2NZ1A

Viral chemokine binding protein m3 from murine gammaherpesvirus68 in complex with the cc-chemokine ccl2/mcp-1
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
371
structure length
371
Chain Sequence
HSSGVSTQSVDLSQIKRGDEIQAHCLTPAETEVTECAGILKDVLSKNLHELQGLCNVKNKMGVPWVSVEELGQEIITGRLPFPSVGGTPVNDLVRVLVVAESNTPEETPEEEFYAYVELQTELYTFGLSDDNVVFTSDYMTVWMIDIPKSYVDVGMLTRATFLEQWPGAKVTVMIPYSSTFTWCGELGAISEESAPQPSLSARSPVCKNSARYSTSKFCEVDGCTAETGMEKMSLLTPFGGPPQQAKMNTCPCYYKYSVSPLPAMDHLILADLAGLDSLTSPVYVMAAYFDSTHENPVRPSSKLYHCALQMTSHDGVWTSTSSEQCPIRLVEGQSQNVLQVRVAPTSMPNLVGVSLMLEGQQYRLEYFGDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein GAMMAHV.M3
publication title Dual GPCR and GAG mimicry by the M3 chemokine decoy receptor.
pubmed doi rcsb
source organism Murid herpesvirus 4
molecule tags Viral protein/cytokine
total genus 85
structure length 371
sequence length 371
chains with identical sequence B, X
ec nomenclature
pdb deposition date 2006-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09213 M3 M3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1330 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2nz1A01
2.60.40.1340 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2nz1A02
1ML0A 2NZ1A 2NYZA 1MKFA
chains in the Genus database with same CATH superfamily
3QB7C 2ADJA 3DXAA 1GGCL 3NCBB 2AK1H 5KVEL 1EJOH 1G5GA 4TL5A 1FFRA 3KDPB 5EU7E 4KAQL 5IB5A 1LO2L 1CFVH 3BC9A 1KJVA 3I3EA 3OG4B 3OV6A 1I8LA 1R5WA 3C12A 2LQRA 2X4TB 1W0WB 2J8OA 3CVHA 1EXUB 3SOBH 1YCSA 2Q6WB 1ZDSA 1IGJB 3VM7A 3PWVB 4XMKH 5C0JA 1H8SA 2NUPB 4XO4A 5BZZA 4KRLB 1C16B 1QD0A 1YEDB 3SSGA 1CTMA 5JHAA 1DJSA 2PXYB 2Y7OA 5IIEB 1OD9A 4XCCL 2YUWA 3MNDA 2BVOB 1Y0LA 2F0CA 5BZWA 2R4SL 2YXFA 4AJYV 4UQDA 1MFBH 4YDVA 1J9SA 4YDNA 2FTAA 3BVWA 3RZCC 5E8DH 3QXDA 4MQXC 3ZT6A 3FRPG 1AQDB 4PY7B 2W60A 5LGKA 1BGXH 4Y1AA 4XP1L 4LVOB 1SXBA 1M7XA 5I0VA 2ZD0A 2C5DC 3LD8C 3TO4A 3NRFA 3HZVB 4XB8A 5DSCB 1CYGA 2CKNA 3C5ZB 3MBXH 3TYGL 1BIIB 3VRJB 1BYNA 4P9ML 1EAOA 4WW1A 4W9EC 4MJJA 3ZN6A 2ADIA 1IV8A 2WIIA 2YZ1A 1G9NC 1GAFH 3RVUD 4NZDA 4PSRA 4JDEB 4RISH 2K70A 1CE1L 5HD8C 4HOXA 4RAHA 3G6JE 4F8NA 2GUOA 5CU5A 4YDIL 3ZE0F 5CEZH 1L6XA 3DVNB 3GHPA 3IRZA 4N2GA 1XDTT 3UYPA 4DVRH 1AZNA 4XCNA 4HF5H 5C0BB 1X9LA 5FM5M 1IL1B 3DVGB 3N9GL 1U33A 4KY1H 4WWKB 5ALBH 3ZRCC 4B53A 1NEZA 1WICA 1MN4A 3OHXB 4L1TA 1U3HC 1S9KC 2V6HA 4P5TD 3FOLA 2F54D 1TETH 2NZ9C 3H9HA 2X05A 4N20A 4YEEA 4G5AA 5FYJD 3ZMNA 4JQIH 1OB1B 3ISYA 1P7QA 2ZKWA 1S7VA 2J12B 4YSOA 1RPUA 1HWGB 4YSRA 2LAAA 2R7EA 1WA2X 3L9BA 4JKNA 4LKCB 3SJVD 4LEBA 5BNXD 3VFMA 5T3ZD 3HG4A 1O5DT 4JZNA 2CE6A 1AE6H 4XNMB 2PMZA 1E4WH 1FG2B 4X7CC 1CDIA 2QPFA 4MA1B 4YAQB 2E56A 1X6NA 3HNSH 3ZO9A 1RJZB 3QJUB 5EMYA 2KL6A 4GB9A 4IRJB 5G5DB 1H8OA 4TOYL 4P49A 4E9RA 1FPTL 3GB7A 1MCSA 4HBQA 3GXTA 4QRBA 1MJJB 5GZOC 2UWEE 2EC9T 2NDGA 3NPSC 5FEBA 3V4PL 4NUGL 4GKNA 4FP8H 4MA8L 1BVZA 1BECA 4PQXA 5AFAA 1DBJL 5CS7A 1XGZA 3U1SH 3T0EE 2BFVL 1WH0A 3F00A 3FB5B 4TNGA 1P0SE 2DEXX 5T1DH 3REWA 2BINA 3PQYB 2Y1VA 1QQDA 1ED3B 3ZUNC 3GI8L 4Z3TA 5B3SB 1DBAL 4KI5F 2ZF8A 5GS3A 5C3IA 4P9HH 5B22A 3IJSB 1CFSA 1WUZA 3P3YA 2HFGL 1D5IH 3E6FA 1FL5B 4M7KH 3DIFB 1BEXA 1RHHB 2AXFA 1LVEA 4PPTA 3VFOA 5LXVA 1J1XL 5CIPH 4JM4L 4WFHD 5TTRA 1FNEA 2E75C 4M5YH 1S9WB 1HQ4A 1LO5B 1UM6H 2Q3ZA 5BO1H 1B0RA 4QAWA 2NX5A 1WSST 4ISVB 3Q48A 4U0RB 4TN9A 1CD9B 1JDCA 4BM7A 4LCWE 4KVPA 5SV3A 3VJ6A 2NT1A 4RFEA 3FZUD 2XXGA 3D12B 5ISZB 1I3RB 1P6FA 3EHBB 2PPDA 4FTVB 3EGDB 1DSFH 3WNMA 2CDFB 1R47A 4Z7WA 5GJSL 4AXWB 5IR1A 3QEUB 4J23A 3LEXA 3ZYJA 4B9FA 2BVQA 4AIEA 1UXLA 3NMEA 3OKYA 4AYSA 5JNYB 1BVNT 1RJCA 1X3DA 3I6LD 4PRDB 3ABLB 3TCTA 3P77A 4FS0A 2QQQA 1U8KA 4YSQA 4BCZA 4HUXB 3DK0A 1PFOA 1M6OB 5I66B 3LQAC 5DYOB 2WLLA 5I1EH 4Y4FC 4P3DB 2WZ5A 3V8OA 3UTPE 3EYSH 3P4MA 2J4WL 1UGKA 1D6EA 1MQKH 5TF1L 2NY7L 5EOTA 4BUQA 1CICA 2NPLX 3GKZA 2NZ1A 5DF0A 4YFEA 4PRBB 5E56A 4G11A 4L8BA 4WAFA 5JMOC 3BMWA 1AQKL 1YEFL 1Q0XL 2D7OA 1JS4A 1CIUA 4LSSH 4E9TA 1KCWA 4BSVA 2P52A 2D03H 1G1YA 1U8CA 4GRLC 2Z31C 4KVNL 3HBGA 3K4ZA 1OLZA 1NBZA 3HIZA 4D9RD 3F7KA 5I19L 4DCQB 4BHUI 4PY8I 2QKIC 2N0KA 3TZVB 1ZT1B 4X8CA 3NUKA 3FN0H 4CGTA 4HWUA 3KE0A 1AXTL 4HZAA 3BFOA 1BD2E 3THMH 4WEBH 5FS5A 3F2LA 4P9HC 1B4JL 4XPBL 1XF5B 1E65A 25C8H 2C34A 4AH2A 4JREC 5HGGS 2W07A 5KVGH 4UBDC 1QHQA 3RZCD 4ZUUB 4BCYA 4MQXD 4HT1L 3VXTA 4DP9X 1JGIA 4ZMXA 4R2GB 3KLHC 4F7TB 2FR4A 3K6FA 2A73A 1QA9A 4E2OA 2BIQA 2XSKA 4LASL 4PN6A 1F58H 4OIFA 2H7WA 3LJ3A 1RUML 1JZEA 2YAQA 1SQMA 4JFFA 5B1BB 4F7CB 2GSGB 1J9TA 2D0GA 2V9UA 2XT1B 4ABQA 2MKLC 3KL0A 5IK3A 4PG9B 1RULH 4ZAKA 5LG1A 3VMPA 1ANUA 4P46A 3UG5A 3K6SB 4FQHB 2QJDA 3IN2A 1NEZG 3RILA 4U1SA 2OPCA 4G59C 5TDNA 1KEML 3QHZH 2B1HL 3OR6A 1LXMA 3VCLB 2UWEF 2VDML 4PJGE 4W9JC 3GGWA 4YGVB 2XA8L 5DMYA 1ZEAL 4I87A 5HI5C 4XR8C 1S46A 4PGBB 1JXFA 4NZRH 1AOZA 1QSEA 3H2PA 4CL7A 5ITFA 1LE5A 1RK1A 5E70A 1K72A 4EDXB 3U46B 1U3HD 3HAEG 2GIMA 3MRGB 2P80A 2WINB 3C6SB 2Y1ZA 3L17A 3KH4A 4W9KC 2OYKA 3I50L 2QQLH 3IS1X 4OZHE 3EBGA 4NQED 4DO5A 3S8FB 1V3LA 4X9YA 2PETA 3DJ9A 3Q5TA 2DIBA 3P2DA 3BP5A 3L48A 4GMTH 4IMKC 3VFRB 1I4FB 2HWZL 4DW2H 5C07A 3S34L 4WUUA 8CGTA 3KPNB 2XWBA 1CD8A 4RMSA 4Q2ZA 2LW3A 1H5BA 4G42A 4HS8L 1HL9A 2BP0B 2X1PA 4GRLB 3WTYA 4OTXH 2YK1H 5D4HA 5GZOD 4MJIE 4NUQA 4CN1A 4UOW1 2VLJD 5J12C 5IB3B 4KKZA 1RQ5A 4N2BA 1FNHA 1NC4A 3LZFH 2DKSA 5DHVB 4LFHD 1XH3B 1JWMB 2VLLA 3CAFA 4BK5C 4U3SB 4NI6A 5CCHE 4LHUB 5JTWA 2CAKA 5MENA 2A4ZA 2EIMB 1HHIA 1T20A 3P4NA 1PZSA 3VXRA 1MCLA 1P5UB 4YHOH 3ILPB 1BAGA 1RZ7H 3VE0B 4RA3A 2BIIA 1BEYL 1UB6B 2FH6A 2G5BA 3B9KD 4ZUVA 4JFXA 3HS0C 3WLWC 1I3GL 5AW0B 5FECB 2C9PA 4LARH 3S37H 2Z8SA 1NFDE 2IOOA 4K9EH 4BFRA 4HGMA 2X0VA 5DJAB 1NH6A 4Q6IA 3A47A 3BP6A 1VDGA 2ZXCA 4IRZL 4HHAA 3U25A 5DZ9A 3V6OE 3S8WA 3G08B 1PYWB 4XP9H 4OKVB 5A7EA 3PHSA 4JLRB 3B7SA 1L6ZA 3KJ6L 2AI0H 3ELAT 5FDWB 2OJEB 1YC7A 3TA3C 1O6TA 3D39B 4UNIA 1XH1A 3TNNA 5DGRA 1IO4C 1FN4B 3BVXA 2ZCHH 1B0GB 5KW9H 3N50A 2CKBH 2VLRA 4IOFC 4ZMQA 2X7LB 2YPLB 3K2IA 2HSIA 4PV8A 3EH5B 3S3BB 4ZMVA 4IRSC 2YMXH 4P2YA 3FNKA 2J2ZB 3U4EB 4N0YH 2DLTA 3BPLC 2TSBA 3NP4A 4Y4FD 3RY6C 1UJ3A 2V2XA 4NZFA 4KTEH 1BF2A 3TX4A 3INUL 3QIWA 1N3NA 4PP2A 4P5RA 5E00A 4LESA 3V4VB 5IB5B 4BQCA 3PWUA 8FABB 3BIKA 4XWGL 1YMMA 2YZ8A 1KJVB 3PWPD 3HG3A 5DQDL 1R5WB 2X6AA 5C9KA 1X5KA 3O2WH 4F9LA 2HPTA 5EF2A 3RWGB 2R1WA 2XKNA 3GBDA 5BPPA 4MJHA 3UAJC 1IKOP 2CLVA 1U42A 3NJLA 5F6IC 1KENH 3MRIB 4J3BA 3Q9PA 1Y0LB 5HGBB 4Z23A 2JQZA 1L7IL 1BZ7A 3KPSB 4YDVB 4W4OA 5F7LB 4FLOA 4UANA 4ONFL 4GI6A 2I60L 4GMSL 3QJHA 4N1CA 4F37K 3QXDB 4JN2A 4TNVK 4GAGL 1GH7A 1NKOA 3IF1B 1V27A 3BP7A 2GW5A 2XZAH 5CLTA 1LTXA 4PJGF 3C5JB 3OHMB 5IHUL 1MHCA 2QPDB 1KJ3L 1A3RH 5A16A 3BCDA 3IDXL 3GDCA 3RFZC 3TT1H 2F53D 1IGMH 5FHBL 5SWQB 5KYWA 4WW1B 1BZ9B 2DZEA 3UERA 2ZUUA 1KELH 3U6XS 2WIIB 4AGPA 5CF3A 3RVTD 3VWKA 2MQ0A 1JN6A 4AQ1C 2FBOJ 2IBZY 2NNCA 2NY2C 2FJGA 3NH7H 4ANKA 4K9EC 4UT9L 4DO6A 4Y9CA 3A67L 2HT2C 2E6JA 5B1CA 2R0WH 1SEBA 3E38A 1EIBA 4JPQA 2DS4A 5KTEL 4M43L 3MA7A 3OZ9H 1VZGA 3QSKB 3RTQA 3HMXH 3IBEA 2HLAA 3DSFL 1KCLA 2JQAA 4Y0GA 5J13B 4AYFB 4PLKD 2ZCKH 3AGWA 3D5OF 5I8EA 4NB7A 3H9HB 3LHAA 3TA3B 4ZTPL 1LJMA 1ZVHA 3G6DH 1DCLA 1SJMA 3GXDA 2IG2L 1P7QB 5DC0A 1S7VB 3LH8A 3QCUH 4IRSB 1Q9WB 4FA7B 3KL3A 4M00A 2VQTA 1OQOA 4YSAA 1I7TA 3QUMB 4JZNB 1A7RH 2UWEA 3PHQA 1ECYA 4FZEH 1BOGB 3IVKA 5K9KB 2XN9E 4P5MA 4TF4A 1U8IA 3ZKXB 1NGZA 3DI2B 2WW8A 2YAOA 1R3LA 3MCG1 3FUKA 1T5WA 1Y6MR 1T66D 2OX5A 43CAB 1JWSB 2ZTBA 4QWWC 1SDAB 3LKSA 4Q74A 4RWHA 2IPUK 3TIEA 5IWLC 1GGBL 1K5WA 3SPJA 3VG9C 1VIWA 5JYLA 1PAZA 3O0RL 1FLRH 4LAQH 4Y2OA 5KBMA 5KVDL 4H8UA 1ETZB 2OZ4L 5F9OH 1PNCA 2FBJH 1NFDF 4Z95H 2B2XH 3GMLB 4HLZH 3NYKA 2DEYX 2BSSA 3KGRA 3CDYA 3K72A 1BZEA 1GGYA 3BWAB 4YHKH 1OM9A 1IFHH 1MHPH 2Q8AH 1KZQA 1P9MC 2WSDA 4Y9EA 1BIHA 5CKAA 5LAPA 5D7LD 1OCWH 1PSKL 2DWDA 1CMOA 4HP5A 1HHHA 1CJYA 3A24A 4LCIH 5I26A 3MUY1 2AJZB 3ZZSA 2G3MA 1MIEH 1HL8A 2ZOLB 4XPAH 5KYYB 2WWKO 1HQ4B 3UC2A 2X87A 2GJ6E 4FEMA 1OPGL 4YHPB 1B0RB 1TIUA 1Z9OA 3ZTJG 1G7IA 1ZIAA 2ATKB 5F88A 3SIKA 4HKBB 1L9SA 4X6DF 2ZCZA 1CVRA 3D3VB 3GRWA 1B90A 4K73A 1TQSA 3HHMA 4J3TA 5DEFA 3U30B 3VJ6B 3A4DA 1Z5LA 4ZFQA 3WLWD 5L9DL 3T2OA 2BY2A 2DV6A 1AH1A 3TFKC 3PV6B 2DQHH 1NMBH 1SY6L 4HJUA 4W9HC 3K6DA 2CBTA 3CFDB 1XGRB 3IS0X 4ZMAT 3RFRA 5FPIA 1YPZF 2BRQA 5BZDB 3S36H 3ML8A 1GCYA 1BJ8A 3V0DA 3O3DB 3CSTA 1EHLH 1NMAH 4Y1TA 4Y4HA 1OAYH 2WLLB 1GOGA 1MFUA 1CYXA 2M8XA 1RZJH 1VESA 5KYNA 1GJIA 2UV3A 2YN3A 3HI5H 4N2EA 1IE5A 4N0FB 3KEDA 5EO0A 3BP4A 3VW3H 5EOTB 2XBDA 3T65B 3H42H 5SX5H 3BXNB 3LN4A 3WO4B 2J25A 4NM4L 4GSQA 4MYPA 4L8BB 4U6XB 4NZ8A 1GY1A 4MHHI 3TBCA 4B97A 1D9KC 1PZ3A 3WEBA 1G0DA 1AZCA 2PABA 2BXYA 1PLGH 5EU6E 1U8CB 2AV7A 1N2RB 5C97A 5BRZD 5HYFA 1BD2A 4FI7A 3D0VA 5CUSL 2YQBA 4PJ7F 2GJZB 2ORBL 3DV4A 4LEXL 3GS7A 5FO7A 2AGJH 3UAJD 3QXVA 3MBEA 4NO3A 5CILH 1AZUA 5DMIL 1GGIH 3L95A 2WWNA 3PP4L 1UH4A 2CNYA 2F58L 3QXTA 3V0VA 5MEQA 4AH2B 2VW7A 5A6IA 3H54A 4XN2A 4WSGA 3CX2A 4HBCH 1YECH 1T7VA 3CFBB 2VRKA 3NSJA 3U2SB 3WFEL 2A73B 5J89A 2ZXDA 4X7EC 4YHZH 2VKXA 1PVHA 3NIFE 1F3JA 4WI4A 5D2NC 1NCBH 2GTZA 3L9RB 3QK0A 5F1SA 2ZIDA 1TTGA 2P5WE 1CDHA 5D6CA 1SNRA 4N0RA 4CC4C 4GKZA 2K0RA 1TF4A 4IJ3B 4H2CA 4JFFB 4RCAA 5E6YA 3K4AA 1DVQA 5EUOA 3BZ4B 4XHJC 1MI5B 4DP0X 1E7UA 1HSAB 2AV1A 4J3SA 2EDNA 5IK3B 2Q86B 3HPJA 1W72A 4ZAKB 4P46B 3EGSA 5H8DA 5IW6B 4M7JH 3TJPA 3TURA 4UAOC 4G7SB 1NLDL 4U1SB 4OF6A 2NY2D 5E0FA 3RNKB 1GGCH 3C5SA 5KVEH 3M17A 5AAMA 1VCBC 2J7LA 2EDKA 2HT2D 3LIUA 1LO2H 4CJ1A 4FEIA 2VW6A 1CPUA 4I77L 1TFPA 1NKRA 2JK5A 2WXJA 2Z35A 3GLZA 1HKLL 2FQGA 3ML9A 4WSJA 1YN6A 1YZZA 1N8ZA 1RZJC 1DANT 3RWCA 5I1KL 3QEGH 3CFEB 3L1EA 4JK0D 1KIUA 1QSZA 3GNMH 2W9LA 4XCCH 1A4KA 1QKZL 2ZICA 2KMWA 2R4SH 3DARA 1YEGH 1MREH 4YDKL 3K3QA 4QRPE 4PJHB 3W37A 4NSKB 3LCYA 5HGAA 1QRND 4OD3L 3BP5B 4JHAL 5HGDA 3QH3B 3TBSA 1A66A 3HFFA 4TSAL 1DQQB 3U9UA 3W5MA 3ZIMA 1S4IA 4A7GF 4LDCA 4JM2F 5KJRL 1K5NA 1PS3A 1V3JA 4G42B 4OLXL 3QIUB 4GW5B 5AVUB 2YA1A 1X4XA 4H13C 3SZKC 2X2JA 2FECL 4YIQA 5BXFA 1FL6A 4QLWA 1CE1H 4WTWA 3QJSB 2VLLB 4IIZA 4YDIH 1A0QL 2IH3B 4M61A 2X4QA 1NGWA 1Q9LB 4MJ6A 2IBZX 3IB4A 2X3CA 1HHIB 1B2YA 7TAAA 1XWVA 2CHWA 5HDBE 2YBGA 3ZKQD 3BAXA 1DN0A 2B20A 2XOTA 4YC2B 1KJ2L 4Y16A 1BVKA 5F8QC 1D5ZB 1BX2B 2KHAA 4YHLH 2G5BB 5L8KB 3R4DA 5GJTL 4ZUVB 1ZTMA 1WHOA 5T5FL 3V6BR 1KT2B 3HFML 2MPVA 3Q1EA 3SDCA 1ACYH 5LBGA 3MUZ1 3U0WL 1O7DE 1J7VR 1ZE3C 2WVUA 4OJAA 4LLWA 4Q6IB 3QDMD 3WMPA 4JPWL 1EDQA 1I9RL 2A4EA 2Z92A 1UWXK 2YA2A 2I25N 2DH2A 3I9AA 1BHGA 3TFKD 3L3GA 5T1LD 3ECBB 4FMKA 5ICUA 3KPOA 4HSAC 1E4JA 2FHBA 5D7IE 5D1QC 3TNNB 3ZKMC 3UP6A 1G6RB 1MZYA 4X6DA 1XF4B 2EC8A 2VLRB 2FB4L 4YZFE 3V4PH 5J11B 4M7ZB 4YOKA 1SUJA 1DBJH 5AQ0A 2BIPA 3I75A 4JFDD 5D7KE 2YPVL 4JDZB 5DMJB 2BFVH 5GRVL 1NUDA 2QADB 4GFTB 1XBDA 4NHUA 3GHEL 1JD7A 5A2JH 3NIDE 3CBKB 3EYVA 1YPZA 3GI8H 3CFMA 1DBAH 2CIIA 2NR6C 3G5VA 1N3NB 3QIWB 4PP2B 2A4CA 3AAZB 3PAUA 3PWUB 4ZS6D 2OR8A 1SJHB 1DQVA 1YMMB 3NIFF 1E67A 2HFGH 3OF6D 3OX8A 4R90H 3VFVA 1KCRL 1QABA 4XT1C 3RGHA 3WNPA 1TTFA 4UIKH 4AKOA 4JN1L 5LWYL 2R1WB 2XKNB 4F20A 5EC1B 1LP9B 1D9KD 3Q0HA 2W80C 5K1VA 4G71B 4JKPL 4NAMA 1U2YA 2ENYA 3NFPA 5J0BA 2PPCA 1J87A 2HLFC 3F7RA 3TLRA 3KPLA 3MCYA 1KPVB 3NCMA 4S2SA 3QJHB 4L4VB 3FFDA 3IJHA 3AXLA 4FABL 2EH7H 2ZAIA 1RK7A 2DIJA 1W2KT 5A16B 4PJ7A 3U82B 2NLJB 1SLXA 2G60H 3M7FB 3SCMD 3BWZA 1LMIA 4UTBA 3AW5A 3ROLA 4OFYA 3MV9A 1YMHA 4L3CB 2J6WA 4M1GL 4U1JA 3VWKB 5TPWL 2F1AA 4FGMA 5F1KC 3FBKA 1SN2A 2NY7H 3RPBA 1T6WA 3T6ZA 3E1ZA 4WVRA 1KB9J 5CN2A 1CFQB 4Z7UB 1XGQA 4PFEA 2BIOA 4X5LA 3SE4A 2EO9A 3RTQB 3FDWA 4JFHD 1BP3B 2HLAB 1TQBB 1AQKH 1YEFH 3EFFB 4HD9A 5SX5K 2H8PB 1Q0XH 3A0OA 5I8EB 3BD4A 3GJFH 3QBTB 4LQFL 4APXA 4LGSB 1DVXA 1UA3A 3VGBA 1BJ1H 3IDMB 3VD0A 2H1PH 1XCTA 5I19H 1TZHA 5JIMA 4G82A 4OZGB 1PFCA 3VWJC 3WIHA 3SKOB 3H7BA 1ZHNB 1PAMA 3POCA 2EILB 2PUQT 5B1JC 1AXTH 1MFDL 3CTTA 2WTRB 4AIZA 2LVCA 4P5MB 4J3WA 4PGZA 1B4JH 4XPBH 1NGZB 5FK9B 1R3LB 2QBWA 5HDBF 2FX9L 4CADA 5LGJB 1T5WB 2ODHA 3N06B 2OX5B 3PFUA 3WHE0 2I9TA 4X4XB 3CFJA 4DOHE 1B2WL 3TIEB 3X1NA 5DC2A 2BCMA 5L88L 3GZQA 3ARDA 5IF0B 4UZGA 3QR1A 4B9PA 4NHCL 4FLQA 2AEOA 1OAQL 1RUMH 2NNXA 5AOIA 2R9HC 3CSYB 4HALA 4M7LL 3U4BL 4KZEL 3DUSA 1ZD6A 2GKIA 5ANME 4QKTA 5CBAA 4ZW6A 2BSSB 3QUZB 5HHNA 4B6ZA 3K8KA 3QEQE 4GOSA 2VR7A 1XQ4A 2VL4A 3MODL 3UGEA 4A7GA 2GJ6A 4JM2A 1YNTB 2Z7YA 3I6GB 1MUJA 4EZLA 3H6JA 1KEMH 5KVFH 2CLRA 5D7IF 2IFGA 4HOZA 3WS6C 4NC0B 1BJ1J 2VDMH 3DRTA 1A7BA 2XA8H 1ZEAH 4OIBA 2X40A 4NQDA 1MHHB 1GIGL 5FAAA 5F88B 2HJLB 4PB9L 5DJYA 2D7QA 2JE8A 2XN2A 4U1HB 2NW2B 4ZFZA 1A4JA 2H9GB 2MPAL 3CNKA 4D8PA 3I50H 2FD6L 3QXUA 1Z5LB 4N3UA 5LNDA 4F33A 4IMLA 2C3XA 5EWIL 1HZKA 1Y1UA 5EIIA 4MMZA 1CGSH 3ERXA 3JWNH 1PQZB 1CO1A 4E68A 2PYEB 1KZYA 2R39A 5C0CD 4JQXA 5IB2B 1O6VA 2HWZH 1ADWA 3QXWA 4FXKA 4CSTA 1KTBA 3MKKA 3VAEA 5D1QD 2FX8L 5EF3A 2DI7A 3MSPA 4FQXC 3QR2A 2ZWSA 4B60A 5DZPA 1MELA 2FEEL 3QO0A 4P23C 1UWGL 3ZBMA 4ZSOB 1EHAA 1BFTA 4I2XE 2VDQB 5EU6A 4A2HA 2GK2A 2ZOUA 1TU2A 4GINA 4HU2A 1MH5A 4C59B 3BKYL 4WFFD 1OO2A 3GI9L 3MO1A 5D72L 3Q1SL 3VXMA 3WFCL 2NR6D 1AP2B 4HWBA 4I85A 4FE9A 1K8DA 2AV7B 5EBWB 3KMDA 1AO7D 3BQUB 1BEYH 4PRAA 3N1GC 3DO4A 1WISA 3EXLA 5FO7B 1YEEH 1KFAH 2DMBA 3GMNB 3M6DA 1I3GH 3MBEB 4KROC 4NO3B 1FH2A 2MCPL 2UX6A 4QRTA 2EYSA 5MEQB 3V7MA 5EORL 3D05A 5IBUB 2B39A 2P5WA 2YLHA 2I7OA 3MNWA 4D8OA 1W0VB 3HTLX 4HFWA 3VX1A 4IRZH 4PM1A 4JPKL 1N7ML 1NIBA 3FH7A 1HJBC 2FJFB 2V5TA 5GPRA 4XMUA 4NNYA 1KYDA 1BFVL 3KJ6H 1TUPA 5AW3B 4MQ7A 5DDHA 1W8EA 1ZTXE 4XE0A 3RURA 4YXHL 3W0WD 1UEYA 1ERNA 1KFGA 3O2DH 4GKZB 2E9BA 2FO4A 3TJHC 1ROCA 2AJ3A 5FXCH 1RP8A 5EUOB 2XZZA 2AV1B 2B14A 1DZ0A 1WFOA 3HPJB 3FF8A 4ORZC 2EQDA 4FQ2L 4OLYL 4G9DB 5K9OA 1MY5A 2CJTA 4K07A 5IFJA 2MHAA 2ROXA 3KWWB 3JWNC 3GSNL 5FYKH 3MRLA 5IMOA 2E7HA 4HSQA 3C5SB 3INUH 6FABH 1M7DA 3M17B 3VFTB 3GXMA 1IC7L 4GP8B 2Q8BH 5DQDH 4LIQE 3D4YA 3QUXA 5SWZD 5CP3H 3OB8A 1ND0A 5DUML 1XAKA 3E6HB 4QRPA 5CJBA 5F89A 1KIUB 2FBRA 3RTLA 4APQA 5JO5B 1K8IB 4GSDL 4NN5B 1P4LB 4N2OA 1L7IH 4WTQA 4DAGL 2R83A 4ONFH 2I60H 4GMSH 3VWJD 1WAPA 4IKKA 4GAGH 3EZJB 3MJ9L 4JR9H 4FJYA 4R6UA 1FO0A 3P0VL 4UQ2B 3TBSB 1FV1B 3ET9F 2BPBA 2ZOKB 5HJGA 5IHUH 5HYJD 4PWKA 1F4YL 1K5NB 1NCIA 1KJ3H 4V2CB 3S7GA 2HRLA 1JYNA 5FHBH 1LD9B 1BZQK 1A6TA 3UJIL 1I9JL 4U4BA 3GS0A 4YIQB 3U7WH 3DHMA 4GG8A 1FIGL 4FYSA 3UBXA 1R3HA 2GEQA 1F1AA 2WCPA 4UDUA 3IETB 3IJYB 5I17A 2R9HD 1FDLL 4M61B 3BVTA 4UT9H 1NGWB 3JTSA 4AI7A 5AVRB 2MNUA 1RUQL 3A67H 4Q8BA 4XP4H 4XOCA 1R3IL 5TE7L 1QSFE 3AT9A 5KTEH 1ODUA 1AG0A 2IAND 4M43H 2E46A 5PCYA 2HUEA 3WUWA 1DN0B 3LQZA 3HE6C 1MCIA 4N2CA 1U3YA 3BQVA 1BVKB 2BSED 4ZTPH 1SHXA 5DC9B 1WA1X 3VVVA 1HXYA 3HI6L 4RETB 3FYIB 2V5SA 2VISA 5FW8A 5KZCB 1RIHL 4OLEA 5EUKA 2M83A 5EIIG 1BFOB 2LTQC 4U1IB 5DLLA 3SDCB 1I1FA 5EDSA 4RRPM 2VQ1A 2DYPB 2CRZA 4JMNA 2BOLA 5D7IA 4YO0A 1ZGLM 4Y5YC 3MJ7B 4ZQTA 1U95A 1OP5H 3TPKA 3ATFA 5DS8A 4LQ1A 4O4YL 1NUFA 2R8SL 3L3GB 3HRZC 1HCYA 1FLTX 4KRPB 3P0GB 3RDTB 4J39A 5EZLA 3GQFA 1KXQE 1PLCA 2J43A 4XBMA 1GGBH 4X6DB 3WDIA 3FQXB 3S8GB 3PWLA 3QO1A 1P1VA 5T3ZE 3O0RH 4JRWA 1EAQA 1KWKA 3N1FC 5KVDH 2AERT 2OZ4H 1GYVA 1EEYA 2Y2TA 3B1UA 3MRNB 1J11A 3CFIC 4EI5D 1YPZB 4WNJA 4JFQA 4MB1A 2L3BA 1LMKA 3G5VB 3UFIA 2P5PA 5DD1L 4BJLA 4GRMA 1PSKH 3Q5OA 4EN3A 3VTTA 3ZR5A 1XB3A 1G7MA 2GFBA 2C26A 4ODWB 3I6SA 4O2EA 3IGAB 5BJTA 2B1AL 5EHFA 1OPGH 3H7LA 2EAEA 1KXTB 5GRYA 4AC4A 4BGLA 4N87A 4ZW3A 5I1DA 4TSBL 1XH2A 4X5WA 2XYCA 5C0AB 4ZFOL 3KPLB 2HKFL 2I07A 3MXWL 2JELL 3FFDB 1AGBA 4ALAH 3O41A 3EJRA 5L9DH 4TKWA 5F7AA 2AKRB 3AXLB 2CO1A 1SY6H 4MAYB 3EUDA 4Y5XC 1OGSA 4PJ7B 2CM5A 1INQB 4XGZA 1HZLA 4GI8A 1KLFA 2XPYA 4HWNA 1QWNA 3LMJH 4N28A 2XETA 3MV9B 7FABL 1OF2A 1DDTA 1I85C 3FU0A 2CCWA 4N2IA 1ZRUA 1MCEA 4U1JB 4F3FB 1OT2A 1BYPA 1OAZL 2GBTA 1X5HA 4G2AA 3I6LE 2EDRA 1GL4B 1LK3L 4AM0A 1XGQB 5L8LB 4E41E 4MD4B 4Z7OB 4NM4H 3PABA 1VENA 3MNVA 1MFAH 1HHGA 4XODA 2VSMB 5HDLA 3HRZB 3S88L 2JV6A 3MRHA 3VGFA 4APXB 3GSXB 1BZOA 1G7PB 5DO2C 4LBEA 1L3NA 2VRQA 3QJRB 2HJKA 1T7ZA 3TEXA 3NIGE 5CUSH 2VYRE 2CDGB 4P2OD 4EIBA 5E8EA 2ORBH 3B2XA 4X9HA 1TZHB 2JB5L 4HKXA 4R84A 2NXZB 4NERA 5C2BL 4WU5B 4AEIL 3MLPA 3VGAB 1RSYA 5D93B 3BJ91 4N22A 4A6YB 2PW2A 2VR6A 3PP4H 1UM4L 2ITDB 1DZBA 5GGRB 3JUYA 1LO4L 1I7RA 3OKEA 3HR6A 3FQ2A 5HYSA 3CFJB 2UVEA 3KBEA 1DLHB 5ANMA 3WFEH 1A3QA 3QRLA 1LDPL 1K4CA 5DEZA 4QXVA 5BW7A 3ARDB 2FNBA 2VAAA 3ECUA 4XPFH 5KSAB 3ZDXE 1JGDA 1DVFA 4OCWL 5EF0A 2JJSC 2SEBA 3MLVL 1R34A 2IBBA 3DUSB 3ZZLA 5LVEA 3EO9L 1FFQA 5CBAB 1NPNA 4K5MA 4NFCA 5DK0A 5F44A 2FSEA 5IHBA 1U8HA 3PCYA 3OMZA 4YDMA 4BZ1L 2Y7LA 1MUJB 4NZUH 3WUWG 4QRSB 1NLDH 2FIRT 2OA9A 2QSTA 3QEHA 2VMDA 2WNGA 5I1JH 4EDWL 2WYTA 4XHQA 2ZUQB 3RB7A 1UM5L 4XMXA 5DQ9A 1CDJA 2QGCA 4I77H 3HG1E 4PRPE 1HOEA 2YRBA 1HKLH 4MMXA 4NQDB 5ADOH 3K2UH 3PWJA 4MJ5A 3B6SB 4C56D 2R1XA 4ZFZB 2EYTB 2WUBL 4K71B 2ZUXA 5DVKA 2YOCA 1DDHB 4D8PB 5BV7L 4FFWD 1QKZH 2QTEA 1XAUA 1YG9A 2P5EB 2QV2A 4IMLB 2KLTA 4FXLA 4ZPTA 2P24B 4YDKH 3U9PH 3TEYA 4U6HA 5E9AA 2PR9A 4OD3H 1BSIA 4KZCA 1Q9KB 4JHAH 4KRNA 5FYKD 4NRYB 5I1LA 4TSAH 4NJAL 4U6YA 5INDA 1A3LL 1MLBA 5EN2B 5KJRH 2Z3FA 2EE9A 3ARSA 2V3EA 4D0DA 3L4YA 1S5IH 2V7NA 5HI4C 3BAWA 4I2XA 4OLXH 5FV1L 2X1OA 1FNAA 1TEFA 4NQEE 2K9FB 3ZTNL 1MCPL 1KEGL 4P3WA 3QO0B 1R1CA 2F74A 2VXVL 2WVTA 2DIEA 3FO9A 4P04A 3MGAA 5FUZL 3GIZL 1CQKA 1N8OE 2FLMA 1A0QH 4CVXA 1ZA6A 1AACA 3EBHA 2VDOB 2ZPKL 2VQUA 2PO6C 3MO1B 3DVIA 3VXMB 3CIAA 4HCIA 5J1AB 2EIZB 4LEOA 4YNYA 4OI8A 3ARRA 2VLJE 4D9LH 4TULL 4YXKL 1K8DB 5DHVH 5IT2L 4MYWB 1J10A 2A83B 4N2HA 3BUQA 4PRAB 5HSFA 2F7QA 4Y4KC 5GGVY 1ETA1 1H3GA 2UZPA 4P2QB 4KKBC 3OKNB 2PWFA 5T5FH 3LRSB 3HFMH 2O6FA 3F6LA 4ZZFA 1NBQA 1D5BA 2EYSB 4QJ5B 2ARWA 4J6RL 2OSLB 1K2DB 4FX5A 2A6DB 2ZWLT 3V6ZA 5K9QG 3P4LA 1GOHA 1RU9H 3RX5A 1JUFB 2EVJA 2X5PA 4JPWH 1YA5A 1I9RH 1JZ4A 1MCHA 4M02A 5EZPA 2HTKC 3C8DA 4N2DA 3NCYS 4KH2A 3X1EA 3WL9A 1AD9B 5LHDA 5DDHB 4OCYL 2KPWA 4S1DD 3BPNC 3NIGF 2K3TA 5JR1H 4KK5C 1N64L 1KULA 3HC0A 3GEWB 1MEXL 2FO4B 3ZE1E 2AJ3B 2OTPA 3RG1C 2OMZA 2YAPA 2FB4H 4F58L 5JIQA 2EADA 3VYPA 3UIZA 1JCKA 2JXMB 4H1LA 2I9LB 1VFBA 2YPVH 4NRZB 2WXHA 3FCTA 3GHEH 2C9VA 1Z5YD 2MHAB 3MRLB 5IMOB 1GYWA 1M7DB 2CR0A 1H15A 4LNVA 5KSVB 4FQIL 3RAJL 5EULV 2GJRA 2WQXA 2NY1C 3O45B 4GNKB 1W72L 3RB5A 4LCYA 1KCRH 4JDTL 2ITCA 3ZDXF 4ORGA 1ND0B 4CVZA 5LWYH 2IAMB 3C2SA 4JX0A 1RUKL 1AC0A 2O5ZL 4HAKA 3TASA 3QG6A 2ARJA 1U8JA 1NAMB 5BVPL 4JKPH 5DO2D 4JRFA 4N8PA 4APQB 1OXYA 2LFGA 1H0DA 2DM4A 3BH9A 3CVHH 4PWGA 3IGFA 3PWPE 3JV0A 4OF5A 2VB5A 5D1ZC 2WLYA 5HYSG 3JV6A 1CC3A 1CGYA 5DQJB 5HY9A 1UKTA 5IVZA 3EJYC 4FABH 4FXGA 5F6HI 5F7MC 4ZX5A 2EEDA 4HJGA 3KGTA 1MHEB 2D7TL 1O5PA 1JGLL 4ZO8A 3RL1B 2D31A 1BQSA 1G87A 3SBWA 4X8JA 3WJMB 3UBXB 2YXWA 1R3HB 2DJ4A 2XV2A 5A1AA 1F6FB 4M1GH 4RGNE 2YR3A 1QSFA 3X11B 3FQTA 2WJ7A 1JHLL 2FH8A 1OW0A 5I17B 1EZUA 5I1AA 5IW1A 1WWBX 3W9DA 2JTYA 4L9LA 1UUNA 1OQXA 3JTSB 2DLIA 1MCWM 5D4JA 1AFVL 3OKMB 4OCMC 3FCSA 4YVUA 1JD9A 3VXUA 4X6CE 4O02A 2QZQA 3REVA 4AIXA 2X6VA 3DYPA 3UOAB 3MREA 3LQZB 2XHNA 5AUMA 5IEHB 1AMYA 3O3AA 5IMMB 3PGDA 5F2FA 4IOSD 1HXYB 5FM4A 3VXSB 2C9XA 2F7OA 3WSQL 3SKMA 2F8VA 4F5CE 5ISZD 1ZVSB 4FTVD 1IGTA 2VQ1B 3BFWA 3X1BA 4BH7B 4L05A 1S9XB 3VD2A 4YO0B 1MFDH 4I18A 3FT4A 4TV3A 1U95B 3KGSA 5D55A 3TF7C 5CNHA 2GC7C 4QGTA 4MZRA 3DURB 5EEXA 4H88H 3CFQA 2BY0A 3UJTL 5F71A 5KSBB 1KGWA 4ZMNA 4WGKA 5JPNC 1B2WH 3HAEH 4U7SA 5CJ8A 1H3WM 1O6SB 2EDLA 3PWLB 5L88H 1OGAE 3L3OA 5B3NA 4NHCH 3LPFA 3MROA 4IK7A 4ZW7A 1OAQH 5ERWB 3K1KC 1N5AB 4PJ8C 5HI4D 2FE0A 4M7LH 1I8LC 1EEYB 4WO4A 2PTTA 3U4BH 2COQA 5DTFA 5AAWA 1JNHA 1U8MB 4PI0A 4JFQB 3HPLA 4XMPL 2WSKA 5DZJA 1FZJA 1HXKA 3MODH 5JOPE 4Q58C 2PWEA 2YAHA 3Q2VA 4GXVL 4HHWA 1SYVA 3WUZA 4MNGB 3PF2A 3WYRA 2NQCA 5DGQA 1CF8H 2GFBB 5CD3A 1NPJA 4R26L 5DRXA 3ZE1F 5JZ7C 2Y1YA 4BZ2A 2YSSA 2V17L 2AZAA 4PBXA 3DUUB 3OKDB 3I9PA 5I1DB 2AXJA 4DP6X 5IEKA 4L1DA 2F61A 4JJOA 4GG6E 3TO4C 5AW8B 2D3VA 4Y4KD 5JIHA 1A2YA 1AGBB 3V5HB 3ARGA 3EJSA 3BSGA 2FD6H 3O41B 3P69A 4KKBD 4R2GD 3RWIA 5EWIH 2OBGA 4FNUA 2J6EA 1DSYA 3L7EA 5CFAA 3JUZA 4K4KA 1ZT4A 4UILH 4XGZB 3B3IA 4M3KB 1KLFB 1A9EA 3UH8A 4YVNA 3VDBA 3TVMB 5H4YA 4H1LG 2HTKD 4Z7QB 2ZUVA 1OF2B 1FVDB 3WFDL 1HL5A 4YN3A 1AQ8A 1ZV2A 2DQIL 2GVYA 5FM5O 4CC0A 1F2XK 2DQ6A 1FFOB 4KK5D 2Q1EA 4CMMA 4E41A 4F7MB 3FN3A 4L8DA 4ODXA 3C60A 4ICWA 4F2MB 4WSKA 1SEQH 1ZHBB 3FHAA 3OWEA 4QMEA 4PJ5D 4AM0B 1JZGA 3T8VA 3O4LE 1AI1L 3MNVB 3PABB 3QPXL 2FO1A 1HHGB 1JOIA 3MLWL 4LF3A 5G2NA 2WWOA 4S1QL 4ZD3L 3GI9H 2CG9X 2QQKL 4UF7C 3ASNB 5D72H 3WFCH 4AQ8C 4CRPA 4ZMTA 3ZO0A 1F3RB 2XWJB 3FUHA 4K2UH 2GBUA 3MRRA 4KO6A 3NACL 2OYPA 1AKJA 3KYNB 2HJKB 3OMAB 2NY1D 4AKQA 5E6ZA 1UATA 1GA2A 4N85A 1OWWA 2MQCA 5E8EB 5FGCB 1YEHL 5KOVC 1S9VA 4KC3B 2BS8A 3SKUD 1WD8A 5FCUH 3AT0A 1TO4A 4N2LA 4XNQA 1X7QA 3BAJA 4NUPA 4X0NA 1T6VN 5ALCL 5GGSY 2W88A 3NSFA 1BQ5A 4ELMB 3FO0L 2ZX8A 4OU3A 1N26A 3HW7A 3S96B 1PZUB 3OKEB 3KCWA 5E8PB 5JXAL 2H32A 3WIHL 5DCCA 4X99A 1N7MH 1GXEA 5H35B 3RWFA 4F37F 2OK0L 3PU7A 1BFVH 4TNVF 2F5AL 3JV4A 3VD3A 1K4CB 5J5EA 4X9FA 5D1XE 3MV8A 1S7XA 5I6LA 1YQVL 4YXHH 5I0XA 3CFKA 3FUMA 3UTSD 1MCNA 4YHIA 3MFFB 5TFSH 4M9PA 2AQPA 1D5XB 2FSEB 2P9RA 1U8HB 4MXVE 5EZIH 2JF1A 4K8RL 1XIWA 4CILA 3HG1A 1L9MA 1W6LA 4PRPA 2ZXAA 4NPKA 1JDDA 1RFDL 3ZHNA 4NT6B 3STZB 4EMZA 1IC7H 5JHDE 1G7HA 5C6WH 4A7QA 2BNQB 2FX7H 1WCBB 4L8CA 1DJGA 3VGHA 2O93L 3PWJB 3C09B 1FWXA 1Q1PA 4PGCA 1HDMA 2KERA 2R1XB 2Y7NA 3NZ8B 4LT7A 1C8QA 2X41A 1QTPA 2Q10A 1E9OA 4R7VA 3ZDWA 4MRBA 4MNQD 4PCTA 5CFHA 5I1GL 3UCQA 4Z77A 2KZWA 1QBAA 4MS8C 4N0UB 4QO1B 2CNZA 5C9JB 3IXTA 3EKCA 5GRXG 3T3PE 5I6OA 1ZT7B 3DRQA 4U6YB 2WANA 5FUOL 4OGAC 4YEFA 3M1CA 2YQ3A 1KB5B 1F4YH 1MLBB 1S6NA 3GJEA 5INDB 2H3NA 4QY8A 3DBXB 3QDGE 1CICC 4BKLA 3BH4A 4PJAA 3IWUA 5D96C 5ETUA 4ACPA 1JGEA 4GG6F 1NJ9A 2N7BA 5GHWL 3ARFA 1SFDA 5CLXA 1I9JH 3KPMA 1QRNE 3M1BB 1FIGH 5HJ3B 3QISA 3PHOB 2CO2A 3EDDA 2F74B 3DXAD 5JDSA 1NCCL 4DGIH 2B5IB 4M8VA 4I1NB 2OMVA 3L4ZA 1JTPA 4HGWA 4PJ8D 1ZA6B 2WPGA 4Z0XA 3KXFD 4HOWA 4RMUA 1GMEA 4U1KA 1MDAA 3EOYG 4LEOB 1R3IH 4YNYB 4MB3A 3T6VA 3ZSTA 2O61A 2L4OA 5I2IB 5CHNA 5DFVC 4JRLA 4XOBA 3RWEA 4PGDB 5FF6B 2HFFB 4G9FA 4OCLC 3IKCA 3VXOB 5L0QC 3HI6H 5JZ7D 3DYOA 4C54A 1NDGB 3N0PB 1RIHH 4HWBL 3ZDZE 1P6AB 3KDMA 4Y1AD 4GO8A 3HN3A 3QPQD 4A04A 4KZDH 2BP8B 2X42A 3MACH 4MXWL 3TO4D 2JIXA 5SWSB 3NOIA 4I3SL 1KG0A 4YLQT 4TPRH 2RACA 3WHE1 5KUKA 2MNJB 4YBLC 2EDEA 4Z7VE 5L4MA 2KZBA 3ZTJH 1JHTA 5D70L 5IMKB 2GSIB 2QVFB 4EKXA 3LZQA 5E2TH 2GI7A 4N2MA 1MAKA 2NSMA 5KG9B 4ZPVB 2OMZB 4X2UA 1U91A 1ZHLA 3B1TA 1IM9A 2CRIA 1WTGT 3QDME 2BS71 1VFBB 1E4HA 4PY8J 3FCTB 5E08L 2ED8A 1KIQA 3GD1C 4AW7A 3B7RL 3CCHA 4M4PA 3WTTA 4DVBB 1XF3A 1A9VA 1WBYB 4GQ9L 2HT3D 1H15B 5AOMA 1NTDA 4WFEE 5DD1H 3MRPA 2IFFL 1DO5A 2JKWA 1MCDA 3CBJB 4MJ4A 3S3PA 1EEZB 3BRDA 5FLVA 1PKQA 1BW8A 4JFDE 3Q2WA 4ORGB 3VYNA 4UQBA 3QFJA 1KUMA 1OCCB 2BVEA 2B1AH 3QARA 3NDYE 3WKML 1PZAA 4TSBH 1ROWA 1RZFL 1NCAL 1KIRB 1OV8A 4MXVF 1H0DB 4NI3A 2HKFH 1H5BC 3MXWH 1P2CB 5FB8A 2JELH 3JV6B 2IEPA 3BN9C 4OBRA 2Z7WA 1XTLA 2MSPA 3MRJB 4BQ8A 3BISA 4LOUC 2KDGA 3F5WA 4I9WE 5C6TL 2A74C 1S7WA 5E4EB 3US1A 4Q9CA 1ITCA 5JLZA 1PZ2A 3SO3C 3IAGC 1IAKB 1MOEA 1JL8A 1MW3A 2FLRT 2XWEA 5IQOA 3QYCA 1U4FA 3ZHLA 4TYUA 1BBDH 1FO0L 1WHPA 3HE7A 1E2ZA 2P8LA 4PJCB 7FABH 4NC1E 2D2OA 4X8JB 3ZE2F 5JW4Q 2WBJA 2EUWA 3LNHA 5B7EA 4QNPE 3FQTB 3A6CL 3O6FA 5IMLA 3IPEA 2I26N 4J4PA 4L9LB 3NGBB 1EGJA 1OAZH 4HDIA 3T3PF 4B9GA 3FCSB 1DVUA 2AEPL 5CJQL 3VXUB 3RGVA 2QQNL 3CIQA 4KI5C 4O02B 4R7LA 2V2WA 5DJCA 4ELDA 4F5CA 1U92A 2JKRM 2NX5D 3ENEA 1J8HB 3MREB 1UA7A 1TCRB 5AUMB 1S3KL 2VLMD 4XN1A 3O3AB 2DTML 4JY6A 3PGDB 1CBJA 1WP6A 3K7UA 4Q6KA 4ZG1A 1PD1A 2EE2A 3VSUA 1TMCB 5FLUA 4OZIE 3RI5F 1YAIA 3HI1A 3L3KA 2NY6C 3BEWB 3B2MA 1UZ6F 3TNMB 1ICTA 3MJ6A 4PRIA 5C2BH 2NXYC 1FA4A 3CN4A 4ES9A 2ICWA 3FT4B 4L8SA 3QWOB 1X44A 2UXTA 1FJ1A 4DQOH 2YKKA 1OGAA 1CGUA 4KGLA 4OCNC 3FFCB 3S4SA 1LO4H 4NUMA 2CK0H 3WGUB 5EU7C 3NTCL 4X7SL 1BLNA 4MS8D 4H8WL 4NENB 1YYLH 2AMGA 2CMRL 2WZPD 2OJ1A 4AK1A 5DJZA 1LDPH 3VI3F 1X5MA 3P11H 3PJSA 2VZSA 4OGAD 3LS4L 3ZDZF 4NLAA 3MROB 2ALWA 4OCWH 1CICD 1NLBL 1YUHA 3MLVH 4LRIA 3NJNA 3W81A 4Y8DC 3TT3L 2A9DA 3EO9H 4NLHA 5DTFB 2J3SA 2KH2B 4F9LC 3KPTA 3IMSA 3ZDYB 4LFHG 4B96A 4HGKC 4ANXA 2GY5A 3FCUB 3HPLB 3TCLA 3CZGA 4WGWB 3O3EB 3RHWF 1UZGA 4K15A 4Z7VF 4BD4A 2SODB 1PG7L 3B37A 2G5UA 3OBAA 4G7QB 4LPUA 5CD3B 5F7HA 4EDWH 1C5DB 1P4UA 3B2DC 1RKRA 3MV7E 1UM5H 3CK0H 2YSSB 4R3SA 1KC5L 4XPTL 1Z3GH 2QSCL 5LNGA 5LN8A 1T5XA 1E9PB 4WI3A 4UIMB 3NJMA 3V9EA 1IAOA 2VZTA 1WG3A 1CR9L 4PJBE 3AACA 4FQQB 2WUBH 3LIZL 2XWDA 1ADQL 4ZXBC 5BV7H 3GPSA 5F3FA 4E5XG 5DFWH 2OJZL 5HYEA 1OL0A 1KBKA 2BJML 4FF9A 4KX7A 4YHYB 2EDHA 3IDYC 2VN5A 1JK8A 5KJ4A 3ZW3A 1WBZA 4XCEA 3FTYA 3L5WB 5ILTL 4R0LB 3ZYOA 1A9EB 3GRWH 4NJAH 3UDWA 4K7PY 1NDMB 4JFFD 3ARBA 4NBYB 4RMVA 1A3LH 2VSKB 5BZXA 32C2A 4OZ4A 1ZOXA 3WD5L 2W95A 3QIBC 1CT8B 4CMMB 3KS0H 1J0IA 1MCPH 1KEGH 4PS8A 1VKXB 1YN7A 1S9YA 3DX6A 4JVWA 4ODXB 5LGYA 2OM5A 1MAJA 4WNQA 2P7TA 4L0ZA 2VXVH 3QJOA 1GZHC 3CC5B 3GIZH 3WU1A 1JNNL 4TNWF 4YWGL 4KDTC 5HHMB 4ESKA 3J2PA 3UTQA 3ATDA 4MKMA 3G5ZB 4JRXB 3JVFC 4PW4A 3P02A 2ZPKH 5I5JA 4B5EA 4WNSA 2RH0A 5E6RB 1QSED 4HUUA 1EZLA 1OCOB 4FFZA 5DVNA 3RJDA 2W81C 3MRRB 2Y6SC 4YXKH 2JKIS 4BUGA 5IOPA 5T1MA 5GS0H 5LKNA 4RNRA 1Q0YL 5I0ZA 1CI5A 3KNBB 4QNPF 1QI5A 3DBSA 4GBXB 3T0EC 1KTDA 5DJDA 1FBIL 2A0LD 4KITB 4XNQB 4WFFE 4I5BB 3D07A 4HD5A 2WXPA 3QGVA 4DJMA 5D1XA 5C07D 4WUUD 4J6RH 4X4ZA 3JVGA 2PNDA 1UD6A 4EUPA 4DKTA 2GEEA 4S11A 2YKLL 4XXCA 3S3JA 4N6RB 4HPHA 1TZIB 3JV4B 2GJJA 3MV8B 4OCYH 1S7XB 4OZIF 3KS0J 4AQEB 1N64H 1NC4D 2X4OA 1QUNA 3L4VA 1MEXH 4F58H 1QFPA 2MIZA 1E5AA 2XUWA 4L3AA 5TH2A 3G5WA 4QKXB 3UEZA 1Z9SA 4RDBA 4G1EB 5E9DA 4MQTB 5MEND 1E7VA 2OL3A 4YMPA 5BV7C 3SPHA 5JHDA 3OLGA 2XIBA 3VXRD 2HJFA 4HIQA 2AS5M 1B6DA 1D5RA 4G8FA 3DX2A 1IFRA 3W0WE 2VDRB 4NN7C 2DD8L 5BOJA 5K59E 3RAJH 1G7HB 3MRMA 1YJDL 1W72H 2J55A 4LLAA 2OMYB 4JDTH 1RK0B 1RMFL 2UY6B 4KI5D 2RB8A 4KKAD 4L3EE 4L8CB 2DMHA 5FOBB 1IEAB 3CN2A 3B4NA 2O5ZH 4QHUA 1HDMB 5AW7B 3P3SA 4WI0A 5AVVB 3STLA 5BVPH 2HXAA 4GUPB 3W1ZA 2J8HA 2X89A 4AENB 1HK6A 3S4SG 1Q72H 4V1DA 4HUVB 4HZLA 2Y7QA 4Y4HC 3ESVF 3F6IA 3NZSA 3QDGA 5IM7A 1SMDA 3QQDB 4NNXA 2NXYD 4WY7H 1QO3A 3IXTB 3GZKA 4ZO9A 3ZL1A 4N3TA 1HOCA 1NMCB 4DKEL 2XBZA 4M93C 2VLRD 2C8NA 3RQ3A 4NQCA 2J8UB 3BYTA 2H3NB 5I0WA 4PJAB 4M29A 2D7TH 4AM0Q 4AY0A 1JGLH 3P4OB 4OQTA 1JGEB 2QVKA 1L9QA 2QADD 3SPCA 3C6LA 1HYRC 1JZ5A 3PAZA 4FD0A 1UOLA 4NP4L 5AALA 1QFWL 3FUDA 4AGOA 3HZ3A 3QIWD 2Q5BA 3CE1A 2IDFA 3EOTL 1JHLH 1YMMD 2AJXH 4HGWB 5J8OA 5AAPA 1QVOB 5MEOB 2QGDA 2B16A 5CSZB 5HHQA 2UXVA 1AFVH 1IGFL 1P5VB 5EBLA 4U1KB 2E59A 5TDOB 3VI3A 3DX4A 4K7FA 2DQGL 3H53A 2C9RA 4H8HA 2N7SA 2QVIA 1PKOA 3SYAA 3AXIA 3QNZA 1U58B 1T0NA 4UT7L 1UKQA 2R29L 3MNMA 4G9FB 3IKCB 3M45A 4CNIB 2Y36H 3CVIL 5HDQH 1I1CA 3WSQH 4AEHL 4YQXL 4KZ0A 1B4RA 5CU9A 1M7UA 4ABWA 1XF2A 1BAWA 5IP4A 1CLZL 4P4KC 2JMRA 3FC8A 3GHBL 2I32A 3PL6A 5AVZB 4AGQA 5KS9F 2XACC 1QLFA 4KDWA 2BRRL 3AREA 3F83A 2Y72A 1REIA 3WEXA 5SV4A 2QSVA 3JV5A 1EHXA 5B1KA 3X3FL 3AQYA 3T6WA 5J7CC 1ZTXL 1JPSL 1OT1A 2DIAA 2I85A 2YXVA 3VWKD 1E9QA 1IU1A 1C08B 3A4FA 3DHPA 1ZHLB 1I1YB 5AAMC 3BT0A 4LSQL 3RX9A 1KIQB 3O2VL 3CCHB 5AW4B 3ZT5A 4HJEA 4ECNA 3HMWH 1XF3B 4Q9QL 5JA8B 2APXA 4JE4B 5B4MC 3Q8CA 3N44F 3MRPB 1NPUA 1KGXA 4GXVH 1SLUA 4N2AA 1X5AA 1TCMA 4TUJA 2IBGA 4N9GB 1XGUB 2CBPA 2DI8A 2FRGP 2V9QA 4RQQA 1PKQB 4LIQL 6PCYA 3PDOA 4P2AA 3VQ2C 3QFJB 5F1IA 1WFJA 4R26H 2DJSA 3QCTL 2V17H 5IW3A 2Y6SD 1O9VA 2VDKB 2IADA 3TO2A 4D0CA 3U0PA 3TM6A 5FDYA 4FKHA 4LU5L 4AJVA 1GZQB 2ZG2A 2ZOWA 4QRFA 3F5WB 2VR5A 3U48A 4D9QD 1CE6A 4QF1A 1LDSA 5ESVB 1E6OL 3OLEA 5JW3L 1E28A 3A4AA 4QYAA 5I8OL 5D4QA 2ZSVA 3QUYC 3DX9B 2EO1A 4X5RA 1HE7A 4BSWA 3MLSL 4QYOA 5ABZA 2BXZA 4OFDA 3HE7B 2P8LB 1MJUL 4KVCH 4KXBA 5HHOE 3WFDH 4K7PX 4P99A 5FKPA 2DQIH 5IHZA 3TL5A 5K9JL 4OCRL 4B9KC 1GGUA 1SOKA 2EXYC 2XWTB 3O6FB 4YXLL 1WIOA 3UG4A 3HZMA 4L48A 5GIRB 4PS4L 4Y16C 3H3PL 3CGTA 4EZKA 3EO0A 1G1KA 3CQPA 5KVFE 2I27N 4TL4A 1XH0A 3V6OC 3RGVB 4DP7X 3SQOH 1KXHA 4PMFA 3NJIA 3QPXH 4OGQC 4Q56A 1JXJA 1U92B 5DJCB 4OZIA 4M1DL 3BVDB 3QJQB 2QQKH 3PY9A 3GMQA 3MQIA 4JY6B 3SQBA 1MWAA 2KC0A 4HV8A 3EOAB 4KNUA 7PCYA 3ABZA 4QR7A 4QRRA 4LBAA 3NDZE 1C7SA 3L3KB 1CLOL 4FZ8L 1UASA 1MCFA 3QI9B 2IH1A 2XG5B 3G3LA 4ODVH 1U3JA 4Q52A 1YEHH 2C7FA 4PJEE 2Z7UA 1ML0A 4PRIB 3TH2T 2HCZX 3BUBA 3NK4A 4KJYA 1FAKT 4G8EA 4KQ4H 4QOKE 5ALCH 4JUTA 5GGRY 1UGNA 5DJ0A 2DWYA 2OXGB 3BGFB 3FO0H 4TNEA 5JXAH 1A02N 4Y4HD 3WIHH 1BLNB 4I1RA 1Y6NR 1R3JB 4HUCA 5TK4A 4DK5A 2OK0H 5DJZB 1F5WA 1YEKL 2F5AH 1NAKL 4G6FD 1YQVH 1HI6B 4ZOBA 1SMOA 5HVHC 2VCOA 1HX0A 5IG7B 3RJQB 1AGEA 5B8CB 5GS0D 3D85B 3ZMRA 2PW1A 3ESNA 5F9WC 5E99H 1II4E 1E5UI 3GZPA 1Z6JT 5EOQL 5I75C 3WOVA 1PDKB 35C8L 3BE1L 5E6IA 3MV7A 4B7LA 1TTCA 1OP3K 3V0EA 3C9NA 1A4AA 2VT0A 4K8RH 5D7HA 4AYID 1XB6A 3L3IB 2ADGB 1BD2D 2F7PA 4KUCF 1MVFA 3FB8A 4L2YA 1L5GB 2ATAA 3QPKA 2F9BT 3D7PA 2BOCA 5BRPA 1NBVL 4GLRH 3HNVH 4R3SB 2H1XA 1T5XB 3MBED 1H6EA 2DYSB 2F8XC 1IBGL 1IAOB 3VFGL 4RAVA 5DT1H 3IXAA 2GBVA 4XMZA 4PYGA 2XC8A 3BI9X 4Y2DA 2G2NA 4HFUL 3PIQA 4RGMB 2EC9U 1DE4A 1WCQA 5I1GH 2ZX9A 5INCA 1G4RA 4YS4A 2P44B 2A6IB 3L9YA 1IAMA 4M3JA 2Q3XA 5J4MA 4XI5C 5ACMA 5JPMA 2BIMA 3QS3A 3BZEA 4C56E 4C47A 4KHTL 3KLAA 1N18A 3HC4L 2J6EL 4MB5A 1ES0A 4QT5A 5KYUB 2IV8A 2O6EA 5GHWH 5CZXD 4KJPC 2KBGA 5KS9A 1KBGH 2G3ZA 1YDPB 3DX6B 4MSWA 4ZUWA 2EEFA 5HBBA 4WNQB 1TOXA 1NCCH 2BK8A 3F58L 2EKSB 3FPXA 5FYKE 1GRWA 4NZJA 1KV3A 1FSKC 3GSWA 4MZ2A 3C8KA 4OSUL 4OM1L 3UTQB 1I8MA 4OB5L 3OR7B 2GUYA 3IJ9A 3GBML 2BVPA 4J3XA 5LAXB 5IOPB 5T1MB 4RNRB 2W0FB 3HBZA 3IMWA 5KUMA 2VDOH 4U7MA 3HC2A 1KTDB 4Z7NB 5AENA 4E9YA 3MX0B 2P26A 3BO8A 4HWBH 2B3RA 1ORSB 3CFCL 4YDJA 3QQ4A 5F9WB 2OI9B 5GRJL 3WNLA 4FA8A 3Q6FB 4YE4L 5DEGA 5CBEA 1BQHA 1IGYA 5C3LD 4K8RC 4EUPB 1UB5A 1ZLWK 1WF5A 3R1GL 5GRZA 1MDTA 4I3SH 1PX3A 1CLVA 2D73A 3VO0A 2Y69B 2C7UB 4XNBA 5D70H 3UTTB 5C0FA 4JUSA 2OW7A 2VDLB 1G4MA 3D69A 4JM2C 2Y7MA 1QUNB 4C4BA 4Y19B 1RPKA 3LEYH 5AW1B 5HTSA 4MMYA 1VF5C 3OKKA 1KN2L 3RIAF 3TH3T 4ZZKA 1Z9SB 2IQAB 3RYMA 3IN0A 2X3BA 1F6AB 2L0DA 3MTXA 5E08H 3GIVA 3VVWA 2XWXA 3C6EA 4PRHA 3L5XL 3TPUA 5I71B 4GAJL 2HJFB 4M8QB 5LO7A 5J6GA 5F7EL 2EUXA 1M42A 1OTUC 1SJVA 1MLCA 1F0LA 2RALA 4GW4B 5DUJA 4GQ9H 2OSYA 5CP7B 3LH2H 4Y16D 1TVHB 2IFFH 4UM8A 2ZX6A 3W9EA 1I8UA 2VABA 4X6BA 4I4WA 3EO1A 4XPGH 3EG9B 3NPZB 3JT2A 4AQOA 2R69A 3SDCD 3AY2A 4WENB 4KKRA 4HIEA 4OUUB 3WKMH 4WI0B 5DVMA 2EO7A 5E95B 3STLB 2KDYA 4JQXC 3VQ1C 1AS8A 4PG2C 5E0QA 1NCAH 1EBPA 3RA7L 4V1DB 4YR6B 5D7SL 2VZ1A 1QO3B 2GAZB 2ZXWB 2DWSA 5KANI 1IEHA 1IBZA 5C6TH 3QZLA 2XN9B 2YUXA 3KVPA 3S3DB 3QNXB 3F64A 3BD5A 4NQCB 3F7VA 3QORA 1SHMA 5GGTA 1FI8C 2WLIA 3P0YL 1JDAA 3JWDL 1PMYA 4I0PA 5KVDE 3HZKB 4PTTA 1HEZA 1A4CA 1FO0H 2O30A 1IVTA 3Q8EA 1BWMA 3FTUA 1F6LL 2ZZUT 4GAAA 2X70B 4DGVL 5I6XC 5IFHL 5AKSA 2A7BA 1ZPUA 3C5XA 3A6CH 3PAVA 2VE6A 1C12B 3EJPA 2NY0B 1EJOL 1PJ9A 4Q7DA 3FOMA 2WLNA 3U0TB 2G4GA 4CN6A 3APDA 5EBLB 1CFVL 1RZGB 5CJQH 3IMRA 3PQYE 4K7FB 3KLKA 4LVNB 5J6HA 2AXHA 1T4WA 1S3KH 2LLGA 2DTMH 4ACTA 3ATBA 4QHNB 4O2FA 1QI4A 1GS6X 2JI1A 2RQ8A 3K91A 1Q1JL 5AKVA 4ZUSA 3R4RA 4X4MA 1XF2B 5E8DL 1OSEA 1IEBB 5CR1A 3F62A 1BGXL 3MLUH 1EX0A 3AREB 3H1ZA 1Q4NX 4XWOC 2P3YA 4YGAB 1V3KA 2VH5H 4PSPA 4U05A 1C5BL 5FO8A 1FYTB 1XD1A 4OFYD 3MV9D 3P1VA 4B3VA 3NTCH 4X7SH 1AQMA 5ISZE 1A47A 4H8WH 4XN8A 2CMRH 4FTVE 4WV1B 3TWCL 4EQ3A 5KWYC 3J7HA 1I1AA 4H4NA 3J8F7 5E1AA 4MZIA 2EXSA 4G43A 4UOW0 4IGBA 3MDJA 3LS4H 1GAFL 3HBQA 3GMPB 4Q0XH 1CDBA 3APNA 4PLJC 2FJHB 2ZP0T 2ZYHA 2BDNL 4MAUL 3DTUB 8PAZA 1NSNL 2MCMA 1T1YA 3QUXC 4CAGA 3SDDC 5E51A 2M26A 2ZKHL 4KJPD 4BFIA 4HF5L 2H6OA 4XO3A 2D8KA 3FQ4A 4KY1L 4UQEA 5E5UB 4XBPA 1PG7H 2WQVA 2WO3B 4WW2F 3EFOA 4RQQB 1AMXA 3D8MA 3VFWB 4DUWA 1MW2A 3L3JA 2UY7B 1AHWC 2OULB 5IROC 2NXZD 1KC5H 4XPTH 2QSCH 4UAHA 1CI3M 4LLUB 2HN7B 2IADB 1OGTB 3U0PB 1CDGA 1BQHG 2PWDA 2AXWA 3VTAA 1HQRB 3L6FA 1CR9H 4OLVH 5IHWA 2QMKA 2ENJA 2VJ8A 1TNNA 1BXXA 2CHZA 2H6PB 1A1OB 3DGCR 3LIZH 1AE6L 4L9DA 1JXDA 4WJ5B 2BZCA 2FWOA 2R59A 2XQBL 3GXFA 3U36B 2VTFA 4YFLF 1PCXA 4HH9B 3HNSL 1L4IA 2OJZH 4UNVA 2BJMH 5F72S 3U83A 2O6CA 5HHOA 4LKXA 3SE3C 5C0DB 1VAHA 3DX7A 2P8MB 1H6FA 2AQRA 1E28B 2Z7ZA 3Q13A 4K8RD 4LPWA 5ILTH 1HN1A 1T6BX 2J1XA 2DQFA 2VDNL 3GMRB 5DLMH 4BSWB 3AWFA 2A6JA 3IFNH 3N0AA 3WD5H 5IHZB 1L9RA 2PYFA 4XOAA 5KBNC 2GJ6D 2ADFL 4JM2D 2OMBA 4WU7A 2EEXA 4RFNB 3VGDA 4M03A 2J88L 4R5TA 2JWYA 1PIGA 4EXPX 3W82A 5GGUB 1O7DC 2IWGA 4K3DL 4M5ZH 1W16A 2B59A 1X5GA 4WI8A 4LDLB 1D5IL 1T03L 4YWGH 5KJ7E 3GPEA 2BOBA 5LBSA 1ULVA 1I3UA 2XTJB 4NQDD 3MLYH 4H8WC 5HXMA 1UM6L 1S7TB 3D0LB 3A6BL 1EGJL 1MWAB 5TGBA 4JZOA 4ZYKA 3CX5K 4P2RA 2X1XR 4U1GB 1OSZA 1YEWA 4TSCL 2FT8A 1NBCA 2E4FA 2OSXA 4QOKA 4QRRB 2Y06H 3GTTA 1Q0YH 5T5NG 2IH1B 5BUPA 4FYRA 1V10A 3H9SB 5CEXB 1YQ2A 2Y4SA 3PWNA 1DBML 3CPLA 1FBIH 1D3CA 2E6PA 3F7YA 2QFPA 2DL9A 4G8EB 2R0LL 2WK2A 3MHZA 4PJ9A 3FUNA 4MLSA 2YD4A 4M6AA 4I89A 2JCCB 3H56A 4E0RA 1L0PA 3D52A 4ZFFB 1T7WA 3F6JA 2HG5A 4P8QA 5ENWB 2YKLH 3D18B 3P2BA 2WLZA 2WCGA 2NW3B 1LEGA 2R2HB 4QJ3B 2WBKA 4LDEB 5A2AA 2BSRA 3QQ9C 1FVCA 4CDGC 5DZOA 1TSRA 1GYUA 3BKCH 3E80A 5EU6D 4EN3C 1TQCB 2F1EA 2XY1A 4CSSA 1XGPA 3MRCA 2JNZA 1RZ8A 1SXZA 2MH4A 3M8OL 3VXMD 5DJ8B 4WFGD 4JZJB 4BEIA 3C9NB 4WKZB 4JPIB 4DKDC 1OE1A 1SLVA 3AXHA 4J3OF 4LSSL 3DMMC 5FX3A 2DD8H 2BOCB 3QDAA 2HKAA 1YY8A 1YJDH 5TD4A 5IQMA 4OGYH 5F97E 1A7OL 1PF3A 1NFKA 3ZZ1A 3QZMA 2RR3A 3FTGA 4L4TA 2O5YH 3MRQA 2P5WD 3THML 4GSRA 1RZIA 5F0JB 3GSVA 1BQLL 2XTLA 2K8QA 4HCRA 1RERA 1DE4B 3L4UA 5E6UB 3OKLA 3WNOA 2DLGA 4U1MA 1LO3L 2WGNB 2M1KA 4DSYA 3RJOA 4J2XA 5JPMB 3I6KB 4P5TA 3GSQB 4DKEH 1M2VB 3IGLA 5DVOA 5L4JA 4XWOD 4FQJL 2VLKA 5CKGA 1U8NA 3KL5A 5EOCL 4GKOA 4OJYA 3T4AC 15C8H 4HS3B 4EO5A 1H3PH 4MNQE 2XN1A 5CR8A 1MF2L 1UXWA 4AGNA 4NP4H 5EIQA 3VH8B 5KS9B 4WI9A 1LQBC 4MSWB 4ZUWB 1QFWH 2YBRB 3D48R 1RLWA 2BMKA 4ANVA 1NCOA 3D39E 2W65B 3D4CA 4ZI8A 2ERJC 1RUPL 5B21A 3EOTH 4IBTA 2YPLE 4KDVA 3UMNA 4RDQF 4CN4A 3QUXD 1SHWA 3E7JA 2BVPB 1IGFH 1HEHC 4QRPD 2PP8A 3LKOA 3DX8B 2CU9A 2CHXA 1W0WA 2X4TA 3DKHA 1EXUA 2GTWB 4G80A 2VDPL 4F9PC 2HKHL 2Q6WA 3PWVA 1ZPLA 5FIEA 4APQD 1JI2A 1KV7A 2NUPA 2FATH 1YEDA 3F65A 4UT7H 2A5UA 2PXYA 2WQ8A 4FG6D 4K5LA 2ZX5A 5JUEL 4OJDH 3CVIH 2W92A 2XQYK 3ZVVA 3SPIA 4FFZL 2QL1A 3AFLA 4YQXH 3RKDD 2HPOA 1A1MA 1U2HA 3ES6B 5GGQL 1J1OL 1UKSA 4FNQA 1A6UL 3N44B 4MBOA 5BW7C 1CLZH 3RY4A 5KSUA 4XNUL 5HVWA 4UDTA 4WW2A 2NCMA 3R7QA 1DVFC 2FIKB 2BRRH 1A6VL 2L8AA 1QEWB 2ODIA 1FNSH 3D2TA 1T0OA 3UZQA 5DSCA 3KPPB 3SDXB 3T4YB 3CH8A 1NFAA 3X3FH 3C5ZA 1YJDC 5HPOA 5IJBC 4FYTA 2ETWA 3VRJA 4BDVA 3N91A 2XG4B 1ZTXH 1BJMA 1JPSH 2YGOA 3SPGA 3U2JA 4JKWA 3W57A 3FAWA 3B56A 1J8RA 3T0WA 3UGXA 2WXGA 4JDEA 1KYOJ 1X4ZA 1WT5A 3L1FA 3X1GA 2K6YA 3PLYA 4LSQH 5DMGC 4WWPA 1JERA 3WDJA 3DVNA 5J6GB 3JXAA 4MMXC 5FW7A 2H1LM 2VJ0A 3UJJL 5T3XE 5AOJA 5C0BA 1HESA 3SDAC 4OT1H 1WO2A 1IL1A 3DVGA 5KAQF 4WWKA 4UM8B 4H1LH 4OW6A 1RZ7L 4X6BB 2CO7A 2OL3L 3VG0L 4I4WB 1CS6A 2ENPA 5I76B 1HAWA 1NANH 4LIQH 5EH1A 3RZWA 3UYRL 4HIEB 1JZ8A 3QCTH 1OB1A 3TU6A 3HLAB 1KCSL 3S37L 3VD4A 2IMMA 3O4OC 4LKCA 3N04A 3IU4L 1L9TA 4LU5H 4WCYL 4XNMA 5D7KD 1FG2A 4POYA 3TA4D 2N59A 4YAQA 1JG9A 4ZT1A 4UT6A 1JWUA 2AI0L 4OBSA 1RJZA 2J5LB 2EIBA 4IRJA 5G5DA 1HE8A 1ZGLA 1Q38A 2DBLH 4QD2E 3MKGA 1E6OH 1MJJA 2BC4A 3U2IA 1H3XA 2XYBA 5JW3H 2CKBL 4EBQL 2WLIB 4N1EA 5I8OH 4XBEL 4I0PB 3AUVA 4PTTB 3MLSH 3IDJB 1MJUH 1XVSA 4ODBD 4JFVA 1PD0A 4J1UB 1BXAA 4LSTH 3PQYA 5K9JH 2LU7A 1CL7L 4OCRH 4P3CH 4KTEL 2VE6B 1A8ZA 1FHGA 2ESVB 3PUCA 4J8RA 4EN3D 2HVKA 4PS4H 2N1TE 3FOMB 1R5VA 3H3PH 3IJSA 4NEHB 2A1WL 4W9DC 1ODAA 5E8NB 3SE9L 3HG5A 2J44A 2MEJB 1FL5A 4XPHL 3DIFA 3FU6A 4TMPA 4M1DH 4K5PA 2Z9TA 4W9FC 2HFEB 4M7LT 1WV7T 3STBA 4Y5VC 3T1FB 4XOEA 1N10A 3C8HA 4ZUSB 1WK0A 1CLOH 4FZ8H 5DUBB 4O02H 1T7XA 4AVHA 4N5ED 3L81A 2X9ZA 3K8MA 1I3RA 4P07A 3EGDA 4WHDA 3SHSA 2CDFA 3EW3B 2VLME 2CGYA 4AXWA 5B38G 3QEUA 1PW3A 1RZKH 2DMCA 2XFXA 4JG1H 3O9WC 4GKLA 3TT1L 5IVOA 3O8XB 4PRDA 1UWFA 2AQ2A 1G9HA 1VZHA 4HUXA 1WAAF 1YEKH 5I66A 3T0VA 3UO8B 5DYOA 4JG5A 4PR5B 4P3DA 4QJ4B 4YH6A 3LNIA 1HINL 2LV4A 3L9EA 3NH7L 4F91B 3LB6C 4TRPL 1K3IA 3VQLA 2A77L 3MTRA 1T1YB 5DYFA 2VN7A 1WBXA 5EOQH 3MRBA 35C8H 2R0WL 3BE1H 3BGMA 3TP4A 3FQYA 4UI2A 5D7JB 3OZ9L 5IJCC 4DK3A 1Q9OB 4JFYB 4XBPB 1VJSA 4DEWA 3SGKC 2ZCKL 1QAWA 3EFOB 2FECI 4DK6A 4AE1A 3FHQA 4LDOB 1FF5A 2DEWX 3O0LA 1NBVH 4EVNB 1S78D 3NCJH 1IZKA 1GW0A 4DEPB 1LHZA 5L2JA 4DCQA 3CH1B 3TZVA 4FXGC 3VFGH 1CLYL 5H2BA 4JGNA 1SM3H 3A22A 5D7EA 2XWZA 1RH8A 1UXMA 4YE0A 4BZ2H 1PPIA 2H0EA 1KBVA 2ZUTA 3SBWC 1VEPA 5K39A 1XCXA 1YHPA 4ILDA 3QEQD 4OJEH 1BM7A 4ZUUA 2ZUWA 3GK8L 3IBOA 1G43A 5B1AB 3WO3B 3IDNB 4F7TA 1DVFD 2TRYA 4KU1A 1P84J 1OW0C 5DD5L 2DQUH 1KTRL 3T71A 3ALPA 2EDFA 4S0SD 2E8ZA 4UM9B 2A6JB 4G3YL 1BPLB 1HNYA 2D4FA 4KHTH 4LAQL 4PHXA 4HAGA 5F9OL 3HC4H 4M1CD 2J6EH 2J1WA 1E5CA 3OTTA 4L1LA 5F1NB 4AJ0A 2B2XL 4F7CA 2GSGA 3JWOL 1OAJA 1BZ8A 1UCBH 1UD4A 1J48A 1MHPL 4PG9A 2Q8AL 3K6SA 3OZKA 4FQHA 3F58H 2AJYL 2NTSP 1QYGL 1J05B 5GRWA 4OSUH 4JFFE 1EFXA 3HBPA 4OM1H 5DD6B 4ZTEA 4K23L 5LCVA 4OB5H 3GBMH 3VCLA 3NRPA 1KYOK 2EEBA 4XPAL 3NZUA 2VSCA 3F04A 1XV8A 3NSDA 3TONA 5TGBB 4JZOB 4P2RB 4PGBA 3HOGA 3FN9A 4I18C 2E0PA 1F3DH 1IBFA 1CBVL 3U46A 4FL4C 1I3VA 2P49B 4M6NH 3PGCA 2WINA 4H8PA 5F0LB 3C6SA 1HNGA 2BWDA 3PWNB 3QYMA 3UBGA 4KNQA 4R9HA 4ZQKA 5GRJH 2DQHL 5F7UA 4YE4H 4AMKL 4QRUB 3L3OC 4PJ9B 4DFIA 1EUTA 1A8JH 4BRVA 4TTDC 1DHKA 1CXLA 2WOBA 3R1GH 3FK3A 4WO4C 3KPNA 3SE8L 3K6OA 1CTNA 4PJHE 1LEGB 1OAYL 3GM0A 1IC4L 2BP0A 4GRLA 2Z31A 3PNWA 2BSRB 1F41A 5CCKL 3DECA 3CG8A 3MOAL 2H32H 3LSOA 1KN2H 5AOZA 1QLEH 1LEIB 3T2NL 1XGPB 3AM8C 1SXSA 3H42L 4YPGB 1X9RA 3D06A 2FAUA 1XH3A 1JWMA 2VJXA 4LPXA 3HB3B 4U3SA 1UT1A 3L5XH 2K6WA 1X5IA 4LHUA 3LN5B 2BX5A 1M7IB 2CUIA 4F8QA 4JO3L 1UJTA 3VSTA 1KBWA 2DDQL 3CXFA 1F3DJ 3ILPA 3VE0A 3ARGC 3H6AA 1DQJA 1BZDA 4JAMB 5MENE 1LLAA 2K6ZA 2AZUA 2NNAA 2AGJL 3FZUC 4Q97A 4FFVC 5F70A 3FBQA 4J3OG 4JHWL 3HCVA 3P9MA 4L4TB 3MRQB 2VDRH 5FECA 4NS0A 3BAEL 3NVQA 3IYLW 4HIJB 1GHFL 3HN5A 5DA0B 2HT4D 3RA7H 1M4KA 3OKLB 5D7SH 1S7SA 3BH8A 4KI5E 2YUVA 4GRWB 4OKVA 3V9CA 4JE0A 4JLRA 4P5TB 2F54B 5AZUA 3SO5A 5FDWA 5IVXB 3C60C 1KGUA 2H2PD 2VLKB 4CU7A 1U8NB 2VC2B 3O9WD 4OI7A 4NYLA 3DK2A 3P0YH 3FXIC 2X7LA 4HCFA 2CR6A 3JWDH 3SJVB 2YPLA 3VA6A 1HL4A 4R96B 3S3CB 2BMKB 2K9UA 1SUHA 5GS1C 3VFNA 1HEJC 1XX9C 5IFHH 2WM0A 4IKJA 4WRLA 2VLRE 2V0AA 2X4SA 1WZMA 3WFZA 3LB6D 4UNUA 5I18L 4P0DA 3V4VA 8FABA 3IWVA 3WAKA 4IMKA 1WAAA 3LKOB 4PJ6A 5F9JB 3NJVA 3FJTA 3TF4A 4G80B 1QG3A 2YQ2A 1F8TL 2BW4A 3MCLL 4I3GA 3RWGA 1EO7A 2CUMA 1T1WB 4OIAA 5ACLA 5AVQB 3IJEB 5CLWA 1RPQA 5I0YA 4RDQG 3QEGL 4UMGA 1YMME 3GNML 4HHGA 3MRIA 5DHEA 3MZTA 2CR3A 2ITEA 2P46B 3RU8H 5HGBA 4LVHC 3W3BA 1CURA 2ZOOA 3TYFB 1A1MB 1Q1JH 3KPSA 1YEGL 1MREL 2XZCL 2YGVA 4ZDHB 1LP9E 2XLLA 5KSUB 2YRPA 4UDTB 2Z91A 5FHAH 4ZW5A 3DIVA 3IF1A 4WW2B 4YK4C 3Q6GH 4AOFA 3C5JA 2DQEL 5E8OB 4A39A 3VU1A 3SGJA 1E40A 3UZQB 1C5BH 4L4VE 2VAJA 1JE6A 1PX8A 2NSQA 4Z3EA 3M7OA 3T0XA 4BDVB 2G0KA 1IC0A 3V9FA 4HIXL 5SWQA 1QHOA 1XIWC 1QSFD 1BZ9A 4FYQA 3TWCH 1XSKA 2VITA 1KDIA 1QATA 2WLJA 4H7VA 3WN5C 3BEVA 4PVBA 3Q43A 4QDGA 1PY9A 4NKOB 3HS0A 2ICEB 1P84K 2BDNH 4L37A 4MAUH 3LZOA 1NSNH 3ZYZA 4MXQD 2EEAA 3BLKA 2ZKHH 1UXSA 5I15L 2H4EA 1B9KA 3IPBA 3HS8A 3VXPB 4JG9A 4YL4A 6TAAA 4NOBA 4PJHF 2CO7B 1L3WA 4AYFA 1OIOA 1N0LB 3TA3A 2FEEI 4YHLL 4URTB 5E23A 5FWQA 1ID2A 1G6VK 2ZYRA 1TTAA 3JWDC 2J72A 1BA9A 1KTKE 4P5SA 4LNRB 5KAQG 2WLMA 1ACYL 3O3UN 5AVSB 4ZMPA 4IRSA 1Q9WA 2XXFA 4G70B 1PZBA 1NL0H 4YDLB 3QRFM 3QUMA 2XQBH 3V95A 1BOGA 5K9KA 3DGDA 3ARFC 1JWUB 4OZGE 1MJ7L 1ZGLB 2WGXA 43CAA 3KYKL 1JWSA 2AQTA 5BRZA 1T21B 2BC4B 2IJ0C 3GEFA 2DW5A 4WI6A 5JQIB 4TTDD 4WO4D 4IHOB 2DKUA 4X4YA 2VDNH 5AG8A 1NUGA 2DQTL 1ETZA 2KUTA 1GPOL 1G9EA 3K4DA 1T0MA 4D9QE 4UOJA 3QYNA 4B95C 2YWZA 4HXBH 2R56H 3GMLA 4LHUG 2ADFH 1AR1C 1QW9A 1OOAA 4PWFA 2J88H 4J8RB 3T5WA 2HVKB 3BWAA 5AW6B 1V7NL 4RSYA 3RZCB 1FRGL 1R5VB 5HVGB 4MCZA 1T03H 4K3DH 1MRFH 4R90L 3ABGA 3OD3A 4WLCA 1B6UA 4BGDA 3MCKA 1XTMA 2FYYB 3KM1A 2CPCA 4N5UA 4UIKL 4MA3B 4ANWA 5JHLA 2AJZA 3PRZA 1AC6A 3LD8B 3B9KC 4DESA 5AZEH 2ZOLA 5KYYA 4FADA 2BS9A 3RFZA 3A6BH 3D25B 1EGJH 1AGFB 4ODUA 4PV1C 4YHPA 3AB0C 4OF8A 1Y7VA 1DEEB 4TSCH 2J73A 3EADA 4HISA 1JTTA 2ATKA 3ARGD 3AUWB 1NCHA 3GTVA 2CO4A 2Z64C 4HKBA 1IIKA 4MS6A 4WZ9A 3D3VA 4JPVL 3UZVA 4FFVD 5BOPA 1DBMH 2DBJA 3BKMH 3GFUA 3SEPA 5DS2A 2F8OA 3MYJA 3PV6A 2R0LH 2EH7L 3AQZA 2CDEA 1IJ9A 3BLPX 1DJXA 1PLBA 3CFDA 1XGRA 4JDVA 2YQGA 4LMQI 4AEFA 2XFXB 1H3UA 2YAFA 1SN5A 3IDUA 5BZDA 2G60L 1LK2A 5IQ9B 2OMUB 3KLDA 2R51A 4E41D 1U3HB 3O3DA 3OGCB 5E6SB 5HDRA 1IJNA 3C60D 1N0XL 4Z0BH 1H19A 3Q44A 4F8OA 3KBHE 1ET5A 1LP9F 2F8IA 4F1SA 5FR3A 3BW9A 2YD9A 2LR4A 1E3ZA 4N0FA 2BFGA 1JTOA 5ICXB 1WBXB 1NBYB 3MRBB 2XPGA 3T65A 3M8OH 4GEIA 3BGMB 1TZAA 3BXNA 1BMWA 1UC6A 4W4NA 4KUZL 2EDYA 4U6XA 1I53A 1AKJD 2APFA 3ARPA 3D0AA 3EBIA 4AL8L 1WA0X 3Q01A 2GIXA 3DJZA 3UP1A 4XP6H 5GZNA 2C9UA 4GAFB 1QR1B 3JTBA 4RSVA 2DQCL 4PIBA 1N2RA 2VLJB 3NPSB 4MJ2A 2Q2LA 3OSKA 1Z0NA 4DN4L 2H1PL 2GJZA 3IMVA 4OM0L 1DBKH 4PS7A 1G7LB 1SVZA 5FOJA 5L2JB 1A7OH 2J1KA 5H2BB 2R2EA 3SPVB 4HWEL 4RGNC 2AXGB 5BCAA 2LT9A 1Z3RA 2TRHA 3RX7A 1CFNB 3N41B 3L08A 1BQLH 3S35X 3AABA 3OG6B 3LNEA 5GGSA 1P9MA 5K39B 2XV0A 4PV9B 3GTNA 1LO3H 3MV8D 2WBJC 3CFBA 3MRKB 3U2SA 4AZUA 4WEUD 5F3HB 2ICWJ 5TE6L 4Z7UF 3L9RA 4UV7L 4FQJH 4LL4A 4LP5A 5EOCH 2HA1A 3RVTC 1U8PB 4HVBA 2DQJH 3AB0B 5HVFB 1ECZA 1LYQA 1O7VA 5MHSD 2HVJA 5FYJU 1MF2H 2NYKA 3BZ4A 1XIWD 1MI5A 1DL7L 1HSAA 3HG1D 4PRPD 2FWUA 3TXAA 4HJIA 2Q86A 4ZUTB 1ZSDB 1KGJA 2NY3C 5J56B 4ENEC 1RUPH 5IW6A <