2KT6A

Structural homology between the c-terminal domain of the papc usher and its plug
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
85
structure length
85
Chain Sequence
b'VLKGKRLFAILRLADGSQPPFGASVTSEKGRELGMVADEGLAWLSGVTPGETLSVNWDGKIQCQVNVPETAISDQQLLLPCTPQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane usher protein papC
molecule tags Transport protein
source organism Escherichia coli
publication title Structural Homology between the C-Terminal Domain of the PapC Usher and Its Plug.
pubmed doi rcsb
total genus 11
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2010-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13953 PapC_C PapC C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2kt6A01
3RFZB 4J3OD 2XETA 2KT6A 3L48A
chains in the Genus database with same CATH superfamily
3LH2H 2DQHL 4FQXB 5ALCL 3FSWA 5GPRA 4BSWB 1AGFA 3BPCA 1JZFA 1I9RH 3SE4C 2R1WB 4K7PX 5IFHL 1XGPB 1MHHB 1MZZA 4QWWC 4OLEA 3UZVB 2FEJA 5C0FB 5L6YL 1L3NA 3Q5TA 5INCA 4KJQC 3LJ3A 5HYIA 3IGAB 4HJIA 4JO8A 2Z93A 1M1XB 3U7YH 1QD0A 4IRZH 3LMJH 1P4BL 2B59B 2Y1ZA 4ENED 1CU4L 2Q0ZX 4P57B 5IGXH 3GK8H 2OW7A 1S9YB 2TRHA 1FJ1B 3O6FC 3QG6B 3HVDA 2V7NB 2AXGA 4FYTA 4OIIH 4Y2NA 4HBQA 1T4WA 3UAEA 2J6EA 3MLPA 1LO2L 1M53A 1S7VB 4WK0B 2X12A 3B7YA 2C34A 3AG3B 3C5ZB 3QUYC 4IIQC 1C1EL 1SXNA 1KDJA 3MV9D 1MCBA 1R5VB 1BXAA 1W8EA 2IBZY 8FABB 1JGUL 3KPLA 2EIJB 2VW7A 3EYOB 4MAYB 2UV3A 1A6VH 1TKWA 1IEHA 3I75A 3PV6B 1OAKL 1AHWA 2E7CA 4JRYE 4R4NC 4XXWA 5E4IA 4QWWD 4TLSA 3X14B 4O2FA 3LSOB 2GBAA 3QNYA 4FXKB 4RCAA 4P2OA 1OF0A 1SMDA 2NY6D 2X87A 1OV8A 3Q9PA 1JRHH 2Q86B 3ELAT 3REVA 1NCUA 4C47A 5ID0B 4IMLA 3D85D 1F1AA 1JHLL 2QTEA 2DPKA 2R51A 4ODWB 1C5BH 2X4OA 3OMZA 4G6KH 4K73A 4ODHL 3AT0A 4DZBB 4KK6D 3K6FA 3NSJA 4U2YA 3TN0A 3D9AL 5DHEA 4TUUA 2ZJSH 3O9WD 4HGWA 2WQRA 4UNIA 2FQDA 4RGNE 5IT2L 2Y07H 1PJWA 4E41E 1FNGA 2C1OA 5C9JB 4WJ5A 2VLKA 1O9ZA 1MJ8H 3ULVD 4GXVL 3DTUB 5HHVH 4JJ5B 4MDIA 4TYUA 1LEKB 2I9LB 3IDMA 1YEJL 2AJXL 1P69B 2EILB 3M1BB 2MKWA 4AQAA 4K3EL 4C83B 3FT0A 2PP7A 3JWNE 3WNOA 2YKLH 4NQXA 4JY6B 3K80A 5T1LD 2IANA 2VDLL 4FE9A 3QJZA 3SCMC 5ICZB 5IB3B 4D3CH 3RDTC 1CBJA 2X4PB 4PY7B 4BHUA 3L95A 3OWEA 5J56B 3VCLB 1XR9B 3FHQA 4NQCB 4WK4B 5BXFB 2BJML 3QHTC 1E4JA 5I5RA 4E68A 4TTGA 5E56A 4N90D 5IWLC 4MCZA 5DJAB 2XG4A 3C5JA 2W81C 1NFDB 4CSPA 3RJQB 4DEPB 1ETB1 3ZDYE 5CZVH 2VLJB 3EJZD 3F04A 5ERWA 5ACLA 2PYFA 3KNBA 2Y3AA 1XSKA 3WEOA 3GK8L 5TF1L 3RBSA 3D2TA 5EZIH 4M6NL 4TUOB 3GM0A 4JPIB 4PB9H 4HS6A 1F11A 3VI4E 1KACB 2WJ7A 1WTGT 3E3QC 4P9HL 1MCRA 4HCRH 3FYEB 1T20A 4OLWL 5FR3A 3FCSA 5I1DB 3V0VB 1URIA 3CN1A 3EF7A 5CLTA 5K9QG 1GIGL 1HQ4B 1LQSR 2LW3A 3IXAA 5GXBB 3SCMA 3CIAA 2WO2B 1MRDH 1NKRA 3MTXA 1CL7I 4WI0A 4OV6F 3NACL 5B38B 5CEZD 4XB8A 1HC1A 2FATH 2X0UA 4OJAA 1WZ1L 1YVLA 1OAYL 5E23A 4HS3A 2DJSA 5DC0A 1H19A 5IWLA 1E4XL 2RH0A 3STZA 4YBLB 3RWHB 3V0IA 1XGYL 2BSTB 5AYUH 3PXLA 1T7ZA 5CKAA 1MIEL 5BW7A 4YHML 1F1GA 5KUKA 3QULB 4IKNA 3U9PH 3N42F 4XNDA 2A4EA 1XXDC 3CMOL 4PV9A 4F57L 4QXVA 3FQUA 4LPYA 1VFAA 5C09A 4M3JA 4Z23A 5DRXB 3SDDD 4YSPA 2COVD 5C0RH 5IMLA 3AG1B 3D25A 1AXIB 3SOBH 3WJJA 1GR7A 1Z5LB 1SVBA 4QMEA 3HHSB 2W9DL 1NUDA 2IGLA 3PDOB 5IW3A 4PRPD 3QNZB 4CVXB 5KVFL 2EDYA 2VDQL 3K0WA 3ARDC 4MAYC 4PJXB 3L4YA 2Z31A 1V7NH 4ZQTA 4N87A 2ZWKA 3KVDD 3RVWD 4ZRGA 1E7UA 5E99H 2D0GA 3SQRA 4UQ3A 5B1AB 5CIPA 1Z9NA 1ZT7B 3EGDB 4UOW0 1EBAA 1QTYT 2EH8L 1EJOH 1XGUA 3IFOA 2CXKA 4I9WE 1XCTA 3VFGH 4PJXA 1UD5A 4GP8B 3LZQA 3RFZA 4F24A 2A74A 1OEZW 1TTCA 1OWWA 4KMTH 3EOTL 4LLVA 2QHRH 3GHEL 1WPCA 4NEHB 3VI3B 1ZD6A 2WYHA 4K94L 2IAMB 3V0WH 4AM0A 4Q2ZB 3DUHA 5I75B 2IWKA 1KLUA 3MCG1 4MD5B 5EIQA 3I3EA 3MU3A 1H6FA 2Y4SA 4OY9A 15C8H 4QHNB 1OLLA 4HS8L 4F5CA 2JELL 4KJPC 4LCIH 4X6DE 3TO4C 3AACA 4YHPB 3ESUF 4P04A 4Y2DD 3K7UA 1JTTA 1WZMA 3FCTB 1NC4B 5B39B 1P5UB 1EDHA 2QMKA 2Z9TA 3WN5B 4O2CB 2A9DA 3LX9A 4F7CB 4HZAA 3RVWC 4QPEA 2DYSB 1IC4H 2WQAA 2GJ6D 3I2CH 4B27A 4F7KA 2ZOKA 2G9KA 2R2CA 3H4FA 2HTKC 4J3OG 4JRFA 4UV4L 5C07D 4N6RB 3DWTA 4RBPK 5HHVL 5LAXA 1UC6A 3ZDXF 2R7EB 5D7LB 1CFBA 2R0WL 5IROD 5EF3A 1PLBA 2AJYL 4MNHB 3T0VA 2P52A 4TVPL 3GBNL 4V1DB 5E5RB 3QRGH 2XNAA 3AABA 3IMSA 1T20B 2ARWA 2BO0A 3MUGA 1PQZA 2LABA 3Q6FA 1FLTX 2O5ZH 4JRWA 4XR8C 5GJTL 3T0EC 4H5SB 1QP1A 4R4ND 5DDHA 4BXSV 4XH2A 4Z3IA 5KSAA 4A63A 1JF6A 5F89B 1YMME 3NZSA 3PHOB 3BYTA 4RH4A 2XXGA 3B7RL 3VE0B 4ZPTA 4AG4L 5E2VH 1MCCA 3GXIA 2NSQA 1BOGB 2XWDA 4LIQE 3G08B 3U4AA 5FK9A 3A47A 3N41B 3DIFA 2WP3O 3SPVA 3BPNC 1FZMA 2BS8A 4KTYA 1TFPA 1B4JL 1T5KA 5MEQB 3CDZA 4BQBA 1Z6JT 2KZ1B 4W9DC 2VSDA 5HI4D 5C0DA 3CWGA 2UXGA 5DJDA 1EZLA 1RJLB 3T8XB 1EZUA 1E50A 2GK0B 4IOFD 1SUHA 3WNLA 4G8GE 4X80L 1YZZA 1M7IB 4LEOB 4W6XB 3UBXG 1HE7A 2Q9OA 2WIMA 4KITB 1ZE3H 2Y06H 3V4VL 2YSSA 1MW0A 4WO4B 3J7HA 4X6CB 5EO9B 4MB3A 2VABA 4ZNEA 1FBIL 3FU7A 4LCVA 3NSDA 4HS3B 2E6JA 1JF5A 1A7QH 5KSVB 4OI8A 4HIQA 1XF1A 1BFOB 3MNMA 5G5DA 3RNKB 5BRPA 1KT2A 4YX2L 3IJYA 2IV9A 3MNWA 3D0VB 3NFNB 3VUAA 2QL1A 1UB6A 2NMSA 5ICXA 3FCGA 5TE7H 1CLOL 2AXFA 3TF7C 4KVCH 2WBWB 4LSPL 5DD0H 1ULVA 3MCKA 3MCKB 2VCOA 4M1GH 3TONA 2FHFA 3LDBC 1NAMA 2VKWA 3VG9B 5I76B 3A24A 4RMTA 4LCUA 3WKYA 2JH2A 4TOYL 3ZE1B 5IBLC 2CJSA 4NUGH 1X5LA 2VDPB 4BSJA 4Y4HB 2HA1A 5IHUL 3PHQB 2DQEL 1MCPH 2YGNA 3OD3A 4PTTA 4DP4X 1QW9A 1HINH 2CO2A 4KVNL 4F7EB 5H37A 1KCKA 2AGJL 5EIIB 4OZIA 5MI0C 2BHZA 4JW3A 4WW2A 5GSVA 2QGBA 2YD7A 3GEWB 5BCAA 1WWCA 1XQ4A 1ZT1B 2I69A 4U33A 1CFQB 2EDEA 2VH5L 4Y4HA 3X1FA 5HGAA 1YJDH 1QABA 3BDYH 5GS0H 1MG3C 1TMCB 4UB0H 4TUJA 4OF7A 4F7TB 3EGXA 1KJMA 2V9TA 2XWXA 2PW2A 1CB4A 1ZTXH 1MHPL 1A9BA 2NY0B 3BCDA 4MBRA 5EZJB 1FSKB 4LSUH 4P57A 3QDJD 4PJ8D 1DVUA 4AIZB 4PB0L 1JGDA 1LO5B 1KENH 3M07A 2NT1A 2WCGA 4PBXA 3ARBD 3LS4H 3RWCA 3THML 3HI1A 4OCMC 4N2OA 4N24A 4IU2B 4YXLL 3CCHA 5D7JA 1RP8A 3QNXA 4GS7B 5T1JA 3HC4H 5EOQH 5DUMH 4EZMA 4PGCB 3RX8A 1UYWL 3G5YB 5C08B 3AMLA 3GJFH 4HVBA 1IE5A 3TN0B 4BQCA 2MNWA 2DMCA 3M6DA 2FT6A 3ZQ9A 4FYQA 5IFJA 4QRPB 3UTPE 2OYMA 1PNCA 3WS3B 2V8MA 4LSSL 5M95B 2NY6B 1IKNC 2XVBA 2ZUQC 5CD3B 1G0XA 3VXMA 2OMTB 4U31A 4CA4A 3OZLA 1F3DJ 1IGCL 3ZKMC 2V8LA 1YQ2A 1ONQB 3DSFH 3QNYB 3VMPA 4B9GA 4AT6B 1CE6B 4ZUVA 3GUTA 3D12B 4HXBL 2K6YA 4YVUA 1BEYL 2MPAH 2VNCA 4KTDL 3LIZL 5CEZH 1ESOA 3FTGB 1P5UA 1NOFA 4JDEB 3WN5A 3MV9B 1LP9E 5FUOL 5HJGA 1GCYA 2Z4QB 3D05A 3WS3A 1KXVC 1GYWA 1N67A 2JJTA 4HUUA 3VGDA 1NANH 5MEPA 2L7UA 4DGVL 4XP6H 2PCPB 5C0EA 1NGPH 3UEZA 4O58H 3HZKB 1ODAA 4YHIA 1YY8A 3ROOA 4MWFA 3X12A 1JV2B 3DLQR 3FH5A 1KIQA 3GMPB 5J6GB 3MCLL 5A2BA 2VGLM 1CLVA 4J3WA 1V54B 4DUWA 2P5WA 1YEEL 4N2IA 1FHGA 1SHSA 1NGPL 2B2XH 1HH6B 1NCIA 4FJ6A 3ORJA 4WENB 1BFVL 3U6XS 3PHOA 3VI4F 3OR7B 1J7VR 3O41A 2HMIC 3ZKMD 1N2RB 3T04D 4X4XB 3UGEA 2R27A 4AKQA 2H1PH 1CFVL 1V55B 4HXAH 3MJ7A 4Z0BH 1M2VB 4BKLB 4A2HA 4KXZI 3H7BA 2KT6A 2VRQA 4HKJA 5DFVD 3MRBB 3HNSL 2DWTA 2OCJA 1TVDA 5LCVA 4AI7A 5ICZA 3MRPA 2ODIA 3HFMH 1DTUA 3T3MB 3X11B 3MLRL 3MRKA 5I16A 4JRXD 5ABDE 1KXQE 3BH4A 3GMLA 3T09A 2P80D 1SUJA 5HVGB 4FLHA 5EU6E 2A0LD 5EN2B 1BREA 2BMKB 1EIBA 2W07A 5EU7C 1L6PA 4AMKH 1UENA 2EXYD 4YPGA 1A7PH 3SOBL 3EFFA 1VZHA 2VDOH 5DRNA 1XIWD 2GFBB 4F7EA 2ATKB 3A4EA 4ZX6A 7CGTA 5DJ2A 1DJYA 1FFOA 1VF5C 5CN3A 5DEFA 5CD5C 1OE2A 3ARQA 3TNNA 4GI8A 2PPCA 4LLYB 1U3ZA 4PBVC 1OALA 5F6HI 3U9PL 4KXDA 4BYHA 2ENQA 4ZUWA 3NJNA 2HG0A 4XCNA 1IM3B 3L5WB 2DJMA 3NTCH 1F2XK 3AXHA 5E1AB 1S9VB 4HU8A 4QOKB 4X6DB 4KY2A 3KS0H 4JKPH 1NTDA 4B6ZA 4YHKH 4UMGA 1S7QA 3X3GH 2IBZX 1KJVB 2MQ0A 3B83A 1EAPA 1AZBA 2V5SA 3O4LE 4CADA 2FLMA 3AQXA 4G3YL 4AEFA 3VDAA 3PCYA 2E75C 2YIHA 5E94A 5E70A 2I32A 5DLLA 3QUML 2VDOB 3B9DA 1S2EA 4BK8A 1KG0B 2F61A 4M7JL 3V95A 2K4AA 3DXAD 3C6LD 4K23H 2A6DA 2FNBA 3LIZA 3O2DH 1I7TB 1SOKA 4I8DA 2DQJL 5ETUA 1FIGH 1KIPB 1FP5A 2WSKA 4ABQA 1QHOA 1XF4B 1T2QH 3F5WA 1HXMB 3WE6B 4A7VA 4P4KB 2F19L 2FEEI 5AZEL 1WD9A 4NQEE 1F56A 2GBTA 3VA6A 5JHMA 3HG1A 1JVLA 5AOKA 2WN3A 2V17L 1AQ8A 2ICWJ 1CGWA 2ZYSA 1QWUA 3O45B 4TMPA 3ARRA 4NO5A 3OB0H 1CVSC 5B4MC 1NCBL 1BF5A 3MFFA 4I0KA 5GRJH 3K5RA 2DWEB 2Z8VC 1YJDL 3CVHA 2NW2B 3MUY1 4X4MA 3WLWD 1U92B 3X13B 3ABMB 4CVUA 5ESVB 5GQBA 1ZGLA 3T6XA 4NM8H 3QC5X 4KDTA 3F6IA 3WJMB 3UZEA 1PY9A 1HS6A 2KH2B 2NLJB 1R4XA 3GWJA 1RD6A 2BOCA 4GBXA 3QO0A 3IGKA 1TU2B 3KPQB 1SJMA 5FGCB 1JXDA 3CTTA 4M7ZB 5MP6L 3BGAA 2WWNA 3H42L 5FXCH 3QE5A 3CH8A 4G7YH 5FUCC 1OF2B 1TVHA 3K2IA 5SX4I 2VB5A 3FQ1A 4FXTA 3FSVA 3MBXH 1RHHB 2VDPL 4FQQA 5DWPA 4GXUM 4AMXA 1JPGA 3DX7A 1FC2D 1GSMA 2AJSH 2AJ3A 3L1FA 5L7XH 1DBJH 1AH1A 1IAIL 5TDNA 4RX4D 2ALWA 2LU5A 4GQ9H 4TQHA 4BKTC 5AKRA 4UTBL 2X4PA 1HCZA 3ATDA 5I16B 1FUNA 1YMMD 4UU9A 1T66C 4MD0A 3SJVD 3AW5A 3OL2A 4RMQA 5DT1L 3TC9A 3IU4L 4HJJL 1TZGL 1KZYA 3OR6A 4C54A 5I66B 2BCKA 3GLAA 2FX7L 3UBXA 2IBBA 2XZQL 3BP6A 3I9IA 4YEFA 4G8FB 1DSWA 4PI0A 5C6TH 4M4RB 5E8PB 5F3BA 2GC4C 2X3CA 4LKXB 4XOBA 5CR8A 1L7IH 1OT1A 3Q44A 1HN1A 4H26A 4QAMB 2I5YH 3HN3A 2IANB 4FJYA 3GPEA 4ZDHB 1V7MH 4JMNA 3VRIB 3SDCC 3X1GA 4BUQA 4TV3A 2GC7C 3VU1A 1XIWB 1I8MA 2XRAH 5IKCB 2CJUL 4X83A 4JY5L 5I9QB 2QDVA 4MS6A 5F9JB 4QRRB 3DC0A 4XE5B 5F0JB 5F93C 4NFCA 3BEVA 5JA9A 1HXYA 1A1OB 4RWHA 1CK0L 5EBWB 1MHHA 3NSCA 3T6QC 2CHNA 1Q72L 3HB3B 4DUXA 1A7PL 3B5TA 3G04A 4LIQL 1AKJB 3AS0A 3TTYA 5ID1A 1TYJA 2UZXA 4GAJL 3LTVA 4JM2B 3FQNA 3OXSB 3D25B 2YRLA 1A65A 4YPGB 4B3VA 3GJFK 4U0QB 2RA1A 2BSTA 4UT7L 3RWHA 1FPTH 2ZOOA 1MI5A 4AZUA 1I53A 3C08H 1S9XB 4HG4J 2ZX7A 2AK4B 4PLOB 3MLWL 4PV9B 3SKNA 3BIBX 3O0RH 5SWSB 1E65A 4Z6AT 4JRYB 3KPLB 5C09D 2PW1A 3E1ZA 1XH1A 5LBSH 3SYAA 4HIEB 3GJFB 4WW1A 2NRDA 1U95A 2DBJA 3CQFA 4ELKB 4KH9A 4MA8H 3D18B 3QJVB 2XQ0A 4IBYA 2HFGL 3K2MC 4PJ7A 1OGAB 3ES6A 3PUCA 4KUZL 2ZXAA 4CGUB 3IGUA 3MJ6A 5C0FA 3BIKB 4XVJH 2X28A 1BLIA 5DHVB 3G5XA 1S7TA 3QIUD 5HGHB 3ETBF 2CDEB 3LQZA 3PL6D 1FLRH 3PQYA 1MHEA 4F33A 2R2HB 4DW2L 4P8QA 5DMGC 1A7NL 3FRUA 3W5NA 4XPAL 3ARUA 4XN5A 2VISB 1Y6MR 1SOXA 5T1KA 2R1YA 1JK8A 2ZXBA 5IF0B 2VDQH 4WFGD 4OCWH 1A6ZB 2B1HH 1XWVA 2H0FA 3MRRA 3S35L 3ZY7A 1MQ8A 3VFVB 4H20H 4TNVK 1R5WB 2ZNWA 3AT9A 4K55A 1N59B 3DX0A 5C08D 2M26A 2QVKA 4HCRA 2HLEB 2QZ5A 5T5NF 5EORL 8CGTA 3DGGA 3KJ4C 3MC0A 4PJEB 4AQAB 4NN5B 5E95B 5C9KA 2X1XR 2G3XA 4D9QE 1T1YA 2R2EA 1WWWX 4QI3A 2VERA 4OLVL 2DWYA 2HT2C 3K91A 1RLWA 5E5MA 2Q6WA 3RWIB 1UM5L 3EJCA 4CGTA 4OM0H 4G6FB 5I8KH 3MA9H 3ZKQD 4P2RE 2X4QB 3ZYIA 3C8HA 1W6LA 2NZIA 2VXVL 2F5BH 3Q05A 1JS4A 4NSKA 5D1XA 4XCFH 4K3HA 3FJTA 5AW9B 4H44C 2OL3B 1GHFL 2ZXQA 4LSQH 4XMKH 3TIEB 1Q90A 2YKKA 4UZSA 2OW6A 3RX5A 5K9KA 2ZAIA 4KROB 3UTTE 4BUHA 5KYWB 3LD8C 4JR9H 1G5GA 1WRFA 1KGWA 5BQ7B 2IH3B 2C3WA 1ASPA 3TEXA 1HOCB 3E9TA 3MNWB 5ABZA 3CK0H 1M7DB 2F53D 1N19A 1TYEB 3ZKSD 2D2OA 4PMEA 4NWTL 3GSRA 3PWNA 4J3SA 3PABB 4AEHL 2OQJA 4XN1A 3OJ2C 4W9CC 1QMUA 1YYCA 3OMNB 4IMKC 3KWTA 1LD9A 4GXFA 4WO4A 3VJ6A 4DPRA 3FTYA 5J13B 4N9OB 4GXVH 4PG9B 3WLWC 5A3IC 4NNXB 3RIAF 1A6UH 1NMBH 4Z78B 5JHDE 1IGFH 3FQTA 4L4VE 5BRQA 4DN4L 1G9MH 5ACZB 1BSIA 3Q1SL 5D5MF 5DJDB 3L2LA 3LKSB 1CD1B 3X17A 5MENE 1LP9B 3HG1E 4N5UA 4ZPTB 2CJUH 4YGVB 1DLFL 4UTBH 1B0GA 4JFTA 3IU3A 1NCJA 3LKRA 4GP5B 3U0WH 3ML8A 1I1CA 1A25A 2H41A 2A6JB 2Q7NA 1HI6A 1B2YA 4LLQA 1KIUB 1KCRH 2BXYA 1U8OB 2W65B 2L3BA 4JZJB 5FUCE 5IK3A 5ESAA 5C6TL 3LRSA 3NESA 1HILA 1WCBB 4PJGE 5FO8A 3IJYB 4NAJA 4UT6A 4WLCA 5DEJA 5DI8A 1A1NA 2ZWZA 4PGEA 3Q9QA 1U8PA 2BRQA 1SDDA 5HHOB 1MVUA 5E2TL 1FL6B 4WGVB 5FYJH 3J27A 3IE9A 4Y2OB 2R2BA 1MHCA 4CVZB 4GRLB 2NNCA 5B8CA 4X4YA 1YEGH 2ZPKH 2CO7A 5K59F 3O3AA 1WAEA 2F9BT 2PWHA 2WK2A 1P7QA 3QEUB 3N50A 1H3WM 4EOWH 3FO2A 4ACTA 5FA4B 5IQ9B 2CQVA 4I2XE 2O26U 3WHXB 2P48B 2PPDA 2WXPA 5DHYB 5KYUB 2WINB 1RSYA 5HPMB 2H3KA 1I3UA 3G6JA 2WXFA 3SDCD 5DJCA 4I3RH 2Z35A 3FUKA 4CJ0A 4LHUB 2OSXA 3QNFA 1SQ2N 4AM0B 5HJ3A 1N6VA 4N0FA 4ZUTA 5M7QA 4KZDL 3TV8A 2EKSA 1IAKA 4N8CL 2J72A 3BOVA 3KPMB 1MVYA 4OZ4A 5ADPL 1M4KA 5IFHH 1PZUB 3SBWA 4D9LH 1RIUL 3DO7B 3GLDA 3MROB 3SKMA 4F9LC 4K8RH 2ZX9A 3ISRA 4H1LA 4W9IC 4CN6A 2E9IA 4OIIL 3ZPDA 4KVNH 3DI3B 3QHFH 4Q2ZA 5EH1A 4PHXA 4PJ9D 3BW9A 3U7YL 4YLBA 1Q9LA 3F12A 4NYLA 4DZ8A 4UAOC 2DTSA 3FRPA 5E51A 1WS7A 3KYNA 4WJKB 3VVVA 3FH7A 1DLHB 4H1LH 5ENWA 4PJ7F 3HAEH 3IDUA 3D2UD 5D1QD 5BVPL 1JGVL 1HCFX 3V0WL 3FUFA 4A38A 2G5UA 2VLLB 3A0OA 3KCPB 4WJG3 1U3HB 3HLKA 3PS6A 1W72A 4R8WH 5ISZD 1QAWA 3U30B 1AGEB 5IY5B 2O1AA 5TE4H 1SLWA 1XF5B 2D9CA 2GT9B 4PJGB 5AENA 3V6ZA 2DMGA 1XL4A 3ET9F 4AXWA 3GSVA 1BZEA 1QBML 3F2LA 4FFVC 4X8JA 1C08B 4IRSA 5T3XH 5C71A 1P7BA 4ONHB 1LNUB 1MJUH 1RK1A 3NK3A 4PJHF 2A4CA 4UOW1 4DZBA 3VQMA 1W72H 3DUUB 1H3UA 2JTDA 4E9TA 2BP8B 5MP6H 4ORGA 4XCFL 3OKNB 4I9WD 4KMTL 4QXGL 1RIHL 3VNYA 2EXYC 3ARPA 2JJSC 4GKOA 4I2XB 3NPSC 4XMLL 5EBLB 5E6IC 1TQBB 2A9MH 5SWQA 4ETYA 2J12B 2GEEA 5EDXA 4JK0D 3MLYL 3KBHE 3RWJB 4ANVA 3QDGA 2DIBA 4U6YB 4P23A 3TVMC 1LLAA 3O2WH 4IOSA 2ZAGA 3SJVB 1UD4A 4YLCA 2YEQA 1E28A 5DJ6B 2VL4A 3ABKB 4PBDA 2J5WA 2K3TA 4KFZC 5I6KA 2AEIT 1PY4A 1K4CB 1NFDE 3BAXA 3DTDA 3QUXD 4IBWA 4RWYH 5CINL 4XI5C 1P84K 3UZEC 3AT8A 4Q52A 3GUFA 4ILDA 5TK2A 5HYFA 1SNRA 1A3LH 1CT8A 1LWHA 2XZCL 4NM4L 4JN1L 3C6LB 2GSIA 1HILB 1MRFL 4FTVE 5BV7C 1XX9C 5HHME 2ESVB 2HVKB 1IM9B 2G4GA 3QUHA 3D4GA 3D52A 5EUKB 3ILQD 2WAQA 1ZHLA 3BHBA 3P2TA 1IGYA 3EYSL 4JN2A 3VWKC 4MCZB 2OI9C 1HIML 4G7VH 5ANMB 5JOEA 3W37A 3MRFB 2VR5A 3SE8H 1WCBA 5FO8B 4ZS6C 2JB5H 1BZ9B 3KYMA 2BNRB 4HH8A 2W91A 1DL7L 1MWOA 2EP6A 2P8MB 4LQFL 3S34H 1TYRA 4FQCH 2J1KA 3UIZA 3MV7A 5AYQA 3S2AA 4B3EA 3WY4A 1T5WA 4GLRH 2ICEA 2FX9H 3BVNA 4Y4FC 4QJ4B 3WTTA 3NACH 4QRTB 1ETZA 3HZ3A 4HIIB 2B15A 3M17B 1ZY9A 3ZZSA 4OM0L 3LKSA 4MA3A 3VFUA 3O4OC 3KPSA 4PVMA 5D7IF 2XN9A 4LL9A 4JJOA 2CO4A 1GJWA 5D2LB 1MCJA 2ZCKH 3MV11 2FD6L 4LSQL 2H26B 2BOBB 3ESMA 1QPKA 5GZOC 1OTSC 4PJDB 2G0LA 4FF9A 1CFTA 3KVPA 2EUZA 1X7SA 4NIYE 3RB5A 3QEGL 2B77A 3TURA 3TYFA 1ML0A 3SN6N 5ICYA 5CNHA 4F8LA 3K46A 1TJHL 2JLPA 2VT0A 5AL0A 1V05A 5IJBC 5D96C 3BPLC 4ZXBB 4ZUUB 3TTSA 4U05A 4MCYA 4LHQB 5FO9B 1D9KD 2YXVA 3LQAL 1G9HA 4ICXA 5DMJB 1XBDA 3BQVA 5FV2A 2VMFA 5AWNH 4U1GB 2Q76A 5HJBA 2IPUG 4ODVL 5IB5B 4AYID 3RZCD 2OJZH 4KY1L 3MREB 4PP1D 4JS7A 3FUJA 2JCCE 4TNVF 4X7FC 2V5YA 4M8VA 2B9BA 2J25A 3LSOA 3MV01 1S7VA 4ZNEE 2V2WB 5DVMA 5TGBB 2X9ZA 2EZ0D 5GRWA 1DEEB 1GY1A 1A2YA 1NBCA 2G2NA 4PCKA 1SLXA 3BESR 4KMQA 2WLLA 5JQIB 3QIBC 1KXQA 1VA9A 5HHXH 4OLUH 4LCWA 5AW5B 3WOVA 3FO9A 3GXNA 5C0AD 4D8PA 2X9YA 1WHPA 2D4DA 5PCYA 1YEWA 2B59A 3F01A 1BCIA 1F0LA 4NO3B 3ZU8A 2QSVA 2Y2WA 4OJEH 2XN0A 3DROA 3R8BB 3BRFA 3QG6A 4Z77A 1UH4A 2CLZA 5DD1H 5I73C 3TJEL 5IF0A 2R9HC 3C8DA 3ZTEA 3DJSA 2YC1A 3QQXA 1RV6X 1KTLB 4NNYA 2VR9A 3TM6A 3QS2A 4YC2C 2XKUA 1R5WA 4AVKA 3L08A 3W1ZA 1YYLL 4DKEH 3C5SB 3WCYA 2YXFA 4FNSA 1Z3RA 3RGBA 4LNVA 1RZKL 2XPYA 2X9XA 1CLOH 1UCBL 3CSFA 4K3EH 3REVB 4PJIB 3S96A 3WN5C 1H5BB 2FGWH 5K5YA 2AKRB 3ZK0A 3TX4A 3MRLA 1W8OA 1IGML 5T3ZE 1KB5B 4E5XG 1WVZA 1MH5B 5C07E 3TBYA 3MXWH 4GG6F 1CXEA 4AGOA 4ZQKB 1N0LA 5DHMC 1JSYA 5E1GA 2ZG1A 2WKOA 5I1IH 2YFNA 5L9DL 5EU4A 4ELMB 3O4OB 3TV3L 4MLIA 5SWZB 3DV6B 1FVEA 3IWVA 5CAYB 2JJVA 4FL4C 3O2WL 2VM9A 1K4CA 2GBVA 3TBSB 5EU5B 2JQAA 2H0JA 3IWUA 5CSZB 3HNTL 1J9RA 3OWRA 5FGBA 5KVDE 4M6MH 3I6KA 3SJVA 2JTYA 1KLGA 4AYFA 3F62A 3VGGA 3QUXC 3MYJA 2ROYA 5FYLH 3VMNA 1TSRA 4JY5H 1P1VA 2PO6B 1H9DA 3QHFL 4OD2B 4YXKL 3D39D 4TSCH 3MXVL 1U8HA 1MHPH 5KS9F 3P0VH 3IDIA 2F8OA 3WXWH 3T0ED 1K8IA 4OQ1A 4PJBE 2ZPKL 1JWMB 4X0KA 1DLFH 2PTTB 2VM4A 5JOPD 4Q74A 4WI4A 2BK8A 2A9AA 3SGDI 4KKNA 5T1DH 4H8WL 2YEZA 2NQDA 4L8BB 4XB3A 5TFSH 3WEMA 2QGDA 5JPNA 3O8XB 3BKYL 2LLLA 2WLZA 1P1ZA 3GZPA 1HHGA 2VLRD 3WV0A 4EI6A 1J0YA 2GTQA 3HG4A 4OGYL 1SOSA 3R0MA 2Q8AL 3VTTA 5KG9A 1B9KA 1YNLH 2YEZB 1I8MB 1Z1WA 4XBGB 4KRNA 2PCFB 3CQQA 5CWSA 4XX1G 1O9WA 2CLVA 5E6IB 5B4MD 1T1WB 1BQSA 3GBNH 5I28A 3I6SA 5C0AA 2J73A 2O61A 2V2WA 1ZA3A 4WV1B 1WC7B 4GJTB 1D9KB 2E56A 5LNDA 1X4XA 2WXNA 3U79A 2IH1A 1JNNH 1X5IA 2I27N 1JVKA 2FK9A 2LLGA 2ZWYA 2FBJH 3OGCA 4DKAA 3MLUL 5D71H 1T83C 4ZD3H 1PJ9A 3MV9E 4I3RL 4X9IA 2EKSB 1HXKA 4I77L 3TO4A 1WIOA 4L23A 3U0PB 1JFQH 3EFDL 4NRZB 2KS0A 1T0NA 3ZMRA 5HHPA 1QSFB 3A6BL 4R0LA 2EVHA 1GPOL 5HY9A 3WKQA 1Q0YL 3D3VA 3MLVL 1U0QA 2VXQA 3QXTA 5BMFL 1CU4H 2RAMA 3NCBB 5HPMA 1EERB 1G9ML 1EZSA 5LBGA 1OM9A 1IAOA 1CFTB 2BIQA 4K23L 4G83A 4Y4FD 3T4AA 5ESVA 1ZGLB 4DTGL 3DPBB 4XWGH 1JNLL 2BIMA 2EIBA 3QEHA 5K9OB 3RU8L 4GLRI 3TFBA 2GSGB 4U6TA 2X5PA 1KB5A 3EYSH 3VVWA 5EBMB 1PNDA 2JLLA 4RGND 4KRMB 4L5FH 2ZCHH 3UDWA 4N0RA 1OTSD 4U0RB 1LK3L 4UT9L 1DP0A 1EH9A 4P2OC 4QY8A 4YFDB 2JKIS 4PCTA 1WBYB 5LB1A 1S5IL 2ZUYA 3UTZA 4PJIE 1JMXA 3S0PA 4QNPE 3ULUD 5I8KL 5JQ6H 1DN0B 3TBTB 2B08A 2Y6SD 4LARH 4F8OA 1KN4H 1NLDL 5FPIA 3IM1A 5C07B 2WQXA 1HX0A 2ERJC 3P73A 4NAQA 4XCEA 2HKHH 4X0NA 2WXHA 3MRMB 3L9RB 4FQHB 4UT6H 5HHQA 2Z0UA 5I71C 4DF9A 4PBWD 2I9LA 1G6VK 2DLIA 1UXWB 4PJ5A 2AEQL 2GQHA 1S8DA 5F7WC 2ZP8A 3GHBL 5D1QB 3Q2WA 3QARA 3L3OC 3RY5A 2OZNA 5ACZA 4P46A 3N55A 4EN3C 2ITCA 3ARZA 2GJPA 3LIZH 2YPLE 3CDGB 4G8IA 3CFJA 2IAND 4W4NA 2ZT9C 1U8LB 1GZPB 3I6GA 4APXB 4UBDD 4WI5A 2BVOA 1IBDA 3GXPA 2WM0A 3TT1L 4RETB 4NQDA 3MODL 4HALA 3RTQB 1U91B 4N8VG 4MXVF 2PABA 2E74C 3AREA 1NMCB 3D3VE 2X09A 1NMAH 3BAYA 3VFSB 1FFNA 2VLKD 2AAAA 3L6FA 2KL6A 5C0NC 1CUOA 1NC2B 3G5VA 4Z7OF 4G7SB 4PIRF 1JXKA 4JKMA 1HHKA 2EIZA 3EHBD 3QJRB 3QS3A 3O9WA 5HVFB 2P5WD 1HCVA 3RYMA 3UPCA 3PDGA 4P3CL 3EW3B 1PZ5B 2AV1A 1E8ZA 4NPYA 3HMWL 5CU5A 3US9A 5TDPB 1S3KL 4LHUD 4WRLA 3WSQL 5D6DC 4WWNA 5E1AA 1BG1A 4XNQA 4FABL 2GJZA 4L0PB 1LE9B 2HH0H 4P23D 3K6OA 4HU2A 4POUB 2W07B 2BCMA 1BD2E 1CICC 1P5VA 2GUOB 4Z0BL 2C4XA 2VQTA 4Z95H 1R3IL 5JPNB 5KYUA 4UV7L 2H9GA 5EZIL 4NRYA 1BVLB 1U3HD 2C9AA 5TE4L 3NJLA 3HNVL 4TVSa 4Z7AA 1UWYA 1Q1PA 5J13C 2E9WA 4Y5VB 1D5XA 4G1MB 2DOCA 4EO5A 3FFDB 1KGYE 4LSVH 2BS71 4UYPA 4BE6A 1P1ZB 2VRAA 2PYEE 4RGOL 2HZHA 1NFIB 2IMNA 25C8L 4WU7A 3FTUA 1OAUH 4Y7MA 3V5HB 5HDBF 4Y1AB 3FL7A 5K33A 1NDGA 3BUTA 1PX3A 3EO1A 1OT2A 1Y7VA 2NYKA 1SY6L 3C60B 5C0CD 4JVUA 3UERA 1I1YA 4HDIB 2XWBA 1RUKH 2XTJE 2QVTA 5I1LA 1KXVA 1NGXB 2YO3A 3OB0K 3QQ3B 2KC0A 4JQIL 3ZDZF 3VXTB 4JDTH 1PKOA 4LBEB 3MJ7B 2WVSA 3D39E 3FT2A 4XP6L 3JQOB 4YDJA 5GISH 2V3DA 1FPTL 1S7TB 3FU6A 4PJAB 5HGHA 1KWKA 3NN8B 3GIVB 5TQ0L 3R19A 1NCNA 4UT9A 1CDYA 3P77B 4HSCX 4YR6B 1JK8B 2N01B 3TU6A 1FGNH 4U7SA 4GKSB 1TQUA 4ISVB 3EGSB 2VISA 2VAAA 3OC8A 4LCCA 1B0RB 1NUFA 3ULUH 2VLME 3HC0B 3KPMA 2VH5H 1CK0H 1PCSA 1NCWL 4M00A 1HL9A 4EQ3A 3VG0L 3ARYA 4PRPB 2H4EA 1A02N 3T9WA 1YSOA 2LQRA 3NAAH 3ARGD 1N3NB 3QG7H 4L3EB 5FGSA 4XXCA 1AG6A 1ZTXL 1YYMH 2VLRE 3EDDA 3M45A 4JO3H 2H6PB 3HE7B 1TZAA 4XCCH 3GMOB 2DYPA 5KSBE 4JRYA 5SX5H 5DURD 4JDEA 5AD0A 2CDFB 3JSSA 4WWPA 4YSDA 2WWMC 4P9HC 2X44D 1O6TA 4I2XA 2JK5B 5EU6A 3HCVA 2E7HA 2LFEA 3QIWB 3DHUA 1PKQE 1H15A 2P5EB 4MMXB 5FX3A 4GKNA 3VXMB 4FRWA 3DROB 5LG6A 4G71B 2P4AB 4EI5A 1G4MA 3IETB 4X8JB 5JIPA 3DX9B 2X53A 1FZOA 3BXNA 1SXZA 4L1SA 1SJEB 1KTLA 3UC0H 1AQDA 2FLRT 1JPST 5LBSA 5I6XB 4JFOA 5DZVA 3KPRB 5IB4B 4X7TA 4RGMC 4PRIA 3T6ZA 5DJ0B 3CCHB 2ADFL 1DE4A 3O11B 5HGGS 2C26A 3RNQA 1KIRB 4M6OH 4XBEH 1UZGA 1XCQA 3O6ML 3UAJA 3LXUX 1ZT4B 2IH9A 3FW6A 1SLUA 3HFFA 3FYIB 2X6VA 3CSGA 4PY8J 1NANI 1MREL 1ZS8A 3GXUB 2YQGA 4LDLB 3BQUC 5DYFA 2F53B 3B3BA 4I7ZC 4WI2A 3ZE2F 2XIIA 2CCWA 4BXVA 4I13B 4PYGA 2L0DA 3IGLA 3QPXL 4BFKA 4FERA 3TJPA 4F2EA 1GYAA 2HG5A 2CG9X 4FQ1L 4XVUD 1AR1C 5F7LB 3GFUA 2Z3FA 2C9XA 3B2PA 4BQ6A 3H3PH 4ZW8A 3QZLA 5LDSA 3K2KA 3VFRB 3O2DL 1O5PA 4OLVH 2NZ9D 3GS4A 4BIKA 2CO6A 1KBGH 2H5UA 3RWDA 2E86A 3JWNC 3OHMB 3W56A 5IOKA 4XP1L 1A4CA 1NC2A 4M61A 3OB8A 1JPGB 1Z5HA 3KEDA 3W82A 1OIOA 2DWDA 4WFGE 5KOVC 4UM9D 1FL6A 1HNGA 2CNYA 3FONA 4CBZA 2GUYA 1RVFH 1AFVL 1OW0A 4GKLA 1IKFH 5IROA 3ZIYA 3Q8FA 4QRTA 4LEBA 5HTSA 3CVIH 2AXFB 2FR4A 3O3AB 2OYPA 4Z7WF 5DD1L 4OCWL 1IFGA 4OJDH 1PF3A 1AHWC 2ARJB 3VNZA 3S36X 3DOSA 2ORBH 5BRZB 2VZOA 3WIHA 3ZL1A 1BZ9A 1MVFA 3G5ZB 3KYMB 5EORH 2DQFB 2K8MA 4PJAE 5GS2H 1J8HA 3SE3C 1NLDH 2OXGB 5E6SB 4LARL 4MB1A 4F80A 5TK4A 2ODHA 3ZUCA 1BECA 2JWYA 2XBZA 2W59A 3TVMB 1XTMA 2FUTA 3RURA 1KIUA 4OCRL 1RUPH 2DH3A 1O9VA 1OAYH 1RULL 2BNRA 1TQBC 3GC3A 3RRQA 1RJLA 3KYOA 2XCMC 4X4ZA 2P26A 2HLAA 3WENA 4EF3A 1A1OA 3CFCL 4QRBA 3MLZH 2IDCA 4UV7H 4POYA 3C5ZD 4PREA 5DSCB 1QA9B 1B9ZA 4GMTH 4RISH 1U8KB 3QB7C 3IKCB 3LZOA 1TXKA 1ZWIB 2NY0D 1NKGA 4P99A 4WI8A 4YXHH 3TCLA 2DJ4A 4PV8B 1MOEA 1Q8MA 1R3HB 2P7TA 5FHBH 3U0TB 2IOMA 1L9MA 2W0FB 2MOGA 4ERSL 2JJTC 3GSNL 4H8PA 1S9WA 3T77A 4AYBA 3RIKA 2EE2A 4NO0B 3OAUH 1WE5A 4ZO6A 1T0PB 5E00A 4DETA 5CZXC 1R0AL 2Q20A 1TT6A 3FOLA 4XXCC 2QFRA 4U3CA 3HI5H 1NUNB 1RZGB 5DJZA 3BZ5A 5IZ7A 1NCOA 1U8CB 4X5PA 4CC0A 1RPQA 2BC4B 3S88L 3ZL4L 3NIFE 2AI0H 5CSBA 3H53A 3O6LH 4Z5RA 3RFZC 5LAXB 5FB8A 4M5ZH 2D7MA 2W0LA 2WZPD 3FTSA 1CLYH 2HVJB 5EOCJ 4ES9A 4R4BB 4XPAH 4Z3TA 1GZHC 1UACL 3MA7A 5JUEH 2NYYC 3APFA 3W0WE 3S5ZA 2G5RA 1NGWA 3MJ9A 4KH2A 4KJQD 2BP8A 1XF2B 1UM6L 1CDUA 3CSYB 3G6DL 4P4KC 4UINL 4IOIB 1I1AB 2QVFB 5HYQA 1Q72H 4FQPA 3O2DA 1UXLA 1A14H 2XTJC 3DSNB 1D5ZA 3Q8BA 2FATL 2FZ3B 5JHDB 2A74B 4Z5RB 3MJ9H 1J88A 1DLHA 1J9TA 1DVFA 1SHWA 1YMHA 3QIUC 4OFVA 4XPBL 2IFFH 5E4OA 2AJUL 3GSOA 3QUMB 3CVBA 1NM9A 1ZEAH 4UTAA 1KLUB 3QUYD 1MIEH 4UCFA 3G9VA 2VLLA 3JVGC 3KCPA 3O4LA 4KI5C 3ZVVA 3U36A 4HWZB 3FN0H 1M71B 1II4E 1W15A 3OLDA 3C2AL 1ZVSB 4RIRB 3BP5A 5I8CB 3MRCA 4CNIA 2NX5E 4HJTA 4XNBA 2AJZB 4P2RD 3NFSL 4F2MA 5FW8A 1X9UA 1DUYB 4JZOB 3FFCB 1N10A 5I6PA 3ETBJ 2YRZA 4PW4A 1QBBA 4JFDA 4JPWL 5FO7A 1C12B 1HE8A 3NJMA 1VGKA 2UYLB 4OIFA 1REIA 3GMPA 5DO2C 3MRNA 5DYOB 5DJYA 2BWDA 1BHGA 1VB9A 4WUUB 2VXTH 3B2VH 3LPWA 2VL5B 5JDJA 1AY1H 1P2CB 2PO6A 3OVUB 1K6QL 2ATPA 4PR5B 1USZA 3Q2LA 4NFBA 3O9WC 1J5IA 4E0RB 4NKMB 3RUGE 3QZBA 4XVTL 2GY5A 3OJDB 2R0KH 3ABLB 3E6FB 3HLAB 2RQ8A 3MXVH 2NXYC 2QGCA 5B8CB 3VJ6B 1HNFA 3VFOB 1RHHA 3LNGA 4QHKI 2OAAA 3TV3H 1FL3A 1E3FA 3QYCA 4IIZA 2X2IA 1TVHB 2Y7OA 4KTDH 1HWGB 2IV8A 2O6FA 3GRWA 4JVWA 4PCYA 4XC1H 2H2SC 5FYLD 3ZTNL 4WFEE 1HTYA 4ZK8A 1PLCA 1XBRA 5CZKA 4PRDA 2N7BA 2XI9A 4PJDE 3P4LA 3W9EB 1SBBA 4WGKA 5TFSL 1E4KA 3FUHA 2TSAA 1C5CL 4L8SB 4XP9H 4DPCX 4W9GC 4GRWH 4ABWA 4N2HA 3QXAA 1KXTA 2IPUK 1HI6B 1SDDB 5HHOA 1IGTB 4P3DA 1KBKA 1F11B 2NXZB 5L88H 1UA3A 5DZLA 1IM3A 3L5WA 4MAZA 1PU0A 1UUNA 3TO2B 3EOAB 3MV8D 4DVRL 4QRRA 2BZ7A 2DWDB 5F9JA 5IK3B 3W0WD 3WS6A 3SQBA 4MFHA 4MDJA 5EUOF 3R7RA 1BV8A 3G04B 2ZCLL 1PZCA 4LVEA 5CJOH 5IIEA 3ALPA 3BKJL 4LPXA 5K59E 4ESKA 2CKBL 4BFGA 4CILA 4D0CA 4RGNC 1X5MA 1IT9H 1U8JA 2XVLA 1E4XI 2JKNA 3LKRB 3NAAL 4PG9A 4P2OD 4GQZA 4ZMOA 1M05B 4PW9A 2XZAL 2HFEA 2Y06L 5JPMA 2UXFA 3JTSA 4YFLF 1KC5L 4JFSA 1YEGL 1UD6A 1CI3M 4OTXH 4P4RB 2MQGA 4XMXA 1XR8B 3DRQB 2R69A 3QPXH 2WXLA 2IBGA 5A7EA 4U6XA 2DQUL 1E4WH 4PVLA 4Y5XC 3QWRA 1NJ9A 2FT7A 2YGPA 3U46A 4UTAL 3GMNA 5JNYB 5D1ZA 2WZPA 4R7LA 1B2WL 3EJJX 4NX0A 4OI9A 4UV4H 4K3DH 1LO0H 4OZGB 1DSYA 1FI8C 4HFUL 1XMEB 2CKNA 3DRQA 4QAWA 4XNMA 3EJTA 4JO3L 1D7DA 4NP4H 4K2UL 5FO9A 4ONGL 3QZWB 2Q3ZA 2XXFA 3P3TA 4G9FE 4K8RL 3DX9A 4ZMTA 3F7LA 3FSOA 5FHAL 3TYFB 2DQJH 2IDTA 4PEEA 2WWKO 3FK3A 1WBZA 5ID0A 2WW8A 4YHIB 4KNQA 3G9AB 3S4SB 4CC4C 4YDZA 3WJJC 4XRCB 1ZHNB 2XWTB 2YAEA 5E5UB 4YK4C 2EEXA 4P4KD 2XN9E 4B5EA 2J2ZA 4UQDA 4PUBL 2F54B 2XUWA 1D5MA 3SYQA 4F8NA 1R5VA 3ZKNC 2DQGH 1AGBA 2FIRT 4RRPA 1Q9KB 3T08A 4K4KA 4ZMVA 4Y16B 1Q9OA 1BGXH 4Q89A 4NUQA 2BRRH 4PU2A 1BPVA 4KNSA 3IB4A 5GGRA 4O9HH 2X88A 4QCIA 5J12C 4G9DA 4Z7OB 8FABA 1D6VH 3BH9B 2YZ8A 1FFTB 2Z7ZA 3TA3C 1EANA 1FGVL 3ECBA 5DWUL 3WFEL 2WQSA 4HGKC 3OKDB 4IJ3B 5EBWA 4E42B 2W1NA 4W4OA 2MIZA 4Y9EA 1WICA 5MEOB 2ZUUA 3QZWG 4M6AA 5D1QE 1MIML 1IC5H 2MRYA 3SPVB 1CFSB 3NCJL 4Q7DA 2OSYA 4AL8C 1IARB 3NYKA 4FKKA 4CW1B 3QUGA 4CW1A 4NZUL 3FOMB 5EEWA 2HTKD 2XKNA 3CDYA 4O51A 3TASA 4CNIB 2VL5A 2IF7A 1ILSA 3CFNA 3D48R 1CMOA 4AEEA 1FV1A 3LH8A 3HZKA 1F3RB 3VFTB 5I9QC 2K6WA 3HZYB 3LVEA 5AWNL 1JG9A 1L0YA 2HX7A 5FEBA 3FFDA 4FQXA 2FH6A 4JLRB 4FXGC 5AOLA 1BBDH 2R1XB 3V0AC 5DRZB 2UZXB 1DQLL 1ANUA 3KM2A 2M1KA 5BZDA 3OKLB 5EC2B 5JO5B 4CL7A 3NZ8B 1E8XA 1C16B 3F00A 1A21A 4DESA 4WI7A 3NH7H 4G8AC 1MI5B 4A67A 2BMKA 2VTFA 3KH4A 2HJKA 1IFHL 4YXHL 3HG0A 5KVDL 2YD9A 3PU7A 2EDDA 3QAQA 4M8QB 4RMRA 1A47A 5EC2A 2NY4C 5K69A 5IKCA 1JZ6A 3D85B 4RFNB 4N0UB 3UADA 5LNGA 3ZO0A 1B3JA 4Q58C 1FO0H 4PM1A 1NBVH 4Q0XH 3LS4L 3NK4A 2X9WA 2PYEB 3CJJA 1KT2B 4HWNA 4GAJH 4FA8A 4X4XA 5ISZA 1W0WA 5D2NC 1J5OL 1KN4L 3ULUE 5IHUH 1QNZH 4LLAA 1F3JB 4QRSB 4NQDE 3NCYS 5L2KB 2AQQA 2M8XA 1DBAH 2AHIA 3BSZA 5EU3B 2A6IA 5EULV 5D1XD 1EHKB 1THAA 1THCA 1YQVH 1RULH 1F02I 1G7IA 4GAYA 2YXMA 5JOFA 5EU6D 2P43B 4M1CC 3S9DB 4G5ZL 2YD3A 2X6AA 4HLZH 4JRYD 5C09B 1A3LL 4NM4H 2WIIB 1QR1B 2NY3D 1IMHC 1IAKB 4K3DL 4I1NB 2D31A 3ZHLA 4N0FB 4ZUTB 3F5WB 3VRLE 4BH8B 5IV2B 1ZV9A 4U7MA 5SWZE 1NWPA 2YPKA 3QO0B 3QJTB 2CR3A 1TZGH 3FQWB 4AW4A 2Y6TE 3D7PA 2NQCA 3D4CA 4Y19B 2EUXA 5DHYA 4YE4H 3IN0A 2LT9A 3RGVC 1AZCA 1U8MA 3SDYL 4HUUB 4XPTH 5FB8B 3D06A 1I8IB 4UDUB 3MLUH 5GGUA 5B22A 2ED8A 4MAUL 4UM8A 4Y16D 1BW8A 5FGRA 5JHLH 5D7LA 3NSFA 3E8UL 1ONQA 3EFDH 2J20A 5H37G 1J1PL 2X10A 2ED6A 5D2NB 4PY8I 5EOCH 4LB8A 4XAKD 1QWHA 3GSUB 3P3UA 3GF8A 4OGZA 2GJRA 2CMRH 5H35B 4M61B 4H1LG 3ABZA 1C5BL 2C9SA 4WF7A 2QR0A 2WXOA 2VDQB 1XF4A 2N1TE 3AS2A 3IS0X 3WNKA 2PWEA 5AG8A 4WUUE 2VXQH 4NN7B 4MRCA 1Z9MA 3U9WA 3VWKA 1VZIA 4KOCA 5JORA 2IAMD 3KR3L 4TQEH 4X9GA 3PGCB 2VQUA 3WFDL 1RSFA 3JV4A 4D0DB 3U6RA 2JF1A 1J12A 1FZMB 4MD5A 1IGMH 1TQWA 1FYTD 3HTLX 5AOIA 1MFCL 4Y89A 5K1VA 2WXQA 3MRKB 4NNXA 4I88A 2CK2A 1OP5K 5DTFB 4BFIA 2CALA 3ILEA 4F2MB 4RAUA 1UCBH 5CUSH 2RD0A 3ISYA 4ORZC 2VDLH 1F4WL 5F1NB 2OTPA 3VXSD 4OF3A 1ORSA 3PGFL 3QI9B 4RSYA 3U36B 4A1RA 1EHLH 1F4HA 3H42H 2X41A 1K4DA 1SEQH 3DGDA 3CU7A 4LCUB 1E9PA 1YEJH 2ARJA 2XN2A 4MCNA 1K6QH 2VLMD 4N6QA 2FX7H 4XNUL 3BSZL 3H2QA 2G0KA 3S2CA 5I2IB 3MHZA 3ARVA 4XMKL 4KO6A 2GTWA 3FONB 3H56A 2OZ4A 4AC2A 1KGXA 4B9JA 3F3HA 5J6GA 5D5ME 3U9UB 3U2SB 2FGZA 3RNKA 1AR1B 5E7FA 3FQRB 4OFIA 1DBMH 1A6TB 1FF5A 1IQWL 4PLNC 3T2NL 3L8QA 1OO2A 5CXPA 3BQUB 1JPSL 1JZGA 2WKGA 2MJWA 2P8LB 3GMQB 3H85A 12E8L 2FH8A 3B5GA 3UOAB 5HYEA 5BS0D 2AERT 1LM8V 4EKXA 2JKSA 3H7BB 4EIZC 5EN2A 5CJOL 4L4TD 5FA3B 4YSEA 5J1AB 3Q2CA 1JGUH 3C09C 2EDTA 1DCLA 4N26A 5EO9A 4GW5A 5C0DB 4R4BA 1R46A 4D94A 5HBBA 2X6CA 1KPUA 4OZIE 1EEZB 4HFWA 5DF0A 3UAAA 1EMTH 3OPZL 2YGQA 1YEDB 4PJ9C 1G9NL 1T1ZB 1VKXA 1TJGH 2P7TB 3U0TA 4PV8A 4HK0B 5ELIA 2VLKE 1RUQH 1NC2D 1UZ6E 3EYQD 3K0YA 3P77A 5JW4M 3CZKA 3QCVH 4LOFA 2JIXD 3NIGE 2W88A 3QIWC 1OAUL 4W6WB 1NMAL 5IIEB 3UPRB 3IBEA 3PDOA 5F7AA 3QQ9C 3WN6A 1D6EA 4FQJH 4LF3B 5KJ4A 2ZUXA 3ULAB 3FFOA 5EZJA 1G84A 1R3HA 2NY4D 2DMKA 3A6CH 1ED3A 1FYTE 3QIUA 4B60A 2Z4QA 5K9QI 1X5HA 4ZYKA 3L45A 1PGRB 3EUDA 2P5EA 2D3VA 1QRND 2XTJD 2ZF8A 4E9LA 4UQ9A 3UTTB 1AVAA 4WW1B 2Y5TB 3MLTB 32C2B 4WWOA 3L3OA 3PWLB 3CBRA 2OMTA 4P06A 1XSIA 5FFOA 4AGMA 5E99L 2CO3A 2F53E 3N0PB 3BMWA 1CI5A 1F4YL 4NZ8A 2BY0A 2GJ6E 2V4LA 2YPLB 3JV5A 4HEME 5DK0B 5FCUL 3V0JA 1CGVA 3QUYB 4LEXL 2OJ1A 2AQ2A 1CF8H 1ZK5A 3WTWA 3JV6A 1YN6B 1I1AA 4X5XB 2EC9T 3DVIA 4QRQA 4AIXA 4IGBA 1Q9KA 4PJEF 1UT9A 4J3OC 5DD6B 3TZVD 3JT2A 1G7LB 4OAWB 2WO4A 2E3VA 4FP8H 1IC5L 3B9EA 3IT8D 4MQ7B 5MI0B 4EE2A 4KO5A 3DUSA 4HJ0D 2FUQA 3L3KA 5J8OA 1F00I 4RGNB 4IHOB 3PFUA 4MXWH 3MOAL 3QZWA 1WSST 1YUKB 3G7TA 2VLRA 2AZUA 1ZJBA 1I9EA 2EXWC 2FNWA 3EJPA 3K5SA 1OHZA 1P5VB 2LVEA 5HI3C 5IJKC 1T1XA 4TULL 5JDSB 3K72A 2OYKA 2I24N 4PLKC 3HI1B 3WIAA 4QNPF 3K3QA 1EJ8A 4BINA 2Q86A 2FL5B 3VG9C 3FT4B 1L5GA 2BRRL 4HMCA 3A23A 4RAVA 5E6UB 2HPOA 1B2WH 4CDGC 1R3LA 2XDHA 3LXCA 4HCGA 1XZWA 3RL1A 4UT6L 1MJ8L 4YO0A 4Z7UF 1UFGA 1DVQA 3MKGA 4Y1AA 4I0PC 4AQ8C 1EBPA 4HJJH 1CZ8L 1UT1A 3FB8A 5B1JC 2JCCB 2XBDA 3OKEB 2YS4A 3MRIB 1G0DA 2IH8A 5J11B 2ICWB 4FXLA 5IB3A 3NJXA 1F8TL 2WXGA 1MCOH 4FQHA 4P5RA 1TENA 2DQIH 2DYRB 5CBAB 2G30A 4MKMA 1ROCA 2RTTA 2WQVA 3OBAA 4C8XA 2R83A 2VZTA 5GZNA 4RWYL 1ACZA 3DJ9A 4RFOH 3WY3A 1VACA 1Q4NX 1E67A 2DQCL 4LOUD 3KE0A 4R5TA 4MA8L 3FU3A 3SQBB 4PLKD 4J2XA 5GGVY 4POZC 5CZVL 4W4OC 3BKMH 4LASH 1BVKB 1X5ZA 3RX9A 1CGSH 1ORQA 5K93A 2HPTA 4HOMA 1NMCC 2H45A 2R59A 5C6WH 2B3RA 2YHGA 1C1EH 3ZHNA 3BKYH 2CUIA 5TF1H 3H8NA 1YUHB 3KEHA 4AX3A 3C87A 3LRLA 2FR4B 1UA6L 1MKFA 5DR5H 3TO2A 1A9EA 2CRZA 2H2PC 4K7PH 2GIMA 2VLJD 4JO1H 5G5DB 4UZGA 4KHXL 2EYTB 3VW3L 4IW4C 1WEJH 3ARBB 4H0GA 3WELA 3TJHC 2PXYD 4R2GC 3PWPE 1U8QB 1T21A 1SFDA 4QLRA 5IREA 5KTEH 3RPIB 2WLHA 3M8OH 4K5LA 2VO5A 1KTDB 2EVGA 1M9SA 4TN9A 2CGRH 1CN4A 2A74C 1W72L 1QR1A 2DEYX 2CPCA 4PRNA 3QFJD 3BWAB 1G7MB 3H9YA 4JHZA 4HF5H 2JCWA 4WI3A 3WKPA 4KKCC 3RWEB 3E6HB 3L1OH 3S3DB 2GYSA 1WC7A 5BQDA 4E5XB 4XMLH 3T2OA 1QRKA 5CFAA 2IAMA 1BM7A 1G7QA 4LL4A 4L4VB 3SDYH 3T6WA 1QBAA 2EUVA 4FQ1H 3ZHKA 3FT2B 3IJ9A 4KRLB 4YDJB 3ZSTA 2GHWB 3B6SA 3L9BA 3SB3A 4A2EA 3RFZB 5DUPH 2X3AA 3WEXB 1IGIL 4H40A 2UY7A 2RQEA 3EZJB 4U1NA 5C6PB 1E8WA 1KGJA 3V0EA 4AGPA 4HX1B 1VCBC 2PXYC 4R2GD 3UXFA 4JJ5A 3OXRB 1MCWW 3CFDB 1K3IA 1EAPB 4K3JL 3S4SG 1L6ZA 1JHKL 3H0TA 3AWEA 2GIYA 2K3HA 5A6IA 1PG7W 5GS0L 3UTSD 5HYSG 2KERA 2BVPA 4YHYB 3TBVB 2VMEA 2OMZB 4G2AA 4YSQA 4YE4L 1OPGH 4H8VA 1AHMA 2FZ3A 4L3AA 4QKTA 5I8EB 3B9KA 1A3RL 1BQRA 2ZKYA 3CD4A 3D0LB 3UZQA 2CSPA 1KCWA 2Y22A 3FAWA 3IRCA 3MRJA 5AW2B 2YLKA 2X4OB 5I30H 2J3SA 3HMXA 4X8GA 1YCSA 3N06B 1U8NB 4Y9CA 2K8QA 3S3SA 5KW9L 4N1EA 1DSFL 2D3JA 4FKEA 5IVXF 1A14L 4WV1C 3Q13A 2CPUA 4HGWB 5KYXB 3Q8CA 4OD2A 2C3XA 2L7JA 4OLYH 2GEQA 2OTUB 5KJRL 5HDBB 3A22A 4Y1AD 4NWUH 3ZGIA 1ASOA 1EXHA 2BFGA 1IC4L 1VZGA 2Z91B 3EYQC 1Q94A 1HOEA 2DYPB 3GYRA 4M1GL 4N28A 3GRWL 3QIWD 3I6KB 3K4AA 5DZPA 5FDWB 1ZDSA 5SV3A 2FEDC 1JWUB 3FB5A 4HH9B 4NDMB 2XY2A 1GGCH 1NIFA 2FTAA 5BZDB 2Q5BA 1J0IA 4E9WA 2QDWA 3E0GA 1OSZA 3B2XA 3WFDH 5KTEL 1AGDB 3BD4A 2XKNB 1A7QL 5DJ8A 5J9PB 5AOMA 5C0BE 3KBEA 1GYCA 4GY4A 5E8DH 1N6QH 4A66A 2AW2A 4HQQH 4U1HB 3ESVF 5DJXB 2ADGB 2EYRA 1WG3A 1ZPUA 3VM7A 5CMAA 5GZOD 3MNVA 4GNKB 3EJRA 2N0KA 3ISWA 2VDNL 3IXTB 3KL0A 5I6OA 1RZ7H 3NABH 4TNWF 3HS9A 5FGBC 1TJHH 3VXUD 3C6EA 4BELD 1SJXA 3PE9A 3A67L 5BZWB 5IW1A 1BVZA 1HCYA 2BY3A 2WVTA 1OTTD 3MAWA 3DMMA 3QWRD 2J88L 2KYIA 3IFPA 5IHLB 5L0QB 1RHFA 3GBMH 4RVBA 1NEPA 2D7NA 3P4MA 2P45B 1X9LA 3W81A 5FKPB 2J57A 1NEUA 5IEHA 4BH7B 1Y6NR 2AI0L 4HP5A 4L4JA 4JPWH 3BSGA 3W0WB 4Z3HA 4FNUA 3WAJA 3QA3A 2BP0A 2P5ED 1O7DE 1I75A 1PDKA 1QQDB 2EH8H 3I9AA 2VDKH 1WT5C 3QW9A 5CINH 2K1MA 4JFVA 5EDSA 5F1IA 2APBA 3II2A 3ZTDC 2AJVH 4Z9KB 4OW6A 3V6OE 2EE9A 3DDGA 1J8HB 3HFML 3NJKA 4GOSA 2D03L 4DP9X 3K8LA 5JZ7D 5JIMA 3MGTA 5FF6B 2UWEF 1JGEA 2G2PA 2H7WA 2ZSVA 3CH1B 4AQ1B 3DOHA 3BGFC 1CFVH 4HCIA 4HXAL 4XOCA 4FAAB 4AMWA 1M7UA 2WUCH 3VGHA 2OK0L 4RGMB 4HUCA 3NCMA 4MD4A 5A2CA 4YAQB 4LPVA 1AIFA 4F27A 2EH7H 3DGCR 4FTVD 3CLEL 1KLFB 5HHPB 2NDGA 3VTAA 4TSAH 3UP6A 4YDMA 5EN3A 1GYUA 5FYLE 3WFBL 2AP2A 4WFHE 5DC2A 1ZSDB 4FQCL 3L1GA 2PUQT 4XX1E 2OK0H 1E7VA 5D1ZB 5EF2A 3WU1A 4P46C 4BWUA 4WEEA 4UTCA 3N43F 1Y18A 4G42A 1M6OB 1FZKB 1Z0NA 2JFCA 1GGCL 2VMDA 4HDIA 3C5XA 4YSSA 3VM5A 2YC1B 4ZUUA 4F2FA 1BWMA 3D4ZA 1OE1A 1FYHB 1HEZA 4B50A 4NO2B 3KAAA 4PV1C 5CZRA 1BFVH 4U1LA 1PG7H 5F3FA 3ECQA 5JZ7C 1JFQL 4YDNA 1L0QA 1MPAL 3NJFA 4HKBA 3O11A 5B7MA 5EIIA 3BUPA 2Z1KA 2CJ3A 2R29L 4KXZH 4NZDA 4WJ5B 1YDPB 2A73B 1XGYH 5AYUL 4ZMLA 2UVFA 4GG8B 4U1GC 4MJHA 1OE3A 1LE5A 4XOEA 1AQDB 1HIMH 2WO3B 3MRGB 4YSRA 3MRHA 3C5ZC 4IIQB 4K8RD 2WY3B 2FBOJ 2QSCH 4MB5A 2NNAA 4GSXA 2BFVL 1JFHA 4Y19E 1HJCA 3FB6A 5TQ2L 1ZHBB 4G1EB 3MLXL 4MHHG 4M93C 5T1KD 4MMXA 2VXUH 4FQIH 4NPYB 3BWSA 2NUTB 5DQ9A 3P3RA 1LEIA 3QDMD 1SJEA 1DSFH 2MWCA 3VXSB 2GB2A 3INUH 1TKWB 5D93B 3PP4H 5EB9A 2XTSA 5LWYH 4H4NA 1IGCH 5BZWA 4ALAL 3AU1A 1JDDA 1XH3A 4RMUA 5I1KL 4W1TA 3S5LG 2R23A 2ZKWA 1CFNB 5H8DA 3BKJH 3PWVB 3S97C 3O3BB 3DURB 4KNUA 4LAJH 3BFOA 5J3HC 3LS5L 4OJYA 4LCWD 4QTHA 4X4KA 4PWGA 3VD2A 3SDDA 2BNQD 1ET7A 3QPQC 4Z7IA 4Y4FB 3N91A 5FYJD 5CFHA 5K39B 3L3KB 5GZNC 2XZAH 5EU4B 1OSPH 3WGVB 2A3TA 3QJFB 2VITA 1N0LB 4GI6A 1NM4A 4TNEA 1QSZA 3ARFC 1Z5YD 4MGXA 1ZHKA 2UWEA 3D0AA 2VZVA 2OI9B 5G2NA 1VFBA 4HUWB 3DHMA 2FBJL 4FDWA 3GSQB 4WNQA 2VDNH 4JHAH 3CBKB 1KTKE 1BZQK 3FQNB 1TQSA 3CU1A 3DMMC 4JG0L 5F1SA 3K1KC 4N85A 1BXXA 4QLWA 3IE4A 2K0RA 3SCMD 4HSAC 5I8CA 4WUUA 3GM8A 3N42B 5ANMA 5FLUA 1F4XL 1QFPA 2BNUA 4HAKA 3OPUA 1QZ1A 1G1CA 1UKSA 2BZDA 3TVMD 1LK2B 4MNQE 3EH3B 3N1QC 1JHKH 4M1CD 2KZKA 2ESVA 3PAUA 2EXSA 5E6RB 5HHOD 1R3JA 4RMBA 4HWBA 3VFNB 1GMEA 1U4FA 1V10A 3HNTH 1BBJB 4J3TA 3REWB 3POCA 5LBVA 3HI6L 4JCWA 5DO2D 1R75A 3N1FC 3I50L 1SFHA 4GMSL 4FG0A 4DP6X 1GJIA 4MMYB 2C7UA 3QRGL 3MOBL 5ECJE 3BRDA 3HNVH 3HAEA 3ZDYF 4MZ3A 5JW5B 2YRBA 1CL7L 3SKOB 2DIJA 5A40E 3FNKA 3ZZLA 3MV7D 3EJQA 4UM9B 4YOKA 3NZHL 2R0ZL 5L8LB 15C8L 4JFXA 1CDJA 1UWXK 1OARH 4YSAA 2HFTA 2H32A 3LNHA 3X1EA 3QGVA 4DKDC 2WYZA 3BLPX 4MCMA 4GSDH 2V3EA 2K7PA 4O5LH 4OFKA 4X8CA 5T1DL 1XCWA 3RLSA 3EDEA 5I26A 3HHRB 2PO6D 3MBED 2A7BA 2KZBA 5IBTL 2DLEA 5C0AB 4R84A 5DJCB 1NIAA 4LLVB 1KC5H 1SHMA 2NCMA 1O7VA 1VENA 5L7XL 2E7BA 3I2CL 4P9MH 1GSKA 4JQVA 4FTVA 3DX8B 3B8YA 3BAWA 2WWMD 3HG2A 3I3BA 2B8OT 4KKQA 4WW2F 4HEPG 3O3EA 4A6YL 4O4YH 4YAQA 3I3DA 4B9CA 4UAOB 5D72L 1YNTB 2R0WH 3KPSB 5ICYB 5KZCB 4PS3A 3SY0A 4B0MM 4OZGE 3CIQA 3FOLB 2E4TA 3SGKA 3T0DA 5EPMB 1MVUB 1AS7A 4ZW7A 2F18A 2WTOA 1FIGL 2HLAB 4UTBA 4KZCA 1P84J 1UWXH 3ULUC 2Z31D 3N85H 3QDGD 4G43B 5KVGL 3F58L 4AG4H 4G8IB 3H55A 4DZ8B 2ESVE 1S3KH 4JX0A 1XXFC 1C5CH 2Z65C 4XMWA 2ZNXA 5TQ0H 4WWKC 1DBAL 1LHZA 1RP9A 2GCYA 4OSUH 2VYRE 2JI1A 2YN5A 4QGYA 6FABH 3IAQA 2FQFA 1BG9A 2JMRA 4X99B 1AG0A 1HL5A 3BCFA 3EAKA 1EEYA 4D7BA 3UAJD 2W9LA 3K2UH 4PJCF 3B6SB 1X4ZA 2UZYA 3NH7L 2UZYB 2VERN 4NQVA 3SDXA 2J44A 4F1SA 3EH4B 2RBLA 4K71C 2X2YA 1KIPA 1B3IA 2RALA 3C6LA 2Y25A 3DXAA 5EUOB 3DPBA 4MRBA 2NY1C 2NXZD 5ADOH 1UOLA 3FO0L 3N04A 4MZRA 1QSED 5JORB 3NJJA 1J0ZA 3IDXH 3N0AA 2KDYA 3QUKA 2DV6A 1T7WA 2EXTA 2MOVA 4YHMH 4HOXA 2JELH 3O8XC 4U4BA 4XODA 4NCC1 5K39A 4YBQD 4X7SH 1AGCB 1IAII 4JZJC 4FP8L 1A4KA 3PGDA 2YQBA 2CO6B 5FLVA 1IJNA 4FMFA 4XXDB 3W39B 5L2KE 2PCYA 3RWJA 3PL6B 3WNNA 1U93B 3C9NA 4PJ9A 1SBSH 4KKZA 1IAMA 2Q7AA 4FEMA 1QOKA 2IG2H 1HK6A 1IM9D 1I3RA 4KO9A 4DK3A 2QADB 3TWCH 1FL5B 2P8PA 5B7FA 1FNSL 3VRJA 4JVPA 4JQIA 1MLCB 2W65A 3KYAA 1VADB 4U6HA 5DEFB 1E5ZA 1T22A 5DWUH 1SBSL 2WXMA 1CWVA 3CNKA 1A7RL 1V7NL 2MOQA 5LG1A 2AQSA 1H3TA 5EBLA 3QUXB 2A6JA 1CLZL 1R24B 5K9KB 5GRUH 4X6BB 2FECL 2QPEB 1TCRA 5C70A 2EDNA 1XR9A 4NQCA 5BOPA 2Q6WB 4LFHG 1UH3A 3O0RL 3VH8G 4EZKA 2HAZA 3TT1H 5LUMA 4F2ME 5J6HA 3WTSA 4HWUA 1U9KA 3ZE1E 3JWOH 1I9JH 1OM3H 1F90H 4NQXB 5FYJE 2V5RA 4AOFA 5F70A 4Z78A 5CEZL 3GMLB 4GUCA 3DV4B 5CP3A 3UTSA 4DT2A 4WEBL 3IEAA 1KYUA 2A1WL 2RR3A 1N6UA 3N43B 2CIIB 1RK7A 2QKSA 2NSMA 4K15A 1B4LA 3HB3D 2HMID 4NAMA 1GIGH 3GSXB 4W70A 4QF1B 5EEXA 4LSUL 1MCWM 5IVXB 2AJVL 1MDTA 3U2IA 3FO1B 3CVHL 4Q9RL 3DXAE 3ECVA 5E0QA 3O3EB 3BZ4A 4O2EA 4RZCA 4CMMA 1SYSA 2VO8A 4FQLH 1CG9A 4G8GD 4EJ1C 1HH6A 1LWJA 3GMRB 1AXSB 1PAMA 1T89C 4M5YH 1P7KB 1NFKA 1S7UA 3PPSA 4ZXBA 3NG5A 3RJOA 5EF0A 4F58L 1L9NA 3OGOE 5ISZB 3FCUB 1D5RA 2I9TA 2ZCHL 5IQ7H 4JANA 2DWSA 3BUIA 5G4OA 2DZEA 1F6AA 1PYWB 4PJ7B 2D2CC 1E6JL 5LQBL 3FTZA 1FAIL 1Y07A 2NTFA 2XT1B 2Z1PA 2R56L 1A4JB 5J89A 3IDXL 3RPKA 3DSFL 1RZIB 4PJHA 1ES0B 4ANWA 2D4FA 2DW5A 3DX3A 4UT7H 4MD4B 3RBGA 5ITBL 5FFLA 1B88A 3UP1A 1EEZA 2APTA 1TZ8A 3CX5K 1A7OL 4LHUA 3L3IB 1JPSH 1TO4A 3MLVH 5AVZB 1NGQL 4V33A 3HRZC 5AVQB 1GTNA 1VDGA 3QO1A 2D73A 4HIIA 1A3ZA 5DHXB 3WGUB 3F6JA 2Q3AA 4ELKA 5D7KD 5DA0B 1KV7A 4PJEA 3FUNA 3S96B 3GINA 4JHAL 4NQCE 3GIVA 4U1MA 3UYOD 3S8WA 3VWJC 1L7TH 5HYSB 5DUJA 2KUTA 2XHNA 3NSXA 5JW3L 4TUKL 3I9GL 5CJXC 4IKJA 4CVWA 3LEYL 5I1LB 4LCCB 3ZYOA 1F13A 4BGLA 3MN8A 1M7XA 1LEIB 1QATA 1DDHB 2BVUA 4MASA 2HFFA 2NYZA 2R2BB 3RB7A 4N8VA 1T04A 2MQ3A 5D7JD 1NCWH 1IVTA 3NRQA 4PCSA 1VEOA 2O5XH 3CHOA 1WZAA 1NEZB 4IU2A 1RVFL 3O6KH 1L7IL 4IS6B 2H1LM 3CZUB 1UJ3A 4KZDH 4U1HA 2AEPH 2CM5A 1CDCA 4KKAD 1EFQA 2I5YL 1XSOA 2HKFH 1AAJA 2HSIA 3MRGA 1KNOB 4GG8A 4B7IA 1LE5B 3B2UD 3L4UA 4KOBA 1INQB 4XPFL 5F7BA 5CCHE 2TRYA 5AVXB 2ZXGA 2J1YA 4HKBB 2BHUA 3BUQA 3OKDA 1SXCA 3KG5A 5I0ZA 1RUKL 3MRIA 4D8OA 1S7RB 3OSKA 5F71A 1RLBA 1TCRB 1OAXH 5FW6A 1GL4B 1Q94B 1AGDA 2MNJB 5I1EH 4G9DB 3QAZC 5D8JH 4R97C 4DGUA 5AUMB 2WLLB 4I4WA 3VTMA 4OZFA 4GSDL 1G6RB 3QRLA 1JGVH 3KBFA 4NDMA 4DGYL 2WUBL 4HH9A 1HHKB 2EIZB 2A9CA 3PWVA 2IQAB 1LMKA 2P8PB 1E27A 3GSRB 5JPMC 1FZJA 5KS9A 3LV3B 35C8H 4HLJA 5GGSY 1N5YH 1CO1A 2Y7LA 3O4LD 2V17H 5DEGB 3VWKB 4MD0B 1OY3B 3S35X 1QLFA 3PL6A 1QPXA 4WFED 3QQDA 1OLZA 3OHXB 1MPAH 1Z9PA 5GRVK 1Z32X 4P07A 4PRIE 4YHLH 1DVTA 3S6CA 3T2QA 1QSEA 4KJWC 3BJ91 4LVNC 1KTBA 5BV7B 1HQRB 3BZ4B 4O2EB 3SGJA 3G5VB 4F7PB 1IQDB 4JM4L 2NY2B 2YAFA 1D7FA 4XN2A 2MHAB 3KZ8A 2QJDA 4GSUA 3K74B 4HPYH 4ZG1A 3GGWB 3WG7B 1S6NA 4KAQL 1I1AD 3FN0L 1XSJA 4EUPG 1BJ1H 4Z7VE 3BE1L 5DZNA 1CXHA 2DLHA 2X0VA 4LGRB 4XMUA 1JF1A 3P0GB 1MQKH 4X6CA 4JHWL 3VFNA 4ZNCD 1U8OA 1U58B 2XY1A 3RA7L 1X44A 3QFDA 3GSWA 2Q87A 1B6DA 1YHPA 3UJIL 3HKZA 4ATTA 3RHWK 4UNVA 1O75A 5IR1B 2DLGA 2CD0A 4RBPH 4ZI8A 4JM0A 3PWUA 4HT1L 1YEEH 4YGVA 1VEMA 4LVNB 5AB0A 1NOAA 5H2BB 5TJWK 1AS8A 2E7MA 2BSBA 3MV7B 2J1ZA 1C5DB 4P4RA 7PAZA 5I18L 1UOWA 3MZGB 4QD2E 4YZFE 3OTTA 3DVFA 3MJ9L 4XPBH 4FZ8H 3MRFA 4JDTL 3W0WA 3TXAA 5JPMB 3VXMD 1S7WB 2IFFL 2LAGB 1FDLL 4XNAA 3IDNB 4NZJA 4RFOL 2EIMB 1ODUA 4ODUA 3B43A 5E94B 1U3HC 5E5LA 5DVLA 1SN2A 5DURB 2AXJA 4R97B 4ZSOA 1Y0LB 1GY2A 5D2LE 1I7TA 3R4RA 5EU3A 4AGLA 1DFBL 4FYRA 1CGTA 1FDLH 2FX9L 3QC6X 5GGUB 5CJ5A 3EBHA 5CD5D 1WA0X 3CH1A 3FTXA 3TFKC 1I8KA 4K9JA 1L0XA 3ARBA 4AE0A 4FG4A 5I5JA 5H94A 1BVNP 3BVTA 2IPKA 1NH6A 3WMQA 3JVGA 3VXPB 2FRGP 1HU8A 4ZOBA 3P9WB 2OMWB 4OI7A 2WXJA 4NKDB 2VJXA 4XWOC 4P5KA 2WHVA 1F86A 1SEBB 2O61B 4O2CA 5KVMC 1A3QA 3MLZL 4MS8C 3QJXA 3OXSA 5BRZD 3LRHA 3U7WL 3K4ZA 1NKOA 3V4UH 2OTUA 5FW7A 4FHKA 4EQ2A 1EEUA 3TPKA 3SKJL 4EIBA 4AXWB 1DQQB 3H9SA 1L9OA 3AAZB 4XVOA 5DS1A 3GSNH 2XC8A 4LESA 4PJCE 4QHLA 4J3OF 5JXEC 3K6NA 1OOAA 1ZA3B 1O6SB 4K7PY 3AZUA 4ZO8A 2YPVH 4PS4L 1UZ6F 1AD9A 3HNSH 4G7VL 5F8QC 1I8AA 5GS0D 1HWWA 2YMOA 3CFUA 4ZBJA 3V4VA 2A6DB 2CKBB 3TWYA 3ZOAA 3BVDB 4Y5YC 5EFIA 5DVNA 5E2JA 1KJ2B 1QO3A 2A2QT 3BP4B 3OKOA 4NQEA 5TH2A 1N12A 3MCYA 3ZDYB 1ZXQA 4J4PC 4R7VA 3B34A 4R5XA 5DJXA 3H6AA 4LPWA 4YGAB 1EAQA 5FYKH 3UROR 1JD9A 2YUVA 3OAZH 3H7LA 1PW3A 4QHPA 2FWSA 1XAUA 4CU8A 2OMZA 4NP9A 5GS1B 5KUMA 3LEVL 2OMUB 4ZFFA 4LPCA 1J8RA 1J87A 4WSKA 3CHSA 1WAAA 5FHAH 2DBLH 4BFNA 2OJEB 3GSQA 4KMLB 2K6ZA 4WEMB 4WNQB 3HG1D 4JPVL 1KIQB 1LTXA 3O41B 2P28B 3U6RB 3KLAB 3J8F7 1BD2B 4FI6A 3CPLB 3JZYA 4X6FA 5TE7L 5EA0H 1SVZA 4WGWB 3AUWB 1NGYA 3D51A 3K6DA 2IFGA 3F65A 2DQ6A 3N9GH 2ADIA 3B1UA 2P5WB 1J86A 5MEPB 4DO5A 4NHUB 5C7ZA 3TS8A 2R1XA 1HHJA 2AANA 4Y8DC 4BZ2L 3T0EE 5TE6L 1BX2B 1EV2E 1GKOA 2ZJSL 3LVTA 3KW7A 5I19L 1GGBH 3FUMA 2DQUH 4B9KC 4JG1H 1KB5H 4FQQB 4P48A 3GUTB 3O3UN 4R7NA 1EQWA 1XB8A 3WDJA 3MV8E 1LQBC 3CSPA 4LLWB 3KGUA 5DRZA 3KGRA 1YNKH 4HFUH 1BLNB 2F1EA 4Q9CA 4GBXC 4LGSB 4QYOB 1YUHA 3NUKA 1J1OL 3CVCA 4OT1L 4EZJA 1FH5L 3PQYE 2PPEA 1MFDH 2C8NA 2QQKH 3SSGA 4CVZA 3HHMA 3NP3A 2M2DA 2OCFD 4ZSOB 3WUWA 5EEZA 1EA9C 1I7UB 2HT4D 3LD8B 4NKIH 4NI3A 5CCGE 2BVYA 4KROC 5FM4A 2XN9D 2Q8BH 2IDFA 1UEMA 2DIAA 5MERB 1BFTA 2HKFL 1DANU 1S7WA 4FG6D 2Y1YA 1UGNA 3A21A 4R83A 4JFEA 4ETQB 1FCGA 5KVFE 5L88L 1DO6A 1I8LA 2A38A 3SGJC 3U1PA 3CAFA 4LSTH 4J8QA 1QA9A 1E6OH 4FMVA 5H2BA 3KLHD 3BIAX 1J8HD 1H9VA 1LD9B 4ZW5A 2NZ1A 4Y2DA 1OAXL 2Y69B 3EO9L 4TSBH 1OP9A 2EDQA 5J1AA 1YNTF 5AVVB 3WE6A 1YN7B 4KGJA 3WNPA 5KBKA 3FQTB 4ADJA 2L8AA 4WW2B 3B7UX 5GS1C 2OX5A 4GW1B 3GIZH 4UQEA 1KJMB 3CZJA 1SXAA 2P8LA 1A2YB 2YARA 3AM8A 4KHXH 2V9RA 1TZIA 1PKQB 5HDOA 3NSYA 3KWVA 1J48A 2YA2A 5DFAA 1ZLVK 2CK0L 2X7LA 2CU9A 1RERA 3G6JE 3BN9D 1MCOL 1M6UA 3LNEA 3ZE2B 3IJEB 5AVUB 4I9XA 1SLVA 2FGWL 1W16A 3VRLF 1D5BB 5E4EB 2DQCH 5FYLL 3AXLA 1MUJB 4XCNB 1H3XA 1QTSA 2NLJA 3I9GH 2Z92A 2Z92B 3HE6B 3PRZA 3HN5A 4I5BB 4WWKB 4AYSA 3T6VA 5AW0B 5CGMA 3N3EA 1NJ9B 4M62H 1KB9K 4PTUA 4ZSOE 3IGFA 3VXQA 4NCDA 2HRHA 5EOTA 1NC4D 2VMJA 2YPLA 5IOPA 3VFRA 1YQVL 4MAYA 4KQ3L 4ZO9A 1QSVA 1W80A 9CGTA 2MNUA 3GB7A 3OXRA 1NMBL 1QWNA 1SYVB 4IGBB 3WYRA 1MFEL 2QQKL 2DLFL 1GGUA 4Z95L 3KWUA 3GRGA 2Y5EA 2XA3A 1GCFA 4LPUA 2FVNA 3WEXA 2MMXA 3VFMB 4ZYKB 3TBCA 4AUYA 4PWFA 4DOHB 2XLLA 4ZMWA 1UASA 1F45A 2V9UA 4JM2C 4RAVB 4LSVL 3VFVA 3N40F 4BA8A 3UYRH 3WMSA 4G59C 2VZ1A 1YY9D 2LU7A 2ZWNA 4XP9L 5ILTH 5I1KH 1JXFA 1YRKA 4D0DA 5C2UB 3DX7B 5GRJL 5D7LE 1XD1A 2E9BA 3IBOA 4R9HA 3TH4T 4HWBL 4PD4K 3D50A 3QR1A 1T1XB 2QV2A 5I0YA 2XICA 3V5KA 5KOMC 3JWDC 1E8YA 3ZDZE 1OW0C 3BUDA 2HJFA 3PNWA 5JQ6L 3FXIC 1FC1A 5FK9B 1QW8A 3ARWA 1J5OH 2GSIB 3WDHA 1K2DA 4L8SA 1JPTH 3GS7A 4HKXB 1ZLDA 3BH9A 4L3CB 3FB7B 4QRPE 4FNLL 4XVTH 1MRCH 4WHYG 1SXBA 3KGSA 1M71A 1T7XA 4XH2B 2DQHH 5ALCH 4XPHH 1TNNA 4XAWL 5HDRA 4FA7B 5AVWB 2ZOKB 2DS4A 4TLTA 2XV3A 2WVVA 2EO9A 1GOHA 3II3A 1I7ZB 3L3DA 1IC7L 4LLYA 4OD3L 4FULA 3ZO9A 1IBFA 4AUUA 4GRMA 4P5TC 3BQUA 3GMQA 3OKKA 5DS2A 3ATAA 3MJWA 3PF2A 3FT9A 2L7QA 3CLFH 2XX0A 4YSUA 3ECUA 1FL3B 3OAZK 4GSRA 5KANI 3UBFA 2YUZA 5C0CE 1IC7H 4PYHA 1EFXD 3P4MB 3CZEA 4MLSA 3K1DA 2J5LB 1RUML 2OSLB 4EPSA 5BOZG 5CLWA 3UX9B 5ID1B 2LTQC 2GK2A 5BO1H 1NUGA 4WNSA 1EJFA 4B97A 2NXYD 1MRDL 2CBQA 4ZOAA 2VAAB 5D1XC 4AEIH 3BVVA 4UDTB 5I18H 4RZCB 1LEGB 3ARFB 4DTGH 2ZUTA 4F1ZA 1PBYA 4P9HH 3L3JB 5IESL 4JBSA 4FJZA 2VDKL 2PYEA 3GSXA 3TN0D 1U41A 3FC8A 3C08L 4J3VA 2Z31B 2F7OA 3VSUA 1NINA 5BUGA 2DIEA 4GPVA 4K9EC 4HWEL 3D85A 1S9WB 4Z18A 1YAZA 4PUBH 2BP5M 4W9HC 5CIPB 4AK2A 4WUKL 3CFEA