1YJDH

Crystal structure of human cd28 in complex with the fab fragment of a mitogenic antibody (5.11a1)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
217
structure length
217
Chain Sequence
b'VQLQQSGPELVKPGTSVRISCEASGYTFTSYYIHWVKQRPGQGLEWIGCIYPGNVNTNYNEKFKDKATLIVDTSSNTAYMQLSRMTSEDSAVYFCTRSHYGLDWNFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab fragment of 5.11A1 antibody light chain
publication title Crystal structure of a soluble CD28-Fab complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/signaling protein
total genus 37
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2005-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yjdH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yjdH02
5HHME 4WU5B 4LNRB 1NGWA 2CR3A 1IL1A 2QSVA 1RJYB 1V7NH 1Q1JL 4P3DB 1QSFA 3Q0HA 5EPMA 2Y72A 4KTYA 1HHKB 4KJPC 3QDJB 1MF2H 1F11A 1XF4B 1GGCL 5FEBA 5EIVA 4YDLC 1R24B 5C0DB 3FZUD 2NX5B 1NL0L 4JRXE 5I1GL 3MCLH 1BM3H 3IDXL 4PJHB 1H5BC 4U2YA 1QR1A 3QDGD 1UA6H 2W0FB 1I8KB 1AGDB 4JRYE 5F9WB 1WCBA 5KSUA 1X4XA 3L3DB 5F7KC 4X8JA 5EU3B 3L3OA 5ICYA 1WIPA 4IRJD 1E4KC 5DSCB 2E7MA 1D9KA 4XP6L 1JPST 2X05A 5CD3A 4IEFB 2BY2A 3RGVD 4FS0A 3VWJC 3F8UB 3HC4H 4Z7WE 4MQXD 1BX2A 3BT2L 1PY4A 4JM2B 4NQEB 3MNVB 3IFOB 2J5LB 1YEGH 4HC1H 3IXTA 4QRRD 3LKPA 4NC0B 4AH2B 5D1ZA 2HJFB 4Z7VE 3G5ZA 2E7LC 3LIZH 3JWOC 4KZEL 4PLOB 5DR5L 3RX5A 3O2DH 3EYVA 5D2LA 5JW4M 4H0IA 5C09B 1YY9C 1OTTD 1RQ5A 1G0XA 1GSMA 5DFTA 1WAAA 3BEVB 3L9RA 3VH8G 1PKQB 2JB5L 4IDJH 5CSZB 1YA5A 2VB5A 2JF1A 1YNTA 4GKZB 5D1QC 1UADC 4F15B 3JZ7A 1IQWH 1FO0A 4OD1L 4D9QE 4JFFB 1MUJB 4PB0H 3LS5L 4UT9L 3SDDA 2A2QT 4G6KH 3DBXB 4HX1A 3GSNH 1HHIA 1Q9LB 3SY0B 3HG1E 1FGVL 1S9XB 3ZDYE 4Y4HD 4UIKL 3OWEA 3EO1B 3VXMB 5HYJB 1OGAD 3CLFL 3AY4C 4OIIL 1G9MC 2CSPA 3KPSB 3DSNA 3HPLB 5DHXB 4UU9B 1JN6B 4UNTA 4G9FA 3HE7D 2EH7L 2AEPH 2X4RA 3DMMC 4DN4H 4LLAA 3IDYB 2A0LD 4PJBA 3U4BL 1Q9KA 2HFEB 3C5JB 1A6ZA 4DAGH 4GQ9H 4HLZH 4LRIA 1UH2A 4LSQL 2EE2A 4WI5A 5EZJB 1E6JH 1KELL 1G0DA 3MLUL 1KCVL 4OLYH 3MUGB 1KEGL 5ISZB 3ARGC 3V5HA 4FQJH 2I27N 4W6WB 3U7YL 1M6OB 4AY0A 5FGCB 1JGUH 3UTPD 1FGNL 4N0UB 2VDOL 1J11A 4NKIL 3BMVA 1E4WH 2HTKD 4I3GA 4PRDB 4L4TD 3C2SA 4WEBH 4Y1AE 2XV6B 5ANMB 1G7QB 3SKOB 1JF1A 3BH9B 2ZUWA 1G0YR 3S34L 4WCYH 2GJ6E 3ZO0A 3ISWA 5JO5A 3B9DA 3DGGA 1FDLH 4Q6IB 3IETB 4OF5A 5IQ7L 2QR0A 5LGKA 2P24A 2XKSA 3MLTA 3BO8B 1I1RA 3LKSB 1U3HA 3AUVA 1I3GH 5JHDE 4NC1E 4TPRL 1DQJA 3KPOB 2CQVA 1UVQB 4XAWL 5GSRA 2P8LB 3WIFA 2R29H 3DX6B 1F6AA 3UBXG 1H3GA 2ORBL 2X1XR 2BOBA 4LDEB 4J7RA 2X9YA 3C6LC 2G2RA 3F7PC 3QR2A 5GS1A 2AJYH 3O3BA 4G8GD 3CXDL 4PV9B 3BQUB 5DJYB 5IM7B 4ZTPH 2X70B 1EVUA 1MCSA 5J12C 3FO1B 2VO5A 3G5VB 4XNXH 5FGSA 1D5MA 2GTWA 3TBYA 5EWIL 2R2BB 1QLRB 3FN9A 3MMEB 2RAMA 1I9RH 1TZIA 1UH4A 4YBQC 3BVNA 4P5TB 3O6FB 4JFEB 1HI6B 1VDGA 5DVNA 4NWUL 1I9JH 2R0LL 4DGIL 1LEGB 4ZS7L 3OV6A 4C83B 5I76B 1OARH 3FQUB 5C0CB 3MR9A 5FIEA 5DC0A 2NY6D 2XA8H 1B6UA 4PJ7A 1DDHA 3MXVL 3HLAA 4NQDB 5DJCB 3K0WA 2Y06H 3A6BH 3ESUF 3FFCE 1JYNA 1NMAL 6CGTA 5HY9A 3N50A 5DEFA 3ARFD 4N8VG 5EO9B 1CBVH 5J3HD 1UGNA 2BCKA 2PYEE 4MJID 3T2OA 3W9DA 3K3QA 1H8NA 3TZVB 3MRNB 3ARBB 3MBEB 5DQDH 5H2BB 2YWZA 4P2QB 5AUMA 4PY8I 1QR4A 4ODWB 3GSXB 3I6LE 4ZUWA 2NY2C 3MNZA 1A3RL 1U42A 2C3VB 2VSCA 5F7DA 2X4UA 3M07A 1Z9LA 5L9DH 1MCWW 5IVXA 1U95B 4ZSOA 5HGDA 2HT2D 3SDCB 4P49A 4PRPA 4UB0H 3D48R 4WFGE 3MROA 4PRIB 4ERSL 4B53A 4HGMA 2ICWB 5DDHB 4NNYB 5HVWA 1TTUA 4U7KA 3S37L 3CVHB 3C5ZB 3MRMA 5GRXG 3ZZ1A 5DQJA 2F8VA 5I8OH 4AEEA 2CK0H 5DTFB 4OCYH 1HDMB 4YC2B 2DD8L 5CCKL 3REWB 2P8MB 4F7PB 4HLJA 3GMMA 3PHQA 3WFHB 3CH1B 3P9LB 5ICXB 1BREA 1FE8L 5F9WC 2Z35A 3IDJB 4HIXH 3IKCB 3T0EA 4TUJA 1P7QD 2HJLA 3WFDH 3E6FA 3T8XB 5C0IA 2CDGA 3MYJB 4KDTA 4QXGL 5EU6E 2PETA 3D85A 3I6KA 4XPFH 3ARWA 1BVLB 1U3ZA 1ZGLB 4JM2C 3BKJL 5E03A 4NGHH 3BHBB 1BQLL 3CJJA 4DKFL 2J5LC 1MEXH 3MA7A 2NY4D 4LOUC 5F6IB 4G43A 4JO4H 3VGFA 2K9UA 4KI5F 2WM0A 2EIBA 5DGQA 1IEBA 3GBNL 3VDAA 2FIKA 1S5IL 3GK8L 3NA9L 4AEFA 1Z2KA 2RR3A 2EDRA 1KPRB 3RI5F 4Z7OF 5C0FB 2R2CA 3QQ9D 1MJ7L 1OWWA 1EZVY 2HVKA 1XF3A 1MPAH 3VXPB 2OJEA 4JY4B 1KLUB 3SPVA 4OQTA 1QVOB 2OMBA 5C9JA 4PJ5B 1YJDH 2W9EH 3BPLB 1A7RH 3AROA 3FJTA 3KXFD 3LMJL 4WUUD 4JDVB 4Z7UE 2VDNH 4IOSD 3BRFA 4F15C 3PWPD 3L3IA 1KPUB 1XF1A 2VAAA 3U7AA 4KK9C 3HA0A 2MKLC 4G6JH 5EC2A 1CCZA 3C60A 4HHAB 4Y16C 1DP0A 2PNDA 2XXCB 3R06A 2BSRA 5C0AD 1Y6NR 4JVPA 1CFVL 3UZVB 3IJHB 4OTXL 4HKJA 4N5UA 1FYTD 1W0WA 2AK1H 3GJEA 4OUOA 1DLFH 1DQMH 5E1HB 3KHOA 4NKDA 1VGKB 1YEIL 5D7LE 4N8VA 3UJJL 5CD5C 4QHMB 1RK0A 2AV7B 1VACB 1Q0XL 3IDYC 5IEHA 2BJMH 3WV0A 5E8EB 5JORA 5D5MF 4WWID 2X4QB 4XVUC 1AY1H 2FDBP 2DYPB 1VADA 3OKDB 1KBGL 1NFDB 3G6JE 1RV6X 2W92A 5D7JA 4GKSA 5EZOL 4DTGH 2Q86B 3I6GA 5BOPA 1G7PB 2BVEA 4FZEL 3QEUB 2J8OA 1R0AL 1A9EB 4G7YH 3U46B 2P45B 5J13B 1D5XB 2R1XB 3V9FA 4GRMA 4QRSA 2NNAB 5KSAD 3OJDA 4HJJL 3ULVH 1K8IB 3LN5A 1FJ1B 2DQGL 3CDCA 4FQIH 5GHWL 4HUKB 4TTDD 5GGUA 5IF0A 3CPLB 4RAUB 1WZ1L 1JPSH 1ZLSL 4R7NB 4PJ9C 4PJGE 4HS6A 5D9SA 1AR1D 3BIBX 4N8CH 5E2UL 3QDMB 3TLRA 3VA2C 4Q6IC 2VXQH 2BVPB 1T0MB 2E6PA 1A2YA 5D6DA 1UXWA 3ARVA 4UDTA 3S35X 1CGSH 4M1CC 3EIFA 3GIVB 4LCUA 2O61B 4J4PC 1TJHL 1CD0A 4WUKL 4F7MA 1A22B 5JOEA 2E27L 3HHRB 4IOFC 1EK3A 3VU2A 5J89A 3K8LA 3TN0C 3RA7L 3IT8D 2BNRB 3NIGF 2HT4D 3QHZH 4X7CC 3V4PL 3ZE2E 5BVPH 1I8LC 4WO4C 1MI5A 2DQJH 2GKIA 4Y2DB 5FGRA 1CXFA 2G60L 4NHCL 2HRPH 1J05B 1E4JA 1JF6A 5C08D 3R8BB 1ODAA 1YEDB 4LPTA 4MVBC 3D2UA 4G5ZL 1UB6A 3BQUC 2IGFL 5DMKB 2VDMH 3SDXE 5FCUL 5LVEA 4LNVA 5LG1A 1P6FA 3V4VL 3HC0B 4EI5B 4K3EL 4AEIH 5MP6H 5F96H 4LVNB 4JPIB 5GGVL 2GQHA 3GJFH 4NQCD 5JW4Q 1B0RA 4P5TC 3HNTH 4YFLF 4NO0A 1CXEA 4OLEA 5E8PB 4YQXH 2NR6D 2IEPA 5FM5O 3NACH 4B7LA 1QFWM 4WDIA 5BOZG 5IWLA 4ZUVA 3WHE1 2OS7A 2VLME 5GRUL 1A9BA 2V5MA 1FL5A 1CDBA 1ITBB 2OX5A 3SJVE 2AK4D 3E3QC 1I7RA 1I85C 3VGAB 4H0HB 4QY8B 5DJ0B 4LDOB 2K7QA 3U30C 1EJ6A 4CRPA 1WTLA 5J6GB 8FABA 5C2BL 3V5KA 5IIEA 1BJ1H 4HWUA 3TZVC 2G9HA 4U49A 2DDQH 3ARBC 3MBEC 3JV4A 5HPMB 1I9IH 1TZHA 3B4NA 4RMTA 3DSFH 2W9DH 3PQYB 2HVJB 1JZ8A 2B0SH 3VXUB 3T3MF 1M7XA 4CBPA 2P47B 4OCWL 1E28A 4Z8FL 4JFDD 1ZS8A 4Y4KC 4E41A 4FFYL 1RZ8B 3VD9A 1X44A 4HPYH 5I8CA 4YHOH 2C3WA 4LCWE 4NN6C 1ZSDB 4BZ1L 2GAZA 3DOSA 4RFEA 4LAQH 2JCCF 2EIZA 2GK0A 4WHYH 3C5ZC 4QRQA 4WFEE 3QUZD 2ZUUA 2Q6WA 3DGCR 5FB8B 5ECJE 1R3IH 4ZPTA 3VFNB 1BIIA 1KIPB 1FO0H 2H1PH 1ZVSA 4MNGA 3HPJB 4XP4L 4JR9H 3RTQD 3ZL4L 4M03A 3BN9C 3FOLB 4PRAA 1NAMA 4FTVE 4QLRA 5DI8B 4MSWA 3BUYB 2AI0H 3O4LE 3C08L 2QADB 2EEBA 4KMQA 3F62A 2C1PB 3IVKB 1OTSC 1JGVL 5GZNC 4HIJA 1KENL 4YLQT 2CH8A 4L4VE 4P4RA 3QIBA 4F3FA 2XG4A 4Q9QH 1Q0YL 3I2CH 2XZQL 3QXTA 1E4XI 1MLCA 1WBXB 2W1NA 3P30L 1TJGL 5F89A 4YDIL 3KYNA 5F6IC 4GRLA 3QEQD 1FNEB 2YPVH 3HZYA 2A83A 3U2SB 2Z92B 1AO7B 3F5WB 4LPWA 1A5FH 1MRFL 4N0YL 2IF7A 4E5XA 2NPLX 4MA3B 3ALXA 4M6NH 1OAYH 1DBAH 2BVQA 4X6CF 3LEYL 2GCYA 2FLBT 5SWSA 4R4FL 2DLTA 2JIXA 1HYSC 1KTDA 3WUWB 1G84A 1W72A 5DUPL 3K80A 5DF0A 5KW9L 1FIEA 3OR7A 1N26A 4IRSD 4WV1B 5JZ7D 5JOPD 4I2XE 3IGAB 4NQXA 2YA2A 1CTNA 2Z91A 3CFIC 3MLRL 5IG7B 3KYMA 4WW1A 4YXHH 15C8H 5JNYA 4KI5C 1U3JA 4MD4A 1MF2L 3LAFA 4MMXC 5CJBA 3QRFM 4FQ2H 3DVGA 5HDQH 1U91B 3AU1B 4JKLA 3MCLL 4QGYA 3KYKH 1UA6L 3FCTA 3WDIA 1MCOH 3QQ3B 5FYJE 5I19L 2GY7B 2Y5EA 2ZUXA 4P4KB 3HC4L 4QCIA 5HYSA 3AB0C 4LASH 1YMMB 5K93A 2NY7L 1YEGL 4HC1L 4KJPD 5IBUB 2M26A 4URTB 5FKAA 1J7VR 1BQSA 2F58H 4I0PB 43CAA 4J6RH 2HA1A 1T1ZB 4EBQL 3LIZL 4OLUH 1F4WH 3O2DL 5IK3A 2QEJA 5J13C 1QUNA 1AP2B 2CD0A 5IROA 4MGXA 5C0EB 2ARWA 1AQKH 3ES6B 1K85A 4JO3L 2P5WD 4BH7A 4IDJL 1KJMA 1A1MB 4BFIB 2FRGP 3VE0B 1QPXA 3WDJA 3DXAD 1IQWL 3RL1A 3H3KA 5JW3H 2HFGH 4PB0L 4BZ2H 1TTFA 4G6KL 5HGGS 3S36H 3BJ91 1OGTB 1KYOJ 2P5EE 1JYWA 3GSNL 2EKSA 3BWAA 1I8MB 1YY9D 1U8NA 1QZ1A 2JLLA 3MLYH 3MRGA 4D8PB 1X5XA 2V2XB 4U0RB 4WNQB 4Q7DA 1QYGH 3VXRE 5D1QD 3BZ4B 4WW2F 4YEEA 4YJZL 2FX9H 5E95B 2AEPL 5FO9A 4DN4L 1JHKH 1CZ8H 1QSEE 5FO7B 4G80B 1R3KB 4DAGL 3GJFK 4G6MH 2GYSA 3LY6A 3CXHK 1E6JL 5GQBA 4OLYL 3DHJA 1NDMB 4ZS6C 4F57H 3QXDB 4EI5C 1Q38A 1YY8B 2F54D 4X6FA 1JVKA 4LVNC 1MFAH 2BERA 4PY8J 4FQJL 4JE4B 4QEGA 5CKGA 1NAKH 1BFTA 3C6SB 3H9SE 5IJKA 3DMMD 4Z7NF 3KPRE 2CLZA 3VXSA 1QPPA 4L1DA 4YIQA 1LP9E 1E4WL 3RDTB 4U6HA 1B0GA 4AM0B 2WLZA 2VERN 1XT5A 5BS0E 5KS9E 4QRPD 1I3RA 4Y19B 2JK5A 3EOBA 1ETZA 1SM3H 5D2NB 2XXMB 7FABH 1EUTA 3UBXI 1FN4B 5IKCA 3ARGD 2IANB 1FDLL 1VEMA 1YEHH 2F8OA 4XAKE 1XIWA 4DKDC 5HHNA 3O81A 2VNCA 3OKNB 2CK2A 4LGPB 3L95A 1GGIH 4ELMF 3K1DA 1YC7A 4AG4H 1RULH 2UVFA 1U8PA 2P43B 3BFOA 1OAUH 4PG2C 3B8SA 1IM9B 3CFEB 3IDNB 3MREB 1H0DB 2R29L 3QCTH 4PRHB 1LHZA 1MY5A 1TQCC 3PUCA 2X2YA 4UOJA 3MLXH 4JO2H 2PO6B 4U1MB 1MHEB 3B6SA 3Q5TA 3MNWB 4XP1L 4DN3H 2C4FU 4PJIF 2OR8A 2R0KH 3I85A 1C7TA 2VDQH 3NZ8B 3ARRA 3CC5B 2E7BA 4OQTH 4PB9H 1CT8B 2FB4H 1YEEL 1A47A 4P5KB 4JANB 4ZTPL 2R15A 2BMKB 1UT9A 2EDJA 1JPFB 4XNXL 5KTEH 5TGBA 4FFVD 1F3RB 2IQ9H 4NT6A 5DT1H 1T7XA 4NRXB 1RZIA 3Q6FB 4FQQB 5DEGB 1I9RL 2GHWB 3VW3H 1GZPB 1I7TB 4IM8A 4ORGA 2R9HC 3N1MC 1IE5A 1I9JL 4ELMB 5AYQA 2QADC 4KJQD 5AYUH 3C6LD 1OARL 2VYRE 2BDNH 3HCVA 2NTFB 2WW8A 2XA8L 2Z8SA 2R8SH 2Y06L 3A6BL 4I13B 3BIKB 4K3JH 4ONHB 4OZHE 2AJXH 1FFNA 5I6XB 5D1XB 4HXBL 1D6EA 3T0AA 1PZUB 1Q9WA 2AXHA 1JGEA 1OCWL 5SX4H 2WV3A 1CBVL 1RJLB 2DWDB 2Y9RT 1YMHA 3HUJA 5D72H 5EOTB 5E5MB 3HE6C 4ZOAA 4X5WB 1NJ9A 3ME0A 2CXKA 2YBRA 1JWMA 3H9ZA 3RWDA 2EH8H 3RWGB 1LMKA 4HH9A 3WE6B 1F90H 4CVZA 2YUWA 1LWRA 1XR8A 1MIMH 3DPBA 3RWHB 4PJCF 4M62L 1XCTA 1R5IB 1NDGA 5ERWB 1VKXA 4QTIH 4GG6F 3BW9A 2MQ0A 1TXKA 1HNFA 3NCYP 3MLZH 1BBDH 1XGQB 2APVA 4HUVB 3UTTB 3TIEB 4D0BA 4M1DH 3MCG1 3V0WH 1IGIH 2PTUA 1EO8H 5I8OL 2CK0L 1DE4B 3PDOA 1XF5A 4TVSa 5BZWB 4BUGA 2NY2D 5E94B 5HTSA 1QFWH 3QNYA 4OCYL 4X83A 4K94L 1AGFA 3B2UD 3PL6B 3M17B 3NPZB 3SEPA 3CFKA 4LLMA 3WXWL 1KLFA 5I66A 4K8RH 2NLJB 4RGOL 3RIFF 4KKCC 3I75B 3INUH 4HIXL 3H8NA 3IDUA 2W65B 2E6QA 4PJCB 2VLLB 2EYSB 3WFDL 3FMGH 4F9LC 1XF2A 3U4EA 4JFYB 2HH0H 1J8KA 2B5IB 5J1TC 4L8DB 4XPFL 4L3CB 4P46A 3O9WB 1I1AA 3V6BR 4NGHL 4ZO9A 3MRKB 5JPMA 3FT3B 5GS2D 1JWUA 3VGHA 1MEXL 2FJGB 3RVUC 3T0DA 3QHFH 4GFTB 3EFDL 4QGTA 1R5WB 2NX5D 1UXSA 1FORH 3RUGA 2E9BA 1NKRA 5HHQA 5JXEA 2CJUH 5F1NA 2Z4QB 4PG9A 1K4CB 5ADOH 2CUIA 3WFBL 1OVZA 5I8EB 1MPAL 3ILQC 2I9TA 2DQTH 3T2PA 4NIKB 5HI5D 1QRNB 5L2KB 5MENB 3MX0A 1KPVA 8CGTA 3CXHJ 3P77B 5T5NF 1A7RL 4ZYKB 3U9UA 1T03H 2XN9B 1FG2A 4H25A 3UTSE 3BPCA 1GC1H 2VDNL 2IBGA 4LOUD 1KIRA 1GOHA 4KPHH 1O5DT 4K23H 2R4RH 1AKJB 4F2MB 5H37G 3PWJB 3RVTC 3KVQA 4X0KA 4QOKD 5DS8A 4HWZB 4ZOEA 5F7UA 4PRBA 5GGRB 3U0WL 5C0BB 2VLKB 2QHRH 1T83C 2AK1L 4U0RC 1DLFL 1DQML 2XPGB 1BJ1J 2D4FA 3BGMA 4NQSB 2HJKB 3MJ8B 4WTZG 5ITFA 5GGSY 3VMPA 3KPTA 4JFFD 2HT3C 4JPWH 5C7XH 1T66C 4MAUH 1FL3A 4KK9D 4P5MA 2D0HA 3UTQB 2V6HA 2W60A 4GLRI 4X4YA 1AY1L 4Y16D 2BSED 4HUNB 1BOYA 2ESVA 2PW2B 2IPTH 4LSUL 1UM5H 4BK4A 2ITDB 3BKCL 1A7PL 2QJDA 4DTGL 4NBYB 2C4FT 1SEQH 4XMKH 1KACB 5BO1H 5DJDA 1OWRM 3HTLX 2ARJA 3RWJB 2FGZA 4HD9A 5GGSA 3IKKA 4G7YL 5CD5D 3QNXB 4S1RH 3PXJA 1OSZB 3H9HA 1FVCA 5IW6A 1YN6B 4QHNB 1Y18A 3SCMA 4GLRH 4KVCH 1DBML 4P3CH 4CMHB 3ULVL 1KFAL 2UWEE 1JMZA 3QFJB 5I74B 5LBSH 4FQIL 2YD4A 3G6DH 3E6HA 5KSBE 1JPSL 4FXKB 1NAMH 4CVWA 3DRQB 4JPKH 4FABH 2X4PB 1LO2L 4OLXH 4N9GB 4N8CL 1WUNT 2DJUA 2OZ4A 2VITB 1KCKA 3QG6B 4Y5YA 1YNLH 3DX9A 2VXQL 4YDVB 3WS3A 1CGSL 2ICEA 3D87B 3BZFB 4JZJA 3QRGH 5GS0C 3GO1L 5DJXB 1G7LB 3LV3A 4YAQA 1J0HA 2AJUH 4F9PA 4WEMB 1OAKH 3M45A 3OHXA 3X13A 4PJ9D 4EUPA 4JFXB 2PO6C 2YPKA 3PHSA 3EOAB 3LHPL 2XQBH 3JV6A 4YO0A 4JN1L 2HRPL 2EICA 4FQHA 3QNZB 5DYOB 1A6WH 4RDQF 2Q20A 1DLHB 4M1CD 2C7UB 3MRPB 3ULVE 2BRQA 2VDML 3PF2A 2WP3T 1WQVT 2FZ3A 4IIQB 2A6DB 5BXFA 3TN0D 4BSWA 5ID0B 5MP6L 1W72H 2C9AA 2B39A 1CLYH 2WWKT 1E4KA 1OHQA 4WO4D 4WI4A 2B2XH 4YQXL 3X11B 2LU7A 3NACL 3VWJA 4PR5A 2F5BH 4U7SA 4EDXB 3IFPB 4KRLB 1SJVA 4AT6B 2JJUA 2LTQC 4X98A 1CD1A 4MVBD 2ADJA 3BQUD 4EI6A 4J1UB 3D39A 1NCNA 3WIIL 4QTHA 2DQIH 4LLYB 5I6XC 2VDPH 3STZA 3ZE1F 3QXAA 4XMLH 1CVRA 1ITCA 2YKLH 4P57A 1RZKH 3PDGA 5FECA 5CKAA 4JFED 3IJYA 4Z7WF 5E6ZA 5JQ6H 2DDQL 2XWJB 4G3YL 1I9IL 4XPAL 5IR1A 1WBZA 2HFFB 3DSFL 2W9DL 4ZAKD 1JNHB 4RZCB 4YHYB 2B0SL 2D7TL 4ONFH 2OLDA 4Z7VF 3FKUS 5CIPA 1I9EA 4CU8A 1R3HB 2VISA 4EVNA 2AAVA 5HYQA 5J11C 2HG5B 4HPYL 4YHOL 3MV9D 1F4AA 5E2JA 4N5EC 2FJHA 1QSFE 4LAQL 1BOGA 3OX8B 3MBED 1WC7A 3RWIA 2AQ2A 2F54A 3QUYB 3V6OC 1U58B 1IAKA 2D0GA 3AY4A 1T0PB 4P2YA 1R3IL 4NFDA 5EFIA 2VLRA 1FO0L 2H1PL 3GHEH 3PL6C 4P3WA 4Y4KD 4Z7WB 1OP3H 4OFKA 5TF0A 4Q9BA 4DVBB 5BRZB 3VFRA 5FK9B 5E8OB 4P23C 1KT2B 5DK3A 2AI0L 3L3KB 1FFOA 4PRID 3DYPA 3ZDYF 5EZIL 3W0WA 1YYLH 2BVOB 3C5ZD 3JWOL 5JW5A 2B5IC 5D8JH 4MJ6A 3KPNB 3O9WC 5JDSB 3HFMH 3I2CL 4LBEB 3IFNH 4R26L 4U1HB 4YE4H 4ZFFB 2A73B 1VESA 3ARDA 5HGAB 4LLQB 5DD1H 5L8KB 4MA1C 5D2LE 3BN9D 5ADPH 3CIQA 3GSVB 3GMNB 4M48H 5IHZB 1A5FL 3L5WB 4S1SH 3DV4A 2R2EA 5FUZH 2Y07H 1FC1A 4APQB 4YPJA 5CS7A 4ALAH 1WAAE 1OTSD 3HMXL 1WZMA 5T3ZL 3O8XA 3A6CH 3FTGB 1GVIA 2BNQD 5EIIB 2PCPB 4LLDB 1E4XL 3H7LA 1TQBB 4X99A 1EJOH 4U1KA 1TTGA 4R2GC 1JHLH 1IGTA 1BF2A 1OTUC 1T20A 3Q1SL 4HV8B 5DURB 4XTRD 3L3HB 5IHLB 1I3UA 3JWDH 2GT9B 2RQ8A 3LS4H 5MHSE 1UJ3C 1F58H 3ALWA 1S9KC 1ZA6A 4LPYA 3C8HA 4YXHL 15C8L 3QJFA 5GSVB 5FOJA 1V3KA 1DSFL 1CDGA 1RHHA 2OP4H 5E1AA 4MDIA 3JVGC 1R5VB 2CLVB 4OCLC 4FQ2L 4G9FE 4IHOA 5HDQL 2DQDL 2V9QA 3TVMB 4PJBE 4Q97A 3KYKL 1HYSD 2HMIC 2VZSA 5BJTB 3BD3A 2VWEE 2F53D 5GPRA 3UYPA 1SVCP 2VDKH 4XGZA 4XX1E 5E8NA 3V0VA 2X89A 1ZHKB 4OLZH 5E00A 5T1MA 1GZQB 4LASL 3JTTA 2BSSA 4OCSL 2J8UA 5ALCH 5C3TA 4KI5D 4RFNC 5HHPA 2DQUH 1QNZH 2GTZA 1CICB 3EOTH 3OB8A 5DJAA 4NQVB 3TYGH 1R3JA 1MCCA 2OSLA 5ELIA 5FHBL 2F58L 4XBPA 4J6RL 1Y0LB 4XXCA 4Y1AB 5DD6A 3KJ4B 4L1HA 5DXWA 2I26N 5CBAA 4OLUL 3S6CA 3P0VL 5E6IB 1T89A 3HI1B 1KJVB 1EUUA 1RFDH 2GJ6B 4NHUA 5DMIH 3RAJH 4EKXA 2BRRH 2FBJH 4OZIA 1W0YT 2Z93A 2R4SH 4OB5L 2VQUA 5D96B 2DYPD 4JN2A 2DQCH 4RDQG 1AQKL 5IMKA 3QH3B 5IMOB 5EBMB 1KCLA 5C07A 2EDEA 4YNYA 5JUEH 6FABH 3UTZA 1EEYB 2H26A 4OD2A 1FFPB 5DO2C 4DJMA 4PRNB 5JW3L 4FG6C 1HN1A 1MRCH 4D2NA 2HFGL 1Q72H 1S7RB 4U33A 4KTDH 5FA3A 3OKEA 3S36L 1FVEB 2VQ1A 3GMOB 1RUMH 1BD2B 3UO1H 1HZHH 2DLFH 4I1NB 4E0RA 4Y4FA 3MLYL 25C8H 1IEAA 1MHHA 3FQTB 3T0WA 1S8DB 3C09C 3VXTA 1RD6A 1MCPH 1QYGL 4BQCA 1MFEH 1FCCA 3FAXA 4LNRA 3DIFB 3QDMD 1RJYA 1JHKL 1P6AB 4TSBH 1CZ8L 1TLKA 4M43H 1BFVL 5IJVA 3BXNB 4UMGA 4LAJH 5M95B 4N90E 1T21B 1KTLB 3L7FB 3DUSA 1D6VH 1VEPA 3OAYH 4MYWB 1HHKA 3QDJA 4JJ5B 1XF4A 1J0JA 1IGFH 4AK1A 4G6ML 2ITCB 4XNQB 3WNKA 1R24A 4IIQC 5C0DA 2NX5A 2FBOJ 3UYRH 3ULSB 1HSAB 4ZG1A 4PJHA 4F57L 4QO1A 1P7KB 1I8KA 2PXYC 1MFAL 4LHUB 2AABH 3L3DA 3DYMA 3FFCB 2N7BA 5DSCA 4CKVX 3P4NB 4CW1B 3QDAA 2FR4B 4PJ7E 2PYEB 3RWCB 3NMEA 4JM2A 4NQEA 3BD4A 4A2MA 3DRTB 1SMOA 1DUYB 3ZKMC 3GEWB 3H0TB 4MCYA 4AH2A 1Y6MR 2HJFA 1LEIB 1NC2D 3B9KC 4ZS6D 2E9WA 3EUUA 3TO4B 1SM3L 4KZDH 5EUOB 3AM8A 4EI5D 7FABL 4HULB 1W2KT 4YXKH 5C09A 3TBTB 1YEHL 4M7LT 5DMJB 4KKAC 4LU5L 4JVWA 4JLRB 1A14H 3B8YA 4OFIA 3BEVA 3DVNA 1PKQA 3V95A 4MLIA 5CSZA 1GGIL 2FWOA 4AG4L 1RULL 4P9MH 4KROB 4LVEA 1OAUL 2V5RA 4ZSOE 3O11A 1WFNA 1KXVC 4PRPE 4X8XA 4MWFB 1CE6B 3BH8B 1MUJA 1NQBA 3QCTL 4R7DB 4LEOB 3U1SH 1F3JB 3GB7A 3MLXL 4JO2L 5F1OB 3DBXA 1Q9LA 1U8KB 4KMTH 3SY0A 4DN3L 4IMKC 2R0KL 4ETQB 2VDQL 4M5ZH 1S9XA 2ZKHH 3S96B 4OQTL 1GHFH 1HHJB 4XC3H 2ADFL 4PB9L 1HILB 2FB4L 3DNKA 3EO1A 3VXMA 5JIIA 1INQB 3QUYC 1X5FA 4Z7UF 5HYJA 2QQKH 3KPSA 1I7UB 2DM2A 3HPLA 2J1KA 1JN6A 2IQ9L 2VL4A 2N7AA 1N8ZA 3VW3L 5EU6B 5IHUH 2C1OB 1RU9H 2HTLC 3ZDZF 3T0EE 1DANU 4DUVA 3MV8A 1FZJB 2HFEA 1Z9MA 3C5JA 4L3AA 4XRCA 5D7KE 5DA0B 1YQVH 1MCEA 5GS3A 5I2IB 2P49B 5HBBA 5IB1B 1S7UB 5EZJA 3M8OL 2YHGA 4M8QB 4GS7C 4XWGL 5J1AA 2V2TB 3OF6D 4RA0C 3FQNB 1MHPH 4K3JL 1YPZA 5ISZA 4ZFZB 4QRTA 4BZYA 2AJXL 4UQ2B 4Y8AA 2BNUB 3DWTA 3O3AA 5EZLA 1ZT7A 4UINH 5D72L 2APBA 4N0UA 3D3VD 2R9HD 4UQ3B 3RZCA 2IBZY 4OCRH 4Z7UB 3G6JF 2EH8L 2QADD 4APQC 5BW7C 1F90L 3CCHA 4K07A 1DBJH 5ANMA 1G7QA 1MIML 4XHQA 2EZ0C 4R8WL 1I4FB 3SKOA 5DEZA 3BH9A 4Z76A 3O6MH 2FJFB 1IZJA 2FEDC 5I1LB 2Y5TB 5B39B 1LGVA 4Q6IA 4QTIL 3IETA 5C92A 4HW6A 1GIGH 3MLZL 4PUBH 5CZKA 3BO8A 3CLEH 3LKSA 2ARJQ 3HE6D 4J4PA 1AO7D 4LEXH 5I1KH 2P1YA 4JHZA 4M1DL 1JZ5A 1JYXA 3V0WL 1FV1B 1IGIL 4HJ0D 3NVQA 2M2DA 3K1KC 1XH3A 1EO8L 1H3UA 3OG6B 1FZKA 3QG7H 3DX6A 3KDMB 1QFWL 1MH5B 1WITA 2YD7A 2OZ4H 1PDKA 2DKMA 3G6JB 4OGZA 3QWRD 2BHUA 3TVMC 1QA9B 2IPUK 4K8RL 1EEUA 3PGFH 2A9ML 3INUL 3GI9H 4PV9A 1MCKA 1MNUH 1A6TB 3TT3H 5IM7A 1A6VH 5CINH 3FMGL 1QEWA 1CIDA 3BYTA 2HH0L 5KVEH 2NYYC 5EO0A 3MMEA 1QLRA 3ZE2F 1ZVHA 1ONQA 3LN9A 5H8DA 2YD1A 4X4ZA 2EEAA 3Q3GA 4EUPH 4P5TA 1JTTA 3O6FA 1HI6A 2VIRB 1EHNA 1QFUL 1JPTH 1M7DA 2YN5A 1Z5LA 1F2QA 1FORL 5ABDE 1LEGA 5I76A 3KJ4C 4C83A 4JCMA 5C0CA 2R23B 5F88A 2VKXA 3BN3B 3MRDB 1EEQA 2CJUL 4KKCD 4NQDA 3SDXF 5TQ0H 2COQA 5ADOL 1EFXB 5DJCA 1CL7I 2EDQA 2MHAB 3VWKB 2DQTL 5D96C 1I85A 2D0FA 5EO9A 3PWUB 5EORH 3RQ3A 1YMMD 1X5ZA 1EMTH 1FL6B 1T03L 5GGQH 1GC1L 1LE9B 3L6FB 3TZVA 4XCEB 3FT2B 3MRNA 3ARBA 4KPHL 5H2BA 5E56A 4K23L 1NKOA 1Z3GH 4P2QA 4M4PA 4DQOH 5H37H 4KVNL 5CEYA 4ODWA 1U93B 4ZUSB 1N2RA 3GIZH 1NCDH 4XBGB 3ILQD 5DC9B 5L88L 5L2JB 5C8JA 1N7ML 2QHRL 3SDCA 3HAEG 2X4TA 3ZYIA 1INDH 4HUUB 1MI5E 3FRPA 2WWKO 3NIFE 4O2CB 1FCGA 3F7YB 3VRLF 3RNQB 5DDHA 4NNYA 4ODHL 1H3PL 3CVHA 4JPWL 1MFCH 4LPUA 3OKKB 5D7IB 4ODXA 4QXWA 4MAUL 3D69A 2DQHH 1IGJB 3RVTD 3LPGA 4KHTH 4HXAH 4HGKC 3SOBH 5CIPH 4OLVH 2AJSH 4GRWH 1WTGT 4KC3B 4BKLB 2IPTL 3RKDC 3REWA 4F7PA 1G7HA 5DD3H 3ZT5A 1HWGB 5CWSB 3IDJA 3O2VL 5BO1L 3IKCA 4LSRL 1CGTA 5T5FL 3VXOA 2P42B 4OM1H 1MY7A 1WFTA 3EO0B 2HT3D 1P69B 3T8XA 1T66D 5LCVH 3MYJA 3BE1H 1OSPL 4KVCL 1ZWIA 1ZGLA 3BHBA 1AFVH 1G7JA 3I3BA 3GSQA 4OM0H 5LBSL 5DD5H 4DWHA 5IQ9B 1DANT 3G6DL 3P3YA 5FYKD 4HIHB 3BGAA 4LCYA 3RGHA 1NAML 1BFOA 4JPKL 3MCKB 4FABL 5F7NC 4OLXL 3QUMA 5FYLD 5DFWH 1KPRA 2FHBA 5TE7H 3PJSA 4FA8A 1YNLL 3UAJC 5JR1H 4LVHB 2WQ8A 3VXPA 4JY4A 3S9DB 1NC4B 2ATPB 3WFCH 1QVOA 4OZGF 4PJ5A 1A0QH 1WBYB 3QRGL 1S5HB 2VLJB 2V5TA 4HS3B 4IMLB 4WFFE 4E41E 4KROC 2AJUL 3W2DH 4EDWL 2XFXA 5HSFA 3DARA 3NAAL 1OAKL 4R90H 3SKJH 4UV7L 2P8PB 2BX5A 3P9MB 1I1YB 5EOCH 2H9GA 2CRMA 5EG6C 3N85H 1J18A 2IAND 4BFBD 4N0CC 3FO9B 1S7SB 5CUSH 2IMNA 1PZ5A 2ZP0T 2CMRH 3QPXH 4MNQA 1A6WL 2H8PB 1ZT1B 2ZNWA 3TA3C 4CUCA 5FA4B 3SDYH 3VCLA 4ZUUB 1Z9OA 2GJZA 5GS0D 1JRHI 1VGKA 4MNGE 2BOCB 3AREA 5FGBA 3EYFB 3ILPB 4M02A 4NZUH 5E24E 2OTWB 1ZGLM 3PGDB 4QHMA 3FRUA 4KK8C 5KVMC 1JPGB 3AS0A 1W72L 4YHNA 1VACA 3QCUL 4IRJB 5GJSH 1XR9A 4PRHD 1IAMA 4OZGB 4I48B 2J6EL 2PO6D 5E8EA 3RGVB 4D9LH 2X4QA 4M9OA 2DYPA 5IP4A 2F5BL 2YC1A 3OKDA 4D9RD 1NFDA 4Z78B 4TN9A 5FF6A 5A2LH 1MAML 2EE3A 1BP3B 4X9GA 5SWZA 1SYSA 1IM3B 4QRRB 5JIKA 2Q86A 4NYLB 1JRHH 3VG9B 4GAGL 3QEUA 1P9MC 1E6OH 2DQIL 1CXHA 4M00A 3MSPA 1A9EA 4ZTOH 1QBBA 1ZANH 1E27B 3DX7A 4XMLL 1MQKH 2YKLL 1RZKL 4L8SB 2N56A 4B50A 5C0RH 3GSRB 4PJDE 5DHVB 2NNAA 3IDIB 4O58H 2MQ3A 1OW0C 1K8IA 1CFTB 4HUWA 3LKQA 1BLNB 3HR5A 2EYTA 4C59B 1AHWB 4RAUA 4CN6A 1VFAB 4ONFL 4R7NA 5SWSE 2MPAH 3Q5YA 5DHYB 4F33B 3GFUA 3QDMA 1D5BB 2A1WH 3SGJA 3ZYZA 2HN7B 4CVXB 3CFCH 4AEHH 2D4DA 1J0KA 2FL5B 3GIVA 2O61A 3MRRB 5T1LD 4HAGA 4Y4HB 2YK1H 4JZNB 3T2NH 3AGVA 3NOIA 1U8JB 4M7LH 5IOPA 3CUPA 3G5YB 2BNRA 4ZXBB 3QUKB 5GRWA 3PWNB 3ECBA 1XEDA 4AIZB 3ROOB 3GHEL 2DBJA 4Y2DA 2BVYA 12E8L 1RZFH 2ZOLA 3SDAC 4EQ3A 3SO5A 4L29B 5DMKA 3UTTD 4CNIA 3VFGH 4N5ED 2DMBA 2EDKA 1YYLL 3NIDE 4YK4B 1QO3B 1ZHLB 5AAMA 3HC0A 3O41A 4L3EB 4JPIA 2DF3A 3HFML 1NUNB 3IFNL 4WEUD 4YE4L 5IVNA 3IF1B 1KJ2A 1FG9C 1VFOA 3PL6D 4G8EB 5E8PA 5DD1L 5ADPL 1SJXA 3JV0A 4M48L 5HHOD 2F5AH 4P23D 4CDGC 3KPQB 4L4TB 4S1SL 5FUZL 2Y07L 5KSVB 4UZGA 4Q9RH 2DWEB 4ALAL 1OPGL 4P0DA 1NLDH 1ACYH 3VWKC 4YPGB 5MEQA 4MZ3A 2P5EB 2K3TA 5DJ0A 3O9WD 1EJOL 5AWNH 1CLCA 1JHLL 3BZEB 1C08B 5E9DA 1GGBH 3TNNA 1EBPA 4OGYH 4TOYH 4X6EA 3MLSH 2XY1A 3JWDL 3PQYA 5DUMH 2D2OA 5KS9F 3VXUA 5T1KB 1Q94B 3CD4A 3LS4L 4LCCB 1X5HA 1F58L 2Z8VC 3DV6B 1UZ8A 4XCYA 4XH2B 4HDIA 3P40A 1BMGA 1QRND 2HWZL 5J4MA 5L2KD 1EHLL 2OR9H 2OP4L 3QO1A 4Z0XA 1TCRB 1FSKB 4LCIH 4R2GD 4XZUA 4PJGA 1N5YH 1BJ8A 3I3DA 3B5TA 3VRIB 2FSEB 1OTUD 4G8GB 1XZ0A 2MQCA 3H9YA 5C86A 4NDMB 3SQOH 3OF6A 3S5LG 4JQVC 3L1OH 5J6HB 5FB8A 3WS6A 2VDKL 5DUBB 4HJGB 3TEUA 1GGUA 3VXQA 3HKFA 1UH3A 4E9LA 3SKUD 4OLZL 3TWCH 5JMOC 2VLKD 3C2AH 3HPJA 3GSNB 1LILA 5ALCL 4TULH 3QXUA 2DQUL 4KQ4L 1QNZL 4CADB 3WL9B 4XVJH 3EOTL 3RWEA 5DI8A 4OQ1A 3QCVH 5JPNA 5KS9B 3UDWC 3NCJH 4YHIB 3JTSB 3AS1A 3VXSE 3IVKA 2C1PA 4WWKA 2HMID 1BJMA 1RFDL 5DMIL 4MDJA 1V8HA 2FBJL 2R4SL 1WBXA 3ARFB 3IDGB 3BRGC 2HLFC 1PAMA 2ZOKA 4MJIB 5JUEL 6FABL 1FNEA 2X7LB 2RGSA 1MRCL 3L7EB 3HI6L 3V8CA 1EHAA 1OP9A 3O3EB 4BFGA 3LH2L 4KTDL 4LVHC 4MA3A 1RUML 3UO1L 5GISH 1B9ZA 1HZHL 2DLFL 4JRWA 3P73B 4NN7B 25C8L 1OD9A 2X9XA 4YHMH 3QFJD 3RWFA 3QUXD 1MCPL 4KTEH 1QRKA 4O5LH 1MFEL 4WV1A 4M1GH 1GPOH 5DO2D 2DLEA 3B5HA 2DMCA 4TSBL 5FYKU 5CBEB 4AYFA 5L8LB 5IG7A 5EO1B 4JHAL 4PP2B 2IG2H 3QA3B 3DECA 1NCUA 4X7SH 1L9MA 1IGFL 1TIUA 1IC4L 4E42B 5BVJB 4TSAH 3AU1A 3VD4A 3MRFB 1A1OB 1UCBL 5EC1B 3QQ3A 4YHPB 4XC1H 2AABL 4IRJC 4CJ1A 1KEMH 5EU5B 3O3DB 3RPIB 4LCWA 1PGRB 2W0KA 3WN5C 5DJ2B 4P4KA 1NFIB 3MODH 3WEXB 1EBAA 3MOQA 2WK2A 2MOVA 4UOW1 4WU7A 4P2OC 4I0PA 1PY9A 1T1ZA 4KZDL 1XGYH 3BKYH 1YUHA 3HUJE 5I1JH 3L5XH 2PXYD 1UKQA 5DD0H 5INCA 1A6UH 1AP2A 3TIDB 2C5DC 4HBCL 4OZFG 4Y5VB 5KAQG 1RJCA 3F12A 3ES6A 2KL6A 1A14L 1Z0MA 3OTTA 4TNWK 5HVHC 3KXFB 1L4IA 1AHWC 5B8CB 4WUUB 4P9ML 4BFIA 5A1AA 4MA7H 3ZKMD 1FQ9C 2XZZA 3TPUB 3B9KD 3T3PF 4HMCA 4CMMB 1BVZA 3U1SL 2YRPA 4ONOA 3NABH 1BVKB 3GUTB 1OGTA 1MCDA 1I8MA 4KMTL 2FH6A 4M5ZL 4NP4H 3VG0H 1LE5A 2ZKHL 1FYTB 4D8PA 1I8IA 1IBGL 2C3XA 2V2XA 4U1JB 5ESAA 4X80L 2BY3A 1QKZH 3BAEH 2V5YA 4ZXBC 4AENA 1VB9A 2QQKL 3BZ4A 2F19H 5HHMD 1IKFH 3BDYH 3X12B 4MAYB 1RU9L 5FO7A 4G80A 3CX5J 4LHJB 4TVPH 1YQVL 3ZT6A 1BQHB 3D25B 2HP4A 2WUCL 4JRXD 2LQRA 4TYUA 1BEYH 4LSVH 3T09A 1NDMA 4HG4K 3QXDA 3PXHA 4JRYD 3QWOA 1YY8A 1T6VN 5B21A 4OT1L 3QUYD 1AE6H 3O45A 1UWEH 4R0LB 3RUGE 1RURH 1H3XA 3WO4B 3CVHH 2CKBA 5DC4B 3FT4A 3DTXA 5KSAB 4JZOB 2W59A 4WI7A 2F74B 1XCQB 1IAII 3RDTA 1QP1A 4AM0A 1TITA 2DM3A 2EDOA 4Y19A 1DBJL 1JK8B 4PS4H 4WFHE 5D2NA 3O6ML 4IOIB 1SEBA 2WLYA 3WUZA 1WFUA 5DJ6B 5D7SL 3QJHA 4KJYB 1EPFA 3UPCA 1J0IA 5F7EL 4PUBL 3OKNA 1HH9B 3PWVB 1CYGA 4X4MA 5IB3B 4LEXL 2UWEF 5EH1A 3IU4L 1X5JA 4M7JH 2H6PB 5KSBF 5TDPA 5TFSL 4D9QD 4RIRA 3QXWA 1KCRH 1IM9A 1H0DA 2EZ0D 3QG7L 4A6YA 1YYMH 4HUXB 3QUMH 2FEDD 4U1MA 1MHEA 2F8XC 1FSKC 4ZPVB 3OSKA 3MNWA 4OFYA 3REVA 4AIOA 2OZ4L 3HG1D 2A9NH 4JG0H 2UYLA 4OUUB 1J87A 2AP2A 4NZJA 5I18H 5C08B 1PQZA 3NZ8A 3PGFL 1P4BL 5H94B 3GI9L 1LD9B 3SGDI 4OZFA 4JANA 2ESVE 2WAHA 5FYLL 1A6VL 2BMKA 4KMLB 1JPFA 5CJXC 4GBXA 5F71A 5ACZB 5KVEL 3A6OA 4NRXA 3Q6FA 4PGBA 5DEGA 4HPOH 5EOCJ 4NQCB 1GZPA 2V17H 5JOFB 4RMWA 1JPTL 2FIRT 5DLMH 1WIUA 2XT1B 1DQLH 4HKZB 5IMMB 5HHXL 2G5BA 5EBLB 3ULVF 2NTFA 5TQ0L 2ZUSA 5FDWB 1U8HB 3HRZB 2AK4B 3NTCH 2RIKA 5D1XA 3ARFC 3FHAA 1A7QH 2X4SB 2NYYD 3MBXH 1C5CH 5EORL 1EMTL 5I17B 4MCZA 4Y0GA 5GGQL 5EOTA 5E5MA 2WBJA 5GRVL 5AZEH 4XNMB 4HWBL 3RWGA 2IALB 3WE6A 4Y1AD 3H9SA 4DQOL 4QHLA 5C2UB 3JWNC 4MQSB 1JNJA 3NPSC 2R1YA 3SE9H 2GJ6D 1CL7L 1HCFX 1MQ8A 3GMPB 1V3MA 1NCDL 5B38G 1B3JA 4NN7C 1R5IA 3AAZB 5C6PB 2W0PA 3ESVF 5HJ3A 1INDL 5I1HL 1XGQA 5JHDD 4HUVA 2VXUH 1MRDH 4XNUH 3CDGB 5TJWK 1TENA 4U3HA 3TBVB 4NZTL 3TBSA 2EC8A 3MXWH 1MFCL 3ETBF 4OZ4B 4NJAH 4RQQB 3QUZB 3S4SG 4RGMC 4U6XB 2DQHL 1DE4A 5F21B 5BZWA 1NCWH 4HAFA 4NFBA 4HXAL 1ZLVK 4OLVL 2DBLH 3RTQB 3M17A 2OR7A 3SBWA 1PG7W 2NLJA 5C71A 3I75A 3QSKB 3BDBA 2W65A 1DVFC 2VLLA 4OM1L 3J8F7 4NN5B 4JFYA 1A1NA 5LCVL 4LPXA 3W82A 3BE1L 4L3CA 4P48A 1P4IH 1SHMA 3D39E 1AFVL 4OM0L 3MRKA 3FT3A 2V5SA 2FJGA 5I16B 1X4YA 2AKRB 3QEQB 3MOAH 2JELH 3RKDD 2EXYC 1R5WA 5ENWB 1IT9H 3WHXA 5TH2A 2LU4A 1J5OH 1QBAA 3VFUB 2Z4QA 1K4CA 1M1SA 5TE7L 3FFCD 3U6RA 1OL0A 2CGRH 1AGBB 3CZFB 5I8EA 2WINB 3N9GH 1F97A 1ZGLP 4K2UH 4JJHA 4PJFB 5MENA 4WTWA 3WFCL 2PYED 3CFJB 4JPVH 1A0QL 3QZWG 3OAUL 4GRWE 5B8CC 2XN9A 1KJ2H 1QSFB 5D2LF 1IC1A 2Q7NA 3FB8B 3CK0H 1QFHA 1VFUA 4R90L 3SKJL 5IV2B 1TFHA 4IRSB 1AKJA 3I6LD 4F2MA 3PWJA 5EOCL 4XPBH 3Q2CA 4HWZA 1WAAF 4AL8L 3UAJD 5CUSL 5C0BA 1WCBB 2CMRL 2VLKA 2F54E 2XI9A 3AXLB 3QPXL 4OJFH 3KPPA 5ETUA 1WCQA 3IRPX 5B3JE 3G08A 4P59H 3SDYL 4L9LB 3VD3A 4XVSH 3JVGA 4WFGD 4HZLA 2VLRE 1N0XH 1ND0B 2HJKA 3MJ8A 4NQSA 4HCRA 1K9TA 4KROD 2KQMA 1BX2B 2D7OA 4NZUL 5E70A 4JEGB 3PP4H 4MAYC 3IXTB 2MNUA 5GJSL 1UEYA 3LKPB 4I4WA 1HINH 3UTQA 3G5ZB 3W0WE 4D9LL 3WJJC 5TDNA 5KOMC 3ZDXE 5E0QA 4N0CD 4YBLB 2PW2A 4W6YB 2NW3A 3BP6B 2ITDA 1UYWL 3TA3D 4YX2L 2J4WH 1JRHL 2Q76A 1GH7A 4PJBF 1CFQB 1E6OL 3EFFA 3ZTNL 4BSVA 1F3DH 1H5BB 4R0LC 4YXLL 5K9KB 3UZEA 3QNXA 1ZANL 1YNTB 4KK8D 4ZTOL 3WO4C 1MQKL 5EU6D 4I8DA 3U0TA 5DVMA 4GKNB 1X5KA 5C0RL 5L6YH 1FO0B 4NKOA 5KSAC 2NY0C 3G9VA 4M61B 4O58L 2IBBA 1AXSB 3SDDB 4RMVA 3Q6GH 2P5WB 3A67H 2JE8A 4TTDC 4NO3A 5D4QA 2DI7A 3FQRB 4OF8A 4FXKA 2X4PA 1KCUH 4JREC 5I15H 5CSBA 2YMXH 4KGJA 4XNYH 3X3FL 1UB5B 2VITA 3QI9C 2ENYA 4X7FC 4YDVA 4M6MH 3QFDA 2AXFB 3CFCL 4AEHL 4G9FB 4R4NC 3BZFA 2VKWA 5DJXA 1G7LA 1HWHB 4PJBB 4DW2H 1D3CA 2YK1L 3T2NL 1TETH 1Q9KB 3WIHA 2SEBA 4X5XB 4ODVH 4W4NA 1U9KA 4JFXA 1MLBB 3UTSA 4PJEA 1BZ9B 3HB3C 1QOKA 4HFWB 1RZFL 2Z31A 1YJDC 5CILH 5HHVH 3V5HB 1NEUA 1DLHA 1GXEA 2C7UA 3MRPA 4LF3A 3VFGL 2MWCA 3LCYA 2CXGA 3UXFA 5D7LD 1ZEAH 2J8UE 4W4OA 3OKLA 3QZWA 3NA4A 1XGPA 2E7CA 2NR6C 3K2MC 1JF1B 3X11A 2EDBA 4EDXA 1J8HB 4AT6A 3NZHH 5JO5B 3SDAD 2F5AL 4OZIE 3DGGB 1MJJA 1FC2D 1Q8MA 4ZO6A 3IFLH 3MC0A 1IC5L 5JIHA 3IS0X 2P24B 1S9VB 1YZZA 1NLDL 1ACYL 4JQXA 3MLTB 4J23A 2OK0H 1KGCE 4LLYA 5CEZH 5A2KH 2ENSA 4PV8A 4OCXH 3DUHA 3MA9H 1MCFA 2BY0A 2H2SC 3GRWA 4ZD3H 4JFOB 1GGBL 4QRUA 4PJ7F 4XCFH 1H15B 2XWJA 3QB7C 4OGYL 1N4XH 4BQ8A 4TOYL 3MLSL 2BOBB 3BOVA 1A6AB 4H0GA 5DUML 1JNHA 4RZCA 4NUGH 1N0LA 2G2RB 3ZTJG 1ZHNB 1EFXD 4R96B 4MJ5B 4BH8A 2FX7H 3VWKD 2X41A 1PG7L 5CZXC 2OR9L 2HG5A 3QQNA 3HN3A 1WT5A 3ULVC 1N5YL 3VH8B 3TC9A 2D9QB 5KN5B 1TZIB 35C8H 4XPTH 3OX8A 3WDHA 3WJLA 4B0MM 2VJXA 4LGSB 1W8NA 3QDJE 1HQRB 3L1OL 5IVXF 5TDOA 4Q74A 1U58A 2VABB 3P9WB 3SO3B 4D3CH 4TSCL 2NX5E 2NXZB 3HMWL 3MFGB 5FAAA 4PJHE 1A4KB 1CE1L 3C2AL 1DDHB 3HLAB 4TULL 3O6KH 4DVBA 5BRZA 1HE7A 2UVEA 4XVJL 5E8OA 3O2WH 1KT2A 3WLWC 3X14A 1CFBA 4K9EH 2VUOA 5HY9B 3N1FC 4M7ZB 3OZ9H 1KNOB 5K33A 3W9DB 1YNKH 1I1FB 4NQEE 1K4DB 2BVOA 4WHYG 3W11C 3K2UH 4P9HL 1QFPA 3KPNA 1MCNA 1CGYA 4LBEA 4U1HA 3MLVH 4ZFFA 2A73A 5AUMB 4J3OC 4DK6A 1MCJA 1EV2E 5HGAA 1M05A 3MNZB 4LLQA 3TYFB 5HGHB 1XAUA 5EBWB 3U4AA 2X4UB 4N0RA 3GMNA 5C09E 1CLZH 4PLNC 5IHZA 5IVXB 1B90A 3L5WA 1ZV5A 2VLMD 4ZSOB 2H45A 1HK6A 4UILH 1XGTA 4APQA 1CG9A 3SJVD 5FYKH 1PKQE 3MROB 4JAMA 4M7KL 2R0ZH 2GSIB 4U1NB 5IESH 3NCCB 5EIIA 5GISL 4I9WD 3VMNA 1NEZA 1TZGH 4LLDA 1ZLWH 4PBVC 4JFFE 3K8KA 3V6FB 1WISA 4YHML 2HLFD 2CKBH 2I9LA 4KTEL 3ZHDA 2X4NB 3L3HA 4IRSC 1UG9A 3F65A 3CVIH 4M1GL 4MS8C 1GPOL 2GT9A 2Y7QA 5J56B 3PHQB 4KY1H 3PNWB 4DGYL 1KJ3H 4RRPA 4NFCA 2Z35B 2LFGA 3VXME 5HYJE 3T0EB 4TUJB 1NC4D 5EUKB 4L9LC 3KPSE 4X7SL 4TSAL 4Z77A 4K3DH 4ZUTA 3TVMA 2ZG3A 1B6DA 2PW1B 4U3XA 2Q8BH 3MV8E 4WFED 5BJTA 4YUEH 4XC1L 1QBLL 1LO0H 2D7QA 2OMNA 3FB6A 2QSCH 1KEML 3K46A 1RUAH 2FIKB 3CSGA 3UBXB 4XT1C 4YBLC 1GZQA 4PJXB 2AVGA 3MODL 5DZLA 3SKMB 1HEZB 1YPZE 3HZKA 4A6YH 4FTVD 5ISZE 3RIAK 1PLGL 1CICA 1T5WB 3O4LD 4NQVA 3KJ6H 1U92B 1MAJA 4X5LA 3LB6C 1Y0LA 2EYRA 3T0XA 1XGYL 4N0UE 3L5XL 4LRNH 1X5LA 5ILTH 5DD0L 3ZYJA 1A6UL 5E6IA 4L4VD 1CLOH 1JF5A 3HI1A 4OZFH 3FQXA 4MX7A 3MZGB 4EQ2A 5ANME 1JBJA 3SDDC 3N0PB 4GAYA 3QH3A 5EBMA 5EC2B 3C60B 4OKDA 1O7SA 2AGJH 4MB3A 1J12A 4MA7L 5CAYB 5IB2B 4DKEH 1FFPA 1ZLUH 4P2OD 4PRNA 2UZXB 4HKJB 1W0WB 1ZAGA 2LU3A 1S7RA 3RKPA 1G6VK 4QOKB 2AXGB 4U4BA 3GMOA 1BD2A 4N8VB 1EAJA 1T2QH 1RK0B 4FHBD 4FP8H 3VG0L 4Y89A 5IEHB 4JDZB 4L4JA 4UOW0 3S3SA 1ED3B 2VWEC 1S8DA 3GMQA 3ULUH 1QKZL 3BAEL 1OB1A 2DKSA 4LRIC 3AS2A 5AD0B 4H20L 2L0DA 5JXAL 4PPTA 1IKFL 2P7TB 1NGPH 1WV7T 2VDRL 3BDYL 4KKBC 3DIFA 1HHHB 2GUOA 3BXNA 4G8FB 1T21A 2AEQH 2DTMH 4KRPD 4Y16B 4TVPL 4JJ5A 1KN4H 3VI4F 3ULSA 1HSAA 3O3UN 4GRMB 3NIFF 4QRSB 5FYJD 5F70A 2XKNB 4ODTH 4LHUA 4ZXBD 4U7MA 3H42L 1UWEL 4ELKB 3UC0H 2B1AL 1RURL 3V52H 5C0CE 1VGEL 3P4NA 3T0BA 1U0QA 2HRLA 3FB5A 2FR4A 3T4AB 3CGTA 4NQDE 5INDB 1C1EH 3QQ4B 3DRTA 3ZSSA 1UXWB 3VMOA 1LEIA 4DUWA 3E0GA 4PS4L 3N1PC 3TO4A 5EUOA 4F7MB 4L3ED 3EYOA 4POZC 3B43A 4Z95H 4IBLT 1AC0A 2DIAA 4P2QE 2UY7A 3KPLA 3V7AG 1JFQL 3EW3B 4TVPE 5KOVC 1IAIL 3O0RH 1ROWA 2Y25A 3C8KB 5EIQA 1IC7H 1KCRL 1CE6A 3NCBB 1UB6B 4YDKH 4PJ9B 4R7DA 1YYML 3MACH 4LEOA 1ZTXH 2P5ED 3QUML 1WWAX 2CKNA 1KLGA 2GY5A 5FM8A 1U8KA 4JG0L 2YS4A 4EN3D 1RIHH 3CFDB 1D5ZB 1CXKA 1HHJA 3TFKC 4O02H 1B0RB 4LHQB 2JJWA 1HILA 4NO0B 2YN3A 1MIEH 1INQA 5M94B 3OAZH 4OKVA 3SO3C 5FOBB 4FFVC 5T1KD 2NXZC 3TN0B 3GMLB 5FFLA 4HT1H 4XBEH 3TBWB 1UEMA 1QSED 1A9BB 1CR9H 1FL5B 4WO4B 3MRIA 2DLGA 4TUOB 3U9PL 2BHZA 1I7RB 5DLML 3FQWB 1DQLL 4KJQC 4M7ZC 1FPTL 1RUKH 4X7TA 1S7UA 3CFBB 5IB1A 1DEEB 4JFZH 4M8QA 3PWLB 3SHSA 8FABB 2V2TA 5IIEB 3CMGA 4JB9H 3FQNA 1G1YA 5CZVH 4QYOB 3JV4B 3NTCL 2MTPA 4HCRH 4UQ2A 5FO8B 3PHOA 2QV2A 3UJIH 2I07B 2AQ1A 1C5CL 3MBXL 4Z0BH 5ESVA 4NNXA 3HZMA 4UQ3A 2CDFA 1ZLWK 2CIKA 1GRWA 5BS0D 3VFVA 3BISA 4K7PL 5K9QG 3Q48A 4ZAKB 3IU3A 4PJ5E 1I4FA 2NY5H 1NMCB 4RFEB 3SE9L 2FJFA 2EIZB 5DK0B 2GK0B 5B39A 1WLHA 2A6KB 4KJWC 4XAKD 1KTRL 1OP5H 3V6ZA 1Z9SA 3MV9B 3OG4B 3U30B 5F1SA 1YDPB 2M1KA 3BJLA 3L3GB 4FN0A 3TH2T 4OIBA 5E08H 2VXUL 1EEZA 2EECA 4XNUL 1EXUB 5F9AC 4MNQE 1FV1A 4NRZA 4NJAL 4MSWB 4X6BB 5ITBH 5HGBA 2D31B 4JFHE 2H32B 1NCWL 5D6CA 3T0EC 3VFOA 3OJ2C 3KDMA 3B2UC 1AR2A 4UTAH 4Y4KB 5DQ9A 4C58B 2EDDA 4LP4A 4KDTC 4JKPH 5IB4B 3S35H 4F3FB 1KC5L 1VPOH 4X9BA 1UACL 1MLCB 1S7WA 3SE4A 4NN6B 4X9IA 3I02A 3KYNB 4I0KA 2OXGA 1CGWA 1NFDE 1U6AH 3STLB 5SWZE 2A83B 1MCBA 3WIHH 1ES0B 5CGYD 1C16B 4HF5H 1JTPA 1P4IL 1JGDA 1DQTA 3S8WA 4P2CG 5D70H 2VIRA 2JELL 3MOAL 4GW5A 3FL7A 1DQQB 3MGTB 4RGNE 4EOWH 1KSRA 5I1AB 1UM6H 2QQNH 2R23A 2GCYB 4U1LB 1J5OL 3MRDA 4H5SB 3MV7A 5CLWA 3BKML 2KPNA 2JIXB 5A43C 1EFXA 1J1OH 1DVFD 4K71C 4AQ1B 5HDBE 3OR6A 3LVEA 1W72B 1ZLUK 5HI5C 3N9GL 2R0WH 4K2UL 2BNQB 3OR7B 3SE8L 5D71H 3PWUA 4JPVL 1A7OH 3GM8A 3C60C 1FL6A 4RMRA 1C12B 4LKXA 2Z91B 4HIEB 3QDME 2XQYK 1KJ2L 1MVUA 1LE9A 3L6FA 4UAOB 4WW1B 2D3VA 3CK0L 1DCLA 1LO5B 2EXYD 2RB8A 4MD4B 2E6JA 4WGVB 3SE3A 3U0PA 3DVGB 1U93A 4ZUSA 2BFVH 4OBSA 4XPBL 2A38A 3EO9H 4XBGA 2BNRE 4EIZC 1RMFH 4P59L 4YR6B 3HNVH 3MGOB 2RJMA 4HUUA 4ZNEA 3P2TA 3WFEH 1N0XL 4H1LG 3GRWH 5B3NA 5I75B 3F7YA 3BPNC 4OD3H 2WIIB 3LQAH 4FQ1H 2AJZB 5D7JC 3PP4L 2F53B 3OKKA 5D7IA 3X17A 4C4KT 4JQVA 4PY7A 4G6FD 5FKAB 4V1DA 1V05A 1MWAL 4FQXA 5IK3B 3TNMA 1OT1A 3ZE0E 4HEPG 2J4WL 1FIGH 1BZ7A 3BI9X 3T0VA 2R69H 2WQRA 5FUCE 1GAFH 5CWSA 4UBDC 1DZBA 3DETC 1REIA 4BH7B 1V5JA 4MAYD 1FLRH 2X40A 3MJ6A 4GO6B 5T3XH 1KN2H 4C56A 4ODUA 3NBNA 1KXTB 3AB0B 3Q6GL 5IQ9A 1S3KL 4K8RC 3NH7H 2HFTA 3QP3A 2EKSB 3BWAB 4HIHA 2FGWH 1MJUH 1U8NB 2B1HH 3MCKA 1BPVA 1KCUL 3KR3L 3MRGB 5E9DE 3QDHA 2YMXL 2XRAH 4DUXA 1CFNB 1NBVH 4KDWA 4M6ML 3PQYE 4KGLA 2ATPA 1AI1L 1U8MB 4WJ5B 3VXUE 4AJ0A 5HI3C 5F3BB 3EHBC 5FO9B 2NY0D 2VLJA 2V2WB 1R6VA 1Q1JH 1SYVA 4DW2L 3VJ6A 5HDOA 1TETL 2ED9A 3QIUA 1G6RB 2GIYA 5K9JH 3AMKA 1GGCH 2JJSC 2P8PA 3P9MA 3RIFK 5D5MB 3OAZK 4RCAA 2AXJA 4GXUN 3QI9D 4PLJC 1F6FB 5CILL 2H8PA 5HHVL 1ZT1A 2RFXB 2MFNA 5FA4A 1KUMA 4R4BB 1F4HA 1GC1C 4ZUUA 1IMHC 2W07A 4R4ND 2BOCA 3UPRA 2CLZB 3VXSB 3ILPA 5DRZB 4TTGA 4YIQB 3QDGA 1A4JB 5IWLC 2OTWA 3ORJA 1SBSH 1JPGA 4U6HB 5C0JA 4IRJA 1I3RB 4OZGA 2JK5B 3EOBB 4XWOC 1ETZB 2J12B 3RGVA 2LABA 2R2HB 3HB3D 3NFPA 5DR5H 4Z78A 1PG7X 3ARZA 4FNLH 1IM3A 2DIJA 4QRRA 5K59E 1XIWB 4NYLA 3ARUA 1YEJH 1NC2B 3W39B 4XP9L 1OY3B 3T08A 5CEZL 4OCXL 1E27A 4HH8A 4H1LA 1U8PB 4L8SA 3LSOA 5CJQH 4ZD3L 1K6QH 3W9EB 2H2PC 3IDIA 4KUZH 5EA0H 1AGCB 1CFTA 1BLNA 2OBGA 1N4XL 1OP5K 2FLRT 1MCWM 1IRAY 4ZAKC 1AHWA 1KB9K 3G04B 1NCCH 3ZTJH 1NMCC 2D03H 1M7IA 4D94A 5DHYA 2CRYA 2ZSVA 3HUJF 1D5BA 4UIKH 5JW4R 1UWGL 2HN7A 4OIIH 2YD2A 2H2SD 2FL5A 2FYYB 4NT6B 3MRRA 1RZIB 1V3JA 2DRUA 1JHTB 2XTJE 35C8L 4Y4HA 4MXWH 5GIRB 5CMAB 4JZNA 5HYSG 4W6XB 1OGAA 1U8JA 3G5YA 3QUKA 3PWNA 4D3CL 4LSQH 1FHGA 5LKNA 3P0YL 3U36B 2QKIB 4AIZA 3HE7A 3ROOA 5CEZE 2ZSWA 3DVIA 5BV7L 1TQCB 4NSKA 3QIBC 3O6KL 5CZXD 1KEGH 2X4OB 2VC2H 2KZ1B 4LLVA 4OGAC 3GKWH 3ULVD 4L29A 3N1QC 3OZ9L 4G9DA 1YMME 1YNKL 1YMHB 1QO3A 1FGNH 1ZHLA 3HUJB 4UNUA 2IPKA 4NKIH 2G75B 3K2UL 5J8OA 5H35A 2YBRB 1JWMB 3UTOA 2GSGB 3V79C 1ZHBA 3OKOA 1AGEA 1KB5A 1MJ8H 4PIRF 3IF1A 4ZOBA 3T1WA 1XR8B 4UIMA 5ESQB 2EE6A 2YPLB 2J3SA 3D3VB 4JFPB 5EOQH 1XCTB 1CLZL 3KPQA 4L4TA 3WLWD 1VKXB 1WZKA 4UILL 5IQ7H 2E8ZA 4JY6B 2DWEA 4WTXA 3BSZL 3BW9B 1OM3L 4PTTB 2DQEL 4YPGA 2P46B 5IESL 4LMQE 3W11D 4JKWA 1UFUA 5CLTA 1TZGL 3TH4T 4TPRH 3KHQA 1C08A 3PDOB 4UAOC 2JCCB 2CKBL 1WWBX 1CGXA 5KG9B 3HRPA 1NGZA 3HE6B 4XTRC 3BEWB 5FYJL 1QQDB 4C55A 3SGKC 5ACLA 1IQDB 3CVIL 4M6OL 3CSYA 3CFKB 1Q94A 4LCCA 4KY1L 4PJDA 5I66B 1KJ3L 5EN2A 2KDGA 3DUUB 3DV6A 2ZJSH 4NKMA 4P2RB 1RZGA 4XH2A 1A3QA 1RZKC 3VRJB 4KV5E 4X7DC 1TCRA 4K3DL 5FCSH 3UJTL 1XF2B 3R0MA 1FZMB 4XB8A 3RL2A 2FEEI 5I75C 1QSFD 4LK4A 4P46B 1ADQA 2FSEA 4G8GA 5JPMB 1JWUB 1ZK9A 4PREB 2LE9A 1VFMA 4DVRL 4NDMA 2QSCL 1OT2A 4MS8D 1S7QB 1UXSB 3LOWA 5DUBA 4HJGA 1YECH 5FYKE 1V7NL 1ACZA 5I9QB 5HHQB 5F1NB 1AXIB 1FBIH 3MUHL 4J8RA 4A6YL 5IROC 4CADA 3WL9A 2I9TB 3KJ6L 1IGYB 2NQCA 2XACC 2YXFA 1BM3L 1KPVB 3JTSA 2DJ4A 4PFEA 1NCTA 5C6TH 1FG2B 1K2DB 4GUPB 2APWA 5BZDB 5D1ZD 4X6CB 3AC0A 1CS6A 2EIDA 4Y19E 3ARFA 5ICZB 5D2NE 1TVHB 1T1XB 4QT5B 4X0KB 4MJIA 2IPUG 1A3RH 3D0LB 4PRBB 2AGJL 2AQ3A 4NO2A 3VXNB 4DKEL 3OGCA 2YEZA 2WSKA 1Q9OB 1GGYA 5CJOH 3LB6D 3L7EA 4PGCB 4X4ME 1DUZA 5IUSA 1S9WB 1T2QL 5ITFB 4FP8L 3P73A 3K74B 4FMKA 3SDDD 3DLQR 3H6JA 4CAGA 2XWBA 2E5EA 3ULUL 2YZ8A 4X4YB 3OJVC 1T4KA 4YFEA 1VCAA 4DCQB 3VGBA 2DD8H 2F15A 2B7DT 4RWYH 4D9RE 1NGPL 3CZJA 2QL1A 2D9CA 5MHSD 3CU7A 1AH1A 5F72S 5CBEA 5E4IA 1NUFA 4M9PA 4M4RA 2AEQL 2DTML 4UDUB 2ARJB 4J3UA 4G9FD 1ULVA 4E42A 5BVJA 5IJKC 1KN4L 5IW6B 1FVCB 4I3RH 5IW1A 1Y18B 3SCMB 4Q9CA 1A1OA 5EC1A 5IFJB 4OIAA 5F1KC 3JWDC 1BQLH 4DKFH 1MCLA 1P7QA 5EU5A 4KAQH 3UC0L 3RPIA 3V52L 4KKBD 5T3ZD 3GBNH 1H3TA 1S5IH 3GK8H 5DJ2A 1L6XA 3UZQA 1C1EL 4Y5YB 4GQ9L 3WEXA 3DX9B 4JQIH 1XIWC 4JCLA 5CHNB 4RWHA 3WS3B 3QHTC 3M1BB 1SBBA 4G42B 3ULUE 2ICEB 1FNGA 1S7TB 4JZJB 3TCLA 3ROLA 3LV3B 3FO2B 3TIDA 1UQSB 4H88H 4Z95L 4Y5VA 3OB0H 4GAJH 4J3XA 1JGUL 3OHXB 2IADA 1NBYA 1J8HD 2NY1C 4U05A 4LSPH 3K4AA 3KXFA 2DI8A 2QQQA 3JV6B 2W91A 4WUUA 3WNOA 4WW2B 2DLIA 4OCMC 3PWPA 4WEBL 2X5PA 2ERJB 1CFVH 3TPUA 3IXAA 4U1SB 3B5GA 4YDKL 5EB9A 1SJEA 4CMMA 3MACL 4WCYL 1ZTXL 4POZD 1BVKA 2VQTA 1HXYB 1UM4H 3TO2A 4X6DF 5DJ8B 5C0AA 4QWWC 1RIHL 4O9HH 5EU4A 3MRBB 5DWUH 1FYTA 4NRYA 4O02L 4GRWF 1I3GL 4U1JA 1MIEL 3HNSH 1AIFB 4N1HB 3KYOB 1A8JH 3QYCA 3T4YB 4K7PX 3X12A 4NBZB 3THMH 3TPKA 2X1WL 4XBEL 4MAYA 3TESA 2DICA 4EI6B 1B88A 1CR9L 1Z0NA 4JHWH 3VD5A 3STZB 5B3JF 3RNKB 5K9QI 1BQHA 3D25A 3QXAB 1RUKL 2AJYL 1KXQE 1U8LB 3TFKD 3WD5H 3BD5A 4JB9L 4KKLC 4HJJH 2LVEA 2BZDA 2DQGH 3GKZA 4YEFA 2NXZD 5GHWH 4R0LA 4X6DB 5IR1B 1SJHB 3UJIL 2YSSB 1WZ1H 1D5IH 4Z0BL 4CL7A 5SX4I 5KVFH 4ZO7A 1JV5A 5HYFA 5KSAA 4JZOA 3ZDXF 2F74A 2ILLA 5HYQB 2JJTA 1LQSR 2CDEB 5MENE 2LTQB 1F13A 2CRZA 1EVTC 2NY5L 1TJHH 3FOMA 2XN9E 2FJHB 4IOIA 4XCCH 1WF5A 1BOGB 1MFNA 2I25N 3OKMB 4XXDB 2V7NB 1NBZB 4UT7H 4MMZC 5DJ6A 4C54A 1AD9A 3RWIB 4PJIB 3S37X 5E2VH 1IAKB 1HOCA 4FQLH 4C4KO 4HGWB 4O00A 5EFIB 5T1LB 1HH9A 3PWVA 5E08L 5IB3A 4NQTA 5EBGA 3ZKXB 1EAPA 1NBQA 5C0BE 2VLKE 5DQDL 2Z8WC 1P2CB 4MD0A 4NHCH 4PLKC 1NCAH 4HJ0C 4PRPD 1GOGA 3L3JB 3PABB 1FFOB 1RHFA 5JHLH 1H3VA 2IGFH 3ZLQC 1X3DA 3EZ8A 4LQFH 5L9DL 1QFWI 4UTAL 2FECI 4JGMA 4ZPVA 4DFIA 5DRNA 3VFMA 1A3LH 4K3EH 4KJWD 4OUUA 2VSDA 5J11B 3S35L 4UB0L 1VPOL 4P46C 5C08A 1I1AC 1LVEA 4FQCH 4LARH 3ARDB 5EDXA 3K4DA 1U6AL 4MZ2A 3EYSH 3KNBB 3WIHL 5I9QC 5T1DH 5JXEC 1BFSA 3MRHA 1KG0B 2Y6SC 2XOTA 5GRUH 4NQCA 3T0ED 5LGHH 3GSUB 3BESR 5JOFA 2R39A 5D70L 4K7FA 3O8XB 5D7KD 2I24N 4LFHG 4HKZA 4IRZH 5IMMA 3D85D 5HHOB 2QQNL 1CQKA 3PIQB 4P23B 4U1KB 4S0TD 5A16B 2YZ1A 1DBBH 1IGTB 5C2BH 4KUCF 4X9HA 2GITB 3NCEB 4XMPH 5FDWA 1T20B 3HRZA 2AK4A 3W5NA 2PF6A 2R0WL 1PYWB 4DZ8B 2O5YH 4I0CC 4GG6B 1A7OL 3BZDA 4H26B 5KZCD 4Z5RA 2EC9U 3WFZA 4TNWF 4EUPG 4G6AC 4XNMA 4ZDHA 3LEVH 3QJFB 4JO4L 3VFWA 4MA1B 3W5MA 2IALA 5E1AB 4MDIB 1NMBH 4OZIF 2XA3A 4IHOB 4EIGB 3LPFA 3MJ7B 4OBRA 4W81A 4BZ1H 2WZPD 4JFDA 1SY6A 4KRNA 5CEXA 1YJDL 2W9EL 1MFBH 4H1LH 4R2GB 3C60D 3CAFA 5E8NB 4NZRH 2O93L 1H8OA 3GRWL 1MCIA 4PJEE 5T1MB 1A21A 4OD3L 4NPYB 4EZMA 4RAHA 3LQAL 2OL3A 3CDGA 4FQ1L 3JTTB 1ZKAA 1WFOA 3P4OA 3TBVA 2KQNA 3AFLA 3FONA 4V2CB 3B9VA 2GTZB 3QUZA 2UV3A 1TVBA 4G6JL 4U6XA 5MERB 2PN5A 2E7HA 1UJ3B 3VGDA 5IW3A 4OFDA 3RTQA 3EAKA 3RHWK 4PTUA 1KCSH 2X09A 3SCMC 3RY6A 4RFOH 1Q0YH 2XZQH 4DGVH 1GAFL 3P30H 4GW4B 4JN2B 5C07B 4YNYB 5D7JD 3UTZB 2XWTA 3CDFA 1IKNA 1M71B 3Q5OA 2BJML 1KN2L 5IVOA 2OM5A 4PJHF 4Y5YC 4IS6A 5FA3B 3OKEB 3OB0K 3IAGC 2AKRA 5J9PA 3QEQA 3FAWA 3NH7L 32C2B 1NFKA 4RFNB 5ENWA 1MJUL 3QXVA 4ODSH 1ORSB 4Y4FB 3LEYH 4JZJC 1P7HL 3VFUA 3S88H 4R4FH 4UBDD 4D0CA 2XRAL 3DETD 1AGBA 3CZFA 1YN7B 3P4LA 1NBVL 4F9PC 2WINA 5I1CH 5AG9A 2BXZA 4PJFA 1JI1A 3LN4B 3CFJA 5MEPA 4M93B 4NO5B 1INEH 1KB5H 4LSSH 3MLRH 1WSST 3MRLA 4WW2C 5IJVB 2UZYB 2ERJC 3FB8A 3QUXB 3DUSB 4K8RD 4Z9KB 4WHTB 5K9JL 5TF1H 1L0QA 5IV2A 1P1ZA 4IRSA 4GH7B 5DRWB 2IFGA 2IAMB 5KJRH 4HKBB 4CGTA 5FV2A 5T3XE 3ZE1E 4FZ8H 3AXLA 5I19H 5AEAA 3V4UH 4MQTB 4F37K 4L9LA 4RBPH 5HI3D 1MI5D 3T1FB 3EHBD 5F1IB 4MD5B 3BP7B 1ND0A 2O5ZH 4I18A 1S9YA 3DURA 3VD7A 4ZFOA 3C09B 5BRZE 1SBSL 1DN0B 2NY7H 4YZFE 3D2UD 3QHZL 5BVPL 4MCYB 2DQJL 1T04A 4EBQH 3GNMH 4W68A 4XPHH 1ERNA 4PLJD 2GI7A 3BP6A 3DJ9A 4FNLL 4LSTH 3I50H 4NO0D 3F7VA 2APFA 1CFQA 1YEJL 4JO3H 1J10A 4H8WH 1H5BA 3DVNB 5K9KA 1ADQH 1LK2B 4AEIL 4U1IB 1HQ4B 2PXYB 4LKCA 2FWOB 5F96L 2EDXA 4F8QA 3DI3B 1G7MB 3ZHKA 3O11B 5CJQL 1NSNH 3HNTL 4GKNA 1K6QL 4KUZL 4M61A 4XWOD 5EA0L 3DROA 1AXSA 3GB7B 2P5WA 4AMKH 1YPZF 3FQRA 1NCCL 5JLZB 2D03L 3DXAA 2IQAB 2BSTA 2E7LA 3B9KB 1K5NB 4CDHA 1UB5A 2FX8H 4JFQB 1J0YA 4DEPB 4N68A 3VA6A 2AXFA 5E4EB 3EZJB 4JG1H 1N8ZB 2H2PD 4WFFD 3ZKXC 4E41D 4MXWL 5IVZA 2J8HA 3MV8B 1RVFH 1BECA 1DQDH 2EC9T 2OTPA 4X5XA 4XRCB 5D1QA 5HHMB 4L9DA 3OXSB 2A77H 3HMXA 3T77B 1MLBA 3H7BB 3EGSB 1BZ9A 5J1AB 4MB4A 4HFWA 1QLFB 2VC2L 1YPZB 1PVHA 3QEHB 4QRTB 3GMRA 3GKWL 4MNHA 3GSWB 3ARDC 3O3AB 4JRXB 5EZLB 1EO7A 4JVUA 3WHE0 1ZT7B 4QF1A 1LDSA 1TPXC 4MJ4A 3JUZA 4JRYB 3OJMB 1A64A 3RZCB 5DRXA 3P4MB 2N1KA 5F7FA 1FZOA 1MJ8L 3CCHB 4ZMAT 2KZWA 4QHUA 1TCMA 3O8XC 2ATKB 4JR9L 3DMMA 4MHHG 4HKXB 4Z76B 4JGJA 5LGJB 1J8HA 3QIBD 5EOQL 3JXAA 5SX5H 4ORZC 4OGAD 1TMCB 4MXQC 2M8XA 4UUJB 4PJAA 4Z7VB 4QRPA 4GRLD 5MEOA 2B4CH 1S7XB 1S9VA 1PEWA 4GS7B 5E99H 4Q9QL 3RRQA 3ARGA 4HFUH 5C9KA 3D9AH 3LKRA 1XH3B 2EIEA 4L8BB 5F9JA 4JFOA 1GJIA 1FZKB 2XZAH 1H15A 4RNRB 3LEXB 1U36A 2YPVL 1BD2E 5E7FA 4Y88A 3LRSB 1A6AA 1BWWA 3F58H 1HIMH 3NGBB 4XP1H 5SWSD 2DN7A 4JDTH 3LKOB 2JIXD 3GHBH 1ZHNA 2I5YH 4MJ5A 4R96A 2ZJSL 4JHBA 4M6NL 2DLHA 1YEEH 1OAYL 3S3PA 1DBAL 3AVEA 4PJ8B 1QEWB 3B83A 1T7VA 3HG1B 4LPCA 3VH8A 1T5XB 5EO0B 4HK0A 1N3NA 5KN5A 1VERA 1ONQB 1W0VA 4BUHA 1NUGA 3Q3GB 1MHCB 4OAWB 1HQRA 1M7DB 3OPZH 3DX8B 1Z5LB 2VABA 2JJVA 4XXCC 1YECL 4TRPH 5I8KH 5F88B 3V8OA 1A4KA 4QXTB 3NFNB 1ZOXA 1FBIL 1T89C 2WBWB 5HD8C 2AEIT 3WLBB 2FEEL 4HXBH 2QSQA 3C6LA 3VFTA 4CJ0A 1OCWH 1KNOA 2KH2B 1MCOL 2Z8RA 1I1FA 2OI9C 5C6TL 1K4DA 2HYMA 4X4XB 2DM4A 5CEYB 5EUOE 1IARB 1N2RB 4WGWB 1YC8A 3PV7A 1IAOB 3TYFA 5HGHA 2DL9A 5EBWA 2J2ZA 4M62H 2YUXA 4Y4FC 2VN7A 2A6IB 1KIUA 5C8JB 3VI3E 5CJOL 1ORQB 5BQ7B 2X4TB 1F4WL 1B0WA 3FB7B 2GSIA 4U1NA 4G8IB 4N0FB 5I1DB 2IJ0C 4PBXA 4M93C 4OV5B 3G6AA 4GT7A 4ODXB 2ADGA 2X1QA 3V6FA 3VGEA 3D69B 2BC4A 3IDMB 1OLZA 2FHCA 3QUXC 5C6WH 5L0QB 1PX4A 4OV6F 3KLSA 3KPMA 5JHDB 4MQ7B 4K94H 2X4NA 3DI2B 4RBPK 3NCYS 2NZ9C 4RWYL 4NOFA 2R1WA 1X5AA 4PGJA 3JUYA 2IAMC 3WXWH 4BZ2L 3PNWA 1G7HB 4RGOH 2AJVH 4PP1C 1H8SA 2CO7B 5EUKA 3VXOB 3GSOA 1LO4H 2KBGA 5IT2H 4I3RL 5E6YA 5E7BA 2RCSH 1ZWIB 2PW1A 1G7JB 3GSQB 2FX9L 4WU5A 3EFDH 4KAQL 2ED7A 4U0QB 4LCYB 5FM4A 1L9NA 1BFOB 3UBXA 1CXIA 3AM8C 4P3DA 3QUMB 2FH8A 4PJXA 3PJSB 3SKMA 1HEZA 4JQIL 3WFBH 1T5WA 1RK1B 3MO1B 5IBLC 1MCQA 2VMFA 1U92A 5DK2B 3VXSD 1RZJH 3O4OB 1U2HA 2W0FA 1IFHH 1AGDA 5DMGD 2VZTA 5EU3A 4I77H 4XNZB 1NFDF 2XZCH 1NAKL 2IH1B 4H88L 1DN2A 2XFXB 4GAJL 1T7WA 1BAFH 1W8OA 4LSPL 2EDFA 3HI5H 2H9GB 3ZDZE 3ZHLA 3C5SB 3MNVA 3IFOA 3QO0B 3U0WH 4R97B 1PZ5B 1XIWD 5IB2A 4MNQB 1QFOA 3VCLB 4S2SB 1BIHA 2GJZB 4P9HC 3QT2A 4DEPC 3AREB 2AXGA 4QOKA 2D7MA 5HDBF 5E4EC 1UM4L 3P0GB 3FRUB 4S1QH 1T1WB 2YR3A 4YHNB 5F6HI 5F97E 5I0DA 4O9HL 5DWUL 2ZG2A 1XR9B 4JDZA 4IJ3B 1NGXB 1H3WM 2VH5H 3CSBA 3L5JA 2NY1D 1ED3A 2AJ3B 2E8YA 3HNSL 4GKZA 2WIMA 1I7ZB 5AD0A 2YC1B 5FF6B 3TT1H 2P7TA 4LSUH 4RX4D 5SWZB 3BKCH 1A7PH 4JFFA 3THML 1HHHA 5F7HA 1SYSB 1IGMH 1JL8A 2VZVA 2A6JB 4G8FA 4JHWL 3QBTB 4BQ9A 4Y16A 4YWGH 2NW2B 1YEKH 3HAEB 3V7AE 3RJQB 4RGNB 4QWWD 1SY6H 3DX7B 1T3FB 3TA3B 5I71B 3WD5L 3RZCC 1DBMH 5SX5K 1F4XH 2OTUB 2XKNA 1KFAH 4HUWB 3LKQB 5KTEL 3HR5B 4FFWC 2EYTB 2PTVA 4UU9A 2AS5M 4ELKA 2OL3H 5DT1L 4WHCA 1D5IL <