1YJDH

Crystal structure of human cd28 in complex with the fab fragment of a mitogenic antibody (5.11a1)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
217
structure length
217
Chain Sequence
VQLQQSGPELVKPGTSVRISCEASGYTFTSYYIHWVKQRPGQGLEWIGCIYPGNVNTNYNEKFKDKATLIVDTSSNTAYMQLSRMTSEDSAVYFCTRSHYGLDWNFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a soluble CD28-Fab complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/signaling protein
molecule keywords Fab fragment of 5.11A1 antibody light chain
total genus 37
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2005-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yjdH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yjdH02
3KS0H 2CIIB 1TNNA 1S9XA 4AG4L 3O9WA 5ISZA 1A1OA 5EPMB 5IW6A 4PBWD 4HEPG 3KPNB 3S97C 3UJTL 4ZYKB 1M7IA 2AJSL 4M1CC 2QQQA 4MA3B 4OT1L 4WDIA 5F21B 2YUWA 4LFHD 3KYKL 1I7TB 1S8DB 3JVGA 2BY0A 4LSRH 5I8KL 4I2XA 3T2NH 3K8MA 4QRQA 3SE3A 4F8TA 2B1AL 2NNAA 3H2WA 3M45A 4TOYH 15C8L 5DT1L 1YJDH 4ONHA 5IKCA 4XPGH 5JORA 4XMLH 2D31A 1NCAH 3MLYH 3IS1X 2AKRB 2H6PB 3P11H 3VG0H 1DEDA 1CT8B 4PGEA 3MGAA 3Q48A 3QRGL 1IEAB 2DRUA 4U6VH 2BSED 3I9GL 1MAJA 4UINL 3R0NA 5HYSG 1WCBA 3RWFB 1ZKAA 3PWPE 2Y06H 2YRPA 5CSGA 4I8DA 2DWEB 5F9WC 1NMBH 2BJMH 4RWYL 1X5ZA 3MRFA 3UTSA 3MV7B 3WE6A 4F8QA 3V0VA 1N64H 2KQNA 4KUCF 4U3HA 3CCHA 1LP9F 3MC0A 4KKBC 3ROOB 1J7VR 5DTFB 2KPNA 1WBXB 3U2SA 3WFBL 3BE1L 4JFFB 1LEIB 1QFPA 1QSFE 3HNTH 1UB5A 4JDZA 1RULL 2FX7H 4LSTH 3RKDC 1A1OB 5A1AA 4N5ED 3BHBA 4FQ1H 4C56A 2Y72A 3LV3B 3RY4A 1JGDA 3BKML 3EYVA 5EZOH 3STZB 5J6HA 2R0ZL 4LLDA 3IF1B 3MRKB 2DQUH 4WI5A 4ZPTB 4O2FB 3UROR 3UPAA 5K9QI 1ACYH 4ENEC 3SGJA 3JSSA 4MJ4A 2FJFB 1C5BL 3JBG7 2C9AA 3WIFA 4BKLA 4OCSL 1X6NA 1DE4B 3QFJA 2WAHA 3UTTB 1FFNA 5JQ6H 1NGQL 3AXLA 2FLRT 1EZVX 5HVGB 3BO8A 5DWUH 1UEYA 2XKSA 1WLHA 1XIWD 1K3IA 3QIBA 3MLPA 5C0NC 2X4PB 5HHPA 5EU3B 4GKOA 1RULH 2FX7L 5HYSB 5E8PA 3HI6H 1A4JA 4K3DH 3UZVB 5E2VH 4OCYH 4K7FA 2R29L 4HJJH 3D39D 3X17A 4PJDA 3IDJB 5AWNL 5LAXA 5J9PB 2JELH 1MVUB 4N8VG 1QRKA 3O8XD 1IGFL 3A6CL 3DGCR 4DGIH 4DKEL 3A6OA 1A6TB 3TNMA 3IDMB 4XVUD 4O4YL 5E08L 1QSFA 4M9OA 1J0HA 5H2BA 2YN3A 1DFBL 1AXSA 3FFDA 3MGTB 2D7QA 1A7OL 3H3PL 3LCYA 3QZWA 4X4YA 5J3HC 1NC4B 4M8QA 5FUZL 3FOLA 5FEBA 4R4FH 4M48L 4ELMA 1OVZA 2OTWA 3QIWC 5ITFB 1DBBL 2CK0H 4ZUWB 3V5KB 2Z91A 1T83A 4FQ1L 5BJTB 5E95B 5I9QC 3HNSH 1S9VB 3MX0A 2BOCA 3SE9H 1UYWL 4M3JA 4U7MA 5E6YA 3S37X 1LE9B 2HVJB 2V5MA 4FZ8L 4I0PC 3HA0A 4E9LA 2V2TA 4HXAL 5L7XL 4WHYG 1ZEAL 5D7JD 2G9HA 2AJVL 1F00I 3B8SA 5DMIH 2X9WA 2YA0A 5HGHA 5HGBB 1CF8H 1EH9A 2AGJH 3IFOB 2JIXD 2OSLA 3CXDH 4K55A 4NHCH 2E7MA 3U82B 1EERB 3HZMA 4HGMA 4EN3B 1PYWA 2YPVH 1CYGA 1G84A 3HCVB 5E5UB 1X9QA 3EO9H 4EI5A 3STLB 1JPFA 5D8JL 3S35L 1BWMA 1JMXA 4Z18A 2CH8A 3MO1A 1BFOB 3B9EA 1DBBH 2BFVH 3PWNB 3BX7C 5FYKE 1U8MA 2IANA 3LH2H 1NGXB 5GS2D 4OZFB 3OAYH 1GC1H 2FGWH 5BVPL 3HS0B 3EDFA 4K3EH 1A7QL 2FX8H 3I02A 4XP5H 1D5MB 1QLFB 4UUJA 5FYJL 1D7FA 2PTTA 4AMKL 4MNQA 4E41E 4EBQL 1WT5A 5IW1A 2NY5H 1HOCA 1W8NA 4YC2C 12E8L 3CDYA 1KV3A 1B0RB 2WNGA 4PJEB 4OIAA 4LFHG 3MA9H 4M5YH 4HUWA 5DF0A 4FQXB 1F4HA 1YMHB 4QO1A 5TDPB 3NIDE 1G6RH 1TZIB 1S7VB 4F37F 5ALBL 1AHWB 1VGEH 4PLKC 3MLVH 4G3YH 1UZ8A 2UUDH 3VMNA 1T1XA 1T7VA 2XTLA 4IDJL 2WIIA 2DS4A 4DWHA 3FO9B 1KF9B 2IAMA 3QI9C 1T3FA 1JTTA 3C5JB 3LHPL 3TP4A 2LAAA 3QIWB 3ULVH 1KB9K 1EEYA 3MBXH 3QNYA 1MRCL 2IPTL 5E2TL 4P3WA 3TNNB 2WWKT 4WWKB 3FT3A 3EO0A 1I9JL 3T2NL 2CLVA 2K1MA 5I0DA 1KPUA 4LGRB 2JIXB 1S78D 1RMFL 3PWPA 1MPAH 5IESL 2ESVA 3QDGE 4M02A 1I8MB 4HWEH 2PW1A 2C1OA 2BNRB 4JREC 1DUZB 4FABL 4C56D 4YK4C 2ITDA 4MJIB 4RDQG 5FHBL 5D5MB 3ARBD 1K4CA 1NKRA 4NM8H 1ZSDB 4XH2A 4NZDA 4PG9B 4QRUA 4NHUA 3WD5H 1U8HA 1FHGA 1MCLA 4PJHE 3ZO0A 4HG4K 4R90H 4YHIA 3T0ED 3E3QC 2QSQA 1CK0H 4IRJB 3MLYL 2R2BA 4U1LB 4OZIF 1ZT1B 3ZTNL 4WI2A 3ILPB 4KROB 2FDBP 4AMKH 1KPVB 4H25B 4KMTL 5DYOB 4ZUTA 3E0GA 1IT9L 2J12B 4DCQB 4OLYL 1C08B 3RWHB 4HWUA 1KENH 2VNCA 2J1KA 2WQ8A 5BW7C 1NUGA 1QRNE 5E8EA 3H9SE 3KDMB 4U1KA 4N1EA 1F8TL 1T3FB 1I8KB 2IAMB 5A2LH 5SWSB 2VLRE 5I76B 1CFVL 4GOSA 2BK8A 1HSAA 4J3TA 4E42B 1EJ6A 4XCFL 3FN9A 4KV5E 1A21A 3K3QA 4YGVA 3WHXA 3O6FB 2CIKA 5FDWA 1I4FB 3RUGB 2PO6B 5J6GA 1OPGL 1LO0L 3WIHA 2PYED 2PKDA 3QDGA 1UJ3A 3MACL 3OGOE 4J8RB 1A4KB 5DZNA 35C8L 4E41B 1AR2A 1N0XL 5F6HJ 3KXFB 1XT5A 1U6AL 4AG4H 1Z0MA 4TULL 2IADA 3IFNL 4LLUA 3RI5F 4XVTL 4NQXA 4XC3H 3INUH 4YBLB 4LBEA 3TBVB 2UWEB 4WGWB 5HHME 3ROLB 2XWTB 3MLUH 1U8OB 1YC8A 5JW3L 4AEEA 3MRBB 2C4FU 4XPBH 2QQKH 3FO2B 4G43B 3BI9X 3AM8C 4AL8L 3QRFM 3K8LA 1D5BA 1IAIL 3KPLA 5E2WH 5J57B 3DVNA 2ADFL 5DGQA 5CZVL 1UACH 5DJXA 1DDHA 4KJPC 5HHMD 3AGVA 1Q0XH 4HV8B 2J8UA 5JPNB 2HYMA 3TA3B 2K3TA 5JOPE 2VABB 3VGBA 5DQJA 1KENL 1JWSA 1E4KA 5IMKA 5AAWA 5D96C 3VD3A 5IW1B 4YFEA 2VZUA 2PXYA 4P5KB 1MAMH 2EYTA 1KJVB 3WFDL 2EC9T 2YMXL 2A9NL 4QHUA 1PD6A 1MCWM 2AABL 5FGCE 3DV4A 2W9EH 3VDCA 5FECA 3I75A 4U31A 1HKLH 4BFIA 5FDWB 2IAMC 4RMUA 3SDYL 5BO1H 3IFNH 4N9GB 3KPSB 4LNRA 3WL9A 2XKNB 4RZCA 4APQC 4Y88A 2F8XC 3EUUA 1JBJA 3G9AB 4FXKA 1HXYB 1IKFH 4F3FB 3KLAB 3QQ3A 3ARFB 3ZKQD 2VDLH 4X6EB 5HHNA 3SKNA 4D9LL 2VL5B 5KSAB 3W39B 1JTPA 3VXSE 4PJIA 5FYLH 3GMPB 5FIEA 4FOMA 4H26B 5HDQL 3HAEG 3ZE1F 1WFNA 1P69B 1JPSH 2AAVA 1NGZB 3C5ZC 3KNBA 1E4WH 1FSKC 1NCCH 3MV01 4X4ZA 1F11A 4X5WA 2VLLB 1OGAE 4WO4A 5IV2B 1EIBA 3MRQA 1J11A 1B90A 2DM3A 4ZO6A 4OCXH 4YXKH 4YXLH 1FZKA 4NT6B 4POUB 4ZUWA 4XMKL 3AB0B 1MY7A 3X13A 3ARQA 3LQZB 5T33H 2HVKA 1LO3H 3PWLA 2R4RL 3ZTJG 2GK0A 5MERB 3RWCA 1A6ZB 5GS0C 3QG7H 2R1WA 3O3BA 4R4ND 4Q2ZB 2GK2A 2QQLL 3VRIB 5I1CH 4HZLA 4K3EL 2ARJB 2N7AA 3TBYB 3FB7B 4P2OC 4MB4A 1ONQB 1H3WM 2GTWA 2VDNH 3MXWH 2QEJA 2YD9A 2A6DB 1A6ZA 3D1MC 2AJXH 3MODL 3GBNH 1SBSH 2ENYA 3L6FB 2RGSA 4XHJD 3M8OL 5IW3A 4KK9D 1Z3GL 3RWGA 1I9JH 5GHWL 2A6JA 8FABB 2JJVA 1AP2B 1UB6A 4XZUB 3WJJA 4OD1L 3N06B 3MRQB 4LSVH 1AXTH 3E8UL 2WP3O 3B6SB 5HHOD 4HUUA 2F53E 4KDTC 5E6ID 3BXNB 4K94C 5EIIA 3OKEB 3EO0B 1GHFH 1MCFA 3CMGA 4OM0H 4X9FA 4XP9H 2ESVB 2XTJE 2CDEB 1LK2B 1A3QA 2X2YA 3RZCC 2R0WL 3SBWC 5I71C 3OG6B 1AE6L 1K6QH 2Z8VC 3STZA 5DRZA 1EDQA 2CLVB 2GT9B 5BMFH 3T0EA 5GGSA 2GKIA 3MRDB 4QRSA 3C5ZB 4F58H 3UC0H 3TIDB 4ZFFB 1T1XB 4F3FA 4RAHA 4FQJL 4HPOH 4DGVH 5DFVC 5HHXL 4MA1B 4O00A 1AFVL 2GK0B 3RWCB 1S9YA 4LEXH 4UIKL 3E1F1 4UILH 3UO1H 2X10A 2XZQH 4YAQA 3FB6B 1FAIL 1EEQA 1YEJH 5C0IB 3AB0C 4QRRD 1EVTC 4IOFC 2NY4B 3CU7A 1GL4B 3S6CA 2FL5B 3FT2A 4J6RL 3FCTB 2NW3B 3GZKA 4ZO8A 1KB5B 4KJWC 1IL1A 5DVMA 5I8KH 1NDGA 1W72H 5KSVA 1G9MC 5A16B 2R0WH 3WHE1 4WO4B 3NBNA 3HMXL 1OHQA 4WFGD 3I2CL 1IC4L 43CAA 4LP5A 1YUHB 1BAFH 2F19H 1IQDB 3QEQD 1UACL 3JUYA 1JTOA 1U91B 3EZJB 5C08B 5DD0L 1IEBB 1MF2L 1F4XL 1LGVA 1U8IA 2VITB 3BGMA 4JRYA 1H3PL 2ZP0T 5IB3A 3OKNA 2XV6B 2GITB 5HHNB 3SKNB 1H0DB 2OLDA 3N9GH 3MO1B 3BZ4A 4LVHB 3JUZA 2P7TB 3Q5OA 4YIQA 3GI9H 4OTXH 1NEZG 4Z8FL 3K81A 2CD0A 3RVUD 1RVFL 2A74B 2B4CH 3FZUD 4RA3A 1HWHB 3REWB 1F58H 3UTQA 3T1WA 3VFMB 1PJ9A 3B2VH 3LKRA 4G8GD 4YC2B 5EU5B 4AH2B 2BOCB 2GYSA 3K7UA 4XNMB 3OR6B 5BO1L 4NQSB 3GIVA 1JCKA 4KFZC 1PG7X 1URLA 5HHPB 4WUUA 4QRPD 4LLMA 3RIFK 1FVCB 1S7XB 1C5BH 1V8HA 4HPOL 1GH7A 3L3DB 5FM5O 4YR6A 3S8WA 4M7JL 1I4FA 1L0YA 4QOKA 1HSBB 5I1LB 1YQVL 1Q8MA 3BEVB 4RGND 1J8HB 4Y5YB 3NAAL 3MNWB 5DSCB 1EMTL 3IDMA 3R4DA 3HRZB 3VH8G 5SV4A 3O9WC 5EBMA 2A6KA 3WNKA 4NM4L 4Z7UF 1OP3K 3CFJA 1MFEH 1YMMA 3MBEB 4KH2A 5K9KB 1XIWC 3L3IA 5EOTB 3PXJA 1WJ3A 3X3FH 3BDYL 3ROLA 4YXKL 1CFNA 4YXLL 5J1AA 4GQ9H 4IRSD 1OGAA 4YHPB 3OKDA 4JPWH 1E4WL 1HQRB 5ANMA 5IB2A 4WJ5A 2NZ9C 1S9VA 4K23L 1UM4H 2EZ0D 1MFAL 4UINH 5FKPA 4G8FA 1UZ6E 1HE7A 3VFWA 1CFVH 4CVXA 1KEMH 3N1PC 2RCSH 3P11L 4UV4L 2CK2A 4D3CH 4ONFH 4ETQA 2PO6D 3MCLH 5L8KB 2GQHA 3P73B 1M05A 5GRXG 5JLZB 3K2UH 4ODTH 4ZTOL 3TO2B 4YHLH 3S36H 4X99B 3GDBA 4MDIA 3PL6D 5KN5B 1IM9D 3RWEA 1NFDE 2EO9A 2R4RH 4MXWH 5CP3H 1FE8H 1FIGH 4H1LB 2CXGA 4TUKL 4BZ2L 3CH1B 2DLHA 5C6TL 3LV3A 3ROOA 4Y4HA 5E6IA 4NKOA 5GIRB 4GSDH 3IDYC 1P4IH 2FIKB 3O6FC 3WEXA 2A0LD 4HIHB 4JFQB 3WFZA 3B5TA 3BPNC 3ESUF 4DZBA 4Y4KB 3TBWA 3DXAB 1XCTB 1TCMA 5E8OB 3FO1B 3BKCH 5I15L 3VCLB 1R6VA 1WIPA 3PQYD 5EOCH 4GMTH 3LVEA 4OUOA 3NPSC 3QEGH 5DJZA 4K9EC 4J3SA 4N0UE 1SY6A 4HWZB 4X6DE 3ULUF 4A6YB 2I26N 1RUAL 3RI5K 1H3GA 4ONGH 4X7TA 4LKXB 3EDDA 3SDXF 4ZXBB 4TVSa 1JFQL 1J0IA 5IR1B 3HZYB 2I9LB 4KGLA 4WIQA 3BZEB 5JW5B 1AGCA 4C58B 3QFJE 4OV5B 1YY9C 3UJJH 4ODVH 3AM8A 1DQLH 5FYJD 1AJ7L 4HX1B 4FN0A 4ONHB 2Z35A 2JF1A 1X7QA 1T1ZA 3V6OC 2NY1B 1FNGB 5E00B 5E2UH 3WIHH 1U8PA 5KS9E 3CLFL 3B2UC 1KYOJ 3D9AL 2Q6WA 2XRAH 2NY6D 5MENE 3SDYH 4JHWH 3K4DA 2XFXB 4ZUVB 1WBYB 5C09E 1RUQL 5EZIH 5D7SL 1KJMB 4GAGL 4OSUL 4TSAL 4X80L 1X4YA 5DJAB 3CVIL 4XVSL 4LL9A 2YC1B 4WFFE 1CXIA 3F7RA 4O51B 2E6QA 4EQ2A 2UZIH 5JPMB 2YBRA 4U6YA 4TVPL 2JJSA 1FNSH 2BERA 4ZNEA 2YD4A 4ISVA 2YPKA 3RVVD 4M1GH 1MFNA 5GISH 3U0WH 1OAQL 3OHXA 5IBLC 2Y36L 2I25N 3MRHB 1FPTH 2DQHH 3S4SB 1G6RB 3BPNB 3SOBH 2YKLH 5F7UA 1IVLA 3GNMH 1BQHG 3H9HB 4UDUB 3KPRE 1AR1D 5BZDA 3HCVA 2ADGA 4JN1L 4KKLD 5TGBB 1WZKA 3SY0B 2BVTA 1S9XB 5D7SH 3NN8A 2X6MA 4IOFD 1A6WL 4FQIL 1I1FB 4OD2B 4YDIH 3ZT7A 5BS0E 1WEJL 5MEQA 5E1AB 3LN4B 4V1DE 5B8CB 5C0AA 2JTDA 4PRAA 1WK0A 3NMEA 4I77H 4YUEL 5J1SC 4EZMA 2GUOA 4WNQA 4PJXF 3LQAL 3SO5A 1YY8A 5BJTA 1JZ6A 1KBGH 1W0WA 2Z8WC 1LO4H 5DDHB 4AM0A 1V7ML 1YDPA 4GW4B 1I1AD 2J7LA 1JHKL 1C12B 4MDJB 1BFVL 1WAAF 3MPCA 2X4SB 1TJIL 1MFBH 3WXWH 4P2OB 3H7BB 1B9ZA 2EH7L 2MNUA 3G5VB 5HYQA 3JTSB 4RBPH 4KZDH 4LLMB 3UTPE 3QI9A 3PDOA 4AT6A 3T4YB 2FR4B 4K8RH 3IAQA 4ZQKB 3GJEA 1BQHA 3PIQB 4UDUA 3ORJA 1MFEL 5EBWA 1WBXA 4I18C 4JQIH 4NQTA 4ZOBA 4GG6F 5FHBH 3MJ8A 1Q9LA 1U8PB 4PJBF 4PRBB 1EMTH 4OQ1A 3PL6A 3TGXA 3RUGE 3EYUL 1NAKH 4Y5YA 2H2SD 3UBXB 5CEZH 1IKNC 1MRCH 1EAJA 2IPTH 4H88L 4CVZB 1BGXL 5FOBB 3O6KL 4HWBL 3NCBB 2M1KA 4PJGF 4OCWL 5EZOL 5SWQA 2NX5D 4WNQB 1I8LA 3ESVF 5B4MC 3KLSA 2DL2A 1T7XA 1FFPB 1IQWH 2YK1H 5B8CA 2VYRE 4Y2DC 1ZVHA 2OZ4L 4MVBD 1I7RA 1OP3H 2AEQL 1NFDA 4D3CL 2XA8H 3KPQB 3P9LA 1M71B 1DJSA 1VFBA 5F1NA 1RV6X 4LSRL 1FFOB 2NX5E 4XCFH 2B4CL 4H8WC 4L3EA 1CFSB 2LQRA 3WIIL 5E00A 3QHFL 5SV3A 3ZDYF 4DFHA 5F1IA 5IFJA 2FJGA 4WHCA 4ZFOB 1EUTA 5BRZD 5D1QD 4DJMA 5HSFA 4MA3A 4POZD 4DFIA 5MP6L 1HWGB 3Q1SL 3V52L 2Y07H 1QLEH 4ZUSA 3TT3L 3WS6C 4BA8A 1OWWA 3EYFA 4P23D 3TBSB 3G04A 2WSKA 3PP3H 3PV6B 4Y4HD 3BAEH 3H3PH 3L1OL 4NP4H 4L4TB 3IKCA 2ESVD 3GB7A 4QOKD 4IHOB 4P2RE 4Z76B 2AV1B 3ALXA 4CMMA 4YBHA 1B0GA 1CTOA 4NC2B 4R3SA 5F88B 1WWWX 1J18A 3HLAB 4I0PB 4LLAA 3O3EA 2B5IB 1XGUB 5I1DB 4NOFA 2XTJD 3QIBC 3L3OB 4WI7A 2BNQB 4Y4KD 5FHAL 3V6FA 3BGAA 3DXAA 1KN2L 5C70A 3LEYL 2YUXA 3FB6A 3FB8B 1R24B 3ULUL 2Q87A 4ZFGH 1GIGH 4JPVH 5TE7H 3SE9L 4OB5H 4LLVB 1IM9B 4PRPB 3QR2A 4P5TB 2XZAH 4I4WA 4OFYD 3TN0A 3T65A 2FSEA 3P4OA 4YLQT 5DJ2A 5GGTH 5DMIL 5DMYA 3D25A 3EJYD 3I3EA 4FNLL 1ZMYA 1E4XI 4X99A 3FQXB 3NZ8B 2W9DL 2SEBB 1IGML 1FFOA 4N8VB 1FLRL 3RGHA 4JVUA 4KK5C 3QG7L 2RB8A 3RWEB 3SDXE 1TZGL 4EXKA 5I6XC 4Y2DB 5KN5A 3TVMC 3B9VA 1YN7B 5IT2H 2P49B 1KG0A 1H3VA 1ACZA 3VWJA 2EDDA 5E6ZA 1F6LL 5IHZB 1EFXD 1TMCB 1KULA 1A6VH 2R2CA 2XQYK 2Y5EA 4NQEE 5BV7H 3CGTA 3X11B 5GQBA 2E7LC 4FRWA 4MXVF 1JPGA 2X41A 3JV0A 4MSWB 3CZFA 5T1DH 4NCDA 3QXAB 2B39A 3MNVB 1U8KB 4MJ6B 1WZ1L 3C08H 3BMWA 3ULSA 3EJZC 3GRWA 3IXAA 3B3IB 4NO0D 1OM3L 3ABZA 4UV7H 4HUXB 2MOVA 4G8IB 5HY9B 1ZHKB 4LOUC 2CO6B 2A83B 4PJDE 3UYRL 1XF3B 3A6CH 5C7XH 4NFBA 4QHKJ 3PGCB 3HPJA 2O5XH 2VTFA 2CGRL 5JIKA 2X4OA 2IPKB 3O4LE 5EU5A 4AH2A 2BZDA 3BGFC 3PQYA 3ARBC 3KHOA 3PIQA 4WTXA 1RIHL 3IU4H 4ZOEA 3VXQA 3VD5A 4PB0H 4R4BB 4R8WH 1T03H 4NKIH 4Y4FA 3FQNB 5CMAA 2ARJA 1D6VH 3VJ6A 3BP5A 1Z0NA 5B38A 1EEZB 5EU4A 2DOCA 2WBJD 2ZUTA 3B83A 1A1MB 5E9DE 3ZYOA 3L5XL 3FO0H 1NGYB 4JO4L 1GIGL 1WWBX 4RAVB 1QP1A 1AQKL 1QACA 1NMCB 1N59A 1OQOA 3NIFE 3L3DA 4NBXB 5CKGA 1RK1B 2C3VB 3TF7C 4H8WL 1U91A 2VDPH 4LP4A 2BDNL 1FJ1A 5CJBA 1BLNB 1IGMH 3WO4C 4ODUB 1KEGL 1S7QB 2G60H 3FQUA 4PD4K 1OM3H 4ODSH 4PIRF 2QSCH 4PRAB 3VFMA 4X4XB 3QISA 4JDTL 4JVWA 4HDIB 1NEZA 3IDYB 1CFNB 1VENA 2ATKB 4YPGB 1MF2H 2Y23A 1HH6B 1T20A 1QA9B 4BUGA 4I0CC 1DR9A 3LKRB 1QD0A 4Q6IA 2AXFA 4Q0XH 3DX9B 3D5OF 4U2ZA 4P49A 3HN3A 3LD8B 3QAZC 3QEUB 5H94B 2EDBA 4HGKC 2BCKA 3HR6A 5IB1B 4U6VL 3CAFA 1KLUB 4GBXA 3PDGA 1Z3GH 3OX8B 4Y1AD 3VG0L 3IFPB 1MSPA 3T3ME 4QXUH 2J8UF 3WXWL 5IVXF 3MXVL 1GZQB 1JF5A 1LE5A 3SQOH 4XC3L 3SDCA 1FYTE 1RK0B 3G6JE 15C8H 3WXVL 2BRQA 1H8OA 3PHQA 4OCMC 2FEDD 4XMLL 4E0RA 1EGJA 1A9BB 1CIUA 1O7SA 3MLSL 3OKEA 4CN6A 4HUUB 1CL7I 1F5WA 4P4KD 4OZFG 3DMMC 3UTQB 3AREC 5JHLH 1I3GH 1BVLA 2NCMA 3TA3A 2HJKB 3RBSA 2EC9U 2ZJSL 3QUYC 4OGZA 5K59E 4F58L 2Q8AH 3NACH 5HGGS 1B6DA 5I1EL 4E5XB 4GMSH 3ZT6A 1U3YA 4M6NH 2HJFB 3PP4L 1F45A 1H5BC 2YEZA 5GRJL 2HKFL 4P3DA 1YNTB 4U1KB 5IIEB 4NBZB 4TTDD 3BP5B 5H37H 5IVZB 1OTSC 2RIKA 1OARH 2XWTA 4JM2D 5IBTH 1TJHL 1L7IL 2AXGA 4LSQH 2BOBA 1HHHA 3QUMA 2R69L 4JRXD 1TVBB 3MNZA 5IQ9A 2DTML 4PS4L 3KDMA 2EECA 3VXRA 3BPLB 3TM6A 5JHDE 5I16B 3S96B 4ZXBA 2C4FT 1XCQA 4XAWH 1BOYA 2DQCL 4XI5C 3MRRB 5GSRB 1FNEA 4FFYH 4X7FC 3NGBB 1KT2B 1ITCA 1QVOB 3C6LA 1YQ2A 4G5ZL 1S3KH 3HC3L 4L4VA 2A9NH 1M7DA 1HI6A 5CIPH 5ADPL 1MJJA 3RBGA 1MHHB 2Y7QB 4WW2F 4PLJC 3VH8A 1NC2B 3CDGA 3P0YH 4ZAKC 2EYSB 5C0FB 1FNAA 1JNLH 1KB5L 3VWKB 4F7EB 4Y4KA 3TBWB 3T2QA 3WUZA 1NAML 2APVA 3IETB 1MELA 4Z7NF 4XNUH 4I48A 5DMGD 3T4AA 4HIJB 4X7CC 3KPMA 2X7LB 1EHLL 4DKDC 4YNYB 5FF6B 1AGEA 4KRLB 3MLZH 3H9YA 5T3XH 5GJSH 1AKJD 1YNTA 5JDSA 4LPUA 4PJHA 1QOKA 2WUCH 3LQZA 1F4WL 1R3KB 2W0LA 1RUML 2LVEA 5ISZE 1A7PL 4HWNA 3IVKB 1IC7L 5HI5D 4P9ML 1E27A 5EZLB 3BT2L 1EO5A 2V6HA 1EHNA 3NIFF 4GRWH 4EUPA 5LXGL 4Z7VF 1T2XA 1P7QD 2VAJA 2VDKH 2OTUA 2ZPKL 4JHAH 4PJFF 1MHEB 3MUGB 3VG9C 4MAYA 5ISZD 3QHFH 1W0VB 4XVUC 3MLUL 1KTLB 3WCYA 3D3VA 3BJ91 1S7WB 3CFEB 2VLLA 4R26H 3LQAC 4X7SH 3VXME 5GRUH 1NGPH 3MV9A 3F5WA 1JUFA 3ALWA 4M4RA 1NAMH 2P5EB 4X98A 3DMMD 2WBJB 2YK1L 1Z9OA 3NAAH 1CXKA 5EN2A 2VQTA 1F4AA 2OMNA 3ZKXC 4GBXB 1C5CH 5F7DA 2Q7NA 4ODXA 2FH6A 5D1ZD 5KJRL 3CH8A 3HC4L 2AJYL 4I0PD 3MRJA 4NPYB 2EDFA 2ZUQC 4G8GA 3QSKB 3C60A 4M43L 1MAML 1T0NA 4OCNC 1KSRA 5FYKU 2ICEA 5SX5H 1IC7H 4EI5B 1UWGH 2GCYA 5GGVY 4QOKB 4NIKB 1Q0XL 4L4TD 1P7QB 1CLOH 2DMBA 4C56E 4D8PB 5KVEH 2I07B 2ID5A 2A6IB 4TUKH 1UWEL 1TQBB 4KK9C 2QADB 7CGTA 3F12A 5C09D 4GXVL 5D7LD 4WV1C 4KPHH 4ZD3H 1EHAA 1YYML 3VFNB 2XN9E 5FYJH 2UYLA 1JGVL 3A67L 3SDCD 3S36X 4L29A 1RJLA 2UUDK 3VI3E 3IXAB 3HHRB 4L9DA 4CAGA 2BY2A 2EDOA 3ZKNC 3VW3H 3SGEH 1NDMA 1HXYA 5TDNA 4G42A 3PL6B 3ZLQC 5I15H 2H8PB 1P84J 3B9DA 2N56A 1RIUL 3HMXH 4X98B 4X4YB 3B43A 2DQJH 3W5MA 1CXFA 5ALCH 4L9LB 1FE8L 2VLKD 4YUEH 3QIUB 5D93C 3LHPH 3TJEH 1WFTA 3OL2A 2X40A 4YPGA 3RWIB 1OP5H 4P9HL 2ED8A 4H25A 4ZUTB 4W4NA 2F53D 4M7ZB 5IWLC 1HDMA 1RFDH 3QIBB 1XF2A 1QR1B 2OTUB 3QUML 4YWGH 5IEHB 1S7UA 4LEXL 5MEOA 5C8JA 3OAUL 4P2QA 4AEHL 5C09B 3WHXB 5GZOC 4WUKL 4APQD 2FYYB 1OAYL 5CLWA 4HC1A 1UWGL 4N0YH 4TSBL 3D48R 2WINA 4J7RA 4ZXBD 4PJFB 3KPLB 4LSUL 3T0XA 3QHZH 1XR9A 1RD6A 1YA5A 4LDLB 4M48H 5ENWB 4BK5A 3Q2CA 2V2WB 4KQ4H 4LVHC 3N50A 4LVNB 5HI3C 3ZE0F 4ZODA 3MA7A 4EI5C 4QHNB 1G7IA 4P2YA 1XAUA 2HA1A 1FZJA 2APXA 3MLRH 4QXTB 4YHZH 5I73C 4LLQA 4XVJH 2D7PA 2VAAB 5I0ZA 3ILPA 3GSXB 1G7PA 2ZCKH 2GT9A 3GMOB 5ID1B 1KB9J 1C08A 2H26A 2HKHH 1TQBC 4U1MA 2Y7QA 2F53B 5J13C 1ZGLB 4WFGE 1CDBA 1FVEB 1U95B 3RVTC 3I6KB 4M61B 1CN4A 2BJML 1B6UA 1DUZA 1JRHL 2YPVL 4OCLC 3TFKD 1MHCB 4GKZA 4LQFL 1FORL 1TZIA 4XZUA 5FV1L 4F15C 1XGUA 5I1DA 3C6SA 4M4PA 3IT8D 1DQMH 5D9SA 4GRMB 3ARDC 2IANE 3TFKC 4PTTA 1I3RA 5DMKA 5FA3A 3SKMA 1LP9A 3TCLB 1P7KB 2VZSA 1DVFC 4K71B 4P46C 2X1OA 4JHZA 5J06A 1OB1B 1FNEB 3K4AA 3BRDA 1H3UA 2XG4A 4L3CA 5HHXH 3BKMH 3GMMB 4H0IA 1U3HC 3HC0B 2IANB 2ICWB 4Z6AT 3TNNA 5GS1A 4R7DB 2FJHA 1ZA6A 4Z7VE 5M94B 1P6FA 4IHOA 4CGTA 3U9PH 1Q0YL 5B3JF 12E8H 1EEYB 3I6LD 1G7QA 5LQBL 4I3GA 5L6YL 2PCPB 2J8HA 2UY7A 4I3RL 4P3DB 1XZ0A 5TDPA 1VADA 3H6JA 3QQNA 4XP4L 5CFHA 2RAMA 4O02H 4E5XA 4GO6B 5HGBA 3T8XB 4X6FA 2FJGB 1BD2D 1YEEL 1AHWA 5CZXC 1FYTB 4K9EH 2FEEI 5F96L 1OTSD 5F7WC 4OZGA 5JW5A 2Y5TA 1WV7T 1XCQB 3W9EB 1HHJA 1MFBL 4K3DL 5DJ6B 2EE3A 3OGCA 2R29H 4JZJC 4V2CB 3SKJH 3CX5K 1S5HB 3RVWD 2XKUA 1WZLA 2H3NB 1KCUH 1YEGL 5EU6D 4LU5H 1NGZA 4LHUB 5F1KC 5IB4B 5JXED 1BD2E 2JCCB 3H9SA 5H35B 3MR9B 3D3VD 3AS3A 1TJHH 1UENA 2BSRA 1KCVH 5HGAA 4MNGB 1EJOH 1BP3B 4PP2A 5FXCH 5J13B 4LAQH 3HMWH 4FFZL 4OBSA 4XWOD 1MVFA 4MQSB 4AJ0A 5IHUL 4JRYE 3RIFF 4OZIA 5HHQA 4PRBA 1DEEA 4M7KL 5F72S 5I1EH 4GXVH 1CZ8H 5CEZL 2VXQH 1PAMA 5E1AA 4FQXA 5E6IB 3V5HB 2BSSA 3FRUB 1GGUA 4MJ5A 1A2YB 5SWZA 5TE7L 2YN5A 3C60D 2NTFA 2GJ6D 4R2GC 1A7OH 5DHXB 4CRPA 3BRGC 5BRZB 1NEZB 4NZJA 5D2NE 5GPRA 2IQAB 2HT2D 2HN7A 2F8OA 3P9WB 4P5KA 3V5KA 1FFPA 1QFWI 3FONA 4WRLA 3QDJE 1HILB 1S9WA 3P73A 4NM4H 1HH9B 2X4SA 4XI5D 3RL2A 2MKLC 4Z5RA 1D5XB 3SKJL 3IFLH 1T2QL 4WVRA 2E3VA 2VC2L 3ARRA 3E2HC 5EA0H 4KKLC 4PR5A 3SCMC 1A6VL 1DN2A 5LWYH 4XGZB 5LJYH 4JLRA 2XICA 2NXZC 4LCUB 3DHJA 2J2ZA 4M6AA 5FOJA 3ZHKA 5FM4A 5F8QC 2W1NA 4PJDB 4OSUH 1GAFH 2GI7A 4NP4L 3K4ZA 3VFVB 3FT4B 1QKZH 5ICZA 4I48B 5I75C 4TQEL 1CGUA 2EDJA 1ZHLB 1ZHKA 2Q7YB 3V0AC 4LRIC 4ZPVB 5ELIA 5GGVH 4OCRL 4P59H 4OQTA 2W9LA 5DVNA 2BHYA 3B9KD 3T0AA 1MJ7H 4S1SH 4NBYB 5GGRY 1D6EA 3H3BC 4LSDA 2KH2B 5TGBA 3Q3GA 2XWJB 5IEKA 2Z9TA 2Z91B 4KI5D 5ANME 1KJ2A 5IHUH 3HRZA 5DLML 1M7DB 1AO7D 1EO7A 4UDTA 4L5FH 4DN4H 4HGWB 4L8BA 5FHAH 5IHZA 5ESQA 5GGRB 4ODWB 1DL7L 1MJUH 1SY6H 4FQLH 5IMMA 4FQHA 4UZGA 1TQCB 2YC1A 1BX2B 5EH1A 3V4PL 3CLEL 1HKLL 4E42A 4A6YH 3SDAD 5HHOB 2BX5A 1BZ7B 4X7TB 1WFUA 2LABA 1HHHB 3RAJL 2Y25A 5I9QB 3WO3B 5DXWA 3QDAA 4GAJH 3S35X 4WW2C 3F7PC 4HQQL 5DJ0B 1T1WA 2ZOKB 3GSWA 3O2VL 5H37G 4GFTB 3VRLF 3T0BA 4GMTL 4WV1A 2P5ED 3OKMB 4PJ7F 4MJID 5B39B 4UI2A 3LDBC 4OLWH 1P5UA 2ZCHH 3D25B 1GGIL 3QUZC 5L2KB 1S8DA 3WDJA 3GIZH 2MWCA 5IQ7H 2PXYD 1IAKB 2YSSA 2XFXA 3QIUD 1TLKA 4EN3C 1TETH 3DYMA 5IB3B 1AFVH 1Q9OB 1BFVH 1K8DA 2ZSWB 3BGMB 3A67H 4MJIE 5B39A 4XPGL 3T09A 1T5WB 3X11A 2YWYA 3MRNB 2FCBA 1ZA3A 3ECBB 3FMGL 4AEIL 3PWVA 3K2MC 5J11B 1O7VA 3SEPA 1V05A 5FO7B 2J6EL 2NXZB 4LAJH 3MOQA 5FYLL 4X5XB 4Y1AE 4X6DA 3EFFB 4W70A 2IWGA 3VU2A 2DQJL 3W11C 1NDGB 4XPHL 3SDCB 4POZC 1KBGL 3NABL 5FUCE 3G04B 4GKZB 1UJ3C 5DLMH 5C08D 3AVEA 2ATPA 4HGWA 4MQXC 4GRLD 2YZ8A 1Y18B 4G6JH 4XBPA 3W5NA 3ZL4L 3C5JA 3KPNA 5JIIA 4K3HA 3ZHLA 4OBRA 4F57L 1I3GL 3OKMA 5FYKL 2KUTA 2V7NA 1M71A 1MREH 5C0CA 3DROB 4GS7B 1QHPA 3MFGB 2UZIL 4K2UL 4UT7L 2G9HB 4H5SA 4PRID 5MENA 4GW1B 3O3EB 1MI5D 4LIQL 1MCOL 4WV1B 2Y36H 5ADPH 2IQ9H 2XOTA 3OXSA 3L5WA 1YMMB 3O6FD 3L7FA 1GGIH 4J3VA 3OJ2C 4MS8D 3CPLB 4FXGA 3FQTA 2BFVL 1JGUL 5F9OH 5ITFA 4KKBD 2OTWB 1KIRB 1K8DB 2ZSWA 3MV8D 3KWWB 3QZWB 2GJ6A 4UQ2A 1NSNL 4M7LT 4UQ3A 1R5IA 3CVHL 1IAOA 4LF3B 4PGBA 5DJCB 2GJZA 2BVUA 4CJ1A 1RJCA 5D93B 3LIZL 3VFWB 3LPWA 2R23B 1UZ6F 1ADQH 3ARDD 3MCLL 3ZYZA 1F42A 1J0JA 7FABL 2H32B 3GSRB 4YDJB 5ICZB 3ZHDA 5HTSA 3UMTA 3GKWL 3OR7A 1UFUA 2DQDH 1VACA 1RUPL 1JNNL 4ZPVA 1BQHB 5E2WL 3AU1A 3QULB 2CMRL 3GUTA 2OL3L 2PF6A 5J56B 1NAMA 5D7IE 4QRTB 1IGTA 4PR5B 4ORGB 1VEMA 2F5AL 5SWQB 4KWUA 4HCRH 5FUZH 2MQ0A 3RDTC 2ZKHL 1ODAA 5J12B 2VDQH 2HG5B 3S37H 1KC5L 3BKCL 2Z0BA 3SE8L 2HKFH 1AI1H 2VLKB 1AQDB 4MLSA 3BN9C 5BS0A 4DKEH 5C2BH 1P4IL 3GSOA 1NBYA 4HF5L 1G9ML 1RZGB 4X7EC 2NTFB 2WQRA 3HUJA 1ORSB 4C55A 1YEDB 1LQSR 1A0QL 4IEFB 3FQRB 1NLBH 5MEPB 2ADIB 5HGDA 1UADC 3MRPB 3MUJA 3KXFE 1RJYB 1T4KA 3OTTA 1KYOK 4OF0A 4TSCH 4FMFA 4HC1H 3C5ZD 3TVMB 3S4SA 4F15B 5TE6H 4F2MB 5FAAA 1CLOL 4X6EA 2JJWA 5EFIA 1EA9C 1AY1L 3LIZH 4MB3A 1ZLWH 5INCA 1MWAH 4OLYH 3RHWF 2AQ1A 3BEVA 2DWEA 4PJHF 3AS1A 1U0QA 2CDFB 1JHLL 5EO1B 5D7IA 4BFEA 4OGYH 3ULVD 1DQJB 1IEBA 4CBPA 4EDWH 1HHIA 2VXTL 1A7QH 3O2WL 3RP1A 4WCYH 4TQEH 3W0WA 4OZGB 4UT6H 2OP4H 3N1GC 4NC0B 1YN6B 3HC3H 4U05A 3WHE0 4MQTB 2Z92A 3HR5B 3MRKA 1LVEA 1CE1H 1A6AA 4OLXL 2VWEE 2NY5C 5HI4D 4URTB 2CUIA 3DV6A 5HJ3B 3QPXH 4X9HA 1OY3B 3U4AA 3MACH 4OAWB 2DD8H 2W0FB 1ITBB 1DBMH 2W0KA 3O3DB 2BMKA 5DRXB 3LS4H 3JV5A 1YEIH 4DZBB 4IIQA 4AIZA 2O5XL 1E28A 4Z7OF 1FP5A 3WE6B 4DVRL 4TUJA 3SQBA 1CVRA 5C08A 5LGHH 4L3EE 3GSWB 2GTWB 3BOVA 4R7NB 1Q72L 4UBDC 4GRLB 2VC2H 3TH2T 4WTZG 1OB1A 3P4NA 4HT1H 4Y1AA 4EDXA 5KSAC 4PJCA 3UAJC 1FZJB 4QXTA 1RZKC 3ZYJA 2IAND 1BJ8A 4HK0B 2VDRH 1TIUA 4LKCB 1FO0A 4ACPA 4NN6C 1Y6MR 4ODSL 2MTPA 1XF1A 1KTLA 4EEEA 5IMLA 1BZ9B 5DR5L 3WDIA 1SMOA 3O2DA 3CSBA 5D2LB 5DUMH 1T89C 3MUGA 1RZKL 5EORL 4Y5VC 4S2SA 4M62L 2YPLB 2VDPL 1OAUL 3RWJB 1FVEA 1KJ2B 4OM0L 3SDDD 1J0KA 2FIKA 4JM4H 1VADB 3O6FA 3QAZB 1N7ML 5JXAL 4O4YH 4M6OH 4Y4HC 5E08H 4OIIH 5E4EB 1A7BA 1NUNB 4X0KB 3OQ3B 4AIOA 5ICYB 1ONQA 3T0WA 2EE2A 3DVGB 3TIDA 4ZFFA 4BZYA 3TBYA 4OD3L 1ND0A 4KJQC 3QUXA 5JOPD 4J4PC 4QRSB 1T83C 4HKXA 5EO9B 1I3VA 1G9EA 2DLGA 1G6VK 1SBBA 1W72L 3KPSD 4P2OA 5FK9B 3CU1A 4QTIL 4WU5A 5IVNA 2AXHA 4J23A 5HYEA 4LASL 1JYXA 1P4BL 3BD3A 3VXRD 1X5LA 3SCMB 4XCNA 1AGFA 4I5BA 5I74C 3Q3GB 8CGTA 3PP4H 4OFIA 3QUYB 5B38G 3EGSA 1WISA 1INEH 1FAKT 1FQ9C 4GG6E 1R3LA 2HT4D 4JQIL 1N7MH 2FEDC 3O6ML 1JRHI 4KHTH 4L29B 4UDTB 5JXAH 1HQRA 3BUTA 2IALA 3KS0J 1HHKA 4PB0L 3WEXB 4O58L 4J12A 4RBPK 1FZOA 5CGMA 1I8IA 4JM4L 1KCRH 2CLZB 3ZYIA 1BMGA 5SWZB 1DTUA 4CL7A 5JHLL 4JR9L 2WUBH 1ES0A 3T2PA 1TVHA 3SJVA 4AYFA 2AI0H 2BVEA 2VLJD 3C09B 2VZTA 4MYWB 3O4LA 2HP4A 4JFHD 1MAKA 1INDL 5TFSH 2ICEB 1VKXB 4FXKB 4OTXL 1QNZH 1YY9D 3IJYA 3MBEA 4JFZL 1CGSL 5IB1A 2EIZA 3QO0B 3OAYK 4X6BA 2ZUVA 3BEWA 1D5BB 3NGBC 3O8XB 2HJFA 2IH3A 2DYPD 3VFPB 4HMEA 1OW0C 1LILA 1XGTB 4P57A 2XN9D 5BZWA 5KZCB 1CGWA 3OKOA 1C7SA 3ARGA 1P4BH 1FVCA 1S7XA 3F12B 3OZ9L 3QPQC 5C09A 1JUFB 2EYRA 5DUPH 3QDJB 1I9RL 4FP8L 3D85A 1RJLB 2KDGA 2DBLH 1X5FA 2NY4C 1AO7E 3B5HA 1N4XH 3EYQD 3QDJD 3SE4A 2YD7A 4OQTH 3TPUA 4C4KT 4GG8B 2W92A 1II4E 4OIBA 3QUZB 2HH0L 1JPTL 1A3LL 1CDYA 4JREB 4PGDA 2GW5A 4XTRC 1L9MA 3C60B 3V0WH 4IOIB 3U30C 2DJ4A 3IU3A 1IC1A 5IBLD 4KQ4L 5ACMA 3HMXA 1MRFH 3LB6C 1BWWA 3GSNL 1OAQH 1D5IH 3WJJC 4DAGH 3BP6B 3X14B 4U6HA 3R8QA 2FB4H 3EW3B 3AS0A 5LGKA 4J3UA 2OK0L 3HZKA 3V6ZB 2VZ3A 1P6AB 5DRZB 3T0EB 5KSBA 2ZG1A 4P23B 1TNMA 3HG1D 3OKLA 4FG6D 3W11D 5DK2A 4KKAC 5GSVA 1DSFH 2EDTA 4J4PA 3VXPB 1INDH 1SEQL 1FL6B 2AJYH 2XZQL 1CCZA 1A3LH 4HJJL 2OL3B 4TSCL 2C26A 3QUYD 2UWEE 2YR3A 4OGXH 2DJUA 3W0WD 3QCVH 1EO8H 4MAYB 1MQ8A 2RBLA 2P7TA 5GJTL 1MHPL 1RK1A 1SJVA 2C3VA 2KKQA 2DAVA 4IRSC 1YEKL 5HPMB 4QHLA 4PLNC 5IFHH 2IF7A 2D7TH 2CIKB 1CE1L 1NGYA 1D9KD 3GJFB 5DD1H 5D71H 4HUVA 2IH1B 3PABA 3WUWB 3IAGC 3KHQA 2WZPD 1A22B 5JHDA 5EN2B 1JGVH 4TNWF 2D4DA 2E27L 5IG7B 2FLBT 3V7AG 4BFGA 1ZT1A 4H20L 1G9NH 4IRJA 2EH8L 2WBWB 3FJTA 2IPKA 1I8LC 3GJFA 5SWSE 1M05B 5T1LA 2DQFB 2LFGA 3NCJL 5E8NA 2A1WL 5DYOA 3M8OH 1JZ3A 4PJFA 4YHYB 2AEPH 3DTXA 1UWEH 2X4PA 3GJFK 2VDML 2CKBA 3UTSE 4ERSL 5FA3B 3SKMB 3TCLA 4PLKD 2XNAA 5DMKB 3SKOA 3C60C 4PTTB 3DWTA 4R2GD 3QJHB 4G6AC 1UCBH 4WO4D 1FZKB 2J4WL 2VDRL 5IK3A 4EUPB 1WITA 4F9PA 4KAQL 1YMHA 1I8MA 5E70A 4WFEE 1IGYA 2C4XA 5T3ZD 5L8LB 1X5YA 1XEDA 5I17A 1QQDB 2H1PL 1XF2B 3GMOA 5D96B 1QR1A 4HK0A 4HKZB 1MWAB 4PY7A 3TJEL 1ERNA 1A9BA 4RGNB 5FK9A 4NNPL 3RA7L 4KJQD 1U6AH 5FUOL 3IKCB 2BSTB 3HFMH 4B5EA 4C4KO 5B39G 4OZFA 1HYSC 4RNRA 5CJOL 5GGQL 4PUBH 3QNYB 2Q3ZA 4YO0B 3K0WA 5DD3H 3LKQB 4GH7B 1MWAA 1DLHB 5JHDB 4N8CH 2QQKL 2XWBA 3KR3H 5FGBA 3OB0K 4GAGH 4NT6A 2W0FA 1RZ8B 1LDPL 2CRIA 3MRLB 3U48A 1ADQA 2BNUB 4NZRL 3RDTA 4NNYA 1IMHC 4HLJA 2DQHL 3I75B 5IJKC 4KY1L 3D3VE 4WCYL 1QFWL 3UTZB 1DN0B 1XGQB 4EVNA 1DBML 4HUWB 4E0RB 4KAQH 1OSPH 5MEOB 3O3AA 1HIMH 1ZHBB 4FZEL 1E4XL 5L2JA 1NC4D 2RFXA 1S7QA 1F11B 1NGXA 5DRWB 5DQJB 5FB8A 3V4UL 4CVZA 2QSTA 3U4BH 3C2AL 5IM7A 4KXZH 4GSDL 3D18A 3GNML 3HS0A 4XXCC 2HT3C 2WW8A 4WHTB 5FA4A 2IH1A 3PABB 1A14H 1UC6A 3CFBB 3RVXC 3WUWA 1LO2L 3D85D 2WBKA 4L9LA 4Z0BH 3TVMD 4N9GA 3VFUB 4I2XB 4DVRH 1A3RL 5F9WB 5ID0B 3Q0HA 2NTSP 2OM5A 4W4OA 3X13B 3L3GA 3MV9E 5IBUG 4LNRB 3WD5L 5EIVA 3ALPA 3G6JF 2G75A 4FS0A 5TPWL 4LPTA 3RWDB 3P77A 4OF7A 4X6CF 2OSLB 2I07A 4PGCA 1ORSA 2E5EA 2DYPA 1INQB 4N5UA 4L4JA 2OL3A 1X5KA 2XN9A 2DBLL 4FQCL 1JFQH 4U1JA 3IXTA 5EUOB 3GMNA 1NFIA 4MX7A 1ZLSH 5IBTL 2JCCF 4ODBD 4ELME 1SY6L 2VLKE 4NWTL 1K85A 1UM5L 4YDVB 1K9TA 3NCYS 1A9EB 3V8OA 3FFCB 1UWXH 5CBEB 3DX7A 4P2OD 5B38B 3RPIA 2EKJA 1IGTB 1FG9C 2XACC 3R1GH 4P4KA 3FQNA 5CMAB 1GJIA 3VWJB 3PXHA 4F33A 3UAJD 2VN4A 1GCFA 4Z0BL 2NY3B 2IFGA 1H3TA 5F9DC 1X4ZA 4ELKA 2B0SL 5DUBB 1S7WA 1AGEB 1VPOH 2HTKD 5CJQH 3MROB 3L5XH 4NN6B 1Y0LA 2VH5L 4PGDB 1ZGLP 2W60B 5L7XH 1I8IB 5GZNC 2GAZA 4MD5A 3QUXB 1R0AL 1MVUA 3NA4A 1GZPB 1ES0B 1A8JH 1D9KA 5KVGL 1OSZB 4G8IA 4HG4J 1OTTC 1ZANL 4YK4B 5IMKB 4P4RB 4XRCB 3BQUB 3NFPA 3PGCA 5C07D 1I1YA 4PRDA 4J8RA 2CRYA 3RJQB 4HS3A 2RCSL 4UV4H 3SOBL 5HD8D 4LASH 3ARXA 5F96H 4GAFB 1X5AA 2B8OT 3IDXL 4H20H 4LSSL 1T0MA 1GGCH 1MFAH 4P9MH 5B4MD 3SPVB 1GC1L 2HT4C 5IVXE 2V17L 4N0FA 5JZ7D 1QBLH 2NW2B 3TNMB 3HE7D 3OJDB 4CNIB 1S7TB 5D6CA 2JELL 4MXQD 1OD9A 1NJ9B 1N5YH 2CLRA 3VFOA 1Z9SA 3P2TA 3HI1B 1FL3A 4Q2ZA 2MHAB 3O45B 5CGTA 4HS8L 5D2LE 5CJXA 5CUSH 1XF3A 2OXHA 3H9ZA 1L0XA 2IEPA 2AI0L 4NQCD 3QDGB 5F6IC 1WGOA 4WI6A 3L7EA 1JWMB 5CWSA 1PX4A 1JE6A 1YPZA 5C86A 1LO5A 3KXFD 3HNSL 2HJKA 3IDNA 3ZE0E 5IMLB 1RU9L 2JJUA 2EKSA 4HCRA 4CN1A 1MJJB 3QBTB 4Q9QL 4NJ9H 1L4IA 2JIXA 3AFLA 5TH2A 2YPLA 2R2EB 5T3XD 1HOCB 4NQED 5A3IC 4ERSH 4R3SB 5F7MC 1FL6A 2NY7H 3I6LE 2YBRB 4U6YB 5AZ2L 1QEWB 2VUYA 4GRLA 2ESVE 2XTJB 1CDJA 1I1AC 4Y7MA 5IVZA 3VE0A 1VCAA 5CBAB 2XY2A 3B2UD 1GAFL 4PGEB 1WAAA 3IFLL 1DUYB 4GW1A 4HIXH 3TN0B 1VDGA 3S4SG 3AC0A 2F54B 5C9KA 3K1DA 5ECJE 3CMOH 4UU9A 5IW6B 2X05A 4FQXC 1DBKL 4OCXL 4QRQB 3O9WB 1T04A 5HBBA 1SEBB 4R90L 1FNGA 2OTPA 3MLWH 4QHLB 3V0VB 3ARUA 1WQVT 4K8RL 4DTGL 1UKSA 1YYLH 5C0DB 1MEXH 4UV7L 2AEIT 1EO8L 4K94L 1EBPA 1FGVH 5CJXC 5SX5K 2HTKC 1CBVL 5I8EA 2HMID 4FQLL 3HLAA 4I0PA 5T1DL 4FFVD 3QH3A 4X9BA 3MV8A 1CICB 4IM8A 1CT8A 4LAQL 2H6PA 5TE4H 3TYGL 1HQ4A 1MUJA 4XWGL 3QFDB 2DKSA 3D2UB 2MQ3A 5JHDD 1LHZA 3RZCA 1J12A 4Q9RL 1RU9H 3F58L 1C16B 2B5IC 5T1KD 3FO9A 3JVGC 3G5YB 4V1DD 4X6BB 3VFGH 3FO0L 1RHHB 1UH3A 4Q6IC 3IJYB 2PTVA 1KCLA 1NMBL 5DA0B 1ZLVK 3ZMRA 5EFIB 4U1HB 2WV3A 3I3BA 3GSNA 5E5MA 4GRWE 1SJEB 4JCMA 4K94H 4LDEB 3B4NA 2V2TB 1NCUA 1VGKB 1I1CA 4L4VD 1G6RL 2MHAA 1FRGH 3RNKB 4XP6L 2J8UE 4PLOB 4LRNH 3OPZH 1WUNT 1MEXL 1CFQB 4XNXL 2VXUH 4JM2C 5F89A 5J89A 3PDOB 4QWWD 3CFKB 1CD1B 2DQTL 4KHTL 1IRAY 3EIFA 5DHVA 3JWDC 3HUJB 4EIZC 2VLKA 3DO3A 5T3XE 1N59B 3U0PB 5D7IB 5KSBF 5IJVB 2W0PA 3DHMA 3MLWL 2VLRD 5JR1H 3TN0C 3A6BH 3FAWA 1EAPB 1EXUB 2HT3D 2YRZA 2I60H 3WIFB 4QTIH 2VXTH 5IF0B 4WEBL 1RPQA 1XGTA 5BZWB 3MUHL 3QI9D 3LS4L 4XNYH 1PBYA 5E2VL 3W0WE 1I8KA 3QG6B 1UA6H 3QWRD 4MGXA 4JO2H 4R96B 1CL7L 3RWHA 3VD7A 4GXUN 4Y4FB 1YECH 1J1XL 1K4DA 1Q72H 4ZSOA 5EU3A 1KOAA 2FZ3B 4KMLB 3E6FA 1B3JA 3KLDA 4PJBA 5DMGC 4XT1C 2HVJA 1NGQH 4UOW1 3V95A 3D0LA 4MAYD 3NFSL 5ABDE 4YGAB 2GJZB 1SJHB 4ODHL 1LDPH 1ZANH 3PGDA 4OB5L 5DUPL 3ULSB 1IE5A 1SJEA 2JCCE 2B1AH 2HKHL 4F33B 3O4OB 1R0AH 1E4XH 3VI3F 3L3JB 5CJ5A 4PRHD 5DR5H 3MLTA 3BPOB 3MRCA 2DQDL 3NCEB 1PW3A 1KNOB 5C0GA 1IILE 1PKOA 2P5EE 3U0PA 5JR1L 5EC1B 3BP7B 3GMQA 4QCIA 1I7UB 1I7ZB 4QRTA 1H3PH 1XF5B 1RUAH 1I1AA 3BWAB 3MLXH 3Q5TA 3L5IA 4IMKC 3BHBB 2AKRA 5BRZA 1ZAGA 4HJGB 3REVB 4JQXC 4FFWC 4CVWA 5FYLE 3L95B 4MZ3A 3IF1A 2P24A 1J10A 4HK3N 2V17H 4QTHA 4HKXB 4NUGH 5EO9A 4MA1C 1KIUA 4UTAH 4PJ5D 4KVCH 4ZS6C 3TBSA 2R9HD 4XVSH 2WIIB 1U58B 3FZUC 5BXFB 4P5TA 3V6FB 4TNWK 5L0QC 4HSQA 5HVHB 4LF3A 4PGBB 1NCNA 7FABH 2VL4A 3DUUA 5D72H 1KELH 2Y1VA 4NNXB 5D70H 5GIRA 1WCBB 3RWFA 1XF4A 3DI2B 35C8H 4G7VL 4P4KC 1BHGA 3DURB 3R06A 3P0YL 4JY5H 4WO4C 4Y19D 3HPLB 4P0DA 1HN1A 5F8RC 1BPVA 3I02B 4P46D 3KLHD 3RY6A 3DI3B 3BP4A 3X12A 4AQOA 3RX8A 4QRPE 1D9KC 2Z31C 3QXWA 5JO5B 1JGDB 1F97A 5K9JH 2BHZA 1FSKB 1S7SB 2DMKA 4NRZA 3JWDL 1MHPH 3A0OA 2NXYC 1VHPA 1AI1L 4RIRA 4XP9L 1IAKA 2OJZL 2YSSB 2Z4QB 4JJ5B 5IJKA 1PFCA 5D5ME 4XCEA 4K23H 4PJ5B 3AS2A 4BQBA 2F53A 2WMPA 4P2RB 1X5JA 3LEXA 1LO5B 4UTAL 4LCYA 4N8PA 1JZ8A 2IBZY 1OAZH 4L3AA 5HDQH 4DQOL 4JDVA 2NR6D 2E9IA 2P24B 5HHOE 3TV3L 5C07A 1BREA 2WUCL 4J3XA 2Q8BL 3E6FB 1M7XA 5F6HI 4U7KA 3QXVA 4P3CL 4XNQB 5T1KA 3OF6D 1MIML 2ARWA 3QXTA 1J1PL 4NCC2 2P8LB 1DQTA 4NZTL 1F6FB 1QO3A 1WC7B 3CFJB 3VFOB 1J86A 2EE6A 2V2XA 4M1CD 3C8KB 1PEWA 3MFFA 1JWUA 1MCJA 1I7UA 4UBDD 4ENED 2DMCA 3RVTD 1Y6NR 1XF4B 3RA7H 1IBGH 1LO4L 5FO8A 1A6PA 4CU7A 1B2WL 3MGTA 1AXSB 3QIWD 4ELMF 5CWSB 4QRRE 2X4NB 4OZ4A 4WUUD 5IHBA 4XB7A 3I6KA 4M61A 1IGJB 4ODVL 3WBDA 1A6TA 4PJEE 3LKNA 1XIWB 2CKBB 3QJFA 3UTSD 4WUUB 1WIOA 2AJVH 4YBQC 4CJ0A 2D9CA 1X6LA 1X5GA 5E2UL 1CFBA 2VLRA 2X4QA 4JVPA 1UYWH 4JKLA 2PTUA 2DTMH 4PS4H 5DEFB 5F3HA 5CILL 5DJ0A 5HI3D 4Q7DA 1TJGH 4NZRH 2ADIA 4S1QL 5HGDB 1GZPA 4AT6B 2FR4A 1NBZA 3SDDB 1ORQB 4J3WA 1BZ7A 3O2VH 4JQVA 2YPLD 1MCPH 3QJFB 3KYMA 3G5VA 4YIQB 5HYQB 3MZTA 4JKMA 4EUPG 3BSZL 5FUOH 5JLZA 4OCRH 4P59L 3TO4C 1RHHA 1TENA 3RKPA 1A9EA 4HQQH 5IFHL 4HBCL 2COQA 3LN5A 2MMXA 4KROD 1C1EL 3NCYP 3SE8H 5KSAD 4WU7B 2E9JA 2QADD 5FGCB 4HXBH 1ZLUH 3LH2L 1A5FH 3FKUS 2DWDA 5F89B 5LCVL 3M1BA 4I13B 3X3GL 2C7UB 4LRNL 3D0LB 5D6DC 4JY6A 3VG9B 3WLWD 4G9FB 3GHBL 4RQQA 3UPRA 5I8EB 1UWXK 2GAZB 4MD5B 3FT4A 4N1HB 4YDKH 1UVQA 4PJ7E 4QOKE 5HHQB 5DO2D 1KTRL 4Q9BA 2PUQT 4UILL 3P77B 2J8OA 1OGTB 4JPIB 4L1DA 4BSWB 4YAQB 3QNXB 5T3ZL 3LSOA 4JB9L 3T3PF 4ZTPH 1JPST 1CXHA 4HIIA 2VB5A 2AEPL 5CSZA 2IC2A 1KCRL 1KACB 4IDJH 3D2UD 5DJCA 4WI8A 2ATPB 3WKMH 2X70B 3SQOL 1QSVA 5DQDL 1CD9B 4R7DA 3MRHA 3AROA 5HHMB 43CAB 1GC1C 2XTJC 1ZLWK 3U0WL 3KPOA 1CLZH 4MNGA 5SX4H 2DQUL 3ETBF 3T08A 4IJ3B 3GMLB 3ZKND 5EC2B 1V3JA 4XPBL 4RFEB 3Q5YA 1CGSH 3GSQA 4YHNA 5DD0H 4NN7B 3T0DA 4G7YH 4LDOB 4PJGB 5LBSH 5IKCB 4ZUVA 3O3AB 4YZFE 5J0BA 4HWEL 2BSSB 3I50H 3RVWC 5DJYA 4OLEA 5C6WH 4NQVA 1B4JH 5DEGB 4LCCA 3RFZC 2I27N 1JWMA 3OPZL 5FCUL 3MRMA 1NL0H 1OAXH 5CEXB 4M1DL 5IBUB 2PETA 2FJHB 4U1MB 3KPRD 3CD4A 4I9WD 1NANH 4RNRB 3CH1A 3I9GH 3RX5A 2CJUL 3S98A 3MR9A 4C83B 2J88L 5EIQA 2X5PA 1J5OL 4JQXA 1VFMA 2JB6A 1WBZB 3DVFA 4FQ2H 1KPVA 4GT7A 3H3KA 2AXJA 1XH3A 2R2EA 3IRZA 3JWOL 4HD9A 3QCTH 3VE0B 5DT1H 5AWNH 3HG1A 1ZGLM 5C3LD 1QEWA 3QA3B 4Z8FH 4X4ME 1MHCA 4POYA 8FABA 2FB4L 3FN0L 1HHKB 3MRCB 4OT1H 2DJSA 5KVDH 1T6WA 4Q6YA 3B2VL 1KGCE 3C08L 3QUYA 4BSVB 1CDHA 1CE6B 1RVFH 3WO4B 3HG1B 5ID1A 3PWPB 1G7PB 3STBA 3WFBH 3RHWK 1DL7H 1MJUL 4YO0A 2NYYD 2L7UA 4JM2B 4JPWL 2BHUA 4KJPD 4PD4J 5KVFH 5LQBH 4NFDA 4R96A 5AEAA 4H26A 5K9JL 3GBNL 4DCQA 3T2OA 5I73B 4JG0H 4RAUB 4ETQB 1P7KA 1CF8L 4XNUL 25C8L 4JGJA 4GG6A 3TZVC 4CVXB 3I6GB 1AGDB 2W65B 4KUCD 1J8HA 2AEQH 3U46B 3PF2A 4OCSH 4ALAL 1RIVL 1Z5LA 2PYEE 3WJLC 2VRAA 3OKYA 4PJEA 1KJ3L 4LEOA 1GPOL 1I85A 4LIQE 1P1ZA 1YNKL 3PHSA 1QTYT 4HUKB 3GSVB 3WFDH 4JFHE 4HH9A 3GHEL 1NFIB 1D5ZA 4KQ3L 5GRYA 3QA3A 2EDWA 4RFEA 3HZVA 3T77B 3JTTB 4L8SC 1AE6H 1K6QL 3EOBA 1B88A 1S7UB 1BIIA 4G6AD 1JN6A 4XP5L 3FQWA 3KNBB 4HAFA 3C5SB 1YYLL 3O4OC 4Q58C 1FNHA 3NPZB 3GK8L 5ITBL 2Q1EA 6FABH 1RZJL 5I8CA 5CSZB 2P48B 2OP4L 2FX9H 5KAQF 3VDAA 1KCKA 2J3SA 5KVMC 1ZS8A 3BSZH 4UB0H 2DB8A 3DSFH 1K3ZA 5CGYC 3QDMD 5B21A 5GRVL 1FNFA 2AW2A 1R3JA 3ZKSD 3PGFH 4LPYA 4FNLH 4PRDB 3CIQA 3T1FB 3N0PB 3PNWB 3KAAA 1S5HA 4F9LA 4NQSA 3CXDL 4BQ8A 1YEIL 5CILH 1J8HE 3BPLC 4K3JH 3UBXI 5D1XD 1IC5H 1P7QA 5A2KH 3QDME 4JFDB 1FJ1B 2R9HC 4X9IA 1ROWA 3W0WB 2PXYB 3WNLA 4M93C 4YDKL 3U6RA 1BECA 5IFAH 2V5RA 4PRIA 4JKPL 3QQ9C 4Y89A 4GKSB 2GITA 2NY6C 1RZKH 3Q6FB 1LEGA 3U79A 4OZIB 2DLEA 1BM3H 1ZT4B 3DO7A 2O26U 1S5IL 2HT2C 4J1UB 3P30L 5FM5M 5J7CC 4MNGE 4KDWA 4KGJA 4JKWA 4Z0XB 4GKSA 1N6UA 2P45B 5FECB 3RU8L 3MCKB 2P42B 1BQLH 1OCWH 2Z31B 2X7LA 5DC4B 5LGHL 3T4AB 4HS6A 1MH5B 3MUZ1 4PREB 4TUOB 4BK4A 4KV5F 1YZZA 1YEDA 2E6PA 2YD6A 5D7LE 1HNFA 3OMZA 4LPXA 3FHQA 4OD1H 1DN0A 1YEEH 4I5BB 1AGFB 1KUMA 2IPUG 5TPWH 1TJGL 4L4VB 4RISH 4TSAH 5GHWH 1CS6A 4N0CD 2E8ZA 1RSFA 3MGOA 2ZKHH 1QVOA 5JNYB 4PJ5E 1CDCA 2FO4B 1IAII 4OUUB 1A1MA 3LY6A 4BQCA 4G43A 1W2KT 2YD3A 4MHHG 1KPUB 1XH3B 3MLRL 3GRWL 5IB5A 2ARJQ 2ORBL 3LKQA 2EICA 2LAGB 1TVHB 3SJVB 4PRPD 3IDJA 4HZLB 4EOWL 2B7DT 4I18A 4XWGH 1NBVH 4QGTA 4XCCH 5B22A 1X5XA 2QSVA 4XPHH 1RUMH 2R56L 2H32A 3DECA 1WEJH 4LSPL 5IROC 4M93B 3WS6A 3QJHA 4LIQH 3MRFB 4NWUL 2Z4QA 1A6WH 3IJHB 4FQIH 4KMTH 1O5DT 3L6FA 1FG2A 4NNYB 1MCCA 5LCVH 4JFEB 1S7SA 3MQIA 4JPKH 1MFDL 2EXWC 3BESR 4N68A 2BVQB 3CDCA 1T0PB 3MV8E 4OKVA 5F7NC 3JWOC 2FECI 3KR3L 5E8DH 3W82A 1WC7A 4G8GE 1MCOH 2YD5A 3ZKMC 3DJ9A 3BH9A 4L4TE 4O5LL 5T3ZH 2JE8A 3RKDD 1FVDB 4PJCB 2HTLC 4PBVC 4DOHE 4H5SB 3VGHA 1FH5H 3BKYL 4KXZI 1S7RA 2ZCLL 4FQQB 4RWHA 5IB5B 1GGBL 4I4WB 2N4IA 4IDLA 1CWVA 1E6OL 4YHIB 4A2MA 5DEGA 3P4MA 1LEKB 4JFOA 2YWZA 4NQVB 1IAIM 2QV2A 3S36L 4YHLL 3ZDXF 1BFTA 1BVLB 1YYMH 2X4RB 1OT1A 4M8VA 5D7JA 3RWJA 4Y4FD 5ACZB 2FNBA 5DRXA 1OARL 1IQWL 1O0VA 1TTGA 1D5MA 1QLFA 4TUOA 4R0LC 4XNZC 3O2DH 4WHYH 1NUDA 4HS6B 1J1XH 2XT1B 4ZS7L 5EBLB 4QHKI 5EBGA 4ZOAA 4JY6B 1JZ2A 4HEME 4KKNA 4NQCB 4JRYD 1ETZB 1JF6A 4FFYL 4NQEA 2NYYC 2E8YA 2VIRB 4HKJA 3LS5L 5GSVB 2MCG1 3PHQB 2APTA 5EZJA 4ONGL 5DJXB 1DQDL 4PV8B 1MIEH 3HI5H 4LPWA 4TVPD 3L1OH 2R0LH 3QO0A 4IOIA 5F6IB 4HWBH 4EUPH 4G42B 3CFIC 4MNQD 1T4KB 5E9DA 4LVNC 2HMIC 2HFEA 3JV4B 2D7TL 2K7PA 4OLZL 5I1KH 4PJBB 4LHUG 3QXDA 2VLMD 3CVIH 4WEMB 1VERA 1JN6B 4KK8D 4N1CA 1B2WH 4WW2A 2PTTB 3AREB 2ILLA 4NJAH 4DGYH 3TV3H 5EO0B 4JZOA 2BDNH 5KSUB 4B7LA 1I1AB 3BWAA 5I71B 4D0BA 1GSMA 5FUCC 2XY1A 1F90H 2AK4E 4CU8A 1U8NA 5IF0A 1G1YA 4AM0B 1HNGA 4PBXA 3AMKA 1EJOL 4FQHB 1C7TA 4NSKA 2WWMD 4G9FE 3VGEA 1UXWB 5D71L 2VO5A 1DE4A 3QEQA 3MLVL 3RRQA 4ONFL 1MI5B 2A1WH 3C8KA 3VFPA 3O8XA 2R0KL 3QNXA 1KEGH 4RDQF 2IGFH 5JDSB 1BF2A 1G9NL 3QEHA 5EUOE 1QSFD 4HAGA 1WTGT 3VJ6B 1FN4B 4JEGB 1JP5A 2H45A 4OI9A 3CUPB 4XNZB 4GUPA 9CGTA 4CMHB 4RQQB 3UPRB 3S34H 4PY7B 3MOAH 5EOQL 5DQ9B 2ZSVB 2RHEA 5L2JB 4X0KA 1CICC 2C7UA 2PO6A 5J6GB 3OAZK 1JIBA 4N5EC 1BLNA 3BZDA 4NHUB 4LARH 3FRPA 3MNVA 3IS0X 3JWDH 3P0VH 1AGDA 5CJOH 5EA0L 5TF0A 1JHKH 5D1XB 3UEZA 4BH7B 1W0YT 1FIEA 4RIRB 3MJ9H 3VXTA 4N90E 4NRZB 3FFDB 5C0BE 3L5HA 1RZ8A 5DMJB 1EHXA 1NMCC 3ULVC 1E27B 5EZLA 4BKLB 1C5CL 2VE6A 5JO5A 4HW6A 3D69A 3U36B 4HUMB 3DX8A 1BJ1J 1FLRH 4U1SB 2SEBA 1VFAA 2H1PH 2OQJB 1R3KA 4FXGB 1FO0H 5I76A 2GEEA 4R4BA 3DRTB 5HYIA 5IVOA 2Y4SA 2JB6B 1F4YL 1CIDA 3H0TA 1XGYL 3MJ7A 5E8EB 4Q9RH 4OD2A 2FD6L 4TUJB 1U92A 4PJCF 5GGVL 2VLRB 5E2JA 3CLEH 3NOIA 5L2KD 1A4JB 1T22B 1AXIB 3FOMB 3O6LH 5GS3A 4NNXA 1FZOB 1HIML 4FZEH 4HXAH 5GRWA 2R56H 3CVHB 1QFWH 5C0CB 1QYGH 1KCSH 3C9NA 5DRNB 5EZIL 2P44B 1XGPB 4GW5A 3TPKA 5C07E 3GEWB 2VERN 3LD8C 4BSVA 1G7MA 5C7XL 5CP3A 4JFFE 4JO4H 2AVGA 2BXZA 1G7LB 4JJ5A 3MV7D 1H8NA 3EFFA 3HE7B 3SGJC 4JDTH 5D2LA 1H15B 2AV7A 1YN6A 3GI8H 1I75A 3CPLA 5FO7A 5CKAA 4IOSD 2BNRD 1FO0L 1T03L 2H32H 2W59A 2D31B 3MV8B 4H0GA 3MBEC 4HJ0D 3CMOL 3OKLB 3KG5A 2P46B 1QRND 5DJAA 3ZKXB 1U41A 4PP1C 1T1YA 3MODH 5ILTH 5DJZB 1A1NB 3FAXA 3VFTA 2MCPH 4PP1D 2PR4L 5GGUA 5IVXB 1QSEB 2XQYG 5C07B 2Y07L 1AQKH 5C9JA 1KLUA 3DMMB 2NPLX 4ODHH 5ESVA 3B5GA 1CICD 1JYNA 2M26A 4JO3H 3ULUC 4ZUSB 4JO1H 4QY8A 4WTZA 1JZ5A 3I3DA 2VDOL 3EZ8A 3G6DL 2YS4A 5DWUL 4JJHA 2ZOLB 5D5MF 4GJTB 1TCRA 1JRHH 4PJIF 1NL0L 4O58H 5DZLA 3UO1L 3AAZA 1VPOL 5F88A 3TIEA 3LMJL 3L3KA 2P8MA 1QFUL 4GRLC 4QXWA 4F9LC 3ZDZF 4NFCA 4P2CG 2HWZH 4NN5B 3QQ4B 4P46A 4MD4A 3NIDF 4K07A 3BP7A 2LU3A 2P5WB 5GRJH 2XWJA 5IEKB 3RUGF 4EXPX 3MYJA 1ZS8B 3G08B 1UM5H 5ICXB 2HH0H 5I8CB 4YFDB 3FN0H 4XNXH 5T1LD 4N0CC 5KG9A 4FHBD 4WI3A 4HIHA 2QHLA 4PRHE 4U0RB 1DQML 3LSOB 3RGVD 2UZXB 3IU3B 3HE6A 4GUPB 4OCYL 4HPYL 1BGXH 1L7TL 5HDBE 4QTHB 5C2UB 3PGDB 4MS8C 1ZVSB 3MJ7B 4S1RL 5ILTL 1RJYA 4XBGA 1MY5A 3L95A 1HH6A 1QUNA 2HLAA 3O41A 4PJEF 1HK6A 1MCEA 5ESAA 3QYCA 5EDXA 5KG9B 3BDXA 3VFVA 2XA8L 1MCSA 1A7RH 4JN2A 3W9DA 4J2XA 3EGSB 5EO1A 2R0LL 1QPPA 1IGIL 4JG0L 5DHYB 5AYQA 2HWZL 2UWEF 3RL1A 5IT2L 2XXCB 1AQDA 3TZVA 1OL0A 1RY7B 5DDHA 5MP6H 4MD4B 1UQSA 5FCUH 3U9PL 2DLTA 4OCWH 3RL2B 4MA7H 3GKZA 2RJMA 4M1DH 4ZSOE 3GIVB 2OCFD 5JUEL 2R0KH 3FB5A 5LBSL 2EIZB 2GUOB 4JGMA 4PJBE 3VXOB 3S5LA 3DPBA 2ZSVA 4M3KB 4L3ED 4UAOB 3I50L 4F37K 3RWDA 3VGDA 1AO7B 1YNKH 1MCIA 1ZWIB 4L8SA 2VR5A 3GFUA 2G75B 3V79C 1JNHA 3ULVF 5GS0L 2QR0A 3CFCL 2CRMA 4MJ5B 2A2QT 3FHAA 4K7FB 5I2IB 3H7BA 5DTFA 3FB5B 4P5MA 4HIXL 3WNMA 4NYLB 3G5YA 3HE6B 4YEEA 3DETD 4RMWA 4QHMA 1NLBL 2BVPA 2IALB 3CFBA 3VI4F 3G9VA 3BVNA 3B9AA 4LHQB 5KVDL 2JCCA 5CBEA 3D87B 1HCFX 3ZE2E 4WI4A 5FYLD 3LS5H 4OV5A 2DTSA 4O9HH 3O8XC 3EO1A 2H3NA 1G0DA 1KXQE 3OBAA 1T2QH 4WHDA 4EDWL 3L3KB 5MHSE 4LKCA 4MQXD 4NJ9L 2O5YL 1JWUB 2P8LA 4WUKH 5L9DL 1FDLL 2IG2L 4U0RC 1U3HB 4XPTH 3LB6D 4NC1C 4EDXB 4TPRH 1F3JB 3ECBA 2W9EL 2L7JA 3L5WB 4JAMA 3MRNA 1N3NA 4RGMC 3FRUA 5DS8A 4LCYB 3L3HB 1SHMA 4YE4H 1FNSL 4HXBL 3OJMB 4HC1L 4IIQB 3ZE2F 2Q3AA 4XCEB 3ZL4H 3ZSSA 3O3DA 4LCWB 1HZHL 2B4CC 4KMQA 3LKSB 2FD6H 3LEXB 4PV9A 1R5IB 2OR8A 4CW1B 3GHBH 1CFSA 3CXHK 4ETYA 3O9WD 5DJDB 1FAIH 1P5VA 4PJIE 5FA4B 4KRPB 4XXCA 3H9SB 3RTQB 3U7WL 4HJGA 3REVA 5L9DH 5GRUL 5DURD 3WFHB 3HC4H 2GJ6E 4PTUA 3HAEB 1ETZA 1LP9E 3Q6GH 3OXSB 2C3WA 3N1QC 4LGSB 2FWOB 1QQDA 4F7MA 2NXYD 4OZHA 3VXNB 1Z9MA 3O6LL 4MNHB 4IS6B 3SE3C 3EO1B 4IMLB 5CIPA 4EKXA 4ESKA 1KJMA 5JW4N 2RQ8A 4WW1A 5DQDH 3GB7B 4JFEE 2NQCA 4OFYA 1ULVA 5GRZA 4YPJA 3RWGB 4D9RD 4KPHL 4NKMA 4D0DB 4RGOL 4KRPD 1ZTXH 3PE9A 2BP3A 4WGVB 4R0LA 4OM1L 5L8JB 4GW5B 2KBGA 4UU9B 1JZ4A 1YPZB 3O45A 1P2CB 4QRPA 3OXRB 5JXEA 1RHFA 4XBPB 3VXRE 2I9TB 3ZDZE 3DBXB 2B2XH 4XPTL 1DLHA 3G5XA 1UVQB 1D3CA 1A14L 4JFED 4Y0GA 4YHPA 3ELAT 4DK6A 4GMSL 3LKOB 4LLWA 5CAYB 2I9LA 3BZEA 2EDXA 4X83A 1KLFA 1LO3L 2MPAL 1I7ZA 4KK6C 2AJXL 2PNDA 3V8CA 1BX2A 3KPMB 4L4VE 3PUCA 1GYAA 4LSPH 3NIGE 5HHOA 1EFXB 1WF5A 2FGZA 5D7LB 3MJ9A 1BM3L 3MJGX 3D6GA 4HWZA 4G8FB 1G7MB 3EOAB 3LN5B 3VH8B 1ZT7A 1UH2A 4OFPA 4LSVL 4KJWD 4D94A 1KIQB 4MD0A 1IAIH 2AK4D 3TWCL 1KN4L 4Y19B 2VQUA 2DI8A 1ZHLA 1N0XH 1LMKA 1OGAB 3VXSB 3LN4A 5GRVK 2DQCH 1U8LA 3FTGB 1D6EB 4N0RA 4WJ5B 5EBWB 5K9KA 3BQUD 2QR0B 3RU8H 3NABH 1HDMB 3W39A 3TZVD 5F71A 1F4WH 5MEPA 4K2UH 3MBXL 3KPSE 5CHNA 4QRRA 3QUXD 4J1UA 2YD8A 1UKTA 1T5XB 5DUBA 1F3RB 1YMMD 3QT2A 5D2NA 5ICXA 4NDMA 1FGNH 4JGUA 4WFHE 4U1GC 4BSJA 3ULVL 2WINB 3GM0A 3EYQC 4IRSA 3VWJD 5D1XA 5HYJE 2Q8AL 1KELL 3PP3K 4DZ8A 3D18B 1IKFL 1KEML 1QLRA 1W72B 1AIFA 4YDVA 4WWKC 1A5FL 2P8MB 2RFXB 4X8XA 1NGWA 5D1QC 4NO5A 4P5TC 4PJ7A 3FFCE 2DICA 1R3HB 2CR3A 3O0RL 1KB5A 1GOHA 1MQKL 1RI8A 3GI9L 1IGFH 4DGIL 4Z7NE 4N8CL 1EVUA 1RK0A 2V7NB 4JZJB 1GPOH 4RX4D 5C08E 1VGKA 2Q6WB 4OLVH 3V5HA 4XHJC 5C6PB 5I1HH 2V7HB 3X14A 2ADGB 2VITA 2H8PA 2IQ9L 4ODXB 5E4EC 4LCIH 2MCPL 5JA9A 3MRBA 4IRJC 2QHRH 25C8H 1S3KL 3HE7C 4NPYA 2R69H 3QFDA 3G08A 3CZJA 5C6TH 5ETUB 3TYFA 1YNLH 3FQWB 1DUYA 3HB3C 4NQXB 2NY0C 1OLZA 3DV4B 2C5DC 4HIEA 4XAWL 5DJ6A 3KYOA 1CLYH 3OSKA 4I2XE 3GMNB 2OL3H 1FYTD 1JZ7A 1CTNA 2HN7B 2H2SC 4W6XB 4ZD3L 1H5BA 4K9EL 2BVQA 4NWUH 2A6IA 4BZ1L 1JNNH 1Q94B 4WUUE 5IMOA 2EDYA 5JOFB 4Z77A 6FABL 2CKBL 5DC9B 1EK3A 2KL6A 4B41A 5I74B 4L8DA 3LQMA 3GKWH 5JPNA 5DVKA 5K9QG 2N7BA 3EJYC 3DRQB 2WLYA 1MRDH 1QFWM 2HFTA 2DI9A 4H1LG 1S7RB 2KZ1B 4FQQA 3WNNA 1C8PA 3THMH 4JRXA 2UVFA 4TTGA 2VISA 3DX6A 4YE4L 5DD5L 3P4MB 1U8IB 5EU4B 1QSEE 3NFNA 2NY2B 4MCZA 4EI5D 2F54A 1QR4A 1YMME 1DQLL 3HI1A 1QBAA 4NUJB 4KRNA 5IHLB 2EDNA 3VWJC 5IM7B 3RY6C 2IPUK 1T6VN 3IETA 4YBLC 2P4AB 1GHFL 1N5AA 4FQ2L 3GK8H 1JGEA 5KZCD 3BXNA 5EIIB 1JK8A 3BAEL 4W6WB 3KJ4C 5TH2B 2DBJA 4MCYB 3PWUA 1WWCA 4W68A 2CDEA 1U8HB 4EJ1C 4JFEA 1IZKA 1RUQH 1K4CB 2VKXA 4S0SD 3QCVL 1ZA3B 2CKNA 4XAKD 3MV7E 5I17B 3OJVC 3BQUC 4K8RD 5KOVC 4GRMA 5T5FL 1KXTB 4R4NC 1P9MA 3HI6L 5D9SB 3PWJB 4KKCC 2QSCL 1YEJL 2A6DA 4ZFGL 4MZ2A 5IV2A 4G9DB 5JTWA 4WWKD 2V9RA 1SYSA 3CVHA 5CJQL 5GS0H 1KN2H 1I9IH 1PQZB 1OQXA 2G60L 2NLJB 4OGYL 2FBOJ 4H1LA 2DIAA 2R1WB 3O3BB 3OZ9H 1ZLUK 1ZHNA 3RDTD 5C0AE 2ITCA 3M17A 1QBBA 1X3DA 1TZHA 4I3SH 5E2TH 4APQB 1S9KC 4U1LA 3SDAA 3GHEH 1G7JA 2D0FA 4XMKH 1MFCL 1JPTH 3F7QA 3LDBB 3R8BB 5C71A 3C6SB 5DJYB 1NANI 1QFHA 5IK3B 4KDVA 2XZAL 2ZUXA 4S2SB 2NY0D 3EKCA 2Z92B 3NTCH 4WFED 4QHUB 4X5WB 4FA8A 4PJGE 5FKPB 5KSUA 1J1OL 1H5BB 3CC5A 1NCCL 4D0CA 3MTRA 4JG1H 5I30H 4B0MM 5IP4A 2XZCL 4PYHA 4JFDA 3MRGB 1C5DA 1DVFA 4G6FD 2NY2C 1P4LA 3QIUA 3F8UB 2X4UA 4LLYB 2VR4A 2VXSL 1GZQA 1LE5B 3QDGD 2PYEA 3GSNB 5E5MB 2GSGB 4F7CB 2CDFA 1SBSL 3HAEH 5EOTA 4CDHA 2HFEB 3KJ4B 1FN4A 5EOQH 1L0QA 2AS5M 3OV6A 2AGJL 3TO4D 5SX4I 4XXDA 3WNPA 4JRXB 5F7FA 2VN7A 3RVXD 1YJDL 4ZS6D 2O5ZH 5CZKA 4YXHH 3PQYE 3KYNB 1CQKA 2PYFA 2F19L 2VZ1A 1NCAL 3C2AH 5I1CL 1N6QL 3UJTH 3VFNA 3ES6A 4MQ7A 1J9CT 4LCCB 1NDMB 2AQ2A 3WN5B 2OR9L 1PZUB 2EIBA 2UWEA 1IQDA 3ARSA 1UXWA 4G3YL 2NY7L 1Z2KA 4LSUH 4BFIB 4ZAKB 1UM6H 4M6ML 4OLUH 4P2RD 1M1SA 2D2OA 2LU7A 5IMOB 4PG2C 1NKOA 1MCDA 3LPFA 2YUVA 4KK6D 4NKQB 5BVJB 4PRIE 4MMXC 4Z7UB 3VXPA 2EEAA 3IXTB 1MCRA 5DGRA 3B9KB 2YKLL 5KSBE 3BE1H 1PSKH 5EC2A 1ZLSL 3WN5A 3BYYA 1DDHB 5CP7B 1J5OH 2ERJB 2LTQC 1XGYH 3EFDL 2M2DA 1SEBA 1VA9A 4JFDE 2AJUH 3K8KA 2KZWA 4FQCH 1UA6L 3IFPA 1J87A 4DZ8B 1JGLL 5C0BA 3BKYH 2JK5A 1PG7L 3DGGA 4HIIB 4RWYH 3HUJE 4GLRI 1UT9A 4XVJL 5DI8B 3BEWB 2NY3D 3MV11 3GI8L 3QULA 5DEZA 1FVDA 3MREB 3MRDA 3D39B 3JWOH 3BIBX 3BH9B 4Y8DC 3T3PE 4G6FB 4X6CA 3K74B 2OI9B 1T20B 1LNUA 4ORZC 3TBVA 1RURH 3V4VH 1QPXA 3DVGA 4FQJH 4NC1E 1LE9A 1MHEA 4NQUA 4Y5VB 1AD0B 3N85L 1IGJA 5C0FA 3WLBB 3U9UA 5BV7C 4MHHI 3QO1B 3WS3A 3M1BB 4OF6A 1PY4A 5MI0B 1RZGA