2KT6A

Structural homology between the c-terminal domain of the papc usher and its plug
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
85
structure length
85
Chain Sequence
VLKGKRLFAILRLADGSQPPFGASVTSEKGRELGMVADEGLAWLSGVTPGETLSVNWDGKIQCQVNVPETAISDQQLLLPCTPQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Outer membrane usher protein papC
publication title Structural Homology between the C-Terminal Domain of the PapC Usher and Its Plug.
pubmed doi rcsb
source organism Escherichia coli
total genus 11
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2010-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13953 PapC_C PapC C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2kt6A01
4J3OD 3L48A 3RFZB 2XETA 2KT6A
chains in the Genus database with same CATH superfamily
4Q0XH 1ZT1A 4OQTA 1WYJA 1MCPL 3ME0A 4JZNB 5I0WA 6PAZA 5KS9E 4TTGA 9PCYA 2X9YA 4YGAB 1WG3A 2APXA 1KBGL 3BQVA 1P84J 1JHTB 4RIRA 5EN3A 2F53D 4Z7NB 5AAPA 3FO1A 5I0YA 3QFDB 1ZANL 2J73A 3FQUB 2OAAA 4FL4C 2H2SD 5BS0A 2AITA 3MLXL 2KC0A 3FT4B 3Q1EA 3QIWB 4NUGH 4DERA 1NLDL 1A0QH 4WW1A 5IFAL 1CCZA 3L7EB 4UV7H 2C9VA 3B9KD 3SIKA 1IE5A 2XWEA 5IJVA 1GMIA 3KW7A 3ZYJA 2O26U 3HHSA 2NRDA 3I85A 2CBOA 1GC1L 3PWPA 1GTNA 5D72L 1NJ9A 3BP6A 5DZOA 3WXVL 3O6KL 1XFPA 1O7SA 4IKKA 4RGND 3WFEL 5F9JB 1HIMH 4WO4B 2OSYA 3G9AB 5HI5D 5HYJB 1JVKA 4G6FB 3GKZA 5D1QB 5EO1B 1Q4NX 1BFSA 1YG9A 5DQJB 3BZFB 1AXSA 2FWLB 3WLWD 1AANA 2DM7A 2KQNA 1ZGLP 1E2ZA 3BGMB 2MRYA 3H4FA 4EXPX 4UILH 4PLJD 4I48B 4R8WH 1R5WA 1QR4A 4XZUA 3W39A 4EDWL 3MKGA 5B39A 2KZKA 3H9HB 3OKLB 1A6TB 2PCPA 3DTUB 1TG8A 4J3SA 1G7LA 4WSGA 4XWGL 1NKGA 1TQBC 3IPBA 3L3JA 5AVVB 1U95A 4PJGB 2BVUA 3NPSC 3KBEA 4HGWB 2F7QA 3GLZA 1FNAA 5DD0H 5CZXD 1O6SA 2FO8A 4UT6H 4IS6A 3BVDB 1WFMA 1DUZA 1RZ7L 3FK3A 4L4JA 1PG7W 2XZQL 2DPKA 5HJDA 1N26A 3KPOB 1OAQH 4G43B 3KXFE 1ZXKA 2IFFL 2XBZA 1NBCA 3FN3A 5IG7B 3KW8A 5E8EB 4MDIA 3X14B 3GXTA 5ADPL 1MEXL 2IGLA 2HVJA 2IO5A 4P3CH 4AV0A 5EC2A 4MB5A 3V7MA 2BY3A 1QTPA 4J27A 1O6TA 3B9KA 1HL9A 2WQRA 3ZGIA 2H4EA 2JKIS 3VAEA 5A40E 2WOYA 3KH4A 3BKJH 4JL2A 2WLIB 1JWSB 2APSA 2FIKB 2MEJB 2WLHA 2NUTB 2ZSWA 3N85H 4GRLB 3VXOB 1U8OA 1EGJL 4IU3B 5GGTL 3Q2VA 1ZWIA 1KF9B 2EH8L 4ZMWA 3X3GL 2I9TA 3T1FB 1BQLL 2WYTA 1FZMB 4PW4A 3BD3A 4LARH 4X7DC 3QIUB 5JQHC 4L1LA 4TYUA 1D9KC 3F04A 3WIIH 2YUXA 3WIHH 3M6DA 4Z77B 4YDIH 5IBLD 5BNXD 1PZUB 1JOIA 4OCXL 3QT2A 3SJVB 4BELD 2BMKB 1X5JA 5EUOB 3IDNA 3KPSE 1NBVH 1JP5A 3SKMA 3VGBA 1OWRM 3Q8AA 1GZHC 3QUKB 2EIKB 1NC2D 5SV3A 2UZXB 4QRPD 1YYCA 4XBGB 1QFHA 2ZUXA 3SGEH 1S7XB 5F1OB 4FKHA 2YKKA 2Z8VC 4K71B 4ZFGH 1E7UA 4LIQE 2VH5H 1KB5B 2A9ML 4N68A 3DX3A 4F9LA 4XNZB 1TDQA 2EXSA 3IDGB 4YHIA 1EZLA 1JZGA 3V5DB 4LP8A 4OCYL 2A83B 4JFVA 4JFEE 1E6OH 3FB5A 3RL1A 4N25A 3T2NL 1MCDA 5GISL 3SDAB 3T4YA 5HDQL 5JHBA 1FV1B 4JPVL 2Y3NA 5JHLA 1VLXA 3QDJA 5FYLD 2F19H 3MBEB 3AQXA 1MFBL 3PP3K 3BEWA 1ZV2A 3KYKL 1NUGA 5CFAA 1BQKA 4M62H 3CDGB 4NJAL 5HDRA 1C1EL 1FIGL 4H8VA 1AHMA 1MI5D 2FWSA 4WI2A 3MR9A 2B3RA 3J8F7 1IZKA 5EU5B 4UT9H 5DMIH 5AZ2H 3TBYA 1DL7H 2YD6A 5IB3B 1ZLUK 3SDYL 2DWDA 4DN3L 2ORBL 4PJ9B 3FFCE 1FZJA 4AV4A 2P24B 4E9YA 4XOCA 1AKJA 3A6OA 2FWOA 1NFKA 5B1JC 5K59F 5FR3A 5KJ7E 3V6OC 1U3YA 4LRIC 2C9QA 3K74B 2DWYA 2EAEA 4QXTA 5D1ZA 1F18A 5I6XB 3U6RB 2IGFH 3HNSH 4FFWC 4XCFL 1PYWB 1VADB 4E9XA 1ZT1B 3R18A 4M3JA 2VERA 1OTUD 3ME0B 4Z5RA 4K7PH 1FBIL 2KPNA 3O2WL 3CBRA 1WBZA 2MQGA 1JWUA 4MSWA 1NIBA 1A14L 2CA4A 4RIRB 3RWDA 4NT6A 4FGMA 4XPAL 4DO4A 3MRQA 4U1LA 2DBLL 2GC4C 3FO1B 3BP4A 4ABUA 4UZSA 5BS0B 2A6JA 3S3CB 5JHDA 4WW1B 4NCC2 5LBGA 2ENQA 3SGDI 1N70A 1U36A 1NSNL 4NBYB 4YDLB 5EDSA 1TENA 4A66A 1SHXA 5IJVB 5F7DA 3HHSB 2ITCA 5J6HA 5EORL 2X9XA 1KDJA 2OPCA 2E9BA 2A6IA 3PWPB 4JS7A 3KWWA 1NJ9B 3BP6B 3N42B 2VLJD 4KAQH 3ZYZA 1ZGLM 2C9SA 5DEFA 4DUVA 1DVFD 3MA9H 3UTSA 1AGDA 1ET7A 3V0EA 3WNPA 3OR6A 1TTGA 3TBSA 1XQ4A 1R3LA 1LHZA 1JFQH 3ESMA 4Z0BH 3QDME 2V3FA 3HBZA 2DI7A 5BO0D 3IS0X 3O0LA 1AXSB 4C54A 5CP7A 4YHMH 1MI5A 4U6VL 1OZTG 1F1DA 3KPPA 1M2VA 2H2PC 1RVFL 2W88A 3HB3B 4YXHL 2Q7NA 5JPMA 2HH0H 2ENYA 1KJ2H 4XBEH 4MDJA 3BT0A 3H7BA 5LGJA 1R5WB 4I0PD 4XZUB 3T0BA 3ZQWA 3W39B 3QDAA 5B39B 5IHHA 4OZFG 4PWHA 1NKRA 3HI5H 4J3BA 2QV4A 2PCPB 3FZUD 4YBQC 1M9WA 2HP4A 4XAWH 4O5LH 1OCWL 3T77A 1G7LB 4N2AA 3ZDWA 3L3JB 4G3YL 4DEPC 2CGZA 1MRDL 1U95B 2V6HA 4PJIF 3ARFC 1OF0A 4JKPH 4N1HB 3CNKA 2PETA 4LNRA 1O6SB 2RB8A 4IS6B 1R6VA 4GIOA 1DUZB 7CGTA 1PAMA 1FRGL 2BC4A 3AS2A 5F7YC 1HHKA 1Q0XH 3I6SA 2XIIA 1X9QA 3T3MB 4MDIB 4CSSA 1BV8A 1AAJA 4YE4L 2HVJB 5F72S 3VM7A 5EC2B 3N04A 4WWPA 5AVYB 3K6FA 2ITEA 4O02A 1YEIL 5GS1C 2ROXA 3QRLA 3B9KB 4QOKA 2EEFA 2PTUA 2J8UF 3QEQE 5L88H 1BQUA 5GS0D 4X7SL 2MOQA 4NM8H 2ZSWB 1JMXA 4YHLH 1U8OB 1KEML 1WT5C 1ZWIB 3LS4H 4JRYE 3ZTJH 2I9TB 3ARDC 3WTTA 2VXTL 2JKLA 2DQCL 1DVFA 2BERA 4H8WH 4WK0B 5F2FA 4K3DL 3Q6GL 3N41F 3WSQH 3RVVD 2IWEA 4MXQC 2XY2A 4A55A 3N91A 5C8JA 4PB9H 2IQAA 4M61A 2DD8H 5TDPA 1UWEL 5LBSH 3GSVA 3UTTD 1FI8C 1T83A 4FLOA 4YK4C 1VEPA 3O4LE 1EQWA 3IDNB 5HI3C 3S98A 1JF6A 5DMJB 3SKMB 2K78A 1WHPA 4JO4L 4E9SA 4ONHA 5TF0A 3ULVE 3TOPA 2VL5A 5FHAL 4DCQA 3FPXA 1T6VN 5IHWA 3PQYA 4FXGC 4LHQB 4XBMA 1MJ7H 5C0BD 3K5RA 1ECZA 3WN5C 4YHIB 2LU4A 1N5AA 4JM2F 3VNYA 5L8KB 4JR9H 5EA0H 3QO1A 4UQAA 3RL1B 3FB5B 1J1XL 1XX9C 4HQQH 4KTDL 4FTVE 1B6UA 3T4YB 2JWYA 2ADFH 2EYSA 4LGSB 3NQKA 2CJSA 5CLZA 5E2VH 5L0QB 4OJFH 5IREA 1HI6A 3QDJB 5DK2A 4AQOA 4JO3H 2CIIA 1BAFH 2H32H 2JK5A 3HMWH 3BEWB 2I32A 3IKKA 3K6SA 4Y9EA 3R1GH 1EZSA 4KKPA 5EZOL 5D96B 3MR9B 3LZOA 1OP3H 4N2EA 1OK8A 3TBYB 4NUJA 2WXLA 5LXGL 1Q72H 5T8IA 1HNYA 4MXWL 4XWOC 1T66D 1LDSA 2DWDB 1QPKA 3D08A 4LLWA 4S0HA 1L0XA 3FSZA 1FZJB 1Q0YH 4DN4H 1AKJB 2IWGA 2FWOB 3JTBA 4E9LA 3SCMC 4W70A 1A3ZA 5CIPH 2HXAA 3U9PL 3FC8A 4NZDA 4G7VL 4KDVA 4QXTB 5D1ZB 4C83A 1JHKL 1CL7I 2K1MA 1R33A 4NBZB 4W9ZA 1RI8A 2NY0C 3GRWL 4Z5RB 4GXUM 4Q56A 1BXXA 1DQLL 2ZKWA 4EZLA 4HOMA 1TJMA 1WBZB 3LKPA 1JWUB 1FNGA 4MSWB 1Q1JH 3RDTD 5TQ0L 1URZA 3RWDB 4NT6B 1B0RA 1MF2L 1NC2B 3MRQB 4U1LB 4GMSL 3BP4B 4DKAA 1D5XA 2A6JB 2EDFA 4U1KA 5JHDB 2DICA 1Q38A 4DKFH 3KLHC 5AOJA 1G7JA 1Z7JA 4YR6A 1MPAL 2DYSB 5J1AA 3AQDA 1CURA 4L8SA 5F7DB 2CMRL 1PY0A 1OAUH 2ITCB 4PJAA 3BP5A 5J6HB 3QS3A 1PIGA 3ZL4H 1BF8A 1QBLH 4CKQA 2A6IB 1RHHA 3KWWB 2YS4A 1BHGA 3IN2A 2YXWA 2DI9A 4Q0XL 4D2NA 4LL4A 4F58H 4NN7B 5DEFB 3BPOB 3UTSB 1AGDB 1EFQA 3G5XA 3OR6B 4HJUA 1H19A 5EUKA 3TBSB 4A67A 2BP8A 1R3LB 1Z9SA 1ZS2A 4OV6F 4WVRA 3MUUA 4Q8BA 6FABH 2WXNA 4A68A 3EOAA 5EEVA 3L1OH 1HCZA 4PG2A 5CP7B 1CICD 4NUGL 1XSJA 1MI5B 3TFKC 3KPPB 4UOW1 1A0QL 4ZBJA 1M2VB 3G6JF 4UV7L 3IJEA 2MPVA 4Y2NA 5JPMB 3VX1A 2WIIA 4MDJB 3H7BB 3P54A 4I77H 2DYRB 3T0VA 5K59E 5LGJB 2Z4TA 5KAQF 1RIHH 3GD1C 3U4KA 3VRLF 2V5YA 1VKXA 4GQQA 5CBAA 1QSED 1OAJA 2FK9A 3T77B 1DCEA 5I6NA 4OCWH 3U0PA 2WBJA 1HIML 3GSQA 5AG8A 2E7LC 4ENED 1HAWA 4M02A 3AC0A 1BXUA 4LNRB 2A9CA 4N1CA 2YOCA 2MCPL 2V5SA 1BBJA 2B5IB 1H0DA 1EX0A 4F1ZA 2BC4B 3PGFH 4JPQA 3KL5A 4UILL 4JFYA 3RDTA 1HHKB 4ATWA 4NQUA 1L9SA 1IVLA 3AG3B 3VSUA 4ACPA 4R8WL 2CU9A 3ISWA 1BF5A 3QUZD 1IARB 3NZHH 4V1DE 1Q90A 1KCVH 4EI6A 5AKVA 4O02B 3WJMA 2YAHA 4QOKB 1TJGH 2ADIA 1KGYE 5FECA 4I1RA 5AOZA 4PGCA 3G5ZA 3WHXA 3QRBA 5E6RB 4KI5F 1BZ8A 4RMSA 4FLQA 5DD0L 2Z4QA 4UT6L 1FORH 3DROA 4HJ0C 1DVFB 4AC4A 3TTYA 1BW8A 1OAQL 1P2CA 2DF3A 2E6QA 3D33A 4WU7A 4X6CE 4Y4KD 5HVWA 2BOLA 1KZQA 2R83A 5C8JB 2IQAB 3N43B 4M61B 5EO0A 5TDPB 1ZLEA 4P3CL 2AZUA 2Q8AH 4GRWF 1XSKA 3WO3B 2EXYC 3GSVB 5I1DA 4CMHB 4ZMVA 3C6LA 3V4PA 4KZDH 3EBGA 3IJYA 4K73A 3RJOA 1NBYA 3BKJL 2BIPA 7TAAA 4ONHB 2J71A 3N85L 1UENA 4PP1D 3V2AR 2VL5B 4PJIE 1QSEA 1RKRA 2DQTH 4BYHA 4DCQB 2ODIA 1HNFA 3IMTA 3VTAA 1XB3A 3RTQD 3EFDH 3PQYB 4XMVA 4JVPA 3R4RA 1MVUA 5AD0A 2JF1A 2EUZA 4LARL 2NTFA 3EW3B 3SPVA 1UWXK 1N5AB 3QO1B 3WIIL 1ZMYA 3WIHL 3ZPDA 4XMLH 4YDIL 4GUPA 1IC4H 2EYSB 4K94C 3GLEA 5L6YH 1E5BA 5E00A 5KYWA 1HI6B 5DK2B 1JSYA 1NBVL 2CIIB 2JK5B 3MNVA 5BZXA 5E2JA 3DJZA 4MCYA 2J8UE 3L54A 3K6SB 3CN1A 4FN0A 5IMMA 3DGCR 3IKCA 3CHQA 4HK3N 1NMCB 5J5EA 4ZFGL 5LCVA 5EDXA 2VH5L 2X42A 4NUJB 4P4KC 4R4FH 3ARGA 3H53A 1LDPH 4DK3A 1SXBA 1UA6H 4XO4A 3MXWH 4FG4A 1JZDC 4UOW0 4NP4H 2WLYA 4LLWB 1XL4A 4FCAA 3F3HA 3HE6C 1E6OL 1ETA1 4U0RB 4Y16C 4YPGA 1F4YH 5I73B 3C5XA 5CHNB 2NR6A 4Y4KA 3BVVA 3LPWA 2F19L 2WWMD 4C83B 1CFSA 2R0WH 2QKIC 4M62L 3NP4A 4ONOA 2V9RA 4P46C 3NRFA 2ZXEB 5AB1A 1ZVYA 3LKPB 4UT9L 5AG9A 1DL7L 1FNGB 3MJWA 3VD3A 4HKBA 4N6RA 1B0RB 1CZ8H 5IB1A 3ZTJG 3WNOA 4GBXA 4LPWA 1D5XB 5EU6D 1VADA 3RWHA 2O5YH 5LG1A 4U1KB 3TN0A 1F0LA 3G6AA 1KOAA 2ARJA 1Y7VA 3WD5H 1G7JB 4JM2C 4YR6B 4Y2DC 5FDWA 3N1MC 3DMMC 5J1AB 4ZTOH 4L8SB 4J28A 2ZE0A 1OP4A 3BP5B 2IGFL 4H0IA 3HNSL 4PJAB 5DJ6A 2VB5A 1O7VA 1RHHB 3K2KA 4OLEA 3BWUF 1T04A 3PAYA 4BQCA 3SY6A 2HX7A 1VEMA 3H42H 3FYEB 3G5XB 1TYRA 5EUKB 2BP8B 1L6XA 3QJOA 1Z9SB 1LP9E 4XVJH 1NEZG 5A2AA 2IH1A 3ATDA 5AENA 1HE8A 3EOAB 4LQ1A 4JE0A 3EYVA 5GGSA 1KDIA 3X1GA 2X41A 1XD1A 3N1PC 4ZX3A 5L2KD 2YXMA 5F7HA 4UV4H 1TU2A 4FLRA 3IJEB 2WIIB 1NGQH 1FG2A 4KOBA 1J10A 1HQRA 2BJMH 4M00A 1JXDA 4FF9A 1I1RA 4UINH 3UPAA 4UMSA 5CBAB 4ZW5A 1VKXB 3G5YA 3SDDA 4ETQA 3QH3A 3S37H 3U0PB 4I9XA 2WBJB 2Y2YA 1CT8A 3MA9L 3GSQB 3MV9D 5FYJU 2NXYC 4Z0BL 1JFQL 4Z7UF 4F57H 3CXHK 3DRQA 1C08A 4KKCC 4YNYA 3UMTA 4A2FA 2XWXA 4YHML 1GGYA 4BKLA 4H8UA 3EJTA 1BBJB 3ATFA 1H0DB 1OKEA 5CCHE 2EC8A 2NY6B 2HH0L 4JFYB 1KJ2L 3D05A 4MTMA 4XBEL 4Y8AA 5AW9B 2X1WL 3RDTB 2CIKA 2IMMA 4UF7C 3S3PA 3HFFA 4M7JH 4XT1C 1U3HA 4EI6B 4XAWL 4Q74A 4O5LL 2YMTA 5F9AC 4UI2A 3WJMB 3A4AA 5CCJA 3TEZA 2ADIB 1S7RA 3L16A 1J86A 1BEYH 1WV7T 5FECB 4KJPC 4PGCB 3G5ZB 3WHXB 3J7HA 2ZG3A 2VDRL 4JKPL 2GQHA 1JYWA 2Z4QB 1EXHA 3DROB 2EDOA 2YRPA 1H3UA 2XN0A 1KB9J 4QXGH 1IL1A 1P2CB 3MJ8A 1Q0XL 4WU7B 3DUSA 3G6JE 3LEXA 1DN2A 1CFVH 1XH2A 4LSUH 5EO0B 4E9VA 5BJTA 4WF7A 1XIWC 4W9EC 4PJFA 1YUKB 2D9QB 5IKCA 3SB3A 5AZEH 5I1DB 3U6XS 4KC3B 3C6LB 3V4PB 5SX5H 1UURA 3IJYB 4QEGA 1NBYB 4J3WA 3D34A 4NM8L 3X1BA 4YHLL 3SN6N 4JBSA 1QSEB 1HVXA 4WDIA 1KGWA 1QLEB 3LS4L 3WIFA 3A67H 2FYYA 3F7VA 4G42A 3AZUA 3L4YA 4GP8B 1MVUB 5AD0B 5CF3A 4H8WL 3VGGA 1OGAE 1TZ8A 4J4PD 3WSQL 1G9EA 2TRHA 1PLAA 3U30B 1WWBX 2NTFB 4W81A 3SPVB 3UZVA 2BSDA 3AXLA 5AZUA 4PB9L 1MFMA 2DD8L 5EF1A 2GHWB 2XV3A 4GKOA 4GUPB 1NOLA 4FQXC 5LBSL 2WJ7A 1M3IA 5G4MA 3UG5A 1XBRA 5E00B 5KYWB 3KJ4B 1I9JH 5C09D 1BJ8A 3TFBA 4F2MA 3WAJA 2CO4A 2IAMC 3MNVB 5JIMA 4FFVC 2QQKH 3FDWA 3L3DA 4MCYB 1EO5A 2XKNA 3MOBH 5EEZA 1J9TA 4D7PA 1BD2E 5IMMB 2OM5A 4HCRH 5E4EC 3IKCB 5GRVL 1IC1A 4YSDA 2R69H 5DLMH 3AUVA 2J5LB 3Q5TA 4KI5C 3ARGB 1MJ7L 4HAKA 1FJ1A 2D3VA 4Z3FA 4DK6A 1KXVA 1P7BA 2P5WD 4JR9L 4MRCA 5EA0L 5CZVH 5C07E 3MN8A 4YPGB 4HQQL 4OZHF 1QRNE 1BEXA 2ADFL 3QZNA 4FZ8H 2FAUA 4I0KA 5HYEA 1FCGA 4GRWE 4M7LH 1ZTMA 4OJFL 4Y4KB 4NC1E 5E2VL 4LCIH 4JO3L 3NDYE 3HMWL 1BAFL 4D94A 1CFSB 1J8RA 3NIDB 4N0CD 3A6CH 1U2HA 2WN3A 4P9MH 2XVLA 3MACH 3R1GL 4JY6A 1W8NA 4P2QE 4K7FA 2OW6A 4YDMA 1F3RB 1Q72L 2APTA 2EDLA 3L5IA 4FKEA 4N6RB 4OSUH 3TVMC 3BUPA 2MOGA 1I85A 2AXJA 3ESNA 4X9IA 2X1XR 5IB1B 2K4WA 4GBXB 1UB6A 2HKAA 4QTFA 3RWHB 4AGOA 3QJFA 3L2LA 5DT1H 1Q0YL 5H37A 1T7VA 3TN0B 3NFPA 4DN4L 3G6AB 1GCFA 2ARJB 3PWUA 5FDWB 1FGNH 2CHDA 3F05A 3V79C 2LT9A 1EMTH 1FO0H 5E7FA 5DJ6B 1D5BA 5D7KD 1X5YA 2B0SH 5JOPD 3TA3D 1T04B 1FSKB 5EWIH 3JYBA 2Y1AA 1U58A 2G3XA 3EF4A 1V10A 5C09A 1Q1JL 2J7LA 3PNRB 4QHKI 4PGJA 1NANI 4ZOEA 2IH1B 2BY1A 3J2PA 5C6WH 5FGCB 2YLKA 4BZ2H 3EYVB 3EOYG 5GGSB 4K07A 2GFBA 4KRPB 3TWYA 2A0LD 4DKFL 1TU2B 4CSTA 2VLLA 2WXGA 5E99H 2DJMA 2Z7YA 3WEMA 2DY2A 5I1IH 1FG2B 4O9HH 2XXCB 3EUDA 4QHUA 4HPHA 1EVTC 1HQRB 3VG9C 4BRVA 1OAUL 3AQZA 3KXFA 4JQXA 4WW2A 3ZL4L 1KV7A 1FQ9C 1QBLL 4WJG3 1MKFA 2GJRA 3QNXA 3WY1A 3G5YB 1RZPA 4ETQB 3QH3B 4F58L 2HLEB 5HDWA 4O2FA 1EHXA 2CXGA 3FT9A 1CT8B 5AVUB 4Z7OB 1YEHH 3EHBD 4Y9FA 2ADYA 2WY3B 2X6MA 3NTCH 1TQSA 1CTMA 3P4MA 4MVBD 3TZVA 4FG6D 3KLKA 5HHNA 3DRQB 6FABL 1C08B 1I3VA 3OHMB 4LFHD 2DQGH 4YNYB 1J8HE 3CVHA 3L1OL 2CHXA 5DRWA 1DVZA 4V11A 5AALA 1U8CA 4NN5C 4A37A 4DGWC 3CZLA 4BKLB 3TBTA 5T33L 4WTZG 4WUUE 3FFCD 4ZTEA 1PY4A 5JO5B 1HE7A 5AKSA 3EJYD 1XR9A 2CIKB 4HT1H 4PJ8D 1K72A 4I9WD 4I77L 4MQSB 3V0FA 1MCJA 4N2CA 3Q0HA 3FTGA 2XZAH 5EU6B 1D9KA 2VRQA 1U3HB 3VU1A 3THMH 4OCWL 1D2OA 4BJLA 3U2SA 2VRAA 2WP3T 4G11A 5IVXF 5T1LD 1S7RB 2L4OA 4RFEA 2AQQA 3BWUC 3AROA 1MFAH 1WP6A 4IRSC 4N9OB 2C3XA 1A7RH 3AREC 3DOHA 2GUYA 4UNVA 3OSVA 4GEIA 5TH2A 1CN4A 1GYWA 5DO2D 5C0CE 1NMBH 2Q87A 1QAWA 2W65A 3TA3A 3VE0A 3UDWC 5ERWA 3KCPA 1I9IL 4BGLA 2DKUA 5C2UB 4OT1H 3FTZA 4NN6C 3WE6A 1A4JA 1IL1B 4C56E 3PGFL 3MJ8B 1PLGL 1A6ZA 3DUSB 3KM1A 3LEXB 1OTTC 1B3IA 1RSYA 4XN5A 5BJTB 1UZ6F 3NZHL 5G5DA 4NZ8A 4PJFB 1JXJA 1KCVL 5IKCB 4X80H 3OXSA 5IW1A 5DA4A 4P5RA 2ZYSA 5AVSB 1CDJA 5AW8B 5FLUA 2CG9X 4WY7H 2RFXA 1JGLH 4O4YH 1BA9A 2WQSA 3DURA 3JZYA 1TJGL 4RFNC 3WNLA 3RVWD 3M1OA 1IGMH 2CAKA 3ZTNH 3H0TA 4WDIB 3WIFB 4DQAA 1FORL 2PO6D 2FYYB 4X9HA 3LKRA 3F7VB 3HZVA 4G42B 4F7PA 1B6DA 2WW8A 5D4JA 4DETA 5C0JA 1C16A 4OCSH 2FBRA 3FUMA 4JFHD 4R97C 1KNOA 4U4BA 4DPCX 3UZVB 5D7IF 3AXLB 3T65A 1XF3A 4H13C 5EEYA 2A1WH 1I1AC 3QR2A 3ZZSA 2Q8AL 4DGYH 5I17A 2PP9A 5AYUH 5C86A 5EB9A 1DBAH 5EIIA 3FFCA 3FFOA 1G4RA 3I75A 3MRDA 5B1JA 5LG6A 2GW5A 4KZDL 3PL6C 4GG8A 1VZGA 4F2MB 3RZCD 2VRKA 1I8AA 4M9PA 1CD8A 3L3DB 2XKNB 2HX8A 3APDA 3LH9A 2DQTL 4JDVA 2DL9A 2XJKA 1EVUA 4HOWA 5MENE 3EFDL 1FNLA 5I1HH 3KCWA 4FNUA 1A6PA 3ZVVA 4JW3A 1FJ1B 3F7RA 3OJDA 2BLFA 4F24A 4XMWA 4WI7A 3FUJA 4FL4B 4ZSOA 4XMLL 3V0AC 1E9OA 1IC4L 1J12A 4P5SA 2QBWA 1NGZA 4NRXA 1IM9A 5GZND 3HPJA 5L6YL 1FGVH 4XXWA 2ZICA 3NYKA 3AU0A 5AB9A 1VFBA 4DP6X 1MCLA 1G1CA 1NUNB 3WN6A 3TBWA 3V0WH 2YD1A 2AXHA 5FUOH 2JKNA 5C6PB 4ODXA 5A2JH 4JY6B 1Q1PA 1OVZA 1UWXH 2WKOF 2G9HA 3QISA 4HHAA 1YNLH 2DWXA 4K7FB 4R4FL 4S0SD 4QKTA 2YAMA 1XSOA 2VQUA 3DYMA 1LDPL 3GS7A 3L45A 4XN8A 4YSUA 1ID2A 1UA6L 2BIMA 1TZAA 3MXWL 4BFIA 4NP4L 1UB6B 3QDMA 3ZTDC 3QJFB 2LVEA 3NFPB 3UBXA 2DTMH 1OGTA 1F4YL 4JKLA 5TDNA 4WEMB 4U0QB 3VJ6A 4Z7VF 3PWUB 2NY7H 2EO7A 2P46B 2XVGA 3DK0A 5DSCA 3TJEH 2VXUH 1KCWA 2R0WL 1D5BB 2E6PA 3AG4B 3KGRA 3QNYA 5F8RC 2XN9E 2DRUA 3ULVD 1FG9C 2GTZA 2OYLA 3D6GA 1U58B 5CEZD 4OAWA 2JQMA 5CZRA 4JFWA 5C09B 4BSJA 3RZCA 1GH7A 1CDGA 3NPSB 4JX0A 1CZ8L 1OPOA 2QR0A 3SPGA 2NNFA 5KANI 1MW2A 2O5YL 2GFBB 4X9GA 3GHBH 3WD5L 2IBGA 2VLLB 3T4AC 1ZJAA 1KBVA 2EABA 4OZHE 1TYJA 4QHUB 3ZRCC 4ZTOL 3SGDH 4ANUA 3KXFB 1M56B 5AKRA 2I85A 4WW2B 1BVZA 4WI9A 3VI3F 4IRJD 3QNXB 1RIVH 2YZ1A 4ANVA 2VLKD 4O2FB 4KK9C 4AY0A 5GZNA 3H42L 4KX9A 1KYOK 3P2DA 1EUUA 4YWGH 3UZEC 1A4CA 3DXAE 5L4IA 3ZIMA 1KC5H 1PJ9A 3HI1A 4M3KB 3P4MB 3TZVB 4XI5C 5A2LH 4XVJL 5HHNB 2YSTA 2FHCA 4Y4FC 5H8DA 4KUZH 5DRWB 3CVHB 3OLDA 4JM4H 1U8CB 3Q44A 4QY8A 2O6EA 3TBTB 1W72A 3ARDA 1I9RH 2ZKMX 4NRZA 4UV4L 4JRYA 5B7FA 1I7UA 3O2VH 1XR9B 1NGQL 1CYXA 5DTFA 5HJBA 4LLYA 3SSGA 1CK0H 2BJML 4L1SA 3SPJA 5C1MB 3FTGB 4HCFA 1NCNA 5DUPH 1D9KB 4UINL 2EILB 2FLRT 2K7PA 4FC3E 2B1AH 3EZJB 3RQ3A 4OGQC 3S37L 1XH1A 4YBLB 3MJ9H 3UAAA 3U2SB 2GSMB 3FT2A 5DEJA 1MH5A 4RFEB 3E1ZA 4F57L 3LH8A 5AW7B 1DQDH 1DLFH 5TH2B 5DVMA 2BVOA 3REWA 2JI2A 3C5SA 2W65B 3TA3B 3VE0B 5ERWB 3KCPB 1ZTXH 1KY7A 4M29A 4X83A 3WE6B 1A4JB 4M03A 4PS8A 5E6YA 5ITBL 2ZOTA 1A6ZB 3SBPA 3WN5A 5AYTA 3HW7A 5IROC 1PD1A 4M7JL 5G5DB 8PAZA 3GBMH 1DO5A 3OXSB 3OZKA 4JFFD 5CSZA 5IW1B 4B5EA 3AWFA 5CN3A 2RFXB 4FTVA 3DURB 1TO5A 2A4CA 4K8RD 1MFCH 1BEYL 2YUVA 3WHE1 5E08H 1PTZA 1E65A 5DHYA 5T3XD 1JGDA 3H0TB 1JNJA 3FHEA 1W91A 4G5AA 5GSVA 5D1XD 4C59B 3P9WB 3OB8A 3LKRB 2VTFA 3HZVB 3NIFE 3RA7H 4F7PB 4QXGL 5C0JB 1C16B 4QHPA 1HHGA 3WI9A 1KNOB 4AKOA 5KBMA 4F5CA 1MCNA 1XT5A 3VXSD 3T65B 1KGXA 4MJ6A 1CBJA 1OY3B 1XF3B 4LSUL 1CFVL 2QGBA 2VMCA 1TZOA 5I17B 4LPTA 4ZMXA 3UOAB 5CGMA 5EIIB 5AZEL 4X9FA 3FFCB 5A6IA 3I75B 3MRDB 4OB5H 3E8UH 2UV3A 4FERA 3G3LA 4GG8B 3PYCA 4RDBA 1NIAA 1WF5A 3DX2A 2ENSA 1H5BA 2CKBA 4FJYA 5IVXE 4RH4A 2CNZA 4JDVB 4DEWA 2EXWC 4C8XA 3A67L 3BH4A 2WXJA 1TITA 1BQHG 4Z76A 4E9TA 1JPFA 1E90A 4DIXA 1GSMA 1W9XA 3OJDB 4KTYA 4WSKA 1QHQA 1PX4A 4V33A 1RURH 4XTRD 2EVIA 3F84A 2WLJA 3EJJX 1MCRA 3E6FA 4L4VE 4ZSOB 2WXPA 3P69A 1TZHA 1E9OB 3ABZA 3ZKQD 1X5AA 1NGZB 4NRXB 4V1DD 1IM9B 3HPJB 1UZ6E 5DHVA 2JKRM 2F9BT 1A3RH 3FQTA 2XA8H 2Y7LA 1I9JL 3K3QA 4B0MM 1VFBB 3ZE0F 3RKDD 3H9ZA 2QQKL 3TBWB 1TLMA 2FECI 3MOBL 4O2CA 4ZMAT 1E3FA 1LMKA 4MD0A 4ODXB 4HCRL 2P28B 4YPJA 1AZVA 2R69L 5DLML 1WIPA 2G9HB 5LHDA 3MHZA 4IDLA 4HHAB 4H0GA 3WFBL 4DGIH 1QLRA 3EFFA 5KW9H 3LVTA 4RSYA 4BFIB 3QZWA 2BFGA 3QDMB 3OKDA 1JDAA 3W3BA 5CZVL 4BQ9A 5D1XA 1DANT 3UBXB 4AEEA 3D69A 5TDNB 1OGTB 4ERSH 5JW4R 1JYNA 1MDTA 3VJ6B 3WS6A 4PREA 2DLHA 4FZ8L 5T3ZE 4M7LL 5DSCB 2WVUA 4LCIL 4XNAA 3JV0A 2NXZD 3ASOB 3VXSA 4FNLH 4XHJC 1MUJA 3SBWC 3PDDA 4GQPH 3A6CL 1AQMA 4HS6A 4P9ML 2F15A 4S1RH 5KYUA 4AC2A 3QNYB 2FEEI 3MACL 2WQ8A 1CL7H 2PYFA 2AQSA 3IMWA 2R0LH 4XXDA 1EK3A 2GTZB 3RUGF 4GKLA 4P59H 4Y1TA 2O6PA 4OAWB 3QQNA 2E9JA 4HLZH 4OGAD 3RZCB 4OSUL 2E7LA 3MV7E 4I3GA 1VF5C 5DUJA 2Q2EB 2FDBP 2QR0B 1DCLA 5DT1L 1RXLA 4PYHA 1OQOA 5L8JB 2AXGA 2BSBA 2APFA 4M56A 4X6FA 1IBDA 1FGNL 2EEXA 2NQDA 3L1FA 5LO7A 1HYSC 1A6AA 1EMTL 1FO0L 2C3WA 3CDFA 1ORSA 2B0SL 2HTLC 4ZUSA 3CH8A 4QXVA 5KBKA 5EWIL 4V1DA 1J0ZA 2Z65C 1UATA 4KK8D 2HT3C 1RH8A 1AHWC 4CGTA 3T2LA 1F8TH 3HI1B 2J6EA 4KVPA 1M53A 4J3OD 2M2DA 1JGIA 3AQYA 1G84A 4AVJA 2JSFA 5C0AD 4BZ2L 5CGTA 4OTXH 1LO3H 4MAYC 4QY8B 5ILTH 1OARH 1OCRB 4FAAB 1W72B 3ARDB 3LH2H 1T5KA 4IK7A 4NRZB 4JRYB 4M1DH 5E99L 5JW3H 5IQOA 1E9QA 4KX8A 1I7UB 2CCLA 3U9UA 2ZWNA 5DTFB 5I1IL 4L3ED 4O9HL 4LLYB 2PW1A 2Q0ZX 2EQDA 4IM8A 4FYRA 1YVLA 4X6CA 1MWOA 3OKNA 2YQ2A 3DBSA 4E5XG 3H6JA 4ZO6A 4M6MH 1BVNT 3HA0A 5L4FA 4HEME 5A2BA 4BCYA 4RSVA 4AYMC 3FT2B 1MH5B 3S4SA 1YEHL 1KV3A 4N2BA 2K0RA 3NTCL 3NCXA 4PU2A 3HI6H 4GAYA 3I9AA 2BVOB 3EXJA 1I53A 2Y72A 3REWB 2DQGL 3C5SB 3LIUA 1G7PA 3B2UC 3B6SA 3DVIA 3O2DH 4OVVA 5ICXA 4DVRH 4FFYH 4W4OA 3OMIB 5I26A 5F7EL 3ARBD 3EH1A 2YBGA 5EBWA 1YNTF 4HT1L 4KKBD 3RFZC 1UT9A 1QWHA 3WN5B 2XZAL 4NQCD 5E5LA 1OB0A 2VDPB 3THML 5CSZB 4KHXH 3BZ5A 4OUUA 1MLCA 2Y7MA 3CQPA 2E27H 4X8JA 1HNGA 2CJ3A 4FTVB 4YHYB 3LNFA 2YQGA 3QJSB 3QNFA 4AGLA 2WXKA 3F6JA 1MFAL 5LXVA 5DHYB 1HKLL 1ZKAA 4HU2A 1A7RL 3IPEA 3UTOA 4JDEA 1JGDB 1NMBL 5GSVB 2COVD 4XE5B 2J8UA 1IZJA 4I88A 4BCXA 5FLVA 4OT1L 3QFGA 1NM9A 2QZQA 1OAYH 2CBMA 1ZRUA 1HHGB 3ISRA 4P4KA 3SDCD 1EGJA 5GGTA 5BPPA 1SMAA 3D87B 2GI7A 2ATAA 4MJ6B 1X5KA 1G87A 4LAJH 1XWVA 2A4ZA 1PMYA 2V7NA 15C8H 4MJ2A 4QRAA 5D6DC 4N8CH 5C0AA 4ZMTA 3QEGH 3HE6A 2PXYC 3CBKB 4X80L 4LQFH 4DP8X 4WY7L 2LLLA 4O4YL 1JGLL 5DQDL 4I1PA 4FXTA 4AOFA 1D5IH 4HKXA 1H5BB 1IGML 4KHTH 2CKBB 3UGXA 4EDXA 1HEHC 5IBUG 4UQDA 3D48R 1IU1A 3ZTNL 4BE6A 2CJUH 3NJJA 4PLKC 2QKIA 4K0OA 3X2QB 3AS3A 2X4NA 3JTSA 4I7ZC 2NY0B 3CSPA 2EH7H 4PJ5D 4ZD3H 3QHZH 4Z76B 1JPFB 4AMKH 4OCSL 1DQKA 3IRCA 4IBWA 3ML9A 3QPQD 5B22A 4BKTC 1A47A 4Z9KB 2C1PA 4NKQB 3RHWF 4NUMA 2A1WL 5A16A 3E6FB 2BIHA 1IEBA 3FSAA 3HG2A 3K1KC 3MGTA 5AYUL 1TZHB 4DGYL 3VW3H 1VIWA 1DBAL 5AVTB 5DHVB 4KV5F 1MFEH 4D7BA 3GEWB 3FQTB 1WK0A 1HN1A 2E86A 5ECJE 4EKJA 4Y2DA 2QMJA 1G9HA 1CGUA 4N8VG 5F8QC 2WXHA 4R3SA 1BREA 4O2CB 1C8PA 4NQCA 3FTWA 2OS7A 4MD0B 3IAPA 4BH7A 5CD3A 2FB4H 2BSRA 3WGUB 5I1HL 5I30H 1WDAA 2UZYA 4YC2B 3US9A 2Z35A 4N4YB 2PNDA 1QLRB 3EFFB 3RKPA 5KSVA 1M7UA 4Y0GA 4X5RA 3U0WH 3WXWH 4B9KC 4MA3A 3QZWB 4L3AA 1UOVA 3OKDB 1IKOP 3WEXA 1LP9A 2DQIH 3LZQA 4GW1A 2VC2H 5D1XB 3QB7C 3D69B 5HDBB 5JIKA 1E3ZA 1T5XA 4PREB 3QORD 4Q6YA 2E7MA 1FGVL 2A9NH 4MMYA 4FOMA 3C60D 2VAAA 3UTZA 4JN1H 4S1QH 3LJ3A 4FQ1H 3VXSB 3LN9A 1MUJB 1A1MA 4Q6IA 5F1NA 3V0WL 4HS6B 4URTB 5KYUB 5FUOL 2PYFB 1CFNA 4XXDB 2V37A 4QHNA 1YNLL 4XNDA 3KPMA 1H9DA 2HWZH 3CXDH 4G7RB 4Y89A 4JGNA 4JQIH 4MBOA 1S4IA 3BIBX 3BEVA 1AGCA 2MIZA 1JZ2A 2G4GA 1J7VR 1FLTX 3FQ4A 5HSFA 1X7TA 2DTML 3FKUS 1SYVA 5FOBA 3MLPA 1O7DE 2AXGB 5JOEA 4PHZA 3MLTA 4X6FB 2NY7L 2Y69B 1NGWA 1HCVA 3L3HA 1KENH 3NDZE 4U1IA 5DYFA 3TJEL 2VMJA 4AQ8C 4HH8A 2VXUL 1A6AB 1FPTH 1MCQA 5LAXA 3S35H 2VSKB 4APQC 1S78D 2AFNA 4QGYA 1ORSB 3MRBA 4OLZH 4NPKA 1KN4H 5D2LF 4ZUSB 1CF1A 3ZE0E 3EJUA 3HR5A 4V1DB 2YMOA 1OEZW 4KI1A 4K5PA 4AYFA 4HDIB 4LOUC 1Q0EA 3I02A 3RX8A 4ZUWA 3DHUA 2X12A 4ADJA 5JW4M 1KT2A 2CBQA 4JGUA 5GGSY 4NP9A 3GHBL 3B4NA 4IMKC 1FFQA 1U4EA 3IDYB 1E9QB 3U9UB 4DWHA 1J0IA 2HRGA 3EF7A 4GO9A 1B4TA 2VMFA 2PW1B 2TRYA 4IRZA 4X6CB 3RGVC 3LNEA 3OKNB 4IJTA 4M1GH 1RIVL 1XIWA 2EDDA 3RJDA 3WTSA 3QORA 1KTCA 1OGSA 3QUHA 2FL5A 3LQMA 3S4SB 4YWGL 4D9QE 2AXFA 2X9WA 1KC5L 1BOGA 3RUGE 4GAYB 1RMFH 1Y6KR 3V5HA 1X4XA 3M7OA 4KUZL 2DH3A 4JM4L 5BOZG 1G7PB 3S34H 3B6SB 1T0NA 2WP3O 3DUHA 3IN0A 1VGEH 4U6XA 5ICXB 1U93A 1I9RL 1N10A 1RU9H 2HN7A 3HC2A 5J12B 5EBWB 3O2VL 4RDQG 3TS8A 1CK0L 1OGAA 2PPCA 3KBFA 3W11C 5F97E 5DUPL 1VJSA 5AVWB 1JL8A 1NQBA 5G4NA 5IB2A 1WZ1L 2B1AL 3ZHDA 4OUUB 1MLCB 3M45A 4D8OA 5J57B 4X8JB 1N6QH 3MJ9L 3NMEA 3FT3A 4Z7NF 4OM1H 2HTKD 3WDJA 4AIZA 2IAMA 1DQDL 2R51A 4JDEB 5EZIH 1DLFL 2CRIA 3MCKA 4XPBH 3RIAK 2J8UB 1SLWA 1L9TA 1RP9A 1I1FA 1ZTXL 3ECUA 4Z95H 3WENA 1BD2A 2GSGA 3LKQA 3FQRA 4HLZG 5FIEA 1OOWA 3HBPA 1W6LA 5KVDH 2IGTA 4IDJH 1AGFA 4P4KB 2BNRD 2Z8SA 2XN2A 4PRNA 4MQXC 2V7NB 5C0AB 3VGHA 4N22A 3HE6B 2CBPA 2YR3A 3GBML 2VN4A 3LRGA 3N41B 4HJGA 4Q4EA 5C07A 5MI0C 5C08D 3BFQG 3FTVA 1QRNA 5DI8A 4F7TA 2UZPA 3K2UH 1MFCL 5EG6C 1HEJC 1CFTA 4YSRA 1X7SA 5E08L 2ZTBA 4HKXB 2B8OT 4KU1A 4M5TA 5ACLA 3TIDA 4P5TC 4EDXB 4WIQA 5A3IC 3N44F 2QKIB 5ID1A 2BX5A 2X4NB 3JTSB 4HWZA 4FFZH 4MMXC 3SD5A 4P05A 4WI8A 3AXIA 2BVEA 3DJ9A 4EVNA 3RA7L 2XTLA 1MNUH 4JJHA 4XVOA 1WAPA 2YC1A 4ES8A 1ZDSA 2VMEA 4F7EA 4Z18A 2IC2A 3O9WD 3TVMA 3GTTA 2QHRH 5E6ZA 2C1PB 5HHOE 5A16B 3FU7A 2Y9RT 1IEBB 2XUWA 3ZE2E 3MGTB 1EJ8A 2WNKA 1T7YA 2EACA 3E9UA 4YHOH 4PJGF 3P9MA 4OB5L 3E8UL 1WBXA 1ZHKA 4W9LC 4Y2DB 3R8BB 4TXVB 2WD0A 2WV3A 3TH4T 1S7WA 4R3SB 2EUVA 1X6LA 5G55A 3I6LE 5DWUH 4NQCB 1CXKA 1BIIA 1SXZA 2Q3XA 3FULA 4KKAD 3UABA 4BH7B 5CD3B 1T6WA 2BSRB 1GXEA 2BNQE 3LXCA 1MG3C 3OGCA 2P3YA 3O3UN 2UZYB 4MNQE 4NDMA 4CAGA 5HPOA 2Z35B 5KSVB 5E8PA 4XX1G 1NAKH 4N1EA 2AMUA 1RURL 2AJYH 4MA3B 2P45B 1LP9B 4GW1B 3EH5B 3K91A 4A2HA 1AZCA 1T5XB 4MMYB 1A3RL 2XA8L 2VAAB 1X5IA 2X4UA 3RP1A 3UTZB 2HMIC 5HVHC 1XR8A 32C2A 5H4ZA 1A1MB 4OKVA 4Q6IB 5F1NB 3U48A 5LJYH 3BVXA 1FVCA 4XPTH 2E8YA 2NY3D 1TNNA 2VABA 2GJJA 5FPIA 3I6KA 1CFNB 4TTDD 4U1MA 1TJHH 3T09A 4HUUA 3CD4A 4QHNB 3KPMB 3RY4A 2ESVE 1DSFH 2OI9B 1AGEA 1AS8A 1IAIM 1TETH 4DGIL 1L0YA 4ZFFB 2Y4SA 3OC5A 1YY9C 3H9SE 2OP4H 5KW9L 2CUAA 3BEVB 1AGCB 4FNPA 1VRSA 3GRWA 3SKUD 4ZO9A 4EI5D 5ISZE 2CLRA 3NGBC 2B77A 1PY9A 2UUDK 5FOBB 1DBBH 1YY8A 1SYVB 1GSKA 5EUOF 2Q6WA 2R1YA 3MLTB 5HPMA 1JZ4A 2NYZA 3L3HB 1NGWB 4WUUA 5AL8A 2P47B 1JXFA 4U1IB 1DVSA 3A3YB 1NPJA 3O9WA 4KROC 4MA1C 1QTYT 3D39E 3BISA 4FNLL 4KV5E 5LAXB 1INDH 3DO7A 3MRBB 3Q9QA 5FEBA 4S1RL 5B38G 4OFPA 4BUGA 3MNDA 3BLBA 4UIKH 3VFGH 1CL7L 3HR5B 4UQ9A 5F6IB 2R0LL 5EIVA 2J88H 3X13A 4ETYA 3BVNA 4P59L 2AJXH 2IBBA 2EDQA 1WIUA 4AYFB 2WBKA 2X70A 4APXA 2B2XH 4K3EH 4PM1A 4LU5H 3I02B 3AREA 4ZUWB 4YDKH 3Q05A 1KT2B 1NANH 2I60H 2P8LA 3AS0A 5C0CA 1A8ZA 3IDUA 2FHFA 4WI0A 3FUIA 2J8HA 4WNSA 1CBVH 2YAFA 1S7VA 4NCC1 5FUZH 4L1TA 1AD9A 1U21A 4C56A 2SODB 3BRDA 3S36H 5HGGS 2FRGP 2F7IA 2IWFA 5IMKA 1XIWB 3NZUA 3BKCH 3QORB 3CZJA 3CZKA 2FL5B 2LE9A 2QPSA 3JT0A 1IBZA 3T0EE 5J3HC 2AXFB 2BVPA 1F8TL 1BOGB 1UD3A 1FNHA 4G6AC 4JPIA 5D8JH 4NYLA 2HKHH 3V5HB 3D4CA 5CD5C 1GAFH 1LO3L 2CPUA 2F5AH 2W9EH 3HN8A 1XDTT 1T0NB 4OTXL 5ILTL 1OARL 3ZR6A 1OOAA 1BMWA 2EZ0D 4P3DA 1U93B 3LH2L 4U6XB 5A6MA 4IBVA 2HN7B 2HT2C 4M1DL 5JW3L 4HD9A 2X6BA 2ETWA 5HYSG 1IKNA 3CHRA 3DV4A 1OGAB 2QVIA 1ZJBA 2G3MA 4RZKA 5T5FA 4EI5A 1WQVT 5IK3A 3C08H 1ES0A 4YSEA 2WNGA 2BZ7A 4ORZC 5A2CA 4M6ML 5IB2B 4BUQA 5KYXA 2XV0A 5I1GL 3VQ2C 4Y1AE 1IQWH 3TF7C 1OALA 3FT3B 5D2LE 3PGCA 3B7TA 4FCHA 1A9EA 2AJ3A 1SBSH 4JG0H 4PGZA 3HI6L 1AR1D 2IAMB 3MCYA 2D4FA 4AIZB 3MCKB 4QNPF 1NAMH 4BFJA 5TD4A 4HUCA 4JG9A 3S8WA 5DZPA 2PTVA 1ODUA 4FE9A 4MYWB 3O2DL 1I1FB 4OM0H 5E4EB 1BD2B 2GSGB 2WBXA 3FQRB 3LKQB 4FFYL 1KGCD 4HIJA 4DVRL 2XQYA 1AGFB 1GGBL 4KXAA 5MENA 1MHPH 5GJTH 2FSDA 3TH2T 4NO3A 5JQIB 4UT6A 3TIEA 2ZT9C 4PRNB 2X2UA 2WKLA 5BV7C 4I1NB 3Q5OA 1L9QA 1LM8V 4HJGB 4KHXL 4ZODA 5C07B 2E27L 1HH6A 3B2DC 1QRNB 3BGAA 3QR0A 4Y4HD 5DI8B 4LCWE 4F7TB 2W0KA 2E56A 4OVUA 1T2JA 5E5RB 4OGZA 1CFTB 2X5PA 1LL1A 4GRWB 1VAHA 2AJVH 4LPYA 4M6AA 4XVUD 3TIDB 3GLDA 3DXAD 3V9CA 1ND0A 4L8DA 2GC7C 5ID1B 1DHKA 4HWZB 5JYMA 1M9SA 2W92A 2BFVH 4GT7A 4HIEA 2W0LA 4XO3A 4EVNB 2Y6SC 3HG3A 3FSWA 2YC1B 1OAYL 4QRTA 3ILQD 2DYPD 4F7EB 3TVMB 2CWRA 4KUCF 1GRWA 4S10A 4BWUA 2OW7A 1PD6A 3FU7B 4N8CL 2IANE 5F88A 5JIHA 3QEGL 2GJ6D 1DN0A 4LQFL 2QQLH 3P9MB 4I5BA 4LP4A 1XV8A 1WBXB 1ZHKB 2GHZA 3LZRA 4HAGA 2WOBA 4AL8H 1S7WB 1D5IL 4KITB 3OX8A 4KHTL 3BQUA 2XYBA 5LGHH 2DMGA 1BIIB 1V8HA 2CJUL 4NFBA 4RAUA 2NLJA 4KMQA 3BSGA 4XP4H 2EH7L 4L23A 4ZD3L 3RVXD 5D7JD 3OGCB 3WTUA 3QHZL 4NDMB 4AMKL 1SEQH 2YD8A 5E8PB 5H2BA 3RNQA 4AGPA 1JTOA 2OCJA 2CHNA 3MRJA 2JJUA 3ZUNC 5BOJA 1F4HA 6TAAA 1TXKA 4PRDA 4DZBA 3CFUA 3VW3L 3ULUF 4YZWA 1MFEL 3TL5A 5AWNH 3LXBA 2X4UB 4KNQA 2Z9TA 1XR8B 32C2B 5HYJE 2V8LA 1CDIA 3VG9B 2YFNA 4OLWH 1TTFA 4OKVB 4WO4C 4XP1H 4N2IA 1FVCB 3TPUA 5D1QE 4X7EC 2DQHH 2VABB 3NQIA 2BDNH 3I6KB 5D1QC 2XFGB 2YFOA 4U1MB 2FB4L 2BSED 1R34A 4HUUB 4Y4HA 5I30L 1FZKA 3I9IA 4EOWH 1JZEA 1AGEB 1PZAA 4TLTA 1VCAA 4XNUH 2AERT 2MPAH 4LHUD 1EZVY 3U0WL 1WH0A 3PJSA 2OJEA 3PDGA 3ZKSD 2EVHA 3DXAA 3WXWL 3LS5H 4Y4FA 2CLRB 5CJ5A 2DQIL 4WQOA 2VC2L 1YY8B 4NN5B 3QRFM 3JT2A 5C0DA 2R1YB 3H2QA 4OY9A 2Q6WB 5HPMB 1XGZA 5IOKA 5FM8A 1W0YT 1ZVSA 2A9NL 4WUUB 2YO3A 2DYPA 3O9WB 2NW3A 4JN1L 4S1QL 4FQ1L 4PJGE 5HD8D 3DO7B 4JFXA 2ICWA 1HU8A 1MRFH 2GABA 3GNMH 3PV7A 4UM9D 4YXLH 3OKOA 3X13B 4CVWA 3BVNB 1IM3A 1AXTH 1UGNA 1SHSA 2HWZL 2W0PA 1E8YA 3CXDL 2VITA 1DBKH 2X70B 3IWUA 3HR6A 1UC6A 4KK6C 3BCDA 1KGJA 4JQIL 4APXB 3L48A 3AREB 3RL2A 2YGPA 2F8XC 4P9HC 3HNTH 3MRMA 3WFCL 2P8LB 2Q3ZA 1LYQA 3FN0H 5C0CB 3GJFK 1PZ3A 1Y18A 5D7JA 1X5GA 4WI0B 4R4BA 2HT4D 5EZJA 4JM0A 2ZCHH 2OZ4A 1S7VB 1LO5A 1KENL 2LU3A 3G5WA 1AD9B 1EA9C 2YXFA 3Q2CA 3MBXH 4C56B 4UYPA 3H9YA 4YL4A 2AQPA 1FPTL 3PPEA 3S35L 1QKZH 3VXNA 3ATAA 5IROA 4OLZL 2DN7A 1KN4L 4Q58C 5IMKB 5CN1A 3AT9A 1I8LC 5F0LB 2EIBA 1T20A 2AHIA 4DAGH 3QI9C 5FGRA 5BVJA 5I18H 2IH9A 3TEXA 2BVPB 1A7NH 4AYGA 3FOLA 1ZPUA 4JPIB 4NYLB 5AKTA 5DVLA 3T71A 4ANKA 3QIUC 2XC8A 4P3DB 3V8CA 4GP5B 1UD6A 4U1HA 2FT7A 1BM7A 1Y6NR 3QQXA 1F45A 3FU8A 4M8UA 2IAAC 3DV4B 4CC0A 3L5HA 4EI5B 3P02A 5IK3B 5KEZA 2BXZA 2RIKA 1ES0B 4U7KA 3OWRA 4M1GL 4N2NA 2FJUB 5KYXB 3ALPA 5C71A 2R27A 3KYNA 5C97A 4ZOCA 1XTLA 1E30A 2OJZH 3PGCB 1WWAX 5IFJA 4ZQKA 1A9EB 4K71C 2AJ3B 1FL3A 5BUGA 4Q4IA 3W5MA 3PHSA 3WELA 4XNZC 5AB2A 3VXPA 2UYLA 1AQKH 3S34L 1EERB 1FN4A 3HEIB 1XF5A 4M48H 1VGEL 5H4YA 4HIJB 4UYQA 1RU9L 5MENB 2G3NA 3BYYA 4OZ4A 3QUMH 4NO3B 5KVEE 4MLSA 3TIEB 1VDGA 3MBEC 2WZ6A 1CG9A 1OK0A 3SE3C 2NZ1A 4L4VA 4H1LH 1HH6B 1N6QL 1QWUA 1G1YA 1QSZA 4FQHA 3HZKA 4OM1L 3Q43A 3UFIA 3MJ6A 5EZIL 3D12B 4PRIE 4XPBL 1ND0B 4L8DB 2A7BA 1BDYA 3V0GA 4JRFA 5DJXA 4Z95L 4HIEB 1NEPA 2D3NA 5KVDL 5ES4B 2J6WA 4X9YA 4IDJL 4QRTB 4ES9A 3QE5A 3GZPA 4WTWA 4BZ1H 1RZJH 3JVFC 3EJPA 1DE4A 2I27N 2XYCA 3O4OC 4NNPH 5F88B 2G60H 3MX0A 4PHXA 5HDOA 5D7LD 3RI5F 1DN0B 3KWTA 4I5BB 2PUQT 4HOZA 2WYIA 3VXMD 3WMPA 5I1AA 4JHWH 3K2UL 5TE7H 3OX8B 4UDUA 2JNZA 3BQUB 4RESB 5LBSA 2KQMA 5IB5A 3FSOA 4HLJA 2P42B 3K8LA 2X2JA 4RAUB 5MHSD 1I31A 2NLJB 4XNQA 2VZVA 1OAKH 3GTNA 1TOXA 3N0PB 4QNPE 5IM7A 4ZYKA 3BIKA 1MNUL 3GBDA 3D9AH 3KWUA 4TNWF 4AVIA 4TNFA 1ZTXE 3GF8A 5H2BB 3RNQB 1AR1B 1NEZA 5D7EA 5BZZA 1U30A 4L29A 4AGMA 1KXQA 1DLHA 2QHRL 2ZOUA 2C9AA 3MRJB 2FX9H 3LIZH 3MOAH 4YDLC 5TE6H 2ALWA 4PRDB 4DZBB 2NZ9C 3QWNA 4KOCA 1YEKH 3QUXD 2C26A 4KVNH 4UNIA 3VM5A 4YHOL 2IPUK 3SPCA 4R84A 4FEIA 3QXUA 1QQDA 5HYFA 2H45A 2ITFA 3ZKXB 3HKZA 1USQA 4MXVF 5DWUL 4FNTA 3TPUB 2VYRE 1OAXH 3KNBA 4NQSA 5MP6H 3NCBB 2V9UA 4Y4HB 1FZKB 4PWFA 4FJ6A 4AKPA 3TCTA 1AHWA 3DHMA 3N43F 4FNRA 1NAKL 4F91B 3PJSB 4YDZA 2OJEB 3CZGA 3DXAB 4AQZA 4AYDC 1UM6H 4BM7A 4Y4FB 4PPTA 3M17A 3D3VD 5GJSH 1P4BH 1SOSA 2WTRA 2NSXA 5C0DB 1ZVSB 1CQKA 1YN6A 1FL5A 2BS9A 2DYPB 2NW3B 2OL3H 3DARA 4U6HA 1P7QD 2XDHA 4JFXB 2ICWB 3FU3A 3Q9PA 5LWYH 3S5LG 2XZCH 4XPTL 4P9HH 5TTRA 5CIPA 3VO0A 2HSIA 3DVNA 1TJHL 1OCCB 3OKOB 4X4KA 1IM3B 1J0HA 1MWAH 1XZ0A 4XVSH 1DSFL 1TETL 2VITB 5DGQA 4J1UA 2OP4L 2F53E 1SN2A 1VSCA 5EC1A 3RL2B 4QAWA 1S9WA 3MRMB 2HVBA 4NI3A 1A4KA 1DBBL 1I1CA 3MU3A 1Y18B 5EU3A 2H2SC 5D7JB 5EZJB 4R4BB 2GPZA 1R4XA 1LO5B 4HOXA 4KJYA 1GKEA 5DZNA 2C9RA 3L3GA 4PVNA 3B9KC 4QGTA 3RFZA 4GMTH 2PWFA 3VXNB 3ULUC 3WBDA 1INDL 4ODUA 4NC2B 1U91A 1EAPA 3N1GC 4X4ME 3RWFA 5I23A 4UIKL 3VFGL 2LVCA 2HB0A 4R2GD 5IUSA 5C0ND 1T20B 2J88L 1N64H 5BVJB 4RGNE 2AJXL 4R83A 1THCA 3KHQA 3VQLA 2QSVA 2UUDH 1VFAA 3OB0K 4LB8A 2B2XL 4K3EL 3FOLB 1LNUA 2R4RH 5E6ID 3RX7A 5HI5C 4YDKL 5B4MC 2AANA 3DRTA 2I60L 4YFLF 3CXHJ 1O75A 4U1HB 4G70B 3WLWC 1TLKA 1UYWH 2F0CA 3QAQA 4LMQE 1CBVL 1UOKA 3NIFB 4MLIA 4NWUH 5D7SH 5FUZL 2Q8BH 2K9UA 2R9HD 4PLJC 1KB5H 2CUIA 1ONQA 3S36L 2X2YA 4KFMA 4AEIH 1TUPA 2CCWA 4UOJA 4QTIH 2K45A 4C4UA 4LSPH 2AZAA 2VJ8A 3ECVA 3QCUH 3BKCL 1UXMA 2NY5H 3KYNB 4Y5YC 2W91A 1JF1A 4MA7H 5F0JB 5I8KH 5IFJB 4ZQKB 2AAAA 4BFKA 2PPEA 1FL3B 3UYPA 1MCOH 2RALA 3GBLA 5D8JL 3N2JA 2HKHL 2UX6A 1NOAA 1KCUH 3GBNH 2UYLB 1GAFL 1UHVA 2W9EL 2F5AL 3VXPB 1TVHA 3DTXA 1FN4B 2FTAA 1XF5B 3HBGA 4ELDA 5CZXC 4ODBD 2NYYD 1FIEA 2VDRB 1RZGA 3CZUB 4JPKH 2MQCA 3RLSA 4OZ4B 1PD0A 3VDAA 3DX0A 1B9KA 3VX0A 1IBBA 2CRZA 5L0QC 3DV6A 4AI7A 1AYRA 2YAOA 3C08L 2A74A 1R46A 3T0XA 1CG9B 3N9GH 3C5JA 5DQ9A 4L4VB 1QBMH 5ICYA 2AQ1A 1IQWL 4XWOD 4FQHB 4DH2A 1WHOA 1A6VH 3HZKB 3LPOA 4OR1A 1SBSL 3ARZA 4JG0L 4JKNA 5DFVD 3RZWA 4DFIA 4LF3A 1JGUH 1NAML 1PZ5A 2GTWA 5FYKH 2CR6A 3NFSH 1LJMA 5DJXB 2QVTA 4OM0L 4W9GC 1CUOA 5I1KH 1Z9PA 1TEFA 5GS2H 5IFHH 5F7KC 1MHPL 3PGDA 5GJTL 5E1GA 2WO3B 1OP9A 4WNQA 3ZSSA 1MIMH 2X0WA 4MJID 1QPPA 5E6IA 5I6MA 1ADQA 1DE4B 1HK6A 2Q7YA 4LPXA 4DKTA 2KMWA 3MX0B 5D1ZC 3TT1H 3ZOAA 5KANG 2VZSA 2EJ1A 3ROLA 2E4TA 2VT0A 5E4AA 1AC0A 1BVLA 4OKDA 3VGFA 5I1AB 4WWOA 1XD0A 5CR1A 1QFWM 2WVSA 3IMVA 3STBA 3FFDA 1IC0A 1RUPH 4UDUB 3RG1C 2AJVL 5IB5B 1QYGH 2W95A 1IFHH 2W1NA 4KTEH 2V33A 4QRPE 4XNQB 2J4WH 2GCYA 2BFVL 2VW7A 5LN8A 4XX1E 1LO2H 3BIKB 1GW6A 4ZYKB 5IM7B 3UADA 3DUUA 3UERA 5DURD 4FXKC 1NEZB 4HALA 2J1WA 4FQJH 4L29B 1DLHB 4E2OA 5B1CA 1G7QA 4Q52A 1OE1A 2R8SH 5C0GA 2VJ0A 4BIKA 4PN6A 3EJZD 1DVYA 2FUTA 3IE4A 3LB6D 4XNXH 1NA8A 1W15A 2QQLL 4L0YA 1T1YA 2ZPKH 2R1XA 5H94A 4NN7C 3BUYA 1QQDB 2D7TH 3RGHA 4NLAA 3BPOC 5FYLE 4AL8L 1KIQA 3BJ91 3I2CH 2HLFD 5LGHL 2Z93A 1HL5A 5IEHA 1CD1A 4PVLA 4F15B 5C3IA 3KNBB 4NQSB 1UWFA 4XP4L 5DD5H 1MI5E 3RB5A 1S9VA 1AKPA 4FX5A 1QR1A 1SEQL 5FA3A 1AHWB 4E42A 1DYZA 5JPMC 2VDQB 3LQZA 2GAZA 3V6BR 5HHQA 3M17B 2JKXA 2WTRB 3K71A 2YGOA 4TL5A 5F7BA 2OMYA 5K9JH 3D7PA 4WLCA 4WK2B 1J1OH 1YN6B 4XOAA 5D71H 1WITA 1FL5B 5AWNL 1DBJH 4PJCF 3VQ1C 4U6HB 5GSRA 4G7YH 1CFMA 5FC9A 4OLWL 2WCGA 4PUBH 5BVPH 4XP1L 1MFVA 2DDQH 1WICA 1LO0H 2ED9A 3FTXA 2DQHL 1R3IH 3P9LA 4H1LG 5CIPB 2BDNL 2IVFC 3CN2A 3GBEA 5DJAA 5DRNA 1C9SA 3TM6A 3DVNB 3LPGA 4CVUA 2F8IA 4D9LH 1SF3A 1XZ0B 2B16A 1OTUC 4CU6A 4EOWL 3BPNB 2PPAA 3CQQA 1FAKT 2B5IC 3TLRA 4XNUL 2WVVA 4J1UB 2MPAL 3E1F1 4TSBH 5I66A 2K3HA 1MY5A 1UWYA 3LS5L 5EC1B 3AMLA 1DQMH 1S9WB 1XH3A 3RUGA 4EQ2A 4NQED 4OCRH 1A4KB 1ZT4A 1J48A 1WD8A 2QSTA 3LHPH 4BKSC 1EHLH 5EU3B 4XRCA 5DRZA 2L0DA 3DVGA 1M1XA 2Y0SA 3CLFH 5TE4H 1UKQA 4KJYB 3D2TA 3L3GB 1X5LA 2E7DA 3IPFA 3CUPA 4NO0D 3RFZB 3LV3A 4ODUB 3QFJD 1U91B 4B9FA 1EAPB 2C5DC 1B0WA 4HJ0D 3RWFB 4U3CA 1MRFL 2VLJE 2Y7OA 3GNML 4MXVE 2AXWA 4YXLL 2H41A 3I50H 1ZE3H 1AXTL 1DVFC 1DBKL 4G8EA 4NNXA 1VFAB 3APNA 4BCZA 3TV8A 1LNUB 2J25A 1CF8H 2EXYD 3VRIA 4E9QA 1L7TH 4TL4A 3HNTL 3DRTB 3FN0L 2ZWZA 5CJXA 5TFSH 3OKEA 2UXGA 4CC4A 2QPFA 3EYQD 1IAKA 4RMVA 3DSNA 1T83C 3L7FA 4CMHC 3MBXL 1BIHA 2YPKA 1WO2A 1QKZL 4R7DA 1SM3H 1ONQB 3UG4A 4L4TE 1P4IH 2WYHA 4ONFH 1K6QH 1PNDA 4EN3D 4DAGL 3FZUC 1JF1B 2FBJH 4ZMQA 3UBHA 5I18L 4DZ8A 5KWYC 2ZONA 1A7NL 3F6IA 4JPSA 3UYPB 1TQWA 3GJFH 3DDGA 3QIBD 2F68X 4HIHA 1DVQA 1PCXA 4P5TA 4IBYA 1NFAA 1SOKA 2N7BA 1T22A 1TVHB 3DTXB 3AS1A 3NA4A 5AW3B 1JD7A 4MMXA 4H20H 5AQ0A 1KG0A 2AEWA 5CFHA 1RZGB 2W59A 3X1EA 3IVKA 3EBAA 3ECBA 5JW4N 5I5RA 3DV6B 3J07A 4FD0A 4I2XA 2A74B 2J56A 3D39D 4PMFA 3UBXI 3C5JB 3QXVA 4HJ1A 5DQ9B 5HHOA 4BE5A 5ICYB 4HC1A 2VR7A 4GUOA 2MOVA 5SWZD 4JY5H 2Q7AA 2OJZL 1NMCC 12E8H 1TIUA 3MGOA 1OSZA 1R24A 4LVOC 5GZOD 2NSMA 4LF3B 4Y16D 1WA2X 3KMDA 1PZ5B 3JWDC 2GTWB 5GS0C 1MQKH 3EJQA 4H0LC 4F37K 1RFDH 5KSBF 3NABH 1AQKL 4M48L 4JK0D 3BUTA 4WKZA 4PS7A 2JKSA 2VDMH 3IFLH 4J3UA 2ZXBA 3PGDB 4ILDA 2BNQA 4WNQB 3U2JA 4POYA 5I73C 3QUML 5E6IB 4MNQA 2NDFA 1QTSA 3RVVC 2Q7YB 2G0KA 3MPCA 4QT5A 3V9FA 4Z7OF 2W8CA 3ROLB 2P5ED 1BVLB 3VMNA 3UTTE 2X7LA 4LLQA 1PU0A 3FFDB 1TVDA 3BPLB 1NDGA 1V3JA 1WFIA 1Z9NA 1BSIA 3T0ED 4U1GB 5AVXB 1BLIA 2HLAA 2KYIA 4PY8I 4YLBA 3RWIA 1MNNA 4N85A 2GCYB 2WN2A 1OB1A 4DO6A 4A7UA 3DUUB 4NBXB 2LU7A 2QVFB 1FFNA 2MH4A 2OX5A 4PTUA 5C0BE 3VD4A 2KDGA 3QIBA 1RZJL 4LEXH 4X5XA 2ZAHA 4BZ1L 2XNAA 5JXED 5FKPA 4NNPL 1B90A 4L8SC 1G7QB 1R3JA 2G60L 4PJEA 3BN9D 5E5UB 2ZX5A 3GXFA 5C0GB 5ISZA 3EO9H 2AABH 3KVQA 3ALXA 1T1YB 2R1XB 4JHWL 5H94B 3BUYB 1LO4H 5AW6B 5TE7L 2O1AA 1KIQB 4I85A 1NCHA 2OBGA 1XAKA 2Z93B 4KJQD 5IEHB 3D39A 1A7BA 2VLRD 1CD1B 3QP3A 2V17H 3WAKA 3ZT7A 2JLLA 3V8OA 5ANHA 1OAKL 4HGKC 4ZAKD 2Y25A 3ZE0B 4PG2C 4HFWA 3BC9A 1OZUA 1S9VB 3D9AL 1KBWA 3SO3C 3T6VA 1QR1B 5FA3B 4E42B 3PCYA 3LQZB 4FQQA 4PJFF 2GAZB 3RFRA 5HHQB 2R69A 2FX9L 3LIZL 3MOAL 3MUHL 1T66C 5TE6L 3Q1SH 3K71B 2P43B 2YSSA 1YEKL 2OMYB 4KVNL 2OSXA 1J11A 2YPVH 4DHLA 2X05A 5TF1H 2H8PA 4MDRA 5KSAA 5GSRB 4KKCD 5I28A 3DX8A 2G5BA 5ETUA 2ZKYA 1E3XA 2L7EA 3TCXA 1CTNA 3P9LB 5DRNB 5DJAB 4ZNCD 1OAXL 5MP6L 2FECL 2J2ZA 4YSTA 4Z1PA 4GG6F 4M3HA 1M7DA 3QXWA 5BUPA 1NM4A 4WEEA 2O6FA 2N4IA 4NGHH 2WVVB 4JKKA 1EHAA 3T0EA 4HSAC 2P5PA 5I66B 1HTYA 3RDTC 4MZ2A 1UM6L 3FU9A 1XH3B 3RUGB 1MCSA 1ZT4B 1P4BL 4G1EA 5GJSL 2N1TE 1J18A 4XRCB 1KXHA 3N5AA 5DC4B 5DRZB 4YSQA 3C2AH 3WJJC 3DVGB 1HT6A 1IAMA 4KJPD 1M1XB 4IGBD 3GSWA 2OL3L 1URLA 4G8IA 3CUPB 3FF7A 3LV3B 4KK5D 5JXEA 2H0PA 2OR8A 5F96H 2FYVA 2OMVA 2D03H 5LWYL 2XZCL 4P9HL 1LD9A 1DJYA 1ML0A 1PSKH 2XIBA 3OMZA 2KT6A 3UROR 4KRNA 1JZ8A 4HF5H 1FO0A 1MWAL 4G6KH 2FEEL 4XVSL 4NNXB 1AQDA 3L4UA 1D6VH 4G8EB 4Y1AA 5D2LA 3ZZ1A 4QLWA 1Q94A 4CSZA 1KYOJ 1NCBH 4TUJA 3VRIB 3WFHA 4NZTH 4E9WA 3CVIH 3QQ4A 1ASPA 3RWEA 3K8KA 3X1NA 3U82B 2CO1A 4ZAKA 3GS0A 3C2SA 3X17A 3OKEB 4RQQA 1U8JA 4W68A 5JORA 1L3WA 1IAKB 5JPNC 2OK0H 1DUYA 1AE6H 3E3QE 1QATA 3DSNB 3L7FB 2AQTA 2YPKB 3E3QC 4GMTL 4R7DB 3QPKA 4K9EH 2D2OA 4TQ8A 4PJCE 1REIA 2XRAH 2PN5A 4B9CA 1IGCH 5IMOA 1WAAF 2E74C 4Q14A 4I18A 2VXQH 3LEVH 5BQDA 1N64L 4UMGA 1MAMH 1T1XA 2FLMA 2WZPA 4DZ8B 4MRBA 1EFXD 2Y1VA 4CJ1A 2R4RL 4NAMA 3FHQA 4HIHB 4P4RA 4YXKH 2PMZA 3EDJA 4P5TB 4PRHE 5CILH 3U30C 4ENEC 5M7QA 1EJOH 1J9QA 1T22B 1YRKA 1C5BH 3HS9A 4MMXB 5AL0A 5ENWA 1KG0B 1YJDH 2OYKA 4Z6AT 1UYWL 2WCSA 4FFVD 1SY6A 3IVKB 1VEOA 4NWUL 3SHSA 3W5NA 3ECBB 5D7SL 3MC0A 2Q8BL 1MHHA 4YSCA 2LAAA 2DJUA 3FQYA 1KB5L 4HU8A 3WTVA 2LFGA 4I2XB 1TTRA 4AEIL 3K2MC 2J1YA 1T0MA 4QTIL 5K5YA 4LSPL 1VACA 2EINB 5HHOB 4KI5D 1CMOA 4QR7A 3QCUL 2IANA 2NY5L 3ZE2B 1RP8A 4D9RE 5I8KL 1SMDA 4MA7L 4IGBA 1EV2E 2J20A 2D0HA 3CZFA 4X98A 1W2KT 4FMFA 2J5LC 3MGOB 1OSZB 1MCOL 1R24B 3I9GH 2HAZA 3OL2A 4BFFA 1BX2A 1V3LA 1DEEA 2DBJA 2QJDA 3OBAA 4NS0A 5T1KD 4XAKE 5HHMD 1KCUL 3GBNL 2DM3A 3VFSA 3JUYA 1T7ZA 1OD9A 1TO4A 1A02N 1AI1H 3PAVA 3WUWA 4WKZB 1PJWA 4KKZA 1CI5A 2BNQB 4JPKL 3S48A 4WW2F 2RMNA 4BA8A 4LVHB 1TPXB 4MNQB 5CXPA 1SDDA 2FQGA 4Y4KC 4NOFA 4TLKA 2R39A 4QT5B 2VXSH 3N9GL 2KDYA 3SYPA 4Y19D 1HC1A 1QBML 2ZKHH 3OZ9H 1N8ZA 2AJSH 2X7LB 4LLQB 3KDPB 2DQEH 3BIAX 4FABH 5ALCH 1A6VL 3L3KA 1T0PB 4UQCA 1NDGB 5HVHB 4NWTH 2HLAB 1JGUL 5CLXA 2WXOA 3FH5A 3RWIB 4MZIA 5FYKL 2BP3A 3NFSL 4PP1C 1U9KA 4GBXC 1OB1B 5I1KL 4RGMB 3TN0C 5IFHL 3EH2A 1FFNB 4PTUB 2OX5B 3BKMH 1MIML 3ABGA 3QIBB 4X5XB 2FT8A 1QHPA 2V5MA 2XNAB 3KM2A 4PAZA 1JGEA 4ZXBD 5FKPB 1BFTA 4MQ7A 1R3JB 4PJEB 5IJDC 3TURA 4F8LA 3TT1L 1H3VA 2DEWX 5ISZB 5EEXA 3UAFA 4G8FA 3ZKMD 3EDKA 3TJHD 1YEGH 1BZQK 3OHXC 1L3NA 3VA2C 1RUPL 1KCSH 4X5WA 1QYGL 4HW6A 1IFHL 4KTEL 3D39B 2G2PA 3PWLA 4U33A 5FGCE 5KZCD 2J4WL 4TLSA 1LO2L 5B1BB 4ZUUA 4HFWB 2D0FA 3MJGX 3VXRD 3MBWA 5KSBE 3H2WA 2GSIA 1W8EA 4FQJL 4FQQB 1ASOA 3BVTA 2E47A 4FQ2H 3HS8A 2R8SL 2YSSB 2ENJA 4XNXL 5IR1A 2ZPKL 2TSBA 2H8PB 2VR8A 4Z7OE 2D7TL 3W9EA 5KSAB 3VFMA 3DX8B 2LV4A 3PREA 2G5BB 5ETUB 3I2CL 4QHKJ 4E5XA 2WSPA 1K9TA 4PCYA 1FCCA 2J2ZB 4WI5A 4Y19A 1I8LA 5DD5L 1M7DB 4RAVA 3QI9A 4ZOBA 1D2PA 3NIGE 4BWTA 2NY4D 2R7EA 3T0EB 1T7XA 3EGDA 1AO7D 1PPIA 4ZMOA 4B9YA 4MB1A 4ALAH 1O6VA 1XAUA 3IXAA 1CGTA 4G1EB 1K8IA 5EU6E 1PYWA 3QJXA 1V7NH 3BUQA 4PFEA 5FYJH 1MXGA 3WY3A 5K9JL 1IAII 1J1OL 4Y5XA 4IRSD 5D71L 2J21A 1DBJL 3GSWB 1UUNA 3HRPA 4G7YL 3CC5A 4G8IB 5DJ8A 3UJJH 4ZXBA 1NC4D 5BVPL 4PUBL 2OMVB 5KUMA 2DDQL 5DHDA 1LO0L 2V3EA 5KUKA 3BAEH 1R3IL 1LD9B 5CJQH 1DJGA 4TF4A 4D9LL 3QCVL 3CTTA 5IQLA 1FO0B 2LTQB 2N1KA 2DS4A 4Y1AB 1AQDB 5D2LB 4YUEH 3K0YA 1Q94B 3NPZB 4TSBL 5HYQA 2FR4A 3FTYA 1T7WA 2JV6A 3OTTA 4TUJB 1DQML 3F7QA 3WFHB 4DP2X 2OULB 3QQ4B 1VZHA 3LHPL 2ZYRA 3RWEB 1EHLL 5DLLA 5ACMA 4PJFE 4ZAKB 5CINH 5L2KE 1D3CA 5JIIA 4RQQB 1U8JB 2NY1D 4A2EA 5JORB 3CLFL 1DUYB 5TE4L 3UCQA 1I7RA 4L3CA 3RYMA 2CHWA 3MFFA 2QVMA 1BQSA 3CWGA 5BV7B 5IMOB 1IILE 2W94A 2EDEA 4I18B 5IJCC 5E0QA 1KIRA 4MMZC 3I50L 4PVBA 3F85A 1T1XB 3MV9E 4GG6E 2QV2A 1I1AD 3D25A 1A8JH 1BM3H 4P4RB 1CF8L 1UM4H 4GAJH 2IDTA 1L7TL 1ICTA 3UBGA 4XNMA 1QUNA 3P30H 3PWVA 2ZZUT 2YLHA 4PRIA 3ZK0A 3LCYA 1CD9B 5ENWB 4C47A 4W6WB 5TFSL 2XV6B 3AWEA 1MJ8H 2VO5A 1MHHB 3RY6A 3U7AA 3MUY1 1SM3L 4N2FA 1P4IL 4FMVA 2ADJA 1T0MB 1Z6JT 4ONFL 4Y7MA 4LRNL 1K6QL 4W9KC 4AYBA 1VACB 5BCAA 2IANB 2OLDA 1MFDH 2FBJL 3RBGA 4IGBB 3O6FA 3P0VH 3BGFB 3P2BA 2XWBA 1U8IA 3CZFB 4X98B 4Z78A 2WQWA 3EOTH 3KLDA 1CGXA 4FYQA 1N9PA 2K3TA 2BVQA 1BX2B 1VA9A 1DEEB 4XH2A 5IHUH 3P2TA 3VFSB 4PCTA 1FH5H 1KXVC 1CGYA 1E28A 3WUWB 1NGYA 3LZLA 4H20L 5JZ7C 2X2HA 4X2UA 1CB4A 1FFTB 2IV8A 3HFMH 1KBKA 5K39A 2IPUG 2BZCA 4G2AA 5GPRA 1SDDB 4P2OA 2X4TA 2Z31D 2ILLA 3H56A 4UIMA 2OR9H 4DKEH 2DAVA 3UBFA 1USZA 1ET8A 4QTHA 4GW4A 1N8ZB 1G7IA 4Z7WF 3Q13A 3NESA 5DZLA 1WAAE 2ZP8A 4XCYA 12E8L 2F58H 1Z66A 1JWMA 1U8QA 2Y7QA 3L3KB 2NT0A 3B7SA 4N2KA 2EP6A 5FV2A 1LWHA 4TS6A 3WNKA 4G8GD 3CX2A 1DO6A 1MQKL 1RFDL 1I85C 3NABL 3FYIB 4P48A 3SODB 4HJSA 3AJ7A 1MZZA 2VDML 3IFLL 5JOFA 3ARSA 3LQAC 3N44B 2V9QA 1JGEB 3MV01 4MQ7B 5FX3A 2C1OA 1YC8A 4GO8A 2XX0A 1A3QA 4G8FB 4RX4D 2CHZA 2ICCA 4N3TA 3F58H 4P23D 3K81A 5C09E 5J4MA 2Q9OA 5CM1A 4GYBA 4X5WB 2L7QA 3VWJD 3ULVF 2EUXA 2H3KA 3PWLB 1QPXA 2P4AB 1PNCA 2GBAA 2ZKXA 2HYMA 1OCOB 5FDYA 1MIEH 4ZX4A 3QUYD 4ZUUB 1ZY9A 5KVMC 2C4FT 5CU9A 3MBWB 3TO4D 3NN8A 4Y8DC 1HESA 2GSIB 3WNIA 1IQDA 2W60A 3ROOA 4A2LA 5IW6A 4LEXL 2P5WE 4LBEA 4KK9D 2NQ3A 2YJLA 2F53A 4JQXC 4WW2C 3E6HA 3EO9L 2AABL 3RDJA 2P44B 4DGUA 2X89D 3L4CA 5IR1B 4NIYE 4QD2E 4BK5A 3HCVA 4OJDH 1LO4L 3AW5A 4NQXA 3W9EB 4A38A 3VFMB 4MNGE 2VDLB 3NSFA 4TQEH 4G59C 3ESPA 5E8NA 4E5XB 2V0AA 1RJYA 4G9FD 3TZVC 2V17L 5SV4A 4Y19B 1QD0A 2AQRA 3KPTA 4X4MA 4RAVB 3LX9A 2PKDA 3OLIA 1BOYA 3QI9B 3WKYA 3Q01A 2UWEE 4UQ2A 5C0FA 2R7EB 3G04A 3IBOA 4WEBH 3EGDB 4ABQA 3M7FB 3L5XL 1UWGH 3OGOE 3IXAB 3Q1SL 1K8IB 1G0DA 3EKCA 2F6AA 4XN1A 5DMGD 2ED8A 4OD2A 3R7QA 4G9DA 3KS0H 3K7UA 2P7TA 2WQXA 2YPLE 1QABA 2YPVL 1IX2A 4JFSA 4Y5XB 5TF1L 3ZDZB 4YE0A 1QHOA 2DLEA 4YBLC 3SY0A 1T3FA 5DJ8B 3CC5B 5FCSH 3AY4A 4ZXBB 1ETB1 4LLMA 4XB7A 5D7KE 5IQNA 2FX8H 5JOPE 3VFUA 3ETBJ 1G9NC 1MCIA 1CIDA 43CAA 5L4MA 3FMGH 4UAHA 2QGCA 3TA3C 3V10A 4Y5YA 1BBDH 1YMMD 4OH2A 4RX4A 5HI4D 4XHQA 2LR4A 1YO4A 2BY2A 3C8DA 4P23A 3EH4B 2J44A 1TEYA 4NGHL 3Q6FA 2FR4B 1KACB 5HYQB 3VWJA 2RHEA 2N7SA 3F8UB 2RAMA 1OTSD 3GQFA 3S37X 1OD7A 3W9DA 3QUYA 2Z7WA 4OFQA 4PV1C 5ADOH 1MDAA 2RA1A 2WB1A 3C2AL 3U25A 3COOA 3WTXA 3NCJH 3OD3A 2AS5M 4AYID 1I7RB 2F7OA 2X3AA 3L4TA 3ARTA 5FYKU 4L3CB 4Z3TA 3ZO9A 2IOIA 1S7UA 3MFFB 2D03L 4ODWA 4P99A 2O5XH 1LQSR 4R6UA 3GLAA 1G9MH 5E1QA 1VERA 4MZ3A 1PSKL 2ICES 2X89A 3VI4F 1KIRB 1CDUA 4HF5L 3MTRA 4G6KL 2G9KA 1D6VL 5ITFA 3D25B 1UG9A 3EHBC 5HDBF 5IBUB 4XNBA 5J56B 1NCBL 1QX1A 4ABVA 3T6QC 3STZA 4NZTL 2ITDA 3C09B 3CVIL 1QUNB 3PWVB 4KNTA 4PGDA 4PRIB 4XNMB 3UC0H 4LSTH 1N4XH 2OCCB 4ICXA 4QRFA 4OFVA 4DP9X 2OK0L 1AE6L 3CN4A 5DJDA 2DM2A 3BRGC 3AT0A 1AG0A 2X0VA 3EJYC 4I9WE 1KWGA 3CZEA 5F9WB 2DQ6A 2EXWD 4K9EL 4OCNC 3GIZH 1M05A 3O4OB 2ADJB 4PJ8C 5HJGA 2XRAL 4KKQA 5T5NG 2RGSA 1F3DH 3CHSA 1GZPA 1TQTA 1EXUA 4GKNA 2VXQL 3EH3B 3LEVL 2KZ1B 4LPUA 3FQNA 1MAML 4HETA 3O6FB 1JZHA 4NQVA 4Z78B 2XWBB 1U8IB 3QSKB 4JHVA 2ARJQ 2JI1A 4LKXA 3WU1A 2BVQB 4QF1A 1MHEA 2D7NA 2HFGH 2VNCA 3K4DA 4LGPB 4YXKL 4XH2B 5CILL 1HYRC 2V3DA 1NCUA 1EJOL 3VDBA 1E28B 1F41A 1C5BL 1NC2A 2ZXDA 5DO2C 1NGYB 4ZSOE 4QRPA 3HE7D 2HVKA 1YJDL 3KL0A 4PLNC 3QCTH 2DLIA 4C4BA 3DOSA 3E7JA 3U6XA 5K39B 4FXKA 3VFWA 4NZFA 4XXWC 3T0AA 5IOPA 4KJWD 5J0BA 2KLRA 4P2OB 1B9ZA 2X4TB 4ZTPH 4FFYA 4GQRA 4UIMB 4HUWA 1WISA 1IGIH 4QTHB 4GW4B 4LOEA 4A6YH 1G7IB 2YN5A 5H37H 4NQDD 2C9XA 3OXRA 3QXDA 3FRPA 3JWNG 4XCYB 5DR5H 1JWMB 1U8QB 1IRAY 2Y7QB 4YZFF 1LEKA 2Z0UA 3I9GL 2CO7A 1E9PA 2NT1A 3RVWC 4TULH