2KT6A

Structural homology between the c-terminal domain of the papc usher and its plug
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
85
structure length
85
Chain Sequence
VLKGKRLFAILRLADGSQPPFGASVTSEKGRELGMVADEGLAWLSGVTPGETLSVNWDGKIQCQVNVPETAISDQQLLLPCTPQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane usher protein papC
publication title Structural Homology between the C-Terminal Domain of the PapC Usher and Its Plug.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 11
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2010-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13953 PapC_C PapC C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2kt6A01
2KT6A 3L48A 2XETA 4J3OD 3RFZB
chains in the Genus database with same CATH superfamily
3O6FA 2ZSWA 4JFFD 4N9GB 2H0FA 4MD0A 4B9ZA 3M1BA 4L18A 3D25B 1RIHL 4QOKD 5C0BB 2BCKB 4FI6A 1FSKC 5AYQA 4DPAX 2WO3B 1PEWA 1G7LA 1MPAH 3EJYD 3K2UL 4MJ2A 2D3NA 2BOCB 1PNCA 1TENA 5FCUH 2E9GA 3BDBA 2MCPH 2Q86B 4UINL 1YYMH 2CUMA 4L4VB 3ARBA 3ARGD 3MRRB 3BAIA 1AHKA 4X6DA 4RZCA 1PEZA 5LUMA 5TDPB 4R7VA 3REVB 2F53D 4N2FA 1C1EL 4MA7H 5TQ2L 4JZJB 4OFVA 1TJHH 3K71B 1JWMA 4FL4B 3H9ZA 4WI2A 4AQOA 1AFVH 3RA7H 1GY2A 4RNRA 1MH5B 2N59A 3S4SB 3QXDB 4FG6D 2P80D 5I1LB 4UM8A 1ZGLM 5AW0B 4P57B 5E1GA 5IFHH 3FCGA 2VN6A 2XV3A 3F7PC 1DQQA 3TYFA 4FKEA 2EILB 5AYUL 2EABA 1FVDB 4JFOA 1HWHB 1QZ1A 3Q1SH 4NQDB 4R96B 2OCFD 3H42L 3OKMB 1XGRA 2YN3A 4RFEA 3CHRA 5IBLC 3LN5B 3APMA 1KF9B 3DRQA 1OTTD 3C08H 4IS6B 4PP2A 1XQ4A 1JYNA 1YPZF 3HC4H 3MNWA 3RDTB 5HYJB 3EJSA 3PRZA 4Q14A 2I5YH 2JFCA 2VNCA 1R5VB 1YEDA 4HUXA 4UTCA 3FK3A 1F90H 4O2EA 4J12A 3NGBC 4X5PA 3S5LB 4QNPE 3MRCA 4YZFE 4GKSA 5C6TH 3SKJL 5BRPA 2LQRA 4B9YA 2ZX9A 5IESL 2VDPB 1LEKB 1XF3B 3UGUA 1X7SA 5GS0D 4G8EB 4YAQA 3GNML 3KPRD 4OR1A 3LH2H 4G8GB 4HGMA 3Q48A 4FQLL 4CVZB 5EZOL 1EERB 4WI7A 3T0AA 1JZIA 3VDBA 4AEIL 3VYPA 3TN0A 1GGYA 3MRLB 1JPTL 4BINA 3IDJA 1L0QA 3LNIA 3SZ6A 1F18A 5CXPA 2AQ3A 5E51A 3EYOB 2CO7B 5IB3A 5IM7A 2VSMB 3SGDI 3VGGA 5IMKB 4JB9L 4XPAH 1R4XA 1EUUA 4QKXB 4OVVA 1RKRA 3V7AG 3F01A 4YC2B 4PJ8A 1ZT1A 3HMXA 4U7KA 2A1WH 3D69A 3X1FA 4GSXA 1BD2B 4WFGE 1UWXK 4XO8A 3G9VA 5DC0A 2WHVA 3L81A 7FABH 1TZHA 1XD1A 1T3FB 4H40A 3ZL4H 4S10A 4WTXA 5L8KB 4LOFA 1N10A 3IWVA 3UBXG 4BD4A 3HG1B 4X5QA 1EO5A 4CVUA 4ANVA 3JV6A 4KX8A 4DGUA 5C0CA 2AQQA 4JM4L 2WUCH 3VUAA 1HWWA 1KXTB 1ASOA 5C08A 1C5CH 5D9SB 3LSOA 3NCYP 4DVRL 4B9CA 3H3KA 4KKAC 4LSUH 1UT1A 1V7ML 2VYRE 3D4CA 3V4VH 4FXGB 3L5HA 1S7WB 2GB2A 3BPLC 3WIIH 2VXVH 3P4OA 1VGEH 4PJBA 1LEIA 3HNTL 3WN5B 2QADB 2EC9U 4HK3J 1YEEL 3O4LA 3R8BB 4NC0B 2NYKA 3W11D 2EUWA 2IH3B 5CP7B 3FH7A 4E9XA 1AIFA 2NZ9C 3O2DH 2JI1A 3MLYH 3NCFB 4XMPL 1IKNA 5IKCA 5LG6A 2NPLX 2APTA 5EMYA 3JWNG 3MGOA 5HGBB 4HUWA 1WVZA 1RVFH 5FUCE 2BHUA 3NOIA 1OF0A 5HJDA 5KBLA 1PJWA 2HVKB 1DVTA 1T66D 4PJIE 1AGDA 1AKJD 1CTNA 1KJ2B 3IPEA 5FO7B 3SDXA 5HDQH 2A6DB 4EN3D 5BPPA 5DD6B 2YC1B 2XWTA 3DXAA 5JW4N 3EKCA 3GINA 5CLWA 1YG9A 3HE6C 3VRJA 1XTMA 4LCYA 2R27A 5CGYC 4B50A 2R2CA 2XSKA 3VH8B 5CO1A 3VU1A 5L2KA 2K70A 3AS0A 1X7TA 2X4UB 3F3HA 3VXRB 3KL3A 4XVSL 5CZXC 3LPWA 1TZIA 5DHVH 3T0BA 4YXHH 4DP1X 3U7YH 3QR0A 1N0XL 4Y9EA 4BK8A 1PD6A 1P7HL 4PJ7E 3S7GA 2JV6A 4L0ZA 1UA7A 2R9HC 3QT2A 1BEYL 1KGCE 5L2JB 2XIBA 3MGTB 2FYVA 2NW2B 2WAHA 4HF5H 3MV8D 3QPKA 1NC4A 1LDSA 3GK8H 1MHEA 5AQ0A 1OALA 5A2FA 4AM0A 1ULVA 2JKTM 1ECYA 3AGWA 3LEXA 4O58L 3WN6A 1VJSA 4PRDA 4C56D 2X5PA 2NXYD 2YXMA 3KG5A 1GGCH 2DYPA 3T3PB 5GRUH 3O3AA 2ISDA 1VZGA 2DQFB 4RX4D 1YY8B 2CPUA 3LIUA 1JDAA 3O2VL 3L4WA 1UD6A 3A0OA 3AT0A 4FLHA 1NKGA 4A7GF 1J8HB 1NBZB 2A0LC 2O6PA 4K3JL 3BI9X 4OLUH 2WVUA 4XPBL 3X3GL 5JA9A 1EZLA 1FG2A 3MJ8B 4GIOA 5T1MB 3SCMC 5IW6A 1UH2A 2XV0A 3KPQA 1I9JL 1YAIA 2NZ9D 2FLMA 5CCKH 1XGYH 4X7CC 2IWEA 2GT9B 43C9A 2ADYA 4Y9FA 1VFAA 1BG1A 2XV6B 4KJYB 1JCKA 4TNWF 4GG6E 4QAWA 4A2GA 2OTUA 5EO0A 3MLVL 3ETBF 5ITBL 4WFGD 4Z95H 1CLYH 1IAOA 1AD0A 1KB5L 2XTJB 4HZAA 3SQRA 4GKNA 5F89A 3STZA 5FGCE 2VC2H 3R06B 3EYFB 3RIFK 4JZOA 2VDLL 3VFUA 1LK2A 4BQ8A 3ULUF 1K85A 3HE6D 3PWUB 1SJEA 5BMFH 5KVMC 3DMMA 4XNXH 5CGYD 1DVFC 4UV7L 2JCWA 3U0WL 2HPOA 5I6XC 1SQMA 3GWJA 2QZQA 4FQXC 1RK1A 1RZKC 5EHFA 1VFBB 1U92A 4BH7B 2VXQL 3CLFH 4FC3E 4JPKH 5D1XB 5J3HD 4ABVA 3X13A 4EIBA 4IIQC 1EAPB 3SDCA 5TF1H 1SXBA 3R18A 4J3XA 3C5JA 2TSBA 3K46A 5KVEH 2R9HD 3AREC 4RAHA 2NY6B 3ISYA 2FZ3B 1IAIL 2CA4A 2VRAA 3WDHA 3JV0A 4DVBA 2WVTA 2YLKA 4ODVH 4PJAB 4O02A 2L7EA 5GRZA 1EBAA 2OV0A 2Z8WC 4V2CB 2Q2EB 4XNDA 5EU6A 2JF1A 3RL1B 3T3PF 4UANA 1JHTB 1IFHH 5GGVL 1UC6A 4BFGA 5G2NA 3UC2A 1G84A 2XN9B 5T1LB 1X5GA 4PP1D 4PSPA 1H9DA 1CMOA 5EF1A 5ADPL 2PXYA 4H88L 1BJMA 4UDUA 2Z1KA 4A6YA 5F3BB 1OOAA 3B9AA 1J9RA 5E4EB 4M1DL 3GBEA 4ZDHA 1HHHB 1Q9LA 5DJ8B 5DURD 4K5LA 2A0LD 3W0WB 3WS3A 2CDEB 3HZYB 3X1GA 2XY1A 3GB7B 3P77B 5SX4H 5I1GH 5HYSB 2Z35A 3SCMD 2JXMA 3D34A 1LE5B 2AQPA 2WYZA 5GS0L 3LXUX 4AQ1A 2AITA 3DIFA 2ZF9A 1KCRH 3DC0A 2H45A 4JKLA 5CCGE 5I6OA 5F0JB 4AGPA 2MQ3A 5IP4A 4UT7H 1LEGA 1JGUH 4HKXB 4QXVA 4AV4A 1T0MB 2Q8BL 5FHAH 4KI5C 3TIEA 3VXQB 5B39B 1SDDA 4WZ9A 4DP9X 1OL0A 1JV2B 3HBPA 3HC3H 3T4YB 4AEEA 1M05B 2UVFA 4L05A 4FLSA 2EQDA 2IAND 2AVFA 5CN1A 1JWSB 1YPZA 4ODTL 1WFJA 2PWDA 1DVFD 3O11A 2WYIA 1YUHB 3UDWC 4QRQB 2ZYIA 5C70A 4FQXD 1E67A 2HLFC 1OW0A 3N1PC 2H3NB 4YBQD 4N9GA 3QGVA 3CIAA 4KHTH 2G30A 5C0BA 1VB9A 2EVGA 2BCKA 3RVTD 5DD1L 4M9OA 1SMOA 5FGBC 4JQXC 1SEQH 3W81A 3Q8FA 2BOCA 2Q86A 3ARED 4CGTA 4PJAF 4PYHA 4GIAA 4L4VA 5DR5L 1X5ZA 4PTTB 3MRRA 5TDPA 5JR1L 4NCDA 3REVA 1BQLH 2WXGA 4GNKB 5KYXB 4G9FA 3GFUA 4JZJA 3KLLA 1I85A 1DSWA 3RAJH 4F2EA 1RZJL 3KWUA 3K71A 2O5NA 1GC1C 2H1PH 4WV1B 4XCNB 5DXWA 4QR7A 2UZIL 3HC2A 1AY1L 3BE1H 5I1JH 1H3TA 5H2BB 2BVEA 5E8NB 1MH5A 3ZDXE 3S4SA 3ARDC 3QXDA 3NJNA 4FNRA 3IT8D 4RRPA 4P57A 5GHWH 5LCVL 4GKLA 1Z1WA 1NCIA 3FO9B 5DVMA 1FVDA 2AAAA 2B08A 1OCWL 2PKDA 3NG5A 4NQDA 4R96A 3MV7B 3OKMA 4XVOA 5DZOA 3SBQA 4Z76A 1QNZH 3IBEA 4G2AA 2XICA 4GS7B 4P9HC 1ZEAH 3HA0A 3LN5A 1UJ3C 3UG4A 1GTFA 4NI6A 4IS6A 4YHYC 1MJ7L 3WI9A 3B2UD 3WIHA 1HVXA 4D9QD 3QIUB 3RDTA 2F68X 1R5VA 1Z5HA 4UV4L 3FCSB 3I9GL 1XB3A 3FSWA 3S5LA 2BXZA 3HE7C 4AGOA 1AD9B 4AYGA 4I18C 2WKLA 1MZZA 4GEIA 1XF3A 3HFFA 1LEKA 2HLFD 4G8EA 1KDJA 2YS4A 1IC0A 3FT4B 2Q8AL 1MXDA 1UM4H 3ASNB 1A8ZA 3TBSB 2DWEB 4CVXB 1H6UA 3K2KA 4CVZA 3BESR 4HZ1A 4HJGB 4ZW5A 3MRLA 5LBSL 3KBPA 3AG3B 4JPVH 1NLDH 4OB5H 2GJ6E 4PREB 3EYOA 2CO7A 3MNZB 4M43L 4CBZA 3S34L 5IMKA 4YSSA 5AZ2L 4I1NB 1CXLA 3TH4T 1DO6A 3CFCH 4PGCB 2AP2A 4GSQA 5HVHB 4H8WH 3KYNB 5EV7A 3PQYD 2IO5A 1BD2A 3CBKB 5E9AA 3GJFB 4X5XB 4X4KA 4XCFH 4AV0A 1FO0B 4MZ2A 5C3TA 2K3HA 1UM5H 1QFUH 3ARDD 1CXHA 2YEZB 1FFOB 1KTJA 1OAKL 3HG1A 5JXAL 2XZAL 5JW5B 1HCZA 3NSJA 4JQIL 2QQLH 4P4KD 1QEXA 2CUHA 5C8JB 1ILSA 4PI0A 1CG9B 1OP9A 2QSCH 5DRXB 3WY2A 4KPHH 4B3EA 3IDNB 1KXTA 2BY1A 1RP8A 5D9SA 2D3JA 1RP9A 1NCNA 4DN3H 5F93C 1QBLL 3FZUD 4KROC 5MEND 1NTDA 4PRHE 1ADQL 4OIFA 4FXGA 4F7KA 1S7WA 1I1AB 4QHMB 1LVEA 2K3TA 3I6GB 2AF2A 1UOKA 2ORBH 2ZP8A 4PMEA 3WN5A 4YZWA 3PREA 2JQMA 1DQDL 4LF3B 5HI4D 3HE7D 1QACA 1A6TA 3IDXH 2XZQH 2IH3A 2HWZL 3EYSH 1XIWC 1WZ1H 4OLWL 5CP7A 3RHWF 3S3PA 4LSDA 3K74B 4H26B 2YRZA 1SVZA 1YEGL 4UAOC 5KVEE 5HGBA 5B38G 4IRSB 1DZBA 4GRLC 1UOLA 3QFGA 5IB4B 1XEUA 2NZ1A 1RHHB 15C8L 3H6JA 4OAWB 2P5EE 4G9DA 3LS4H 2HVKA 5FO7A 1KJ2A 3DLQR 1P7QB 1TVHB 3L1GA 2A6DA 2HJFB 4KK5C 4NQCD 5DD6A 2YC1A 4BCZA 2GPZA 1WDAA 4PQXA 3QC6X 3ULVH 2EO9A 3VH8A 5FW7A 5IGXL 4HFUH 3T2LA 5INCA 2X4UA 2XYCA 3UPCA 3LN4B 4IK6A 3VXRA 2W0LA 3QUZB 1MEXH 5IBTL 5LXVA 4M5YH 1F00I 4ONHB 2P28B 4KVPA 4NC2B 4BZ1A 1NPNA 3W5MA 2PWFA 4J2QA 4U6YB 5SX4I 2Q3ZA 1MCNA 5L2JA 3IDGB 3MGTA 2BSTB 4XOEA 2NW2A 4Y4HC 4DUWA 3FO1B 3ZRSA 2D7OA 3DA0A 4J8RB 1JZ7A 1OAXH 5J7CC 1U8PB 2YXFA 5HHPB 3SBWA 4XAWL 4NNXA 4IU2B 2ZOKB 5JW4Q 5BZXA 3BHBB 2KQNA 4ONOA 4OSUH 3ATDA 3LQAH 4KMTL 2DQFA 1YY8A 2UYLA 4KRPB 3QJUB 1MCQA 1J8HA 1NBZA 1TO4A 3SIKA 5GGQL 5F7DB 1SBSH 3MJ8A 5T1MA 5JHLH 1XIWD 4ZFOB 3O6ML 4XXDB 4ERSL 2GJ6D 4JO3H 4OGYL 4GH7B 4PB9L 4DN4H 2AEWA 2PO6C 4DZBB 2PR4H 5DGRA 2CO3A 43CAB 4A7UA 2GT9A 4KVNL 4K5OA 1NBYB 1E40A 3BN3B 5I23A 4KJYA 3WKMH 4TL5A 1UFGA 2DWTA 1INEL 1OGAB 1BM3L 3VXMD 4LRNL 3BGAA 1KN2H 1OKEA 2OMNA 3PGCB 4F7EB 3JVFC 2NNCA 3CZGA 4NM4H 4WSGA 4OCXH 1GZHC 4YSRA 4KK5D 3ZQ9A 3R06A 3JWDC 2DL9A 5EH1A 1PLGL 1QMUA 3EXJA 4NQTA 3S2CA 4PGDB 3PWUA 4A37A 1TQBB 2WBJD 4OCWH 1K5WA 1MDTA 3BD3A 2UZXA 3ILPB 3ZYJA 1YAZA 4JFDE 4BH7A 1TYRA 4G42B 2I24N 5C0ND 3BLPX 3WO4C 1YYML 5IFAL 3HG0A 5D1XA 1I1YB 4YE4H 4YSDA 1EAPA 5I71C 1DL7H 2PR9A 4MA7L 4X9IA 1A0QL 3RFRA 1YNLL 1GGIH 4FAAB 1E4WH 1WC7B 5I8EB 1X9QA 3HRZC 2FZ3A 3O6LH 3VWJD 2CNZA 4PJAA 1RZGB 1LQBC 1TEYA 3RL1A 1MI5E 3ZY7A 1JHTA 5FO8B 2ZCLH 1GL4B 1MWAL 4JG0H 5F9WC 5C09D 1XGPB 2V33A 4XO3A 4QTFA 1QA9B 3AWGA 2XN9A 3DO3A 5T1LA 2J25A 3ZZ1A 4OTXH 1T6BX 4DEPC 1K6QH 2RIKA 4LSVL 5F3BA 5FO2A 4YHOL 4HLEA 4YQXH 2CMRH 1BZQK 1HHHA 5DJ8A 1JHKH 5E1AB 5T5FA 3NCXA 2MHAA 2CDEA 3HZYA 3W0WA 3GB7A 2HPTA 3P77A 4JFSA 3ECQA 2YKLH 5HYSA 1LE5A 1SJXA 2VZUA 4LU5L 3C08L 3D2TA 2XUWA 2R8SH 2QT6A 2LLGA 2WYTA 5T3XH 1QSEE 4H20H 3EO1B 5CNHA 3TV8A 4IRZL 3LOWA 1KEMH 3O9WB 3TA3B 5IJCC 4QXWA 1F90L 1J1PH 2D03H 4HKXA 1T0MA 2BHFA 3VXQA 5B39A 5C6TL 5IT2H 3PXLA 2GY7B 5JHDB 3H9SE 3VA6A 2E4FA 3GZQA 1E6OH 1UD4A 4I48B 3T4YA 4Q0XH 1UM6H 3JUYA 3LH2L 1JWSA 2UY6B 4MJ4A 4YHKL 8PAZA 5AW8B 4XPTH 1D7BA 3EH1A 3DWTA 5KYYB 3CXDH 1HEZA 4Y5XC 1YUHA 1MG3C 1HOCA 4H25B 2KKQA 1GC1L 3C9NB 2H3NA 2WXQA 4MAYB 3GMLB 3LEVL 1MCLA 1CGUA 2V6HA 3KLQA 2QPSA 3L5WB 3LIZL 4P06A 5DFVC 5FHBH 1IM3B 2FR4B 4MYWB 4L4TB 4R83A 2CBOA 3WLBB 3ZHDA 3V8CA 2WXFA 3GM0A 3DOHA 5KYXA 1X5IA 3DKHA 4P9HL 3TWCL 4YX2H 5GSRB 3F04A 3P0VL 5CWSB 2J8OA 4R0LB 5AL8A 5LBGA 4NYLB 4KY1L 2J21A 4WV1A 4P48A 4XCNA 2ZXCA 3UTTD 3RURA 2N4IA 2WUCL 5H2BA 1P84J 4OF3A 5E8NA 2DI8A 4ZFGH 1L6ZA 2NY2D 1EXHA 4QRSB 2DQGL 4LSUL 1I82A 3V4VL 5EZIL 3WIIL 3FO9A 5DVLA 3W9DB 2AJVL 1YECH 2VXVL 4NN7C 4ICWA 1CE6B 4N8PA 3UIZA 1EV2E 4PY8I 3WU1A 3QUMB 4P23C 2DD8H 1UOVA 1NQBA 5DI8B 2R0ZH 3K6FA 4HULB 1CL7H 4E9VA 3TCTA 3ULVE 1BQRA 1EZVY 5A2IH 2W0FB 1QRND 3QIUA 1BWWA 2CLVB 3O2DL 3QJTB 4IHBA 2A6IB 1E4XI 3IMTA 2XIIA 3FCSA 5CJXC 1T83A 2XJLA 1RVFL 2VZVA 4LNRB 5AW3B 1AD9A 1A66A 4DJMA 4ALAH 3HAEG 3S0PA 4ES9A 1BVNP 2YK1H 1CICA 3MA9L 2WLLA 1V05A 5I66B 2XLLA 4WTWA 2VN3A 3FN0L 4U1JB 2YJLA 3TBSA 1MI5D 2DWEA 4CVXA 5AAMC 3MI6A 4P2OC 5F0LB 1ZXKA 4HJGA 4K94C 1AXSB 1FGNH 5CHNB 1AKPA 4I0CC 1T1WB 2HVJA 4YR6B 2E9WA 2W59A 4OGZA 2JSFA 3EH3B 4PREA 3MNZA 3SE9H 3OKEB 3BIBX 1JI2A 1GOGA 1M7DB 5DLLA 4PGCA 3QR2A 3C2AH 2X7LA 4QF1B 3KYNA 3OKNB 3NAAH 2B0SH 4B9JA 2F5AH 3GJFA 4X5XA 2AQNA 3CZSA 4ZFQA 4JCMA 4GLRI 4P2AA 4JM2D 3MOAH 4F91B 1G9NL 1KLUB 3ZKQD 1YMMD 3NFSH 1CD1B 1P7BA 2W65B 1MRFH 1FFOA 2YEZA 3C8DA 2VB5A 2VWEE 5JW5A 1WFTA 3BUDA 3NFNB 1LE9B 5C8JA 1CG9A 4NHUB 5DRXA 4XP1H 3IDNA 3KVQA 1IIKA 3NCJL 2FJUB 1LL1A 3J7HA 4LCCC 3ZT6A 1MCRA 5CF3A 3VGFA 4P23D 3RWDB 2VDMH 4ZODA 2P3YA 1WGOA 3U9PH 1I1AA 4JRXD 3TPKA 4QHMA 5CCKL 4N2MA 4H1LH 4Y9CA 3I6GA 3MLSH 2ZCZA 2MNWA 3EDFA 4LF3A 1IC4H 3ALPA 4KUZL 2X42A 2IH9A 3GEWB 1ET8A 1B3JA 4MS8C 4UIKH 4Z95L 4DUXA 4H26A 3GF8A 5G4MA 2WWMC 1JNLL 5HHVL 5BJTB 2VC2L 4IRSA 3VX1A 3WKPA 4N2AA 4URTB 5IB4A 1O7SA 3VU2A 2ZWKA 1RHHA 5BMFL 1YO4A 4QRRB 5GS1B 4OAWA 5HDRA 2X6VA 1NH6A 2CCLA 2I60H 1TVHA 2WW8A 1RJYB 2Y06H 2HJFA 4NC1C 4Y8DC 3JWOH 3CLFL 4YDLC 4BQ9A 3D30A 2WPGA 5FEBA 4CSSA 4TS6A 3IMVA 4R2GC 4XNZB 1I8LA 4GT0A 2HKHH 3LN4A 5KVFE 4J3OF 1A6WL 3EJUA 2IDUA 3QUZA 1DEDA 3F6IA 3DURB 4ONHA 3KHQA 2H1LM 5HSFA 1RPKA 4M5ZH 3CH8A 1RUKH 3FQRB 4ODVL 4U6YA 3OB8A 3W3BA 4U49A 5CEZH 3GO1H 4ZOEA 1ZT4B 3CX5K 4N3UA 4PGZA 4PJXF 1IFHL 2DQEH 4TSAH 4N8VB 3IDGA 2BSTA 2KDGA 4FZ8H 3FO1A 1URLA 1J0YA 1CO1A 3OJVC 4L1BA 4J8RA 1A64A 3RX7A 2EE2A 5B7EA 5GZOA 5AOLA 5HHPA 2WZPA 4KO7A 4IU2A 2ZOKA 1QSVA 1T21B 2D3VA 1E3FA 1T2XA 2WQAA 3QNXB 1Q0YH 3FF7A 2BWIA 4NENB 5KS9B 2WWOA 4E9YA 1KCRL 3DDFA 3L3HB 2Q7NA 4P5SA 2KH2B 4Z3GA 1OP5K 1ONQB 3KE0A 4LCWE 1AZZC 4N4YB 1YY9C 4UT7L 1M9WA 1JGUL 4HHWA 3FUFA 2FQFA 4PBXA 3QDME 4ZFOA 5FHAL 1BECA 5EU4B 3P9LB 4PWIA 4XXDA 7PAZA 1JF5A 5I30L 5HHMB 2NNAB 3HNSH 43CAA 4MMZC 4DZBA 4JG1H 4N6RB 2JLLA 1NBYA 2NOYA 4W9ZA 2EXTA 1HILB 2R1XB 1OGAA 3BVWA 3PGCA 2W88A 4XMWA 1QAWA 4FLRA 5E8DL 4F7EA 4MB5A 1KYOJ 5ABAA 3GDBA 1ZLWH 3S35H 1D7CA 3KW7A 4HUCA 1CBVH 1WHOA 4PGDA 3RNQB 3ERXA 3QJSB 5D7JB 3EGDB 2VH5H 1YYLH 2HX7A 1A3RH 5I16B 3FOMB 4X8CA 2FHCA 4K23H 3UAJC 3G5ZB 4G42A 2J56A 5EIIB 3QORB 2YPLB 3BSZH 1I1YA 3US0A 4XMLH 3LKOB 5DUPL 5ANME 4JL1A 3MRMB 3LNFA 1BQLL 4U0QB 1D3CA 3CVHB 3DJ9A 3WKNA 4TNVK 2Y1AA 1WC7A 1PGRB 5D2LE 5I8EA 3RAJL 5DJZB 1TQTA 2WKOA 2ZUQB 3TH2T 5E00B 3PL6B 4WAFA 2HT4C 3BE1L 4OQ1A 1OGPA 3VRIA 1RZGA 1AZNA 3RJQB 1CL7I 1TITA 2RBLA 1UGNA 2L7JA 5FO8A 3TTSA 1MCEA 5D6DC 1PX3A 3NIGF 1XGPA 3Q5OA 3ATFA 1QA9A 2JI3A 3QHZL 3MRNB 2Y7LA 3MCG1 5HHOD 5A7BA 3FCBA 5B8CC 1EEZB 3WFHB 3R1GH 1JL8A 1NCAH 5M7QA 1IQDB 2VDQL 3I9PA 5D7SH 1P4BL 3RKDC 2XVKA 1NMAH 5E1AA 1YY9D 4Z7OB 3LTVA 3C5SB 3K7UA 1N6VA 2PWHA 2XTLA 4FP8H 2OL3A 3OZKA 4KO6A 1T7XA 4U0RB 4RFNB 4R6UA 3EO1A 1WBXB 2WWKO 4MMYB 2WM0A 3HZMB 3TA3A 2GI7A 1MHPH 1OV8A 2E46A 4WDIB 3RWCB 3WV0A 5IWLC 4ADJA 3MBEB 3BXNB 5I9QB 3GMNB 1WIOA 2PCXA 4MBOA 3TBVB 5ICUA 2ADFL 4C4KO 5JHDA 3D2UB 2IPKB 4I48A 5EF2A 4B95C 4QXUH 4KK8C 2JJTC 2UY6A 1WG3A 1D2OA 2EO1A 4TOYH 2FX8H 2VDNL 2WQUA 5KYYA 3WDIA 5J12B 2ZCKH 3FHQA 5KSBF 4H25A 2WQ8A 4GT7A 3PLYA 4LB8A 3UAJD 3BWZA 3C9NA 4MAYA 5C07E 3PAVA 3GMLA 2HUEA 1NLDL 4FQJH 3UAAA 4XO9A 1IAKB 3EDDA 3EUUA 3MV11 1E5CA 3CFCL 3QRBA 3UC0H 5I0WA 1KJ3H 3L5WA 1IM3A 4RBPH 2FR4A 4MA8H 3IXAB 3O3DB 4L4TA 1TUPA 1U8KB 3WLBA 4XCFL 1NGZB 3QG7L 4V1DE 2F54B 4PJEF 5B3JF 1UM5L 5JZ7D 1NINA 2MEJB 5GSRA 1ET7A 1YC8A 1YRKA 5CWSA 1WS7A 3QDMD 4FLOA 5JYLA 4NJAL 4R0LA 2QQLL 2X12A 2WB1A 5EOCL 2ZICA 2NRDA 2HT2C 4UQDA 3RTLA 1FUNA 5AOMA 1AP2B 1D5MB 1NIEA 1SLWA 1T1XB 4QHNB 3UG3A 4LFHD 3ZKMC 2AXHA 2FIKB 4FQIL 1H3UA 2MCG1 2DQDH 3W9DA 4IRJD 1Q8MA 3T0VA 3FL7A 4RISH 2A7BA 1CE6A 2ORBL 4D9LH 3QI9B 3QUMA 5DI8A 1IT9H 3NQKA 1Q0EA 3EYSL 3OMNB 4E41E 2W0FA 2CLVA 2A6IA 3TA4D 4ATWA 1BLNB 1YLBB 2JJWA 3CPLB 2EVIA 3IN0A 3G7TA 3FU3A 4ZMOA 1B9ZA 2R59A 4LNRA 4QEGA 2HN7A 2NY0B 3AABA 5A1AA 4YDMA 1ZLUH 4PJ9C 1GJWA 5CEZE 3W56A 2A9NL 3BKCH 2OXHB 5I66A 1JUFB 2HG0A 4AVJA 3BIKB 5T1KD 3VVVA 2G4GA 1G43A 3OBAA 1QR1B 4U1JA 2R2EA 4Y1AB 1UWYA 5IBUG 4RGMC 2KMWA 3L1FA 5A2KH 1LO3H 3OXRB 1AXSA 5CHNA 1ZE3C 1ZAGA 5C0IB 2Y7QB 1T1WA 4YR6A 2AKRB 1J9SA 4IMKA 4OY9A 2ARWA 3LJ3A 3D08A 2PTTB 4M5YL 1YQ2A 3OKEA 4RSYA 1FAKT 5HPOA 2QL1A 2WOBA 4PLKC 3RUGB 1M7DA 1F4YL 3LXCA 1F02I 1XT5A 4QF1A 3UCRA 4EDXB 2EDRA 5E0FA 2BSDA 2HT2D 4OFPA 3P69A 3EIFA 3NCWA 1OAXL 2QHRH 1FL3B 1KLUA 1CD1A 1AO7B 2W65A 1LK3H 1BXXA 5FC9A 5JIDA 1HEJC 3NSXA 4XODA 4A2FA 1Z9SB 1ZOXA 3H8NA 3NFNA 5JMRA 2QELA 1LE9A 3ARGB 1RD6A 1FVEB 1P2CA 1NMBH 4LGSB 4NHUA 3VFVB 1AR1B 4OSUL 3AG1B 1QPKA 2VDLB 1TQCB 3LQAL 4K71B 2F5BH 5FGSA 1ZV2A 3A4AA 3VGAC 4PAZA 2DQIH 1IL1B 1KIQA 3MBXH 1IGFH 4DK6A 3S96B 4F5CE 3RWDA 4WEMB 2LW3A 4BXVA 1SBSL 4EZJA 2X1XR 4NBYB 5DJCB 5FA3B 4JO3L 1RZKH 5J11B 2PR4L 1U8NB 3FYEB 3PF2A 3PGFH 3PHQB 3V4PL 4HUNB 2ERJB 3VD7A 2WMPA 2OMTB 2OZ4H 2X9YA 2HX9A 1KN2L 5I1CL 2FEEI 4NO3B 3LZFL 4NM4L 1ACYH 1QLEH 3K2IA 4X99B 4TPRH 4AGLA 5BJTA 5E6YA 4ZMTA 1SZNA 2X4SB 1VEPA 2BZDA 2J57A 4BQBA 2IBGA 5DZLA 2JJVA 4OCWL 3RIKA 5GS1A 3CMOL 2EIZB 2IIJA 3DBXA 4JE0A 3RUGF 1RJYA 1TQSA 3KLHD 2JCCB 4OM1H 1VHPA 2IJ0C 4CSTA 1F0LA 3L6FB 3LX9A 5KBNC 1DL7L 3RKPA 1LTXA 4LPYA 1E4WL 4Q4EA 2ZXBA 3KPRB 1IVTA 3DURA 1E28B 1QPPA 3O6LL 4D8OA 2VDOH 3FQRA 1Z3RA 5SWSD 2WZ6A 5I28A 5E9DA 4R3SB 2Q7AA 1ZT4A 3KPSE 3OKYA 1GPOL 1TTFA 4LRIA 4O00A 4N8VA 2E9BA 3ZDZB 1S9WB 4MDIB 3V9FA 3FJTA 5AKSA 1K6QL 3KLDA 2ZWYA 5JLZB 1DQTA 4U31A 3L4YA 1I3GL 3IDYC 4FQ1H 4BKSC 4NNPL 2CMRL 4OFYA 1JVLA 1WEJH 1T21A 1MAKA 4TQ8A 2CJ3A 3MLZH 3AU1A 5BQDA 5ID1B 3QNXA 2R8SL 4NENA 4PJFE 2JKWA 5KS9A 2FNWA 3MA7B 1BSIA 3L3HA 4H20L 4L3ED 4QUOA 4WNSA 1CDCA 5JDJA 4K73A 1KEML 1ONQA 4DP0X 4OFIA 1J1PL 1U42A 3TOPA 4NFBA 3QYMA 1Y07A 1N6QL 2YOCA 2YUZA 2Y5TB 5EU4A 3P9LA 4G7RB 2I07B 2J8UF 5DT1L 4KJWC 2JH2A 2NNAA 1E6OL 4ZRGA 2DWXA 1RULL 3F7QA 1GJUA 3OKKB 4Q0XL 5AW7B 4N6RA 5B1AB 1UM6L 5EU5B 1PL3A 1HILA 2R1XA 2FB4L 2JCCF 3LEYH 3U30C 4OFQA 1JFHA 5EDSA 4LVNC 1F3RB 3MGAA 1UB5B 5ALBH 3KYKL 4WW1B 4YDZA 2G5BA 1DVQA 2D7MA 3EOTH 4L0YA 4IKIA 4XVJL 5I82A 1JN6B 4ZSOA 3O3BB 5IQ7L 5D7JA 1ZMYA 3EGDA 3MXWH 4YDKH 3GSXB 1M3JA 5I16A 2IC2A 3FOMA 4WHCA 4X0NA 3G5ZA 5FHBL 5B1CA 1H3XA 5EIIA 3QORA 2YPLA 4UT6H 3JWNH 1UGKA 3LKOA 3MRMA 3W82A 1I75A 4J4PC 1KELL 4JM0A 3CVHA 1CFTB 2FBJH 4JREB 3P0YL 1AKJB 2KL6A 4YE0A 5DJZA 1CGSH 2X6UA 3E6HB 3P3YA 4P2QE 4WRLA 2SEBB 5E00A 3PL6A 1T1YB 3NJIA 3B4NA 5AOIA 3T6QC 3KGRA 1IUZA 2VLJE 4FLQA 4ZFGL 5IJBC 5GGTA 4LL4A 1HXMB 4D7PA 2CLZB 3B1UA 5JHBA 2OW7A 3WFHA 1BQ5A 4MQTB 4HCFA 3VFGL 4KV5F 1IQDA 1TXKA 1YECL 3SDDB 3U4EA 2UWEE 2R29H 3NCEB 2I25N 1LM8V 2Z8VC 3HB3D 4GJTB 3C5SA 3QJQB 4A04A 2AXFB 4TL4A 9CGTA 4WCYH 4J6RH 1GA2A 4G80A 1G9HA 2Y5QA 1QSFE 1QHOA 2DQHL 4AIXA 1PVHA 1GVIA 3CVCA 2H41A 2ZTBA 4U3SB 4MMYA 5ESAB 3HZMA 1Q90A 4HLJA 1JK9B 4WDIA 3RWCA 1HQRB 4S1QH 4N68A 3MBEA 2PWEA 1G6RL 3BXNA 2BIHA 2X3CA 3TBVA 2K8QA 2NXYB 1KYUA 2OR8A 3CDFA 3HI1B 2X0VA 4MKMA 5AZEH 3CDGB 1DANT 2IPKA 2YK1L 1A6PA 3SGEH 1CXFA 1N5AB 1NUFA 1G4RA 3DPBB 1V55B 1MY5A 4X4XB 4LLMA 3V0JA 1U3NA 2K6YA 2XZCH 5IB2B 3AM8A 1LYQA 3KYAA 5EC1B 4HS3B 3Q05A 5A6IA 1F41A 4ZW3A 5EZJA 1F86A 1IAKA 5F9JB 1F6AB 1ETA1 3C6LC 4B0MB 4E5XB 1B2YA 1FORH 1DDTA 3C2AL 1CFSB 3BZ5A 2WLYA 2WP3T 5EU7C 4HOWA 3O3DA 3DVGB 4KDWA 1WA2X 4IMLB 1NGZA 1G9MC 3QAZC 1R75A 1N26A 1AXIB 1MRFL 1MFNA 4DK3A 5FYJU 5AALA 5CN2A 5JOPD 4M48H 1T89C 2IQAB 4TSCH 1Q38A 3EJZC 2VABB 4XP1L 5E2WL 2BP0B 3PAYA 4YXKL 3F7RA 4G7SB 2AANA 3MYJB 1R1CA 4IBLT 1WT5C 2WSKA 5F6HI 2OJ1A 4M9PA 2UX6A 1AP2A 1D5MA 2VDML 5LXGL 1T1XA 2XG5B 4QHNA 4YDNA 1TQUA 2VSCA 3MKGA 2WQWA 5FM4A 3AQDA 5ADOH 3GRWL 1YEHH 4M03A 4NN5B 2NY7L 3QI9A 3ELQA 4A7VA 3K72B 1F3DH 1JAEA 3SGKA 1NIAA 1PG7X 1BLNA 2E7MA 3CPLA 2P8PB 1UXWB 2Q5BA 3TBBA 1KC5H 5D1ZD 5KW9H 4FTVD 4CC4A 2CJSA 1IARB 1N7ML 1U8IB 2GKIA 2Z92B 4XNYL 4PJIB 4PJ5E 4NUJB 5DF0A 2DY2A 3EAKA 4P2QD 1IM9D 3MRFB 1D6VH 4W9HC 2FD6H 2OXHA 3X12B 4NSKB 1JUFA 2Y06L 1JXJA 3BIKA 1UACL 2OS7A 4G6FD 4ZUWB 2KERA 2UX7A 1QR1A 4Y1AA 1CFQB 3C6LD 3D18B 4QXGL 3U4KA 5DMKB 4AYEC 3WSQH 4FYRA 1O5DT 3QUXC 1XL4A 2Y7QA 1A3LL 4X0KB 3V7AE 5C0IA 4JO5A 2AKRA 3BWUC 4XR8C 2Y6SD 1I1FB 2PTTA 1G94A 4XPHH 3HN8A 3O6FC 4M5ZL 4PJ7B 4JLRB 4NQED 1ZHNB 3BISA 4E2OA 4Y9BA 4NBZB 5CEZL 2EIBA 5DZJA 4EDXA 1Q4NX 3WNPA 4N2CA 3FFCE 4FZ8L 3QEUB 2X0WA 2XPZA 3VMOA 3T3ME 2P5WE 1NAMA 2VITA 4P04A 4UM9D 3ARBC 4G6MH 5CP3H 1RZPA 4AK1A 3ARTA 1AO7A 3LZOA 2GSGB 4JDEB 4G3YL 1Z9SA 3AB0B 3AT9A 2GVYA 2VUYA 3BEWB 1JVOA 4PD4K 2Z31B 1AAJA 1FIGL 5BS0E 4KITB 1CQYA 4XP6H 4ZJ9A 1MW1A 1IL1A 3JWDH 4FG4A 3S96A 4PSRA 4H2CA 1DO5A 3L3DA 4UTBL 1B0IA 4XP9H 1EZUA 3CFJB 5C86A 3OQRA 4OLZH 4YUEH 3VFMB 4KX7A 5DJCA 5FA3A 3FB6B 3U36B 2DMCA 5IW3A 3AC0A 3PHQA 3BCDA 3LS5L 4OD1H 2P80A 2HRHA 3JWNE 4JG1L 1OP3H 4GG6B 4LMQI 4X7SL 4AIZB 2IDFA 4LDCA 3H2QA 3PG2A 5TE7L 3HNVL 5JIMA 1JFQL 5FGCB 1RFDH 4NO3A 1JDDA 5FUOL 3VW3H 3MJ9A 4X99A 1BREA 1ZA3B 4KMLB 2X4SA 1HZHH 4DPRA 3BRFA 3NEOA 2OPCA 3TS8A 1NGWB 2J6EA 1PCSA 2G0KA 2QVIA 1RIUH 4H8QA 2VH5L 4HIHB 3S3DB 1YYLL 4GXVL 1DQVA 1XGZA 2D2OA 5B4MC 5FO9B 2EIZA 4K23L 1CE1H 5AWNH 5DYOA 3QQ4B 2JCCA 4JE4B 4QGTA 4LSRH 4LNVA 3BSZL 2O61B 4YGAB 4XPGH 1IBDA 3BLKA 3HI6L 3K1KC 2B1HL 3O6FD 3L6FA 5HY9B 5DTFB 3F83A 3RPBA 3PFUA 3TJHC 2YPVA 1BQHG 3BFOA 2YD6A 3JVGA 3VFSB 3WXWH 1RAMA 4FDWA 3DGCR 3KPRA 4LPUA 3QG6B 1PU0A 3TN0C 3SE8H 2ZE0A 1E28A 1MNUL 2K78A 3ARBD 2A74B 3N3EA 1YVLA 2J5LB 4R3SA 5KVDH 2LAGB 4W68A 2JJUA 5MP6L 3SQOH 3D09A 3M45A 2DM3A 2OR7A 4KGLA 4PJ8C 1S9WA 4MDIA 4CBPA 4GMSH 3ILQC 1UUNA 5J57B 2A5UA 3R1GL 2L8AA 5DFTA 4AG4L 4N2KA 4NZUH 4MCZB 4OM0H 3FQNB 2FDBP 1WAAF 5EUOF 1JZGA 3IGKA 2F15A 4JKPH 3BVTA 5ID1A 2E7BA 1K4CB 4FP8L 3T0EC 2OX5B 2KZBA 3TWYA 4N0CC 1O9ZA 3LB6C 3MA7A 4M3KB 2H4EA 4WFHD 1BZOA 1MRCH 5C0JB 3FTXA 4M93B 2YGQA 1D7DA 1QW8A 3MLWL 3IMWA 1JPST 3B2MA 4PS4H 3WAJA 5E2JA 4LAQL 2Y5TA 5EOTB 3GUTB 2I07A 5EA0H 3V7MA 3OKKA 4FKHA 4QXUL 4XHQA 5AG9A 3GSUB 5E2TH 2WXNA 5LVEA 5EU5A 4KQ0A 4TOYL 1EJOH 2FX8L 4M6MH 3RWEB 3BGFC 4FE9A 3QXVA 2H3KA 1UB5A 5B4MD 5C71A 4BHUI 1M3IA 4NP4H 1HC1A 3CDYA 4O5LH 4WW1A 1QUNA 4PJCE 1FZMB 4FQJL 1IKNC 1JN6A 2BIQA 1PY0A 3O3BA 3FUDA 4LSSL 2F2HA 3GSXA 1AQMA 1YZZA 4OLXH 2EZ0C 2PN5A 4LDLB 1N0LB 3CXHK 3L5JA 5DK0B 1KJ3L 2VSKB 3V4VB 4U1MA 5E5LA 4K8RH 1R24B 1E43A 4HXAH 3DV4B 4OJFL 2V9UA 4Q56A 2J1YA 4JFHE 3MLXH 3VWKD 2YGOA 4Y16B 2MRYA 1CFTA 5FYKU 1LNUB 5IHWA 1AKJA 5F44A 3IMBA 3E6HA 4PJ8D 2SEBA 4GP4B 3S5LG 2VT0A 3ZDXB 1RU9L 4UOW0 1DQLH 1T1YA 4ZFFB 1SY6H 3M88A 1KBGL 2MCAA 4Q6IB 5D7KD 5C1MB 5ALCH 2MTPA 3NIDF 2KPWA 2I69A 1HXMA 4HJTA 2CLZA 2IPTH 4WK4B 1ZLVK 4KTGA 2AJSH 3ROLB 2VLKE 3AMLA 1VLXA 5C0CD 4JJOA 3SDDA 4RISL 4MSWB 5K39B 5G5DB 5D7IF 4JPSA 3HRPA 1RH8A 5C08D 1HU8A 1I7UB 2AXFA 3VSTA 3U1SL 1S9XB 4P5RA 5LBSA 2XQBL 4RAUB 3TCXA 5TQ0L 4DZ8B 4X6CE 2P26A 5CJOH 4U3SA 4QO1B 5ESAA 4OV5A 5DHVB 3WY3A 3MLUH 1JK9A 1O6SB 4EEEA 1HQRA 3FB5A 3GHBL 4W4OC 4Q6KA 5EZLB 3NTCL 2NXZC 3I85A 4XX1G 2YAHA 3D1MC 3IF1B 3HI1A 5IV2B 2CHNA 1Z9MA 2HFGH 3CDGA 4AKOA 2DIEA 3VGHA 2E27H 3BKCL 4G7YL 5G4NA 1OAYL 4EBQH 3ZHLA 1N5AA 3TGXA 1OK8A 3DPBA 1SJHA 4L37B 1KBVA 1N6UA 1NL0H 2EE9A 4X4XA 4JQIA 2EZ0D 3MJGX 2DMKA 4U05A 1LO3L 2GJ6B 2LOEA 4GINA 2EH7H 5H37G 4H44C 3UAEA 4F8OA 2RR3A 1H8NA 4TTDD 5E4AA 4JANB 5EC1A 4HS3A 4FCAA 5BW7C 3EYVB 3SEPA 5DZAA 2XPYA 1F6AA 3ME0B 5F9JA 4TVSa 4OFKA 4WO4B 4U3XA 4O51B 3T5WA 3B9KA 4HJSA 5KZCB 3U9WA 1ADQA 5LHDA 4E5XA 2DI7A 3DMMC 2P49B 1H3PH 1CFSA 3TXAA 3L4VA 5L2KD 1RL1A 3DVGA 4UT9L 1QWNA 3ZIYA 4IMLA 4IKKA 4FNTA 4UNUA 3GSNH 1MFEL 1CXKA 4BRJA 2WBJB 3IFNL 3SDCC 2C9VA 2MQGA 2YBGA 3CLWA 3WO3B 4KO9A 3UMTA 3JUZA 2K6ZA 2IQAA 1NMBL 3QCTH 2VABA 2VC2B 4M8UA 2BP0A 5CJQL 1P0SE 3FPXA 1NC4D 3MYJA 4PRHB 2PF6A 1IGFL 4DGVH 4ZO7A 2BDNH 2XG5A 1CD0A 2NMSA 1WFOA 3VWJB 5E1HB 3WLWC 4MQ7B 3HLAB 3DTUB 4F9LC 2DYPD 2PXYC 4AVHA 3PGFL 3VACA 1CFVL 3K72A 4WUUE 3QEHB 3SPVB 2YGPA 1ACYL 1QLEL 2R56H 4AQ1C 3PDGA 4Q9RH 3JYCA 2XN2A 4N5ED 2P5EB 3S37H 1UD2A 3OR6B 1QFPA 3W1ZA 2Z92A 2QSQA 4PJIA 1ZS8B 1OT1A 4NUJA 5KVDE 3MRFA 3U6XA 1ML0A 1UENA 3U25A 3EBHA 1PZCA 3X12A 4NSKA 5HVWA 2AV1B 4NGHH 4AUJA 3MOBL 4GAGH 2N0MA 4ZUWA 4OM1L 1FBIL 3PNRB 4XO4A 1SHXA 1CFQA 1JCVA 2DKUA 3D18A 4PW9A 3RY6A 5DMKA 5I15H 3N44F 3EFDL 3TO2B 3ZDYE 3HFML 3DMMD 4IYKA 4X0KA 3OKLB 2WLZA 1I1FA 1XMWA 4DTGH 3EH5B 2QTVA 4PBVC 3EHBB 1OW0C 1AS8A 4PJ7A 3OAUL 3UTPD 4JLRA 3F7LA 1OGTA 3RB7A 2H2PD 2EKSB 4YDIL 4NZFA 3M7OA 1P4UA 1J5OH 2M1KA 4OF7A 1HAUA 2QVFB 2EDNA 3GMQA 4APXB 4ZO8A 2EINB 2L3BA 2AK4E 3GIZL 4LLDB 1CPUA 3T1WA 3VD2A 2GSGA 4XVTL 2ED6A 3L54A 1QX1A 4JDEA 3SJVE 5H35A 4IBVA 3NEEA 2YXVA 3WFEL 4JZJC 3MLZL 4Q58C 1I85C 3DK0A 3BEWA 3L7EA 1ZLWK 4EQ3A 4YIQA 2Z31A 3S88H 1P9MC 3WLWD 3GTVA 4NNYB 4FL4C 3WNLA 1D7FA 2BSCA 2NYYD 2FL5B 3GBDA 4MQXC 5MEPB 1NFDE 4AYMC 3MXVH 3WJLA 3IMRA 1G1OA 3QIBB 3KM2A 2FGZA 5I1IL 4JKMA 3CFJA 3AQXA 3VFMA 4HD5A 1WAAA 4AYDC 5K93A 3FB6A 3U36A 1DBAL 2O6EA 2OFQA 4QYOA 4LCUA 4F15C 1MAMH 4GG6A 2NY2B 2WOYA 2Q2LA 4AIZA 4PM1A 2VZSA 3LEYL 1BAGA 1OD7A 4E9QA 1ILUA 3HEIB 1AOHA 2VSDA 4ZXBB 3UYOD 1ZA3A 3RDTC 2G2PA 2IOIA 4G8IB 4G83A 3B9DA 1JF1B 1NGWA 1JRHH 3OAZK 3U0PB 3I2CH 4JFDB 3MXWL 4HIHA 4MVBD 4YDKL 4ZMXA 2BVQB 2EDEA 5FO9A 4ZMLA 4P59L 3QQ4A 4WTZA 2DW5A 2YD7A 5ENWB 4HPHA 4NN6B 2DTSA 1VFOA 5F1SA 2VM3A 4JO2H 3CSBA 3FDWA 3COOA 5HY9A 5DTFA 3QPQC 4YFEA 5C0BD 1LO2H 3HAEH 3TZVC 5I76B 3LQZB 3QS2A 3CFMA 1XXDC 3ARYA 2BOBB 1WUZA 3VFSA 2WAQA 3QG6A 4Y5YC 1E3ZA 1SVCP 4LDEB 3WFCH 4L2LA 5L88H 4N24A 5JOFB 2A74A 1MI5B 4M6NH 1S78D 3QZWG 4HMDA 5T5NF 3NSYA 1CK0H 3ESNA 2QQKH 3FTUA 4F58H 3PWPE 3FU6A 1O7DC 1M71B 4C55A 4RWYL 2Y07L 1OZTG 4PGJA 4G9FD 1JPGB 4WUUD 2NY3B 4YC2C 5HYIA 4ZD3H 4PJDE 1KCSH 2JKJA 4U2YA 2R7EA 3GI8H 3ASWA 4MCZA 1AR2A 2ZXDA 3FQNA 5LQBH 2VDNB 5DHDA 4GQ9L 2QLYA 1FV1A 4Y4KB 1PFCA 2GCYB 4CDGC 3Q2LA 4WGVB 2EDLA 1QSEB 1K4CA 4J6RL 4WCYL 1L9OA 2J2ZB 2OX5A 4BA0A 3BJ91 5HI3D 1FL5B 1J5CA 1JGEB 1RHFA 4JM2B 1HZKA 5C0JA 2VR5A 1WCBB 4XOCA 2EIEA 4LESA 2PPCA 3U46B 3VFNB 1RURH 4JMNA 4AZUA 2W5PA 2Y7OA 4RBPK 3KBFA 3TV3H 3LIZA 2Z34A 5EOTA 3GUTA 1A4BA 4JFQA 3D51A 1HIMH 4FXGC 1U95B 1XV8A 3SO3C 3GSUA 4L8BB 2E6QA 5CM1A 2DDQL 3Q43A 2Y36H 1MCBA 2ATPB 2V3DA 4TVPD 3RWEA 3WN5C 4JY6B 2QADC 3C5ZD 5FYLH 4JJHA 1FZMA 4NHCL 3FKUS 3POHA 1XGUB 3D0VB 3QPQD 3Q8BA 3UO1L 2FATL 2OP4L 2EDYA 5DK0A 1FORL 3H0TB 4I1RA 3V4VA 5A40E 3BZ4B 3QHTC 2CIIB 2UUDK 1R24A 3DUSB 3DV4A 4EVNB 5T3ZD 1X5MA 1GTNA 1SEBB 4L8DB 4WWID 3VI4F 4Z7NF 3QEGH 4NC1E 4TQEL 5L4FA 4Y16A 3GHPA 1LNUA 3OJ2C 3O2DA 4QI3A 3V5DB 5F7LB 1NOFA 4CN1A 4HFWB 4ZFFA 1CUOA 3PAZA 4HWZB 4MDJB 3HUJB 3EDJA 3ESPA 4Q6IA 4HX1B 2GTQA 1PCXA 1ZLUK 3WXVL 4JM2F 1LDPH 1NGQH 4S1DC 1PX4A 1TOXA 1EAJA 2J4WH 1GSKA 2FX7H 3CHPA 4EF3A 5C9KA 5FKPB 2C8NA 3ROLA 3LXAA 4B41A 1URIA 5E7FA 4MSWA 5K39A 5B22A 5KAQF 4NKDB 3EGSB 4DHLA 1NAKL 1I7UA 4ZW6A 3P4LA 3SBWC 2LU4A 1S9XA 2R0KH 4MHHI 1FNHA 4KKLC 4RAUA 4DZ8A 1ZE3H 4NPYB 4LSPL 3R7QA 5DHVA 2WLNA 1KC5L 1CS6A 1O6SA 5KW9L 4OGAC 1S7UB 4BM7A 2P8LB 1A7PH 1OM3H 5AAPA 5EEWA 5SWZE 3IF1A 3MZGB 5IV2A 5DVKA 1ES0B 1NCGA 1WCQA 4EUPB 2DH2A 3NUKA 1LO0H 4FEIA 1ND0A 2QJDA 3TBTB 3C2SA 4K3GA 4HXBH 1T22B 3QQNA 2BRQA 3A67H 2A77L 4L37A 4L5FL 1WE5A 2EDTA 4BWTA 1RV6X 3LD8B 2V9TA 4XBGB 4Z7WE 4BEIA 2GJ6A 4CKVX 1WHPA 1GRWA 5GGUB 5DVPA 3QHFH 4OBRA 3AY4A 4JANA 4D94A 2QGDA 3HZKB 3EYVA 2XTJC 5HD8C 3ME0A 4XPHL 1F45A 4WO4A 5G55A 4O51A 4O02L 1YEJL 2BY0A 2R0WL 1GHFH 2DM4A 3D39E 3D9AL 3Q3GA 3STLB 3HUJF 4X4YB 5DCCA 3V6BR 3TFBA 1GW0A 5INDB 3IJ7A 1PY4A 5K9OB 3MFFA 2PLTA 5D70H 3VXRD 2WBJA 1GY1A 2C9XA 5D1XC 3K0YA 4G6ML 4XX5A 3V4PB 5AOJA 4MB4A 3UZVB 4XTRC 3HMWH 1O9VA 5IHZB 2OSYA 2GK0B 5I1KL 4S1DD 2Q6WB 1L3WA 2YD9A 3PV6B 5HVGB 3U7WH 1R5IB 4YHLH 5ACMA 5KVGH 2NY6C 4MZRA 2Y7MA 2A83B 4YSUA 1YNTB 1CJYA 3AWEA 3IAGC 4YK4B 4PRHA 3UTSE 5HDBE 5DSCB 1DZ0A 1R3JB 3BW9B 4KKBD 1TKWB 2C3XA 3HHSB 2EC9T 4XN9A 4OLZL 4YUEL 3VWJA 1TNNA 2B77A 2RCSH 4MQ7A 4PBDA 4KXZH 4YSOA 5F7YC 2MPAH 1JRHI 3F8UB 4OD1L 2HFEB 4OGAD 5E4EC 3VGEA 1J8HD 1GS8A 2HCZX 1CZ8L 1R3IH 1KBWA 1W6WA 1L5GB 2BFVH 3S36X 5HHOB 5EF3A 4CILA 3QEHA 3SPVA 3WNIA 3VAEA 5KBMA 1QBAA 2OI9B 4AYFB 3VW3L 3ARQA 5J13B 2EDOA 5DJXB 3GLAA 2P5EA 1SN5A 2DEXX 3OR6A 1HZHL 3IGLA 4ECNA 2YMXH 5ELIA 1V5JA 2EXWD 4CU6A 3OB0H 3R0NA 2VQ4A 3TONA 5JNYB 2VR4A 4M7KH 4R9HA 1NM4A 3WCYA 5C97A 1XF5B 2Y9RT 3IS1X 4LAJH 4IBWA 1D9KB 4WEBH 3PDOB 1JYXA 4DKAA 3N5AA 4JFEE 3T4AB 3KS0H 2D2CC 3TO2A 4NQQA 5JPNB 1I1RA 3OKLA 2ZX7A 5JXEA 5B1BB 3LPPA 2B3RA 4MD5A 3P9MB 4XNBA 2ZD0A 4AL8H 4GW4B 5D1XD 1KPUB 2EKSA 5KVDL 1KBBA 3F62A 1SVBA 2EYRB 3SQOL 4JO1H 1YCSA 4YL4A 5E9NA 5CEYB 1YUKB 2YA0A 3ZE0E 3OLIA 4APXA 5SWQB 2O5ZH 2XN0A 4GMSL 1ZTXH 2HFTA 1ZTMA 1BHGA 4PS8A 3N41B 4LLDA 5E6SB 1MREL 1N8OE 4MDRA 5SWZD 2A6JB 3A6OA 4YWGL 4XMTA 5I1EH 4JKPL 3HS0B 3VTAA 3CX5J 1KCVL 2VR6A 3VXPB 5D5ME 3JTTB 3KWTA 5LN8A 3QZOA 5FYLE 3JQOB 3WIHL 1PKQE 4M7JL 4G6JH 4JY4A 4NNYA 4WV1C 4UBDD 5E8EB 2FL5A 1MRCL 4QIRA 4N9OB 5MEPA 2Y23A 5D72H 4OF0A 4TVPL 2BK8A 3QDMB 4I77H 1T5WB 4A7SA 3QIBA 1PAZA 4YEFA 2OQJB 4PS4L 2QGEA 3GKZA 3IDIB 1VKXB 1GYAA 1N4XH 2DQJH 4WWNA 4L3AA 3W0WD 3KBHE 5EA0L 5JMOC 1XZWA 5D96B 5DK2B 4EKXA 1QKZL 5FA4B 1FCCA 1B90A 2EDXA 4M6ML 4K7PL 3ZYOA 1NSNL 2R4RL 3KYOB 1SOSA 1W91A 1X5KA 4LLYB 2G3XA 2H8PB 2OW6A 3NRFA 4ZOBA 4ZXBA 4FADA 3ZE2E 4IRJB 3L3IB 1JD9A 3QIUC 5T3ZL 3WHE0 4G8IA 1J1OH 2DKMA 1JF1A 1E4KC 4LPCA 2FQGA 3OMIB 3SPIA 2WO4A 3U0PA 3GSVB 1XB6A 1T83C 4JFDA 1I3UA 3HVNA 4AQEB 3D06A 4Q8BA 2BVQA 1H3VA 3AGVA 3ZTJG 1GYCA 4KUCD 1FRGH 4D3CL 5ANMB 3SE6A 5ENWA 1NKOA 4LSQH 4EOWH 3TCLB 3T0DA 4M4RB 4W93A 4HXAL 4KRLB 3UTSD 3FBQA 1S4IA 2NT0A 2O6CA 3X1EA 5D2LB 2L0DA 1HTYA 4HKJB 3ZO0A 1NCCH 5I76A 3BLBA 3LQZA 2YRPA 3T0WA 1I8IB 1F4XH 2BOBA 3N41F 4IGBB 4LVEA 2H9GA 3F7KA 1PD1A 5E70A 4ONGH 5T1KB 2VN7A 4XXCA 3GRBA 3H56A 3I6KB 5JOFA 1U6AH 1BOGB 1MI5A 3ZXAC 4ZX3A 4OIIH 4K5PA 2WXJA 3VFWB 3HI5H 1LLAA 1M71A 5ALCL 5DD3L 1WK0A 3I6LE 5HVHC 1RIVH 4WVRA 4N2NA 2AJSL 5LB1A 1Z9OA 4N2EA 5IEHB 2BRRH 1WSST 4Y4KA 4N85A 2GCYA 4C47A 4EIUA 1MN4A 1QSEA 2J2ZA 2OR9L 1FL5A 4XC3L 3SB3A 2WUBH 5ANHA 4D9RE 5CJOL 5PCYA 2NY5L 4G1MA 3TJEL 2F1AA 5JIQA 4GRWF 4N28A 3T0XA 3S8WA 2HJKA 2AGJH 3U46A 3VFNA 5AD0B 3Q5YA 4BFNA 4ETYA 5JORB 4YFDB 3L7FB 4Z78B 2XWCA 5TTRA 3H9SA 4PG2A 1BPVA 1L7TL 3ARFC 1LWHA 1JBJA 5IQOA 5HJGA 1U95A 2YBRB 1I1AC 4GUPB 4X8XA 3WUWB 3QIUD 2A9DA 1BJ8A 2WWNA 4AKPA 4EBQL 3PY9A 3W38A 3JV4B 3TFKC 3ESMA 5ABZA 4DGYL 1H6EA 4JY6A 4ZW8A 1NL0L 4P3WA 5IHLB 5JIIA 3IETB 5C07B 3H55A 4NRYB 1BGXH 4Z7UF 3C09B 1EDYA 4R8WL 3PCYA 5JQIB 4Y5VB 4KQ3H 2X3AA 1DJGA 5DJAB 3DUUB 1CICD 1XGUA 3D0VA 2JKSA 3JBG7 3X3FL 4IRSC 4GG8B 4MRBA 2VDMB 5DEGB 3B7SA 1ZLSL 1XH0A 3H0TA 4TM9A 3W2DL 1ZA6B 3L3KA 1DBMH 3BZ4A 4V1DB 5F9DC 3T1FB 1ZHBB 4H1LB 4IHOB 3DUSA 4MJJA 4EVNA 4F1SA 1SEBA 4L8DA 3CHXA 4KVCH 3EZ8A 3VI3F 4MCNA 1DQMH 1S7QB 5MHSD 4N0UB 1KJVB 2XA8H 1I8LC 4JY5L 1FNGB 3V5DA 3WFDL 3O0RH 1TJGL 2IADA 3QCTL 2P1YA 3QUZC 1QWHA 4HWZA 4MDJA 3WY4A 1JYWA 2ZOWA 4HX1A 3VRLF 4B6ZA 3MVSA 3LHPL 5TJWK 1V10A 4P99A 2FSDA 2ROYA 2BDNL 4P2YA 3MROB 4JJ5B 5FKPA 3T6VA 3AWFA 4KZEL 4J8QA 3MNMA 2GG1A 1IBGL 4NKDA 2DAVA 2WQRA 3EGSA 1L9PA 3NJVA 2AZUA 4E41B 5GZOC 1P5UB 2C3GA 1VPOL 2JJSC 2QMJA 4UF7C 3HKFA 3UO8B 5KYUB 1PIGA 5C0EB 5JYMA 4NPYA 5JHMA 3LKQB 2R56L 4ZUSB 4Q9RL 4PGBB 5F21B 4LOUD 4KRPC 1S7UA 2P8LA 4PLJC 4BK4A 5DS1A 4RESB 4Q89A 4FRWA 1ES0A 2HKFL 5DZNA 2D7TH 4JNXA 2H6UA 4J3OG 4M56A 1NIDA 5E2UH 1HHGB 3TBTA 4FQCH 1T22A 1DLFH 2EXYC 3KD4A 1ZTXE 3OC8A 3FCTB 5AL0A 2CCWA 2A4CA 3GBNL 4XBGA 4NZRH 3X14B 3I6LD 2WIIB 4Y7MA 1C5BL 1NCBH 4B9GA 1TNMA 5GGUA 4W9GC 3HZKA 5HP5A 4DTGL 3LKSB 5F0MB 4KTEH 5FIEA 2LE9A 4CMMB 1TQBC 4XZUB 3STLA 1J5OL 4X4YA 1EHLH 1DEEB 4PV8B 4BZ2L 2IGFH 5INDA 1OP3K 4F80A 3VJ6B 3QUZD 2A4EA 3L9YA 3V4PA 1T2JA 1SYSB 1ICTA 3UZVA 4KZDL 4ZUTB 5F7AA 5C0AE 1DANU 2ZOLB 5F7MC 5IHZA 2GK0A 2YWYA 1GYUA 4OZGF 2Q6WA 3PV6A 2N3JA 1CDUA 3AS2A 1R5IA 4UMSA 3FQ4A 3QDGE 2AEPH 2VDRH 4WEUD 2A83A 2CA3A 1I1CA 1YNTA 5AW4B 5LWYL 4PS7A 5DSCA 3APCA 3R0MA 1LP9E 1R3JA 4HG4J 3BW9A 5GZOD 1TKWA 2WZPD 3HHSA 1K3ZA 2VERN 2XFGB 5FYJH 1FHGA 1YQVH 4GOSA 3VD4A 3B7RL 1YEKH 5AVUB 2J5WA 2FUTA 1GXEA 1MJ8H 3DOIA 1YN6B 3ZQWA 5DVNA 2B4CC 1U4FA 2HFEA 2K7PA 2G4EA 2J1KA 4HWNA 1FZOB 5E94A 4OIAA 1L5GA 4QHKJ 1ORQA 4AYFA 5J56B 4NS0A 4EI6B 5DJXA 4J39A 2UZYB 5EOQH 3S8GB 2EXYD 1XH2A 3HB3B 4HUUB 4N1EA 3TC9A 3L17A 3I02B 3O9WC 3TA3C 3E38A 3VXNB 4HPYL 1C08A 3CCHB 2FEDC 1GSMA 5JNYA 1OGAD 2VE6A 1JSYA 3GXFA 4NRXB 1WITA 3SSGA 3ULSB 2H1XA 1MQKH 1XF5A 4X83A 2Z93B 1BVNT 1D9KA 5CBEB 1J7VR 3PDOA 4HIQA 3X1NA 3P9WB 5IUSA 4I0KA 3IFLH 4LO9A 4JR9H 5JPNA 1XF2B 1YJDC 3QO0A 1HINH 2XDHA 2DLFH 3FT2B 3B8YA 3DYMA 2IAMC 5HJBA 3P9MA 4ZG1A 5C0RH 3HVDA 4GW4A 3WFCL 3KPSB 2XU9A 1OAUL 3SY0B 1KPUA 1KY7A 1N70A 4FZEL 4I9WE 4MKTA 3QS3A 1KG0B 2QQKL 3Q8EA 4UZGA 2EYRA 4EJ1C 4EI5A 3V6OE 5E6ID 1KFAL 5CEYA 4H8VA 5SWQA 1G7PB 2P4AB 1L6XA 3E3QC 4ZD3L 1FYTE 3ZHNA 1NA8A 3GI8L 1N8ZB 4Z7QB 1OVZA 2O6DA 3CG8A 1WBYB 2A6JA 2PPFA 5LQBL 3KPTA 4MMXB 4PJFB 1V7NL 4PPTA 3HS0A 5CSGA 3GIVB 2BSSB 3NDZE 3VXPA 2P48B 3JTTA 1A9VA 1T0PB 2OKMA 3ZL2A 3R4RA 4LCWA 1DVUA 4WUKH 5E8EA 3DDGA 4ELMF 2PMZA 4ZOAA 2SODB 3QDMA 4JDVB 1T5WA 2F61A 1TQVA 4LOVA 3AY2A 4OV6F 4ZK8A 5BQ7B 2OQJA 1F5WA 1VSCA 1VKXA 3IDIA 2ICCA 3TV3L 4P5KB 1EK3A 4U2ZA 5CILH 1HIML 4OZIE 1OLZA 5DK2A 2BVPB 4NQXB 1MRDH 5FA4A 4AMWA 1PZAA 4YHNB 4PJGF 3MV01 3TA3D 5C92A 3KYOA 4QRBA 4LLYA 4ZMYA 4ODBD 2H8PA 2Y0SA 1CURA 1Q0XL 1CVRA 2FEDD 2IVFC 4ZMZA 3A4FA 4IRJA 3L3IA 1V8HA 1SDAB 5FX3A 4Z5RB 4PLOB 5LKNA 3FRUB 4NKIH 4QTHB 1YNKL 4OF8A 1I9IH 3GSVA 5C0AD 2CE6A 2DKSA 4AQEA 2BO0A 2HKAA 3QBTB 1S9YB 3QJRB 1B3IA 1HL9A 4DSYA 1MJUH 5ANMA 1CGVA 3N50A 2XETA 5D1ZB 2HLAB 1GYWA 3GXIA 4HT1L 2P9RA 3TCLA 4M4RA 4MAYD 3AFLA 2N0KA 3LMJH 1KFGA 5D2LA 3J07A 3QEGL 3ECBB 4P2QB 3WEAA 3ROOB 5I2IB 3F2LA 4P49A 4Z7QF 3HLKA 1I8IA 4IGBA 3ZKND 1HXYB 1MZYA 3WE6B 5T1KA 1OZUA 1OTUC 2HH0L 1IM3D 5DEZA 2VLJB 3I6KA 4IMKC 4Z3JA 4OI9A 1BOGA 1UT2A 2BLFA 2J43A 4L4TD 4ZTPH 3T09A 5IK3B 4LEXH 5BRQA 1Q9KB 2G75B 4JN2B 1R5WB 1SOXA 2YGVA 4FQ2H 4TTGA 2WBWB 2A2QT 1AOZA 4DQOH 2D8KA 2FX7L 3FAWA 4WFFD 2JNZA 1E5AA 4PRAB 2UWEB 3DYPA 4MB3A 2BNUB 4GAAA 3ZTDC 4DPBX 4PUBL 3OLGA 5IEHA 5D4QA 2VO8A 4PVMA 3ZE1F 4FJ6A 3MACH 3C6EA 1UVQB 2WXKA 1QSFB 1NEZB 5EWIL 1GZQB 3ETSA 2R0KL 3B2PA 4MASA 1XL6A 1QFWI 2W80C 3EYUH 5AW2B 4M7LT 1CF8H 3NEXA 1XD0A 2X2UA 3UJIH 3HTLX 2C4FT 5AD0A 3BDYH 3EJTA 3WIAA 2E56A 5JORA 4PJHE 3L7FA 4Z78A 4OF6A 3ESVF 4HIXL 5IREA 2AJUL 5E8OB 2EEXA 2IFGA 4MAZA 2YBRA 4GUPA 4R90L 2DWSA 2A38A 3WUWA 4BZYA 5I0YA 1ZVSB 1UG9A 4FYQA 3JV4A 5CZKA 2HT3C 5C2BH 1CLZH 1ADWA 3A67L 2ITEA 3L4TA 3OLEA 4ZPVB 3IETA 3IPBA 5C07A 4NRYA 5C7XL 2XI9A 1U3HB 4KK9C 2CM6A 1FYTD 4MXVE 5D1QE 3IU3B 3US9A 1E65A 2NTSP 4Y5VA 5DJAA 3DUUA 2EDQA 3L9RB 2WZAA 1R19A 3DVFA 3UYRH 4AGMA 1ZWIB 4GG8A 4RDQF 3BPCB 5DEGA 1QUPA 2MNJB 1LQSR 5GS1C 1V54B 1ZA6A 3PGDB 1MFVA 2YR3A 5FB8B 3G6DL 4J3VA 4V1DA 5CU5A 3T1FA 1ZHBA 4H1LA 1QFWM 4IHOA 4EO5A 2W1NA 3L95B 4IU3B 1WH0A 2VJ8A 2FBRA 2Y4SA 1X5FA 5FYJE 2D0GA 1N3NB 1T2QH 5L7XH 2EUZA 1CQKA 1S7QA 3UBFA 1AYRA 4A6YH 3HMWL 4XNZC 4G6KH 4S1SH 1ERNA 1FNGA 2GBTA 3U7WL 1XF1A 3UJTH 1QLEB 2BVUA 5D8JL 1MJJB 2Q87A 2G60H 4ODUB 1ZSDB 3TF7C 1RLWA 2KQMA 1MUJB 2W9DH 4H8UA 1IGYB 5ICYB 1XX9C 1PIFA 2ZUYA 3D07A 5DO2D 4JZNB 5FYKH 1UFUA 3DX3A 3ZMNA 3MROA 1G87A 4JJ5A 1BX2B 4LRIC 4ZFOL 2NCEA 2JQZA 3ARSA 3W37A 2WXHA 5E4OA 1WWWX 2MPAL 5LN4A 5DRNB 2DV6A 3KHOA 5BUPA 4E41A 3I84A 3OHXB 1P5UA 4PY8J 4U6XB 1CGTA 3VTMA 4YFLF 5KYUA 5EORL 1BFVH 1R3IL 5IVXF 3BQVA 3BMVA 3H9YA 2BFVL 4E9RA 5C0EA 2AQSA 3QCVH 4MFHA 2COQA 4U1GB 3I3DA 3LKQA 4RMWA 4AWJC 4ZUSA 4PGBA 4X5WB 4HP5A 4N8CH 5JDSB 3T0EE 3WYRA 4PJ5B 3WS6A 2YMXL 1LMKA 2L7UA 3VA2C 4KTDH 2AAVA 4UM8B 1EO7A 3FO0L 3CN0A 5AVWB 4EQ2A 1TETL 1HHGA 5CFAA 3B2XA 2B39A 4M7KL 2GJZB 4KDTA 4S1RL 4WEBL 5DLML 3FCTA 2G2RB 5ERWB 1B4JL 3Q2VA 1AHWB 3VMNA 3X14A 4WHTA 2WIIA 1E8YA 4ZAKB 3B9VA 3NPZB 1B6UA 4FFYH 1GGTA 2FSEB 3BD5A 1JGLL 1P5VB 2FECL 1IVLA 1MCPL 2BS8A 3BWUF 3LKSA 4I2XE 4RIRB 4X9HA 3GMPB 5JO5B 4CMMA 2YQ3A 5DEFA 3UBXB 4UTBA 2BMKB 1X3DA 4XE5B 4XZUA 5D7JC 5F7UA 2GTWB 1DEEA 4PV8A 4XNQB 3T3MB 5KEZA 4NZ8A 1R9FA 2EO7A 1XSJA 3FU8A 2X6AA 3IFPB 3MN8A 5B3NA 1ZTXL 3VJ6A 2AJXL 3HBZA 1L3NA 3QORC 5CUSH 2W91A 1G7JB 2VXSL 2EH8H 1PBYA 2B4CL 4QAMB 1SYSA 3WMPA 3V6ZA 4WKZB 4ZUTA 3GS4A 4JX0A 2ZOLA 3S3JA 2Y7SA 4X6DF 1DQKA 5E9DD 4OCRL 1AHMA 5BS0B 1UWFA 2OL3L 3G6JE 2Z0UA 3MLRL 1AGFB 5B3SB 2MMXA 4G6JL 4F5CA 5DQ9B 3PL6C 4PHXA 2PW1B 4EPSA 3VWKB 4JDTH 4XN8A 5LGKA 4ZNCD 2CR6A 4APQD 3K6SB 4ABQA 3DGDA 4HCRH 1N4XL 3MO1B 5D1QD 1BDYA 3BSZA 1UZ8B 4U6VH 3BQUB 4F9PA 4HBCH 3G08B 1YN6A 1X7QB 3B43A 3WGUB 1MFCH 3UH8A 1A7NH 1KUMA 3B37A 1FZOA 3FMGH 4BSVA 2DIJA 4G6AD 2ID5A 2VRKA 1UCBH 2EC8A 2ZOOA 3DVIA 3MSPA 5C0CB 4EI6A 2Y1YA 4RFNC 2UZYA 3IRCA 4U0RC 4AMKH 1EJ8A 1J1OL 4HUUA 3E6FB 1F42A 1HN1A 4A66A 4ES8A 3I02A 4FMFA 4K3EH 2OYPA 3VXNA 2O6FA 1ODUA 2B2XH 2VCOA 3EJRA 3CCHA 3MBEC 5I9QC 4B7IA 4MJHA 4HHGA 2XZZA 4EDWH 4NRXA 1FRGL 5DU7A 3DX4A 1T4KB 3MODH 2Z93A 1TCRB 4R7NB 4W6XB 4EOWL 5CBEA 1BZDA 3NA9H 1AQKH 1LEIB 1MIML 5E6ZA 2CK0H 3QARA 3JZ7A 4YSEA 4GP8B 4W81A 1A7QH 1YEFH 2VERA 5J12C 1XF2A 5E08L 2A9MH 5J1AB 2NR6D 1F4XL 3CLEL 3FT2A 3AM8C 4ODSH 1KN4H 2X44D 1F4AA 3KPSA 4TVUA 1U6AL 3SY0A 5IVNA 5ESVA 4RMUA 2QHLA 1JTOA 1IGCL 1KG0A 4LIQH 2E76C 2HFFB 2W81C 5H37H 4K9EH 1S3KL 4FYTA 4A2DA 2FJGB 4F8TA 3SDXB 3NCBB 3M86A 4KJPC 4N25A 1RIVL 1F2QA 4JUSA 1DUZB 1N8ZA 4P9MH 5DMYA 3PL6D 4IQHA 2CBQA 1WBYA 4I9XA 3UEZA 5D7EA 2E3VA 1DDHA 1E2WA 4MMXA 4PJFA 1WF5A 3F64A 1CBJA 3GIVA 1CFBA 5L2KB 2BSSA 1EGJH 4PIBA 2UXGA 1U91B 2WUBL 2GTZB 1ROCA 3L5XH 1Y18B 3NMEA 5JUEH 1GIGH 2YUXA 1AZUA 3N42B 1CLVA 1I9RH 4JDVA 1MVUB 5FUZL 4OT1H 3I75B 3INOA 4P5KA 4I3RH 1THAA 2EIMB 1P4IH 3PHOA 1GGUA 1KZQA 2X1QA 2BVPA 1F58H 3GM8A 4NQXA 3QO1B 4YHNA 4QLRA 3VD1A 2Y24A 5IROC 4NZTH 2CRIA 2K9FB 5BZZA 4OUOA 3UROR 3CAFA 2VMFA 3G5YA 3QI9C 3DHUA 4N0YH 4PJCB 1L7IH 1OCOB 4YXLH 3QWRA 4LVOB 4HQQH 4PJBF 3DTDA 2QPDB 2VLMD 1Q9OB 4Z5RA 2XFXB 3QZPA 3SGKC 2DYPB 3BIAX 4KQ3L 5CD5C 3WAKA 3FRUA 4QTHA 3ULUH 4BE5A 5B7FA 5DQDL 2CLRB 4HUVB 4CC4C 2BSED 3DO7B 2MQ0A 2NY0C 5CINH 1SLUA 1S9YA 3QPXL 5FYKE 1X4YA 3TJPA 3EH4B 3ZN6A 1DBML 4RAVB 1F8TH 2P24B 4U7SA 2HLAA 5D1ZA 1QWUA 3ZZQA 3ETTA 4C59B 1CGYA 4YPJA 4V2BA 2HAZA 2DIAA 3J27A 3WEOA 3SDXF 3OR7B 1OEZW 3ECBA 1UB6B 3WNJA 4P2QA 2E6JA 5F7NC 3B5HA 1DQML 1B9KA 1WZKA 1HXYA 1REIA 3WE6A 1JZHA 2R15A 3CXHJ 4KJPD 3U9UB 1ASPA 1FGVH 1A1MB 4KKPA 2VLJA 4Y8AA 1YPZE 3NP4A 4GUQA 3V52H 3BP5B 2ZNWA 3AROA 4NCC1 2XVBA 4M8VA 3O2WH 4U1HB 4ZW7A 2HTKD 1QG3A 5IK3A 1SJEB 3N0AA 3AS1A 1Q9KA 2G75A 4FXKB 4JN2A 4F8NA 2CSPA 1R5WA 3ILEA 2FGWH 4N6QA 2VLKB 1TYJA 1QTSA 4PRAA 1O9WA 2UWEA 2FT7A 5H4ZA 2BNUA 5D2NE 3CBRA 3FB7B 1U8QB 5LLIC 2M8XA 4ZMPA 1UVQA 1P53A 1QSFA 1NEZA 3QULB 4JFWA 4M3HA 1GZQA 2Z91B 3EJYC 4XI5D 3KJ6H 1SN2A 5AVTB 4GQPH 3WTVA 4XN7A 1V3JA 3ARGC 2VW6A 1QO3B 4K7PX 1U8CB 1AR1C 1BFTA 4AC4A 1S7TB 1TQCC 3SE3C 3OKDB 4K71C 1RMFL 1J9QA 2PPAA 1AZBA 1MCWM 2APVA 2IWKA 5HGDB 3QI9D 3GZPA 4KBPA 3RPKA 5E8OA 1IV8A 4UT9A 1DN0B 3RL2A 4FQCL 4UDUB 1A7RH 1B0RB 3II3A 2LAAA 5J11C 4P2RE 2W07B 1R33A 3RI5K 3Q5TA 2ZUXA 4ZPVA 2AQRA 3DJSA 3L2LA 2E7LA 2ERJC 2NY0D 4QY8B 1U3HA 2X53A 2V9QA 5ILTL 3IU3A 4ANKA 4J7RA 3DIFB 1G5AA 3L9RA 4ZPTA 3DIDA 3FUEA 1ZWIA 4KH9A 3ISRA 1JZ2A 3BPCA 2ESVE 3UBGA 3MR9B 5HYJE 3KEHA 3TIEB 2RACA 3PGDA 1RI8A 3HR5B 1DN2A 2IGFL 3HG3A 2EUXA 3BAWA 3L95A 3UP6A 4IU3A 4R26H 3DSNA 5TDOB 1HJCA 1N3NA 5BV7H 3BVXA 3AXIA 1IRAY 1JJUA 3QDJE 5I8KL 1MHCB 3N1FC 4LARL 4O4YH 4WW2B 2OZ4A 3V0VB 4PWHA 3HC0B 3N40F 2EP6A 4WU5B 3V0WL 3QWNA 5GS0C 2ICWI 3JVGC 3LRGA 1MJJA 2AEPL 4G8GE 2H32H 4ODUA 1ZSDA 4RGNE 4Z7VE 4YHIB 3C75A 2A4ZA 1MUJA 3QUYD 5ICYA 1IGYA 3OB0K 3E2HC 4JZNA 4RVBA 1AO7D 2Q10A 4Q9BA 2JKRM 1MY7A 1VEOA 2CJUH 3DX7B 1BX2A 2ILLA 4RRPM 4YOKA 4M62L 4OUUB 1JXKA 1YEKL 2QV4A 1DR9A 5AKVA 5L4IA 1AR1D 2JB5H 3BKYH 5DRNA 5IB5A 4HMEA 2HRLA 2GI0A 3ML9A 2P8MB 3OHXA 4G9FB 5DRZB 2W9EH 4WUUB 2F74A 5DWUL 1BD2E 3UL4A 4U6XA 5EBMB 4A63A 3F12B 4M6OH 1FAIL 4XX1E 5F6IB 2OTPA 1EFXA 5JDSA 3U4BL 4X5WA 1Q1JL 5TH2B 5BVPH 2IH1B 2DEYX 3TASA 3HG1E 3DHMA 4PJ5A 3P30L 3CSGA 3QR1A 1ORSB 5CSBA 4LIQE 4ADIA 4I88A 1GGBL 1CDHA 5BZDB 3Q6FB 1RSYA 2GJZA 3AMKA 4XN2A 2G2RA 3ZDYB 5ERWA 4Q97A 3JV5A 1IBBA 4Z76B 1XMEB 3V5KA 1NUNB 1AHWA 3IFLL 1XCWA 5CIPH 1XEDA 3CVHL 3ZJAA 4ZAKA 1E4JA 1RZJC 4JFTA 2YRLA 1IAMA 2FSEA 3HG5A 3QA3B 1P5VA 3D0LA 3L45A 1N5YL 4RIRA 5JO5A 4KDVA 2D9CA 3GMPA 3RIAK 1OO2A 2NUTB 4BSJA 2IFFL 4GSDH 4AJ0A 3C5ZB 3UBXA 1LWJA 2BMKA 3FFCA 3WD5H 5EEZA 4DKFH 3W11C 5ECJE 2GTWA 1Y7VA 5GGTL 5IHUH 4XBEL 2P5WA 3NT0A 4XNQA 1JPFB 4HGKC 1QI3A 1BXAA 2ZJSH 4FI7A 3IFPA 2AK4B 1ZY9A 2AK1H 4Z8FH 5D71H 1UD5A 1G7JA 2M83A 4CL7A 3DI2B 4HEPG 2LVEA 3SJVB 1I8MB 2MIZA 4WKZA 3RP1A 2YIHA 1WGVA 5A6MA 2YAOA 1UCTA 2WSDA 4DEUA 1S9VB 1OAZH 2CGYA 5BS0A 4ZTEA 1T66C 4JREC 5LGHH 2WANA 1AGFA 5DYFA 4EN3C 1NFDB 3BZDA 3FO2B 4U6HB 3GJEB 4B53A 5DQ9A 4AENB 4P2RD 4AVIA 2PW1A 3ZT7A 3VWKA 4LP4A 1NFKA 4DKTA 3ULUE 3K6SA 4MXWL 2R69H 1PZDA 3ATEA 2NSXA 4EZKA 1TIUA 4EI0A 3MO1A 4UT6A 1UZ8A 3BQUA 4XPFH 5B38B 3G08A 5DC2A 1X7QA 1JGDB 3LCYA 5I6PA 5CCJA 1UYWL 3SDDC 1E9QB 5E6RB 3O8XB 4QTIH 5I8OL 4X80L 1EMTH 1G5GA 4HKBB 3JT2A 4F20A 1Z6JT 1IGIH 1HH9B 1H3GA 3K5RA 3QWOB 3CFBA 3VXUE 1KBPA 2BC4B 2C7UB 5AVSB 4BK5A 3E6FA 4DH2A 4NKIL 1OANA 3QDJD 4WFEE 2O5YH 3QJVB 5H4YA 4JL2A 3NJJA 5FLUA 2WY3B 3T3PE 2NXYC 2WNXA 2DLHA 5K9JL 1MJUL 1T4KA 2C3VB 4RGND 1TCRA 4R7NA 3IGUA 2G3MA 4OU3A 1JNJA 2R29A 3LMJL 1LJMA 4YLCA 5GS2H 4W6WB 1FO0H 1A6TB 4HJJH 1E7VA 5DK3A 1OTSD 1PDKB 5J1AA 2FBOJ 1LO5B 2DB8A 2XJKA 2CU9A 4ZTPL 3PWPB 4DP7X 2BINA 1QI4A 4XWGL 1E5BA 1QD0A 4DKDC 2WXOA 2HFFA 4AIEA 4PJDB 4G9DB 3FSOA 4B60A 4BZ2A 1AVAA 2F7IA 2FJGA 3ZTNH 1C12B 4DQOL 1DUZA 1MFDH 3UTZB 3TO4D 3QISA 4J3UA 1IU1A 3KLAB 4UQCA 3LRMA 2IV8A 1F2XK 2W9LA 2Z7ZA 3LVEA 4IOIB 4ENED 1NMCB 3LAFA 2GSIB 3EJJX 1QABA 3UJJL 4DGIH 5INCB 2DTML 3RZWA 1BLIA 2OTWB 3BYTA 3EYUL 4AT6B 1JG9A 1U91A 3A22A 2GTZA 1QTPA 1Y18A 2YFOA 1BAFL 4R4BB 5J3HC 1NDTA 3UJIL 4ODWB 5JW4M 1MVUA 3E8VA 1XAUA 3CHOA 2VW7A 4PHZA 3SDDD 3PFQA 3I75A 2PYEE 5AW9B 4B9KC 5TE4L 2WCSA 1L0XA 4RMBA 4BYHA 1FVCB 4N90E 4FERA 1DBJH 4AM0Q 3BAYA 4PJAE 4BHUA 1A4CA 3GSNB 3QO1A 4WQOA 3H7BB 1VA9A 3SPGA 5LNEA 5L0QB 1KLGB 4FFTA 1RUPL 5GSVB 4NN5C 4NNXB 4KZ0A 2G3ZA 3GD1C 1TVBB 2N7AA 1VRSA 4PJCA 3P54A 2ZX5A 5HXMA 4XCCH 1KIPB 4LLVB 4PP1C 5AVRB 4X6BB 1H6FA 3PP4L 1SXSA 1Q9OA 2DMHA 2XFXA 3ARZA 1DBBH 4G43A 2ZCHL 3KMDA 1P6AB 2UYLB 5FFGA 5F96L 1QW9A 2CLRA 3MTXA 1F11B 3CN1A 3QQDB 4V33A 4HUVA 3DO7A 1I3RB 4HIEB 4F7TB 2F8XC 1HKLL 1LWRA 4XO5A 1ASQA 1W72H 4RAVA 1P69B 2P24A 5GS3A 3VMPA 4OJCA 4PJDF 4UWQB 3MFGB 4TMPA 1NAML 5LNGA 1UOWA 1SXZA 3NIFB 1KB9K 3OR7A 4MNGE 4U3CA 5IW1B 1UB6A 3F58H 3ULUD 1HOEA 2AI0H 5L7XL 3OMAB 3TLRA 1HCYA 1JHLH 2ENJA 4HJUA 3SOBH 2ZP0T 5C9JB 3B9KD 5TK2A 2ODIA 4G6KL 4ZT1A 1D5XB 3U9UA 5IIEB 4H4NA 1A1MA 5A2LH 3PIQB 3BP5A 4U1HA 5TGBB 3CSPA 1UWGL