1JXGA

The 1.6 a resolution crystal structure of a mutant poplar plastocyanin bearing a 21-25 engeneered disulfide bridge
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
100
structure length
100
Chain Sequence
MIDVLLGADDGSLAFVPSEFSCSPGCKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords PLASTOCYANIN A
publication title The 1.6 A resolution crystal structure of a mutant plastocyanin bearing a 21-25 engineered disulfide bridge.
pubmed doi rcsb
source organism Populus nigra
total genus 27
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1jxgA00
4ZK8A 3NJJA 2UXFA 1ZDQA 3NJKA 3S8GB 2UX7A 5B1JC 2VW4A 1AACA 2JKWA 1BQ5A 4YSEA 1AZBA 3NJHA 3OMIB 4KO9A 1FFTB 1M56B 1V10A 5B3SB 5AKRA 4DP1X 2EINB 2YXVA 1BYPA 3FSVA 3QJRB 1NIFA 2YAFA 1DYZA 1A4AA 1NTDA 1QLEB 2DWSA 3ABKB 1SFHA 5B1KA 1NIEA 1YLBB 1A3ZA 2Y69B 2OJ1A 2QT6A 2XX1A 1R1CA 3FYIB 3OM3B 4G7RB 4NB7A 1GS6X 8PAZA 2YAOA 3TU6A 1JXFA 4HALA 1HAWA 1NIBA 1OCCB 5B7EA 2QDWA 1IBZA 4DP0X 1OF0A 2W88A 3PLYA 3WG7B 1L9QA 5AZUA 3S3CB 4UF7C 2IWFA 3X1NA 2IWKA 3FQ2A 1ETJA 2PPDA 4HAKA 1SF3A 3FPYA 4A66A 2P80A 3BQVA 1OCRB 2GHZA 1KDJA 1QNIA 2VM4A 3UABA 2BP0A 4E9VA 4E9YA 4NAJA 1GR7A 1J5DA 2RACA 3NP4A 3QJQB 2DV6A 4BWUA 3NP3A 1OOWA 1ET8A 3CG8A 3EH5B 1GY1A 3EH3B 3FU7B 2GSMB 3RYMA 2HX7A 4GP5B 4Q89A 1PZCA 3QQXA 3TA4D 2FT8A 3EH4B 1L9OA 1ASQA 4NERA 5IY5B 2QPDB 1AZCA 1N68A 3OD3A 1JXDA 2IDFA 2Y1AA 3ASNB 5I28A 3ABGA 2PPCA 4M4RB 1RZQA 5E9NA 3NJNA 1AOZA 4HHWA 5D4HA 3CVBA 4BDVA 5AFAA 2IDTA 3C75A 3NSFA 2CAKA 1PLBA 2ZOOA 1F56A 4GYBA 2DYRB 1ET7A 1GW0A 5F7BA 1VLXA 1UATA 2XYBA 4F2FA 4KOCA 4PAZA 1SJMA 4A68A 5ANHA 3ASOB 5B1JA 2UX6A 4DP5X 4GP8B 3UAEA 1AZRA 5D4JA 1J9SA 4E9TA 4E9SA 1JZIA 3S3BB 1OE2A 1AS7A 1XMEB 3H56A 2IAAC 3NSCA 1GY2A 1E67A 1W8EA 1B3IA 2LLNA 3ZX1A 1PNCA 2IDSA 1RKRA 4YSUA 1CURA 1BAWA 2CALA 3FU7A 1NPNA 2ZONA 3SBPA 4YSCA 3NJFA 2IH9A 1PZAA 3AG1B 5B7MA 1ID2A 2FT7A 2YAHA 1JOIA 2YAEA 4A2GA 3AW5A 1JERA 2PCYA 2VSKB 4AKPA 1OCZB 4G70B 2AVFA 1A4BA 2IWEA 4P5RA 4DP4X 3UAAA 1BXUA 2BWDA 5I6PA 3V9CA 1A8ZA 2QPEB 1WA2X 2AFNA 2VM3A 1PCSA 3DTUB 2FJSA 1MZZA 2BZ7A 2BZCA 2P80D 3NJGA 2EIMB 1W6LA 4ENZA 4YSAA 2ZXWB 4DPCX 2AZUA 6PAZA 1JVOA 2HXAA 2WO3B 3GYRA 4AX3A 1AS8A 3NSDA 4N8UA 2BW4A 4G7SB 1KGYE 2IDQA 1AR1B 2XXFA 4BDVB 3X1GA 1MG3C 2XWZA 1RZPA 3TBBA 2DY2A 2DWTA 1GS7A 2GI0A 3IN2A 1KCBA 3FQYA 5LDUA 4A2DA 3PAUA 1KYAA 2FQEA 2XU9A 4L0PB 4BXSV 4DP8X 1E5ZA 2Q5BA 2XV0A 4YL4A 4TXVB 3ABLB 6PCYA 4HCIA 1ZDSA 2BHFA 1JVLA 1NPJA 3FSWA 3OMAB 2J56A 3PXLA 4F2EA 2EIJB 4AKOA 2XXGA 2PP9A 3OMNB 1V54B 2E86A 3SBQA 1I53A 1L9RA 2VN3A 2TSBA 1CYXA 3GDCA 3D12B 1CYWA 1L9TA 1OV8A 4KNUA 1ZV2A 4JKNA 1FWXA 1HFUA 2MRYA 1WS7A 3SQRA 2GBAA 4BWTA 5I6MA 1XB3A 4KO6A 1NDTA 4A67A 1AQ8A 1PZBA 4JHVA 3WKQA 4QKTA 1XB8A 2XUWA 1CC3A 2H47C 3ZDWA 9PCYA 3ZIYA 1ILUA 2OCCB 4YSPA 3WNJA 4HIPA 1PY0A 3PPSA 2FQDA 3AG4B 4GP4B 1X9RA 4MFHA 1T5KA 1XB6A 1AS6A 1EZLA 4BXVA 1KDIA 2YAPA 3KW7A 5I5MA 2BW5A 3AG2B 3UGEA 1J9TA 2J55A 1GS8A 3H4HA 3WKPA 3NJIA 1E5YA 4W1TA 3CDZB 1JZEA 2YXWA 2NRDA 3X2QB 3S3DB 5I5IA 1MDAA 4YSTA 3OQRA 3QPKA 1IC0A 3TASA 4YSOA 4EF3A 2DYSB 1ILSA 1NZRA 3IE9A 4KNSA 4G7QB 4DP2X 3AZUA 1KCWA 2ZWNA 3PCYA 4RH4A 4K9JA 5EHFA 1BXAA 3HEIB 4UAHA 2XV3A 1EHKB 3FSAA 1E65A 1N70A 1TEGA 2XLLA 1PAZA 4HHGA 1J5CA 4BK5C 1AAJA 3N2JA 2H3XC 4M3HA 2R7EB 3BVDB 3TBCA 2Q9OA 2FNWA 2GC7C 1M57B 3GXUB 2CBPA 3T9WA 3U25A 1OE3A 2X87A 1SDDB 3IBOA 4DP9X 1AG6A 4KO5A 5D4IA 2EIKB 1URIA 2JXMA 3NYKA 1TU2A 4GY4A 2YQBA 1W6WA 1ZPUA 1E30A 4CSZA 1AIZA 3QJUB 2J57A 3FS9A 2VW6A 2EILB 1WA1X 3ERXA 3CDZA 4UANA 1MG2C 2XV2A 2GIMA 1NWPA 1KBWA 3QJTB 1A65A 5I5JA 1HAUA 5B1AB 3JTBA 5TK4A 2UXVA 1A4CA 1NICA 2PPFA 1FA4A 2J5WA 2YAMA 1J9RA 1AZUA 4DPBX 1PNDA 2A3TA 3FU8A 1NWOA 3IEAA 2CJ3A 1PLCA 2W8CA 3NSYA 4GXFA 5PAZA 3SBRA 1JZFA 4BWWA 5B1BB 2WO2B 4F7KA 1ZIBA 1SNRA 4HCFA 2B3IA 1NIDA 2TSAA 3NJMA 5I6OA 5A7EA 1KV7A 2I7SA 1WA0X 3QJVB 1RCYA 1JZJA 2VSMB 3AY2A 2R7EA 1PLAA 4A2HA 3ABMB 2CUAA 4WKXA 7PAZA 2MTAA 2PPAA 1ADWA 1AANA 4KOBA 3PAZA 1SDDA 1NIAA 5TK2A 1MZYA 3V9EA 4AZUA 2HLEB 1SFDA 1OE1A 5PCYA 1ET5A 1ZIAA 4CSPA 5I6KA 3CVDA 4E9QA 2IH8A 3WNIA 3NJLA 1BXVA 3ZBMA 1BEXA 4N4YB 4AI7A 5I6LA 5I26A 4FAAB 1ASOA 1AZNA 3WI9A 2N0MA 1IBYA 1PF3A 3DIVA 2QDVA 3FPXA 3FQ1A 3T6XA 1TEFA 1L9PA 1NINA 1GYCA 2XX0A 4JHUA 4YSQA 3JT2A 1SHWA 3PAVA 4G71B 3FSZA 2UXTA 1JZHA 3CZUB 3X1BA 2YARA 1PMYA 1IKOP 2BP8A 2VMJA 1V55B 2OV0A 1WS8A 4YSSA 2BO0A 4FA7B 2FQGA 5FC9A 1L9SA 3N55A 1J9QA 2GC4C 2HRGA 3HB3B 4E9RA 4YVUA 4DP6X 3H4FA 3KW8A 3T6VA 2H5UA 4E9WA 4HCGA 1DZ0A 4G72B 4YVNA 2IDUA 1CUOA 3FYEB 3NT0A 2VW7A 1BQKA 2WSDA 1TKWA 4PCYA 2FT6A 3CVCA 3EHBB 1SF5A 3QJSB 4HZ1A 2X88A 2FQFA 4DPAX 4W9ZA 4A2FA 1KBVA 2PPEA 2I85A 2UXGA 1ASPA 2AANA 1WAEA 3EF4A 5F7AA 1SHXA 2PP8A 2HZHA 2BWIA 3X1FA 1IUZA 7PCYA 2FWLB 3T6ZA 2CCWA 2XVBA 3AG3B 2PP7A 4E9XA 3MX0B 5I6NA 4YSDA 3X1EA 2HX9A 3FT0A 1JZGA 4KNTA 3FU9A 2JFCA 1OCOB 4QLWA 1QHQA 3UADA 3T71A 4P5SA 3L45A 4DP7X 2B08A 4Q8BA 4YSRA 1BQRA 4X4KA 1M9WA 2I7OA 4AKQA 3MBWB 4KO7A 2PCFA 3G5WA 2HX8A 1GSKA 2YAQA 3WIAA 1BYOA 3T6WA 2BP0B 2FTAA 2GB2A 1JXGA 3S8FB 2HRHA 1AG0A 2AZAA 1X9UA 2PLTA 3DKHA 4WTQA 3UACA 4A2EA 2BP8B 5B7FA 3IN0A
chains in the Genus database with same CATH superfamily
3HR5A 3WHXA 2XVLA 1H8OA 3D3VE 4WSGA 3WEBA 2VLME 2WLLA 3BKCL 1AVAA 1TTFA 5CLZA 3UTZA 1NEZG 1D9KD 3CZEA 4ZO7A 4CVWA 4G8IB 4X4XB 5IW3A 1UXLA 2J4WL 1CPUA 5EORH 3MX0A 4RQQB 2IGFH 3GS0A 3DPDA 3MRJB 4IKIA 2Y6SC 2ATKA 4I4WB 3ULUF 1SM3H 5F7DA 1NGZA 2JI2A 3RPKA 5IGXH 1OPGH 3HLKA 1SYSA 4WWOA 1OCCB 2YMTA 2QDWA 5HHOD 2E4FA 2XXCB 3SQBA 3HAEA 4L8DA 1CD0A 1S7XB 5I5RA 3QZNA 4OZ4A 5CGMA 4G6MH 4ADIA 3KPRB 3SKJL 1ETJA 5HXMA 3FUKA 2J1WA 1P1ZB 4LOUD 4E36A 1OCRB 1QA9B 3HCVB 4WW1A 3DUSB 4QHUB 1XL4A 3N5AA 4E9YA 1UVQB 3GI9H 2D3LA 2VLJB 4JO5A 3VTAA 2DQEH 5DZNA 2VITA 4OLUH 1J5OH 1IC4L 1DJHA 1TVHB 2H2PD 4XNUH 1GY1A 4DEPB 2AI0H 4JZOA 5ICYA 3PQYA 2VMCA 5E0FA 1LO0H 3NVQA 1PZCA 35C8L 1TQBB 2Q8AL 3BT2L 5D1ZI 5AL0A 2LHAA 4PJ8D 3WOVA 5IJVA 5MEQB 2R4RH 4JN2B 5TE6L 2EXTA 2QPDB 3TT1H 3UZVB 2WLHA 1NGXB 4APQB 4NO0B 5G4OA 4YDLC 2ERJC 3BI9X 4U7KA 4HXAL 5ERWB 3VI3B 4AZ8B 1T20B 3CVBA 5LBVA 1K4DB 3N91A 2WBJD 1HTYA 3MQIA 2HG0A 4E42A 1JSYA 3MLSH 1UATA 2BIHA 2LLGA 2MQ3A 2ZWKA 4MKMA 4O51B 4PRIE 5DURB 1UA7A 4LIQE 4Z7UB 3ASOB 1VA9A 3JYCA 4YPGA 2UX6A 4PJHE 4I0PD 2MPAH 1S3RA 3M8OL 4M7LL 4YDIL 4OV5B 2IWGA 4FQIL 1UT1A 4UT9A 5LWYH 5LGYA 2W5PA 4JFQB 4WTWA 1XV8A 1B6UA 4QHMA 4ZW6A 3P40A 1JZIA 1T2QL 1AGDA 5KZCB 3BUDA 5I8KH 3EO9H 4F7MA 1QBAA 3FJTA 1HINH 2AQ1A 4ZS6C 2EEDA 1B3IA 1JZDC 3BDXA 3Q2CA 1RKRA 3QDMA 3VO0A 3WY1A 4FA8A 2CALA 5C09A 3NCMA 1QRNB 5I17B 2XN9D 2OMZB 4JAMB 3TO2B 3MDJA 4RFOH 4X9BA 1FLRH 2QR0A 4KH9A 1MJJA 3PF2A 4WO4C 1O6SB 1U0QA 4X6FA 1SXAA 1JDDA 5EBWA 2A2QT 1MJUH 2RMNA 4NJ9L 3BC9A 2F7OA 5I1KL 3WS3B 3Q01A 4NBYB 1WZAA 3JTSA 5EN2B 2VH5H 2NDGA 2OMXB 1ANUA 1E4KC 1ZEAH 3LIZH 3SQOL 3V0JA 3KCPA 1EEUA 1EO8H 1MZZA 5JW3H 2BZCA 4U6TA 3NJGA 1CVSC 2OI9C 4JFPA 3C6LD 4MD4B 4NQUA 4QNPE 2XZCH 3DIFB 5I16A 1AI1H 4MX7B 5F89A 2WXRA 4PGBA 2XPGB 3QIUD 5F21B 3VXMB 5AAWA 1JPFA 1JVOA 1RLWA 4KKCC 1I7UA 2ZPKL 3H6AA 3U83A 3VU1A 4AX3A 4XR8C 2VE6B 2BW4A 3BN9D 5ESAA 5CN3A 4LXFA 2VISB 3ETBF 3X12A 4EN3B 3G08B 4XPGH 3FN3A 4PD4K 1QTYT 5F9JA 4KKBC 4YHIB 5AVXB 3IN2A 4NLAA 3DSFL 4XX1G 1UB6B 4A6YB 2A9ML 1G7QB 1Q9OA 2JIXD 3PWJA 5D96C 4Q56A 5LJYH 3Q9QA 1NBVL 1NM4A 3BSHA 4JE0A 4JFXB 4D8PA 5E2UL 2BNUB 3ATBA 3FK3A 2XV0A 1HEHC 4Y9GA 2XRAL 4P3DA 3W82A 4KU1A 2FEEI 5TQ0L 2VR9A 2G2PA 3VGAC 3V4PL 3CH1B 3POCA 1IILE 1QKZL 2VL5B 4NWUH 2YZ1A 1BSIA 2PP9A 5IP4A 1XF3A 3MMEB 4FQHB 1X7QB 4MJIA 1DQKA 3TURA 3B9KD 4HUMB 4CU6A 2ZX9A 4FEMA 4ORZC 4Y2OA 1OZTG 4UAOB 4EXPX 1MHCA 4YHLL 1IAKA 4ODXB 4PR5A 1XH3A 4UUJA 1RZKL 1QLFB 2DOCA 4ZUSA 4AY0A 4TULL 4DNLA 4MA3A 2OXGA 1E9QA 4YHNA 3EOYG 1DN0B 4KJPD 3TA3A 3OKDA 3ZOAA 3RY4A 4YSPA 1TYRA 1XMWA 2HB0A 4FS0A 4XI5C 5JA9A 3WNJA 3D3VB 1ZTXL 3HUJB 5ENWB 2YAPA 4MJIE 3ZKNC 4YQXH 2DW5A 2VDPH 5E99H 1J9TA 1T1ZA 5DEZA 1AGFB 1KIRA 3KYOB 1BAFH 4NQSA 5DO8A 2YXWA 1A6VH 3K2KA 3OKNA 2ZAIA 5J7CC 2BCMA 3FOLA 5JIIA 3M1BA 5HJGA 3RE0A 4YSOA 3RU8L 2JJVA 3N41B 3QXAA 4KQ0A 4N8CL 4GKNB 3WHE1 4OZIA 4DZBB 5FV1L 3X11B 5KYWB 3LX9A 2ICWJ 3S88L 1H0DB 1N70A 1Q0YH 1QEXA 2XLLA 4MSWB 4WIQA 4TNFA 4Q9RL 3GSNL 3VGEA 5A2BA 4NC1E 5IMLB 3WEXA 1A3RH 1YJDL 4GRMA 1OAUH 3DOSB 4AC4A 5I23A 3D50A 3HFFA 1R9FA 2ATPA 3OAZK 1IZJA 3Q9PA 3IFOB 2FUTA 4WFGD 1JDCA 3VVVA 5JIQA 3NFPA 2QHLA 2RHEA 3O8XB 1G9NC 4DP9X 1WCBB 4UCFA 1LO5A 4HYTB 4KO5A 4ZFZB 4YXKL 1SHMA 3CX5K 1DVFA 3ULVE 4FFZH 3I3DA 2UWEB 4IGBC 2JXMA 3VDCA 3V4VA 2P45B 1W6WA 4CSZA 3Q5TA 4DGYH 3TCXA 4O2CA 5IOKA 3MFGB 4U1NA 4LLDA 3VRIA 5BS0D 4TF4A 5JHBA 3ZDYE 4YDMA 4LSQH 3F58H 5CR8A 3VCLB 5F2FA 1HAUA 5TK4A 3WE6B 4BQ6A 5E7BA 2H3NA 3IKCB 3QUZD 4I3SH 4QJ4B 3INUL 1BF5A 1AZUA 4KRPD 4GW4B 4KXDA 4JQXC 4WHDA 2XETA 4PRIB 3IEAA 5TGBA 5EZLA 4NQEE 4HKJA 4PJHB 3U1SH 4OM0H 1VFAA 1HQRA 1KV7A 3BHBA 3NCJH 4P2QA 2NY2B 2OCJA 4X7FC 3X14A 1CE1L 1WFIA 4R7DB 2B3RA 4JM4L 3DUHA 1BQHG 5D7SH 5DS8A 3N40P 2ODHA 2OZ4L 3ABMB 2FB4L 5KVEH 2ICEC 2MTAA 4QXUL 2HVKB 5IZ7A 5GGRA 3WLWC 3NCYS 2A4ZA 4OD1L 3RWJA 1LEKA 2BNRA 1L0XA 5DVPA 4DUXA 5LXVA 4X6DA 3FO0H 1J8SA 2YQ2A 1FV1B 4ZUUA 3CJJA 5JHDB 5HDBF 3WFHA 1ASOA 2DTMH 1CDHA 1XGRA 3B5HA 3EFDL 4P9HC 3LPFA 3NQKA 4QI3A 3K71B 5CGBA 1KY6A 4PJIA 5HD8C 3PWVA 3K91A 1DJZA 3Q48A 1SJHB 2Q3XA 5HHNB 1GRWA 3X1BA 1ACZA 4FKHA 2A4EA 2YPLB 3ARGA 2VDQB 1EPFA 4YSSA 1MELA 2BO0A 3G9AB 4N1EA 3BVXA 3BZEB 3M46A 4JRYE 5AAMA 1U21A 3F7QA 3BP7A 2GC4C 1XR8B 2PCFB 4EAEA 4E9RA 4JFFD 4HW6A 4M1CC 5SWQA 2ZCHL 3U6XS 4MWFA 4I5BA 4Z7QE 2R0LL 2WGNB 2WIIA 1HQ4A 3B5TA 1T4KB 4EUPB 1LDPL 3HC4H 2WLJA 1YEGL 1BQKA 4IQHA 4E5XB 4GKZA 4LU5H 3QUYA 2V7NB 3TN0B 2BC4B 2DBLL 1EDHA 2X10A 4DVBB 5JIDA 4I1PA 4LCYA 5KG9B 2CE6A 5JNYA 5TF0A 1CTOA 2NY1D 2WWKO 1U8NA 4Z7OE 4XVJH 4W9ZA 1A7OL 4MNGE 5GS0C 5J9PB 4HOWA 1YQVL 4OZIF 3GXNA 3FRUB 5DUBA 3MRHA 5AOMA 3UG4A 3ARVA 1GYWA 1TQVA 1JZ3A 3AXLA 1FG9C 3VG9C 4NNXA 4ONHA 4JM2A 5FM8A 2C9UA 2IAMA 1UOVA 2V37A 3QQDB 4NDMB 3RVTC 4N0UA 5D71L 1YPZA 4DKFH 5IMMA 4WEBH 2R2HA 1ZPLA 4NNYB 3VRJB 5D7LB 3MBWB 4WWNA 3GJFH 2OK0L 1QX1A 4F8TA 2IXQB 3G5XB 3DNKA 5GRVL 5CSGA 3L3OA 3TYFA 1C5DB 3EJZD 3QFGA 3FO1B 4O4YH 2ENJA 2DMGA 1N8ZB 1PG7H 4HKXB 2AQPA 3S7GA 2WXOA 2X4OA 1RUKL 4ONFL 4Q58C 4ZPTA 5GGUB 2QBWA 3O6FC 3IGLA 2Y3NA 1GGIH 1HHIA 3JWNE 4RNRA 3S8GB 3P73B 3RVWD 3H2WA 1ZK9A 3NJHA 2F54B 2QJDA 3OXRA 1RSYA 1RJLA 1SHSA 1RXLA 4QRUA 4UT7L 2ZKWA 1BYPA 4K3DL 4H8WC 1GYUA 1NIFA 5DZVA 3WJJA 3ABKB 5I0ZA 3R8BB 4NO3A 4RRPM 1CYGA 2XJKA 3OKKA 4GOSA 1HOEA 2WVVB 4LBEB 1YECL 1HAWA 5K69A 2DB8A 1T2XA 4XRCB 1HH9A 2DWEA 4M7KH 2J5LC 1HJBC 3FQXA 4Y5YB 4WCYH 4NOBA 1YMMD 2BM3A 3HFML 4ZODA 4WI3A 1NCAL 1KNOB 3BAJA 2OYMA 1UFUA 3GK8L 3GZKA 4IRZL 4Q52A 2GIXA 2LW3A 5LGHH 1QNIA 3G7TA 4G9FE 4X6DF 4YHMH 5C0DA 3T4YB 3MODH 4MQ7B 3UYPA 3PWPD 3V6FA 1D9KA 3CZJA 3ZQ9A 5DQDH 2VOTA 2YD4A 3CH8A 3MZTA 3MUJA 1QVOB 1FL5B 4URKA 1BVNP 4FFYA 2UZXB 1MRFL 4J1UB 1IM3D 1FQ9C 2HX7A 4P04A 2ROYA 5D72H 5F72S 5E2VL 3QPXH 2PYEE 4MNHA 1R3HA 4PJIF 1C16A 2WINA 4UM8A 3HVNA 3FH8A 3QBTB 3ZT6A 3ALXA 3TNNB 2JF1A 4BQBA 1RZGB 4LSUL 1NCTA 1IGJB 4FQCH 2ZOLB 1I3RA 3FC8A 4P5TD 3ASNB 2DS4A 2GBVA 1Q94A 5E9NA 2VLKB 4FC3E 3NJNA 5DD3L 2R39A 1H6FA 5ICXB 1QLRB 5IW6A 4XPAL 2OMWA 3TBVA 5EC2A 1UEMA 2K9FB 3SSGA 2XTSA 2ZCZA 4HS3B 1D3CA 1JN6A 1MJ8L 3ISYA 4LDCA 3BD3A 3QAZC 3QXWA 2EH8L 4RIRB 3BAEL 4W9KC 1RZFL 5A40E 2AV7B 1FZJA 2N56A 2CLRB 3FT2A 1DDHB 1N2RA 4HJ0C 4JY4A 4GKOA 4L4TB 2F5AH 3CFJB 3HRZB 3K6SA 1DUYA 1KJ3L 5HHOE 1CLYL 5KSUB 4N25A 2RTTA 3FTUA 5EU3B 4EEEA 5BZXA 3H56A 4UV4H 3ZT5A 1KYDA 2D7PA 3CHOA 3E6HA 1CFNA 3QUMB 4N9GB 4OF0A 2VRKA 3CSYA 2QZQA 3P0VL 1LWRA 3EW3B 2NY7H 5IHHA 3O45B 4O5LL 2YIHA 3V6OE 4JO1L 1Z5HA 2C9RA 1MCNA 2VNCA 3LPOA 4QYOA 4Z7VB 1A14L 2I9LB 1FNSH 4WU5A 4ZG1A 4LLVA 4J8RB 2Q1EA 4MNQB 3PGCB 1PZAA 4GSXA 5MEPB 2FT7A 3OZLA 4I1NB 2QQNL 3AREA 3FUFA 3VD7A 4JM2F 4AQEB 3ULSB 4U1HA 2FEDC 1J8HB 1YPZF 4J3XA 4NQCA 1XCXA 4QHNA 4YX2L 2BJML 1UYWL 4GXUM 3J7HA 4P5RA 3BP4B 2FSEA 3UXFA 4JRYB 2JWYA 5MERA 2BS9A 5JO5B 1IBGL 2VM3A 1TFPA 2ICWB 2MKLC 2ZOKA 5FYKL 3EFOB 3IMWA 4ZSOE 1H8LA 3IFLL 4F5CA 4RMRA 1FGNL 5E2JA 1OCWH 2GT9B 3D4GA 5A6IA 5AWNL 4OJCA 4DFIA 3P54A 3IXTB 4ATTA 4ZNCD 2VKXA 4FI8A 5KVFE 3LY6A 3SGDH 2X0UA 4QXGL 3U1QA 3ESNA 4Z78B 3OG4B 4Z7OB 3SE9H 1CDGA 2QADD 4PN6A 4MAUH 4F58H 3PHQB 3REWB 5F9OH 2CH8A 1A6TA 2QQLL 4F57L 1R3KA 2Q8BH 2OMUB 3MYJB 4NLHA 4AVJA 1MCCA 4AXWA 1R4XA 4P05A 4DQAA 4F5CE 2DI7A 4AW7A 3IB4A 4MMXB 4FQJH 2JB5L 4IMKC 3JWDH 2XN9E 3JWOL 4K3JL 3OC5A 1BD2B 3Q13A 1XSKA 1A2YB 4P2OD 5IMKA 3FCTA 3V52H 4B41A 3DX4A 2ALAA 5CKGA 3VI4A 2XZZA 3KYMA 2OX5B 5HGDA 4M9OA 4OUUA 2HH0L 1EGJA 4M5YL 2GJ6A 1V54B 3DRTA 3SGJC 1XF2A 3BXNB 1A7RH 5JQ6L 1L9RA 1KJVB 4O9HL 2TSBA 2KLRA 2H6OA 5DC0A 1KTRL 4XP9H 2ITDB 1IGYA 1I9JL 3NFNA 4AV4A 1IGFH 1NUDA 2Z8VC 1SY6L 5HYSA 3MRNB 5FPIA 1P7QB 5I1HL 3MNDA 4X98A 4KXZH 1I9RH 2W38A 4KK9D 1IAIH 5D7IA 4FA6A 5DGRA 1UQSA 5CXPA 3HC2A 3KDMA 5J6GA 1WAAE 1CC3A 1EIBA 1SPDA 1J7VR 2P5WD 3A67L 3JUZA 3G6JE 3VI4E 5KOVC 2ZG2A 4KHTL 2GAZA 4Y16B 2KDGA 5IHUL 1T5KA 4K9EL 3Q06A 5C0RL 3TH4T 4LFHG 1AGCB 1XAKA 4OGYL 1DJIA 1UT2A 3O9WB 2IAND 3MFFA 1T03L 4S1DD 3CFEB 3H4HA 3B9KA 4XMVA 3RB7A 1G87A 1IQDB 1ZA6A 2Z4TA 2H41A 4PYHA 1PTZA 1P84K 2NRDA 3S3DB 3PWNB 4K23H 3PP4H 4EDWL 2JKLA 1XXDC 3V5KB 1OGAB 1G1CA 3ARDB 3B9AA 4YHZH 1VACA 1HE7A 4K07A 3P4MA 4M7JH 4OLWH 4EF3A 3FTSA 5D1XD 4DP2X 3NTCL 2K3TA 1LE9A 2XACC 3FTGA 5FYKD 4JQIH 1I3VA 4P4KB 1ZLVK 4I9WD 4ZFFB 2N7SA 4ESKA 1HL8A 1OP9A 2AEPH 5CZXC 5DHVA 5LKNA 3GMOA 5ALCH 5DMKA 3ZYJA 4B3EA 3UOAB 1XFPA 4QTIL 4TUKL 5HDQH 4WK4B 1WWCA 1J1OL 4G1MA 4R5VA 4YE4H 4G9FB 1E40A 1G7JB 3V0WL 2DWDB 3ZW3A 2W0LA 1VFOA 4L1SA 3NCXA 3Q1EA 1HXMB 1ULVA 5IR1B 5T1JA 3T2NL 4NRXB 4CADA 1QO3A 2WWKT 2Z31B 3CFBA 4HPOH 4LHUA 4CNIA 3WKML 1XAUA 2H9GB 3FCSB 2GK0B 1FH5L 4PJEA 3WNOA 1UCBL 1OE3A 4I13B 2ZAHA 3T0XA 4ODUB 1Q90A 4MA8L 5IEKB 4ELKA 4TNVK 2EYTA 3LKQA 3CSPA 3MA9H 3KPPB 4MLSA 5I74B 4GAJL 1TFHA 3RVUD 1ZPUA 2D2OA 1E30A 3PJNA 1E8YA 4MAYC 3WGUB 4RA0C 1QFUH 3O2DA 2E8ZA 1HWWA 1S5HB 1S7WB 2XFXA 1QP1A 3L5WB 1KBWA 3I84A 1JCVA 3QJTB 3QB7C 1FDLH 4KTEH 3JTBA 4YEFA 4N20A 2UXVA 1LE5A 1KEGH 2PPFA 2D31A 2D0GA 3VXQA 2BXYA 4PJEE 3SDYL 5CIPB 5HHXL 2GY5A 1TNNA 5DVOA 2C9QA 1OVZA 4WW2C 1IX2A 3SBRA 5J1AB 5DJDB 3ZDXE 4QWWD 1ZIBA 5DYOB 3D18B 5GISH 1NA8A 5HHOB 4DUWA 4B27A 1NAMH 1ZGLA 4JN1L 2J88L 4P48A 3C8DA 5EO9A 4AMXA 1KG0A 4LPUA 5E6ID 4GINA 3T0DA 4KXZI 1X5IA 3K6FA 3ARFA 1IAII 5AOJA 2DAVA 4P2RB 4EZLA 2F61A 4K7FB 5LG1A 4D0BB 1ADWA 3V4PA 4GMSL 2DMCA 4P23C 3NPSC 1CGYA 5D2LA 3CZNA 2CR3A 4M5TA 3CLFL 2UVEA 5G55A 1BFTA 3QUZA 4PJ5D 4WFGE 2ZXQA 4H25A 1OAJA 4M48L 4JJ5B 4RFNC 4EBQL 4Y4HA 1TT6A 2AJVH 4F3FA 3EYFB 1UD8A 4XPTL 4MMYA 2N0MA 4PJ8B 5GRUL 4Z3JA 3BSGA 5T33H 2ZX8A 5JQIB 4X8XA 2CGZA 3MOAL 1XIWD 1NUFA 5DFWH 3KPTA 5AKVA 4YSQA 3NABL 4QAMB 1OD7A 1T21A 3PAVA 4HUWA 4Q2ZA 5BS0E 2DD8H 1RU9L 4GAYB 4NI6A 1RZ7L 3D1MC 3LAFA 4MVBD 1PMYA 3I9IA 5DJAB 3HG1D 4ZSOB 3GXFA 1G5AA 1HOCA 3NAAL 4JG1H 1O5DT 5D7IF 1P5UB 1TG8A 2WBJB 3FB7A 4QDGA 4WI0A 1JHLL 4N2AA 3LRHA 5KYYB 4M6MH 3DROA 3U2JA 5D2NC 4KDTA 5AL8A 5BVPL 1BP3B 1Q0XH 3MXVH 4L05A 2O5XL 3UP6A 3O0LA 1RJZB 4I0PB 4A2LA 1HHKB 3WV0A 4EPSA 2DLFH 2WLNA 2B59B 3DWTA 3BIKA 2ZYSA 2MCAA 5CEZH 4KK8C 1EERB 2YSSB 4XAWH 4XVTL 5HTSA 1CLZL 1GA2A 5ESVB 3S5LA 2X88A 4JNXA 4DPAX 1WAPA 4KGJA 4UIKH 3BRGC 4QLRA 1ZTXE 2P43B 4HFUL 2TAAA 4P9MH 4WQOA 4MJ5B 3QHTC 4OJDH 4QMEA 3GSNA 2V9QA 4JR9L 4MA1B 2XN9B 1XVSA 3ZRCC 4XCCH 4GBXD 4FLSA 3RUGA 1ED3B 2PO6A 3QIWA 1G9HA 4RETB 3R19A 3K8MA 3EJYC 2QVFB 3QWRD 8CGTA 4ZQTA 2WWNA 3APMA 3CFIC 4UQAA 1L5GB 4PGJA 1FO0L 4NYLB 2BVOA 3BOVA 4KFMA 4L3CB 5DTFA 1U3JA 2BY2A 3UBXI 3MV8D 2OMYB 3T71A 2JH2A 1H9DA 4LGPB 2X4TB 3DYMA 5DD1H 2R2CA 1U3HC 5KSAB 1MAML 1DL7L 4PJEF 2FLBT 1YN7B 3DMMC 3S3SA 3P3SA 4JO8A 4HFWB 3QORC 1Y0LB 4QTHB 1E4HA 3VXSD 4DUVA 4WTZG 5F6HJ 3ZDXF 3DECA 4Z18A 1R3IH 2BCKB 1VZGA 1BVKA 1MY5A 3T6WA 3C6LB 1CICC 2IBZX 5DHYA 4PJXE 2ZUYA 4F7EA 2FR4B 3QIUB 3S3JA 4JFFE 2EEXA 1QI5A 4C8XA 4NGHL 3G5YB 5KOMC 2V17L 4QIRA 2OTPA 3MRBA 3P0YH 4FFVD 5JZ7C 1KJMA 3MLPA 4ZX3A 4X83A 4WHYG 4PU2A 1BIIB 3NJJA 3Q1SL 3AQYA 3UC0L 1Z0NA 2K6YA 3WGVB 2VW4A 4AYBA 1R5WA 3U30C 3C09B 1XGQA 3BE1L 4PLOB 4PSRA 4WJ5B 4XVSH 4OLYH 4Z3GA 5B3SB 5IKCA 1GCYA 2JIXB 1Y6MR 3QJRB 1A1NA 4S1RH 2HT3D 4H88L 1G9NH 1QQDA 1SQ2N 2NCEA 5I6XC 1QR1A 4ELDA 2R15A 2Y7SA 5FXCH 4FXLA 3IS0X 3N6YA 4X99A 4XOBA 4XP1H 1DBAH 5E6ZA 4NP9A 2J8UB 4OZGA 4PS4H 1ERNA 2C7UB 5FHBH 2X28A 4G7RB 4N0RA 3S4SA 5ADOL 2AJZA 2DMBA 4LKCB 1DBJH 5T1LD 3V0VA 2XTJD 2WVSA 3NZHH 4Y88A 3D2TA 4RX4A 1H3XA 4FULA 3V2AR 3ZR6A 2KI6A 1ZLUH 4PY8I 4QTFA 4R9HA 2ZT9C 3HC3L 5D2LF 3VG0H 1NOFA 3GBML 4POZC 1GZHA 2P80A 1K72A 1KN2H 2IALB 5F1SA 1KDJA 3EYVA 3IFNH 1NEPA 3BJ91 5CLYA 3ULAB 4JVPA 3RG1C 2HKFL 1QSEA 5G5DB 5FLVA 4BWUA 4BKLA 5T3XH 1GMIA 3HE6D 5IB1A 2DQTL 2KMWA 3QQ3A 5DQJB 4OLXL 2QSCL 3E3QC 4Q4IA 4NJAH 3QQXA 5EBLA 4Y4KC 5KW9L 5JXED 3U0WL 2YGVA 4R7VA 4C4BA 5DI8B 4AM0Q 2KZBA 4UDTA 4RGOH 5IT2H 3B7TA 4HWEH 3DYOA 5IY5B 1ADQH 3FRPG 3QDAA 1FIEA 1MIML 2FHFA 2I32A 3L16A 5HI3D 3VXUA 3QRGH 5GZND 1IL1B 2ED9A 4GO6B 4ZMLA 3LXAA 3OF6D 1KBGL 4OFQA 4I18C 2MCMA 2K9UA 5I9QC 3HBQA 3F6JA 4GW5B 1U4FA 2H32H 4FMVA 4OQTA 5E4OA 1XZ0A 1ND0B 1NBYA 3Q2WA 3NZ8B 2DMHA 3EADA 4KQ3L 1NAKL 3QXDB 4RGNC 1B4RA 5F7BA 5HYJA 5J5EA 2ZWZA 3EYSH 4K73A 5B1JA 4DFHA 3DX9B 1IC7H 3TBYA 3FFDA 1K3ZA 2EIDA 3B9EA 4KK5D 1I1CA 1NFDB 2XYCA 3QI9B 1QUNB 3D05A 4IBWA 1A4JB 4ZAKC 2R9HC 3V0IA 2P8PA 3M7FB 1G9MC 5BJTA 1KN4L 5ICZB 3AU1A 3HN5A 1YMME 1W16A 2ZUQC 2ITCA 4M7ZC 4NC2B 2ZIDA 4AQ8A 4TNVF 4WNSA 3MTRA 2OL3H 4JO4H 1VRSA 4P5TA 5HHMB 3E0GA 3KYKL 3RUGF 1BAWA 1UEYA 3BH9A 3PWPE 1NBCA 2F58H 4M8UA 5EV7A 2WJ5A 3LH2L 1U8OA 5FUCC 3WBDA 1JOIA 3FNKA 3C6EA 4J6RH 3ET9F 5BS0B 4O58H 3EOAA 2F74A 4HH9B 4G70B 1BIHA 4CL7A 5DFVD 1JFQL 1PQZA 1THAA 3BIBX 3MRIA 3TTSA 4KRPB 4L3ED 4NHUA 3BEVA 1VADA 4FCAA 4QGTA 5ID1A 4MJ6B 2Y22A 1JHTA 5C0IB 4Q6KA 3VXOA 2BFVH 3T8XA 4EZMA 4X6EB 4L0YA 3KBHE 3ZK0A 4YSAA 1HESA 2XY1A 3QJXA 2EUZA 1T22B 1DEDA 3GIVA 4M02A 1K8IB 1XL6A 1NFKA 4RRPG 3ILPB 12E8H 1T0MB 2DQIL 3P77B 1E8WA 4N0YH 1H6UA 2FH6A 3US1A 4OCLC 3JV4A 1LO4H 2BSCA 4MZRA 4PMEA 1WC7B 1P7KA 4LLWA 1FFNA 2CHDA 3LKPB 5I71B 2KC0A 2NDFA 1UWFA 4MB3A 1P9MC 3COOA 3QYMA 2NXYC 4TS6A 4AQ1C 4J12A 4A2DA 5J13C 2C3VA 4OZGF 3A47A 4HAFA 4WWKB 5EU6A 1XGUB 3KAAA 3VUAA 1CGTA 1MVYA 4BXSV 2V0AA 4CSTA 4FFZA 1M71A 1ZHBA 2AKRA 1MIEH 2BHFA 3AUVA 1K4CB 3OMAB 4ENEC 5TDNB 4AKOA 4EIBA 4N22A 5F9DC 3HS0B 4X8JA 3TL5A 3KR3L 3LN5A 1QMUA 3QUKA 4FNUA 1E4JA 4PLKD 1A7QL 3NIDE 2MCPL 4L8CB 4N1HB 2G3NA 2J72A 2VN3A 2ADJB 4PGCA 4LDOB 4H8WH 4XNYL 4HGMA 1C12B 4AG4L 4C56B 1FL6B 3P3RA 2D7QA 3JTTA 3UBXG 2CLZB 5EUOE 3D30A 4PJDB 1A6UH 2YRBA 4PJXB 3K7UA 5FM4A 5IVZB 3IDNA 4OAWB 2HJKA 3STBA 3WMPA 3HI6L 5DMIL 4QKTA 2TRYA 3I2CH 1BEYL 9PCYA 2HKAA 2VB5A 4GXVL 4R90H 3H9HB 4NPYA 4AV0A 1JHKL 5D1QC 4AIZB 1CQYA 3C2SA 4HK0A 4DCQB 1OGPA 1B0RA 2VDNL 3AG4B 3ZRFC 3VD2A 1OKEA 2DQJL 4ALAL 4BXVA 1AS6A 1EZLA 2P5EB 4HUUA 1KXTB 1KCRL 3MNZB 5CGYC 5B39B 1I9IH 4L9LB 3AG2B 4QRRD 4MMZC 5DD6A 1X4XA 2ISDA 1DLFH 3VXNA 1WWBX 1JZEA 1S7SA 3C60C 4HUCA 4JDTL 1AIFB 2WWMD 1QSVA 3GI8L 4R0LC 4BJLA 1XSOA 5ABZA 1ZT7A 1EHLH 3SDXB 1DUZB 3ZKMD 2ICCA 4XBPB 3AZUA 5H2BA 3RA7H 1I1FB 4FYQA 1JK8B 4L1BA 1UB5B 2R1YB 3SY6A 5CLXA 5DUJA 1BBJA 4HZLA 3LZRA 2P5WA 1HHHB 1HYSC 1DFBL 3IMTA 3O41A 3LNFA 4S1SL 2H26A 4LLMB 3D85A 2ZQKA 4AEIL 4ZXBD 2BVEA 3ZMRA 4KGLA 4DZ8A 1M7IB 2EE6A 5H94A 1S9VA 1UA6L 1DBMH 3SZKC 1U8IA 2NCMA 4MQSB 3BVDB 2IANA 4KI5D 1T04A 2Q9OA 2I60L 3QCVL 3L95B 4G43B 4UDUA 3Q6FA 1HSAA 1OSYA 4UT6L 4D94A 5CCJA 3I3EA 4BE6A 2BP3A 4E41A 5IW1B 1XGPB 1ZT4B 3RFZB 2X4RB 5K1VA 1FZMB 5GGRY 3PHOB 4TTGA 3EJPA 1UD6A 3O6MH 1KC5L 3SDAB 1YUKB 4M5ZH 5D1XA 1SMAA 2LV4A 2WKOA 2CDEB 3Q3GA 3NRQA 3TF4A 3BDBA 3O0RL 2P5WE 3WSQL 2WZ6A 3BSZH 4XNXH 4AUJA 3MJGX 3FU0A 2C3XA 1VENA 1FN4B 1VERA 5FHAH 1Q38A 3C08L 3DO3A 3F00A 2EH7H 2X89A 2DL9A 2IANE 5IIEB 1PVHA 4DKDC 3WO4C 2RQ8A 4GIOA 2VMDA 4J4PD 4G5ZH 4RZCB 2O6FA 3QDJA 5B38A 4TNEA 3U0PB 3PABA 1JG9A 4EQ3A 4G6AD 2JKTM 2X70B 3CN2A 5AVZB 5I73C 4XNQB 3WNLA 2VDRL 1F3DJ 1CLOH 4XWOD 5KSVA 1G84A 3CXHJ 3KBPA 5D1XE 2NZ9C 5SX5H 5FYKE 1AMYA 1HZHL 2JKNA 1NGPL 3HHSA 4I9WE 4QOKD 3TZVC 2O5NA 3RJDA 3JVGA 1YMMB 1NLBH 3A0OA 2YLHA 3MRMA 1B0GB 2V5YA 1X5YA 2WQ8A 1TKWB 2Z0BA 4UM9D 5L9DL 1AANA 1FFPB 1KB5B 3VFPB 1W72H 4IGBD 2BH0A 4QY8A 3C5XA 1D5XA 2KDYA 3J27A 2FX8L 3ZBMA 2R0ZH 1RURL 1TO4A 1IM3B 4FAAB 1QNZL 1CFVL 4HSAC 3C5JA 3BVUA 1SLVA 2QDVA 1JXJA 5BMFL 5DJ6B 3SKNB 4GRWB 5LNEA 1RY7B 1OK8A 3NA9L 4PJ9B 2XX0A 2APTA 4OCYH 5DK0A 2P7TB 3EO1A 1OQXA 2ZXGA 4Y4FA 3ARWA 3MA7B 2DM3A 1YRKA 4HJGB 3B83A 4QJ3B 4X4MA 1NCBL 2CMRL 2LFEA 1C7SA 3ZTCC 3GSQA 3NEOA 4FA7B 5I2IA 2Q6WB 5DMGC 1J0ZA 4OF5A 5D7JD 4FCHA 3M07A 1IKNA 5GHWH 2I5YL 2W9EL 3HE7D 4KJYB 4HIEA 4MCNA 7FABH 3QIBC 5E6SB 3DXAD 1NMAL 3I6GA 2CO7B 1MLBB 2ARWA 2HJFB 4OJAA 1DSWA 4JHBA 2F2HA 2XWCA 3OLIA 2WSDA 4KTDH 2VDKB 1VFMA 4RMWA 5GGTH 1IE5A 2AJSH 1EJ8A 3LDBB 4HIIB 4ZDHB 4Y5XC 3ZO0A 4LCWA 1IFHH 2B15A 5LXGL 1A3LL 1EAPB 3HB3D 4HUVA 1LP9A 4WK2B 1TZGL 5DZLA 1DQDL 3W3BA 2A6JA 2UXGA 1E0OB 5E6YA 2XWTB 4YL9A 4JDVA 2AEQH 2JB6A 5K9KA 2R27A 3BQUA 1HKLH 3FT9A 4CVZB 1SHXA 1T7VA 2BWIA 1S7RA 1IUZA 3IETA 1P2CA 3FULA 3SGEI 2FWLB 5IHZB 1MAKA 2EC9U 3S37H 1HWGB 4O2EB 4PJ5E 5FA4B 2NW3A 4AOFA 5IJBC 2C5DC 3ARZA 3BGMA 1FYTD 3HMXL 5SV3A 2W60B 5I0DA 4GO8A 4N2MA 3FOMB 1UWEL 4L1LA 3VXRD 2HUEA 2EXSA 1OQOA 4RWHA 2XKNB 3MNVA 4JK0D 4BK4A 4B53A 4XT1C 5GIRB 2O5ZL 5EUOB 5JXAH 5F3FA 2NLJB 1E8XA 4NPJA 4A7QA 1QFPA 4H1LA 4X9IA 1M1XB 1YY9D 2OULB 3WN5B 3HG1E 3WIAA 3ZY7A 4GQ9L 4XOAA 2YUZA 3W2DH 1KGJA 4HDIA 4YOKA 2GTWB 2WKOF 3T0BA 3RIAK 1E4XL 1XEDA 3CDGA 4NHCH 2WAHA 3P2TA 2FWSA 2GJZA 3T4AB 3I50L 2COVD 4FQ1H 4PJGA 3STLA 1X9UA 43CAA 4JDZA 3G04B 5EIQA 3QULB 3QWRA 3TO4D 4LSVL 5GSVB 3UTPD 2J6EL 5A2KH 3LTVA 3UABA 3VXTA 2UXFA 1JV2A 2ZSVA 4JJOA 4P57B 4Q9QL 1NCWL 4F8OA 1BQ5A 5KVMC 4QUOA 2QSQA 5C0GB 1ZLEA 4HMDA 4XNZB 1SOSA 5LGJA 2BRRL 4XNMA 2NNRA 4FNTA 3SE6A 3IYLW 4LCUA 1OAQH 2X0WA 3SOBL 3QO1B 1V7ML 5DD0L 1R3JA 2Z35A 4HH8A 1J5IA 1S78D 2E6JA 4KI1A 2NR6D 2UZYA 4FLQA 4AJVA 4WHCA 4P2OB 4BUHA 4LNVA 4JKMA 4LOEA 4OJYA 1TQBC 3V55A 4UTAH 5JPNB 5F9WC 2W88A 4ZPVB 1WO2A 2Y5EA 3F2LA 1V7NL 4LSTH 3S3CB 3MLZL 4DPRA 1M05A 4JKKA 2R1WB 4OD2A 5KJ7E 3KHQA 1ODAA 1AFVL 3MV8E 4PGEA 3RY5A 5ISZD 4WDIB 3OKMA 2JELL 1YDPA 5DJ8A 2IPUG 4JJHA 1A21A 4JANB 4NP4L 3OL2A 1SN0A 3QWOA 3RPIB 4F7TB 5DRNA 2RACA 4PRPB 4QRFA 1CFBA 3VXSE 2AGJH 1VZHA 4Y1SA 3KL3A 5T1MA 2XWRA 3EH3B 1KCKA 4OIIH 4FXTA 1JWSA 5F7EH 3X13A 1ES0A 1H8SA 1JCKA 3LIUA 1N5YH 1TJIH 3TA4D 4F15B 2R23A 1G7LB 4KMTH 2AXGB 4Y2DB 5I1CL 1OSZA 4LCCA 5FW7A 4LPXA 2YMOA 2EC9T 2BPBA 2YA0A 5TFSH 1BF8A 1IGMH 5AOZA 5GRYA 4DVRL 4KVCL 3ZQXA 4K5PA 3CVIL 2XZQH 1T1XB 5D4HA 3CVHA 1RK1A 1S7TA 1XCQB 4ZMPA 2ZOOA 3V4UL 1A9EA 2E27L 2WXHA 2NZ1A 2VLRA 3HR5B 3WHXB 4RZKA 1NCCH 4BD4A 2OR7A 4EE2A 2DQHH 4WNQB 1IQWL 2YC1A 1J86A 4DP5X 4RAUB 2DQEL 1TJHH 3OHXB 4GEIA 4ZFQA 2NX5A 3HBZA 4OLUL 3UTZB 1J5OL 3VWJC 5D1ZD 1ZTMA 2Y06L 3N0AA 3TWCL 1U8QB 3AROA 4QRBA 5JXEA 3WU1A 3SDCC 2XTJE 1LP9F 2AI0L 3UIYA 2J1ZA 1AS7A 2V5TA 3BIAX 3BVNA 3EDFA 4NRZB 2NXZC 4O2FA 3WELA 1X5GA 3TEZA 1M7XA 4LEBA 4U6VH 5AD0B 4ONOA 2IPTL 3DHUA 2R4RL 2X9XA 2X7LA 3QFDA 1SOQA 2DPKA 3JUYA 3LMJH 3TT1L 4IS6A 4N2IA 3DHJA 3FTZA 3G6DH 4U0RC 4BKSC 3HAEB 2WUCH 4N0FA 2FEEL 3GMLB 2P28B 3ES6B 3UJJL 3W0WD 1WYJA 3K0WA 1LM8V 1WT5C 4Z5RA 2F9BT 1XXFC 3FQNA 1H3VA 3AMLA 3UX9B 4F8LA 3T0VA 2ICWI 4UIMA 4AKPA 1XF1A 4UNIA 2V7HB 4JRXA 4XHJD 4FQXD 3MLSL 4FG0A 1UJ3B 2VITB 3ARBD 5CCKL 4HKBB 3B2VH 4UV7H 1CFQA 1TTBA 4M6AA 2Z92B 3RNQB 4X7TA 1BXUA 3C5ZD 1UWYA 2E7MA 3L5IA 4KXAA 3WIHH 4JZOB 1ZWIB 5ICYB 5LWYL 2DYPD 3CLEH 3MXWH 1H5BB 2JI1A 4HPYL 1VGEH 3CX5J 4I85A 4ABWA 5F7WC 1UZ8A 4PJGF 1ZLDA 2IV9A 2ZKXA 5F44A 1NCDH 1HINL 4L48A 5IFJA 3MKKA 2LOEA 3CDFA 3IFPA 4LRIC 5CWSB 2DQDH 4EUPG 3TGXA 4P46C 1C5CL 1ETZB 2K4WA 5E6IB 4E5XG 1L7IH 5EH1A 5IJKC 2Y7OA 5BPPA 2K7QA 3L3IB 2ZYRA 3MVSA 2EKSB 2PR4L 4H0HB 4YFLF 2YD5A 4UAOC 3OX8B 4AYFA 1NL0L 3GSUA 4OIBA 4G3YH 4YPGB 2PTUA 2KERA 4PJ5B 4N6RA 3PFQA 1WFTA 4L3EA 2CLVB 2JCWA 3HMWH 4TQIA 4JEGB 4XN4A 1HKFA 1N64H 3MR9A 1AR1D 5JOFA 2YPVH 1FVDA 1ZEAL 4HS6B 5CN1A 3ROLB 3N40F 2YR3A 5DGQA 1NGWA 3VX1A 1XIWB 5FWQA 4F7MB 5JW3L 4NKIL 4U1GB 1YNKH 1IEAB 2ADGB 3RZCC 5AENA 2IH1A 1FORH 3QK0A 2YD1A 2DQUH 4N3TA 1OAKH 5C09B 2RQEA 4OCXH 4Y2NA 4GMTH 3HG1B 3FHAA 1CFTB 5GGSY 2DKMA 1FZKB 5L2JA 4KNUA 1ZV2A 1IMHC 1IGCL 3II1A 3MRFB 5FGCB 3CK0L 3PUCA 3IVKA 4X6FB 3MC0A 4NZTL 1BHGA 2HP4A 4WO4A 4L3EE 3CN3A 4XPGL 4DN4H 4HA1A 3WFCH 1MKFA 4MB4A 3L3GB 4YNYB 3L3DB 5IEHB 5ACMA 2VERA 5E94B 1EJOL 1NAMA 5CZVL 1JXKA 2BVTA 2J73A 4N6QA 1O75A 1VDGA 2YWYA 3OMZA 5F1IB 5JW4Q 1BVOA 3RKDC 3WEAA 1V27A 4NQXB 1JZ8A 3KCPB 5T5FL 4V1DD 2G2RA 5FDWA 4IM8A 5DVKA 2CGRH 1MWAH 2DQ6A 2J55A 4H13C 2EABA 3KPLA 1IB5A 4JFPB 3SYCA 3MJ8A 5E56A 3KLLA 3LKRA 1B4JH 1JWMB 1WGVA 3NZSA 5IK3A 4ZUTB 2E0PA 4IBVA 1KXQA 3M86A 3B9DA 4Q9CA 3UPRB 3GGWA 2EDHA 2ZWNA 1RZ8B 3HZVB 2NSXA 5F9JB 1Y6NR 1RP8A 1J5CA 3WTVA 3L3JA 2EVFA 1NFIA 3QE5A 4NEHB 4UZGA 4YBQC 3VFVA 2GUYA 1Q9OB 3WXVH 1TZOA 4X7CC 1KACB 3ZMNA 4L4VD 2WW8A 4XBGB 3RIAF 1RIHL 2VDMB 5FOBA 4RMVA 4IEFB 3IM1A 5KS9A 2CKBB 3LB6D 1ZLUK 4AEEA 2B4CC 2MNJB 4JVWA 3VXSB 2ICES 1LWJA 3QEUB 4JKWA 2XQBH 3HNTL 3U25A 1Z9NA 3GNML 5LAXA 1KV3A 2FEJA 1KXQE 4ZMAT 2IPKA 5I8OH 5F8RC 1ZK5A 3H7BB 1A7NL 5D4IA 2OTWA 2EIKB 5GZOC 2IF7A 1MN4A 2A83B 1OAYH 4Y2OB 3QO0B 2VDOL 1G9MH 3F7VB 4GSRA 1MHCB 3O4LD 3QJUB 1BQLH 2YXMA 4QRPD 1GC1C 3PDOA 3OB0H 1NEZA 1WA1X 4PR5B 1NANI 1XH3B 1TMQA 4NQVB 4QO1B 4LPCA 2A74B 4HVBA 2GJRA 2P4AB 5KS9E 2VR3A 1KPVA 1ORSB 4QRRE 3W57A 2OXGB 3HC0A 1NICA 1KYUA 1OGTA 2AK4B 5TQ2L 5JA8B 4YHNB 2YKKA 2A6DB 3QG7L 4PWGA 3OKDB 1PNDA 4X6BA 1A3RL 1ZV5A 1FJ1A 3TT3H 3GSRA 2W8CA 2WK2A 4ABQA 1XCTB 2IVFC 5FLUA 4ELMA 2HJLA 3UCQA 3ZL4H 5T1LB 1WA0X 4Z0XA 1CDBA 4GAGH 1NPUA 5EUKA 4HG4K 4AE0A 1ODUA 4NQSB 1YN6B 4AQAA 2ARJA 3U7AA 4LNRB 2HTKC 4JDEA 4K94C 3CFQA 2PPAA 2Z93A 5LGKA 3J2PA 4Y19A 5E8PB 1PZDA 4KJWC 4JPQA 1LK3H 3DV4B 1LD9A 5EZIL 4KI5E 1MZYA 4J4PA 2ID5A 3F58L 4YK4C 3RI5K 3WYRA 3HE6B 5DVMA 3UTSA 2O6CA 4F1ZA 2JLPA 3MZGB 3CGTA 5JYLA 6FABL 4OKDA 4GNKB 4NZRL 4ELME 4FTVD 1MCOL 1GGCL 4I3SL 1TF4A 3KWVA 2QLVB 3UROR 4MD0A 1PD1A 6TAAA 4KZEL 4R97B 3T6XA 2ATPB 3SEPA 1LGVA 2V3FA 1I8MA 5AVVB 2EE2A 1NINA 5B4MC 1FO0B 4UQ3A 1BECA 1R5VB 4RESB 2YPKB 2JKIS 5A1AA 2H1PH 1L0QA 5J11C 4UM9A 4CSSA 2DQFA 2AV1A 3BZDA 3VFSA 2OMTA 1RUAL 3TFKD 1L9SA 4JZJA 3V6BR 4IGBA 4PTUB 2VUKA 3RGVD 1EBPA 3WEOA 3D25A 2QGBA 4CN1A 3LNGA 1D6VL 2JTDA 4OCRL 3MTXA 4FQ2L 5E00A 1I8AA 2VW7A 3B34A 3GMPB 4QOKE 4S11A 2XI9A 3P0GB 5EEZA 5LB1A 1OTSC 4P49A 1G6RL 2OS7A 4MXVE 5BV7C 3U9PH 3N85H 1DVQA 1OT1A 2E9IA 2IH3B 1JRHH 1BM7A 4JQXA 4XVUD 3SCMD 3GMQA 4AV5A 2PPEA 4AH2A 1Y1UA 1FG2A 2AANA 1HQRB 3EF4A 2FIKA 4PW3A 3EXLA 3L9RB 2HZHA 3X1FA 1X7TA 4F33B 4N2NA 2EDNA 2V5SA 1M9SA 5C0AD 1RZJC 2G9HB 3HNVL 5DHDA 4UT6A 4BZ2L 1TVBA 4E9XA 1F86A 3HE7A 3QWNA 1F3JA 4BA8A 3FT0A 3DXAA 3KS0H 4GS7C 1UFGA 4DKEL 3RDJA 2X4UB 4NO5B 5KS9F 2D0FA 1J5HA 3BH4A 1UM5H 3UL4A 4X6DB 4EDXB 1FNEA 3U2SA 2B08A 3L1GA 3WL9A 4YSRA 3QJFB 4X4KA 2I7OA 4RDQF 2OSLB 4GB9A 3WFHB 3U82B 1EDYA 3RRQA 1BGXL 3A6CL 5DEJA 1GSKA 1UH2A 3DBXB 2VN7A 2YEZB 2YGQA 3PGFH 4OGAD 2UUDH 3TA3C 3VQLA 1SXBA 3AUWB 4YZWA 3IGUA 3KEHA 3BW9A 5BRPA 3ZE2E 4PJIB 1KTLA 1KEML 3SKOB 2BHYA 2SODB 3JWNG 3DXAE 3N9GH 3R4RA 1HIML 3AGWA 1FYTA 3P2BA 2W94A 4HWUA 4NC1C 3VXRA 2FYYB 4HIHB 2UV3A 2ZD0A 4Y5YC 4UQCA 2WCSA 4BFBD 3A21A 5A2FA 2BHZA 1OP5K 1ZVSA 4AJWA 2Q7AA 2XWBB 4Z76A 1FFTB 1IE4A 1IO4C 1EVTC 3KXFD 3P4OA 4MWFB 3S96A 4KROB 4U1KA 2YD8A 4FJZA 4BYHA 1HQ4B 5CN2A 1K3IA 1JPSL 4TLSA 4ELMF 4N87A 3ULVC 1VESA 3L7EA 5M94B 2C34A 2OJ1A 2ZWLT 1C8QA 2A9NH 4KMQA 1BZ7B 3FYIB 2FO8A 1DJSA 4YPJA 3OKOB 4ZD3H 1IBZA 1FYTE 2MOGA 4O02L 4Y0GA 4HGKC 3S5ZA 4YDVA 2VL4A 3VXRE 3K4ZA 2KS0A 4EI6B 3KYNA 4XX1E 2PPDA 2WWOA 5HVHC 1SF3A 4XN2A 5DUBB 4EVNA 3H42H 4XXCC 2BP0A 3QH3A 4EXKA 3AXLB 1TVDA 3G9VA 1J5DA 2OW7A 4JG0H 2CO6A 1IC5H 4WUUA 4CBPA 4XMUA 1DVFC 1OOWA 3EH5B 3NJVA 4JM2B 4DQOL 5E24E 1P4LA 2NNCA 2OSWA 5IMMB 3EOTH 4V33A 5DU7A 4P59L 4GP5B 5I1IH 1YNTA 4WEEA 2GW5A 4FD0A 4ZS7L 4W68A 2OPCA 1VKXB 3HPJB 3L3OB 5EO0A 3UTPE 3V0GA 1FVCB 1JMZA 4Z7WA 5I0VA 4ONGH 3KPQA 1ZHNB 2ZE0A 1BQUA 5H37H 2F1EA 3WFDH 4PWKA 2IDTA 2OBGA 3EG9B 4OM1H 2CAKA 3FQRA 1OIOA 3H1ZA 4ZPTB 5JORA 1JJUA 3WTUA 1JUFA 1GW0A 1HHIB 3KYAA 4MJJA 2FO1A 2G3XA 3JV6A 1L6ZA 1HNYA 2JMRA 4AMKH 2FJGA 1LK2A 2OSYA 5DQDL 1AQDB 2EXWC 2EAEA 3HPLB 4W81A 2VM9A 1RJLB 3K8LA 3RLSA 5SX5K 2AXWA 4OIFA 1OE2A 1P84J 4PM1A 1T1YA 5D72L 5TE7H 3UCRA 1YY8B 3UH8A 2NW2B 3MRCB 1WQVT 2Q0ZX 5ISZE 1AO7A 4DT2A 3RPBA 3OKKB 1PNCA 2Y7QA 3ZX1A 4YSUA 2CDFB 1CURA 4YHPA 3ZE1E 2NTFA 5HJ3B 2PTTB 1V3JA 4FZ8H 1KB9K 1NBQA 3ILQC 5BO1H 3W39B 2UZIL 4BGLA 1YMHA 1PIFA 5INDB 1E6OH 2WQRA 5I0WA 3KH3A 3U46A 3IJYA 4MQTB 1NJ9A 1CU4H 4YAQA 4OFVA 2DWXA 2FVNA 3BZFB 5T1KA 3C2AH 1OW0C 1YUHB 2AFNA 1PZSA 2GY7B 3VSTA 1BFVH 1KJ2L 2A38A 1MPAH 3VDAA 1DQLH 2ZKMX 1PBYA 1YHPA 2CRMA 3B5GA 1WBZA 4X7SL 5E9DA 4AJ0A 1REIA 2J6WA 3AC0A 3IK2A 4NUQA 5EOQL 1OLZA 4IKJA 4BFNA 4FXKB 5D5ME 3O11A 4UOW1 3VRLF 5EDSA 3VQ2C 1B2WH 6PAZA 4JFUA 4QOKB 5BUGA 3QUYC 1BQHA 3NSDA 5BOZG 4IBSA 4KHXH 2QHRL 1FNSL 4G6KL 2BXZA 3PWUA 3A6BH 4G7SB 3GPSA 5K39A 4GI9A 2OMWB 3KPSA 4HCRA 3T3MF 3TBVB 1EH9A 2IEPA 5E4EB 3OLEA 1X5KA 2BZDA 5HYQB 4L3FA 4UI2A 3QXVA 2P9RA 3UGUA 3LRSA 3PWLB 3ARBA 2HFTA 1NC4D 3VGGA 5ADPL 3C5ZA 2GYSA 1A1MA 5F3HB 2YKLH 1FZJB 3K72B 1N3NB 1JAEA 1FRGL 4UMGA 4OZFB 3PIQB 2Q5BA 4BCZA 4ISVA 2G0LA 4TVPL 4KK6D 6PCYA 1PDKA 3PRZA 1A5FH 4ICXA 4YUEH 2Q87A 4ADJA 2VQ1B 2E9GA 3W0WE 3JWNC 1YEDB 5J12C 2I27N 1HILB 1ZAGA 3FT4A 4Y16C 5DSCA 1NUGA 3NN8A 4JHWL 2RJMA 3O3EB 5EULV 1R0AH 4HC1H 3KZ8A 1MNNA 3E1F1 3VD4A 2F7QA 2Q3AA 4K3HA 3O9WC 4LLVB 4OKVB 2R0WL 25C8H 3L4YA 4PG9A 4R96A 2XG5A 5EU4A 4JKNA 3LEXA 1RSFA 4K5NA 1R34A 5DZ9A 3UZEC 4AGMA 4KUCF 4U1HB 5D7JB 5F9OL 3BGFC 3FAXA 2O5YH 1FL3B 1PZBA 1YNTF 2HFGL 4QHNB 3FMGH 3IDJB 4NKMA 2XWDA 4ZW5A 3PHAA 2QFRA 3DVIA 1ILUA 2X2HA 4H5SA 2RBLA 4QPEA 3GLDA 4AENA 5MERB 4HD9A 3TLRA 1WG3A 1J1PH 3T77B 4CILA 1MI5A 3DX8A 4Z7WF 5TTRA 1PKQA 4Z3FA 4OT1H 5AVUB 4FFTA 3UGEA 1N6QH 1XBDA 4PB9H 5LAPA 4IRSD 2FUQA 1INEL 2Z31C 5E1HB 4A2FA 2HKHH 4YSTA 4XMPH 5GGQL 3U4AA 4BM7A 5EN3A 4LEEA 2VXQA 4U1SB 3BFWA 2KKQA 3FT3B 1DO6A 3LQZA 3WNPA 2DYSB 1KF9B 4KNSA 4G7QB 3RVXC 4M62H 3MV11 2C4FT 2A7BA 2O61B 1IGFL 1TLKA 1IGTA 3QNZA 1AKJB 1R3KB 3QPQC 5I1EH 2EUVA 1JGDA 4WI6A 2BDNL 1I9RL 2CU9A 5I74C 1IAIL 1AY1L 3B2PA 1Q9LB 2W95A 3N0PB 1JGEB 4EZKA 5TDPA 2Z4QA 5GGVL 3PV6A 3DJRA 1N7MH 2ILLA 3CXFA 3IDGA 4PSPA 4V1DA 4WY7H 4DGIL 3SZ6A 2VUOA 3D0LA 3FF7A 1KMGA 3AB0B 1D9KC 5HY9A 3TONA 3GXUB 3VGBA 4FNPA 3LH8A 3MI6A 2DM7A 2EIZB 5IMKB 1U92A 3ULUH 3UDWC 3UTTD 3KYMB 5HGDB 5I75B 5IHLB 2JQZA 1X9LA 1AG6A 4XZUB 5DJYB 1PJWA 4ZTOL 2GJ6B 3EBAA 1E9PA 4FN0A 3GRBA 4TRPH 5ETUB 4XMXA 4K23L 3SGJA 3PP4L 4Z95H 3SGKC 5ID0B 5GGTA 2Y1VA 3TO4B 4LGRB 4NWTH 4OLVL 4TVPD 1IGYB 2OXHB 4OLWL 1PX8A 1VFUA 2VAAA 3NFNB 1GCFA 1O6TA 5A6LA 5EG6C 4JQIL 3SY0A 3MCLH 1BA9A 4V1DE 1D5BA 3QC5X 4LOUC 4J3OG 4YH6A 1A6AA 5ALCL 1IIIA 5B1AB 3V6OC 3KDMB 5J6GB 2R1XA 4MRCA 5DFTA 5CP7B 3CPLA 4JO2H 5F1NA 4YE4L 4CW1A 2OFQA 2H2PC 5FW8A 1PLCA 1DCLA 2GAZB 4WU7B 4K2UL 5F6HI 2NY3B 4ZW8A 4ETQB 3GMNB 3CFNA 4PB0H 4E0RA 5I6OA 7CGTA 2CDGA 2YD0A 1BBDH 3QJVB 4PJ8C 4L2LA 4XCYB 5AVRB 4RLDA 4N2HA 2OR8A 2HCZX 5D7KD 5KANG 2AJYH 3O4LA 3SN6N 5ISZB 1KT2B 1HNFA 4QRPA 3IRCA 4LE8A 1NMBL 4L4VE 1MFMA 1OB1B 3ZE1B 2ADIA 2E46A 5JHLH 3WJMA 1LE9B 1MF2H 3NPZB 4HLZG 5L7XH 3V9EA 3KMDA 2O1AA 1EO5A 3QW9A 5EBMA 2WBJC 4DO6A 4BEIA 3FN9A 4FADA 2IH8A 5IB4A 3RGHA 2A6IB 4XP6H 2L0DA 4U1LA 1FDLL 5GGSB 4G1MB 2FWOB 1AZNA 2WXIA 5BRZB 2X12A 4RAVB 3MYZA 5KVGH 4I0PC 4YIQA 1MVUA 5SWSB 4CADB 2R29L 4ZRGA 2KBGA 3O4LE 5KN5A 4QRPE 1URZA 3PJLA 5EIVA 1A66A 2Y72A 1TSHA 3REVA 2UXTA 1JZHA 3DLQR 5FB8B 1YC8A 1F13A 1IRAY 2EE3A 2VZOA 3I6SA 2CJUH 4JPVH 4BH7B 3N55A 2MEJB 5LCVH 3QFJA 2XICA 4YVUA 2F5BL 3A5VA 4N2CA 4FNSA 5IREA 3GMRA 3BWAB 1EX0A 4MXQD 3JQOB 4MAYA 4ZQKA 3ZZ1A 1YEEH 4FNLH 4ZUWB 4EKJA 5JLZB 5C7XH 1IT9L 2PXYD 3EDJA 3LS5L 1PZ2A 4KY1L 4PQXA 4XPFH 5D1ZB 2BHUA 4D0DA 2VN4A 4A38A 1JPTL 1LE5B 3LN4A 1KXVC 2DRUA 3VXQB 3VJ6A 4BSWA 4ORGA 5AW4B 2R8SH 3DV6A 4FDWA 2Y0SA 1GJIA 5HHPB 2FQFA 3I6KA 1ZJBA 2B1OA 1K6QH 2C9VA 2Z9TA 3FO2A 4WW2A 1D5ZA 4WV1B 1HC1A 1DVSA 2Y5QA 3PJSB 4LK4A 3ZZQA 5L8LB 1ZGLB 1J05B 3LZLA 4OCWH 5ACZA 3UYOD 1PPIA 1Y6KR 1AD9A 1ICTA 3C6LC 3L9YA 2Q7YA 4LEXL 1F1DA 3U6RB 3QIUC 3L2MA 3RGVA 2UVFA 5DWPA 1LNUA 2YMXL 4FTVE 2JK5B 3SD5A 5AAPA 3U0TA 3BN9C 1J0YA 1JF6A 4FQXB 2NUTA 2BSBA 3BPNC 3L4UA 5D2LB 3SDDD 3MXVL 1EFXD 3VB9A 3QT2A 2WCPA 3V0EA 4OZHE 4H25B 2DLFL 1M9WA 3EYQD 4IRJD 4XOCA 4AKQA 2X6CA 1GMEA 2XVGA 3CU7A 3ZTJG 1E7UA 1TTUA 5CEZL 4PRDB 3EGSB 2HN7A 3CZGA 4LSRH 5FO8A 3QYNA 4MMYB 3M45A 1BYOA 4XAWL 2NNFA 3DI3B 3B3BA 4FX5A 4N2KA 4NUGL 3SJVA 5CJ5A 1Q72H 1JXGA 4KKNA 3B7UX 3S36H 3MLRH 1T21B 5J1SC 3K0YA 3WTYA 3CFUA 3WS6C 3X3GL 1HZKA 3H2QA 4XCCL 5BQ7A 1E5AA 5CJQH 2DQCL 1HOCB 3IN0A 3LOWA 4WI0B 3B9KC 5B39G 4I7ZC 3RWGA 3BEWA 4YSEA 2B4CH 1AZBA 2EO7A 1XX9C 3DROB 3F8UB 3QCUL 1Q1JH 4JB9H 1D5MB 2EVGA 1CG9A 4KDWA 1FC1A 2FNBA 2F15A 3F3HA 3E9UA 1DCEA 1TQCB 5DD1L 3KWUA 1YLBB 1VGKA 3GSVA 3IMVA 5HYIA 1HZLA 1TQSA 4YR6B 5DZPA 3S5LB 4TPRL 1W0WB 5C0AE 1ZCRA 1GC1H 4RFEA 4W6XB 1UZ6F 1R3IL 2GI7A 3L1OH 3FCUB 1D2PA 3CBJB 1RQ5A 4JKPH 3RX8A 2IWFA 1TSRA 1TJGH 3W56A 2ZOWA 4DW2H 1X9QA 4D9QD 3GHPA 5EIIA 4HAKA 3WIHA 4AVHA 5EF2A 4HWBH 4NZUH 3C5SA 5F1KC 3UZQB 1MFNA 3D52A 1XH0A 4G6FD 3GRWH 4B7LA 2DF3A 2GSGA 1LMKA 2YGNA 4ACTA 1C08A 1E28A 4ZTPL 4J7RA 2BMKB 3WY3A 4UT9H 4LASL 1C1EH 1OARH 3QR1A 2BNQD 3BUQA 4XVSL 4KKAD 2GSMB 3BWUC 2PW2A 4OI8A 5C86A 5HVWA 4LEOA 4ODSL 2D03L 3EH4B 2APFA 3WD5L 1U3HA 4HUNB 1GOGA 2JJTC 3VWKB 3DETD 4PS4L 5FA3B 3LH9A 3GBNH 3QORA 1AZCA 3DX3A 2K7PA 4QHPA 2CO1A 3OD3A 2QLYA 4KAQH 3OB0K 2JLLA 4JCMA 4M1DH 3VFRA 1CFSB 4B9JA 3VFUB 43C9A 3KXFE 2HLAB 3QDGA 2DN7A 4F8QA 5CEXB 3GHEH 1UKTA 1H6EA 2Y2WA 4MZ2A 4X0KB 2BSRA 4PREA 2ZAGA 4XB3A 2L7JA 3F12B 4FGMA 5C0CA 5CEZD 4GT7A 1ET7A 3AXHA 1GGTA 4M6NH 3EXJA 1A7PL 4A6YL 1R5WB 4APQD 3CDYA 1ZS8B 4DJMA 2WD0A 4Z8FH 4R4BA 2HRPH 4FABL 5AB2A 4OJFL 4YXHH 1MREH 1PJ9A 1A1NB 5I1DA 2P8MB 3CZFA 3DUUB 4JMNA 4WW2F 3U9UA 4BZ2A 1QR1B 2I9TA 1YEJH 5EA0H 3D51A 1GY2A 5F7LB 3EF7A 4XNBA 5BZDA 2VXUH 4X99B 2I25N 1J0KA 4NSKA 5CCGE 1A6WH 4OZGB 4RGOL 5E70A 3IE4A 5IT2L 1KTDB 4JL2A 4L8SB 1TZIA 1ADQL 3QUZC 1EUTA 4AC2A 1RERA 4KRPC 1VPOH 3FU7A 3QRGL 5I30H 2B16A 3BZ4B 4N26A 1E9OB 3CXDL 4WGWB 1T5XA 3CE1A 3FUNA 4L1HA 1HVXA 3GJEB 4TUJA 1RZKC 2O6DA 1KELH 3SD2A 2V2XB 3PYCA 1MRCH 2ZP9A 1GHFH 5BV7H 2K6ZA 2SEBA 2WOBA 3AADB 3GTVA 4HHAB 3OWRA 4GAFB 4B97A 1A4BA 4FKKA 4EI5D 4EIUA 3CFKA 4H44C 1QRND 1IC7L 3LVTA 3UAAA 2YFNA 5I71C 4PY7A 2P8LB 5SWZA 3WDHA 5IMOA 3RURA 1CE6B 4KDTC 1MEXL 5L8JB 2X41A 2B1HH 1U2CA 2BZ7A 2GFBB 4FLOA 4CVXA 5B3NA 4Y4KA 1KCSL 4WWKC 2FGZA 2EIMB 3NRPA 2BY3A 5ECGA 2OL3L 4JO4L 1E27A 4JUTA 4DPCX 1NBZB 3RWEA 1M2VB 2A0LD 3DGDA 1I8KA 3VXUB 3FB8A 1SUHA 1AS8A 5IB2B 4Z7NE 2F8XC 5DRXA 3GIZH 1ZVYA 3F7YA 3KLAB 3MCKB 4AT6A 2AJ3B 2R4SL 2WMPB 1AP2A 1NGQL 2ZKHL 3HS0C 4I18A 2VABA 1KGUA 1SEBB 3C6SA 1AQKL 1XZ0B 4XODA 3DTXB 2ZJSL 4J6RL 4O02A 5HYJB 4LCIL 1NDMA 1RJYA 1YJDC 4PVMA 1Z1WA 1CR9H 1TZAA 3GZPA 3FFDB 4MRBA 2H2SD 1AHWB 3NQIA 4FTVB 4DKTA 1I8LA 4TXVB 5BJTB 3S8WA 1S9YB 4ZAKA 4EN3D 1LHZA 1PU0A 4DK6A 1DQJA 2ITCB 3WTTA 3L4VA 2BFVL 3QHFH 4GI8A 4R5XA 5H4YA 3U4KA 1F58H 2EVJA 4UWQB 4TYUA 3AU0A 1QRKA 2WPGA 2NY1C 3U7WL 1DANT 1U6AH 2NYKA 2D7OA 3BH9B 12E8L 4U0QB 5L88H 4L9LC 1BZQK 4PGDB 5GS1B 4NZFA 3GEWB 3FTVA 3J8F7 1S9WB 2FL5A 3ULVH 2IQAA 4PJ7A 1LO4L 1NC4A 3UMTA 3IGAB 3EAKA 3FHEA 4U3SB 4FG4A 3MROA 3KJ4C 2X4PA 2AXFA 2VDPB 2DDQL 2JNZA 3SPJA 2UUDK 2WUBH 4R3SA 3DIDA 3TNMA 1HI6B 3VW3L 5AW3B 1ZT1B 1PIGA 5IQ9A 4D0CA 5JDSB 1G1YA 1UD5A 1SOKA 3D48R 1XB6A 4HIJA 4KRLB 4NHUB 4XMLH 5HDOA 1DQQA 1XWVA 3HJ0A 4NCDA 5GJTH 1E90A 4IU2B 1JHTB 4LL1A 1N6VA 2HPOA 4OGXL 2N01B 1CBVH 1BYNA 4PJFA 5L2KA 2V9UA 2BSED 4OSUL 3GIVB 1AGEB 3V9FA 4DN3L 1MCKA 4XB7A 3IRZA 4PJ7E 4U1MA 1W0YT 3EJZC 3MRDA 2WLIB 1FAIH 3V4VH 5K9JH 1TPXB 1YYLH 1NZRA 5F88B 5C0AB 4B0MB 1ZHLA 4X6CA 2FRGP 4R7XA 3IJSA 4KBPA 2GITA 3GHBL 1A6UL 1RZIB 4PGZA 1E6JH 2LABA 2YHGA 3QEHB 1JZ6A 5EF1A 2B5IB 4U7SA 2QKIB 4H20H 3P4NA 2DJMA 5I66B 1FLTX 4Q6YA 4MZ3A 3RVWC 1ZXQA 3I2CL 3WEMA 4CMMB 1EXUB 4WTZA 1D2OA 5FF6B 5TDOA 1M71B 4HT1H 1IARB 4U1IB 3MRGA 3T9WA 1HCVA 3BKML 4LSDA 1C8PA 3R06A 2VZSA 3N42F 2CO2A 3HNSL 2RCSL 4KX7A 3U4BH 2AW2A 1N6UA 3LKOA 4FEIA 3L7FA 3UAFA 4Z7NF 1KJ2A 2Q76A 1FF5A 5K9OA 3H85A 1EHLL 1AIZA 3F7PC 1FHGA 2OTUA 2XJLA 3VYOA 1MG2C 4J2QA 1II4E 1F4YL 3O8XD 5I24A 1E2VA 4JY6A 4BSVA 1BV8A 1TYEB 2XIBA 4JGUA 4P3CL 4AQZA 3SPCA 4F7CB 5HGAA 4NPYB 4YE0A 3BDYH 4YC2C 4GG6E 4YHYC 3FU8A 4N8VB 2VXSL 2CIKA 1IVLA 1JZFA 3A23A 5ANME 4F7KA 3ZO9A 2A6KB 4ZUVA 3LZFH 5D6CB 1OALA 1TXKA 2VJ0A 1UWGL 1SYVA 3ZKQD 5KAQG 3AWFA 4JO3H 4MMZA 3DGCR 3KPNA 3TBSA 3VXNB 3PNWA 1CB4A 4Q6IB 5C9JA 3O6ML 3C60A 1KPUA 3HBGA 1P6AB 4M5ZL 2B0SH 2CUAA 5CS7A 7PAZA 4P5TC 2PYFA 3OBAA 5TK2A 5C0EA 3R1GH 4ODWB 2NY2D 1BM3H 5FHAL 4NNPH 3HAEG 4HF5H 4LL9A 2OZNA 3OAZH 1S7VA 3UTTE 2VN5A 2VTFA 3ECQA 5C3TA 4MGXA 1T83C 4I3RH 2OCFD 3DBSA 3TH3T 1N8OE 3TJHD 2Y07H 5JHMA 2F8VA 1CLOL 3N43F 2PWHA 4XBEL 4JHUA 2Y3AA 3LDBC 4TVPE 5FS5A 3DA0A 3EJUA 4P5MB 5L4IA 3FSZA 3T0AA 5A6MA 4NBZB 2F53D 4PJ7F 4PJCE 3AQXA 5JHDD 1T7WA 2BP8A 2VMJA 4JPWL 3WLBB 4D9LL 3SYQA 1QYGH 4F8PA 3Q3GB 4JPIA 1A6ZB 4MKTA 1G6VK 3D39B 1EQWA 5K59F 1DVZA 4LARH 3DURB 5I1JH 3ZE0F 4XPHH 1AKPA 1KCUH 4PW9A 2XY2A 1AD0B 2EZ0D 1RHHA 1G7MB 1QSFA 2YPLD 4AK1A 2ZUVA 4W9LC 4Q14A 2FBRA 4R8WH 4PJFF 3QDJB 3EHBB 2NYYD 4DOHE 5D7KE 1X7SA 1XF5A 3UBFA 3OAUL 4HEMA 1MQ8A 3BISA 3K74B 3F65A 5ITBL 5EZOH 3KNBA 2ZYIA 3G5VB 1U91B 4OCYL 5F7AA 3WN5C 2PP8A 4X6CF 1NDGA 3FB6B 1JPGB 3TN0D 5EZJA 3T6ZA 3TZVA 3DHPA 3VYPA 5JTWA 2L7EA 1SEQH 5F7NC 5TH2A 4GRLB 1Q9KA 5I1LA 2IFFH 2YFOA 3X1EA 1QW8A 5KTEL 3T4AC 3V5HB 2BVQB 3GJFB 1LXMA 4HK3N 2JFCA 2EO1A 2PXYA 4PVLA 3VFMB 5I76B 4MCYA 1QHQA 4QY8B 2QADC 4WTXA 4P5SA 2K8QA 4PCTA 2Y9RT 7FABL 1NKGA 1BREA 1DTUA 1KGCD 5DR5H 4AYEC 3MRLA 4PV8A 2AQ2A 4UTBL 5H37A 1Z7JA 2FJHB 4IOIB 4XNZC 1HH6A 4FYRA 2AJSL 4MDJB 3ZKSD 2VCOA 2CCVA 4JFZL 3FTXA 2C3GA 5DEGA 2EDOA 2X1WL 2R56H 1GGYA 4PJ6A 4RRPA 3MRPB 1SXZA 3VFWA 1OXYA 1VJSA 4MCZB 4Z3TA 4P2OC 2YEVB 2D2CC 3AT9A 4IIZA 5HYEA 4WTQA 3HI1A 5D7LD 1A1OA 4FG6D 4ES9A 5I8CA 4NZDA 4Q9BA 3NJKA 3DDGA 4DETA 2W07B 3DSNA 3M17A 4S1QL 5I2IB 3SDDA 5KSBE 3KPOB 4OFYD 4YHOH 1DVXA 2IG2H 3BPLB 1FNGA 4MZIA 1V10A 3FU3A 3P9MB 4HIEB 5CIPH 2IOMA 4FFYH 1Y07A 1MFEH 2AABH 4XO9A 1PFCA 3I6GB 5DJ2B 3QIBA 3TYGH 4KK9C 2DWSA 4BQCA 2Z91B 3DVNB 3QUML 1A3ZA 1RIUH 3WIIH 3WFBH 1R1CA 2P44B 4LCWB 4Y5XA 4HALA 3P3YA 1NIBA 2F54D 2R2EB 1LP9B 5FW6A 1GIGH 3AACA 3WG7B 1MXGA 3NFSL 4HBCL 3WIFB 5I1GL 4MTMA 3W38A 4TV3A 1CXLA 3BQUB 4NHCL 2UZPA 1Z9OA 4Z9KB 1RK7A 4FQ1L 4S1DC 3UBXA 5EEUA 1PX3A 1WBYB 3STZB 3IETB 3WFEH 1A8JH 2G4GA 3CSGA 5AZ2H 1ZGLM 3DOHA 2R29A 4E9VA 2YD9A 4R2GD 2Z8SA 5AZEH 2R0KH 3HZMB 4URTB 2B14A 5D1XC 4A63A 1HHJB 1ROWA 2BSTB 2GSIB 4APXB 4UBDD 3SPHA 4HJIA 5AVQB 3MNVB 5FM5M 4X80L 1Z5LB 5JYMA 4PV9B 4Q89A 5E2WH 3NDZE 3VGHA 1DJWA 4UILH 4XWGL 3OHXC 3IPFA 3BX7C 5MP6H 5JPMB 3UYRL 2VXTH 3IDUA 3GEFA 3TV3H 5TE4H 1YEWA 5G2NA 3NIFB 2CO4A 1QOKA 3ESVF 2IDFA 1T3FB 2PPCA 4UTAL 5DMYA 4BKTC 4GG6B 1TDQA 4RQQA 2AK1L 4S2SA 4WFHD 3MRJA 3CD4A 4GLRI 5F6IC 4BZ1L 1FFQA 3MACH 1WCQA 1H3PL 3QQNA 3VE0B 4Z1PA 4F9PA 3EZ8A 3VXTB 2ZSVB 4KOCA 1MY7A 5K93A 5AW1B 1L4IA 1S7XA 1U93B 5FDYA 4Y8AA 3RVUC 3KPRA 5F7HA 2E9WA 3JWOC 3L4XA 2MSPA 4G2AA 4LCVA 4D3CH 2VLKD 4J23A 1DEEA 4LKXB 2VC2H 1P1ZA 4K3EL 1WITA 5I15H 1QA9A 3HCVA 3DUSA 4N90D 4QHUA 4XX5A 2E9JA 3RWDB 1UVQA 2Z35B 1UJ3C 2VLJA 3BKCH 2CHWA 4D9QE 1W8EA 3B9VA 3GZQA 2YJLA 1TVHA 5J6HA 1H5BC 2CRYA 2NQDA 5CU5A 2BOCA 1NGYA 5TFSL 4LBAA 2MQCA 4RGMB 4L4TD 2HLFD 1I82A 1A7BA 3N3EA 1B6DA 4PH8A 4YLBA 5CCHE 4QWWC 2BIPA 3GXIA 3CHXA 5MEQA 2BNQE 2YAHA 4W6WB 4EQ2A 1XBRA 4JPSA 3B2UD 3O6LH 3UZVA 1I1YA 2X1PA 4APQA 4ZZFA 2WTPA 1AR2A 5E6IC 3L9BA 4NO0A 4R4FL 1OCZB 5ERWA 3D2UB 1S7QB 1NCCL 3VI3A 4PJCB 1T20A 4BFGA 2E5EA 3SKJH 1VF5C 1K4DA 1PG7W 1CDIA 3CFTA 1B0WA 3MBEB 4K9EC 1MHEA 1TJHL 4MYPA 4MNQD 2JKXA 3RX9A 2ZXEB 3X13B 5HI4D 1IKNC 4KV5E 4O51A 4B5ZA 1J8HD 1MCDA 1MQKH 4LCCB 1IC4H 4U6VL 2NY4D 1EGJH 4OV5A 5CEZE 4TSCL 3GXTA 4PEEA 4JFQA 3WTXA 3LMJL 3DO7A 4LMQI 3US0A 5E2TH 35C8H 2IIJA 2IBGA 2Q8AH 3HI5L 1XIWC 3WMSA 2WQVA 1P6FA 4DOHB 4U1GC 1F4XL 3IDMB 1MG3C 3VI3E 2DIAA 3WXWH 2NSMA 2CPCA 3ZYOA 5IFHH 2A9DA 2O30A 1JZ2A 2X2YA 1DLHA 2IBBA 2WYHA 4MVBC 5E8EB 5ABAA 4NQDB 4WAFA 2KZ1B 4HXAH 3SE8L 4YLCA 2FIRT 1QRNA 1WBXA 5I17A 1W0VB 2OMZA 5LDUA 4JAMA 3TO2A 1JF1A 4OB5L 4Z7UE 1O6SA 2PCPB 4KNQA 3B2VL 4UV7L 2W65B 4ZOCA 4HG4J 2OYKA 1Y7VA 4JQVC 1ESOA 2H0EA 3L08A 3SDCA 1VGEL 2MFNA 5DFAA