4CVZA 4J3TA 4PBXA 4HG4J 4WWKC 4Y16D 1BD2E 1A3RL 5CZVL 1I85C 4NC1E 2VR4A 2ILLA 3X14A 3BWAB 5K33A 3W81A 1DQDH 3S4SA 1JNLH 2CMRL 4UILL 5DYOB 3VJ6A 1IAKA 1ZTXH 3JVGC 2HJFB 1CDIA 2YC1A 4YC2C 3HB3C 1KPRA 3P73B 1FPTH 1YEGL 1KJ3L 5ICZA 2JJTA 2DDQL 3FKUS 2EC9T 1MIEH 1DBAL 4PJEB 4HS8H 4XRCA 5C2BH 3JWNC 5C6TH 3GKZA 2EDXA 5D6DA 1ZT1A 2DQIL 2GTWB 2P7TA 3OR6A 4NWTH 4U05A 5GRWA 1MFBL 3QXDA 3MV7D 5C0CB 4XXDA 5D7LB 1KT2A 3CUPA 1MRFL 1PZ5A 1RZIA 1I3VA 2J7LA 4PJGF 3WFZA 4X7SL 1U95A 2F53E 1Y6KR 4C54A 4XXCA 4OAWA 1IGCL 4PJCE 4UT9H 3GSOB 2ZUQC 3MMEB 4K71C 4WI5A 3AY4A 1IAIM 2AK4A 1T3FB 1YA5A 4JKLA 4WNQA 5FGRA 2VXVL 2R0KL 1II4E 3MA7A 1RV6X 3PJSB 5C0BA 4NO5B 1UZ8B 2I5YL 2NY4D 3V5HA 4X6EA 4LASL 5I1HH 4QRSB 3S37X 4LVHB 1KPVB 1A5FL 4NO3B 5BQ7A 5BOPA 4KTEH 4DQOL 4W6XB 3FT2A 4DVRL 2EKJA 5IVZA 3RZCD 3KDMB 4PGCA 1H8SA 1G1YA 1X9QA 1NBZB 3C6LA 3WV0A 3F5WB 5HPMB 4U6YB 4U1JA 2OZ4A 3U0TB 4F33B 4L3EA 4Z7VB 2V9TA 5DT1L 4OLWH 1A7OH 5GGQL 1KYOK 5AYQA 3G5ZB 4NWUH 1N7MH 2FLBT 1TETH 3T08A 1OGAE 4FN0A 2GFBB 3MNWA 4FQCL 3QDGB 4KK6C 3CDFA 4QXWA 2HJKA 3PWNA 5INCB 4KDTA 5DK2B 3DXAB 1AXTH 1CGUA 3S36X 3VFOB 4M6OL 2VAAA 4OM0L 4HUKB 4JAMB 2NW2B 4XNQB 1J0IA 4NO2B 4ZXBD 1QSVA 3CLFL 4HS6B 5F9DC 1OSPL 2Z92A 4NRYA 4IRZH 5L2JB 3T77A 1ORSB 3BIBX 1RJZB 1V3KA 4HLZH 4KI5C 3QEQA 1I7UB