2NZ1A

Viral chemokine binding protein m3 from murine gammaherpesvirus68 in complex with the cc-chemokine ccl2/mcp-1
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
371
structure length
371
Chain Sequence
HSSGVSTQSVDLSQIKRGDEIQAHCLTPAETEVTECAGILKDVLSKNLHELQGLCNVKNKMGVPWVSVEELGQEIITGRLPFPSVGGTPVNDLVRVLVVAESNTPEETPEEEFYAYVELQTELYTFGLSDDNVVFTSDYMTVWMIDIPKSYVDVGMLTRATFLEQWPGAKVTVMIPYSSTFTWCGELGAISEESAPQPSLSARSPVCKNSARYSTSKFCEVDGCTAETGMEKMSLLTPFGGPPQQAKMNTCPCYYKYSVSPLPAMDHLILADLAGLDSLTSPVYVMAAYFDSTHENPVRPSSKLYHCALQMTSHDGVWTSTSSEQCPIRLVEGQSQNVLQVRVAPTSMPNLVGVSLMLEGQQYRLEYFGDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/cytokine
molecule keywords Hypothetical protein GAMMAHV.M3
publication title Dual GPCR and GAG mimicry by the M3 chemokine decoy receptor.
pubmed doi rcsb
source organism Murid herpesvirus 4
total genus 85
structure length 371
sequence length 371
chains with identical sequence B, X
ec nomenclature
pdb deposition date 2006-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09213 M3 M3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1330 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2nz1A01
2.60.40.1340 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2nz1A02
2NYZA 1ML0A 1MKFA 2NZ1A
chains in the Genus database with same CATH superfamily
5T3ZD 1YEIL 5C0CE 2EIMB 5CGTA 5DWPA 4PCYA 1Y6KR 3HS0B 4OB5L 4OJCA 3KEHA 4U1HA 3DX6A 4OGYH 5DMIL 5K59E 4ZMQA 5HGDB 2H0FA 3FO1B 5FHBH 2APSA 4QPEA 1DUZA 5HDBB 1YLBB 2ZXWB 3B6SB 2OM5A 2EIDA 4FQLH 2Q2EB 3IXTB 3PQYA 2ICWI 1HIMH 1NUDA 3RIAF 3RTQA 4F7PA 5BO0D 4LMQI 2GHWB 4ORGA 1HHKA 1QTPA 3B2MA 1KIRB 1IGCL 2VRKA 4PGCA 4UTCA 1TO5A 3RX8A 4P4KC 2X53A 1U8LA 2A9BA 3NCJH 4PWKA 4DK3A 1WZLA 3VJ6A 3LDBB 3IU4L 4KY1L 4XZUA 1UB6A 1KV3A 3RFZC 3WEXA 5HHME 4HZLB 4X42A 1A25A 3UO1L 4Y1AB 1QPPA 3CPLB 4LCCA 4L37B 4X6CF 1E4KA 2F7IA 3WUZA 4PRHE 2N1TE 3R0NA 3KLDA 2Q5BA 3GSNB 1RXLA 3ARDA 5D5MF 2AQPA 4DP1X 3BQUA 4PR5B 4K3JH 5CN1A 3N44B 3ZPDA 4HD9A 4IBTA 3FXIC 5F71A 2IAMB 3A4DA 1IEHA 4D9LL 5GS0H 4IBVA 5F3HB 5L0QB 3QFJE 2FIRT 4G7RB 1U3JA 4PY7B 5ERWB 2P48B 5A2AA 3QJHA 3OM3B 2O5YH 3DX4A 4M61B 2WWOA 4M8VA 2AITA 2F19H 3A6OA 3NCXA 4OGQC 3JV6A 4W9ZA 1TNNA 4YDZA 3ALWA 3V4UL 2OP4H 4TQEL 3CNKA 5I1EL 4NQVB 2NXYC 4PRID 4GRLC 3S9DB 5AOIA 1OO2A 3JWDL 1IVTA 1JK8B 3KPRE 4PP1D 3APDA 1UD5A 3IFLL 4Z7UF 1B0RB 4R2GC 1JPFA 1FRGH 1L5GA 5SWZA 1G7JB 2K0RA 1IM3A 2O6CA 3CV5A 3N55A 2WLZA 1TZGH 4RSVA 1P5VA 3OKLB 4JDEB 4HPYH 3S34H 3FUDA 3V95A 3U9PH 2H47C 1E5CA 2D31A 4XNBA 2WKOF 4YJZL 4YOKA 1QW8A 2A6JB 1KCKA 3BN3B 2XZAL 4JM4L 1F3DH 4MYWB 4EAEA 4RGND 5GS2D 1K8IB 1A8JH 2VN3A 1LO3H 4OBSA 4XTRD 1A9BA 2H4EA 2VW7A 4AV5A 5E6IB 4IBUA 4P4KA 3EJPA 3PP3H 2AQTA 1CFTA 2FD6H 5I6XC 3WS3A 5JIMA 1Q0EA 3DIFA 1FL3A 3RFZA 1FGNH 4H26B 1AZUA 3NP4A 1WBXA 3ATDA 1BG1A 3CFEB 1K5NB 3F84A 2PXYD 3S88L 2P8PB 4MX7B 3KCPA 1UYWL 5T3ZE 4BH7A 2RD0A 2ZP0T 2EH7L 4HIIA 1YQVH 2UYLB 3SY0A 2Z31B 5FX3A 1RKRA 3CQPA 3ARFB 4BH8A 1OOAA 3GZPA 4EN3B 2PO6B 4ADIA 4MVBC 4MD0B 1IAMA 4RIRA 2J5LB 5D7LD 4ANXA 2OMNA 4GRWF 3EDKA 2X4RB 4MDIB 3MXVL 4YHYB 5D8JL 4B9FA 1MCKA 2DL2A 1QW9A 2VABA 2VNCA 3ULSB 3V0AC 3NIGE 1IQDB 4HBQA 2NNXA 4IOSA 4J39A 5IUCA 1DQQB 2EEBA 4GRLA 1DANU 2R4SH 4ZFQA 2X12A 4H2CA 1T21A 4HSCX 4JAMA 3MLYH 3RLSA 4ONGH 5FGRA 2P52A 1RLBA 1R6VA 4JR9H 3X3GL 2YEVB 3AG3B 5D71L 1PZAA 4WI6A 3V4PB 1BOGA 1B3IA 3QHZH 1E4JA 5E2VH 2AXFA 5E7BA 3U7YL 3W11D 1JXDA 2FSEB 1WFJA 1YCSA 1GGYA 2I7OA 3Q0HA 1IGFH 2W60B 3BSZA 4LCYA 4YGVB 5FUOH 2BC4A 4YSUA 5KYWA 1P6FA 1UOLA 2B7DT 1ZVHA 3ES6A 3MA7A 4Q7DA 5FM8A 4R0LA 1SJMA 1ZA6A 3EBHA 4WLCA 5F88A 3L3HB 3H8NA 1K6QH 2JELH 5GRUH 2Z0UA 4B60A 5J5EA 5BMFL 2X70B 4H4NA 5H94B 1E9PA 2BIOA 4J3OD 5DJYA 4YC2C 5JXEC 4FNUA 3RUGA 2BVPB 4OD1L 4HWBL 4N25A 3I3DA 1C08B 1YNLH 2AQ2A 4U3SA 3QUMB 4TXVB 2YRZA 3FUJA 3W81A 2VXVH 4CMHB 2ZG1A 3L81A 1BYOA 3S7GA 1SHSA 1BEYH 5DJ6B 2GPZA 2IDCA 3WXVL 4BSWB 2VT0A 4HXBH 3KBPA 4GW4A 5B1AB 3WFHB 3ZE1F 4JUTA 4G43B 5C0BB 1PGRB 5DWUL 3F5WB 3ULAB 1EQWA 1L7IH 3GFUA 1DVFA 5I8CA 3CU1A 3KYNB 3V52H 4BWWA 3AACA 1Z6JT 4X5PA 2E7CA 3DVNB 1O7DC 4E0RB 2VQTA 2W65A 3MV9D 4P5TB 3O3DA 1RUPH 3KDPB 1IZJA 4HJ0C 4NM8H 3BKCH 1MZYA 3QUZC 4LSRL 3BPOB 3NDYE 3VVWA 5K1NA 4WNJA 3TIDA 3FTGA 3T2LA 3LNHA 3PHOB 4D8PA 4U4BA 4IJTA 1AXSB 4MLIA 1P7KA 1ORQB 3L5WB 1T3FB 3A6BL 1F97A 4X8JA 4HKXB 4B9CA 2AMGA 1MCIA 3MRCB 5I8EA 4GW1A 4HJSA 2DL9A 1U58B 2FJGB 2ICCA 4O4YH 4XCEB 3LHPL 4P2OD 3NPZB 5EBLB 1OAQL 4E41D 1ADQH 4GSXA 1RSYA 4NN7B 3QXDA 2KBGA 3X13A 3FO9A 4ZMPA 4LLDA 2AERT 3O6ML 2QQLL 3TV8A 4K2UL 3II2A 3SJVB 5EZIH 1T22B 3KS0J 1ZT4A 4YFDB 5C0EA 4Z3EA 1OGAD 1LGVA 3PCYA 2QVMA 3WKML 5B3NA 4XCYB 5TE6H 1GZHC 4PJIE 2BMKB 5BVPL 5JXEA 5ADOL 3EOTL 5I76B 1NEZA 2V2TA 5T3ZL 2B39A 4Y1TA 4I9XA 2GUOA 1R5WB 4LEXH 5K59F 2B2XH 3MNVB 5LBSH 2ZYRA 2XG4A 2Z35B 4UTAA 2W92A 3B3BA 3UTZB 1A7PL 4JPQA 4IEFB 3ECWA 3O6LH 1X5MA 3ARGC 3MRKA 1YRKA 2VL4A 1COBA 1RIVH 3H9HA 3QRLA 1EVUA 3UBXI 3HR6A 4WDIB 5F9JA 3GXDA 2HWZH 3W9EB 4YBQD 2VR9A 4KFZC 1CK0H 1NWOA 1SDDA 2O26U 4PJXB 5DZLA 2OFQA 2GI7A 3IKCB 2Y07H 5EU7E 3QUZA 5AVVB 2GSGB 5AYUL 1LP9A 3BAIA 3NZUA 4OFKA 2A9MH 1R3LA 1KBGL 1PVHA 2CK2A 3ZT5A 2BOLA 3HC2A 2R56L 4WHDA 5E08H 5EF0A 4M56A 1V7NH 4DZBA 4LHQB 4NZFA 4ZDHB 4HFWA 3S35H 2YJQA 5CLYA 2X0WA 3VXNA 5E8PA 4M6OL 5TF1H 1KTDB 3TBSB 4E9TA 1RERA 3ALXA 3T0DA 4OF6A 1GIGL 1NAML 3CXFA 3LIZL 3OZ9H 4UYPA 1U91B 4JFYB 3FB6B 1SQ2N 2E47A 4GSDL 3VXRA 4YK4B 5JHAA 2CKNA 3C5ZD 2P9RA 3BVTA 5KYYB 3ARBD 2HTKC 4OCXL 1W0VA 1UB5A 3HEIB 4KAQH 4ZO8A 1DEDA 3P11H 3IGKA 3C6LA 3H42H 1LILA 3UG5A 5JW4R 3VI3A 1Z7JA 3FCSB 1AANA 2JJVA 1MG2C 3VXOB 4JRXB 2QKIA 3BP4A 3IPBA 3CFCH 5L8KB 1YYCA 4LL1A 1QNZH 3GZOA 4KQ3H 4QRRA 2EIJB 4YIQB 1PDKB 4NKDB 4X6DA 1FLTX 5LGJA 1D7CA 4GAYB 3IGLA 3LPFA 3RIFK 1V7ML 5HGHB 3WV0A 3ZYZA 5IQNA 4PJGA 2N3JA 4BJLA 2P26A 4MRBA 4NEHB 5IF0A 1IAIH 4HWUA 3HG1A 2V3DA 1A4JB 4E41E 3RIFF 4WI4A 4P59H 2ED7A 5E8OA 5HHOD 1I3GH 3VXMA 1NBZA 4UI2A 3ZX1A 2VLMD 1HSBB 2CGRH 2JXMA 4WW2C 4V1DB 1J0HA 5ETUB 2HP4A 5DFTA 3NZ8B 2JV6A 4FQHB 4WI8A 43C9B 2IV9A 3QUXC 5GS0C 4GSQA 1ZHKB 5MEND 3PWVB 4AEFA 1OGAE 1KXHA 1ZV9A 4TQHA 1MFUA 3U2SB 1I8IB 2NY0B 3IDYC 3PPSA 4KVCL 1HAUA 3L48A 3AAZB 3QEGH 1FZMA 2XPGB 4OKDA 3NSJA 4TRPL 3HC4L 2PUQT 4DESA 3FCUB 5JYMA 4JDVA 1UXLA 2Y5EA 3TYGL 1Q9WA 1CR9L 2VLRB 3EO1A 2VM4A 3JV4A 1T7ZA 3AS3A 1A6TA 1QASA 4QHNA 5ACLA 2X4PB 1UA3A 2DLGA 1GVIA 4KRPC 2ALWA 2XIDA 3F58H 3GJFH 4JQVA 4QUOA 3DBXB 4FLSA 1BJ8A 5BRZD 1FNAA 1T1ZA 3NIGF 2IH3A 2CCVA 3HB3B 3BH8B 3NZHL 3E0GA 3G5YB 4JB9H 5GRZA 1MQ8A 4JRWA 2Y7LA 1E6JH 3BSHA 1N5AB 4M3KB 2ADJB 4BQCA 3IU3B 4N0RA 4TL4A 1NDTA 1S8DA 3MGOB 1F42A 2J1ZA 1BFVL 3U6RA 1N5YH 2EYTB 2J4WH 2J6EL 4ZS7H 3ATBA 5FPIA 2NZIA 1GPOH 5KANG 4HX1A 1EIBA 1OOWA 3I9GH 3QG7H 4X4KA 1DBKH 5IQOA 3WIIL 5FECB 1FZJA 2ICEB 3GT6A 4JQIL 3WFBH 1C12B 3LEXA 3SQOL 3PY9A 4L2LA 4JL1A 4JS7A 4DO4A 4XP5L 5BRQA 4JFZL 4JO1L 1OALA 4IMKC 4U7MA 1LQBC 1T2JA 4XMKL 2WXRA 4P2AA 2AK4B 3G7TA 3VFGH 4H2AA 3I50H 4NO0D 1CG9A 4WW2A 5LDUA 1AXTL 3THMH 2V9UA 5KBMA 4GI8A 2Y1VA 5BJTA 4C56A 1EFQA 3QUXA 4PJ9D 5E94B 3UBHA 3J7HA 2OMVB 4M7JL 4TTGA 4PJAA 1I7TB 5JLZB 3ZZ1A 1M71B 3HG0A 3TJHC 1L9RA 1D6EB 1RZIA 2YWZA 3ML9A 2VL5A 4QRQA 5GGRA 5ADPH 1J8HA 2VISB 3D2TA 2IPTL 1ZTXH 4LAJH 1QYGH 1I7RA 3WD5H 4TF4A 5F7UA 1CCZA 1XX9C 4LASH 4CDHA 2DQIL 2AQ3A 1BYPA 5A1AA 2JF1A 3L1FA 2Y25A 1ZE3H 2Z92A 2M2DA 3IVKA 3II1A 4P46A 2DWYA 3MRMB 4N2FA 1X7SA 5F8QC 5FGCB 5HHOE 2LU5A 3VXUB 4H25B 2VLME 2GC4C 4LQFL 3DETC 3LN4B 1U8NB 2AP2A 2EDWA 5DVOA 1RJLB 1XIWD 3H0TB 3VD7A 2O72A 3TEXA 3GRGA 1S3KL 2R1XA 1HL9A 5HI3C 5AD0B 4MXVE 1QA9B 4XBPB 1VPOH 2YAHA 3V7AE 1FIEA 5MENE 4NAMA 5HVHC 4IRJC 4TULH 2ZYHA 2AJXH 5EWIL 1WQVT 1IAOB 1WC7A 5D96B 2HLAA 4XHJC 3TN0C 1S7XA 5HHVH 1XGZA 4QEGA 4YX2L 1MSPA 2ZSWA 3U2JA 5KJ4A 1S9VB 1A7OL 5HVGB 1I1RA 1NIAA 1ZLSH 1YO4A 3GMQB 5CD3A 4HD5A 1BA9A 1EZSA 1ZHBA 2E6PA 4PJ6A 2FR4B 1HI6B 2A4ZA 4QRPA 4IMKA 4S0TD 4XE5B 1AKPA 4ADJA 3BPLB 5DS8B 1JFQH 2VDMH 2B59A 5DS1A 1ULVA 1X9QA 4PJIF 5B7MA 5BRZE 1G7MA 1E28B 3K8LA 3RVVC 1F13A 3G5ZA 5KYUA 4G8IA 4DPRA 1ZVSB 4XNYH 1PZ2A 4KKQA 3SPGA 5CBAA 5MP6H 1SMDA 5J9PA 3L6FB 3S8FB 4OCLC 2AXWA 1H5BC 1CFNA 5BQ7A 3FFCB 4ICXA 5HI4D 3QNXA 4AUUA 3N6YA 2YGPA 2WGNB 5CEXB 3IJYA 3D39A 3L2MA 5BXFA 4FQQA 3BEWA 1JK9A 1LNUA 2XG5B 1HWWA 4NZRH 2OMTB 2C9UA 1JOIA 4AE0A 5E4EC 2WXMA 3GI8H 1NFDA 3DX8B 2JLLA 1IM9B 3B2DC 4FCAA 2XX0A 1EBPA 5K5YA 4PJBB 4EQ3A 4J3OF 1RPUA 5DS2A 3HI5L 1AI1L 4X6BB 4MA1C 4WWKC 4EI0A 3EGDA 1W72H 3GBMH 4B9GA 4QIRA 5ID0B 3VQ1C 3CDCA 4HDIA 5F0JB 5CEZD 3WLWC 1FVCA 1EHNA 1NCIA 3CFDB 1WWCA 2BVOB 3QJTB 4U1KA 1E0OB 4H8PA 5EDXA 3TN0A 2YN5A 3MLXH 4MA8L 4KKPA 3T0ED 4EQ2A 4G6JL 4WHTA 3UCQA 2DEWX 3OWRA 3QPKA 4OJFL 3QUML 4RBPK 5C2BH 3P0VL 1HX0A 5I1JL 4WU5B 4AT6B 5LG6A 3CFKB 4CUCA 3K6SB 5HDWA 1XGYH 4KZEH 3P2TA 1JHTA 4PJEA 3P9WB 4HF5H 1Y0LB 2MHAB 4EEEA 5I16B 2ZP8A 5LLIC 1NCDH 2AZAA 5DJ0A 3T09A 5TDOB 3TCTA 1FFPA 3WNPA 3R8QA 3DOSA 2MPAH 2AEIT 4LE8A 4AYBA 3SE3C 3SGEI 4YXKL 5SWSD 1VEMA 4LVOC 1RK0B 3ZE0E 1H5BA 4PYHA 3KPSB 5ENWB 5IBLC 3L7EB 1UM6H 4R26L 2O6DA 3I75B 2PN5A 3BP5A 4XHQA 4AIZB 4U31A 2R8SL 4V1DE 4P23B 3LZQA 4KOCA 4AGQA 3JWNH 1G9NL 1MFBH 1OK0A 4NYLB 5DQDL 1OXYA 4XMXA 3G6JB 4GKOA 4MAZA 2XVBA 4AKPA 1HFUA 4AZUA 1WD8A 3V0GA 1S7SB 4IDJL 1YEIH 3DRQB 3QQNA 4NUQA 3SDCB 1ADQA 3K81A 4A37A 1MI5A 4UIMA 2YR3A 5K9JL 4GNKB 3RAJH 2XACC 1ZIAA 2ZT9C 4F24A 4GUOA 2EE0A 3ZOAA 2VQ4A 1JTOA 3GGWB 5DMIH 5C09D 5HI5C 1AG0A 3G5VA 1NGZB 3LEYH 3MN8A 4R97C 2FX7L 3ISRA 3UJIH 2EIZA 1T0PB 4N5EC 2GHZA 4HXAH 3EOBB 4YHNA 4BD4A 2V37A 1T04B 2CHZA 5FKPA 4NHCH 3NSXA 4GRWH 5JPNB 2C8NA 4G6AC 3QXVA 1BREA 2JKWA 1HWGB 1IGCH 1Q0YH 1EO7A 2EIBA 3PAVA 4PS4L 4BZ1L 4ZFFB 3MYJB 2BY3A 2A7BA 2EDDA 1O5PA 4NM4L 1P7QB 1SDAB 4KY1H 5LBSA 2ICES 4CA4A 2RALA 5I30H 3CBJB 3IGFA 3ARUA 4CJ1A 2FT7A 4PUBL 5E0FA 1K4CA 2Q7AA 3LKNB 4J6IA 4P8QA 5HYJD 2IBZY 3GI9H 4MCYA 4Q9BA 4ALAL 4LPWA 4M43L 1FNGA 3TV3L 4E9WA 3EH1A 4OZGA 3LH2L 1SPDA 2A99A 1XGQB 4YDVA 3SE3A 1EO8L 3QEQA 4KKAD 1TTRA 4D9LH 2ICWJ 2ZCKL 3D2UA 5DHVH 5J6HA 1EHKB 5CEZE 1HEJC 1E5BA 1PZ3A 2QADD 1PG7L 1JN6A 2DLEA 4HU8A 4HIEA 5KVDE 1ZT1A 4I8DA 4JLRB 3DHJA 3RWEB 4HSAC 2V5MA 4HKBB 3T0EE 2Z8VC 2EACA 3RHWK 1W0YT 3V4UH 4W9LC 4UOJA 4XNMA 5F7EL 3JWDH 5T1KD 2J6WA 3B9KC 3IFLH 4MS8C 2O5XL 5HYSG 3FONB 4A7SA 1RMFH 5AB9A 1CXIA 5C97A 2DQFA 1W16A 2B1HL 3INUL 2JQMA 3QA3A 3SE9L 1L0XA 5TQ2H 2XQYG 4K9EH 1ZWIB 2FNBA 1QUNA 1JG9A 4XWOD 3WTVA 5KS9A 4JM4H 4U7KA 2E27L 3H7BB 4MZ2A 4DGYL 2C9QA 1BZ9A 4QRSA 2A83B 3SDAC 4UDUB 1BQUA 3BO8A 5CNHA 5AOLA 3V79C 3HVNA 3U9UB 3RA7H 4S2SA 1DVYA 2WBJD 4LHUA 4XC1H 1UOKA 3ARSA 2BNRA 2UZXA 4NN6C 3GXMA 5IHHA 4QO1B 5IV2A 1CF1A 1LEGB 2FJHB 4MXVF 2ZXDA 3W2DH 1UYWH 4IIZA 3D51A 3R8BB 1J0KA 3WIHH 1JTPA 2EH7H 4N6RA 3ZKQD 3PL6D 3D0AA 5ESVB 5DMGD 3X11A 2W81C 3QQ9D 2HFFB 5B3JE 1A6ZB 2UVEA 3MCKB 2IPKA 4O2EA 1U30A 3HZ3A 5C09E 4HIJB 4KROB 4BUGA 4N8VA 2PYED 3SGDI 2DQUL 2NXZB 2ZYIA 4D0CB 2F1BA 3MXVH 5D8JH 1F90L 4NKOA 3LXAA 4FNLH 2R29L 3FQ1A 3KXFA 3TBVA 1EFXB 1S9YB 4PBWD 3GXIA 1HNGA 2DBLH 4PD4K 3SDXA 2YKLL 2Y23A 1U8PA 4LP4A 4Q74A 1XZ0B 2XUWA 2YHGA 3QJRB 1MRCL 4PTUA 4I7ZC 4AY0A 1FL5B 1U8KA 1WK0A 3UBGA 3P3TA 4OCSL 1I4FB 3O3AB 3QJSB 3B9KA 4JEGB 2DTML 5D9SB 1NUGA 1RZ8A 3KYOB 5IQ7L 2C3GA 1LM8V 2WIIB 3X3GH 2DDQL 3CSBA 4L5FL 2YD2A 5D71H 2UUDH 5HYJE 1U93B 1AIFB 3GPEA 1G7LA 2OYKA 4MQ7B 2VYRE 3U7YH 5E8NA 1SQMA 1WZ1H 3TO2A 4NQDD 4AL8L 1SEBB 2ZD0A 2A6DA 3DSNA 3MQIA 3PDOA 5DCCA 4FS0A 3VU1A 2LHAA 3DHPA 1TZAA 1FYTD 1E27A 5DZAA 5FAAA 3FT4B 1P4LA 4B95C 1IMHC 3O45A 3ZO0A 4RGOL 4CADA 2DIEA 3KPTA 3N43F 5BMFH 3SDAA 3DV4A 4W9DC 4R83A 2LTQB 1WPCA 4UILL 1L3NA 4XVTH 4ELKB 1CDGA 3ME0A 3MLZH 4ZRGA 1LWJA 1U2YA 2NRDA 4OD1H 4HWBH 2V5RA 3GSQB 5JMOC 3V4VB 1E43A 4Y7MA 1AD0A 2DD8H 5LB1A 1OE3A 3IDIA 4BFJA 2YGQA 3CSTA 3CZGA 4U2ZA 3CLEH 2P8MB 1DQTA 3GXPA 1BF8A 3DHUA 4RFNB 1MCHA 1IC0A 4LSUL 2QVFB 3OBAA 4YSCA 5C3IA 4KXBA 1F18A 2IPUK 1IEBA 5CEZL 2CO1A 4YHOL 5DWUH 5CBEB 4WFGD 5KVDL 3BIKB 5I1IH 1F00I 2WYZA 2QQQA 3IT8D 3FU5A 4HIPA 3VWKD 1N67A 2GY7B 2H0PA 3PUCA 4QHMB 1PG7X 2I07A 4UQ3B 4NIYE 4WU7A 1Y07A 1MHHB 2ZX6A 4NP4L 3RL1B 3IJEA 5CS7A 1QOKA 3TPUB 4LSRH 5T1LD 4MBRA 3Q8EA 3POHA 4XB8A 5IJKC 2BWIA 4OUUB 5J11B 4K71C 3A6BH 1UUNA 4OW6A 2YQBA 3MRNB 4ZPTB 1JWSB 3BZEA 1I1YA 2F9BT 1TEYA 5D72L 1KG0A 3P3SA 4LRIC 3RIKA 3ZE0F 3LHPH 5IEHB 2XV0A 1OAQH 4V11A 3OAZK 1IGYB 2B5IB 1HZHL 3VSUA 5BZWA 2Y06H 1ZANL 3VE0B 5DJAB 3IRZA 4NFDA 1MRDL 4FADA 3RY4A 3EHBB 1JZHA 3O6MH 2CZNA 2F5AL 4M48L 1FZOB 2QQLH 2PYEE 4K2UH 2C7UA 3ZKXB 3AQDA 2WQAA 3QDGD 1ZV5A 3QK0A 1EUTA 3DVIA 4MJ6B 2BS8A 2XWBB 4IMLB 3I02A 3U9WA 3T8XA 2AC0A 4WGKA 5EO9A 3AW5A 4AVIA 4MB1A 4MJIA 3SDDD 3F83A 5JHDB 5T3ZH 1ZGLM 4WWNA 4U3XA 1MQKL 4PLKD 3NIDE 2BVQA 1UXSB 4UQDA 3NVQA 3VFPA 4CKVX 1S78C 3KWWB 1M7IA 1OT4A 2EYSB 4JM0A 4GSUA 1T03H 1G6VK 2DW5A 2OMZA 1XR9A 2F5BL 5D93C 3IJ7A 3P2DA 3CVBA 1J05B 1S46A 3GXTA 3AXLB 3GO1L 2MCAA 4G42B 4ZW6A 1I8UA 4KRMB 1MF2H 4S1RH 5KSVA 1GR7A 4NQDE 4JDTL 2Q3ZA 5JOFB 4EKJA 1N70A 1LJMA 2LE9A 1NCAH 5IB5B 5IT2L 4PRAA 1J1OH 1FYTE 3CFBA 4L8SA 4JG1L 2ATKA 3KD4A 3IJ9A 2G4GA 1RZGA 1OT1A 3GIVB 3EOAA 1UKTA 3NT0A 1ID5I 1KMGA 2B14A 1MAML 5IJKA 1D5XB 2W1NA 4M9PA 2ZP9A 3CXDL 1U9KA 3F64A 4TNEA 4FE9A 1NUFA 2R56H 3BZFA 5BS0D 3V9CA 3QZMA 1TKWA 3BDXA 1JVKA 2WUBL 2W9LA 1IT9H 1NFIB 2ESVD 4RMQA 2YK1H 1N7ML 3VFNA 3FTVA 4BKSC 3F6IA 4KKCC 1G7QA 1BQ5A 3TFKD 3OSKA 5BO1L 5EOTB 2ZXAA 3QWOA 4ZXBB 4PYGA 3SQBA 3SHSA 3QUYA 4GSDH 4M1DL 4X6CA 3VB9A 1KPUB 4ZMWA 4MXWL 4RQQA 4HGMA 4Z3IA 5E4AA 4WFGE 3O3BA 1YUHB 3EYSH 1X5KA 4F33A 1D9KD 1W72A 4F5CE 5D5MA 1BZDA 5JA9A 2CIIA 4BINA 5DURD 4GBXB 4DN4L 2XU9A 1YEFL 2GJRA 1KWGA 3BLPX 4NPKA 4CU7A 5E1HB 3UPCA 3ARZA 3FOMA 2OV0A 2YZ8A 1FNSL 1AR1C 1G6RB 3VFMA 1E30A 1F4HA 1KGJA 3RI5F 5MI0B 5ISZB 2AF2A 3SKJL 1FQ9C 3NYKA 5FO8A 5E00A 1CE1L 2A9NH 3L3DB 3NACH 4LGRB 4PP2B 1V7MH 3SCMA 1K9TA 5DFVC 4PRPB 5KBKA 2ICWB 2Y4SA 4JFHE 4Z7UA 3RGVD 1OCWL 3FQUB 4XP4L 3APCA 3TXAA 4E9LA 4F8TA 4I18C 5GS2H 2DYPD 3ILEA 2WNXA 3U30B 5I1KH 2QQKL 2X1WL 2ZWSA 4PGZA 3EGSB 5DO8A 5A40E 4HG4K 1XMEB 3W5NA 1T6BX 4HKZB 1SGKA 3QDGE 1CLOL 2YXMA 4J27A 1CLZL 2WKOA 2FNWA 2YARA 2YJLA 5ANMB 3QDAA 3X1NA 1BJ1H 5HHQA 2BERA 3QCTL 1JWMA 4TUJB 1ZOXA 1TQBB 3LQAH 3WSQL 3TONA 1LXMA 3RPIB 2BHZA 3KGUA 3V55A 2G4EA 2XV6B 4KVCH 2OCJA 4P2QA 5B3JF 3BAEL 2X87A 4RMUA 4TRPH 3PV7A 4G5AA 4FHKA 4X9FA 3NCEB 3HI1A 3TYGH 2V8LA 4MNHA 1U8OB 3JWDC 5FF6B 3DPBB 2NR6C 1CR9H 2MRYA 4G80A 1WEJL 2A5UA 4XCFH 3HPJA 1DR9A 2CR6A 4DKEH 3E1F1 3RKPA 3MJ9H 2E7LC 5GISL 4QAWA 5IB4B 3CFMA 3TA3D 3NZHH 4UM9B 2D7PA 5FXCH 4I2XB 4I1RA 1ITBB 4DHLA 5IK3A 4M3HA 2R7EB 3GHEL 4NWUL 5E6RB 5FV2A 1HZLA 2UWEB 2CK0L 3MC0A 3SYOA 1OF2A 2XN9B 4R9HA 1N8OE 1BFVH 2IJ0C 4TNWK 3Q1SL 1UCBL 1MWOA 2J6EH 3LD8C 3Q6GL 1JZGA 1KLFA 3B56A 5AALA 3PDDA 4M29A 3WIIH 3HI6L 3DWTA 3PV6B 1I8KB 3RZCD 3C60D 1HOCA 4UQBA 1AGFA 3FN9A 4QRTB 4URTB 2G5UA 4FXGB 1RHHA 4XP5H 2YUXA 1A6WH 2Z65C 1S5HA 4JFZH 5GRJL 3CX2A 4ZAKC 1X9RA 1I1CA 3S5LG 2KHAA 2VDLB 3HAEH 4BCXA 4I18A 4XMKH 7FABH 4PB9L 2EUWA 3WENA 3QI9D 5E5MA 2WLLB 1UOVA 1TJXA 5FA4A 4M6AA 1ETB1 4G71B 1AXTH 2CRZA 2EKJA 2UXGA 4J3OH 1RCYA 4Z77B 3EJSA 4Q6IA 2NDFA 1AMXA 5DHVA 3VFWB 5KSUB 3HE6A 4BSJA 2VJ8A 1KXVA 1BJMA 2MFNA 5F89B 3MNDA 4YDIL 3LZRA 4PQXA 1AO7A 3PWNB 3QDJD 4HMDA 4PY8I 1BX2B 4ZFOB 4LU5H 2R15A 1AFVL 2YAOA 1Z3RA 2VXQL 3OAYH 5TGBB 4JVPA 5KG9A 4S1DD 3VRLE 3QJQB 2IPTH 4PWEA 5JYLA 1EAJA 5F6IB 1K4DB 2DQIH 1LEIB 4FA8A 2E7LA 2PWEA 3D0VB 2X0UA 3QORB 3PNWA 5CINH 3RWFB 4RBPH 1UWFA 3KNBA 2FVNA 1G9EA 2E7MA 1SJHB 3O9WC 2EXWC 1IRAY 3D3VB 1CGUA 4D0BB 3BWAA 4LAQL 3RDTC 1S3KH 2Q87A 2DQEL 1M2OA 2WUCL 4YDLB 3OKDB 4DNLA 3CFIC 4KJYA 4NJAL 5EWIH 1NSNH 5I5RA 4OFVA 4L1LA 2FBJL 1BZ7B 3P4NA 3TJPA 5HGAB 4BE6A 1GGTA 5CWSA 1VAHA 2HTLC 1JPTH 1EA9C 1G7IB 4UUJB 5EN2A 3W0WA 1SN0A 3D7PA 2DLFL 4OF7A 3SB3A 3V0DA 4PW3A 4Z78A 5GXBB 5JNYA 3CD4A 1GZPA 3QDMD 1A47A 2CJUL 1EVTC 4PJCE 1TQVA 4ZAKA 1QR1A 1OP3H 3HUJB 1A9EA 1YECH 3MFGB 2FL5A 3F00A 5I26A 3WIHA 4ETQB 1XAKA 2L3BA 5MERA 4IHOB 5C0AB 4HWZB 4NNPL 1INQB 2GFBA 4P2RD 1H6TA 1YEHL 3KL0A 3KPPA 1OAYL 3LKQA 4B7LA 4X83A 3ATEA 4JK0D 1XT5A 5AUMB 1Z0NA 3NIDF 4WUUA 1OQOA 2VR7A 3MUZ1 1QSVA 1NGQL 4NENA 32C2B 4G83A 3PF2A 2X6VA 2FO1A 3IRPX 5BZDB 5DZJA 2O30A 2ZAHA 4R3SB 4W9HC 3LNDA 4MMXB 2YA2A 4JFWA 4QHKJ 2G0LA 3DMMC 3GZKA 4G1EA 4PRBB 4QJ4B 2DB8A 3H9YA 4OM0H 4HCRH 5C0CA 4W9KC 5B39B 4J3VA 3UC0L 2Q76A 3NDZE 2GSIA 4LGPB 1F56A 1BFOA 2HT2C 3US1A 1PX4A 2JIXB 5IUSA 2UXVA 3FCTB 3WJJC 2YEZA 1RZJL 4D0DB 4P57A 4GAGH 3OJVC 4CVWA 1M3IA 3GNML 2RMNA 1WSST 2IBBA 5IFJB 1U8CB 1E8XA 3PWPB 4MA7L 3ZYIA 4Z7WF 2XI9A 3VUAA 5FUCE 1BIIA 3PWLB 3VM7A 3HI5H 1SLWA 3NFNA 2GKIA 4UM8B 2HKHL 3O9WA 1J5OH 3HW7A 5A43C 2CNYA 3DO7B 3AXHA 1QFPA 1YEEH 1IBDA 1I8MA 4L4VB 1CGVA 3OTTA 4I88A 1SOKA 3QDJE 5HYQA 5KSAB 1OB1B 1MHEA 3OKKA 3CZUB 3OXSB 4GUCA 4J8RA 4G6JH 4HWBA 5F7LB 1JNHA 4OJFH 3A6CH 4QRUA 3P0VH 2ZJSL 1UWEL 4J3TA 4S1QL 1BAFL 5D1ZD 4XX1E 4B41A 1EDYA 1T83C 1E4WL 2GUYA 5HJGA 3RL2B 4HFUL 2XWZA 1T5XA 4BKLA 5ISZE 2OSLA 4JM2D 4KKBD 1CFSA 2WZPA 1MG3C 2WYIA 3QFJA 3U1SL 2D4DA 5LNGA 5DA4A 1LWHA 1OE1A 2OJZL 4A68A 1TSHA 4JFED 3DTDA 1UWXK 3FULA 2WTRA 3VFSB 4YXKH 4X80L 4DP7X 1TTAA 2WLKA 3J8F7 3MBXL 3FTXA 3GSRB 3BWSA 3AWEA 3KPRA 4CU6A 4OZ4A 3DMMA 1N68A 3VGAC 3D18B 5EU6B 2CIKA 2J25A 4FYRA 2R8SH 5INDB 1W6WA 1WFIA 4MJJA 4AGOA 3GJEA 1TZHB 1G9NH 5DQDH 4R8WH 2A6KA 3IJSA 2IGFL 1R34A 5ANME 1ID2A 1SXAA 4I3SH 3WJJA 3QDME 3VFTB 1WGOA 1CDCA 5D1ZI 2IIJA 2FQFA 4IDJH 3D4ZA 3E8UH 4AV4A 3ETBF 3WE6B 1MCLA 4APQD 1BD2A 4FQIH 5K9JH 4KGLA 1JZ4A 1A1OA 3JBG7 4P2RE 2JMRA 3A4EA 3QAZB 2EIKB 2GITA 1JZ2A 2DMHA 1JZ3A 3M1BA 5FW8A 1WWWX 2QVIA 3ECVA 4NNYA 3LN5A 4U1GC 5LCVL 4C8XA 2WP3T 1UTDA 5B38A 3QIUD 4KXZI 3VI4B 3RZWA 3L5IA 3I9AA 4EI5C 2EXSA 1FZKB 1SM3H 1JUFA 3O6KL 3GSOA 4O02B 2QSVA 4GP4B 2B15A 4BZ1H 4DP9X 3WKYA 4LLMA 5IJVA 5DK3A 2VOTA 5EU4A 1OCOB 3DUUA 4PIRF 3BVNB 4OM1H 1T83A 4Z5RA 5EIIA 4K7FB 5IM7A 1QLEB 4PUBH 4ATWA 4YVNA 1Z3GH 3DYMA 4F15B 2VZSA 4NI6A 2AJYL 5CSZA 5E8EA 1ZT7B 2FK9A 4M1CC 2XWTA 4P04A 1B9ZA 5IW1B 4M43H 3TV3H 1PZBA 3AGVA 1QLFA 1ZLWK 5DZVA 1GXEA 2DI7A 4JO2L 2VO8A 4L8BA 4PV9B 2BP8A 3OMIB 3UIZA 1EO8H 2PCFB 2E46A 4NPYA 3VA2C 1VA9A 1ZMYA 1PG7H 3VFOA 5H4YA 2NW3A 3CSPA 1D5ZB 3ESOA 1VADA 1YY8B 3WLBA 3NZSA 1JDDA 2YGNA 1IBZA 1UACL 2ZXQA 3CJJA 4NRYA 3SYCA 2CRMA 4F1SA 1KIPB 5IBTL 3RGHA 5KSBE 5F7EH 3HRZC 2VZ1A 1VZHA 4FXKC 4V33A 4FTVB 2O5XH 3P77B 5DEGA 4XO8A 1ES0B 4HG4J 5GJSL 5BPPA 5CN3A 3AQZA 2N4IA 3CC5B 5EG6C 2B1HH 4MS6A 3IDJB 4KUZH 1F58L 4I5BB 4RESB 2BHUA 5DYOA 3U4EA 4JFEE 4OLUL 3GC3A 4MAYD 4N2KA 3VRLF 1J12A 4MLSA 3DARA 3MJ7B 2MCG1 1OPOA 4WFHD 4PRIA 1XB6A 1NWPA 4DGYH 5DJZB 2DWEB 4RNRA 4X8XA 2XN2A 1J88A 2J8UE 3MRRB 2CO6A 4JG5A 4TSCL 1C5CL 1UOWA 2H32B 2YFOA 4ZFZB 2A73A 4NQED 1I8AA 2LAAA 5HDQH 5B1CA 2HLEB 3TP4A 4GO6B 3W11C 3PGCB 4IGBD 1NGYB 4L0YA 3ROLA 1KTJA 1ACYL 1LO0L 4Y9CA 4ZUTA 1IQWH 1KBWA 4ZUWA 2NY7L 1X6LA 4RAVB 3ZUCA 2WJ5A 4AQOA 2G9KA 3X2QB 4ZO9A 4QTHB 2WK2A 5EIVA 5EU7C 4IK7A 2D4FA 1OAUL 2H2PD 5F7YC 4LLWB 3HBZA 3FAXA 4HUXB 1WISA 3VGEA 1F90H 4PJCF 1ZGLB 2BOCA 2RGSA 5IMOA 3SOBL 2R29H 3VGHA 1JD9A 4L1SA 4WRLA 1IGTA 2YKLH 3MV01 1HL4A 1IAKB 3Q9QA 3QRGH 2IOMA 2PXYA 1VKXA 3FUNA 4YH6A 5F7WC 3N40F 5F93C 2O6EA 1MRCH 3MBWB 4R7LA 1CFVH 4UBDC 3S0PA 1ZSDB 4YHZL 1CQYA 3CPUA 3HRZA 2P24A 1OT2A 5MEPA 4NJ9H 3W37A 4LSQH 4H0LC 3EJYD 2AJVL 3QISA 3Q2WA 4NQXA 5D2NB 1QUPA 5DJXA 5D7LA 1BZOA 4BDVB 2DDQH 1B0GB 5E4IA 5IFHL 3MJ9A 1M7UA 3TIEB 4KK9D 1KEMH 3Q01A 5ITFB 1A1NA 1AGEA 2OXHA 4WJ5B 4GKZB 4G6MH 3Q2CA 3B3IB 1TMQA 4RGMB 1TZ8A 4PJIA 2PABA 3MO1B 4GMSL 3MV7B 1D5MA 5D6CA 3CK0L 1CFMA 2D3NA 3H9SB 4BXVA 5JW3H 5CJQH 5ICYB 1PD0A 2WZ6A 3QO0B 3IXTA 1UXWA 1F0LA 2PTTA 5I1AA 3NCMA 4RGOH 2V8MA 3UC2A 1ACXA 4M7LT 2BS71 1RI8A 2J6EA 2J88H 1IBHA 3OB0K 2BCKA 4UILH 3CH1B 2ZWZA 3BZ4A 4XN8A 1OHQA 1JF1B 3HN3A 4KDVA 1SNRA 4DT2A 4NO5A 3EZJB 1CBVL 4P2OC 1IBYA 3GMLB 3HFMH 3ZMNA 4GG6E 3SKOA 3PGFL 2P43B 3CX5K 1KFGA 3CMOL 4AVJA 3NH7L 1VESA 3PU7A 4KK5D 2ZXEB 4Z1PA 3SGEH 1WBZB 2A4CA 3O0RH 3UEQA 1PKQE 4RMVA 3CPLA 4L37A 4NO3A 3HAEA 4L3AA 2VDLL 3L9RB 5AOJA 1MZZA 2R1YA 5CEZH 4DK5A 2D03H 4N1HB 4W6XB 1MCOL 2Z31C 3P3YA 4ZOBA 4L9LA 4BUHA 2OZ4L 3VD9A 3FO2B 3HCVB 2V5SA 4F37K 1UQSB 4LFHG 2DWDB 4Y5VB 2JI3A 5FUZH 1A4BA 3W39B 4CSTA 4YHYC 2OMYA 2ATPB 4WFHE 3WUWB 3RWIB 1OIOA 4NP4H 3WY3A 4ONFH 2GB2A 1KCRH 4JFQB 4YZFE 5IREA 4Y19B 2E9BA 4N8CL 3EOYG 4HKJA 4JG0H 4ODWA 4PJFE 1QABA 2HVKA 3L1GA 2ADYA 5EZOH 1VZGA 4NQEE 3T3PB 1XF4B 4IK6A 4M6NH 1DEEB 4X6FA 2YMOA 2LW3A 4HZAA 1HHJA 2DKUA 3OVUB 4J1UB 5K9KB 3KMDA 1G7JA 4NQSA 4GKNB 2ID5A 4LDCA 1T1YA 1HZHH 3DX7A 1ZANH 3CCHB 1MLCA 3EG9B 4ODXB 5L2KD 4CW1B 4E68A 3AQXA 3MUHL 3COOA 3T4AC 5DRXB 4XNUH 2F5AH 4M48H 1A3LL 1TVBA 3RY6C 3SEPA 4EO5A 3NBNA 4BXSV 3S3DB 1NBVH 2VDOH 5IKCA 3OQRA 3P30L 4M5TA 2VGLM 2LABA 1U95B 1CQKA 5F9WB 4LEBA 4KMTL 4XX5A 3GMPB 3RB7A 4DGUA 2QMJA 4P2OA 5IGXH 1JGEA 3PGDA 3WCYA 1OSPL 4E41A 1VGKA 1LHZA 1YN7A 1KNOA 2YBGA 5KWYC 4G8GD 3UBXA 5TF0A 3FU6A 3BC9A 4NS0A 2R2HA 1LK2A 1HSAB 2E74C 1HQRA 3D4YA 3ZBMA 1MVFA 1U3HD 2ODIA 3QH3A 4IKKA 5CIPH 2NCMA 4IRSB 1D5BA 2KI6A 3L4UA 1R3JB 1OGAA 1IGJB 2GTZB 4N3UA 1CZ8H 1L9SA 2IADA 5HXMA 4YE0A 4OJYA 5CCJA 3JZYA 5CEYB 4OLEA 4P3WA 4Y2DB 4JFFD 3BPCA 2G2RA 5IT2H 2WLMA 2WGXA 2X4RA 1DLFL 4JG1H 4LSPL 5B4MD 4HBCL 1F2QA 4KTEL 4CILA 3EFOA 4P5TC 4PBDA 3HG4A 5C0FA 2O4EA 1A7QH 3IBOA 4HIHB 5DD3L 4HCRA 3KYMB 5EULV 3WGUB 1Z9OA 3MFFB 4POZC 4R7DA 4Y5YC 3BUYA 1UM5H 3WEAA 1U8MA 2KZWA 3MBED 4LESA 1G9NC 3QZWA 2VLLA 1KYAA 1EZVY 2WVVA 2W0PA 5D70L 4KNQA 2V5YA 4JO4L 4DZ8B 3GEFA 3QJVB 4KVNL 4FG2A 4ODUA 5LAPA 5BO1H 1NFKA 2ZUSA 2ETWA 2XWDA 5HDOA 1XGRA 1MY7A 1YY9D 4ZG1A 4NN7C 2Q9OA 4ZQKA 4M1DH 5TE7L 3WJMA 4MXQD 1C5BH 3IKKA 4FMVA 1EWHA 3P9LB 1K3ZA 3QEUA 2DQDL 4H7VA 4MXWH 3T4AA 2X4SB 3EYVB 5CHNB 5ABDE 3L7FA 1MNUH 2K45A 3PIQA 2HCZX 5KSBF 2VZTA 4DN4H 3V6OE 2B9AA 4P2YA 4BFEA 2C1OA 2HXAA 3L3HA 2NY1B 4MQXD 5CZKA 3CFUA 5DK0B 1E7VA 3RDJA 4Y88A 3QR1A 3S4SB 1KT2B 3MSPA 1OV8A 5C08B 3TNMA 3BGAA 2WWMD 4JM2F 3SE6A 1IGIL 1XDTT 2IDUA 5IVZA 3SKJH 5ID1B 4XVSL 3UERA 5KANI 1ETJA 1CE1H 2KT6A 2XWRA 3C5ZA 3T0WA 5JIQA 4FQXB 3ORJA 1Y6NR 4GS7B 1T20B 1PZCA 2OXGB 1AD9B 4B9YA 4XP4H 3QQ4A 3V8OA 1NLDL 2J8UF 2L7EA 2AW2A 4ALAC 3UP1A 2QQKH 1YUKB 2FBOJ 1KYUA 4KJQC 3KVDD 2Y5TB 3MCYA 4LBEB 1INDL 4PGBB 5F7BA 4ODVL 2NY6B 1KGCD 4J6RH 4CSSA 3SE8H 2CO4A 2EXYD 4KC3B 2L7UA 4TUOA 2MNJB 3WSQH 4FEMA 1MH5B 4ZX5A 1WVZA 4O5LL 4KPHH 2DWSA 1PJ9A 4G7VL 3K7UA 4LLAA 3X14A 3BAEH 4Y5YA 2DMKA 1A1MA 1NTDA 2HN7A 5HHOA 1DQJA 4G8GE 3LMJL 3FRPA 2Y3AA 1WEJH 3HC3L 2P5EB 5F0LB 3MRJB 5L9DH 4L29A 3N41B 3ZL1A 5E2WH 5D1XB 2NQDA 1BVLB 4H1LG 1NAKH 2ZCLH 4X8CA 4ZPVA 5MENA 4YK4C 4IOFD 2C26A 2QTEA 2QLYA 4P4RB 2Z91A 1MHCA 2CRYA 4ISVA 2OMWB 4NWUH 4JFFE 3OG4B 4L0PB 3QIWB 4QYOA 1FGVL 5F0PB 5DLLA 3WFZA 1MNNA 2EJ1A 3QO1A 3Q1SH 2EE6A 4XCCL 4P05A 1PIFA 2KUTA 3Q6GH 3V6ZB 4BZ1A 1CXKA 5F3FA 3MV7E 5LDSA 1PBYA 3DGDA 3HI6H 5AZUA 5I23A 4E5XB 1JYWA 4AW4A 4NUGL 3M8OL 1M53A 5BRZA 2G75A 1W80A 3I6GB 2BVEA 3K1DA 4QOKB 4R4BB 4AQEB 2P8LA 2I9LB 1NCWL 2W9DH 4MCZB 5GRJH 3WKQA 3UTZA 1JPGA 2XPZA 2X7LA 1XIWC 4WI7A 3GBEA 1NMCB 4EOWL 2BP3A 4WI2A 4Y4KD 2FB4L 5A16B 2VN5A 4N68A 4POUB 2CDGB 4FQCH 5CM1A 2FZ3A 2OTWB 1ZHNA 3QBTB 4HUKB 3NN8B 4GG6F 3OR7B 3G04B 4RFOL 4ZMVA 4HAFA 3AU1A 4HUWB 1AGCA 1EEYA 1SY6L 4HAGA 1OGTA 4JFSA 4YDIH 4PGDB 4K55A 4GKLA 4DKFL 5DJ2B 1T0MA 1LO5A 1MIML 4UAOB 4OLZL 3REWB 3QXAB 4LKCA 4KO7A 3ECQA 4NDMB 3WTTA 2WP3O 3VRIB 4P4KD 2VXQH 3AS1A 5T5FL 3MRQB 3V10A 3F7LA 1A4KA 2HJLB 5DZNA 2QHRH 4AYEC 4NO0A 1CD1B 4ZDHA 1QSEB 1U36A 2A38A 3U1PA 1YMMD 1Z66A 1F6AA 1ZXQA 3BUPA 4QHPA 1MJ8L 4N2LA 4XP6L 4PJ9A 1JV5B 5DUPH 5JHMA 5JPMC 4P3DB 5E99L 1YNKH 4LPXA 3LHAA 4PPTA 4Z76A 5E2TL 3MUGB 4PJFF 1JSYA 3L4XA 1T2QL 5HI4C 3DTUB 4J2QA 3FQYA 4AL8C 3FB8A 1L9TA 1J9TA 4TQ8A 4LAQH 2J57A 5ALCL 1NGXB 3CE1A 1KGCE 2WUCH 3IYLW 4HS8H 3ZU8A 5KJRL 1KB9K 3W5MA 4J8QA 3CDZA 3S8GB 1XGPB 4NJAH 1J9CT 1FO0B 2OCCB 4KO6A 1P1VA 2JVUA 2AAAA 1XSKA 2FBJH 3GS4A 1L7TL 2H26B 5JUEL 4AQAA 6FABL 4YL4A 4BGLA 1DQML 2ICEC 2NXYD 4Z95L 2XICA 2CGZA 1MREL 5HGHA 1BQHA 3TEYA 1Q0XL 3LXUX 2CJUH 2OYMA 4OF3A 4DKDC 4KITB 1WUNT 3DO3A 1XIWA 4R2GD 4NBYB 1A4JA 1DL7L 2OL3H 4Q2ZA 1VEPA 5D4QA 5EBWB 4NNPH 3T65A 5I1GH 1RZ7L 2R2CA 5C0JB 5GGVY 1YEHH 2G30A 3DXAB 1MY5A 1LWRA 5GGQH 3O11B 1VACB 2X89D 4FG6C 2LLNA 3E6HA 2QGDA 2CCWA 3Q5TA 3DROA 3IWVA 1RPQA 4JRLA 5I1LB 3OKNA 2X4TB 3UAJC 4PJ5B 4I0PB 1X9LA 3CN1A 3GIZL 1OAJA 2R29A 4DOHB 5I73B 1LD9A 4Z7QB 4OIIL 4QJ3B 1I7UB 1XCTA 4NBZB 1NCTA 1KLUA 2R0LH 4ZMAT 2CGYA 1HHHA 4P5SA 3DK2A 4DJMA 3GHBL 2BNQB 4UZSA 2W9EL 5KN5A 1FIGL 2NX5B 2BVUA 1JGVL 15C8L 2ED6A 4GYBA 5F1SA 1RZJH 4AM0B 4JFXB 3GNMH 3KVQA 3WL9B 1YJDH 3FRUB 1TU2A 1FG2A 5JPMA 3ZSTA 2EDFA 2I85A 4GQQA 4N0YH 1ZLUK 4OLYH 4MVBD 3WNKA 2ED9A 2NYYD 3CAFA 1OM3L 5A7BA 2H6PA 3QIBD 3U36B 2VKWA 3N0PB 1NCOA 4LCWD 3C6EA 1ZLWH 3AT9A 2Z9TA 2XNAA 4ZYKA 2R1WB 4HISA 4ZO6A 1AP2A 1FVDA 5D96C 3F12B 3F8UB 2Y7NA 3L3JB 4D2NA 3E8VA 4MKMA 2DJMA 2ZKYA 3KWVA 2BFVL 3HZYA 4S1QH 5T8IA 4FQ1L 4HJJL 1E4WH 3KJ6L 4XOAA 3FFDA 4PM1A 5C08E 1YMME 3JVGC 2EC9T 4HT1L 3P4OB 1LLAA 4Y2OB 1GS6X 3VFVB 3BPLC 4I1PA 4KFMA 5IY5B 3MR9A 4LLUA 3U1SH 3P69A 2OJZH 3PAYA 1TVDA 5T33H 4ONOA 3L3GB 2JKJA 4OJDH 4KKRA 1S7VA 3T0EA 2MH4A 3NJJA 4K3GA 3GB7A 4X80H 4ELME 3QFGA 2TSBA 2X3AA 2WCSA 3H3PH 1D2OA 2VUKA 4EZJA 4FFZL 1QD0A 1PZDA 2BY0A 2UXTA 4LOFA 5IIEA 4M4RA 2VR8A 4K5OA 2DIBA 1D6EA 2BSTB 3N0AA 3AREB 5KYXA 4XVJL 1UT9A 4ODHL 1AOZA 2H6OA 2IGFH 2J20A 3AGWA 1JP5A 1QI5A 2O1AA 1WG3A 2Z7WA 4GIOA 3BH9B 4BSVB 3AQYA 3GSVB 3H3BC 4LDLB 1DHKA 1YEJH 3UTOA 2N7AA 1CE6B 1FFOB 2C9AA 1QRND 4UT9H 2FJFA 2VQ1A 3WYRA 3SPJA 3MRMA 3SD2A 5I2IB 1QSFD 4PBXA 3DJZA 4JFUA 1ZV2A 1SVZA 2D3JA 3LN4A 1DN0A 3PHSA 1TTFA 5EUOB 4F93B 4DCQA 3V6FA 3MV8D 4P0DA 5LCVH 5LXVA 4RFEA 4OCYL 1VCAA 5D1XE 2VDNB 1U8HB 3DIVA 1KTBA 1MRFL 5HHXL 4M7KL 1F4XL 3O6KH 5JDJA 3Q05A 4K94L 1M2VB 3V5KA 1XF3B 3CFTA 5AW4B 2FIKA 1LQSR 1PF3A 3EYOB 4X5LA 1TSRA 4Q9QL 3MUY1 1DVSA 3JV0A 5E9DB 3VXPA 4FEIA 4ZSOA 5CZVH 5C09A 3WFEL 1JNJA 1PY4A 1SJEA 3TO4D 3VGBA 4RAUB 4DUXA 3OAWA 2AJYH 1TQTA 5I5MA 4XWOC 3EF4A 1UCTA 4IS6B 1NC2B 1ESOA 5CFHA 1U92B 1ZRUA 4QOKE 1AZBA 3B7YA 4UT6L 2E8ZA 1RFDH 4JO2H 4R7NA 4H5SB 2IOOA 4XXDA 1HCZA 4HUUA 4DVRH 4FG4A 4X9HA 1DVQA 2VH5H 4M93B 4F8LA 5C7XL 5F3BA 1GOFA 4NLHA 2D9QB 4ZUUA 1P69B 1H0DB 1ED3B 5JW5A 1C8PA 2WBJC 4NHUB 4O2FB 1J0ZA 1KB3A 4KKLC 4LCWE 1JZ8A 1UACH 4A2EA 1TCRB 2V0AA 3FJTA 5HYJA 2AZUA 4CAGA 2WO3B 3M88A 3PL6C 3IXAA 4PS7A 4NO2B 1H3VA 4J3BA 1FFNB 1T0NA 4HHAB 4J3UA 4K3DL 4NQCD 4NZUL 5IMKB 1S2EA 1GHFH 5E6UB 3D07A 5GJSH 1FE8L 1P6WA 3SDCC 3ARGD 5B8CB 3NUKA 3UCRA 2VE6A 2VLKB 1F58H 3ECBA 2HRHA 5BVJA 1VFBA 2J44A 5EC2A 1RPKA 2P7TB 1FJ1B 3C5SA 4WI9A 4EVNB 1DUYA 1WH0A 3D85B 2LFEA 5ICZA 3X17A 1CF8H 1QLRB 3LXBA 1A14H 1FSKB 3MMEA 1RK1A 2VC2B 1A4CA 5T1KA 2WNGA 3OWEA 2HT4C 1U41A 3CFDA 2BVOA 2F53D 4AIEA 4MWFA 2OPCA 4RETB 3P4MA 1SYSB 2W38A 1KTLA 3B2PA 3NRPA 2YGOA 3IK2A 5DQJA 3BFOA 3FQTA 4PHXA 2XIBA 3CDGB 5F1NA 3FCBA 3EFFA 5IHLB 1ZJAA 5FGBC 5D6DC 4YXLH 2BNUB 1ACYH 4PGEB 5F1IA 3T8MA 1QRNE 2NY7H 5K39A 5C0ND 2C3VA 1KIUA 5TH2A 2AJZB 4B9JA 1QSFE 3M6DA 1KV7A 5EC1A 4X2UA 2Y7OA 4QLWA 4MBOA 1QEWA 2NNRA 3HBQA 1OAUH 3MV8E 4G9FD 1XR8B 2GBVA 1R9FA 2APBA 3QZBA 4CVXB 4D8OA 1U8QB 4FI8A 2WBJA 3SOBH 3TBTB 5DRZA 3D1MC 1K8DA 1AZVA 1CYXA 3QHTC 4JGNA 3OSVA 4GAFB 5GZND 1U21A 4U0RB 3FSVA 4MMZC 5C0RH 3H2WA 3HE7D 3PL6A 2NT0A 2HH0H 4YHZH 4FA7B 3UTSD 3MRPA 1S7UA 2AJVH 4MDRA 2ZX5A 4MKTA 4IU3A 1I1AB 5EU3B 5JTWA 2IANB 4GXVH 5IFHH 2PYEA 3HZMA 2F0CA 2QR0A 3CZJA 4ZUVA 4YNYA 1DBML 2XOTA 3FCGA 4Y8AA 3T3MB 3VWKC 1DSWA 4IBWA 1HEHC 4GAAA 2V7NA 5H35B 5EA0H 2G5BB 3OZLA 4A63A 3FB5B 3EGXA 3CK0H 2XPYA 4QI3A 4LPTA 3BE1L 1EHXA 4DIXA 5F44A 2GI0A 2HA1A 5DHXB 3ZE2B 5ICUA 4LKXB 2SEBB 3FQ4A 4D9RD 5FO7B 5FDWB 1CBVH 2YAPA 1HILB 2XJLA 3P9MA 5EO1A 5JOPD 4U6XB 3FQXB 3K0WA 2B1AH 3CVHB 5EFIA 3CMOH 3ILPB 3NH7H 4NQDA 1QBMH 5FGBA 4G6KL 3QB7C 5SV3A 3GSWA 3KH3A 3LAFA 4NQCE 4IJ3B 5JW4Q 1OARL 5DK2B 1FYTA 4WNQA 3I2CL 3MCLH 5C7ZA 2AGJL 3DVFA 1KB9J 3QEHA 4UV4L 4ANVA 5F9OL 2MNUA 3OR6B 2R2EA 3TJEL 3EH3B 4Z7WA 3S6CA 4G6FD 4FABL 4HLJA 3EYFB 1KGIA 1R3HB 2EDKA 4FQPA 4KROC 5JXAL 1HXKA 1JF6A 1X5JA 3U4KA 2FYYA 3A24A 3IF1B 2EZ0C 1ZK9A 5D7IE 3UYOD 2NXZC 1H6UA 5ALBL 4PLKC 2LLGA 4IKNA 2P42B 3R06B 1UKSA 1GTFA 3Q3GA 3G9AB 4XBGB 2DEXX 4N8CH 1ITCA 2F53E 4FJYA 1DDHA 2VAAA 1F11B 4MMZA 1I1FB 4G8EB 1ZCRA 1C5DB 1AKJD 3L13A 2VXQA 5SWQA 3IDNB 4F1ZA 5KW9H 1FP5A 3HC0A 4KBPA 1FYHB 4AJWA 4UB0L 1P6AB 3T2OA 1Z5YD 3ZDYE 2OJ1A 3PXLA 4KXZH 2X3BA 3HZVB 4RX4D 3V9EA 4ELMF 1JHKL 1RZJC 4F5CA 3EO0B 3R19A 4AQ1A 3VWKA 3CGTA 4U6HB 4TNGA 5ITBH 4OTXL 4OIFA 4A6YH 2PPCA 3CHRA 3DYOA 1GOHA 3VXSB 1BEXA 1FBIH 3CHOA 5T1LA 4BWUA 1DLHB 4HQQL 3UYPB 1N3NB 2ERJB 1CDJA 3HMXL 4G9FE 3T4YB 1A3LH 5IFAL 3LSOA 3VQMA 1DSFL 4F2ME 5KVMC 1ZHLB 3P30H 1M9SA 5F21B 1FCCA 5SX5H 1IGML 4IBYA 1FO0L 2A83A 3TJHD 3DNKA 2LTQC 3QPQC 1AQHA 5IVNA 4JKPL 3TFKC 5CAYB 1OTSC 3D39D 1NBCA 1MAJA 3DUSA 2AVFA 3NCYS 4PRNA 1GGIH 3MOAH 3UTSE 2CUHA 3C8KB 1PJWA 4J4PD 4K73A 5DD6A 5GJTL 5D2LE 1KIQA 3TL5A 1D9KC 2OL3A 3ZTJG 2XDHA 3QDGA 2Q7YA 3EAKA 4W68A 1JPSL 2F8XC 2F08A 3RWGB 4RH4A 3DETD 5ICXA 5FHAL 4BZYA 4HIJA 4HVBA 1JGDB 2WXHA 1L9NA 2XC8A 2Z0BA 4GIAA 3SDDA 3T08A 1WCBA 1KXTA 1G5AA 3STZB 5HI3D 2FGWL 4AEHL 1DLFH 3FQWA 4LLVB 5IWLC 4KTEH 2JKTM 4IRJD 4KI5C 4FULA 3QNZB 4F3FA 3ABMB 3CVIH 5DD3H 3HOGA 4HSQA 2YPLB 4D9RE 5DFWH 2OMBA 2VDQB 1NKGA 3KL5A 1XZ0A 5C0IB 3TH2T 4K3EH 5B1JC 3K2UL 5J11C 3RGVC 3NSFA 5JOPE 4JRFA 4HH8A 3MA9L 1OAKH 2GJ6D 2YAFA 3BD5A 5D70H 2HLFC 3U4BL 1OF0A 4YL9A 4KVNH 5GSRB 1KXQA 2UZYA 3CFJB 5LBVA 4P5MB 3U0PB 3SKMB 3WO3B 1DQVA 1HDMB 1EANA 5E1AB 4E9QA 1KC5L 3BW9A 2B5IC 5TE7H 2AJ3A 3E9UA 3PABB 3NFPA 2BVTA 5EU5B 2VW6A 3VG0L 3TZVB 1SF3A 3EHBC 5J8OA 1TUPA 3ISWA 5IB1A 2YPVH 3ILDA 5AW8B 1YEDA 3MU3A 3ZKXC 5BS0A 4L4TB 1KN2L 4W9EC 1U0QA 2BLFA 2ESVA 2Y2YA 2IVFC 3GBLA 4LL4A 1YEGL 3MLUL 3CXHK 4PJ8D 1J9RA 2OBGA 1T7WA 2XQYK 2VWEE 4AENA 4ELKA 1KN4L 3QFDB 2YD9A 2CDFA 3HN5A 5AZEH 2XTJB 3C08H 1B0IA 3DO4A 4OZIB 1T6VN 4XNXH 2YD3A 1A64A 1FV1A 4F7EB 2YD1A 2YOCA 2LU3A 2WXKA 3TA3C 4S10A 5G5DB 1D9KA 2AQRA 3ZT6A 3MRGB 1A3RL 2E7DA 1HXMB 2Z8SA 3BWUF 5DO2D 2FJUB 2YFNA 3CZNA 4L23A 4G3YH 2NY2B 4GAJL 1PZ5A 5PAZA 2PYFA 4KO9A 3OQ3B 2PCPB 1OKEA 1AYOA 1GCFA 1NL0L 4HS6A 1INDH 1E3FA 1N0LB 4WWKD 5GHWH 4ODVH 4C58B 4YAQB 3SGJC 3Q13A 3WXWL 5KVEE 3WLWD 1TETH 3RZCC 3C60C 2YBRB 4MZRA 3EBGA 2PP8A 2AXGA 4I4WB 1X5AA 4O5LH 1QFHA 4HA1A 5LGYA 2VERA 5HHPB 4G7VH 3DLQR 4RWYH 4WK2B 4KQ4L 3LV3B 2WMPA 4LRNL 3RGVA 3ZK0A 3LMJH 5FUCC 4DAGL 1UA7A 1MJJB 3SGKC 3HC3H 2VDRL 1W15A 4UT9A 3KPNA 3D0LA 3HS9A 4ZXBC 2XZQL 3OLDA 4Q9CA 1A65A 3ZZSA 1AXIB 1MFAL 3PRZA 1X7QB 1R19A 2QBWA 2IWEA 1HK6A 5LCVA 1MFCH 3TVMB 3X12A 1H8OA 4UQ2B 3QEQD 1RUKL 4GBXC 4Q4EA 2VDNL 5I17B 4S1DC 1XL4A 2HG0A 4XCCH 1N8ZB 2VLJB 1F3RB 3IJHA 4PJCA 4EZMA 5IBLD 2OTPA 4X5XB 1MCWW 3BJLA 1BF5A 1SYVB 1SBBA 3ABLB 4JREB 4QY8B 2ADIB 4Y4FB 3SPVA 3IFOB 5BW7A 3M8OH 1A7RL 4Y16D 4BFNA 1IEAA 2GJ6E 3MREB 3TA3A 2LU7A 1RZPA 3ZE2E 1FL6A 2DYSB 3VXTB 4Q58C 1KBPA 1CICD 4BYHA 3STLA 3O8XD 2CLRB 4XZ4A 1PMYA 2OX5A 2YMXL 3TBWB 2XA8H 4L3CA 1R17A 1WGVA 5AAWA 2VDKB 3SGJA 2W0FB 4N5ED 1JERA 1OD7A 1T7YA 3MNZB 3LRLA 2CUAA 3QP3A 3C60A 4L3EB 3RZCA 1EK3A 1RV6X 1HZKA 2JI1A 3GIVA 1MIMH 1AHKA 2R23B 1Y18A 2BOBA 4GB9A 4XB7A 1ZLUH 4CN4A 1K85A 4NX0A 2Z4QB 5ELIA 3DX1A 1H3GA 2EDQA 5HY9B 5T5FH 3FUIA 3QI9A 5I1DB 4GT7A 1BG9A 2BH0A 3MKKA 3SKUD 3SGKA 4YMPA 2HRPL 1QVOA 2ITDA 5D7IF 3T6XA 4RMWA 4MSWB 1MJ8H 4UU9B 4XP6H 2OMUB 3HZKA 2A3TA 1A6AB 5DMYA 5E99H 4F8OA 5E2TH 4K4KA 1T2QH 3FTSA 3QDJA 3L8QA 2JJUA 2ADFL 3LEVL 5LGKA 3FH7A 1N2RA 2H0EA 4OFYA 2HJFA 3T8VA 4AYFB 4JFPA 4N86A 5KOVC 3G6AB 1GGUA 3ZJAA 3ZDYF 5KJRH 4JPKL 4CU8A 2V2WB 3GMRA 3VX0A 1CGTA 1M7DB 1R3KB 2C9RA 2NY4D 3RFRA 3G08B 3N1GC 4RMTA 1DQMH 4YZWA 4YSAA 3NIFB 3C6SA 4Z95H 1MREH 1NEPA 1Q0XH 2A6IB 4FXGC 1KYOK 1UM4H 2FYVA 4FDWA 1SXSA 5CCHE 1BVOA 3VTAA 4AH2B 1DL7H 2YA1A 1CFQA 5KVEL 1RZ7H 4KI1A 4M3JA 2X4UA 3ZDZB 3VMOA 3UYRL 1KJ2H 1NCGA 5GGSA 1HHIA 2CQVA 1JYXA 2WAHA 5C71A 4LF3A 2IO5A 4Y4HD 1EO5A 2AABL 5EEVA 5D2LF 3BP7A 3QDMA 4XMLH 4OIIH 4OZFB 1TPXC 4ES8A 2YLKA 2ZUQB 1O6SA 4GI6A 2CM6A 5I19H 4RRPM 3QZNA 1WA2X 4HCGA 3WNJA 3RNQA 4P2RA 2W9EH 2NDGA 1FIGH 1UH4A 2XV2A 1JGVH 4HH9B 1KACB 2CU9A 3OLIA 4Z7OE 5F6IC 1ODUA 5FWQA 3IFNL 4PJDB 4PN6A 5KTEL 2DM2A 4AW7A 5J56B 2HT3D 3QORC 4LVNB 5A6IA 3PWUB 1J48A 5D7JB 3D52A 4L3FA 5LXGH 5BV7B 3HLAA 2OJEA 2RH0A 2VIRB 1CT8A 3GSXB 4TOYL 4FL4C 4M62L 4ZOAA 2VR4A 3F05A 4YFLI 1YAZA 3HG3A 4TN9A 1XWVA 4TSAL 1CVRA 1CURA 3IRCA 1ASPA 4UT7H 2CMRL 3US9A 2MQ3A 4CL7A 3ASNB 1ET7A 5F7MC 5DT1L 2NQ3A 3WO4C 3PHAA 1BM7A 3BHBA 4NSKA 2NZ1A 3B37A 3PV6A 4JFDB 5TK2A 4APQC 5EO0A 4FQ1H 2CE6A 2YPKB 4UMSA 2ISDA 3CVHL 3W9DB 3F7VB 4DEWA 4HJJH 1JCVA 2ZCZA 4OLWH 3OHXB 4MJ5B 1ML0A 4OAWB 4F20A 4HT1H 4IOIA 1NDMA 2WCGA 2CLVA 3O41B 4MNGE 1Z32X 3PP3K 5D7SH 4LEOB 1YEKH 4X4YB 3CSFA 1FDLL 3BDYH 3A22A 3FQNB 4OZIE 4HHWA 3FQRA 2IH8A 3BYYA 2EYRB 3LZFL 3WY4A 5HHNA 2I60L 4AGNA 2MCPH 4QXWA 3Q6FB 2ZOKA 5KSBA 1MFNA 3ABGA 5D1ZA 5BOJA 3MJ8B 2Q2LA 4KOBA 1HL5A 4MMXC 3S98A 4WTWA 3H2PA 5B7FA 3GMNB 1S7QA 1G7HA 3CQQA 3CWGA 4FFZH 4GO8A 4YHLH 4FXTA 1INEL 5E03A 4DEPB 3LKOB 1MVUA 4HIXH 1BZQK 4JM2A 4XVJH 4ODHH 2BP0B 4ECNA 3WE1A 2XQBL 4JFEA 1ASOA 1NBQA 1RUAL 3Q7JA 3RQ3A 5C6PB 5I6PA 2E75C 5J3HD 4LNVA 5IVXE 1E5AA 3PHQA 4YSPA 5LNEA 3S5ZA 1UKQA 2D7TL 1HQ4B 1ZA3B 4A6YA 4WAFA 1AACA 1FAKT 1Q9KA 4PREA 2CR3A 2J8UA 2OCFD 4CBPA 4G5ZL 4TS6A 3NK3A 4GQPH 3QUKA 1JZFA 1X4YA 1RJCA 2IXQA 4JZJB 5E70A 1ETZA 4KTDL 4FFWC 2CBOA 2FEEL 1PLAA 4FQ2H 4LVEA 3AABA 2DQCL 1G0YR 1MRFH 5HHXH 1F4XH 3NEEA 5G4OA 4K94H 5C07B 8FABB 4FOMA 5DHYB 1U8JA 1PYWB 3FH8A 3MRDB 5FA3B 4LPYA 2WO2B 3ESVF 1A66A 3IMRA 4JY4B 4KO5A 4XNAA 3D30A 2Z4TA 4APQA 4CC4C 2G2NA 3K6DA 4CMMA 1NGPH 2IQ9L 1H3UA 4B9ZA 1DBBH 1EZLA 2M26A 4BELD 3WFEH 4PTTB 5E5LA 1KBKA 3QIUA 2X9XA 5E8DL 2F54B 4JJ5B 4HWZA 3N2JA 3ZKND 1FNEA 5DMKB 4QXVA 1UT1A 4YO0B 4UT6H 4NAQA 3GMMA 3LKRA 1TQSA 4ZTOH 3BUQA 4IIQA 2XIIA 3CXHJ 3FB7A 3FU7B 3FOLA 1DFBH 2AEWA 1Z5LA 4LSSL 4Z7VB 4MD4A 1WFMA 5KUMA 4XMPH 3ZE2F 4LNRA 4ZMLA 3FTUA 2BSDA 3BGMB 1E5YA 4MNQD 4MMXA 3GTNA 4Z9KB 4EZLA 4TVPD 3CVCA 4G9DB 2ENQA 4IGBC 3SPCA 5H8DA 4Z0XB 3WTSA 2BSRA 2UY6A 5FM5M 3ZTDC 4J3SA 4FD0A 5CU5A 4F8QA 1HCVA 1S78D 1M56B 1NPJA 5MEOA 2DF3A 1EJ8A 3MOBH 4JY6B 1WHPA 4TUKH 3LS5L 1U2HA 3BKJL 5J6SA 3UJJL 3EW3B 5DYFA 1FE8H 3QW9A 3KPLA 5J1AA 4WI0B 3MTXA 5FYLD 4OD3H 1YN6B 3T71A 2GJZB 1L4IA 2QGEA 3QAZC 1KTRL 1J5HA 4I9WD 2YPVA 1UHVA 3GBNH 4GG6A 4LFHD 1RAMA 4EUPB 3EFDH 2VW4A 3EJYC 1QZ1A 2EDOA 1KPVA 1NBYA 2K6YA 1PKQA 1FHGA 1IB5A 5ANHA 1P5UA 3REVB 2OK0L 4OCNC 3GLDA 1MLBB 4ESKA 3PJSA 4CC4A 5JW5B 2RQEA 3WN5B 3GPSA 3VMPA 1M42A 3O6FB 1ZGLP 2XTSA 3NK4A 3FDWA 1MPAL 3O4LD 4FYTA 4KKCD 4MAYA 1GYVA 3DX6B 4U1HB 3ZQ9A 2D73A 3BXNA 1X3DA 2WD0A 4JGJA 1HNFA 1DUZB 4I3GA 1UZ6E 2G2PA 4DO6A 4QTIH 2E9WA 3PQYB 3RBGA 3RTQB 3LY6A 1J8RA 2VUOA 4JGUA 2ZG2A 4ORGB 1JHLL 1HHKB 4MGXA 5MHSD 4G7QB 4PJFA 5EF3A 1A22B 2QFRA 3EZ8A 1NCCL 2E56A 4PGCB 4NZTH 4NQEA 1ZK5A 4OSUH 1U8LB 2VDPB 4IU2B 4N20A 1BHGA 3VJ6B 4XZUB 4IGBA 1UB6B 3GWJA 2X09A 2YC1A 1QHQA 3WEXB 1AR1D 5INCA 5FYJU 4L05A 1RP8A 2G60L 1WBYA 3Q1EA 1RULH 1SDYA 4FCHA 5EZLA 5IB2A 3AMKA 4RISL 5ILTL 1PY0A 2LU4A 2K7QA 4JKWA 4KQ0A 3NQIA 2AFNA 3ARDB 1PQZB 3B9EA 4K8RD 1IFRA 4EXKA 5IQ9A 3BQUB 1SZNA 1JNLL 1LK3H 4MYPA 2P5WD 1AJ7H 4WUKL 1DBMH 2EE2A 1ROCA 2CSPA 1E40A 2EUVA 4NWTL 4O2CA 2DMCA 4LARL 2J8HA 4RZCA 2X1QA 2UX7A 4NBXB 3QJHB 2KDGA 1TR7A 3JV6B 2I7SA 2Z7YA 3BE1H 4ZOCA 3VRJA 1DVUA 1WA0X 4Z7OF 4NCDA 3V8CA 1CD8A 4QKTA 5HYFA 2RCSL 3MRIA 2EDMA 4MNQE 3T1FA 4TVPE 1RZFH 4XVUC 2WQVA 5DHEA 1QBLH 2HUHA 1D7DA 1JPFB 3CUPA 5SWZB 1IM3B 2FDBP 3DX9A 2H8PA 3HPLB 1P5VB 1J0JA 4P3CL 1MEXL 4G6KH 2NR6D 6PAZA 4QF1A 3ILQC 3C12A 4KY2A 3TT3L 1OARH 4L8DA 2D31B 1F4YH 2OSWA 1I3RA 3VNZA 3I2CH 5L2JA 1ADWA 1CI3M 1WE5A 3QSKB 4ADGA 3D12B 1DANT 1S3RA 5F9OH 2Y7SA 3TJEH 5FYLE 2X9ZA 3KLAA 4PV9A 4UYQA 5JXAH 1QFOA 4I9WE 1A9BB 2OQJA 3LRGA 1T1WA 3U79A 4HGWA 4AZ8A 1CFTB 3V6BR 3WS3B 2B77A 3SODB 3DIFB 1FL3B 3OMNB 1UWGH 1NJ9A 2P47B 2G3MA 3B5HA 3RFZB 8PAZA 1GRWA 2WXLA 1L3WA 4XN9A 1M05A 3PJNA 1U3HC 5IESL 5T5FA 4AEIL 3KCPB 5DUMH 3ABKB 4BH7B 3FQ2A 5LKNA 3QQDA 2EIEA 4HIIB 4W4OC 3UPRA 3W0WD 4BGDA 4UB0H 4XODA 3J27A 3SY0B 3CZKA 4QGYA 5I66A 3O4LE 1VFMA 4RIRB 3ZQXA 3LXCA 3V6OA 2JJTA 2NY5L 1C16A 2IFGA 4J12A 4JZOA 4OTXH 4F7CA 4GJTB 1QWNA 5B4MC 3R7RA 1ZEAH 2RHEA 3PFUA 4LOUD 2VABB 4HQQH 35C8H 5MHSE 3LRHA 3HMXH 1BPVA 4AMWA 3MRBA 5IFAH 1DSFH 2EDHA 3AY4A 5KOMC 1RUQH 3LZLA 5DRNA 2K8QA 3LVTA 2XVGA 4GRLB 2WANA 5EBMA 5IVXF 1IGMH 2IBZX 1T21B 1XFPA 4GRMA 4JAMB 5AL8A 5I28A 1AY1L 1OCRB 3D8MA 4JKPH 2PW1A 2FHFA 2EKSA 2HZHA 2ORBL 1RHFA 4JRYD 4WEBL 5C0CD 2EDRA 1T5WA 5KBDA 1BOGB 4YFLF 3OX8A 1EH9A 2AXFB 4GLRH 5F6HI 5C07E 4AUJA 2XFGB 5GJTH 5DU7A 1TJHL 4J7RA 3AJ7A 4LCYB 2BC4B 5KYWB 2P5WE 5T3XL 3N1PC 1JPSH 3ES6B 2R0KL 3MA7B 1AQKL 4R0LB 1G87A 1ZA6B 3CG8A 4JHVA 3KHQA 4LVHB 4U1JA 5F88B 3LH8A 3MGAA 1KJ2A 3S3PA 1E9PB 4XMTA 1F5WA 4MMYA 5DJYB 3RDTD 2ED8A 1YYMH 3RUGB 2F54E 3Q9PA 4Y5VC 1NCBL 4G8GA 2ZKHL 1F3DJ 4U3SB 2X41A 3GK8L 3TTYA 3K6OA 4CVUA 2E5EA 1SFHA 5HHMD 2P4AB 1GH7A 1N12A 1NC4D 1U3HA 3UTTD 3QS2A 4UANA 3TASA 1WZKA 4HK0A 4YUEL 1F1GA 1JNNH 1MJUL 2WZAA 4JCMA 3TFBA 4PRHD 4A2GA 3ZW3A 4F27A 3VD1A 5AOMA 2O61A 4ZZFA 1ORSA 3NJXA 3QJOA 4U3CA 3U4BH 3K80A 2X0VA 2FWUA 1DVFB 1CGYA 2YZ1A 2AVGA 5I8CB 4JFFA 2OI9C 4N5UA 1TZOA 3ARPA 3LS4H 1JV2A 2EXYC 3QFJD 2W65B 1H8NA 2XKSA 1UGKA 3BT2H 3TH4T 3O3DB 4TVPL 4YSRA 2MNWA 3DVGA 1RU9H 4FYSA 1B6UA 1MCQA 3VG0H 2WLYA 2QGBA 3ZKMD 3MV7A 5L4FA 3IN2A 4X4XB 4Y5XA 1FFRA 3GM8A 3TIDB 3FTGB 4D8PB 3A23A 1KDJA 1KN2H 3MBEA 4W70A 2AJSH 3VYPA 3UGXA 1P7KB 3ZZQA 4XX1G 4X5WA 2NLJA 3WI9A 1CYWA 4Q6YA 4K94C 1YEGH 3MLUH 4X8JB 5F9WC 1BW8A 1KCVL 4Z0BL 2VMDA 5I8EB 4GW1B 2DQGL 1H3PL 4F2EA 2F7QA 3VNYA 4MJ4A 3FMGH 4JFOA 5F7DA 3QXDB 5FYLL 3ZDXE 3T04D 3X13B 3FO9B 4IOFC 4LLDB 1IAIM 5DZPA 1H3TA 4CC1A 2PNDA 5JZ7C 4GAJH 2Y6TE 4O9HH 4IRSC 2Z8WC 4TNVK 2XVKA 1CFBA 2R69L 4EZKA 1ZT4B 5C0EB 1QACA 2XKNA 2KL6A 4XRCA 3HCVA 4AYSA 4K7PY 4TNVF 4Y2DC 5J12C 1NEZB 3WXWH 2V2TB 2F74A 1CGXA 4OZHE 3GS7A 4PB0L 2GUOB 4UF7C 3WDIA 1K2DA 3GKZA 3ZY7A 2CBTA 3VYNA 2XY2A 3FUHA 4Z7NE 2XG4B 1KYFA 4FFZA 2GAZA 1UZ6F 2MOVA 5DHDA 1QAWA 4NUMA 4X7CC 4CGUB 1RVFL 2X6CA 1KEGL 5EPMA 4KQ4H 4LRNH 9CGTA 4JRYE 3ATAA 3NP3A 4QHUA 3MRKB 5FWRA 3WEBA 4KZDL 4PG9A 1U6AL 1IKOP 4Y4KC 5EEYA 1LVEA 4ZW3A 2Y3NA 2VDRH 3RIAK 2AKRA 1X5ZA 5F9JB 4PJHF 4DGIH 3FT3A 2Z8RA 1SDDB 2XZQH 2ZX9A 2Q86A 5JQHC 4DN3L 3GUTA 3QUZB 1BVKA 2FLRT 3KPMA 2C3XA 5GZOD 1LP9B 4AQZA 4L2YA 1R3LB 3QR0A 1RUKH 9PCYA 1E8ZA 5HD8C 3A67H 3KPQA 3BCDA 2EE3A 4X5QA 1IKFL 1U95A 1SXZA 3UX9B 4DZBB 2B3IA 2ZOLB 4HFWB 2XWJA 3GMPA 1U33A 4K8RL 3LX9A 1Q38A 3HHSA 1WZAA 5E8PB 3UTTE 3VXNB 1ET5A 2NY3B 4Z8FL 2HKFL 4R4FL 3T77A 1A7RH 4WW1A 1WAEA 3QQ3A 2CKBL 3VXRB 4RVBA 3KDMA 1PU0A 1DJWA 3N1FC 1BQSA 3D08A 4PG2A 3ZL2A 5E6SB 1NQBA 2Q8BL 4GS7C 5JHLL 1KYDA 1Q9OA 2PWGA 1EPFA 1UB5B 1W0VB 2EDTA 3IB4A 4IRSA 1WDAA 2YGVA 2QPDB 2YLHA 1V55B 2WNWA 3C6LB 4ZFGH 4UT6A 5CMAA 3VI3B 1TJIL 5CU9A 2ZKMX 5FOJA 2QVTA 4FNSA 4Y2DA 2QKIB 3BP4B 2O5ZL 4Q0XL 4X99A 2OYPA 3E9TA 3HNTL 5JO5A 4QRRB 3FYEB 3X1GA 3IDUA 4EI5D 4X6DB 5LGJB 1G84A 2DLTA 3FU3A 3X1EA 1QFWM 3VWJB 1EHAA 2EUZA 4X7SL 1WICA 4PJGB 2K9UA 2ZCHL 2WIMA 3FU0A 3HG1B 1IX2A 1YVLA 4GW5A 4N0UE 4Y4KA 4A39A 5L7XL 5E8OB 1YPZE 3VXMB 1NBZB 2E3VA 4TSBL 1OQXA 2MOQA 3TWCH 5F96L 1GOGA 2WTPA 2JXMB 3WKPA 3T9WA 4OCWL 3P54A 5D1XC 4EIBA 2UZIL 4M1CD 2WSKA 2ITEA 5FCSH 2C4FU 2WINA 1T1XA 1JAEA 1AQDA 1BGXL 2ADFH 1TITA 4UQIM 1P84J 4AMKH 3KPOA 1EEQA 1JWUB 2DTSA 3QIWC 1ILUA 1FZMB 1W0WA 3ARYA 4EDXA 2HPTA 1C7SA 4JDVB 3WHE1 1OHZA 5C08A 1YMMA 3D69A 2IG2L 1Q9WB 3L95A 4DP8X 3EO1B 3QULA 2WLIA 1U4EA 1A6TB 1SVBA 2XZCH 4QHNB 3WFDL 5CSBA 4K5PA 4HK3J 4G7YH 2I5YL 4UNVA 5GGTL 1GKEA 1KB5H 1AAJA 1T1ZB 4JY5L 4YSEA 1FNFA 2IH3B 2NUPA 3GD1C 3CH8A 5DQ9B 2NYYC 4YLBA 4ELMA 5KVEH 3VW3H 3QIBC 3B2VL 5LQBH 1NMCC 3B8YA 3TYFA 1F6FB 2BIPA 1J11A 3BUBA 1MJ7L 4MCNA 3U6RB 1HC1A 3UYRH 5I1CL 3QS3A 3EUDA 1VFAA 1Z9SA 2Y24A 2Y5QA 4HX1B 1CLYL 1RURL 4DUWA 2KLSA 2YRBA 2D8KA 4WI5A 1FZJB 1HKLL 4NZ8A 3RKDC 4P06A 1KY7A 2C3WA 1P7HL 4PCTA 2JKSA 5DEFA 1E9OA 2H1PL 3JTSA 5F9DC 4UAOC 1ND0A 1IL1A 4HC1L 3O3EA 4RSYA 1G5GA 2WAQA 5D4JA 1SOQA 5B39G 2BWDA 3ZZLA 3GMOA 3R0MA 3RUGE 4QDGA 3IETA 5IB3A 2QPEB 3HKZA 5GS3A 1HH6A 3VTMA 2E9IA 2BIHA 2QDWA 2ZUVA 5DD1L 4A2MA 5BQDA 2X89A 4MZ3A 1CG9B 2WB7A 2XWCA 4Y1AD 2A9AA 5D1XA 5KTEH 3DUHA 1H8SA 5BJTB 4C56B 3LKSA 2H6UA 3QUXB 3BGFB 5I0XA 2OR7A 3BWUC 1JYVA 1OP5H 2WN2A 1CIUA 4PJAB 3BAWA 3N85H 4D7PA 3CZSA 1EHLL 2C5DC 4DF9A 1IU1A 2IAMD 4OJAA 3ERXA 3L54A 1RZIB 2LR4A 2XHNA 2VL5B 4QRQB 5GGRB 3GXNA 5GRVL 1UJ3C 1IZKA 12E8L 2CMRH 2JB6A 3ZRCC 1J8HB 1DZ0A 1RJYA 3JWOL 1I7RB 5JIKA 5DDHA 3MI6A 4JVUA 5CLZA 1QKZL 3DBSA 4UBDD 5SV4A 2G3ZA 3IVKB 5E6YA 4KRPB 4P46B 3I6GA 4AQEA 2AI0L 3EYUL 1J8SA 3QYCA 4KVPA 1XSOA 5DXWA 1GYWA 1SLXA 4ODTH 5TDNA 2Q3XA 4KNUA 2ZOOA 4XNQA 4JCWA 3QIBA 4BHUA 1FPTH 2F8IA 1QTSA 1XH1A 4EIZC 4OJEH 2R1XB 1F86A 4BFFA 4HMEA 1FDLH 4AKOA 1E9QA 1KGYE 3P1VA 2HFTA 2E4TA 1DQLH 4LCWA 2Y2WA 2FWOA 3LZFH 5B21A 1WC7B 4MRCA 1BFTA 4ONHA 1BAGA 4YPGA 4TLSA 3SDYL 4MB3A 3ZDXF 3NOIA 1J0YA 1Q9LA 1S7XB 2E4FA 2Y7QA 3FN0L 4H8QA 3VD3A 4I0PC 4DEUA 2H5UA 2ZSWB 4YQXH 2L7QA 3EYQC 1KLGA 5CD3B 1L9PA 3CHXA 2WQ8A 4CVZA 1ZHBB 3LB6D 3QCVL 5HYSA 4F57L 4QRPB 5E6ID 1AHWC 3BQVA 3TO4C 5AWNL 1ZS8A 3U46A 2HMID 2B59B 2BS9A 1CD1A 4U1NA 1RUAH 1XO8A 1G7MB 2X2UA 4U1LA 3G5ZB 5KYUB 2ZNXA 2QZ5A 3QYMA 4G8IB 2XQYA