2NZ1A

Viral chemokine binding protein m3 from murine gammaherpesvirus68 in complex with the cc-chemokine ccl2/mcp-1
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
371
structure length
371
Chain Sequence
HSSGVSTQSVDLSQIKRGDEIQAHCLTPAETEVTECAGILKDVLSKNLHELQGLCNVKNKMGVPWVSVEELGQEIITGRLPFPSVGGTPVNDLVRVLVVAESNTPEETPEEEFYAYVELQTELYTFGLSDDNVVFTSDYMTVWMIDIPKSYVDVGMLTRATFLEQWPGAKVTVMIPYSSTFTWCGELGAISEESAPQPSLSARSPVCKNSARYSTSKFCEVDGCTAETGMEKMSLLTPFGGPPQQAKMNTCPCYYKYSVSPLPAMDHLILADLAGLDSLTSPVYVMAAYFDSTHENPVRPSSKLYHCALQMTSHDGVWTSTSSEQCPIRLVEGQSQNVLQVRVAPTSMPNLVGVSLMLEGQQYRLEYFGDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dual GPCR and GAG mimicry by the M3 chemokine decoy receptor.
pubmed doi rcsb
source organism Murid herpesvirus 4
molecule tags Viral protein/cytokine
molecule keywords Hypothetical protein GAMMAHV.M3
total genus 85
structure length 371
sequence length 371
chains with identical sequence B, X
ec nomenclature
pdb deposition date 2006-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09213 M3 M3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1330 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2nz1A01
2.60.40.1340 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2nz1A02
1ML0A 2NYZA 1MKFA 2NZ1A
chains in the Genus database with same CATH superfamily
1EANA 5FC9A 2WNGA 4S1RL 2X1PA 3RDTC 2JB5H 5T3XD 3MREB 2C3WA 2YAMA 2X4RB 2OYLA 1D5ZA 1Q0XH 2YC1A 3QFJB 4IOSA 1JK8A 4R4ND 3WTWA 2Y23A 2AAVA 3DTUB 4UTBH 3RX7A 1MHEB 5ERWB 1BMWA 4GH7B 4WI0A 4WNSA 2VGLM 1XCXA 5I1IL 2E4TA 3GSOB 5IMKB 5I8KH 3MCKA 1X5YA 4HIQA 2J56A 1CD8A 3QG6B 4UV4L 1N7MH 2OZ4L 1F18A 3QG7L 4D0DA 1LK2B 4F37K 1A4BA 3NOIA 4GAGL 5IIEB 1J8KA 4XAWL 1VHPA 3U4KA 3ILQD 4FQ2H 4F80A 4OF0A 1DZBA 1MF2H 3WL9B 5F8RC 3CBRA 4BCZA 2LLNA 2D7MA 3KEDA 5KVEE 4AVKA 1I85C 1G43A 4JKKA 4XOAA 1C1EL 2IBGA 4KDWA 3TT3L 5BW7A 4JFEA 1WD9A 4FNUA 3RY5A 4OLUL 2BNQB 1DUZA 4A38A 3O9WB 3RPBA 1D5ZB 3QFJA 3KXFA 2CKBA 3TNMB 1B2YA 3HG4A 3A0OA 2HN7A 1KJMB 5AKTA 4AEIL 3N43F 5E8OB 3S35H 2G2PA 1BOYA 2G30A 2W9LA 5ISZD 1RPQA 3FRUB 2Y1ZA 3ARYA 5FECA 1P69B 3ULUE 2PP8A 4DP2X 4IGBA 1HN1A 3KBFA 5AL0A 3ZE1B 4GG6A 3F7QA 5KSBA 1DJGA 4JJ5B 3AWGA 3KNBB 3JWDC 4BZYA 1KBPA 3IFOA 4M56A 2FTAA 3A47A 5EEZA 1WUZA 3HG1A 3SBQA 2Y4SA 1RVFL 1MFDL 1IQWH 3OQ3B 4JPQA 1RLWA 2PW2B 1KNOB 2PWEA 3GZOA 3F7YA 1ZLWH 3FTWA 1XGQB 1UKTA 1IC4L 3NSCA 1DBAL 1C7SA 2FT6A 3CDZB 4GXUM 4U4IA 3TEYA 5C92A 1UD3A 3H4HA 5HGAB 3VDBA 2ITFA 2YXMA 3KW7A 1UD4A 3O11A 4NPYA 4GO6B 3NBNA 3BMWA 1QLFB 3G6DL 3C5ZC 1YAIA 3F00A 1IGIH 4HPHA 3DIFA 3C5ZB 4PJ5D 2VDPL 3UTTD 3SPVA 2GBUA 2IXQB 5J06A 2HT2D 2O93L 3NZUA 4JFHD 5F1IB 1YY8B 5IQNA 5JUEH 3AT9A 5JHDA 1XBDA 2OTUB 1ORSA 2DTMH 3BX7C 3REVA 5A2LH 3FFOA 5EBMA 3QC6X 5C0NC 2VLKD 5JHLL 1HQRA 1H8NA 5KYNA 3TS8A 1RZJC 1Q1JH 5FO7B 4TUJB 1KYDA 3PL6B 2IPKB 3U9PL 4LIQH 1S46A 4XH2A 5HYJE 4H8WC 5HHPA 4HUVA 2VLLA 2CLVB 3RIAK 1QTYT 3X13A 3MKGA 3BUYA 4BUGA 4DCQA 4JHWH 3FQTA 5FYLD 1AD0B 4EKJA 4B9CA 1DQLL 1S3RA 2V2WA 1LWHA 3MRPA 3TBVB 2G75A 3CFNA 4OIAA 3P3YA 3O6KL 4XP4H 4P2RA 5CHNB 4H25B 1QHQA 3BKJH 4XNZC 2X4NA 4R2GB 4RRPA 1H5BB 1T0MA 2H0FA 4RZCA 4TRPL 2FJHA 1DJSA 1K9TA 1KGYE 3CLFH 1CQYA 3QQ3A 3RVTD 4LL1A 1YPZF 3U4EA 3V6ZA 4B53A 3ZQXA 5C0RL 5AKVA 3FTUA 5EC1B 4RWHA 3OSVA 2X44D 5KANI 3TZVD 1YEJL 3EYUL 5HJBA 3KPOB 5ACZA 4EIZC 1MVUA 1U0QA 3HC0A 5BV7B 5I23A 5ICYA 1XIWB 1EUUA 4JFED 4MQ7A 1BV8A 4YFEA 4JFFD 1QVOA 4B27A 5DD0L 5EUKA 1TTBA 1UOLA 4RNRA 4LNVA 1Q72L 4E9VA 4MXQD 4EDWL 2F08A 4Z7UA 4RAUB 1NIDA 3R7QA 1OQXA 2FSEA 3GLZA 4A1RA 1FFOB 3MLZL 1GZQB 3QZOA 5MERB 5SWZD 4KZ0A 5IB3A 5IHUL 1KY7A 2KI6A 1IFHH 3C2SA 1R5WA 3NCYP 3OSKA 4HZLB 4I3SH 4MDJB 5ESAB 5CEXB 5AWNL 3GBML 2J4WL 1UKQA 5IT2L 4JO1H 1XGUA 1H0DB 1KG0B 2XDHA 1MRDH 5IVOA 1HXMA 1NCWL 5IBUB 3D5OF 1ESOA 3ETTA 1GSKA 5F72S 4G6KL 3MNWA 3T8MA 1RP9A 5FM4A 3PL6D 3VMPA 1M6OA 2CHXA 3MTRA 1T04B 4FF9A 4LGPB 4PJ9B 3PFUA 5E2VL 3HE7A 1MFEH 2VXUH 4ZBJA 4X0NA 5C0AD 3FUEA 4B0MB 1PZSA 1V3JA 1F5WA 3D33A 4LSSH 4OV5A 3CVHB 3QJSB 4B60A 2F5BH 1T22B 2KERA 3T6ZA 4PG9A 3VWKA 3G6JA 1NCAL 5D2LF 2UY7B 4ZOAA 2ADFH 3OB0K 1U6AH 4YE4H 1VEOA 4JKMA 5AOLA 1KCBA 3WMPA 5LGJB 4DGVL 5FB8A 1BOGA 2FBJL 1T1WB 3DOHA 5I24A 4HS6A 5DZOA 1GZQA 2FHFA 2JB5L 1RZIB 3EJSA 1GH7A 1YNTF 3H85A 1JF6A 2EVHA 4UNTA 3EJJX 2AEOA 1HSBA 3MI6A 1E9QA 3NPSC 4KV5F 3FDWA 1S7UA 2D03L 4W6WB 1SEBB 3SQRA 2R7EB 1N3NB 1UJTA 4NQED 4WKZB 1J0YA 4X0KA 2Z35A 1SFHA 4HZ1A 5A6LA 4Y4KB 1P2CA 1F58H 5HGBA 4PJHE 4F7TA 2FH8A 3BSHA 3IU4H 1KF9B 1T04A 2P3YA 2EXYC 2Y7QA 1OAXH 2NUPA 1IKFH 3DWTA 4BFOA 5FKPB 2XN9B 2BHYA 4UYPA 4MMZB 1RJYA 4IM8A 2DMHA 4IW4C 4N2FA 5EFIB 4A6YA 4CSTA 3ZTCC 4NO2A 1SHSA 3O2DL 5BUPA 4MJJA 1FL3A 3CQPA 4L5FH 2OSXA 3OAZK 4LEOA 1G9NC 4CVZA 1HCZA 3AM8A 1U8OA 5C0GB 5GZOC 2A83B 3DV4B 1P1ZB 5ID1B 4N8CL 4G6AD 3MRLB 1RZ8A 3N1GC 4PP2A 2XZZA 2Q2LA 3B1TA 4Y16D 1OV8A 5B1JA 2OMYA 3QR1A 1NLDH 5DRNA 1FFOA 2D7QA 3ZKQD 4RCAA 1JRHI 25C8H 3THML 4GKZB 4ANVA 4ZTEA 1SEBA 1CVSC 3ARSA 5LWYL 2C7FA 3HG1B 4U1LA 2MPAH 1AKJB 1I7TB 1ZHLB 3PUCA 1G6RL 2WXOA 2PYEA 3G6JF 1XVSA 4WUKL 2XFXA 1EXHA 1WBZB 3O4LB 4HX1B 5E00A 5KJ4A 1T0NB 1T0MB 5E2TH 4A67A 3ZDZB 4N5ED 1RZ7H 4LSSL 1NIAA 2YGNA 5FUZH 1A1OB 3RFZB 3CMOL 2OW6A 5D7LB 2IPTL 5E2WL 1R3KA 1WFTA 1FC1A 1C5CL 1RPKA 3CVHA 3CX5K 1QEWA 3FK3A 4PJCE 3QIUB 4Z6AT 4JN1H 2GIMA 3WHXA 2VDOH 3O4LD 3CFUA 1FVDA 3UYRH 3WV0A 2DQHL 5JW4N 3KGTA 3QNXB 4CSPA 2VR3A 3HKFA 1DVFD 3ZE0B 1YYLL 2H3KA 1LP9A 4HIEA 4DO4A 4UT6A 4Z7NE 4UQAA 5KANG 1ASOA 1LILA 3GM0A 5JA9A 1JZ4A 4WNQB 4XC1H 4L9DA 3RPKA 5EIQA 2H2PD 3ECBA 4JZJA 4DP8X 5IEHA 3TESA 1TZHA 2UVFA 4DK6A 3TGXA 2A9NH 3PL6A 3WY4A 1OOAA 4R96A 2OXHB 2LAGB 1IBZA 2WLHA 1IVLA 1EBPA 5HXMA 5HI3D 2JSFA 3KH4A 3PIQB 2B3RA 1WCQA 2NNAB 4KBPA 5DO2C 3ZZLA 3NA9H 4HK0B 4UQ2A 5FYJH 3WFHB 4FNLL 4BFJA 4LSUH 1MAJA 1SHXA 1BAGA 3PWVA 4LRIC 2DYPA 2B1AL 4ONGL 4F58L 4PRDB 2YD0A 5H2BB 5C6PB 4NO0D 3P3UA 3PGCB 1U93A 4OV5B 1VFBA 1BHGA 3ILQC 2XVBA 2XZCH 3TF7C 3G6JB 1UWGH 4I7ZC 1CZ8L 5IR1A 3WUWB 4ZMZA 5I6KA 4DF9A 2Y3AA 3HMXL 1T1ZA 3QA3A 3TZVA 4F15C 5C0CB 3GTVA 3T0XA 1XCWA 1I1AD 2VE6B 3LKRA 2QSVA 1JCKA 2QPUA 2J72A 3FOMB 4G9FA 2R1WA 3T2OA 5LBSA 1XGTA 3NJIA 4WWPA 1WCBA 2FL5A 4X0KB 1A3RL 2H32B 3OZKA 4WEEA 4MKTA 5I75B 1EJOL 1LMIA 5D70L 2WB7A 2ZYRA 4NWUL 5IFAH 1AZZC 1J7VR 2Q3XA 1OOWA 5HTSA 1BJ1H 3D85B 4J2QA 2CLVA 4UT9A 4X6BA 3S3BB 3VMNA 2VZSA 5INDA 3W3BA 1FF5A 4HS3B 4U3CA 3ULVF 2HTKC 3WIHL 3MLRL 1HHHB 4QRTB 5FXCH 3IXAA 1BVKA 2ICES 1ET7A 1D7DA 4HLZG 4UANA 4XNXL 1OW0A 4M7JL 3TXAA 2QGCA 1TVBA 4PJXE 4XX5A 3SDCA 5T3ZD 1JV5A 1RUQL 3GSQB 2JIXD 3PJSA 4BQ6A 2JI2A 3LXCA 4JO4L 5T5FH 4BFIB 4WW2B 2OYPA 4ZG1A 2V7HA 1FBIL 4WO4D 3HA0A 3IDJA 4BGLA 2X5PA 4JE4B 3VWKD 3ATDA 3HE7B 3QQ9C 1EMTL 1T0OA 5AW6B 2FZ3A 4QRRA 2AXFB 4UQDA 4FHKA 1MKFA 3GMRA 4FI6A 4Q8BA 4GINA 3GSNH 1UH2A 4PJAE 2A74C 1D7BA 2Z65C 1FRGH 3LRLA 1JYVA 4S1RH 5D93C 1UWXK 3F12B 4OJFL 5ABAA 1SUHA 4ODUB 2B3IA 3RWJB 5CSZA 4CMHB 1OF2B 1W0WA 3QCVL 2ZAHA 4JFSA 4LCYA 4A6YH 3IE4A 4X4KA 4WRLA 1DEEA 1SMOA 4PJ5B 3E9UA 5F44A 2FSEB 3EBHA 3SY6A 2J43A 4DN4L 5I1EH 4MQXD 3IFLL 3IDNB 2QR0A 2PCPA 5GS2D 4KJWD 1XV8A 3NZ8A 1KB5H 3ZDXB 1AAJA 5D7JA 1XZ0A 3U0WL 1JK8B 4MMYA 5I6NA 5J9PB 4BE6A 4IMLB 2EDWA 1PAZA 1C5BL 3FF7A 3GB7B 3LEXA 3UMNA 4HQQL 2WUBH 3P2BA 4L8SC 5J3HC 4ZT1A 1CDBA 1PS3A 1MWOA 3BAKA 2A7BA 4QF1B 4CC1A 1EAOA 4EVNB 5SWZE 4YNYB 1KGUA 1AG0A 4Z7QF 3SSGA 5AG9A 1KPRB 4OCNC 4QJ5B 2LVEA 4KAQL 1QA9B 2QHRH 3WNNA 4FTVA 4H2CA 2F8XC 5IREA 2EDXA 3WXWL 5B4MD 1IT9L 3MRRA 2DQMA 4IMKA 1W91A 4N0UB 1EHXA 3RNQB 2DLFL 2DIEA 3ALXA 4LCCA 4WTZA 4C56E 2E0PA 3DJZA 2NZ1A 2OCFD 2P48B 3MLWL 5C07E 2JI1A 2XN1A 1HEHC 3RL2B 4DFHA 4YHZH 4M7ZB 4V1DB 5GHWH 4PJCB 3VFGL 2CIKA 4HU2A 3L3GB 5JXAH 2FZ3B 1A4JB 4XO3A 5D7SL 3JVGC 4NC2B 5ITBH 3SGJC 4TUOB 2UY6B 3WL9A 1PZ3A 3C6LC 5F9OL 3NH7L 3CLEH 4HHAA 4P2QE 3OR7A 3DVNA 3IDIB 2KC0A 2A4EA 4W9EC 2MWCA 3SDCC 1H5BC 3LKNB 5D7KE 2C3VA 3RGVA 5LJYH 1INQA 1JERA 5FYLE 2EEXA 4YBHA 4B50A 3ZDYB 5BZDB 3HI1A 3V4VB 4IBQA 1SXCA 2GSIA 5IVNA 3FQ2A 1DVYA 2AANA 3UTSB 3JWOH 4PSPA 1M2OA 3PGFL 4NHUB 4S2SA 2X9WA 2PCPB 2NX5A 5K1NA 5CWSB 4GSUA 3MV8D 2EDFA 4WQOA 4EI6B 3S88H 2QADC 1QYGL 1DEEB 1S7WA 4JFOA 3PWUA 1IEAA 1BW8A 4NPYB 4XPAL 3GHBH 3DUSB 4UAOB 4JFDB 3IT8D 1OAUH 4WFFD 5KJRL 5E23A 3VI3F 4NUJB 4AJYV 5IIEA 2EUZA 1CBVH 2OLDA 4GI8A 3TF4A 1HCVA 5T3ZH 3NCFB 5K39B 2IOOA 3FQ4A 1JP5A 3ASWA 5I1JL 2VABA 4XZUA 3EHBD 3SN6N 3AUWB 4G9DB 1YYCA 5I6MA 1QYGH 3BPLB 5TDNA 2EDNA 3RJOA 4JPIA 3PNRB 2L4OA 4JGJA 3H9SD 1P84J 1F6FB 4HJUA 4NSKA 2PTTA 5CSGA 3FTVA 4Y9CA 2OMUA 2NQCA 2VUYA 3TPUB 1KCVH 2ZCLL 3VXMA 1BZ7A 4TVPE 3EO0A 4HOZA 1ET8A 1SHWA 2NTFA 3LD8B 1MJ8L 3WY1A 4OM0L 3CVHL 4O2CA 1UXWA 2EIJB 3RFZC 3KM2A 1G1CA 4ONGH 1TEGA 2QMKA 3S36L 2EVFA 5TF1H 3BGMB 3MJ8B 4WW2C 4A7GA 2A74B 4M02A 5LNGA 2EE3A 4Q0XL 5CZXC 4NENB 3WELA 5IFJA 12E8L 4OI8A 2OBGA 4X6FA 5D7SH 5C2BL 3NCYS 1AGDA 2YEZB 3V5KB 3ZMRA 4DP7X 2OTWB 3BZ4A 4DK5A 1WA0X 3MRFA 3F7PC 4YIQA 5A2IH 2DJSA 2KHAA 4ES9A 1Q9WB 5I16A 4DPBX 1P5VB 4F20A 3H0TB 5C71A 1X9UA 3ZE2B 4H44C 4PCSA 4J6RL 5JPNC 2R15A 4AYMC 5L4MA 1YZZA 1FVEA 4YOKA 4QHLA 4AM0B 2EJ1A 3INUL 4FRWA 2P5WE 5CBEA 3BSZA 1UD5A 2GSIB 3WNMA 3UABA 2GITB 2NNRA 4OFYA 3G6AA 2UXFA 3LXAA 1CD1B 3ECUA 2XG4B 1VFBB 4Y7OC 4S10A 1WFOA 1PX8A 2I27N 3CGTA 4HCRH 2IDTA 1QHOA 4BFIA 4HIPA 4RIRB 4LESA 1NGYA 1TQWA 3FSOA 3QORC 1HE7A 1QQDB 5AQ0A 2MPAL 2BC4A 1VFMA 4UT6H 1QPPA 1OAXL 4TN9A 3BEVB 2EH8H 4HSCX 4HIXL 5D7JC 3TV3L 1FO0H 1HESA 3B6SA 3DMMB 1DEDA 5DZ9A 4MYWB 3EFFA 3TONA 1CFSA 5AVXB 3CVHH 2ZOKA 5HD8D 3WG7B 1GIGL 4EEEA 4HKXB 3OV6A 4NJ9L 5C70A 4CN6A 5FO9A 3K81A 2SEBB 2IJ0C 4FQLH 4DFIA 2NX5D 1ZLVH 1MCFA 3QDJE 4HD5A 5C09D 3LRSB 5HDBB 1T5WB 3E1F1 5J13C 1BVLA 3EH4B 2WD0A 3QUMB 1ES0A 4ZMAT 3UAJC 1U8MB 4HIXH 3TV3H 3UL4A 5JO5A 2AEIT 1VACA 3FU6A 4Y19D 1Q9OB 4Q0XH 4K0OA 3C8KB 1II4E 1A2YA 4BQBA 2WBJB 4JDVB 3NFNA 5DZLA 3GIZH 5L88L 2C4XA 5CJ8A 2HA1A 4O9HH 4QHMA 2B39A 3CFBA 4IBYA 4MBRA 1AKJA 1I7TA 4L3ED 1INDH 1S7UB 2N01B 5BOZG 3KLHD 1DVFB 1XIWC 3ZT5A 2E7MA 3T6QC 2VZTA 1OARL 1M1XB 2H9GB 3OHXA 4C58B 5EEXA 1FNGB 5HJ3A 3U48A 4D9LL 1NCGA 3AU1B 3O45B 4L2LA 3D8MA 1GPOL 2OL3H 3SKNB 4BFKA 5FEBA 4GP8B 3RBSA 1X5HA 1OAQH 4E0RB 4B6ZA 1IC0A 4E5XA 2WLLB 3U6RA 2J20A 3UAAA 3VWKC 4GY4A 2VXSL 4YSPA 3ZZQA 3U9UB 4YSEA 3FUJA 1FA4A 4H8VA 1MQ8A 1SQ2N 1PU0A 1SZNA 2ADFL 2EIDA 3AABA 4W9JC 2F54B 4XPGL 2APXA 1IL1B 4RFOH 2FUQA 3RWHB 5JR1L 5LQBL 1ID2A 1PL3A 3QUKA 2F74B 2UXVA 4Z0XB 4EN3B 4L4TB 4TQEH 1NC2A 4D8PA 3WGUB 2ZCKH 3LHAA 2G2RA 4GS7B 4KMQA 3I74A 3N40F 2FVNA 5HDBF 1S3KH 1QWHA 5TPWH 3TA3C 1MUJB 1RHHA 4AMXA 1NKRA 3CMOH 3GMNB 4LF3B 1CFMA 4PB0H 2KLSA 2NYYD 4HDIA 3KCWA 1YEEL 5E6SB 4XPTL 2I7SA 4CL7A 3UGXA 1HX0A 3TCTA 4QPEA 3SZ6A 3K8LA 3BZDA 5EUKB 3PV6A 1AFVH 3HFMH 3QJRB 3NGBC 4OQ1A 2AK1L 5DC4B 2EYSB 2YAEA 2KQNA 3F01A 4OCXL 2D7TL 4J3OF 1KB3A 3CFJB 4BGDA 3WTXA 2GEQA 5KS9F 5GS0H 2V3FA 1I8LA 4PRHD 4X8JA 4OR1A 4MQ7B 4P23C 4UT7L 5C0FA 4IOFC 3BPOB 3CZGA 3B8YA 5AB2A 2NPLX 4XXCA 3VD7A 2NY3B 1AO7E 3C8KA 4NP4H 4Q14A 2NOYA 4FI7A 2A6IA 2Z1PA 2BINA 2WTPA 2YD7A 1PQZB 1XCQA 4HIEB 3WFEH 1G9MC 5BS0D 2XN9A 1TJGH 3G9AB 4JRXB 1M6OB 5F70A 5T1KA 3PLYA 3UBXB 4YGVA 4L3EE 4APXA 1OALA 2AK4B 3RKDC 2PLTA 3P4NA 4D0CB 4LHUA 2JJSC 5D4HA 1KFAL 5D7IB 4EKXA 3RA7H 1P7QA 2CDGA 4JCMA 5KVDH 1E90A 1ECZA 3OHMB 3PGCA 3L2LA 4OZFH 5E4EB 3MLTA 4AEIH 4Y4FC 1CFVH 2FX9L 3QXAB 1ETB1 1YYMH 3T3ME 2DYPB 2XQBL 3UCRA 3DX7B 4G7RB 1KGWA 1TQVA 5F7MC 3KWWB 2JQMA 3O3DA 2OSWA 1U2YA 1CMOA 4QHNB 5HYEA 2UZYA 3DRTA 4DEPC 3LN5A 3F05A 5AAWC 4BUHA 1OLZA 1TU2B 2ARJQ 2QADB 1RZFH 3U30B 2OYMA 1UG9A 1ETJA 2VLJA 2YA0A 3U36B 5DTFB 4EN2A 1UD8A 4YDLC 1N64H 2O6EA 5JMOC 2O5YL 4Z9KB 4NEHB 1V5JA 3VQMA 4GAGH 4BH7B 2WBJA 4JDVA 2BO0A 3A67L 4KVNL 4Y1SA 1YG9A 4YUEH 2H32H 4OJAA 5FA3B 5SWZB 3VNZA 1CXFA 1MVFA 2R8SH 3VXUE 1NFKA 3EHBC 2ORBL 5CKGA 3VFMA 4OLXH 3HKZA 5D7IA 4ZMYA 2EO1A 2WXPA 4HHWA 1XMEB 5LAPA 1OSZB 3TYFB 4LSUL 2CKBL 4M5YH 4XOEA 5T5NG 2JTDA 5IW1B 4N0FA 5LN8A 4MZIA 4X6DF 3VCLB 2GYSA 3CBJB 3CDZA 2E3VA 2VDNL 4MMZA 3JWNG 3PABA 1JNLH 1AE6H 2D31B 3ZY7A 2PR4L 4JO4H 1S9YB 2BVEA 2YUWA 4M7LH 2NZIA 4AM0Q 3WGVB 4LFHG 5DJZA 4AZUA 2EIEA 3VYOA 3WIIH 3BVUA 4M8VA 3WI9A 1YYLH 2H6PA 3MXWH 3SOBH 2JB6B 3P40A 4LOVA 4NKMA 5E6IB 4CVXB 1F8TH 2H4EA 3FTSA 4JQVC 4YDZA 4EQ2A 3VRJB 1MW0A 4TSBH 5HI5D 3LSOB 3LPPA 1NJ9A 5T1LA 3CJJA 1ZT7A 3L48A 4L1HA 5E51A 4ES8A 3OAYK 2GUOA 2B1HH 1ORSB 3UAJD 4JZOB 2HJKB 4PGDA 2GAZA 4KX8A 1CYGA 1WQVT 4JPKL 3APMA 2XBTA 1AQDA 1JK9B 4AQ1C 1WC7A 2DBLH 3UZVA 5I1KL 2D0FA 4A6YB 1YEGH 1IM9A 1ES0B 1A6UL 3HS9A 1BVZA 1MCOL 2V8MA 3FHAA 3NSDA 3MUJA 1SXAA 3C5XA 3UTSD 5IJCC 3C5SB 4PRHA 3LB6C 1ZJBA 3G3LA 3HPJB 3DUUB 1EXUA 4HKBA 4H25A 1RULH 2BVPB 1WP6A 4WTQA 2XWDA 4HSQA 3CSTA 4XNAA 1MCWM 2VMDA 4NPJA 3VWJA 2J1KA 5FYJU 5LBSH 2YUXA 3BW9A 4IOSD 3II1A 5EO0B 4R4BB 4TNVK 5E95B 2G75B 4CU6A 3IAPA 1AOZA 1ACCA 1MCBA 2YSSB 5T5FL 3RZWA 3GHEL 3UPAA 2AQ1A 4LDEB 4ODHH 4Y9EA 2ZSWB 2IBBA 3GBDA 1JXKA 1LL1A 3LS4H 3WSQL 3P73B 1HDMA 1QRNA 1OGTA 4QUOA 1P7BA 3P30L 1F0LA 3QHFH 1OTTC 3DX1A 3QEQA 1QAWA 4V1DD 3RI5K 2XWZA 2DAVA 2ZXEB 2R29L 5BRQA 3BRGC 1IE5A 4MX7B 4KI5D 3IWUA 5C7XH 1TEFA 5DD5H 2WPGA 5DO8A 4NN5B 3QYMA 4K3GA 2J1YA 4FXLA 4KQ0A 2HCZX 1NBYA 4NS0A 2KUTA 3ZRSA 4XI5C 1AD9B 2BNUA 3MDJA 2VAAB 4KJQD 2G3NA 4Y9GA 3SOBL 2FLRT 2WOYA 3LMJH 1L0YA 3FO0H 4K94H 2ZAGA 3QZWG 5JZ7C 4PYGA 2WXFA 2ED6A 1M05A 3BZFB 4FN0A 3CFCH 5C9KA 3HFFA 43C9A 4NUJA 4NC1E 4GXFA 1RIHH 3Q05A 3O8XA 4PGBA 3VXMD 3TBVA 1JFQL 2WW8A 1VGEL 2P8PA 1BX2A 2NYZA 2V6HA 4GKNB 2R4SL 1C8PA 2ZP8A 2GUYA 4AGQA 4NHUA 4S2SB 2BIIA 4FQIH 4F9LA 5BUGA 3EO9L 2EDLA 2VXVH 3VGHA 3APFA 4LLUA 2I07A 3MLVL 4ZZKA 3PAVA 4XPAH 1ZVYA 3HNSL 5L2KE 3SE8H 2OR9L 1YEWA 5T1KD 4NCC1 1XF5A 5E5LA 2XTSA 3ARGB 1G7HB 1KCRH 3QUXA 1D2PA 3F58L 3IJEA 3JWNE 5I66A 5TK4A 4DO5A 2H6UA 4R90H 5D1ZD 4UV7L 2OTUA 2MCMA 1L0QA 4LHUD 3UBXG 5I15L 4D2NA 1EZVY 1A14H 3BP7A 2AQ3A 3UTTA 2ZKMX 4ELKA 4F33B 2OI9C 3A3YB 3H2WA 5BVPH 3JT0A 2AABH 3B9KA 2QGBA 4XXCC 1BYOA 1MW2A 3X1NA 5GJTH 2AXGB 1O7DC 1GZHA 2XXMB 4MS8D 1YCSA 1YJDL 1F56A 1M6UA 1F4WL 1A8ZA 1RZPA 1XGQA 2WTRA 2YQ2A 2V37A 4GW4B 4KI5E 5LLIC 1BZDA 2A73A 2WBXA 2WCSA 3LS5H 4JN2A 2BZ7A 2Q76B 4WWOA 4TF4A 3BYTA 3PG2A 3S4SA 1AZCA 4WHDA 1KJ3L 1TO4A 4MJIB 1PD6A 4Y16B 1A6WH 4GSRA 1KCSH 1HINL 4QHKJ 3VRLF 3QJVB 1S9KC 3J27A 1XCTA 4O02B 3FQWB 4RZKA 3HZVA 5J13B 3NACL 1G7HA 1K5NA 5FM5O 1G6RH 4N9OB 4FQXD 3HAEH 4L37A 4ZMOA 2J8UE 3GSQA 5EORH 3K6OA 1L7TL 4D8OA 2XKUA 3KBPA 5E2JA 1WWAX 3ROOB 3LJ3A 4GW1B 3UPCA 3KLSA 3DMMC 3NZ8B 1FPTH 1QRND 1JPEA 4XVJL 1HZLA 2E56A 1FL6A 1L7IH 1J1PH 5J0BA 5J9PA 4MD5B 5FGCE 5DJ8A 4UOW1 4O51A 4X6EA 1G7QB 2CBPA 2DTSA 1C5BH 1E50A 2DJMA 1YC7A 1N6UA 2G4GA 3DDGA 3NCXA 4HFUL 4LIQL 4U6XA 1BVOA 3O2DH 3TA4D 2CO3A 4JY5H 5BPPA 5C86A 2XN0A 4R5XA 3ZSTA 1NAMA 2P8MB 3ET9F 4YSDA 4BE5A 5DCCA 3F85A 5T5FA 4IU3B 1OXYA 3GZQA 4I48A 4JFFA 3VXQB 3ZR6A 4NZJA 5JHMA 1NGWA 2C3XA 4GKLA 3QO0A 1G1OA 3SGKA 1XSJA 4PD4K 4JFYA 4KMTL 4HPYL 2ZUVA 4Q9RH 4R90L 1UACH 2NY5L 3ARGA 4X9FA 2VAAA 1B2WH 4E2OA 4MNQB 4WWID 3E2HB 2V3EA 3VE0B 5JORA 3O6KH 4XP4L 2P9RA 2X70A 1FYTB 4L8BB 4FNLH 4M48H 4WWKD 1M3JA 3QQDB 5KBMA 1IM3A 1J5HA 4OCLC 3HNTL 4GW5A 4LL9A 4QRSB 2J5WA 1XTLA 2D8KA 5H2BA 1XGYL 1OAQL 2BXZA 2WHVA 4YSAA 2OP4L 3S4SB 5IQMA 4TSCL 4XPTH 3VQLA 4WGWB 2CR6A 4OZIF 3U2IA 3HN8A 2EC8A 2AEQH 2C3VB 4XMPL 4MA1C 4O02A 3QUMH 3T0EA 3X3GH 2Q2EB 3HUJB 4TVPD 4Y4HC 1ZSHA 3OMAB 3TO4B 3ZDWA 5CZVL 1CO1A 4O9HL 1EEQA 4FI8A 1BMZA 3VACA 3UYRL 2NY4D 4OD3H 2X6BA 4Y2DC 5E6ZA 2X6CA 5FGBC 3UXFA 5KBPA 3RKPA 2GTZB 3QUZC 1A0QL 3OM3B 5IMLA 4TM9A 4RMRA 2IAMA 1PLAA 4IKIA 1UZ8B 2J4WH 2CA3A 3HZYA 4NM4L 2FEDD 4PHXA 4A7QA 3B9KD 1GY2A 1MIML 5BMFL 2DQCH 4J4PA 4AKQA 2XX0A 4R7LA 3V0WH 2VYRE 2F7IA 1CCZA 2BP3A 1YDPA 4LLWA 5DJ8B 1BG1A 4MVBD 4DKFH 1Z3GL 4IRSB 3QP3A 2B4CC 1DQVA 4P4KD 4CSSA 1QHPA 5IW6A 5EOTB 3OWEA 4GBXB 4OV6F 4KZCA 4MJHA 2ZUTA 4XN8A 4AMKH 2JFCA 3EYQD 4A2DA 4L29A 1QI5A 4ISVA 2FBRA 3VH8B 4NQSA 3MXVH 3WNPA 1MHCA 5F1KC 5A16B 3WNKA 5D7IF 4OZGE 1S8DA 4RX4D 4IU3A 3VXQA 3MCLL 1ZVNA 5IEKA 1H3VA 1I9IH 4HC1H 1WISA 4Y16A 2J6EL 3PHOB 1J5IA 3DPDA 1CD9B 2UVEA 3EYSL 4G2AA 4BINA 2FO4B 2FECL 4HEPA 2HTLC 3BLKA 1WV7T 3FO2B 3O6LH 3HUJF 4I85A 4K4KA 4HLJA 4JFZH 3CSBA 5CLYA 1A1NA 5JMRA 4YDNA 4OF6A 3TZVB 1RIVH 4HXAH 4OZGB 4A2FA 3AREA 1U8LB 2L7JA 3R06B 4TPRL 1T21B 2PYFA 3U1SL 1DJIA 1ZANH 5SWSB 3VI4A 1IJ9A 2Q1EA 3MUGA 3ZR5A 5EU6A 2ERJC 2ZUXA 5E5MA 2OQJB 4PJ7E 3U46B 4Y89A 3BAIA 3FC8A 3U0TA 1T6BX 4TVUA 1QFUL 3IVKB 4NFDA 3X11A 3H56A 3L4CA 4MWFB 3QXDA 4BV1A 4XGZB 5B1AB 1WVZA 2WYHA 5KOVC 2X7LB 5FUZL 4X6DB 4HCGA 5KVMC 4NUQA 4ZW8A 1JZIA 5GGUB 4KU1A 1T5KA 4BSVA 4NDMB 5K1JA 2NT1A 4EF3A 4R96B 1NLBL 1UM5L 3HAEA 4PVLA 4WSGA 1UWXH 5GGRB 2ISDA 3ZE0E 4UB0H 4UUJB 2VJ8A 1RJLB 5KVDL 4YHOH 2XIIA 4WENB 3SD5A 1R3IH 3QCUH 5EBWA 5AVRB 2WJ7A 2CKBH 4M5YL 5JOFA 5AG8A 4OZFB 3UC0H 4CDGC 4F2FA 4GP4B 1FZJB 2GK0B 4FADA 3B7SA 3Q1SH 4QEGA 1XGRA 3T0ED 5IB5A 2I60H 4FTVB 4P4KB 3BP6B 3EO1B 3QRGH 3V10A 3VGBA 4URTB 4H0LC 5K1VA 4JFPA 4NO0A 5D1QD 3PDOA 1MFBL 3ARBA 3RDJA 5K9QI 3EGXA 4GB9A 2NTSP 1I3UA 3QULB 1SRDA 3PHQA 4MBOA 4IK6A 1QR1A 2WZ6A 4I5BB 5A2JH 3GSUB 1QUNA 1ACZA 4LL4A 5F1NA 3C8DA 3FSZA 4LBEA 3SGJA 3JVGA 5I19H 5AZEH 4YS4A 1T2JA 5C0RH 4O00A 2HRLA 4RQQA 3H6AA 5IESL 3BSZH 1FAIL 2CUHA 2Z92B 2WWMD 2EQDA 2F58H 1MVUB 4MXWL 4HKZA 4X6BB 5D8JH 3SQBA 2H3NA 4CVWA 3FH7A 3BVDB 3W38A 1KZYA 4OCYH 4ZFZA 4KJPC 1ZS8B 4P2QD 2VRQA 4PG9B 5FM5M 4XMXA 1JFHA 2JIXB 1MI5B 2VERA 5IQLA 4HV8A 2DQCL 5EZIH 5ID0A 2AJXH 1NEZA 1PBYA 1NC2B 4N9GA 4I0PD 4AKOA 3EXLA 2A0LD 3C09B 4MCZA 2W0FA 3B56A 4O5LL 1SJEB 2O5ZH 1Q9KB 1XL4A 3B7YA 4OZHA 1XHHA 4TNFA 15C8L 1T7VA 2Y36H 3Q3GB 4ZW6A 5C0BA 1IKNA 2ZG1A 4ZDHB 4HZLA 4LSQL 1OWWA 2DD8L 5ESAA 4YMPA 2ADIA 4Z18A 1M42A 2WQWA 1WBYA 3ESOA 1T2XA 3O9WC 5EIIG 1Q0XL 3FT4A 4P5KB 3LQAL 3HG3A 5GRZA 5T1LB 3BKCH 4UDTB 1RERA 4Y2DA 2AJYH 2KH2B 3TU6A 1DJZA 2VR9A 5LVEA 5KBNC 1I1AC 3PV6B 3RVTC 2G5RA 2NY4B 2X9ZA 4KQ3L 5DT1L 1TQSA 4F5CA 5IROA 2G9KA 5J6HB 4PW3A 3UTQA 2XXFA 2EKSA 1TF4A 1C7TA 1VESA 1JGEB 1CIUA 1JMZA 3BKMH 3NSFA 3ULUL 2V2TA 2WLZA 1OTTD 2W80C 2WUBL 2QKIB 1IGYB 2GBAA 2P8LA 4ZQKA 5TPWL 1G0DA 3VWJB 5JW3H 4JK0D 3I6GA 3TOPA 4R4BA 1I8IA 2K3TA 1RZ8B 3EH3B 3HNVL 3NRFA 4PRHB 4M6NL 5AVWB 4UIKH 3EGXB 1E6JH 1IAIL 1EXUB 3ERXA 1PLBA 2DM2A 3IGFA 2A6IB 5J12B 3BRDA 2APWA 3KZ8A 4HUCA 1NWOA 2AK4E 3MV11 5J3HD 2LTQC 4MNHA 1OAJA 1F4YL 2H3NB 3DHJA 4FZEH 4PS4H 3WEXB 1CL7H 1GTFA 1ZTMA 3C6SA 3BE1H 4LKXA 4XRCA 2X0WA 1ZT4A 2YGPA 4JHAL 3REWB 4PWGA 1A4AA 3STLA 5CJ5A 4M43H 1CGXA 4R5TA 1KCVL 1QATA 2ZCLH 3CFKB 4H7VA 5DJAB 4Y5YA 3W5MA 5I71C 4BQCA 4MNGB 5FKAB 1FP5A 2ZOUA 1U42A 2IQAA 4QDGA 3VFNA 4AJ0A 4JHWL 1M7XA 4ZUTA 1KJ3H 3MTXA 1M7DB 3OG6B 1LQSR 3MOBL 4HF5H 4XVTL 4QHNA 4PUBH 4FKHA 2IEPA 4ZDHA 1BM3L 2GTQA 2P5EA 4KTGA 4K8RD 4X8CA 2VB5A 4I8DA 3QIUD 3RIAF 1VKXA 5E2VH 1MELA 4KHXL 5D7LD 1TPXC 3QIWA 3QVAA 1AQKL 3HTLX 3S7GA 1N6QH 4IIQC 4DKAA 1DVQA 3HB3B 4NN6B 3TWCH 3UEQA 5FDWA 1PW3A 1DFBL 4N8VG 1T21A 2PYFB 3UADA 2VZ3A 3R8QA 2OAAA 3ZHNA 3LQMA 4LCUA 5GRJL 4MA1B 3IRZA 1GGCL 1DQDL 2DKUA 2MQ0A 4YDIH 2J2ZB 1Q9WA 3CZFB 2DL9A 3F58H 5SWZA 4NWTL 4FQXA 5KYYA 3OKYA 1AGEB 1J1OL 3HHSA 5AL8A 1SJVA 1O5DT 1VEMA 2X2JA 1CE6B 4K5OA 3QJQB 5I19L 4HK3N 5JW3L 3D85D 3C5JB 3W56A 5KYWB 1LD9A 5DJ0B 1IGYA 2QKIA 2OR7A 4ZO9A 2JCCE 4A66A 2QJDA 1VJSA 1ZCRA 5GGUA 2YKLL 1PD1A 4KO7A 2H26B 4BSVB 3LIZA 5DYOA 2ZOWA 4QOKB 3WFDL 3OB0H 4UWQB 1CLOH 2VQUA 2R9HC 4U3SB 3VXSA 1QSED 3LZOA 1NGQH 3D0LB 2DM3A 4IOIB 5D2NB 5E0FA 4XX1G 4Z7NF 2H9GA 4JHZA 4OD1H 3ZTEA 5MI0C 3DBSA 4PMEA 2B1OA 4OM0H 2IIJA 1VCBC 3ZZ1A 1PZBA 5ALBL 4CN4A 3HPLA 4QXVA 1K3IA 3V0HA 3AREB 3K5RA 3FUKA 4K9JA 4Y2DD 5FHBL 4AIEA 3QDME 1XGRB 3FPYA 1Y7VA 4Y8AA 2WGXA 2O5ZL 1ZA6A 4ELDA 4JZNA 2Y22A 4ZS6C 4YXLH 1GOFA 4Z77A 3APCA 3BN9C 3PDOB 3V4VL 4Z0XA 3LKQA 1ZSDB 4U1KB 3AAZB 5I18H 5K9OA 1XGPA 5DMGD 1G6RB 4ALAL 3IU3A 3AQZA 3II2A 1HE8A 4IJ3C 1CGSL 3ZO9A 3RE0A 4JPKH 5DVMA 3CHSA 1ZDSA 5G2NA 3PDGA 3UYPA 3L5WB 1IB5A 3KS0H 2YQBA 1ZGLB 4PI2A 2J1ZA 2X53A 5CGTA 4AZ8A 4ESKA 4WUUD 4X4YB 4GSXA 8FABA 4IGBB 3WDIA 2H2PC 3GSOA 4ZO6A 2GJ6E 4NO5A 2OJZL 5DK2B 4GW5B 4F37F 2ESVE 1RHHB 4QHMB 2X88A 5E9DA 1QW8A 3QDGD 3MBEB 1MJJB 4Q58C 4B9ZA 2HMID 4D9RD 3HLAB 4TL5A 2LE9A 2P24A 4UM9A 4XCNB 3PP3H 2BSTB 2VSCA 3L3OC 1MIEH 3MFFB 1N4XH 5H94A 2W0FB 5D1ZB 1E4HA 2LV4A 4XMTA 2AKRA 4AGMA 5FO8A 3H8NA 3E8UH 1NAMB 2P8MA 1XMWA 3SDAD 2FX7H 5EIVA 2D0HA 1OB0A 4H4NA 2NSXA 4NN7C 3WFZA 2B8OT 1MVYA 2IALA 1JZ8A 1IL1A 4NKIL 2XN2A 2WQVA 1AGDB 2YEZA 3HE6A 1KIPA 4BK4A 4LLDA 4MASA 5DMGC 3UO1L 5DMKA 3MODL 5LBVA 4ZX6A 2XNAB 3IEAA 3EF4A 4OIIL 3KPLA 3BN9D 4WV1C 2ZOKB 4LRNH 2XPZA 3D18B 1D5IL 3D69A 4NLHA 2AZUA 2AV1B 4LNRA 1KXHA 4I77L 1DQJB 1KC5L 1OT2A 1RSYA 1ZOXA 3N1FC 5DLMH 4JGNA 4ZMPA 3QCVH 1JD9A 2D3LA 1E3XA 4R0LB 1J0JA 4ALAH 1MXDA 1XH2A 1BQLL 3U1PA 2CHDA 4Z78A 1YQVH 4JFDD 2PCFA 4AC2A 3DXAE 1A3LH 3N40P 4O2CB 2NUTA 1R24B 5L0QB 5I0XA 3HLKA 3NJVA 4EBQL 1IBBA 4KTDL 1CF1A 4Y5XB 2IAMB 1P4LA 1BDYA 1GYVA 4R4FH 5CD3B 4AQZA 4YDLB 2G3MA 2R4RL 3DGCR 1DQDH 4M6OH 4QI3A 4NO3A 3WCYA 3WN5B 4DZ8A 2WO4A 2IBZX 1OHQA 1EWHA 4G8IA 1CTOA 4GQRA 1BFVH 4HIJB 5EOCH 3WEMA 4FYQA 2XJLA 2XTJB 2FHBA 4L4VA 2ICWI 2AXJA 1N0LB 2VH5H 1NBVH 1K4DA 1ZHBB 5C0CE 3ZL1A 3VO0A 3KPRE 1NDTA 2UX6A 1B3IA 1KPVB 1P5VA 4G1EB 4JEGB 1XBRA 3W37A 2Q86A 4Q2ZA 1IX2A 1OE2A 1AP2B 4ZD3L 1XO8A 5SX5H 1YQ2A 4CSZA 1BLIA 1QA9A 5KW9H 2F19L 4TKWA 5HPOA 1ZE3C 3BO8A 2DMKA 3GMQB 1BGXH 3IBEA 1UURA 4L29B 2X70B 5B39G 4RWYH 1NCCL 3DBXB 3GRWA 4KDTA 4U3HA 4HPYH 4QY8A 2ZKYA 4P46B 4M29A 1IM3B 3MLPA 5KZCD 1XCTB 4NHCH 3ZJAA 2Y7LA 1EFXD 3QEGH 5ABZA 3CMGA 2DH3A 3BZEA 1G84A 5E2UH 4JFFE 1KWGA 1TQBC 4HUWB 2VRAA 1N0LA 5I18L 3SPGA 1N6QL 4JM2D 4AITA 1BGXL 3E3QC 4GEIA 3TIDB 1BD2D 4I3GA 5C97A 4G82A 5CCKL 2DOCA 3G08A 4MXVE 3L4UA 4R7NB 2CHWA 4QR7A 5L7XL 1EJOH 4WI4A 1VENA 3WO3B 4DKEL 4XOBA 5E0QA 3FTZA 1MRFH 5DDHB 3ZL4L 2FYVA 3GIVB 5F7LB 2VDQL 3MRKA 1TZIA 1U8IB 4Z7VB 3ATBA 1JNNL 3DX9B 3DDFA 4TTDD 2VLRE 4JFFB 4KK9C 1BECA 5F6IC 1T89A 5IV2B 1TJGL 2WXNA 3FZUD 3BIAX 5I75C 3GDCA 5BUAA 5DEFB 3HLAA 4CAGA 3K0WA 4CC0A 5CWSA 4P3CH 5T8IA 3CZLA 1R24A 5I8OL 4HPOL 1KTJA 2CDFA 4KNTA 2R2HB 3V52H 1I9EA 1GKEA 4OT1L 4N8CH 4DPAX 2IFFH 4DIXA 4WI0B 5GGVL 4HT1H 3FT9A 4AG4L 3NIGE 4LCIH 5KSUB 5F9DC 3BSZL 2EDRA 2DIAA 3JYBA 1T03L 3VE0A 2K78A 1D7CA 5G4NA 5HVHC 2F8VA 1K85A 3IJ9A 1FNAA 1TENA 4P23A 3BVWA 3GF8A 5HVFB 3Q6FA 3ZVVA 3T65A 5AKSA 5LNEA 1Z3GH 2FWLB 1AMXA 3BVNA 1J11A 1FORH 4Q2ZB 4UNVA 3AY2A 1G6RA 1IQDA 2AF2A 3ULUF 1EIBA 4GG8A 1XF2B 3P0VL 2W0LA 3BZFA 3IRCA 3MA9H 5I8EA 5T33H 4OZ4A 3RGHA 4PRID 4K2UH 1PGRB 1WAAE 3UTTE 4R3SB 1A7NH 2I5YL 4M1GH 1TTAA 2DN7A 1OTUD 2BS71 3W9DA 5IFAL 3V0JA 1JGDA 3P69A 4K5NA 2H2SD 3QUXD 4ZO7A 3OG4B 2W1NA 2ZYSA 1G1YA 3K4AA 5C08D 2LOEA 2CRMA 1VADA 1BSIA 3QIWC 1UVQB 1H8OA 4IDLA 3WN5A 3CN3A 3O2DA 4BFGA 4G8GE 2OMTB 4PJBE 2IQ9H 1S9WB 3QQNA 2OMVB 2R9HD 1ZA3A 2DKSA 2IDSA 3O4LA 3OZLA 1HDMB 1XF1A 4X4XB 3LZNA 5KJRH 2LU4A 4Y9BA 5EA0H 3CX2A 3JSSA 4Z7WB 1HIMH 1E6OH 3M7OA 3ARGC 2COVD 4KH9A 3UTSE 3EAKA 2BOCA 4P2RE 5DZPA 1PZ5A 3GBEA 1SYVA 4XPFL 2W95A 1X9QA 4QD2E 2ZX9A 2PTVA 1A5FH 5B3NA 1JGVH 1PG7L 3TEUA 1DQKA 4QWWD 1QBBA 4Z7WE 2OM5A 4HWBL 4XCFL 4FQHA 4DSYA 3VGFA 1V7NH 4L3CB 2XPGA 1RAMA 3OF6A 2J1XA 1QSEB 1W9XA 4NRYA 4ONOA 2BCMA 3SB3A 2V9RA 3NK3A 3ETSA 5E4IA 3CXDH 2UWEF 3L9YA 4N0CD 3UZEA 3E9TA 2I24N 1KN4H 5HHMB 3B5HA 1R3HB 4OJDH 5F9OH 4QRFA 2R1YA 2YR3A 5F6IB 4A39A 1VA9A 2GJ6A 1HCYA 1XDTT 4YDIL 3TN0B 3TM6A 4BWTA 4KNUA 5G5DA 4I77H 1RVFH 3NN8B 3KLAA 1AS6A 3GSNA 4KHTH 3HC3H 3ZDYE 3KCPB 3A6BL 1BQUA 3BPCB 4HJGA 1JZFA 2BSED 2QFRA 4K9EC 4Y88A 1HJBC 3TL5A 1NFDA 2JCCB 2J8OA 1WT5A 3RFRA 4DKDC 3K0YA 4G11A 2YSSA 3CIAA 5B3JF 4NRXA 5EU7C 1G0XA 3HMWH 1URIA 2EACA 1EEYA 2Y1VA 3U1SH 3EFDH 4PBVC 3ECBB 1WA1X 4JZJB 5ECGA 1UOWA 3VWJD 4OIBA 4RBPH 2ENQA 4L1DA 3KGSA 3AJ7A 1WCBB 2QQNH 3K8KA 3K46A 2R0WH 3STLB 4AL8C 4OLUH 2MCPL 4JO8A 2BDNH 2XACC 3KL3A 3Q2LA 5F89A 3QFJE 3TIEA 4G9FB 1CGVA 3E7JA 3V0VA 2GEEA 2A6DA 3T4YB 1TJMA 4R2GC 2EDMA 1N10A 1BBJB 1J0ZA 2QQQA 3VFMB 4GRMA 4BRJA 3F6LA 2DV6A 3JV4B 2BNUB 3GSXB 4ZSOB 1P4IH 3HR5B 1EFXA 4ETQA 3V0FA 4ICXA 3FUIA 4PRIA 1EA9C 3LKPB 3MJ7A 4N8PA 2P5WB 2BSDA 4GRLD 5IBTH 5I8CB 4Z7VE 1U58B 4WY7H 4P99A 4F57L 1TTCA 3QIWB 5C0FB 3I02A 3P9WB 5DEZA 5EF1A 2OMXA 2C7UA 2WXQA 2R0ZL 1ZHLA 4AVJA 5LBSL 5CM1A 3WKMH 3CXDL 3VXSB 5D9SA 4A63A 4P5KA 3BAXA 4U1JA 1RUAH 3FU8A 4M4RB 5E6IA 3LN4B 4FYSA 4F9LC 4X7TB 3WY3A 4C57C 1NJ9B 2OR9H 3WSQH 1LVEA 3CK0H 1V7MH 4HWZB 2AK4A 1NGXA 4FC3E 4IHOA 4XMLL 5HDWA 4D0CA 3A6CH 3PAZA 1PSKH 2XZQL 1FG2B 1XGTB 3JV4A 3SCMC 1D3CA 4KFMA 3VD3A 3T3PF 2VT0A 1I8IB 2QSCL 2XRAL 1W16A 3P4MA 4XP5L 4N2MA 1BLNB 2X6AA 3IMVA 4P5TC 5C6TH 4DP0X 1CD0A 1ZPUA 4TVPL 1J0KA 2ZXBA 4YHPB 4GLRH 3KS0J 1U8CA 3NSJA 5C0ND 1HL5A 3RWCA 3W2DL 3CD4A 3MLZH 4U1JB 3VXUA 2PPDA 1T5XB 5DTFA 4FTVD 2R2CA 2BY2A 1SJHB 3W0WD 4A2HA 4GT7A 4N8UA 4XPGH 3PWLA 4YBQC 4XN4A 1RK1B 3V55A 5C2UB 2ZJSH 4JG5A 3NH7H 1J5OH 4JFQB 4RFNB 1OGTB 3UBGA 2Y72A 5E4OA 2X42A 4PRIB 1Q9LB 1A14L 4Y19A 5IB1B 1D9KB 2NQ3A 3MOAL 1KJ2H 1AHMA 4PJBB 1DQIA 4N0UE 3MRGB 1QFWH 2Y6SD 2ZXGA 1Z32X 1YMMA 3QS3A 1EFXB 2B15A 5G5DB 1VGKA 1J0HA 3EG9B 3WLBB 4V1DE 3VNYA 5CN2A 3M6DA 1ODUA 2BZDA 2X4NB 4DAGH 1L9QA 1ZD6A 3GM8A 2OMWB 2MNWA 2GIXA 1WS8A 2EE0A 1INEH 2IH3B 4N6QA 2X12A 4XMLH 2N59A 4UCFA 2ODHA 3TBBA 3I9GH 3VXTB 2ZWSA 1EEYB 2VL5B 4P46C 1B0RB 2AABL 4H1LA 4NB7A 1SMAA 3BEVA 4KFZC 5CLZA 2X6VA 5MENB 2PYEB 3MRBA 4Z7QB 1ZHKB 3EYOB 4AEEA 1NCHA 1BBDH 5G4OA 5GGSY 2VM3A 4ZRGA 2Z0BA 1YHPA 3ECWA 4ZUWA 4LCCC 1YEKH 2IMNA 4BK8A 3X11B 2AHIA 2A77L 3C12A 4UZGA 4D3CL 2WOBA 3GEWB 2EADA 4MQXC 5LGKA 4WJ5B 4UBDD 5DJZB 5EDXA 5AYQA 4UT6L 4WW2F 3U82B 4ZMXA 5D72H 2VR5A 1SYSB 2PWHA 3L7EB 5A2CA 2WWMC 2HRGA 3SOTA 1NM9A 3BMVA 3EZJB 1T5XA 3ARBD 4HH9B 1A9EA 5HJGA 2NY5C 2G9HA 2QDVA 4PY8I 2R1XB 1SM3H 2V17H 4RFOL 4XX1E 1L9OA 3GK8H 1VLXA 3DPBB 4RGMB 2ADJA 2QVTA 4X5QA 5CJBA 4AYGA 5E2UL 1QSZA 1EERB 1FGVL 4EDXA 5K9JH 4OZFA 1ACXA 4ODVL 3HI5L 1OD9A 4K9EL 2Q6WA 2NYYC 1XTMA 5FGBA 2HJLA 1ZEAH 4HGWA 1QBAA 3NJKA 1QFWL 2P80A 3O3BA 3MNWB 4XOCA 1MHHA 2HYMA 3HC4H 4E0RA 3CTTA 4Y9FA 1FL5B 1KBWA 1Y6MR 1S7VB 4J6RH 4AEFA 1HWHB 1D9KA 3C6LB 4G42A 1MREH 4EI5A 3UCQA 4X8JB 4X5LA 4X4ME 4DTGH 2D9QB 4MA3A 3WFBH 1FC2D 1D6EB 1FBIH 4KO6A 5AW3B 5EU6E 3US1A 1SMDA 5HGHA 1SXBA 2HX9A 4LBEB 5ANMB 3EYFB 3EYVA 2HT3C 1OP3H 4BFBD 2YC1B 3B7RL 4RQQB 3BAJA 3MRJA 1YY8A 2JKLA 2X0UA 2W60A 4Y4FA 1WBXB 3VM5A 2X4UB 1LEGA 3MRDB 2BIOA 4TUKH 3IXTA 4P5TB 1R0AL 4JM4H 2APFA 2RHEA 4JPIB 1HHGB 1ED3B 1PCSA 2BRRH 1AXTL 2NY1B 5CBEB 4FFVD 5MEPA 5JA8B 4MXQC 3LH9A 3L6FB 3LNEA 3ZTNL 1B4TA 5C0EB 1MCSA 2DM4A 2VDPH 1SF5A 1MCHA 3CXHK 3U6XA 5HVGB 3PWPD 3SDYH 1YEKL 2VCOA 2CZNA 2QSTA 3QJFA 1S7SB 4JM2C 5DR5L 1YMMD 1WWWX 1AD0A 3PREA 5FFGA 1X5IA 3MNVB 5HGDA 3VD0A 2X2UA 3A23A 4PJHB 3SYOA 1PKQB 3B2MA 3DIVA 3O4LE 1TQCB 5F3HB 5KAQG 3LHPL 4UMGA 4NKQB 4KK8C 2X3BA 2XZAH 4YR6A 3V4PH 4J3VA 1TJIL 3WENA 2BY1A 4PJ7A 1CZ8H 5E4EC 3B6SB 3DMMA 4X98A 4XNYH 2W07A 4I5BA 3ME0A 5C0CD 4U1SA 5SWSE 3N0AA 3QWOA 2F53E 3WHE1 3S9DB 3JZYA 4HULB 5GZNC 2EINB 4QYOB 1E28B 2VC2L 4TLKA 1EGJH 3LD8C 1I8MB 1GIGH 1KIUA 4EOWL 4NKDB 1DQMH 1N18A 1WHPA 1J9TA 3GSXA 3DROA 3FUFA 1RZGA 5IHUH 4JKPL 5I6OA 5LXGL 1J1XH 1CXHA 4FXKB 5HDBE 4MCMA 2K8MA 3NIGF 3IGKA 2YLHA 4GIPD 3TV8A 2N0MA 1CJYA 1YQVL 3H2PA 3CFIC 3CN2A 1J5CA 2WB1A 1DN2A 1F3DH 5BZWB 1IGCL 3HCVA 4WCYL 1GZHC 2WZ5A 3AT0A 1TLKA 2BP0B 1YEJH 3DOSB 3EYUH 1QLEH 3B9KC 3KLQA 4PRPD 3T9WA 5A7BA 4AV0A 4CJ0A 4FXTA 4Y5YC 1ADQH 3SKNA 1Y18A 3TN0C 1IM9D 3RPIA 3ZLQC 2TSAA 2EIBA 1CLYH 4IKJA 5KG9A 4HFWA 1RJCA 4GAAA 1HS6A 1S7QA 3GXNA 3GYRA 2XKNA 2JK5A 5IVZA 1D2OA 4ORGB 5DVLA 4EN3D 3EYQC 4KKPA 5FX3A 2OXGA 3EGSB 1LDPL 4KK8D 4TPRH 5IT2H 4M7KL 5D6DC 3QCTL 3PWPB 3Q6GH 1S2EA 4HC1A 3WS3B 1L9MA 2FT8A 1WG3A 2QT6A 3NCJL 3T08A 1GTNA 2P5EE 1AS8A 2V2XA 3DARA 4AQAA 1AKPA 4HAGA 4NQUA 1IEBA 2Q76A 4DN3L 3RVUD 4JVUA 2E59A 1UWEH 1M71B 1FNHA 4N22A 3MX0A 1MY7A 5FYKU 1BVLB 3TO2B 2XWJB 3GBLA 3GSRA 1E4WL 2AQQA 2XV3A 3QJHA 4V1DA 1V3MA 1WS7A 4HWBH 4G6JL 4XCFH 4NN6C 5J11B 2DQTH 4E9SA 3FFCD 4AV4A 1IKFL 4ZTPH 4TVSa 2DQ6A 4F15B 1RURH 4KUZL 2OV0A 3S48A 2X4SA 3WNIA 3VFTA 3GWJA 4OGZA 4ZUSA 2EDOA 2WVUA 3QPKA 2R0KL 1JXFA 3ILPA 4JQIA 5MEOA 1RZGB 1VPOH 3SDDC 3FRPG 1A9BA 1KENH 4QRRD 1FFPB 1SXSA 1CGUA 2MQCA 1AS7A 5GISH 3V4VA 1GYUA 4KMLB 3MNDA 1NBYB 1A22B 3V0EA 2X41A 4F8OA 2E5EA 1BF8A 4MAYD 4RVBA 4KRLB 1CXEA 3RIFF 5I5JA 4PJEE 2I25N 2NX5B 1UOVA 1BFSA 1JGVL 2PABA 3HZMB 3X14A 1G7PB 4QY8B 4GUPB 2XN9D 2DPKA 4PMFA 1JWSB 4KZDL 4W9KC 1FYTA 1CDCA 4GNKB 3EOBB 2YGOA 3CC5A 3PQYA 4OT1H 3DMMD 3EZ8A 5DZAA 4POYA 1D5XB 2WKLA 5D4QA 2NY1C 4EI0A 4YR6B 3PWJB 3ZDYF 4WDIA 4XWGH 5FYJD 2O6CA 5HYIA 1EZUA 2F0CA 3L54A 4S1SL 1JFQH 3KM1A 1A9BB 3NA4A 2EUWA 3VFSA 2AEQL 3WXVL 4QAMB 3MAWA 3WN6A 3A6BH 5EOQL 3L2MA 4BK5C 1CL7I 1HXKA 3E3QE 3MRKB 2EABA 5J1TC 1WYJA 3V0DA 3R0MA 1JGLH 4OZHE 3VGGA 2PMZA 4QYOA 4XPHL 3EJYD 1MAKA 1NTDA 1PJWA 3RAJL 1CDIA 4YHMH 2KZKA 4IRZL 4JO5A 3O6FC 3I75B 4GXUN 4GUPA 4O2FB 4HUUB 2V2XB 4PJIF 2ESVB 4LLQA 1UM4H 4IMLA 3WKML 1U36A 3DBXA 3NGBB 5EPMA 3SO3B 2Q8BL 3IXTB 2BS9A 3CUPB 5LN4A 5CGBA 1YECL 3SE4A 5JW5B 2VKWA 5KSUA 4FA6A 3HMXA 5CGYC 1PG7H 3OD3A 4MAUL 4X5XB 3VFWB 1F02I 1FNSL 5E8EB 5FK9B 5I8OH 4NQDE 1AXIB 4MZRA 4TQPA 1E4KC 4Q9BA 3MOQA 3PIQA 4GKNA 2VDML 1DBKH 1ZPLA 4PSRA 1MCWW 3CPLB 3RDTD 3UBXI 1P4IL 4ZW3A 3KGUA 4ZTOL 5BXFB 4Z3HA 3UEZA 1WWCA 2H41A 5KG9B 1U30A 3CHQA 5F7UA 2D31A 4MMZC 1JVLA 4H88H 5EU4B 5JW4M 2VZOA 3MFGB 5JTWA 3RL2A 1GL4B 2JJTA 5I5MA 4WFED 4NBXB 3AY4C 2C9UA 2PF6A 3P0YH 4KRPD 3WUWA 2RAMA 2ZG2A 4FHJA 1LK3H 4YDVB 5B8CB 2CBQA 4V11A 3B2VH 4QRPD 4BDVB 1XAUA 2Y1AA 1ORQA 3MSPA 3PWNA 3BDYL 5JLZB 4ACTA 2J7LA 7TAAA 5F3BB 4NZDA 3VFRB 2CBTA 5F6HI 3GI8L 5FDWB 1LEGB 3MRDA 5C8JA 4J3XA 4K2UL 4F33A 5DURD 4OQTL 4JPWH 3K2IA 4DW2H 4F7EA 5DHDA 3LSOA 2VN6A 3ORJA 2YGVA 2QEJA 3BD4A 3UTOA 2WYIA 3TNNB 4XAWH 5E24E 2UWEA 4MYPA 4ILDA 1D5MB 3T0AA 4CVUA 1U91A 3RWGB 1TYEB 4LNRB 4MAYA 3HS0B 1J18A 2NY6D 4G59C 4ZNEE 5DJCB 1BFOA 4HJJL 3TT3H 5F7YC 1MEXH 3D07A 2OULB 4BYHA 3WLWD 1U8CB 4PG2C 2CO1A 4G6MH 5C0AE 1MCDA 5TGBA 1BAFH 5AVUB 3S5LG 3SGDI 2OJ1A 4LHUG 4O58H 2YD1A 5F7EH 1HTYA 3BW9B 4YXHH 4DP9X 2ITEA 4WK4B 3UBXA 5L4JA 3KYMA 5CD5C 3ROLB 3BAEL 3K6IA 5IF0B 3KJ6H 4K3DL 3QCUL 1PY9A 3BWSA 2GSGA 3FTGB 4L1SA 2HTLD 4PRNB 3BSGA 4K9EH 5TDPA 5F7DB 4B9YA 1P2CB 4N5EC 4DEUA 3RWEB 4KVPA 3NFPA 1LO3L 4UTBL 3PPSA 3CVIL 3L1FA 2J6EH 3N50A 3OJMB 2B2XL 1AD9A 4AC4A 1PIFA 3MV8A 3AXHA 1UATA 4OLWL 2GAZB 2BZCA 5I0WA 1HKLL 3BGFC 3D0VA 2FJFB 2WXJA 3MJ9H 3GS0A 4I3RH 2HT4C 3C5JA 2WGNB 2FIRT 5GRUH 5KUMA 2CGYA 3IXAB 3QAZB 4PJAF 5IJDC 1WAAF 5DVNA 4LIQE 4A2MA 3B9VA 3PRZA 4OFYD 5DYOB 3DV4A 5ID1A 3SKMB 2JCCF 3CZEA 2OMYB 1BOGB 5HI5C 4KI1A 3TA3A 3VFVB 5PAZA 5JDSB 2BNRA 3B2XA 3S37X 1F45A 3V8OA 4BHUA 3ETBF 2P52A 5FLVA 4MS6A 5D96B 1BBDL 3MBED 4JLRA 4P8QA 5GRUL 1Y6NR 3QNYA 5H8DA 2A2QT 4N2KA 5DO2D 1HYSC 3L3JA 3W81A 4BFEA 5D6CB 4LSVH 1RJYB 2K70A 4AWJC 4CMMB 5IW1A 3CFDB 1IC7L 2Q20A 4Y4KA 5SWQA 3MFFA 4L8SB 4ZFOL 4JZNB 1FYTD 3TIEB 1XH1A 3AMKA 3O9WD 4NI3A 3ARUA 4PJ8C 3HOGA 4MNQD 5AW1B 5L0QC 5L2KB 4QTFA 1NWPA 4OGXL 3VFGH 1XH0A 4K8RL 4LSPL 5I1HH 1NFDF 2CJ3A 1ZWIB 2H8PB 1NQBA 3ZE2E 1D6EA 5AW9B 2QTVA 4IBUA 3V0AC 2O5YH 3BGAA 2X28A 2ZOTA 3QJTB 5ANMA 2WWKO 1PYWB 3DECA 2H26A 4PJ5E 2XLLA 5GRVL 3T0EE 3GSVB 1ZT7B 2F54D 2ZOLB 1PLGH 2F8OA 2DQHH 2CRIA 3D52A 5AAMC 1F42A 1QTSA 2OMXB 3Q3GA 4I1PA 1I7ZA 4HWNA 4U49A 5F88B 3VFPA 4HZAA 1X5KA 4XP6L 4AJWA 2ZJSL 2N7AA 3JWOC 4OD2B 4CMMA 2OA9A 4JQXC 3L3HA 4NZUH 4U2ZA 3T0DA 3UBFA 1BIHA 5EWIL 3RWEA 2DWEB 3VXPA 3W5NA 3GHBL 3JZ7A 4OBSA 2ZIDA 4Y5VA 1N6VA 1YEEH 3GRGA 3II3A 2B4CL 3Q2NA 5AVVB 2AJZB 1EO7A 1UD6A 4F8QA 5BRPA 5JQHC 5D1ZI 5AYTA 3K72B 4MJIE 1FVDB 1WUNT 1Z5LB 4AQEB 4PJ9C 3EUDA 1BCIA 2HKHH 4QO1B 4AQOA 4R7DA 4ZODA 1TTUA 1B88A 4ZJ9A 2V2TB 1B0IA 4IU2B 2VM4A 2W60B 1QSFE 4G7QB 1KFGA 3NQIA 3GXDA 4Z76B 2WKGA 3WNLA 4L48A 5C07B 3WAKA 2C4FU 1AIFA 4LLMA 1GOGA 5HDLA 3N1QC 1E4XL 3ZTJH 3L95A 5E8DL 1XD1A 2CXGA 4IDJL 4M61A 2E76C 4X6DE 1FNGA 3AGVA 1WITA 1BZOA 4PJ8D 2VSDA 2GHZA 4RH4A 4X7DC 4ADJA 1Z7JA 3BUTA 2YBRA 1BVNT 2IWGA 1MRCH 4G80B 1LO0L 5FHAL 3UAEA 1U4FA 1GRWA 2XWBA 2TSBA 3X1GA 1YSOA 4ABQA 3LOWA 1ZWIA 1BREA 3CN4A 3CH1B 1TPXB 3L5XL 4L4VE 2OQJA 1QFWI 3MLSL 5I5IA 1KSRA 1QZ1A 5T33L 3BQUD 1AR1B 3ZDZF 2Y25A 3I85A 5JPNA 5K59E 3BEWA 3G6JE 3ZHFA 1LYQA 1X7TA 1DLFH 3S3DB 1Z9PA 3TA3D 2VDLB 2WJ5A 2X2HA 4OIFA 1BM7A 3B3IA 4MDJA 4HW6A 4EN3A 1PNCA 3SY0A 1DJYA 1JYWA 3K6SB 4WWKB 1I3GL 1MZYA 4UU9B 4MAYC 4UM8A 2X4QB 4P3WA 1VKXB 4Q7DA 5KSAA 5A6MA 3OPZH 5IBUG 5F9AC 2OW7A 5I6XB 2YPVA 2D2CC 1MWAA 3F7YB 4NJAH 2JJUA 3BKML 2BK8A 3FKUS 1AGBB 2IBZY 3SQBB 4ZAKA 5BCAA 1CDYA 3KNBA 1KCWA 4F8PA 3KLAB 4XCYB 4ZUWB 3T09A 4N4YB 1JZDC 1BQKA 5DZNA 3SPHA 1GGIL 2CO2A 1AXSA 4GI9A 2ZG3A 4ZSOE 3LRHA 1NKOA 4PJFA 3FB5B 4XMKL 1RUKL 1RUPL 4OLYL 4WKXA 2ZKWA 4X99A 5F93C 5C1MB 3FJTA 4Z76A 5CUSH 2IAMD 4ZX3A 1MRDL 5IB4B 1WZKA 2XRAH 1FH5H 1G5GA 3MRMB 1KTBA 5DUJA 1QLEB 1NGQL 1XX9C 1YEHH 4R7DB 1ADQL 1MI5E 3ASNB 3U1QA 2DY2A 3INUH 1S7XA 4J2XA 2JKTM 3DIFB 5DSCB 3KGRA 5JHDE 4LASH 2VW4A 1T66C 1TVDA 1TOXA 3B8SA 2GT9B 3GGWB 3W11C 1D5BB 2J88L 5IZ7A 3SDCD 1U8HB 3UYOD 4E42B 4UQIM 4CKVX 1M7IA 1KN4L 5I16B 3KHOA 3O3AA 4DQAA 5HGBB 1QSFD 4PV8A 4TQIA 2L3BA 1KNOA 5FO9B 3F6IA 5HYJA 2DQFB 3V6BR 3OAWA 1IGFL 4JHVA 4J8RA 5TTRA 1RMFH 1PKQE 2IPKA 3DJ9A 2ZXAA 3VM7A 1ZS2A 4J5VA 5KVFH 4JPVL 2IOMA 1UEMA 2FATH 2C7UB 3GXFA 1CD1A 5JOPE 4ZFGH 5INCA 2ZX7A 2DWYA 1G7PA 4UIKL 3TWCL 1EK3A 1MXGA 2OZ4A 3D39A 3TJPA 5AOIA 3V4LA 4DEPB 5D70H 1YUHB 1H19A 1AYRA 4IBWA 3T8XA 1TJIH 3CFBB 1HILB 4PVMA 4B41A 4WZ9A 4WK0B 5E6RB 1SN2A 4ODWA 4AQ1A 1E67A 2MCPH 4TUOA 1OCRB 1XSIA 4M6ML 1RIVL 3P9MA 4Y4KC 5DD1L 3FO2A 4DZBB 3NJJA 1DN0A 3OAUH 5EC2A 1U8JA 4ZUUB 4S1DC 2WNWA 2VC2H 3MGTA 4OZGA 2ICEA 3LQAC 1YA5A 3WEAA 1UT9A 2DBJA 3NJNA 5CD5D 3QORD 4KY2A 3D1MC 2BSSB 3DIDA 4JFWA 4M7JH 1S7WB 4LCCB 1MFEL 3ZKSD 2F54A 3HE6C 3DSFH 4NZRH 4XE0A 2CU9A 4NT6A 3ZTNH 4KUCF 5FV1L 4GIAA 2YBGA 3HZ3A 2N7SA 3EOAA 3KVQA 4OAWB 4LVHB 1UB5A 1WEJL 5GGRA 3F8UB 5IOPB 1P4LB 2CNZA 1JF5A 3ALWA 2FEDC 3ARQA 2F1EA 4W9IC 3VD1A 2MNJB 1NGPL 1NGYB 2HLFC 1EAQA 1GMEA 1HVXA 1VGEH 4UQEA 1UZGA 2MRYA 4CILA 4ORGA 1BXUA 4J3OD 4YZWA 3P4LA 1AC6A 4G6FD 4E9YA 5FW8A 1PF3A 3CCHA 3QQ3B 1RK0B 5CMAA 4IRZH 9CGTA 3RTQB 4GFTB 5HHXH 3KYOA 2ZNXA 2ZYHA 5L8LB 1XH3B 2AFNA 4YHIA 2PWFA 2PTTB 2BHZA 4ZX4A 3DUHA 1NUDA 2IFFL 3H9ZA 4APQC 1F6LL 4NT6B 3DTXB 1KN2L 1W72A 3LDBC 3F7KA 4Z7VF 1E9OB 4MJ6B 3MRNA 5FS5A 3HCVB 2EC9T 4FLRA 3LX9A 1CE1L 5D1QC 5H37G 3MLVH 2DQUL 2Z7ZA 4G8IB 3IAGC 5HYFA 5EN2A 4WWKC 1O5PA 2P5WD 3TYGL 4CC4C 1CS6A 3NA9L 1EAPA 1PDKB 1UM6L 4KV5E 4FNPA 2CE6A 2ID5A 3BD5A 4U1MB 3NDYE 4J7RA 4DZBA 1QPXA 5EO1A 4YLQT 1AH1A 2UXTA 3V5HA 4MZ3A 3L4TA 1JHKL 1G9HA 2OP4H 5M94B 4BKLA 3KJ6L 4WCYH 2YD4A 1JDDA 3CN0A 4F91B 5FO7A 3VFWA 3QG6A 3SGEH 4YDJB 5LWYH 2IFGA 5EO9B 4OBRA 5HYJD 2HSIA 3D30A 1E5YA 1E28A 2YPVH 4A55A 1LE5A 3G6AB 4X2UA 3FONB 3TN0A 1ZA3B 1O9ZA 3Q8FA 3HIZA 4MTMA 3FXIC 4AYDC 3LMJL 1Z6JT 2X2YA 3D9AH 1CDUA 3D4ZA 2Z91A 3QZLA 4MJ4A 3LAFA 2IG2H 1TEYA 3ZUNC 4WI5A 1ZLUH 3PGDB 1IZKA 1CICA 3OXRA 4C54A 1GSMA 1KGJA 2W59A 5DS8A 2A0LC 1DP0A 3CXFA 5GRVK 3CLEL 5HYSB 2Y07L 1GYCA 4Y2OB 3IAQA 3RA7L 5B3JE 1VCAA 3I6LD 5C09E 3FZUC 1EH9A 3CWGA 4XVUD 2CO6B 4M6NH 4AIOA 2E7HA 4WUUB 3FHEA 3MX0B 2QSCH 2YXFA 3H7LA 4H1LG 3EOTL 4F7PB 2DICA 1G87A 2OZ4H 3Q43A 3RX8A 4DN3H 2VDMH 4LCIL 4QRRB 1NAKH 4UTAA 3JV6B 2BW4A 3MLXL 4F24A 1X5LA 2OXGB 3EGSA 3NIDE 2X4RA 3SCMD 3ATFA 1I4FB 5JIKA 2VDRB 3IS0X 4FFYH 4JRXD 5AOMA 5HPMB 1I1FA 5T1MA 1JSYA 1PVHA 1WO2A 4B5EA 4EDWH 2BIQA 3L45A 3QORB 5EU3B 3KH3A 3IKCB 3T77A 1RUKH 1W0VB 3KDMB 1CB4A 1Q0YL 1WTLA 2CDEB 1HU8A 1B4RA 5HVHB 2X87A 3BPOC 4W9ZA 3HE6B 4WI7A 4WIQA 2V17L 3F64A 4OCWL 3HRZB 3TPKA 3B9DA 1DANT 1NZRA 5DJXA 3FN0H 5IMLB 1NPJA 1JHTA 1L6PA 3UJIL 4H8QA 2YXVA 4FMFA 4WNQA 4JPWL 2C3HA 3RL1A 3VFSB 2WKOF 3Q9PA 3W0WA 5IJVB 5DJ6A 4LCWD 1HOEA 4PJ8B 2EXWD 1IV8A 1SBSL 1TDQA 3MODH 4TULH 4U31A 1IGJA 1X7SA 3ZTJG 4DESA 1U21A 4YBQD 4JRYB 3MJWA 1UXLA 3H7BB 2Q6WB 1MJUH 5I6PA 2VZVA 4MNGE 3LPWA 3OXRB 4XP9H 3E6FB 3QIUA 3LH2L 1WTGT 1XH3A 1IBGH 3OVUB 2RA1A 3EBIA 4S1QH 5IR1B 2MHAA 3LQZB 5E6YA 3LIUA 5E7BA 2AITA 3I2CH 4N8VA 4K7FA 3PXHA 4LCWB 1DUYA 4GBXC 1TETH 4JQIL 4P2RD 5D5ME 5CD3A 1UCTA 3ZU8A 4X98B 3TX4A 1J88A 1QSFB 5D71H 1USZA 2J6WA 3UTZA 3U7YH 4TVPH 4EI5C 2CJUL 4K3JH 2VDQH 4NOFA 1ETZA 1XL6A 4R84A 4G6KH 4ZPVB 3IETB 5IROC 1MCPH 5BZXA 3PV7A 2HWZH 3BAEH 3LKOB 4NBYB 2CR3A 4JB9H 3OC5A 4W4OC 5JPMC 2QPEB 4UIMA 1N64L 5D72L 5EO1B 3I3BA 3Q8AA 5HP5A 5B1JC 3BIKA 1CLVA 4XNQA 3D85A 5ICUA 1XSKA 4LQ1A 4RMBA 1E5BA 4CA4A 1TTGA 3IE9A 4DKFL 4WU7B 4ADGA 4RRPM 3N41F 4DT2A 5L4IA 5B38B 1JWUA 4LKXB 1RZJH 2DF3A 2H32A 4NRZA 3CZFA 1K8IA 4BFRA 3UZQB 4M48L 2I7OA 2IAND 2P49B 1L9PA 2HPTA 4E41B 4GKSB 2ZICA 4XAKE 5GGQH 1OEZW 2G9HB 4G9FE 1CVRA 4AGOA 2F5AH 5AKRA 3FU7A 4NXSA 3TBYA 4QNPE 1JXGA 1RK7A 1DLFL 2JELH 2VN3A 2RFXB 3VA6A 5FUCC 1L9NA 1HILA 1WHOA 1WEJH 2HFFB 3CCHB 2XKNB 3D34A 1N3NA 1TQCC 2IG2L 4YQXL 1KEGL 4MLSA 3TP4A 4WU5A 3MV7E 3Q13A 2MSPA 3C2AH 5E00B 2RH0A 3FUHA 1Y18B 1YNTB 5E1QA 1WZLA 3HNSH 4Y0GA 1ZHKA 3EYOA 4HFWB 1BD2B 2W07B 4L0ZA 3IMSA 3QXAA 1LP9E 1IE4A 1GGTA 1AO7D 4MNQE 2YQGA 5ES4B 4ZMVA 2YMOA 1IBGL 3MO1B 4S1QL 3JWDH 4XC3L 3W57A 5E8DH 3EOTH 1VAHA 1N4XL 2FRGP 3UYPB 5DUML 3QNXA 3ARGD 2A83A 2CPCA 1FFNA 1VZHA 4I9WD 1XGPB 1C1EH 2FECI 3EFDL 1JYNA 3QI9C 3UPRB 1E42A 3BEWB 3BWAB 1G7LA 2JKRM 4PRPE 2CUIA 1GC1H 1Z0MA 2ZX8A 3HPJA 4HKBB 4BJLA 2DEWX 4DEWA 1IAOB 3KPSB 4KGLA 4I1NB 2V7HB 2VL4A 2J73A 1EZLA 3MV9A 3PQYD 2IDUA 3S4SG 2QELA 3VXNA 3WIHA 1CU4L 2QDWA 2W0PA 4OZFG 4GLRI 1J86A 2XWBB 3RNKB 4D0BB 1TYRA 4FFVC 1BF2A 1MDTA 3Q2WA 4JE0A 4OIIH 5GZNA 4HJTA 3QUGA 1YJDC 5FKAA 1GY1A 3IFNL 1OAYL 2ZPKL 1QBLL 2XOTA 3BH8A 2AI0H 3VFNB 2O72A 3ZRCC 5J6HA 2PCXA 2ZWLT 4YSQA 3SDAA 2R29H 4H20L 2AC0A 2CSPA 2NLJA 1I8KA 3BIBX 4Z0BL 3I02B 4PIRF 2RIKA 4PCKA 3MLTB 1P7QD 4LEOB 4BCYA 1O7VA 3QRGL 4LLDB 3VGAC 4OLWH 4PJAB 3DO7A 1TCMA 1CICC 5C0GA 2DJ4A 3E38A 4PJGA 5CJXC 2CR0A 2NXZC 4YHPA 3KPPA 3VVWA 4YZFE 5DZVA 3JTSB 2YHGA 3BDBA 4J4PD 4P5MA 3UBHA 1L9RA 5KWYC 3DA0A 1P6WA 4JY4B 4OZHB 3QFGA 43C9B 3FL7A 4M43L 3U7WL 3C2AL 1ED3A 3K6SA 2DWEA 4ODBD 5I28A 2WWKT 3KPRD 3RGBA 4UNUA 2I69A 4XMKH 4NNYA 1F8TL 2AXHA 1UFGA 4F7CA 1H8LA 1K8DB 2NR6D 1NGXB 3CG8A 3G5XB 2FQFA 5IB4A 3GQFA 2YRZA 1FGNH 3MRGA 4L9LB 2Y06L 2C1OA 3WTVA 1TG8A 1FVCB 5HBBA 4MXVF 4EI5B 1SF3A 4PVBA 2E27L 4QRPE 1H3PH 1NANH 4B9KC 4H8PA 3ARFB 3CLWA 2J88H 1KPUA 2FWOB 2JLPA 5D1QA 1IAKA 1A5FL 1LO5B 3GT6A 2NZ9D 4N2LA 3PWLB 3AXLA 4TSAL 1IUZA 1D9KC 4GQ9L 3O3AB 5F7BA 1NPNA 3K6FA 5KVFL 3VXTA 3NRPA 3VG9B 3ZSSA 5I1HL 2R1YB 2Z34A 2R39A 5KVGH 1RMFL 3WJLC 4ODXB 4HP5A 4PY8J 1GZPB 4FHBD 5EU6D 2X40A 4J4PC 4FS0A 3WAJA 3SKOA 4Z7OF 2J12B 4WO4C 2A9BA 2F7QA 3JBG7 1U8OB 3BUPA 5EEYA 5EBWB 3IDGB 2G60H 3DLQR 5GHWL 1AVAA 1G4RA 2EDQA 3K72A 3ZL4H 1VGKB 1SOQA 4ABUA 4JG9A 4FLQA 1OZTG 5TQ2H 1FZMB 4Z0BH 2K6YA 1RV6X 3G7TA 4KRMB 3QHZL 5EZJA 4Y2NA 4C56A 3TEZA 2OR8A 1OAKL 4FAAB 5KSBF 2C1PB 4P9HL 3WJLA 4J39A 1JPTH 4ACPA 1EZVX 4M93B 1LO5A 4HWEL 2P5EB 4LPVA 4PCTA 3EGDA 4GAYB 4BZ2A 1V55B 2HKHL 2ZOLA 1Q1JL 2ITCB 4MD4B 5J57B 1IFHL 4BKTC 1KTDA 1T2QH 5AOKA 1U91B 3QI9B 3RWGA 5IVXE 3V0GA 2O6PA 1E9QB 1A66A 1F4YH 1MCIA 2UV3A 5DK0B 5K93A 1AE6L 1JNLL 4JANB 3MV01 4Z7AA 4HJSA 2FJUB 3G5XA 1ILSA 4K5LA 2LU3A 1IVTA 1UZ6F 4KZEH 2NY7H 4HDIB 4L9LA 4P2OD 1ROWA 2GITA 5EUOB 1A0QH 1K4CA 2JH2A 2MFNA 1FL3B 3VFOB 3E6FA 3H54A 1MF2L 2HXAA 3AT8A 2PTUA 4OB5H 1SLVA 1LDSA 1I85A 1LO0H 4MCZB 5J6SA 2BXYA 2BNRE 2VAJA 4FKEA 1FFQA 3MXWL 1SJEA 5CILH 1DZ0A 2D0GA 1Q94B 2YZ8A 3BXNA 1OW0C 4IKNA 3WKQA 4RAVA 1IC4H 1M1SA 2B7DT 5A2KH 3NIFF 4OKVB 5EOQH 5GZOD 3QUYD 1KJ2L 4NX0A 3U36A 3KYKL 3TN0D 1NOAA 2ZP9A 4FL4B 1F1AA 3MRFB 5C0IA 3PUUA 1JPSH 3AB0B 2H0EA 2IDCA 3Q6FB 1UGNA 4G8GD 4OZGF 1WD8A 1ANUA 2B14A 3ARRA 4BHUI 4QRRE 1RU9H 3NJLA 1U92B 5KSBB 1KIRA 3C08L 4KQ4L 4QXUH 3A24A 3H6JA 4J1UA 1TQTA 7FABH 4WFFE 3ZQWA 3U46A 1A3RH 4MMXC 2YK1H 5EOTA 2PW1A 1UXSA 4K7PH 3SDAC 3TZVC 4AIZB 3KR3L 5M95B 3CVBA 1YJDH 4JPVH 3KPQB 3MR9B 4WTWA 4X6CF 2RTTA 1E4JA 2HVKA 2ICWA 1JGDB 5HI4C 2H45A 3MLRH 2NXZB 5D7JD 5C6TL 1VFAA 1T5WA 3CSYB 3QPQC 4LSTH 1DHKA 1JUFB 3B83A 3NJXA 1LEIB 1G5AA 5B39B 5JO5B 4JLRB 4XNUH 4A2LA 3MLYL 1H0DA 1KG0A 4LDLB 1GS7A 4NLAA 2CO6A 4F8LA 2MEJB 4FABH 3RB7A 3HG1E 5JDSA 2AJ3B 2WUCH 4G72B 2Q7NA 4YL9A 4UAOC 3FB7A 5ISZB 1Q4NX 5IQ7L 4GXVL 1S9VA 4EZLA 5HY9A 1L9SA 3NK4A 4K8RH 4LSPH 2DI8A 4LO9A 4FA8A 1DJXA 1WFJA 3PL6C 4F7KA 2B2XH 4NQQA 4JVWA 4N2GA 4KK9D 2BWDA 1I8KB 4TTDC 3ZX1A 3BT2H 1HNFA 3ULSA 1NGZA 2X1QA 2XU9A 1U3JA 4XHJD 3E6HA 3GBNH 2CPUA 1KJMA 3GMMA 3ULUH 5IW6B 3C75A 3KL5A 3MNZA 2ATAA 5CEZE 2K8QA 3P02A 3I75A 1NIEA 2FX8H 3B3BA 2GC7C 4KK6D 5L2JA 3VRIA 2OSLA 4L37B 5EOCL 1I9RH 4XGZA 3F83A 4Y1AE 2CALA 3S96B 3UC0L 4CU7A 4AMWA 4ZOBA 4PLJD 3HEIB 2V5TA 4FFWD 4ZO8A 5ENWA 1I1CA 1ID5I 1UVQA 2GY7B 3K80A 3RILA 1HOCA 4IIQB 3COOA 5JHBA 1DVZA 32C2B 4ONHA 1YN7B 4UAHA 4JNXA 1SBBA 4NWTH 4G8EA 5GIRA 1EJ8A 2B4CH 2WLJA 2BDNL 1J5DA 2YK1L 1JZHA 4LB8A 1UGKA 4PCYA 4FG4A 2QHLA 2H0JA 1W72B 3D3VD 5DS1A 3TH2T 5KJ7E 1E40A 3X1EA 1JGUL 4J23A 5C7XL 4LSTL 3VUAA 3QDJD 4TNEA 1TQUA 5MP6L 2RR3A 4EUPB 1OM3L 1T1YB 3QZWB 5CCHE 1DJWA 1FNFA 3RWDB 2WXLA 4FFZA 4DGYH 2RQEA 1BZ9A 1RSFA 1U41A 2FYYB 1OGPA 3CZSA 3I9IA 5JORB 2HUHA 1IBHA 1KY6A 2Z8WC 4KVCL 43CAA 4HWUA 2OMBA 3AS3A 3KLLA 4Y8DC 4Y5VC 3UERA 4R26L 1JHKH 4JDTL 5IJBC 2JK5B 5IQ9A 2EVIA 2KPNA 1Z5HA 5T3XL 1HK6A 3S6CA 1RUAL 3L4XA 2V0AA 3ULSB 1LDPH 1XSOA 2XI9A 2XPGB 5CEZL 3BLBA 1FIEA 1UT2A 3FT1A 1UH4A 3GMLA