1YJDH

Crystal structure of human cd28 in complex with the fab fragment of a mitogenic antibody (5.11a1)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
217
structure length
217
Chain Sequence
b'VQLQQSGPELVKPGTSVRISCEASGYTFTSYYIHWVKQRPGQGLEWIGCIYPGNVNTNYNEKFKDKATLIVDTSSNTAYMQLSRMTSEDSAVYFCTRSHYGLDWNFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab fragment of 5.11A1 antibody light chain
molecule tags Immune system/signaling protein
source organism Homo sapiens
publication title Crystal structure of a soluble CD28-Fab complex
pubmed doi rcsb
total genus 37
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2005-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yjdH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yjdH02
4XRCB 4JDVA 5MENE 2VDLL 5ALCH 1DBJL 3HR5B 4JG1H 3B5HA 1G7LB 4JFEA 4H25A 3Q6GH 3HC3H 2CIIB 4J6RH 4BQ8A 2AGJL 4OBSA 3G6DL 3ZE1F 5FYLH 1Q72H 4NQDE 3V6FA 4JHBA 1J18A 1IGIL 2O5YH 2WINB 3GMQB 1IC1A 4PGEA 1U2CA 4AQOA 2LVCA 2B5IC 4D0BA 3DRTB 5F1KC 4F58H 4Y4FA 4Q74A 3FOLB 4UOJA 4MAYC 1JV5B 1NCAL 3IDXL 2BDNL 3SDCD 4JHZA 4DUWA 4K9EH 5GGTL 2DQEL 1FZOA 5JW5A 1NUNB 1Z9LA 4NKOA 4JFPA 1YEEH 3ARGD 1KJ2B 2Y36L 3CUPA 2DLTA 1NPUA 3FB7B 3V8CA 5CFHA 3LN4B 5JHLH 3TH2T 3TO2B 1N4XL 2MJWA 4PLJD 3WL9A 4ERSH 3FKUS 1LHZA 2BRRH 5DC4B 1F02I 4JO2H 4EIZC 4NM8L 4GG6E 5LXGL 4UV4L 4PJ5E 2VYRE 3BJLA 3O41B 3NFNA 4JQVC 4KVCH 5BCAA 1U93B 2EIDA 4U6VH 2R56H 1QEWA 2JJVA 3LDBB 3CH8A 4PS4H 3VD4A 4QKXB 3DIFB 1PEZA 2RHEA 4PRDA 4FFZL 2VDMH 4ZNEA 2OR8A 1MLCB 2BVPB 3FCTB 4MYWB 1I3RA 3DV6B 4TNWK 4EUPB 5HTSA 2JJSA 2RB8A 3UXFA 2VZ3A 1GZPA 4GMTL 5J6GA 5FB8A 2CGRH 1JGDA 4LSSL 2R1WB 2AK4A 2WBJD 4W6WB 3VMOA 4I9WE 2KDGA 3BKYH 3NIGF 5F7NC 5KSVB 2PXYC 4JFHE 4PRIB 1Q0YH 2ZSVB 3TIDA 5IFHL 2OTWA 3CXHK 4JRYA 4YNYA 2FLBT 2JK5A 2YC1A 5TPWH 1ZT4B 3X3GH 1FQ9C 3D85B 3SKMB 2E7LA 1NC2B 1YYLL 3FT3B 3ZSTA 4QRQA 1KJ3H 3BDBA 3FB5B 3IB4A 1I7TA 3E6FB 4OTXH 1F2XK 3QQ3B 4LEXL 3RQ3A 5KVMC 5T3ZD 1S7QA 3BKCL 4FNLH 4TOYL 3WJLA 5GGQL 3STLB 3GMLB 5FOJA 5E2TL 4ELMB 1FNGA 4JN1H 1INQB 1NUDA 4P2CG 1VDGA 2Y36H 3PWLB 2YD2A 3BGAA 4HIXL 2VLLA 4KJYB 4JN1L 1LO0L 3IDJB 1VCAA 5EU6B 3C9NB 1N59B 4U1JA 1GC1L 5C0DA 1I3RB 5EIIA 1A6WL 3MRFB 4NP4H 4WUKH 3IKCB 1MRCH 1FDLL 3B2UC 4PGEB 1FV1B 1KOAA 4R26H 4F57L 2V2XB 3QO1A 3P4MB 4Q0XL 1U8NA 4E0RB 4U1GC 3QH3B 4APQA 4YBQD 3FTGB 5H37H 2ZNWA 2UZIH 2F54D 3ULUC 3CAFA 2WMPA 3TIEA 3SKJL 1KC5H 3SE4C 5IT2L 4NQCB 1A6ZB 5ESQB 4AJ0A 3BUYA 3LKOA 4WHDA 2A74A 3RTQC 1Z6JT 1UXWA 1T66D 3THMH 3WCYA 2XTJD 2EE3A 1EFXB 3DXAE 1WC7B 1ZSDA 1XGTA 5KS9A 4UINL 4PJDF 5ICYB 5KVDH 5IW6B 3QXVA 4PPTA 4X6CE 1DLHB 5BRZA 5EH1A 4PJIF 4UT9L 5DD5H 5TDPA 1NMAH 4IOSD 4YE4H 2JB5L 3K81A 4XNQA 2CRIA 1JNHB 1I7ZB 1NAMB 1T1YB 3EO0A 1I8KB 2W0KA 4S1QH 5C0DB 4F9PC 3QA3A 2VDNH 3ORJA 1GGIL 1QSVA 3VXNB 4RISL 3LRHA 1E4XL 1HCVA 1TQBC 4IOIB 5IEKA 2F15A 1GC1H 3OAYH 4PY8I 5I0ZA 4M6NL 1C1EH 1L9MA 1I8IB 3QUYC 3U0WL 5IMKB 5J11B 2H32H 5EZJA 5CJOH 4OCMC 2FSEA 5I8OH 3ALPA 3IGAA 5KSVA 3T1FB 3D0VB 3I02B 2Z91A 5ELIA 4QNPE 4NRYA 2YN5A 4FNLL 4ESKA 5EWIH 2BP3A 2BNUA 5FA3A 4R8WL 1VADB 1JYWA 5I19H 1VEMA 3ARFA 2I27N 5K9QG 5ANMB 1NEZB 4YHLL 5I1KL 2GI7A 3LKNA 3LEYL 4U0RC 3QIBC 5IW6A 1QFUH 2B4CC 1Q9KA 3DX6B 3DRQA 1A6UH 3FO0H 1SMOA 2QSQA 3GSVA 4WUUB 2WINA 2NW3B 1S7QB 1KB5A 4WW2F 1YNLL 5L9DL 1I1CA 5HGBB 2VDKL 3TP4A 5D7JC 5DWUH 1UA6L 4YFLI 3SKUD 4JM2F 3QEQD 3VG0L 3E0GA 4PJFF 1S5IH 2D7TH 2DYPB 2EXYC 1I1RA 2OP4L 3ARDB 2HTKD 4JM4L 1II4E 4X6DF 3CDGB 4G6ML 2V5RA 2V5SA 3TPUB 4KGLA 5F7UA 5E8PB 2VDPH 3MC0A 5CKAA 4Z77B 4ZDHB 1KENL 5T3XH 1ZLWK 4OZFH 3DBXB 3PP4H 5T1LD 5IV2B 2BHZA 4MCYA 1DUYA 3QH3A 5HD8C 3BMVA 4G9FD 5IWLA 4PRPD 1NMCC 3L3KA 1EHAA 5I76B 1TCMA 4PB0H 1U3YA 1KT2A 5J6HA 4QRRA 3MTRA 4GG6A 3HNVH 5EOTA 4IRJA 4PLKD 4O2FB 1FORL 2JIXB 4D3CH 5D7LE 1L6ZA 5JLZA 1QEWB 4RGMB 4OD1L 4Y0GA 3SCMA 1UZ6F 4KHTH 2I60L 4JPWH 2LU3A 4G8EB 4C83A 2YWZA 3HPJB 2ZUUA 1TXKA 4ZFZA 3SE9H 4MJIA 3TO4D 3QFJA 3QDGE 3DMMD 5D96C 5B38B 4UZGA 3U46B 3I2CL 3EYFB 4NC0B 5I1LA 1NAML 2K9UA 3CMOL 3HZYA 1FFNB 2XV6B 4RCAA 35C8L 1PG7L 3TO4A 4XXDB 3VG0H 4XVTL 1IVLA 4I5BB 5DD6B 2WANA 3LH2H 3RY6A 5D7SL 2QADD 4X7TB 4NKIH 3UTTA 1UCBH 4U1NA 3SDCC 1BQHA 5E8NB 4X4YB 3DVNA 2P47B 3OR7B 4JG1L 3QUXA 1Z9SA 4OB5L 4X83A 3H3KA 2HFGH 5J8OA 2D0FA 2UWEE 2XNAB 1FO0A 1RMFL 4RGNE 5E2VH 1RUML 3S4SB 1JPFA 3H7BA 5IIEB 1YNKL 4TVPH 1DBBL 1G7MB 1UFUA 3ARGC 5E9DB 2NW2A 4POUB 4Y4KB 2COQA 2NY6C 4QRPB 1PYWA 1EDQA 2ZUXA 1CGUA 2KKQA 2FH8A 3SGKC 4XTRD 1DVFA 1CVSC 1OAZH 3IDIA 3H9SE 2IAMB 1XF1A 2WBWB 2W59A 2FRGP 2P24B 5HYSA 5E4EC 4F7EB 4K94H 4ZPTB 3IDXH 3RVXD 1F3RB 2WBJA 1UACH 2SEBA 4RX4A 1P4IL 4EVNB 1TZGH 2O5ZH 1RHHA 4NCDA 4U49A 4U33A 5K9QI 4OLWL 5JR1L 4UT6H 5KSAD 1UENA 3UZQA 3WUWB 2JTDA 3FO9A 3VXPB 1SBSL 2ZG3A 4G7VH 4RMQA 4KMTL 5DMYA 1XH3B 1A0QH 3OTTA 2MKWA 3I2CH 4YBLB 1OQXA 2VDLH 2VXSH 5ALCL 1MHEA 3T4YB 1IILE 1BVLB 2BZDA 4N0UE 1CWVA 1YY9C 4X0KA 1XCTB 1XGPA 5GS0D 1R3IL 4BZ1H 4DQOH 3IXAB 4P2QA 1P6FA 4Y2DD 5GPRA 1CD1A 5GS1C 5DJ2B 3MRQB 3O0RL 3OPZL 4PJXB 5AAMA 5KZCB 5LQBL 4MA1B 4Z95H 1SY6L 2F74A 4L8SC 3VFSB 1MCSA 2IH1B 3MV8B 5TDPB 43CAA 1X4XA 4NSKA 3UZVB 1UM4L 4S1DC 4PJ8A 3C8KB 4XPAH 1IC5L 1SMAA 2BNQD 3V0WH 2IBZX 4V2BA 1QPPA 3DMMC 4IOFC 4FMFA 3MMEB 4MJIB 1K5NB 5ESAB 3B3IB 4RBPH 2OJZL 5DLMH 3D69A 5HYJE 5DFWH 5F7KC 1S7TB 4BFEA 4KUCF 5KS9F 2A1WH 3WIHL 2VLRE 3DVFA 3SKOA 3DROB 3MRDA 4KTDH 4I3SH 5HHPB 4BFBD 1QO3B 4OKVA 4PJFA 3RHWF 5CEZD 3DETC 3T1FA 1MCIA 3P77A 5CUSH 4QTIH 4NQSB 3MV9A 5D1ZA 5I16A 5DC9B 1KTDA 2ATKB 3MRIA 3X11B 4HUXB 3BOVA 2XY2A 3QIWC 3QUXB 2F53B 3S37X 2FNBA 3L3JA 3FT4B 4C56D 3RWEA 3S9DB 1FO0H 3VFOA 2DQUL 2XTJE 2ADJB 4DN3H 5I1IL 1MVUB 3R1GL 1A9EA 4HCRL 3QO0A 5C0BE 1AGBB 3CX2A 3VFSA 4G6KL 1KB5B 3S5LG 1JUFB 3ELAT 1DCLA 3ZDYE 3WFEH 3MRPB 5D2NA 3HC0A 3MCLH 4XGZB 3G6JA 4P3CH 1QYGL 1I85A 1ZEAL 3DVGB 1QRNE 1QBLH 1SM3H 4WI2A 3GIZL 4IOFD 3W0WD 5T5NF 3ARDA 4MMZC 1BWMA 1WFNA 1WTLA 5DQJB 1IGJA 2JE8A 4QYOB 4W4OC 2FGZA 3LIZL 1URLA 4CBPA 3GMMA 4YFEA 2ZCHH 1TNMA 3WO3B 3FO1A 1DEEA 4YDJB 4BH7B 1ZS8B 3ARVA 3QR2A 1QG3A 2VL5B 3VFGL 3K7UA 5TQ0H 2Y7QB 3C5ZD 4LKCB 1BM3L 1NBVH 2G2RA 4JO2L 5DVNA 2Q7YA 5TDNB 1BOGB 1SY6H 1DQQA 3QQ4A 4PBXA 1JMZA 3NTCH 3MBEA 3GKWL 4GKZA 3LQZB 3FMGL 2MFNA 4WW2C 5F6IB 4ZTPL 1QBAA 4LBEB 2QSCH 3GRWL 1QQDA 1RUPH 3LPFA 3H3BC 5IMOA 1IAII 3K1KC 4EI6A 2Z31A 4ZOAA 1A7QH 5C09B 3HMWL 1B90A 3F8UB 4P2RA 5D7KD 5EO0B 3HNTL 3KPPA 3QNYB 3WIHA 3VXRA 5I8CA 1NBYB 5IG7B 1FH5L 1WLHA 1FZMB 3TH3T 2EYRA 1KPUB 1G6RB 3FL7A 4JCLA 2A9NH 5GHWH 3U0WH 1RD6A 1TITA 4I3RL 4OZ4B 5GISL 3NPSC 4JM2D 4LHUB 4JGJA 2X4UA 1AC0A 3WFHB 4L4TD 1U8HA 5KBNC 1I4FA 1JF5A 4PJHF 1OB1A 4S1RL 2BSSB 4GJTB 2BCKB 2ITDA 2LU7A 4MLSA 5D93B 1KB5L 5A43C 5F7DA 5I1DB 3SDDA 4IIQB 3VXQA 3LEVH 4OZIE 1DBJH 3OKOA 2JJSC 4I3GA 1PX4A 4ZFGH 5FF6B 1BZ9B 1MPAH 4JO1L 4BM7A 2DL2A 2I60H 3V6OC 5MEOA 4A2MA 1YNKH 4TVPL 1Q9WB 3L5WA 5FKPB 4Z76A 1L7TH 2EDQA 1DQJA 3S3PA 1KFAL 1CQKA 5AYQA 1OGAD 4PYGA 3SDAD 2X9XA 4HBCH 1LO3H 2V2XA 1U42A 5FM8A 3K1DA 4MD4B 4E0RA 1F3JB 3JBG7 2XA8L 4WFFD 2BOBA 5FM5O 3TO4C 4N1CA 3V9FA 2EDWA 1JGLL 5F7FA 4ONFH 3AC0A 4X4ZA 1RIUL 5H8DA 1VGEH 5IMLB 3C6LD 2ORBH 2VAAA 5F7LB 4YJZL 3EDEA 2MTPA 4Z7UB 1UYWL 4QRUA 3HI6L 3K2UH 4JFED 1E6JL 1SYVA 3HR5A 2IADB 1I7TB 3E6FA 3GMMB 4KKAC 2I9LA 3NIDF 3O2WL 3TBTA 1BD2D 1GGBL 1IQWL 3V4VH 2CIKB 3VXTA 1IM9A 1OD9A 4TQEH 4MWFB 2VDRH 4G8FA 1A7NH 1A1NA 2G2RB 5TDNA 1UM4H 1ZE3C 1A1OA 3PE9A 5A3IC 2VIRA 4RGNC 1FP5A 4NSKB 3WIFA 5IWLC 1F58H 4GKNB 3O0RH 1JI2A 1G9NC 4XCYA 1BJ1J 5IMOB 2AABL 3GJFH 1N2RA 4HIIB 1SEBA 1UM6H 2VQTA 5T3XL 2F19H 1Y18B 2DRUA 3LS5L 4PV9B 5IBTH 3BZ4B 4M6NH 4MB3A 3D69B 4LSVL 1KYOJ 3GB7A 4LLAA 4K7FA 4G9FB 3WV0A 3VD9A 4DKFL 2D3VA 4JHAH 2APWA 1AXSB 4H26A 2V2WA 3LQAC 4DOHE 1JMXA 1A6ZA 5ESQA 3OXSA 2IH3A 2W0FB 4AEEA 3U7YH 4K3HA 1RULH 3RPKA 5F8RC 5JXAL 5D1ZB 4PBWD 5FEBA 3HE6A 2X4SA 1J0HA 3SGDH 4M5YL 3VWKB 5ICYA 1UXSB 1NLDH 3S36H 1HKFA 4FQHA 3WXWL 1G7IB 5IQ9B 2Q3AA 1TQCB 4J6RL 3RGVD 5KSAB 2HKHH 4ZTOL 2UWEF 2XN9B 1AGBA 1YMMD 1I9RH 5TDOB 5EBWB 4C57C 3VXUD 1Y0LA 3WE6A 1UZ8A 1I7ZA 4ZTOH 1T89C 4NUJB 1GOGA 3I6KA 2QR0B 3P73B 2N7BA 5FA4B 1PDKA 2I9TA 4OV6F 3MLTB 5EUOF 5FOBA 3MOAH 1G7PA 3E3QE 1MELA 4M03A 4P9MH 5C0NC 3TNNA 3BPNB 1EFXA 2AJ3B 5CJBA 4KRPB 2FD6L 4KKCC 3QDGA 5D7SH 4LCYA 1HEZA 5FM4A 4ODUA 5E8OA 4PRBB 4F7PA 1HKLH 1CGSH 5AUMA 2D7MA 1ZOXA 1A7NL 3PWLA 1U91B 2GJ6E 4WO4C 4X7DC 2QV2A 4KQ4L 4U1LA 2IPUK 1TJGH 4PGJA 3RNKB 2NZIA 2ZSWA 4AG4H 1LEIB 4F7CA 1FIGH 1G7IA 5IQ9A 4LBEA 3DV4A 3ULSA 3AB0B 5ESVB 3D9AH 1J5OH 3WFEL 4NCC1 5E1AB 2X4TA 2V7NA 2NY2D 5LBSL 4KDVA 5C3LD 5GGSA 2FGWH 1GAFL 4K3EH 4ZOCA 1U58A 1S78D 4U1HA 5C09A 5T33L 4OZGB 1YEGH 2PO6A 3DHJA 1VGEL 4WVRA 1YEJL 4RIRB 5MP6H 3OZ9H 1D3CA 3QFDA 4GG8A 3FHAA 5D7IF 4NJAL 3WFBH 2JJTA 5HVWA 3UDWA 1JE6A 3NOIA 3VMNA 3ARFB 1W72H 5D7LD 3DTXA 5DMGD 3C60B 4C56B 3QRGH 4F57H 1IE5A 3HS0A 5IF0B 3VGGA 3GJEA 1Q9LB 4H88L 1C16B 1A2YB 3C6SB 2L4OA 1XF5A 3HN3A 1WBYB 4QHNB 3WBDA 2EXWC 1BREA 1YPZB 4QRTA 3RI5K 4GT7A 2E27H 2MWCA 1CFNB 5E2UL 3PDDA 1RQ5A 1G1YA 1ACZA 5FKAA 1IGTA 4NNPH 4R7DA 3RRQA 5HHME 3ARBC 3QEQE 4KRLB 2B7DT 1JF6A 6FABL 5M7QA 5F9JB 3U1SH 3DI3B 1TJIL 4PRHE 5JTWA 5KSBF 4PTTA 1A3QA 3HRPA 5EO1B 4J8RB 2ED9A 4NRXB 3O3UN 3KPRB 3MPCA 3MLXL 4FG6D 4JKPH 4CW1B 3UJTH 2RCSH 2P5EA 3SE8L 4KROB 5L2JA 3HLAA 3UJJL 4RMSA 5DUML 1QFWH 3DECA 3UBXA 1Q94A 2OZ4A 3DX8A 1OCWH 3STZB 5HHOA 4N0YL 5I75B 2GY5A 2DQFA 3CDYA 3V6OA 2ZKHH 4XHJC 5C0BB 3R06A 12E8H 3DSFL 3T4YA 4GG6B 1N5AB 1U3HD 4MNHB 4NPYA 4X7SH 3PHQA 3HTLX 3L7FB 1BQHB 2ZUVA 5CJOL 4JFDE 5D1XB 4I3SL 4U6HA 4PJ7E 3AFLA 3RBSA 4TVPE 5E99L 4WJ5B 3VG9B 5KVGL 2GAZA 5CBEA 5DMJB 1MHPH 4NN7B 4IMLB 3L5XL 4LCYB 2Y4SA 4OLWH 4NZRL 4Y4HA 1OOAA 3DNKA 1BIHA 3U0PA 2KZWA 3MV8A 3ZKMC 2W65B 1IM9B 2OK0L 5I1HL 2FATL 1OSZB 2I5YH 4P5TA 2ICES 2HVJB 5TGBB 4BZYA 2D03H 4ODTH 4PREA 5EBGA 4XI5C 5LGKA 4GW1B 5F8QC 3D2UA 4TULH 1MLBA 3QP3A 3BISA 3H6JA 5J11C 4PGBB 4WUUE 1I3GL 2CDEA 4WU5B 2QTEA 3K3QA 5GRUL 4OGZA 1RK1A 3FFDA 5E1AA 5GZOD 3DWTA 1AR1D 5K33A 1UEMA 1XGUA 5E8EB 2W38A 4OAWB 2HH0H 5C08B 1V3LA 1CE1L 2CKBA 5I1EH 1SJHB 3LN5B 5EIQA 4CMMB 3QJHB 3GB7B 3BSZL 3SBWA 3K80A 1ZA6B 3FFCA 5I76A 2XKSA 1AXSA 4KZDL 4NN6B 3E3QC 3N85L 4OD3H 3L7FA 5C0CB 4I2XB 2E6JA 3DXAD 3RKPA 15C8H 1OL0A 1RZFH 2GKIA 1XAUA 1U3HA 2EXWD 4L3EA 3VFWB 5J12B 4MZ3A 4KK9D 3S96A 3MXVH 3CX5J 1LILA 1CTOA 4NQVA 4OUUA 5F44A 4KZEH 3SEPA 3CVHB 4X7SL 4Y5XC 3HR6A 3O2VL 4OZFG 4P4KD 3JVGC 3CSPA 2HKFH 4FQHB 4DKFH 2WQRA 4M5ZL 5EB9A 1UKSA 5DJAB 1K2DB 5ACMA 1KN2L 3OGCB 1HHGA 1QSFE 2AQ1A 2P7TB 4YLQT 2OMBA 3TVMB 2BXYA 4BUHA 2H41A 1E4KC 4FG6C 1E27A 1I1AC 1RUAH 3PF2A 3L6FA 1UM6L 1SJEA 4ALAH 4ETYA 5A3ID 5JHDA 3EAKA 4JLRB 3RL2A 4M7JH 1JVKA 3E8UH 1HNGA 3EW3B 4O2CA 4ETQA 5D71L 1CICB 4CW1A 3BYTA 4NT6B 4YR6A 3HC4H 4M4PA 5GS3A 2Y5EA 1SBBA 4PY8J 3J8F7 2DDQL 4Y5VA 5ID0A 1S3KH 5L6YL 1U2HA 2H32A 4URTB 3SCMD 4Y88A 4DFHA 3TJEL 3NFSL 2JB6B 3G5XB 1QLRA 2R4SH 2YD8A 3UYOD 1LGVA 3SDXA 3MV11 3V4VL 3MODL 5EG6C 4L29A 2ZP0T 2Q6WB 3L5HA 2D31A 1RHFA 4XXCC 1TZHB 4MZ2A 1I9EA 4LCCC 4OLUL 5E94B 5JPNA 1LEGA 4G3YH 4OD2A 3N9GH 2A38A 2BY2A 5F97E 5K9OB 4NNXB 5JPMA 3OR6B 1ZHKB 4MA8L 4PJEF 4XCFL 1PZUB 2XIDA 1NGQL 4YO0B 5E5UB 2DN7A 4LSQH 1PFCA 1MJJA 1YEJH 3GSOB 2JLLA 4OV5A 3RZCC 5D2NB 3JWOC 3HAEB 5EUOB 3IDYC 2F5AH 3QUML 1P4BL 5HHPA 2R23A 3SGKA 3RGVA 2WIIB 2XWJA 3QJFB 1T3FB 2C3WA 1JGUH 3TT1L 5CZVL 4JRYB 1MVFA 4JDTL 2ZOLA 4GKOA 4U4BA 5FXCH 15C8L 1RZFL 1YEIH 2LAAA 4F2MA 4HHAB 3HE6D 3UEZA 4MS8C 5F9OH 5EZIL 3I3EA 4HJ0C 3G5XA 2IPKB 3FB5A 1A7PH 2FSEB 2Y07H 5IROA 2Q76A 3QQ3A 4KJWC 1WFTA 1QR4A 3MV9D 2NQCA 4XVSL 1CE1H 1IT9H 4HK0B 5TJWK 3CVIH 3ARBA 3EOTH 4QO1A 3RUGB 1DFBL 1CCZA 2NMSA 4ZYKA 4QXGL 4EUPH 1AHWB 1RJZB 5E4EB 4TSBL 4FP8H 3OAYK 1DQLL 1IEBB 4Z7UE 5ANMA 4TULL 3RVWC 1YEKL 4UU9A 3F5WA 3JUZA 2FX7L 1HI6A 4FQIH 4X7FC 5F9WB 5IB4B 2Y5TB 3FT3A 1ZWIB 1BGXL 3EFFB 4PJDA 4UT9H 3HNSH 3TEUA 2OTUB 4GMSL 3QNYA 1QFUL 3BPLB 3H3PL 4HV8B 5IG7A 3L3GB 4X6BA 5IUSA 2GW5A 3MLWH 3STZA 2QHRH 3AY4C 4I0PD 3TNMB 2BSTB 2NNAB 3MGOA 3Q3GB 3A67H 1RUPL 1JZ7A 1JNNL 3O41A 1IQDB 5D2NE 3QISA 3F7YA 1FZKA 4WO4A 3ZE0E 1WUNT 4KU1A 1BFSA 1MCFA 4KAQL 1J8HA 3S35H 1MHPL 1OCWL 5EULV 1Q0XH 1JK8A 3PWVB 4XNUL 5B3JF 3C5ZC 1FLTX 3MR9B 5J6GB 3P30H 5BZWA 3QUZA 3KPSB 5HSFA 1IAIH 1FL5B 5IGXH 2Y25A 4DZBA 3S36X 3RI5F 4GKNA 1G6RA 25C8L 3EOTL 4Z78B 1TETH 3BHBB 3IAQA 5F70A 5F6HJ 3EYVA 3T0EE 3AS0A 2MCPH 4JFYA 1CBVL 5FYKD 5IB4A 1UB5B 4QY8A 1OWRM 5L88H 4P9HH 2P5ED 4FZ8L 2JK5B 4QOKD 2UYLA 1XF4A 3C09B 2C4FU 4LHJB 4JR9L 4OD1H 1FAIL 5LGJA 2V17L 1MCCA 2W9DH 3TLRA 1XIWC 3BUTA 2J4WH 4O5LL 2NXZC 5IMKA 4DW2H 1N7ML 3GSNH 3KLDA 4GRWB 3H9ZA 3LKRA 4JM4H 3W2DL 4WDIA 1KIPB 3T09A 4L3CA 3RVXC 1LK2B 1NC4D 2K3TA 5CINH 2Z4QA 1DQDH 4DGIL 3D1MC 5K9KA 4X99A 5ALBH 5BW7C 4PGCA 1MRFH 1TQBB 3MV7D 4PJHA 3C9NA 4TUOA 1A6UL 3FO0L 5I6XC 2NX5B 3K0WA 1MF2H 2EYTA 4IDJH 3DUUA 4LSRL 5LWYL 3QPQC 1YC7A 1ONQA 1R5VB 4RQQB 4S1SH 1P84K 5EC2A 3PGFL 3N9GL 3TA3D 4R2GC 3VH8G 5LWYH 1IZKA 3S4SA 4D0CB 4HUVA 1T66C 3RFZC 5I30H 3QIUD 3NGBB 1KN2H 5ISZA 3UPCA 1PY9A 4NCC2 4XZUB 1QNZL 1OF2B 5BVJB 2VH5L 4PGDA 1I1AA 1YN6B 2Y6SC 2MSPA 4Y2DC 1HQRA 2VABB 1KPUA 5FGCE 1U8PA 1TJGL 3I6LD 4JFZH 5EORL 2UVEA 3KG5A 1D5ZA 3FZUC 4LLQB 5DJ6B 2YR3A 3DO7B 1XF3B 1AGEB 1MWAH 3QQ9C 1PSKL 3ARQA 2EDHA 4Y19D 2A77L 3D3VB 5BV7B 4OM0L 2JKXA 4YIQB 5E8DH 3ZT7A 3WL9B 4JO4H 4RMTA 2H1PH 4AL8L 3O3EA 1Q9KB 3DX6A 3H8NA 1GGIH 4OD3L 1AR1C 3E6HA 4GLRI 4WI5A 3O6LL 3X14A 4RSVA 1U3HC 4LRNH 1P7QA 3OF6A 4Y8AA 3SDXB 3IF1A 4Y19B 1IFHL 4PP1D 3AM8A 2XKUA 5EPMB 2BFVL 5LG1A 4Y4FD 2E27L 1R5WB 4M62H 5AZ2H 1MREH 3OGOE 1LEGB 1Z5LA 4GW5B 3SCMB 3MFFA 1EGJL 2WNGA 1NJ9A 4TSAH 3EYQD 3QB7C 4JPVH 3KPOA 4XAKD 3I9GL 4MDIA 4GXUN 1W8OA 1XIWD 4YEEA 1JRHH 1MAMH 1JHTB 4HGWB 4C4KO 4S0TD 2DLHA 3OKLA 4Z7NE 1FJ1A 1N64H 1DUZB 5C0AE 1N6VA 4M61B 2D4FA 3MV7B 5L8JB 3WSQH 3MLYH 4GAYB 4P46D 4AENB 5DEGA 1F8TH 4JY5L 3T1WA 4LPWA 2Z35A 3UTTB 5SV3A 2KH2B 1T21A 4U6YB 4ZTPH 4QWWC 1D6EB 1MRCL 1FE8H 2F8VA 4WUKL 3MFGB 5FYKU 4UNUA 2EE6A 4G5ZH 2E9WA 2W0PA 4X6CF 4XMKL 1MCLA 3M1BB 3IFLH 3F12A 3UAJC 1NL0L 3QDGD 5GGRB 4NM4L 3WNMA 2EDTA 3WD5H 1FO0B 2BNQB 1SVCP 1U8KB 5HHOE 5C08E 5J7CC 4MWFA 2IQ9L 4WW1B 3V6OE 1U3JA 1MFDL 3CXDH 1DQLH 4D0DB 3WJJC 1S5HA 2CO6B 4FQ2H 3VD3A 5HHQB 2MPAL 4NRZB 2XZQH 1T1ZA 1SHMA 2XZAH 5CJQL 3LV3B 4X7TA 4N1HB 2P1YA 4J3SA 1AIFB 1VFMA 1FFPA 3ZL4L 2V7NB 1B4JL 5CD5C 1IMHC 1PSKH 4ZDHA 1F4AA 1PLGH 3IU3B 4UT7L 5JQ6H 4XNZB 1ACYH 4CVZB 5B21A 4RFNB 1N26A 3SY0B 3D25A 5EU7E 3ZKXC 4XGZA 3QQ9D 2UV3A 2EKSB 3UYRH 1R5IA 4G6KH 5EO9A 5ETUA 5BRZD 1AO7B 2ERJB 5I18L 5DUBB 2ATKA 3AXLA 4X4XA 3GMPB 4PJAB 1IM9D 4WIQA 4YHOH 1WZ1L 1MCHA 3B9KD 3QPXL 1C08A 4A6YB 4NQDB 4WJ5A 4O2FA 2QQLL 4F9LA 3VFOB 1F00I 3IDNA 3VRIB 3TYGH 2RCSL 3HZMA 5B8CC 1MUJA 4YHNA 2XRAH 2DMKA 2ZZUT 4KK8C 4C58B 5GGRA 4RGNB 1OARL 1F6AA 4LARH 2X4PA 1QFHA 5D6CB 2W65A 5MP6L 3LRSA 3OKDB 4JY4B 1TVHA 2AJSH 2DTMH 1T22A 3LD8B 1AKJB 2NY3B 4OFYA 1RUQH 3B2VH 4XWOD 5DTFA 4NRZA 1L7IH 43CAB 3L5IA 3C8KA 1S8DA 5EOQL 4S2SA 3RAJL 3TFKC 1LO2H 1G6RH 2O61B 3RX7A 1T7VA 2P46B 4ZFFB 2OZ4L 2V17H 5I15L 3MLZH 3S6CA 3G6AB 4CVZA 4JPIB 4EOWL 4LSUL 4IRJC 5I8CB 4MA1C 3NPZB 5HHOB 1RUKH 5L9DH 4HIEA 1F97A 3NCYS 3GSRB 3MJGX 4PJ8C 5C6TL 5J1TC 1I3VA 4DCQA 4R9HA 4DUXA 4K3DL 4BK5A 3PP3H 4Z0XB 2VQ1B 4KJPC 3V6BR 3WN5B 1N5YH 2QQKL 1OP9A 3WNOA 3RU8L 2AJVL 2OQJA 1EMTH 1HDMB 2R0ZH 3DUSA 3EO9H 2P8MA 1HNFA 4KMLB 5KSAC 3QIBD 1RAMA 1LP9E 1ZT7A 4ZNEE 4Q9RH 1J8HD 5D2LB 1I9JL 4HW6A 3LHPH 1IRAY 3FCTA 1J9CT 2A9ML 1HK6A 1I9IL 4TRPL 4RZCB 2ICWJ 2P24A 1TVHB 4P59L 1PVHA 5HYEA 2VXQL 4HUWB 5E7FA 3VXRB 4EDWL 1UQSB 1FCGA 3CX5K 2VISB 1B6DA 4GUPA 2AK4E 5ILTL 2PO6D 1SJEB 4I18B 3RJQB 5FYKH 3RDTB 3QFJD 2P44B 3HE7C 3BPNC 4E5XA 3TF7C 5FYJE 1W0VA 1JBJA 4LDLB 1EPFA 3FMGH 1X7QB 4UDUB 3ZE1E 3ETBF 2Z8WC 1FAKT 1RK1B 2OTPA 1ZT4A 5DJ6A 1KNOA 5DQJA 1JZ4A 2FJFB 3VXSE 2WUBL 3PABA 1FZOB 4KHXL 3MJ9H 1S9XB 1X5YA 4OAWA 3VU2A 3WD5L 3KAAA 1F45A 4UIKL 3WFZA 1FNLA 3QUYB 1D9KB 5J13C 1KN4H 3PWNB 1WJ3A 2VQ1A 1U8IA 5HXMA 2APTA 3GMLA 1QHOA 4WEUD 1FNSH 1MCWW 4HMEA 2G9HA 2XXCB 4JZNA 3DLQR 3RKDC 2AK1L 5DO2D 4KK6D 2IC2A 3B6SA 4JY5H 4YBHA 1JGEA 4GW1A 4OFDA 3W5NA 2F5BL 4R0LC 4TPRH 1D5MA 1F11A 1JN6B 3BPOB 1KB5H 1MUJB 2OK0H 4Y4HD 1J7VR 4U0RB 4NYLA 1JTOA 5E70A 3MRCB 4PLOB 1XGRA 4OZHA 4U7MA 4YXKH 4JFDA 3P0YL 3OL2A 5E56A 4LLVB 1S7VA 2ICEA 3UTTE 1CGYA 2XN9E 4PUBH 3RA7H 1U8NB 1IKFH 2D4DA 1G9EA 4XCCL 1LDPL 3RBGA 5GRZA 2F5AL 3QUMH 4UAOB 5IKCB 2EYSA 1KCVH 1MREL 1QYGH 3FQRA 3QQ4B 3ULVC 1N5AA 1NC4A 4RA0C 4KTEH 4GKZB 2CKNA 4GBXB 2LU4A 2PUQT 1Y18A 3A6BL 4FQ1H 4HC1L 5F1NB 2J1KA 2R0ZL 4MCYB 5MENA 2BSSA 4ZXBD 3CLFL 1D6EA 2BCKA 1NCDL 2HP4A 3U36A 3BW9A 5INCB 3BDYH 4JANB 4FQXC 4M7ZB 1JGLH 3BIBX 1MNUL 4OCWH 2I26N 1MQKL 3T3MF 5JDJA 5BRZE 5LVEA 5FF6A 1AGCA 4QF1B 4ZUTB 1U8KA 4UMGA 3GJFK 4KKCD 2ZG1A 1WSST 1VERA 1OPGL 5CGYC 4OB5H 5D9SA 3VFPB 5BXFB 4PY7B 4XTRC 1LK3L 4IRZL 1ZT7B 1WV7T 5CMAA 1CN4A 1S3KL 1TVBB 5L6YH 4XB8A 2UY7A 1GGBH 3TN0B 3A6OA 5ID1A 2ZCKH 3RAJH 3WIHH 1FRGL 2AXGB 2WWMC 3BXNB 3EYQC 1NMBH 4XPFL 1T2XA 5I74B 3B5TA 4Z7VA 1HXMA 2FO4A 3C8DA 4JGUA 4I77L 4HJGA 3FO1B 3RVTC 5DK0A 5F7YC 4CDHA 1LEKA 4HZLB 3UYRL 2VL5A 3JXAA 1C12A 1IC5H 4U7KA 2XYCA 4HUNB 5C0CA 5IB3B 2VZSA 2NY6D 1BFVL 4BSWB 5CJXC 1G0YR 3BP7A 1YUHB 2VDOL 1G7QA 5I1IH 4QRSA 5C6WH 2QQLH 3UP1A 1P7HL 2XACC 5DXWA 3S96B 4N1EA 3IDNB 3VRIA 4Q58C 1WEJH 4YDKL 1Y6KR 2DQCL 1WC7A 5CIPH 4KAQH 4FZEL 3T2NL 3GFUA 3CIQA 1IGYA 2EEAA 5SWZB 2PXYD 1JPFB 5IIEA 5HHOD 4MJ5A 4H20L 3CSYB 3VGAC 5D9SB 2D0GA 3K74B 5BXFA 4LVOB 4J4PC 1WT5A 1QSEA 2CH8A 2H6PA 4JFFE 4Y1AE 2EH8H 3WLWD 4KKNA 4GQ9L 1GRWA 1OD7A 3NABH 4DJMA 2QSCL 4Y5VC 5D70H 1H3VA 3BJ91 1MEXH 1DANT 1HH9A 4FFVC 3SKOB 3NTCL 1YNTB 2OTUA 3QDMA 3QXDA 4MB4A 2GJZA 3DYMA 1RMFH 1JPST 4CNIA 3ZYOA 1GIGH 4NZUL 3GO1L 5TQ0L 1FGVH 2HFEA 4NIKB 3F7RA 4WW2A 1HILB 4BH8B 4PRNA 4NQSA 3RWFA 1P69B 4RGND 5MEQB 3K4AA 4OF6A 1IGIH 5IKCA 1IAKB 2ED8A 5J1AA 3O3BA 4JFZL 4NKMA 1BX2A 1MIEL 1LO2L 5TE7L 4UQ3A 5TE6H 2IQAA 3TBVA 3NACL 5D7LA 2QQNL 4FA8A 3L3JB 3GDBA 4YPJA 1DQJB 5DHVH 2W07A 4F37K 1PQZB 4YHMH 4X5XA 2X10A 1R6VA 1KCSH 4NFCA 1GZQB 4PJCE 4B7IA 1ZHKA 2AJUH 2VXSL 4RZCA 1U8MA 4W4OA 4XAKE 4OIIL 1DQML 3L1OL 4E42A 5B38A 4PGDB 1N6QH 1ZHLB 4XPHH 1MAML 5C9JA 4BYHA 1HSBB 2OTWB 4JPKL 1EXUB 1BFOB 1J0JA 1FVDB 3BZEA 4QXUH 3BHBA 1INEH 5IR1B 4R90L 2NR6D 2NY3D 3KYOB 3UX9B 3B9VA 1DBKH 4F7TB 3SGJC 5CILH 2RIKA 1JP5A 1BFVH 1UB6A 2IFFH 3Q1SL 3VW3L 3TNNB 4J3VA 4N8VG 3FONB 2AEQL 5KSUA 3DX8B 2XZCH 4XCFH 1WBXB 2G60H 2DWEB 2FBJH 3BP6B 2V2TB 5IB5A 4HJGB 1T7ZA 4XPTH 2YOCA 4CJ1A 2H26B 4EDXB 4YXHH 4Y19A 4C54A 4G8FB 4HLJA 2MCPL 5KG9A 1QKZH 1IC4H 5F9OL 4GW4A 1XEDA 1A1MB 1KGCE 3F7VB 2XI9A 5MERB 5A2IH 1M05A 2HT3D 2VN4A 2VIRB 1FFQA 4TNVF 2ZCKL 1S7UB 1I1AD 3FAXA 4JM2A 3I6LE 5DZLA 2FZ3A 2Q87A 1ZHNB 1HZHH 2WUCL 4QY8B 2OP4H 2ADJA 3FQTB 2FIRT 3QIWB 1XF4B 2V9RA 1HYSC 1BZ7A 4U0QB 2EICA 4JVUA 4NM4H 4ZFZB 4AEHH 3HB3C 3MZGB 4PRPE 3UTSA 4M6ML 5IBUG 2P5WB 1DN0B 1GGCL 3WS3A 4RFOL 4RGMC 4PRIA 5GGSY 1K4DA 3A6CL 2LE9A 3VRLE 3LEYH 5AYUH 3JV5A 1RUAL 2I07A 3D18B 5SV4A 1R3IH 2VB5A 4BZ1L 4ONFL 1MF2L 4XXDA 1GAFH 1A8JH 3WMSA 1FYTB 2P45B 3O8XA 1NCBH 1KELL 1FAIH 3P40A 4N0UA 1FZKB 3DV4B 2PN5A 1LO0H 2A0LD 4KVCL 1UXSA 4CVWA 2D7NA 3LKSA 4P23D 5C0AA 3OHXA 5HYQB 1J1PH 3I9GH 5F71A 5L2KD 5DK2B 1ZANL 5T1MB 1S9WB 1X5XA 1SYSA 3WXVL 1J12A 1KG0A 4OCXL 2GSIA 2DQTL 4QOKE 1REIA 2NZ9D 3FOLA 4DAGH 5JW3L 4H1LA 5AZ2L 4NUJA 1EERB 4PJGE 3O2DA 1G84A 5E2WL 3PGDB 5DRZB 1C5DB 2XQBH 5FUZH 4HWBL 2VUOA 1D5BA 1VGKB 3T77A 1GZQA 4IS6B 1UJ3C 1NAKH 3T0AA 1G7PB 3LEVL 2WW8A 2CKBL 5C08A 4OGYL 4HWBH 2P48B 2AK1H 4M1GH 2GITB 4GKSB 4J1UB 2X70B 2YMXL 1NL0H 3VW3H 1EEQA 4M8QA 1F90H 4XMKH 4Z7NF 1RIVL 3CFJB 4UINH 3ARUA 1W72B 3MRDB 4R97C 3MV9E 2YD1A 5LCVH 4GLRH 5M95B 4H0GA 3BMWA 1NMAL 1ZA3A 4WTWA 4KROC 4YDLC 3UC0H 4PRAA 3TPKA 3VGEA 1V7NH 4ZUWA 4H1LH 1H15A 5EUKB 2VE6B 2QEJA 4H8WL 1JL8A 4Z7VF 5SX5H 2AEWA 3LS4H 4WW1A 3AMKA 5FKPA 3WFDL 3UTPE 4TSAL 3CDGA 3OKLB 2BC4B 2P5WD 1BQLH 1EGJH 4APQD 3ZYIA 2CXKA 3R06B 4G42A 2ADGA 4KGJA 3GGWB 1QR1B 1J0IA 3N1GC 1Q1JL 4Q9RL 1JWSB 2GUOB 2DMCA 4WWKC 3EYSL 4JPIA 2GSGA 2PNDA 1R3HB 5TF1H 2DQIH 5MI0C 1MFCH 2WM0A 3UJTL 4OT1L 3MLVH 2R2BB 2OL3L 3SBWC 3KXFA 1CLOL 4M93C 3CSBA 35C8H 5HDBE 3P9MB 1CFSB 4HDIA 3BKMH 3QWQB 1V7ML 5GJSL 4NOFA 5DVLA 1KXQE 1YEFL 2C3VA 2F9BT 1FNEB 3VFNB 5I1CL 5T3ZH 1KXVC 1ZGLM 1CLYL 2HJFB 3VGFA 2AGJH 4R3SA 2BNRA 4MD0A 4PRAB 1EZVX 5IEKB 1H15B 5EUKA 1U3ZA 1RVFH 4WTZG 2R0WH 5HHNB 4TUKL 4DN3L 4Y2DB 4LSSH 4MQSB 3NZ8A 2X9WA 3VXRE 3LY6A 2WIIA 3MXVL 2EDYA 4HSQA 4P46B 1MCPL 4JPKH 1ORSB 3GJFA 2XTLA 4N8PA 4K3GA 3DVNB 1LE5A 3UTSD 1YY9D 1OT1A 5CZKA 3ZKMD 2YHGA 4Z7WB 3JTTB 2I24N 2XICA 3ZDXE 5K59E 4Y5XB 3IJSA 4NM8H 2CGRL 4BFIA 4J3WA 4NP4L 2X70A 4PJEA 3FN0L 1QRKA 2GJ6A 4OZHE 5IBLD 5KOVC 3L3IA 2EZ0D 5DGQA 3ZE2F 3E8UL 5EU3A 5DT1L 1H3TA 1L7TL 2ZNXA 1H3PH 2M2DA 5FM5M 3R8QA 4HUKB 3LMJH 1NH6A 2W92A 1AE6H 1A6VL 3T3PE 1S5IL 5JDSA 1JYNA 1MSPA 3PWPE 4U6VL 5HVGB 5JOFB 4HFWB 1TMCB 4PJ5A 2PKDA 3ULVH 1YNLH 5JPNB 5CS7A 5F7EH 1CLOH 4NWUL 4OZHB 1AXIB 2CLZA 4G8IB 3ULVE 2YEZB 2ARWA 3FZUD 4KQ3L 4GXVL 1XMWA 4JCMA 1QA9A 5TQ2L 3B43A 1V3KA 3VWKC 3VFVA 4QXUL 1KPRB 1X4ZA 5SWZE 1X5KA 5HI3D 4UDTA 1OT2A 4WFHD 5IB2B 3S35L 4F37F 5IVZB 1ZLSL 3T0DA 2CRMA 4Q9QH 1JRHI 3GIVA 3TWCL 5C0RH 1Q72L 4MSWA 5JOPE 1A64A 3HZKB 2HKFL 4DTGH 4L3ED 1L4IA 3ULUL 4OLVL 1BQLL 1YEIL 4UDUA 3LSOA 4GRLC 4IBLT 1I9JH 2W60B 1AJ7L 3GMPA 1NGZB 5JW5B 1MJ7H 3M8OH 4EXKA 3RL1B 1KTLB 2J8OA 4WUUD 1WZKA 4O51A 4PJAE 3CMGA 4QHNA 1FBIL 4Z8FH 3NACH 1J8HB 3N1QC 2HLAB 1HE7A 5BW7A 5CZXD 5GGUA 2EIZA 2QQKH 2R39A 1FSKB 4YXKL 3KPLA 1R3LB 1FL6A 1YY8A 2PYEE 3RZCD 3BSZH 1P5VA 4HDIB 2DKMA 4HPOL 4WTXA 4KKLD 5DJAA 1MCNA 1T5XA 3G5YA 3T04D 5E6YA 3O4OC 3VWJD 4XNXL 4AIXA 2C1PA 2VLRD 3TZVB 5DFTA 1RJZA 4DKEH 3FN9A 2NY5C 2JELL 3DURB 3QUZD 4IIQC 3FB8B 3CGTA 3NABL 5JW4M 4K3JH 5ACZB 5F6HI 4LHQB 1N8ZA 2ICCA 2VXUL 4HIHA 3EDDA 4JO3L 5FIEA 5GGSB 5IVXE 4I13B 3OXRA 5HDQH 3VGHA 4HGMA 4Y16A 3O45A 4JY6B 4HGKC 1S7SB 2H2PC 3B2VL 3P9LB 1LDSA 4GH7B 4H5SA 4RNRB 2FL5A 3REVB 1GGUA 3L3HB 1T04A 2VXTH 4P3DA 1KSRA 3WDJA 3PIQB 4XWGH 2W60A 1XGQA 3RX8A 2VSCA 4IM8A 4Y16C 2AJYL 2YD7A 2IMMA 3OKEB 1QLEH 4PJ9B 2XQYG 4LCCA 2A77H 2AXJA 2NY7L 4KY1H 3P2TA 2FHFA 2WZPD 3C6LA 3RWEB 2DYPD 4RA3A 1JFQH 1J1PL 2ESVE 3D39B 1JN6A 1NCCH 4LMQI 4YAQB 5D7JA 2FX9H 4XBEL 1LO4L 3G6DH 3BPLC 4JHWH 4GSDH 3QHTC 5L8LB 3O3DA 3T4AB 5EU3B 2I9LB 3IYLW 3ZDYF 5D72H 5CJXA 1JZ3A 1MCBA 1E4WH 1TPXC 4C4KT 2VLLB 1AO7D 1EMTL 3LMJL 4EBQL 2H9GB 3RWGB 3HZYB 4PJ5B 3PL6B 4LL9A 3IDMA 3C2AL 3RVUC 2IALB 3RWHA 3PP3K 1WIUA 1PG7X 3QXDB 3DX7B 4O02L 4NC1E 4X0KB 4AM0B 4LP5A 1MFCL 3OR7A 1BIIB 2IEPA 1U8OB 3BH8B 4B41A 1X5JA 4P2QB 1I7UB 2OYPA 5TF1L 2VITA 4FFWC 1ZK9A 1QSEE 3K8LA 6CGTA 2FH6A 3RVWD 1OARH 3V4UH 5HDQL 4XPGL 1HEZB 1P1ZA 3LOWA 5JW4Q 2OL3A 4HK0A 2QBWA 1INDH 3KPQA 1T20B 1FVEA 1NCDH 4NKDB 1I3GH 4DVBB 3T0BA 3KHOA 1NDMB 3S34H 2QQQA 2B1AH 1LK2A 2W0FA 4GW5A 1WZ1H 4N90D 4KI1A 5K9KB 3FO2A 1GXEA 3KJ6L 4OCLC 4M1CC 4FQXA 1CFQA 1F6FB 3VI3E 2VDKH 2EIZB 3ECBA 3N1MC 4ELKB 4I18C 1N0XL 4PBVC 1FYTE 4KMQA 4QHMB 3UBXI 2HYMA 3UJIH 3Q6FB 4ORGB 3VXUA 1JFQL 4TNVK 4MDJB 3EOAA 1HXMB 2FO4B 2XKNB 1WFOA 2Z31D 4WV1C 4KH2A 4KJQC 5IR1A 1NEUA 4JLRA 3RL2B 4KROD 3WIIL 1CDJA 2HRPH 3DMMB 3IDMB 5CJQH 4XP9L 5JR1H 3ZHDA 2DLEA 5E6IB 2ZPKH 2P8LA 3WJJA 3BZFB 5L7XL 3EOYG 4F8QA 4BQBA 4FS0A 3SKMA 4GRWH 2KUTA 2X89A 1NFDB 5DVOA 1E28B 4P9ML 3DX9A 3MRJB 4JRYE 2AI0L 2CUIA 4G6AD 1MPAL 4JO1H 4H0IA 1X5IA 3TH4T 4BSVB 4U3CA 3QIUC 1JPGB 3QDHA 5INCA 3S3SA 1D5IL 1UJ3A 1GYAA 1FPTL 4PRIE 4J3UA 3C5SB 3E1F1 4F7PB 4K3DH 2BVQB 3HUJB 1QACA 4S10A 1A4KA 5ADOH 5F7EL 1G0XA 5TE4L 3FO2B 2G5BA 4NO3B 4PP2A 4PJAF 4EI5A 1U91A 5K9JL 2DI9A 3I84A 3IFOB 3MRNB 1BBJA 1A6VH 2LVEA 1GIGL 4NZUH 5HYSG 5DD0H 2EDEA 4MXQD 4CRPA 1QZ1A 4WFEE 4G5ZL 3OMZA 4U31A 3LIZH 4ONHA 4DK6A 5ILTH 2BSED 4BFGA 1L6XA 5GGTA 3GKZA 1MWAB 2PYED 3RWFB 3QI9A 5A2KH 1NGXB 3JUYA 2BRQA 3QG6B 5FUOL 2C1OA 3OJDB 5HD8D 4PB9H 4Q2ZA 1I4FB 4HHAA 1INDL 2NX5D 3EJJX 5FCUH 4ZFFA 3D3VD 2X2YA 5GIRA 4HJJL 2YA2A 3TBWB 2PTTB 4OLEA 3K8MA 1KULA 3RWCA 1AXTL 5IHUL 4IIQA 3MROB 4HCRA 1YEGL 1KUMA 4D94A 4WI6A 2VO5A 1FYHB 4JAMB 1S9VB 1QTYT 2FJGB 4LGRB 1BLNB 3QRFM 3ZHLA 1E6OH 4QCIA 3BH9B 3QXUA 4IMKA 2WBKA 1LVEA 4UUJB 4O5LH 5TGBA 4OZ4A 1IFHH 1BFTA 2J8UB 3SGJA 1RZJC 2VQUA 1H3PL 4JG0H 5KW9H 5E08L 1ZEAH 2A6DA 2Z35B 4HXBH 2BMKB 3F7QA 3FRUA 3AAZA 1XF2B 4G7YL 5ITBL 3S35X 2Z0BA 1U8LB 1NMCB 1M71A 5FK9A 3P30L 3PJSB 3TBSB 5AG8A 1UM5L 3FQUB 1SEQL 1GC1C 2UUDH 5DMIH 1RURL 4PJCA 2DLIA 2X40A 4J3OC 4WFFE 1BEYH 2VC2H 2Y06H 1VFUA 5K59F 3JTSB 1UWXH 1IQWH 5FA3B 3DUSB 1XT5A 5E9DE 4CU7A 4OCSL 1PX3A 3ZTJH 3QCVH 3VRLF 3CLEL 3DO3A 1QQDB 3K4DA 2K7QA 4RFNC 1T7XA 2CQVA 4NOBA 3T0EA 3RWIB 1FHGA 4I8DA 4M7LL 4RX4D 3IFNH 4S11A 2DS4A 5J1SC 4GRWF 1J1OH 2BC4A 3MV01 3OGCA 4X6FB 4LLYA 1PLGL 4KKLC 5GJTH 2MHAB 2X7LB 1RPQA 3MCKA 4P5TB 2GUOA 3GBMH 4NQXA 4DKDC 3L7EA 2VZTA 5DZNA 4IRSD 2DI7A 1DANU 3L3DA 3W9EA 1NBZA 5CGTA 4JFDB 2ZG2A 3ARED 4W6XB 1P4IH 5FYLE 4EVNA 1U8JB 2DD8L 4TSBH 3QDGB 4AM0A 1MFDH 3CXDL 3GSUB 1HQ4B 3GHEL 3KXFB 5JW4R 3C60C 3TBSA 1QP1A 2IANA 3P9WB 1FPTH 4ZFOL 4Z7UF 1INEL 3NFNB 2VLRA 5IW1A 5HYIA 4DCQB 1QFWM 3VFMA 5FUZL 2DLFL 1QBBA 2JCCB 3PHOA 4P3CL 3BT2L 1CGTA 1MRDH 3EYUH 4DVRL 1F58L 2VDQH 1ZXQA 5C86A 2E6QA 2R29H 4P5MB 3OBAA 1FVCB 3TA3C 1CFQB 2X6MA 3H0TA 3G6AA 4NNXA 2FJGA 3F7PC 4YDKH 3S97C 1QSFB 3ME0A 4HEPG 4YO0A 2ZJSL 4FQQB 4HWZA 2BOBB 1OF2A 5BVJA 3TYFB 5D5MA 1FH5H 4QHMA 4NWUH 5J12C 2ZJSH 3MUGB 2CR6A 1JI1A 1ZAGA 1NFIB 1KIRB 3BN9D 3VFGH 5FUCE 4TN9A 1WIOA 1LE5B 3L7EB 1NCNA 3SDAB 3V7MA 5DUBA 5E0QA 3ZHKA 5F96L 5JUEH 2X1QA 5C0FA 5CLWA 4JN2B 5MEPA 3B3IA 4OF5A 4HKXA 4S1SL 4M48H 4NC1C 1UWEL 3BQUD 3AS3A 3ILPA 4XP1L 5FAAA 5HGDA 2IWGA 2E5EA 2JJWA 4M1GL 2AJZB 5T1KA 5E5MB 2XOTA 3C60D 3VFUA 4PJ7A 1FRGH 2DI8A 1MHCB 2EEDA 5A2LH 2C3XA 2NW3A 5C8JA 1KIPA 3C08H 3NA9L 5HGBA 5CP3A 3HE7D 5CIPB 3GSWB 4ODHL 4UOW0 4FRWA 4J3XA 4QT5B 3AU1A 5E2TH 3I6KB 4U1GB 4P4RB 3VFNA 3TGXA 3K8KA 3KPRA 5C71A 2DQDL 4TUOB 1BF2A 1EAPA 2D31B 4OF0A 3IFPA 3GGWA 5KOMC 1K8DA 5HGHB 1L0QA 2UWEB 2ENYA 3GBML 4KPHL 4EBQH 4OI9A 1TQCC 4HIIA 5F7MC 4OF3A 3OAUH 1EJ6A 1UGNA 1O5DT 1VHPA 2Y72A 5KAQF 1NCWH 2ATPA 3B9DA 3U82B 2NY2C 1SJVA 2XZCL 3G6JB 3NFPA 3MV7A 1JHLL 3S37L 2MHAA 2X7LA 3FO9B 3VXPA 1CDUA 5I1CH 3AREC 3ESUF 3LSOB 4K71C 4AENA 5DEGB 3MNVA 4HKZB 4KJQD 5DD1L 1CXLA 3QHZL 2MCG1 3D85A 4O4YL 3SKNB 3ARFD 4KMTH 3OX8A 2C3VB 4X6CA 4QYOA 3QZWG 1IQDA 1BVLA 1KJ2H 1CICD 1HDMA 4KRPC 1DP0A 5KJRH 3BGFB 2VXVL 3ROOB 4AT6A 1W2KT 4HMCA 3NZHH 5DHVB 4XNQB 1IGTB 3HFMH 1H5BB 1QFWI 4L4TB 1FL3B 3DXAB 1VB9A 3JWOH 4HS8L 4YWGH 3VCLB 5CSBA 3FQNA 5C08D 3D87B 4FHBD 5F9JA 4RRPG 1WISA 3VE0B 3BH9A 4P2OB 4XMPL 2NY0D 3S5LB 4MA3B 4PTTB 2EO9A 1J0KA 1AQDA 4GBXC 3KPTA 1KFAH 4WFED 4YGVB 4JRXE 5E08H 3VRJA 3LKPB 4MB5A 1GCFA 1WCQA 4HT1L 2CLZB 4X80H 2DIAA 2VN7A 1X3DA 5F96H 5JUEL 3SCMC 5B39A 2HWZL 5EZJB 4WGVB 4LSDA 1SJHA 4NBXB 3GMRA 4OM1L 3U36B 1YPZA 1PEWA 4P2QD 5C0AD 3TO2A 1HSBA 4HPOH 3MRLA 4OFIA 1NSNL 1XGQB 2HT4C 5HI3C 4KXZI 2IGFL 3U4EB 1BOYA 4MNHA 4NPYB 4NQEA 1U8HB 1D5IH 2CDFB 2IBGA 4B53A 3Q5OA 1W0WB 3VA2C 1C12B 4JZNB 3QI9D 3GIZH 4YHNB 5D8JH 1HOCA 4PJHE 4GRLD 3ARDC 5JW4N 4NQED 2GFBB 4EDWH 5EUOE 1PAMA 1IGCH 3EFDL 3RWDA 4YHZH 4Y4HB 4L4TA 5IQ7H 1ONQB 1R5VA 1MY5A 5DSCA 4F9PA 3KNBA 8FABB 2QHRL 5HHXL 2PYEB 3BAEH 3WS6C 2ICWA 2FO1A 4EI5D 5FFLA 1W8NA 4KI5E 3CSYA 3MYJB 3V0VA 1A7OL 4Z7OE 1BPVA 5C0BA 3ZTNL 1S9KC 4X7EC 2FECL 3NN8A 3G5VB 1ZHNA 4ISVA 5EU5A 5KANG 2KQNA 2BVOA 3V4PL 1ZLUK 4KZDH 4YNYB 4Z78A 4S1QL 1OAZL 4NQXB 4MHHG 4D9RD 3RPIA 5EU7C 3O4LB 4KTDL 4K2UL 4H5SB 2W0LA 2ATPB 4EDXA 3MBED 3DVIA 4QRRB 1DBBH 4F3FB 2ZCHL 4XNZC 3VGAB 1YY8B 5F3HB 5ITFA 4CAGA 3SDDD 1OAUL 2R69H 1KLGB 5EOQH 3QULA 4HIJB 1WAAA 3IF1B 3JWOL 3FN0H 4QF1A 4KJYA 1AJ7H 3A6CH 3SDYL 2EDFA 3BO8A 3U79A 4NQVB 5D1QD 1W72L 4OIBA 3VXMB 5A40E 3GNMH 4CVUA 3U48A 4ZG1A 1ED3A 4M7KL 2Z31B 5LQBH 1ZKAA 1BBDH 2R2HB 1E0OB 1R3JB 4DUVA 1HHGB 2P7TA 3MZTA 3TN0D 3GSXB 3CMOH 3FQNB 1U8MB 1IEAA 4NDMB 4Y8DC 4D9RE 3HKFA 1V05A 3G08A 1W0VB 4UTBH 1EHNA 4OZIB 5BS0A 1S8DB 4X4YA 2HJKA 1JNLH 3NIDE 4MNQB 5HI4C 5EWIL 4Q97A 2PR4L 3KPSE 5FYJU 3QEHB 2VXTL 2R1XB 2G75A 3PWUB 2J6EH 2NY6B 4LQFL 3VXUE 4JKLA 3RVUD 4J1UA 1RIHL 2YPLD 4K7FB 4WNQB 1A22B 1C1EL 4P48A 1KJVB 2AJZA 5SWQB 5E2UH 4RMRA 4G9FE 5E95B 2E6PA 3O6FD 3D0LB 4NN6C 1HKLL 1G0DA 3G5ZB 1FFOA 4L4VE 2ILLA 5KANI 1T20A 2ZCLL 3CK0L 4JM2C 1FNFA 3SJVE 5MEOB 4H1LB 3CPLB 1BD2E 3EGSB 2ZCLH 3CK0H 3C5ZB 4XC3L 4XVJL 1R24B 1G9ML 4FFYL 2YUVA 5KTEL 3R0MA 3MRCA 1XGRB 4RDQF 3IFPB 3DOSA 2CDEB 1E4XI 5ENWA 5GRUH 5J4MA 4PGZA 4BQ6A 1QD0A 1BIIA 1KCSL 1FE8L 3MNZB 4MQ7A 2MOVA 1F6LL 2OLDA 1E4WL 1V7NL 5HHXH 2KQMA 2DQJH 5TH2B 3O2DL 4APQB 5C7XL 4H8WH 1FC1A 1XIWB 3W9DA 5J89A 1BAFH 4JRXD 4MXWH 1AO7A 1EUTA 1S7RB 1G7LA 3GRWA 2XXMB 2BOCB 3O6ML 4GAGH 4UTBL 5IVNA 5E94A 4Q9QL 1EO5A 4L8SB 3RUGE 2YD6A 2YD4A 4ZAKD 3RY6C 1NLBH 4PJIB 5DURD 2WSKA 5D7JD 4Q0XH 2VDQL 3NH7L 1QRNB 4GXVH 4JFFB 4Y1AB 4JFOB 4L8BB 4Y5YB 3OAZK 4QTHB 5EO0A 3W39B 3Q6GL 5D6DA 1QBML 2CLVB 2GCYA 1CXEA 1G7HB 4MLIA 1NUGA 2KZ1B 5DEFB 5BOZG 3JV6B 3RGVB 4TNWF 4JVPA 1J8KA 1WF5A 4GRWE 2OR9L 3HG1B 1NANH 3MLWL 3WFHA 4O2CB 4CADB 4L8DA 1OGAA 4LMQE 3MUY1 3MRGA 1AD0A 1T80A 4DGYH 4Y2DA 5I1GH 2ZOKA 4LIQH 1M6OA 4POYA 1UKQA 4JB9H 2NY1B 3BESR 2FATH 5F7DB 4OZFA 1NDGA 2JB5H 1YYLH 5BS0B 1U93A 3O8XD 2BOCA 2CSPA 3VWJA 1A7RL 4BSWA 4JJ5A 4ZQKA 5HYJB 2CUMA 5DQ9A 3GSQB 4NO0A 4GBXA 3HS0B 1IARB 4QRQB 5J57B 4J4PA 4WO4B 4L9LC 4JPVL 2DQJL 3C6SA 3SOBH 1MJ7L 4I77H 3JV0A 1ZA3B 2FZ3B 2J6EL 1QRNA 5GRWA 2HFFA 3ZDZF 1NGYB 5FYJD 4U2YA 2ERJC 1T83A 3TV3H 4C55A 2APFA 1DDHA 1F3DH 4EUPG 4JQIH 4E41B 4R97B 2VE6A 1EX0A 3MREB 1T89A 3PDOB 1JV5A 4OFKA 3QDME 2F58H 1AKJA 2ADFH 5C07A 4PS4L 2R23B 3IU4L 3W81A 3WEXB 2W9LA 1AGEA 2FR4A 4PYHA 3DMMA 4Z0BL 2ENSA 3QPXH 3RVVD 5KN5B 2AJYH 4R4FH 4W4NA 1FV1A 4XX1E 1HZHL 2VOTA 2WUCH 5C0GB 4JFPB 2BHUA 1OTSC 1IC4L 4KWUA 5E4IA 3N1FC 2ZUWA 1QLFA 3U7AA 2L7UA 4LDEB 4ODSH 1GOHA 1FIGL 3O8XB 4GRMB 2YSSA 2NY0C 2MQ3A 1GJIA 2OR9H 1TVDA 4LQFH 5J9PB 3SE3C 5I74C 3MQIA 3PWNA 4MAYD 4V1DE 5E00A 3ARBB 5FO8B 3T65A 4P2RE 1L7IL 4HXAL 1EFXD 1NCTA 1H0DB 3KS0H 4OCRH 43C9B 3KLSA 4PRDB 1FNEA 2DL9A 1JGEB 3B9AA 5AYUL 2AV7A 2YEZA 1QUNA 4U1IA 2EIBA 4KV5F 5HHVH 4UNVA 4P2RB 3S8WA 1OAKH 4MA7L 2IAMD 4F7EA 1X44A 4OIIH 3TYFA 3WLWC 4GRLA 5CHNA 5EFIB 1TJHH 1RY7B 1UWGH 3QZWB 3T8XA 3R0NA 5EU4B 1N0LA 3GSNB 4LASH 4I0KA 4UV4H 3MUHL 1UH4A 2FR4B 1YMMB 4HWBA 3HMWH 4L3CB 4YHLH 4WU7B 4CU8A 4OZIA 5H35A 4OFPA 3DHMA 1FNSL 1D5XB 2FYYB 4G80B 4NQDD 3FONA 4OQTA 4ZUVA 1KC5L 1YEFH 4LGSB 2H8PB 5T1LA 2BNRD 2APVA 3HE7B 3L3HA 3CDCA 1LP9F 4Q6YA 5FB8B 3EHBD 5KG9B 2VLRB 3WNLA 2AK4B 2AKRB 5B3NA 4DZ8A 5DHYB 2YZ8A 2NPLX 4GO6B 2RAMA 3EJYC 2VLJB 5IJKC 2FEDD 3MXWH 2YC1B 3MRRB 5CEZE 1Z3GL 1RIHH 3D3VE 3RY5A 4XCNA 3FB6B 1ZGLA 3QZWA 1NCAH 1KIQA 3T8XB 4U05A 5JORA 3W82A 5HYFA 5DJYB 1R3HA 3BKCH 2ARJA 1AD9B 3ARBD 1RUMH 1VFAB 3EZJB 4LEXH 1EXUA 3KPRE 3VFTB 3I3DA 2NLJA 4JDTH 4YH6A 3V52H 1B4RA 4MJ6B 1Z2KA 5EBMA 5GISH 1NUFA 2XG4A 3CFDB 2MQ0A 4NHCL 3VGBA 4PJBB 1WEJL 2LQRA 3HMXL 3OG6B 3DGCR 4TVSa 5BV7C 2EDOA 4AEFA 1P2CB 1Z5LB 4M6MH 5I71C 3O2WH 4N8VB 1KEGH 5GXBB 3R8BB 1ETZB 2Q7NA 5J9PA 3QO1B 1PKOA 2AVGA 4KKBC 1DSFH 3KPQB 5IB2A 1T1YA 3EO0B 1HXYB 1MRDL 1ULVA 3EYUL 2R0KL 2VTFA 1I75A 1CLCA 2EE2A 2PO6B 4P4RA 4NQCA 1AY1L 1KIRA 2XY1A 3MRRA 4JFDD 2J12B 3JV6A 1YEHL 3SJVB 3MJ8B 2DWDA 4OCNC 3ABZA 3SN6N 3KYKH 4X8JA 4FQXB 2DBJA 5EZOL 2VERN 4X4MA 2VSDA 2EC8A 3FB8A 4G6AC 5DUMH 5FCSH 3C60A 3UTPD 3ILPB 4ZO9A 2G60L 2V5TA 5IM7B 1IJ9A 1LE9A 1AFVL 1XGTB 5DMKA 3ZT5A 2J7LA 4ELMF 4OV5B 1S9YA 3HCVA 3D25B 3VFTA 3OJVC 3ZYJA 2X41A 3F12B 1WFUA 3NCCB 4LNVA 2DQCH 2HFEB 4U1SA 3OKYA 3QNZA 3TBYA 1JCKA 4MXVE 2C7UB 4MNQE 1MFEH 3JWDH 5GRJL 1BX2B 3T3ME 5A2JH 4TTGA 3DUHA 2XFXB 4LCCB 1T1ZB 1ES0A 4MXQC 5CKGA 4YEFA 3KS0J 2Q76B 2ORBL 2Z92B 3IXTB 1IAIL 3ILQD 1RZ7H 2YUXA 3DGGA 3O9WD 1PQZA 4XCCH 4ZS6D 3U46A 3VFRB 2IANE 3L95B 2ICWI 4XHQA 4IRSB 3H9HA 1BBDL 4P5TC 2AKRA 2R2EA 4HC1A 4LPUA 3KYMA 3RIFK 5GHWL 1IKFL 5DWUL 1K3ZA 5D2NC 5CINL 2BY3A 3F6IA 4CN4A 3BP5B 3GBNH 4ZO7A 2RBLA 1N2RB 4MAYA 3PABB 5I1KH 5T33H 2NY4C 1VACA 4YHKH 5ITBH 1B0GA 1CDBA 2W9DL 3N0PB 5HGDB 3ZKXB 2HT2D 2FHBA 4JDZA 4QRPD 4Y4KD 4ZFGL 4YDJA 2BSTA 4XPBL 3OKMA 3VJ6B 4V1DA 4LCIL 1T2JA 1ZHBB 4ZOBA 3CFKB 2XA3A 1TZIB 4I0PB 4X5WB 3RTQA 2FIKB 3ZYZA 2ESVD 2CXGA 3QA3B 4Z95L 3DGGB 1YA5A 2O61A 2O93L 1K8DB 5FYKL 4U1IB 3RIAK 1X5AA 4U6XB 4YDLB 3F62A 1QSED 4FFWD 2DIBA 2XWBA 3MNWB 1OSPH 2NY5L 2VISA 4GUPB 4BQ9A 1A6AB 2OI9C 4CMHC 3EOAB 3MGTB 2OL3B 4GBXD 1CF8H 2ADGB 3T3PF 3SJVA 4JFYB 3A0OA 4L1DA 4KDWA 3BE1L 3U7WL 3QT2A 4YHYC 1VACB 5D1QB 3RU8H 5H35B 5I0DA 4U1KA 3AAZB 3KHQA 2QHLA 2F53D 5DMKB 2MKLC 3EDKA 1NSNH 5HPMB 1GHFL 5JW3H 1UWGL 2B2XL 4WEMB 5IFJB 4PJFB 4YHKL 3QG7L 4L3AA 3SDDB 1K6QH 3P77B 5JDSB 1DE4A 3OKOB 2C7UA 1IGML 4S0SD 4UUJA 5BVPL 4IRZH 3CFKA 1HHHA 3MRBB 5TE4H 1FGNH 4HF5H 1FFNA 4K7PY 4I18A 2VLKB 3C5ZA 1TJIH 3EZ8A 3SDCA 3SHSA 4CGTA 4QOKA 3MYJA 2K7PA 4PJHB 5CWSB 1U36A 5CSGA 4G8IA 4ZO6A 1I7RA 5C3TA 2WBJC 2C4XA 3RGHA 3VXMD 4NQEE 4S2SB 4LVOC 2RFXA 4GQ9H 2P42B 5DQDH 2VR9A 1YQVH 3D48R 3UTQB 3MA9H 3LS5H 4JZOA 2UUDK 5D1XC 4HKBA 1A3RH 4Y5VB 5IFAL 5JIIA 4K9EC 4LARL 1XCQA 3L9RA 3T2OA 3W9DB 3LCYA 4DGVL 3AY4A 2NY4D 1CR9L 3AM8C 5SWZD 5J6HB 4OSUL 4TSCH 4P46C 3JWDL 4MA7H 5DJ0A 3X13A 3HMXH 4NQEB 1NC2A 1WWCA 3KPMA 2J8HA 3WDIA 3IS0X 3DYPA 2HLAA 5DD1H 2CIIA 5IOPB 1U8JA 4ZODA 3X3GL 4OD2B 4IMLA 4IEFB 3D39E 2ESVB 1P2CA 5F1SA 3TBWA 3T0EB 4XPHL 4ZFOB 2ZUTA 4HXAH 5ICXB 3QAZB 5FKAB 1T5XB 4QGTA 4K8RL 1A0QL 1G7HA 3GSXA 4I2XE 4JPWL 5DO2C 2HN7A 4XPFH 5IMMA 3LQZA 3QWOA 3H9SB 1ZGLP 4NNPL 1IAOA 4KJWD 2XZQL 3ZL4H 3QJFA 1OGAB 4G42B 2DQIL 5C07E 4EI6B 1HHKA 2EDBA 4XCYB 5DYOA 2VLJD 1IL1A 4X6EB 2A6DB 5MENB 4LF3B 2NXYD 3QXAB 1UG9A 3KWWB 4NO2B 1KJVA 3UYPA 1MNUH 1B88A 4EIGB 1M71B 5FK9B 3QG7H 4G6FD 1AGDA 1RZGA 3TYGL 1QSZA 1JNNH 1OW0A 5ERWB 4ZUTA 1UJ3B 3OB0H 5C92A 5IW3A 4L8SA 3RL1A 2VWEC 3HI5L 2R0LH 3B6SB 1J1XL 1K3IA 1I8MB 2A73B 5MHSE 1IEBA 4ZUUA 3QUZC 3UMTA 1L0XA 3NAAH 5I1DA 3KYNB 3P0VL 4OCYH 4PJ7B 1Q9OB 1UVQB 2BDNH 2OSLB 4WGWB 4G6JH 5HVHC 4JGMA 1EZVY 4E42B 3S36L 3SO5A 2EE9A 1OSPL 1VFBA 1SBSH 3Q5TA 3EKCA 4PJDB 5JZ7C 3TESA 1EEUA 3EJYD 3ESVF 2C5DC 1S5HB 3RA7L 5A2FA 5KVGH 1J0ZA 4JFXB 1QLEL 1TDQA 4MQXD 5D7KE 4EN3B 2NYYD 4LQ1A 2CMRH 3O4OB 3QFDB 1K9TA 1NGXA 5KVFL 4OQ1A 3BD5A 1CDHA 3BP5A 5FA4A 3S7GA 5KSBA 4F15C 3CH1B 4YUEH 4TRPH 3SE9L 3F65A 4QXTA 4XX1G 1RJYA 4GRMA 5EN2B 5I2IA 5HDBF 5KW9L 4L5FH 3O6FB 2JJTC 1HCFX 5C1MB 3SY0A 1SJXA 1W0YT 1WBYA 4CMMA 1MOEA 1FLRH 1RZGB 4BZ2H 2B0SL 1EGJA 5FO8A 1YZZA 3ARYA 1BOGA 5L0QB 3IJYB 3I3BA 1ND0A 3MRKA 2B1HH 1BHGA 1WVZA 4NO0B 4XP9H 5C0BD 4LCWE 5AUMB 5BJTA 4DZBB 2I5YL 5H2BB 3UTZA 1A4JB 1RUQL 4AY0A 3EGSA 1C7TA 1RJLA 3DIFA 3NCBB 5EBLB 1R3KA 2EO1A 3QNXB 4NKIL 3MFFB 4KKBD 1T1WB 4M93B 4R3SB 3MMEA 2P8PA 4LLDA 2UZIL 3T08A 4AIOA 3GSUA 4MJIE 3BDYL 5C9JB 3ULUE 4KRNA 1G1CA 4J4PD 3BEWA 2UY6A 1GGTA 4GFTB 4X6DE 1KBGL 3S34L 3MGTA 3VWJB 4M8VA 4IRJD 1RIUH 5D72L 1CICA 4LSVH 1AP2A 5HYJD 4GAYA 2H2SC 3W0WE 5IB3A 4XXCA 2VNCA 4YHPB 1IL1B 1FIEA 2HFTA 4WO4D 3TA3B 3NVQA 3D85D 3OZ9L 4R0LA 5DJZB 2FJHA 2Q86B 5L2KB 4ORZC 3VD7A 3FT4A 2R56L 3BP6A 3DPBA 3KLHD 5DRWA 4R26L 2JJUA 4TOYH 3BRGC 2AQ3A 1DBMH 1PBYA 3VFUB 3VCLA 4DZ8B 4PG9B 4JO4L 3PG2A 1BVKA 2Y1VA 4EEEA 4XBGA 4Z5RB 1FG2A 3WFCL 4HFUL 4NWTH 1XR8B 2X4RB 4DVBA 2B4CH 3PV6A 2OQJB 2WP3O 5DD3L 4XZUA 4YPGA 1DLFL 2UZYB 5E6ZA 1HWGB 1NKOA 5CEYB 3AU1B 1OVZA 5AWNL 3VRJB 5IB1A 1NEZA 4FQCL 4JR9H 3WJLC 3KYOA 3W5MA 3BYYA 2Y5TA 3EYSH 1A02N 4FTVE 3MV8D 3P3YA 5EZOH 3ZO0A 3RZCA 1Q1JH 2P8PB 4LLDB 2R0KH 3DARA 2EDKA 4P5TD 4CADA 4PRHD 4R4NC 3MRHB 2BNQE 5CILL 1HSAB 2NYYC 1QLFB 2ARJB 1EEZB 1EUUA 1T0MA 1YNTA 3M17A 3QDMB 3O3EB 4CNIB 4DEPB 3DJ9A 3IGAB 5FYLD 3L9RB 4HWUA 3MX0A 3KR3H 4HK3J 2VAAB 5KSBB 3AXLB 2A6JA 4X4XB 4FOMA 4WHTA 3WN5C 1N64L 1Q0YL 4B0MM 2FYYA 4BUGA 4ENEC 4NHCH 2CRZA 3SKNA 3B83A 2J8UF 3BKYL 4MXWL 3B9EA 3LKNB 1T7YA 3MRFA 3P0VH 2XTJB 3D39A 2HH0L 2VRAA 3IAPA 2WLZA 5KSAA 4MD4A 1M7XA 2QSVA 1OY3B 1A5FH 3I6GB 4U1MA 2VXUH 4CN1A 3V5HB 4GRLB 5CHNB 5BMFL 3B9KA 4BZ2L 2BVTA 3LHPL 1A3LL 2V9TA 2JIXA 5I8EA 1OAKL 3U2SA 2DQEH 5C0EB 3O3AB 1TIUA 4ODTL 4JFQB 5JA9A 2R9HD 1Z3GH 1RULL 1O7SA 1VFOA 2X4UB 1D5BB 1VGKA 4QLRA 3GI8H 3T77B 1T1WA 3LKPA 1UXWB 3WUWG 1CK0L 5KN5A 1EEZA 1MEXL 3B8SA 5J06A 1DFBH 3GHEH 4JN2A 2QKIA 3FOMA 1I85C 1R3JA 4OZGA 1G7JA 4UV7L 4WV1A 4LLMA 3NCJH 5I6XB 4M3KB 2EC9T 4LSUH 1F3DJ 1A7PL 1PKQB 2BSRB 4Z7VE 5DK2A 1RK0A 5B38G 2Z4QB 2P43B 3INUH 4IHOB 4Q2ZB 5EBMB 3U30B 1AGDB 5GJTL 1Z0MA 5F72S 3SQBA 1BAFL 3PQYB 5CEZH 3OV6A 4RAVA 3WFDH 3T2NH 5B8CA 4X9HA 1BJMA 1C16A 1AQDB 5CZVH 1AQKH 1T1XA 5FGCB 2NXYB 4R0LB 4CL7A 3EDJA 4OLYH 1AGFB 5T1KD 3PL6D 1UCTA 3I75B 4G8EA 4ZUUB 3QWRA 5HGHA 3L3OB 4HH8A 4WRLA 5H37G 2AJSL 4J12A 1ZGLB 1SVZA 4WFGD 5TQ2H 3DRQB 2H45A 3CZJA 1G9NH 3GI9L 1A6PA 4XBGB 1P4BH 1LP9A 2ZSVA 3U4BH 5BS0D 1XR8A 2X4RA 5IFHH 4XWGL 3PQYE 4P0DA 4NUGH 4WWID 3CFBB 3TV3L 4LFHG 3W11D 5EO1A 4M9OA 1XF3A 3K2UL 3U9PH 5CMAB 1BZQK 4E5XB 4C56A 3O8XC 5FV1L 5HHVL 2FX8L 2E8ZA 4NGHL 4LKXB 4WU7A 4FP8L 5DDHA 2M8XA 5EOCJ 1A6WH 4D9LH 2D7QA 3DETD 1XF2A 4XWOC 4Y4HC 1SYVB 4WI4A 3TJHC 4OGXL 1CLYH 4JDZB 3BIAX 3OB8A 4ZUVB 2R1YA 3QHFL 4O58L 3RWDB 4ZUWB 1BQUA 5T1LB 3PJSA 4NBZB 2X05A 3B4NA 3QNZB 3TBYB 4PJCB 3LRSB 2YPLA 1MH5A 4HFUH 4NWTL 1ZT1A 4LRIC 4D3CL 4RAVB 4N0CC 4HUXA 4NJAH 3V6ZB 3MBXL 2B1HL 1EIBA 4YXLL 1YN7A 4Q6IB 3H42H 3UDWC 4P5MA 4N8CL 1ES0B 1QHPA 4K8RD 3CFCH 4JVWA 4NKDA 5FOBB 5J56B 2YZ1A 1H8OA 4RQQA 1F13A 3TZVC 2GSGB 4KV5E 3CXHJ 2EIEA 3A6BH 3QHZH 1BECA 1JTTA 4L8BA 4Y5YA 3MBEC 1U58B 3CD4A 4U1HB 4IRSA 1GPOH 3BGMB 5IJKA 4P49A 3BRDA 4JZJC 3C5JB 1S7VB 2ICEB 4LSTH 4JE4B 4X98A 5T1DH 4OLVH 2E9JA 3QUKA 1QSEB 1ADQL 4JQIL 4U1SB 1ORSA 2XPGA 4KQ4H 4KZEL 2YRZA 3QI9B 1U8QB 5D1QA 1JPTL 3JV4B 4XP5H 5IJVA 5EZLB 1F4XL 4U1KB 1JPSH 3QCTH 1EJOL 2XFXA 3JTTA 5IBUB 4CU6A 3D3VA 3PQYD 3VDAA 3O9WA 5HPMA 1JYXA 1DQDL 2PW1B 2EC9U 3PWUA 5MI0B 2Z93A 4KKAD 3WYRA 1J05A 1RZJL 4BSJA 4DK3A 4PRNB 5LXGH 5B22A 3ULVL 4ELMA 1FYTD 5C7XH 5FO9B 4RAUB 4QHLA 3MRBA 4Y2OA 5JIPA 1N7MH 3GSNL 4PREB 3OJ2C 4M7LT 4JQVA 1OAUH 3CFIC 4HT1H 5HI4D 2FIKA 2WLYA 2IF7A 4MAUL 1OAQL 1YYML 4XP1H 2J5LB 2IBZY 4MNQA 4KI5D 2DWDB 5L88L 1I9RL 4D8PA 4DQOL 4NO3A 4PR5B 4X9BA 2P5EB 4U6XA 2QADB 1RZ8A 3O45B 1KNOB 2OBGA 2XWBB 3MNWA 1IGCL 3EFDH 3QO0B 2NR6C 3REVA 3RPIB 1NBYA 1P9MA 3TJHD 4MQXC 2AV1B 4ZAKB 2EXYD 1RZKH 3GBNL 2CPCA 2EDDA 1T2QL 2Q8AH 3CFBA 3LKRB 1FN4A 5HYJA 1WWBX 1BVZA 3QEQA 1KEMH 2FBOJ 4X6DB 4QGYA 3QEUB 4ODWA 5EA0L 5E9DA 3CPLA 1NLBL 2FB4L 4RWYH 2R29L 4HWEH 1UEYA 1EA9C 2KBGA 4KRPD 1DQMH 3L1OH 1YUHA 1CI5A 3JWNC 2PTUA 5J3HC 4M6AA 1WBXA 2JB6A 1JNLL 2RQ8A 3JSSA 2UVFA 3M1BA 5A1AA 2P4AB 2H26A 1ODAA 1U9KA 2HT3C 4YFLF 5I30L 1A9EB 4WHYG 4AQ1B 1ZS8A 3VFRA 1V3JA 1WWWX 4ZOEA 1JGUL 2A6KB 1UKTA 3O6LH 3Q5YA 2IGFH 3ZDZE 3GKWH 2AP2A 2L7JA 3MRPA 3BN3B 2OXGA 4RIRA 1GVIA 2YBRB 2BK8A 4DAGL 1AI1L 5DEFA 4FQXD 4PJ8B 4JQXA 1DBML 4LCUB 4WU5A 4OF8A 1WBZB 3F6LA 5F3BA 2DJSA 3MSPA 3FFDB 2PTVA 5FYJH 3DO7A 1MWAL 2B5IB 3QDJD 2J8UA 4FFYH 5ID0B 1U8OA 1LK3H 3GMRB 1C5CL 5LJYH 2VITB 4WI8A 1K5NA 3GSOA 3CZFA 4YHIB 4R4ND 3BX7C 4UOW1 4X9FA 4X98B 5F88A 3QUYD 2ZUQB 3NFPB 4BH7A 4PP1C 5CJ5A 2HT4D 4OGXH 2J6EA 1TTFA 1DE4B 3MV8E 3OG4B 2ADIA 2I07B 4OKVB 4G8GD 5DJ8B 1HHHB 2B39A 1C08B 3JWDC 3QIUB 3QRGL 3I85A 2CUHA 4NKMB 1DBAH 4QRUB 1VA9A 1CBVH 4L8CA 3X3FL 2AV7B 1A47A 4K07A 3GZKA 3ECBB 4HLZG 1FZJA 4ODSL 1GGCH 4X99B 4FFVD 4J2XA 3BQUA 2C4FT 4FZEH 3ROOA 1LWRA 1CFTB 1FSKC 3U83A 4LVHC 2R8SL 5H94B 2BJMH 3KYAA 1QA9B 5C9KA 4MJID 1UM5H 3RNQA 2R8SH 3KPPB 1SYSB 5CD3B 5FDWA 3FTGA 4OI7A 1T3FA 1QSFD 2DICA 4KTYA 1N6QL 1T2QH 2OX5A 5GRVL 1NFIA 3WO4B 1RIVH 4M61A 4S1DD 4C56E 1KCRH 2YMXH 5DGRA 3MA9L 1H3WM 5DI8B 2DLFH 4QRRD 3FQXA 3DX7A 4G3YL 3KYKL 3CFEA 5C0GA 2FB4H 3NBNA 1DUYB 3BZ4A 2DIJA 3QXAA 1AD9A 1NFKA 5F3HA 2BX5A 5ITFB 2DQDH 3MO1B 1DQTA 3IETB 1EVTC 2IBBA 2ADIB 2M1KA 1HINL 4WEBH 3DSNA 3V5DA 4R2GD 2AQ2A 2IJ0C 1C5CH 4MJ6A 1CTNA 3ARDD 5ICZA 5M94B 4X6DA 5H2BA 3G5YB 5F21B 4A6YH 4OZIF 1A1MA 3F7VA 4I3RH 4EI5B 4Z7QF 2YPVL 2KPNA 1A14H 4I0CC 3BPCB 3IT8D 5IK3B 3VWKA 5I73B 4ZPTA 3H7LA 1JNJA 3MOAL 3HG1A 4LOUD 3QIWA 2CIKA 5JHLL 1CLZH 4X6EA 1YJDL 3MLRL 3SE4A 1NGPL 3WUWA 1HIMH 2QJDA 3WE6B 1TPXB 2YXMA 3KPSA 2X4OA 2XKNA 5I19L 2ZUSA 4PJXF 1BF8A 1A1OB 3CDFA 2AI0H 3QDAA 4RNRA 1VPOL 4OLZH 2HKHL 1P1ZB 4AIZA 4W6YB 3UC0L 4G9DB 4YHZL 3QCVL 1K4CB 1KTRL 1BGXH 4N0FB 2OM5A 1OM3H 4I2XA 3UTSE 3FQXB 1CGXA 5JXAH 4K7PX 4NN5B 4FN0A 4JJ5B 4XVTH 5D7IE 4X6CB 3CUPB 1KEML 3FFCD 5TF0A 3VH8A 3O9WC 3SDDC 3LN4A 2Q1EA 4V1DD 3FQWB 4PV8A 1JPTH 5GSRA 3GM0A 4OUUB 3HB3D 2O5YL 4KQ3H 4HK3N 5KS9B 3OKKA 5DFVD 3RVVC 1MCWM 1H8SA 4KC3B 4QHLB 1IT9L 1G9MC 2VLJE 2VLKE 4RMWA 4EN3A 3X12B 4YXHL 3P0GB 2YRLA 4PJDE 1Q9WA 3L5WB 5F89A 4F7CB 4PRHB 1S7WB 5I15H 4LU5L 5AWNH 4YGVA 3BQUB 5BMFH 2H1PL 4AL8H 4EJ1C 3FRUB 1ORQA 5DRNB 4YDVA 1ZV5A 4QXTB 3RIFF 1JJUA 3QCUL 3R1GH 1PGRB 2FX8H 4J23A 4LF3A 2Z31C 5FDWB 1YPZE 2HLFC 2OMNA 3PNWB 1WGOA 3QSKB 4KJPD 1X9QA 1TJHL 2V2WB <