1JXGA

The 1.6 a resolution crystal structure of a mutant poplar plastocyanin bearing a 21-25 engeneered disulfide bridge
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
100
structure length
100
Chain Sequence
MIDVLLGADDGSLAFVPSEFSCSPGCKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN A
publication title The 1.6 A resolution crystal structure of a mutant plastocyanin bearing a 21-25 engineered disulfide bridge.
pubmed doi rcsb
source organism Populus nigra
molecule tags Photosynthesis
total genus 27
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1jxgA00
4KO9A 2XV2A 1UATA 1PF3A 4EF3A 3CZUB 4AKOA 5I6MA 1OE2A 2I7OA 3ABLB 3FQ1A 2PLTA 2LLNA 4DP1X 2RACA 4KOBA 4DP4X 2AFNA 5AFAA 3OMNB 2HX8A 1QHQA 2YAPA 1BQKA 3FSAA 4JHVA 2ZXWB 4YSCA 4BWTA 3OM3B 4YSDA 2XYBA 1DYZA 1ZIBA 1M56B 3EHBB 1AAJA 1ILUA 4GY4A 2J5WA 1BAWA 2E86A 3X2QB 5I6OA 3TA4D 4A2HA 2WO3B 1NIBA 4E9QA 2XV0A 3QJVB 3UACA 2FQFA 2QPDB 2YARA 3WNIA 3NSDA 3IE9A 1JZIA 1TEFA 2UXTA 4PAZA 1IBZA 3FPYA 4AKQA 1AS8A 1BYOA 2UXFA 3ZIYA 5B7MA 3FYEB 3AW5A 3AG1B 3FQ2A 1ET5A 6PCYA 1JZHA 5ANHA 3EH5B 1URIA 2HX7A 2HRHA 1KBWA 3KW7A 1NDTA 3FPXA 7PAZA 1KBVA 1MZZA 2GSMB 3QJUB 3CVCA 4GYBA 1XMEB 2BP8B 3T6WA 3FU7B 4UAHA 2XU9A 4JKNA 3JTBA 3S8FB 2GC4C 1ILSA 3MBWB 5IY5B 4HHGA 1AZBA 2TSAA 1MG2C 3EH4B 4DP9X 3ASNB 4YSEA 1GS6X 1TKWA 1ZDSA 1ZV2A 2P80A 4FA7B 1ET7A 4KO5A 2OCCB 2OV0A 3T6XA 1TEGA 2AVFA 5I6LA 4HCIA 2IDQA 2PP9A 3QJSB 4P5RA 3FU9A 4W1TA 4YVUA 3C75A 1CURA 1WS7A 2IWEA 1NPNA 1L9OA 1PLAA 2GIMA 1KGYE 1IKOP 2J56A 4YSOA 3ZBMA 2CALA 4WKXA 4X4KA 2BW4A 1W6LA 5B1BB 4BWUA 1RCYA 2VMJA 1JZEA 2TSBA 3H4HA 3PLYA 2XXFA 5D4HA 1PNCA 1V10A 4YSTA 2YXVA 8PAZA 1SF5A 3CVBA 4DPCX 1WA1X 2WO2B 5B3SB 2Y69B 2I85A 1GS7A 3SBQA 1CUOA 1MZYA 4NERA 1BEXA 2XX0A 3X1GA 1NWOA 2BW5A 1VLXA 1QNIA 4BK5C 2UXGA 4KNSA 2FJSA 1GY2A 3JT2A 3NJFA 1MG3C 2H47C 1OCZB 4BDVA 1ZPUA 4E9WA 3PAVA 3QJQB 2XLLA 2EIMB 1JOIA 2A3TA 2HLEB 5I28A 1OE1A 4QKTA 1NICA 2EIKB 5I6PA 3WKQA 1L9PA 2UX7A 1F56A 1AG6A 4W9ZA 2BP0B 1E5YA 2VM3A 2DYRB 2XVBA 1WS8A 3NJMA 3AY2A 2X88A 1ASQA 1OCOB 5TK4A 5I6NA 1JVOA 2CCWA 2FTAA 2PPDA 3FT0A 1ZIAA 1WA2X 1N68A 3NJJA 4M4RB 1PLCA 2Q9OA 3S3DB 3DKHA 2MRYA 3CDZA 1I53A 3N55A 4YSRA 3NT0A 4ZK8A 4A67A 3ABGA 2VW7A 3WIAA 2HX9A 3GXUB 3UADA 3FSVA 1GW0A 5I5IA 4GXFA 1A4AA 3V9CA 1V55B 1JXFA 3UGEA 2HRGA 1JZGA 1ETJA 4DPAX 2JFCA 4KNUA 4BWWA 1J9QA 1XB3A 1PMYA 5I5JA 1IUZA 9PCYA 3N2JA 1EHKB 1ID2A 1PZCA 2FT6A 2VW6A 4YSPA 1SF3A 1A65A 1GY1A 1L9TA 5B7EA 2IWFA 2EIJB 4BDVB 3ZDWA 4CSPA 2H5UA 3WI9A 4NB7A 5D4JA 5B7FA 4M3HA 2AZAA 1CYXA 1R1CA 1DZ0A 1XB8A 3NJHA 3T9WA 5TK2A 5PAZA 1M57B 3FYIB 4YSUA 2FQGA 1J5CA 5I6KA 4YL4A 4Q89A 3NJGA 4TXVB 1PY0A 1HFUA 2BO0A 3GYRA 3NJKA 2UX6A 4N8UA 2J55A 3ABKB 4DP7X 3FQYA 3QJRB 3QQXA 1OF0A 3ZX1A 2DV6A 4HAKA 4HHWA 2WSDA 2DWTA 3MX0B 4G71B 1T5KA 1SDDA 3CDZB 3H4FA 4WTQA 1KCWA 1OCRB 3WG7B 1GR7A 3SBRA 3QPKA 2R7EA 1CC3A 3NSFA 1NZRA 4HIPA 2IDTA 2QDVA 2IDSA 3NSYA 4ENZA 2HXAA 2FT8A 3GDCA 3CVDA 3X1NA 1BQRA 1SHWA 4G7RB 4AX3A 3S3BB 1NIAA 2B3IA 1OE3A 1A4BA 3FSZA 3PPSA 1PNDA 3FU8A 3BVDB 1SFDA 2ZWNA 3CG8A 3T71A 3AG4B 1KCBA 1WAEA 2YXWA 3PCYA 2FT7A 2IWKA 4E9SA 2GC7C 1FWXA 2DWSA 2PP8A 5EHFA 1MDAA 3G5WA 3TU6A 2BZCA 5B1KA 5I26A 2XV3A 2IAAC 5A7EA 1KYAA 2IH8A 2XUWA 1BQ5A 3AG2B 1L9QA 2JKWA 1AZNA 1EZLA 1OCCB 2VSMB 1NWPA 2GB2A 3X1EA 4DPBX 5FC9A 1E30A 2XXGA 3IN0A 2ZONA 3NJIA 3OQRA 2FQDA 2BWDA 1NIDA 2GHZA 7PCYA 1AOZA 2EINB 2VW4A 1J9SA 4GP8B 4DP8X 2B08A 1GS8A 4KO6A 1AS7A 4JHUA 3WNJA 4A68A 1BXAA 2PP7A 5B1JA 2R7EB 1X9UA 2AANA 3DTUB 2YAHA 1IBYA 4KO7A 3QJTB 3U25A 2P80D 4DP2X 1ASOA 4NAJA 5F7BA 4A2GA 1L9SA 2YQBA 5PCYA 2QPEB 1FFTB 3X1BA 2BP8A 4YSSA 1E5ZA 4E9TA 1E67A 1AG0A 2UXVA 2YAQA 1BYPA 2BZ7A 4FAAB 3DIVA 1AR1B 4HALA 3ERXA 4G7SB 1PZBA 2VSKB 3KW8A 1AS6A 1BXUA 1A4CA 1TU2A 4L0PB 3SBPA 4QLWA 1B3IA 2PCYA 3WKPA 2YAOA 1NINA 2J57A 1X9RA 1NIFA 2HZHA 1IC0A 3OD3A 2GBAA 4GP4B 3S8GB 2PPFA 3AZUA 1AACA 1CYWA 1HAUA 4CSZA 2BWIA 3OMAB 2MTAA 2VM4A 2CAKA 1ET8A 1QLEB 4E9VA 4E9RA 3UAAA 4YVNA 3V9EA 2PPEA 1AIZA 3NJLA 2FNWA 3EH3B 3TBCA 2EILB 1AZCA 1OOWA 1AZRA 1W6WA 2N0MA 2XX1A 5I5MA 3EF4A 1WA0X 2VN3A 2PPCA 2YAFA 3L45A 3NP4A 1JZFA 1RKRA 2XWZA 2PCFA 2NRDA 4RH4A 3FSWA 1AANA 3T6ZA 1KDJA 2CBPA 3ASOB 4F7KA 5LDUA 3PAUA 5B1AB 5F7AA 3H56A 4A2EA 2IH9A 2Q5BA 1SFHA 3T6VA 3HB3B 4N4YB 4HCFA 4AZUA 4BXVA 1SHXA 2DYSB 4DP6X 1JXDA 2OJ1A 2DY2A 4F2EA 2GI0A 3UAEA 1ZDQA 3IEAA 3AG3B 1KDIA 3NP3A 4YSAA 4AI7A 1SNRA 1RZQA 3BQVA 3X1FA 2BHFA 1PCSA 1SJMA 3IN2A 1GYCA 2W88A 4E9XA 1L9RA 2AZUA 1J9RA 3UABA 5E9NA 2BP0A 1M9WA 3TASA 3RYMA 1PZAA 1ASPA 1J9TA 3IBOA 1AQ8A 3PXLA 4PCYA 4DP0X 5AKRA 1KV7A 1JZJA 3S3CB 2I7SA 2IDFA 2FWLB 1NPJA 3NYKA 2YAMA 4YSQA 4E9YA 3OMIB 2ZOOA 2H3XC 2FQEA 2Y1AA 6PAZA 4HCGA 2W8CA 4UANA 1OV8A 4K9JA 1FA4A 2QDWA 5D4IA 4A2FA 2YAEA 1N70A 2X87A 1W8EA 4Q8BA 4KNTA 3PAZA 4G7QB 3ABMB 3FS9A 4A2DA 3NSCA 4KOCA 4G72B 1ADWA 3HEIB 1E65A 1V54B 4BXSV 2JXMA 5B1JC 1SDDB 4A66A 3D12B 4P5SA 4GP5B 4HZ1A 1A8ZA 1JVLA 3SQRA 2CUAA 4UF7C 1HAWA 1PAZA 1NTDA 4AKPA 4MFHA 4F2FA 3NJNA 3TBBA 2QT6A 4G70B 2PPAA 2IDUA 1XB6A 1JXGA 1BXVA 4DP5X 1PLBA 1NIEA 1AZUA 1RZPA 5AZUA 3FU7A 1JERA 1A3ZA 1YLBB 2CJ3A 1J5DA 1GSKA
chains in the Genus database with same CATH superfamily
4OCLC 1W15A 2QADB 2DICA 4WY7L 1KB9K 4QTFA 1CF8L 5I6MA 1T1YB 2C3WA 5J7CC 5GRVK 2UVFA 5LWYL 1JI1A 1X7QA 3KGTA 2DMCA 5I73C 1GKOA 1URLA 3MRDA 1AHWB 1F8TL 2YAPA 4DEPB 3LIZL 1XX9C 1LK2B 5I1EH 4KKLC 3MCYA 2CGYA 3P0YH 4I9XA 4L9LA 5E8EB 4YSDA 1SYVB 2BM3A 2NY1C 4MYWB 3TIDA 4JG1L 4NWTH 1BFOB 3DI2B 5F7MC 3CCHA 1B0GA 3AXIA 4EN2A 5I6OA 4QJ3B 3UTOA 4JL1A 4ZSOB 1G6VK 5FOJA 2OL3L 4DN3H 3EJPA 2VDLB 1YUHA 3AT0A 2BDNL 3ZHFA 1W0VA 2PTTA 3GRWH 3NRPA 3BH8A 5I1IL 3ZOAA 3A6OA 1ACCA 4P5TC 4NM8L 1ZOXA 4N2OA 4Z7WF 1UASA 3RTQC 3AG1B 2IFFH 1ET5A 4GRLC 2C9QA 2YZ1A 3NZHH 1JZHA 2F1BA 3DX0A 4OQTH 5BZXA 1PLGL 1QR1B 4R3SB 3EJSA 4MA1C 1P7KB 2HJLB 3IDMB 4GSRA 2VAAA 3FPXA 1CE1H 3S88H 1DLHA 1K6QL 2BNUA 4PJXA 2WVTA 2H3KA 4G59C 2R8SH 4UAHA 2IQ9L 1G7HA 2WLLB 2GC4C 2BXYA 2I69A 4NCC2 4FQ1L 5D7HA 1B6DA 1U8HB 2ITDB 3SO3C 5JHAA 3F64A 1JUFB 3D5OF 2PO6D 1RHFA 4N1HB 1ZT7A 3ZE0B 4ELKB 2ED9A 3RIFK 4DP9X 4XNYL 2KT6A 4Y4FA 1MQKL 3MRMB 3JVGC 2XN1A 4MNHA 1IFHH 4KJPC 4KO5A 1ZD6A 4WO4C 3TO4C 4PV8B 3SQBA 4KPHL 1KGXA 2VXSH 5GGTH 1KCUL 4NAMA 2DB8A 3ESMA 4KI5C 2XNAB 1L9OA 3L4TA 3W5MA 4RBPH 4OLYH 4LSRH 3ZTDC 4YSOA 1WT5C 2LLGA 2PCXA 3JWOH 2F7PA 2OZNA 4RMVA 1OAJA 1BAFH 3ZBMA 5MENB 2VE6A 3ULVH 3H2QA 1DBKH 2XA3A 1HL8A 2VMJA 1IM9A 3DSFL 5F44A 3PDGA 3WYRA 5IBUB 1YZZA 5JUEH 3G6AA 4EI6B 3QQDB 4XC1L 1BGXL 5AL8A 3H7BA 1OTSC 4OD1L 2NZ1A 4ZAKC 1BLNA 3FC8A 3U1QA 4BUQA 1VIWA 1UCBL 3LMJH 1UB6A 2VABA 1J5HA 1HSAA 2GTWA 3DX7B 2I60H 3OV6A 2D0FA 1J88A 5IHWA 2E9BA 4FNPA 5MI0C 2XTJB 4F5CE 2BW5A 2C34A 3L5WA 4W4NA 5FA3A 5AKSA 5DEGA 3IJYB 2EDTA 4HJJL 3U9UB 2FJSA 2GSGA 4P46C 1A1NA 2R23A 1KJ2B 1NGXA 3Q5OA 4S1DC 5AZ2L 3PREA 2XKUA 1N5YH 1U8LA 2ED7A 4ODHL 4I0PC 4Y4KA 4ZD3H 1IGFH 1E4WH 4IMKC 2OMTA 1HIML 1FSKB 5I6PA 5I1GL 2J5LB 5CLYA 2E7HA 5JPNA 4KDWA 5BPPA 1E5YA 3N43F 2BIIA 2CXGA 2DYRB 1ZLVH 4K5NA 3SPCA 1YMME 3QQ3B 4LASL 4NUMA 4A7TA 2ARWA 1RUKL 4L0ZA 4OLEA 5IGXH 2FZ3B 4M43L 4BE6A 1N6QH 5FGCE 4PJFA 4MNGB 3SKNB 5T8IA 4XCCH 1G6RL 3VD5A 1I8IB 4MA7L 2DQDH 1G4MA 4ZUWB 3DDGA 4AT6A 1T80A 3KDPB 5H35A 1O7DC 1L0QA 3LKNA 1TUPA 3VMNA 1NAMB 3FL7A 4XZUA 5AW6B 1WVZA 4D3CH 1DJYA 2HT4C 2ID5A 2GAZB 1OF2B 3CSTA 4TM9A 5CBEA 5GQBA 5I66A 5IFAH 4U3SB 1RZIB 2NMSA 4N8VG 4GXFA 3ZGIA 4O58L 1BEYL 4HKBA 5KBLA 3QWNA 5LNGA 1JI2A 2APXA 4PJIF 1N5AA 3F7LA 2XZZA 3O3DA 5MEPB 3QO0B 1WFOA 5HHPB 4KXAA 5TGBB 4AQOA 4EIUA 5E6ID 4FFYL 5SWSD 5DEFB 5F3HB 4WZ9A 4YR6A 4FXKB 3DK2A 1HHGB 4PI0A 1GY1A 4OGAC 1HKLL 1E2WA 1MEXH 1VESA 5HGAA 4JPSA 1QPPA 2V7NA 3SEPA 1UQSB 2DH2A 3MV7B 4GBXC 4MASA 3WEOA 4HKZB 4B5EA 4DUWA 4D0CA 5ETUB 5IHHA 2P48B 4JM4H 1DVFC 5JA8B 1MFNA 2W65A 3N42F 1UURA 3QVAA 3EZ8A 3QEGH 2FQGA 1WZ1H 2OM5A 4GW5B 5AOKA 4PCSA 1PY0A 2NT1A 1NFDA 3LPWA 4G9FB 5ITBH 2Q3ZA 3K2KA 3OVUB 4JFEA 2DD8H 4P3WA 4HBCH 4LHUA 3A67H 1GRWA 2BH0A 3ZX1A 2AJVL 4LESA 5DD6A 5TTRA 2BIPA 1SDDA 3A22A 5CGYC 2OZ4L 1E43A 5E5LA 2OQJB 1E7UA 3RWGA 4BSJA 4AUUA 2FH6A 3AGWA 1J87A 1HINL 3I2CL 4BZ2A 2P4AB 3HPLA 2Y6SD 5GHWH 5DJ0B 3FCUB 5EPMB 3GRBA 4X6DB 3MV9A 1YPZB 4HQQH 2AAVA 3GXDA 4JKKA 1BLIA 3TA3C 1Y1DA 4U4IA 5EBLA 1WBYA 1RK1A 3ZDXE 3FU8A 4RAUA 2X4UB 1FNAA 4JL2A 5AB2A 1WCQA 1FV1B 3H42H 1X5ZA 4L5FE 1KCBA 4UDUA 5D2LB 2Z1PA 2X0VA 3AU1B 3OLIA 5IVZA 4RMUA 1GPOH 4IU2B 3C8DA 1P5VB 4HC1A 3EKCA 3UYPA 5EZJB 1P7HL 2H7WA 3U6XA 1CGVA 2BMKA 3B9VA 1FBIL 4FZ8L 1MFEL 3C9NB 1IILE 3S3PA 4BK4A 5CMAB 2NUPB 3FCTB 3IPEA 4YXHL 1R3LA 4BA0A 2FHFA 5KVMC 2XXGA 3H2WA 1NMCB 1Y18A 3ULUL 5AZEH 2VM9A 4PRDB 5FV2A 5DGRA 4ERSL 1TJIH 3MUGB 4PJ8A 3WFDH 3WDIA 3WTVA 5HYQB 3GSNB 4Y1AB 3N44F 5K9KB 2VDMH 2QSVA 5CZRA 4DWHA 4NI6A 5AENA 1J9SA 5DUML 4MXVE 2R1YA 1VERA 4GOSA 4KU1A 4NQQA 2B20A 2WOYA 2NY4B 3CFQA 4WEUD 5IW3A 1XGTB 1PAMA 5L0QC 3GIZL 1KLUB 2DWDA 2QQKL 4OJCA 1C7TA 5ICZB 1BBJB 3B7YA 3DJRA 4NZUH 4YFEA 4Y4FD 5JO5A 1H3TA 1JNHB 3J2PA 4LQFH 4CBZA 3WO4C 1D9KB 3QCTL 1XH1A 2NNAA 4M5ZL 2BP8A 3VWKB 2BNQB 3RLSA 3FO2B 2WP3T 1BFVL 2UXVA 3L13A 4UQDA 1OP4A 1NCWH 3TFBA 2O6FA 4I1PA 4EAEA 2AJZA 3WJJC 4XNMB 1UB5A 2DMBA 4FQHB 1X9QA 2EYRA 2PCYA 3ARFB 3FOMB 1QUNA 4BZ1H 2AKRB 1IM9D 5I76B 3HS0B 5CD5D 3MYJA 3M8OH 4U6VH 4AM0A 1HKFA 1F4YL 5IEHB 2I5YH 1O9ZA 3SDXB 2XZCL 3C08H 1HU8A 4PJFE 4CADB 3VD0A 5I1DA 3MLZH 1AIZA 4LARH 3NJLA 4FTVB 4C57C 5KANG 2NDFA 3G5XA 1UH4A 2HJFA 1ZVHA 4E0RB 2B5IC 3CX5K 4P5KB 1J0IA 1LEGA 2PUQT 3RY6C 4UTCA 1J1XL 2X2IA 4P5MB 5DHVH 4AEHL 4BGDA 1YN6A 3ZRSA 3MLWH 4K8RC 2BJMH 4Z3JA 1TZGL 1MIML 1XF3A 1ICTA 1AQMA 1UOVA 4RISL 1NGZB 3B9AA 1AANA 1OB0A 2C9XA 5CCJA 3QNZB 4QY8B 3AB0B 5D1QC 4O9HL 5JPMC 2MCMA 3H56A 3HLAA 3CE1A 2JJTA 2ZWYA 3RVWD 5AOIA 3GXPA 1J8SA 3WN5B 3WUWG 4HCFA 5I30H 4J3TA 3UO8B 5FM5O 5JIPA 1G7LA 3IF1B 2BIQA 1ZS8A 4PJEA 1W72L 3NP3A 5D6CB 2GK0B 4HZAA 4AI7A 5L2KA 4HUCA 2XG5A 1SNRA 3MKKA 5HI4C 4MWFB 4X9GA 1MJJA 1HJCA 3LJ3A 4OKDA 3VFOA 3GXNA 1JZ5A 3PHSA 2Z8RA 3OWEA 2CUHA 4LCCB 3WKMH 2XWJB 1KG0A 3UABA 3CN2A 5D1ZB 3QUML 3DOSB 2Q8BH 2Y6TE 1XIWC 2JKLA 1JD9A 4WRLA 2FECL 4DCQB 1SOKA 3GEWB 1D5IH 4XE0A 1CGSH 1A9BA 5KVFE 4LCIL 2R4SH 4M4RA 2YGOA 4WNSA 2OR9H 2NTFA 1VGKA 3G9AB 1F6LL 4ISVA 3VGAB 4EBQH 2HFEA 5I9QB 1X5YA 2VT0A 5FGSA 4WV1B 1CL7H 1D7BA 2DYPB 2JIXD 3AY4A 3QZMA 4K5LA 5BOPA 1G7MA 3MC0A 3NEXA 4FFVC 5FFGA 3T8MA 4EO5A 1X5MA 3ABMB 4R5TA 3QH3B 3KBFA 1E65A 1U3HC 1JHLH 4J3OF 1EJOH 1XTLA 4OJDH 3JTSA 3KJ4C 4N2AA 4L23A 1C7SA 4DFHA 2X6VA 1SLWA 3D12B 3PP3K 1J05A 2CKBL 4FLSA 3V0JA 4C4KT 4JN2A 2CUAA 3BFQG 3DRTB 3FBKA 4NO2A 4ZXBC 4EUPG 1UM4L 1MXDA 2QT6A 1XH2A 3B4NA 4JFED 1X5FA 4MMZA 4IJ3B 4LHUD 3LVEA 3GJEA 1AGDA 2A38A 3HRZB 3HS8A 1AHKA 4XHJD 4JO1H 2XZAL 2WXFA 5DHXB 3DXAD 5T1JA 5FO7B 4G6JL 1A66A 4ANXA 4HJ0C 2O30A 3EYFB 1A3ZA 1B2WL 4A6YA 1BBDL 2VDQB 5C9KA 2X3CA 3FQRA 4YDJA 3QEUA 3UAJA 3OKDB 1NJ9A 2V3FA 4M7JH 4YX2L 5D7SL 2OTWB 3MV9D 1DSWA 3OMNB 3LS4L 2X4QA 3T2OA 3T0EC 3JQOB 2W91A 4DGYL 3CVHH 4RRPG 4JFOA 2GTQA 4RVBA 1U2CA 3V4LA 2G9KA 1S9KC 5EO0B 4L8CB 2NXZC 5DD3H 3EO1A 1MUJA 5JA9A 1XF2A 1B9KA 2W0PA 4GW4A 4Q9RH 2VGLM 2NR6C 3HVNA 1NEUA 3BJLA 4KAQL 2BSRA 2UZIL 4H4NA 2D7QA 1NCIA 4EDXA 5KSUA 1KSRA 1QSZA 2J4WH 3TCLB 3D0LB 4H2AA 3KPSB 6PCYA 3X11A 1MCIA 2F1AA 3NGBB 2ESVB 1JDCA 4ABUA 1S7TA 4G8GA 4PJ8D 4G7YH 1Q38A 4XNUL 3KGSA 4Z18A 3T8XB 1MZZA 3GRWA 5F9WC 3GNMH 5E94A 2HCZX 5E0QA 1UEYA 1AGFA 4DVBB 3IDXL 4R4NC 4BJLA 2EDBA 3DPBA 5C08E 3S8FB 4I3RH 5DK3A 4UTAL 1FFOB 4QGTA 2OYLA 4BUHA 3DO3A 2G9HA 2IAMC 3ELQA 4D7BA 5DEZA 2X4TA 3HRPA 3UTZA 1CFVH 3L3KB 1DJHA 1JGLL 3DHPA 7FABL 4K23H 4IBSA 4PJAF 2P80A 4LSUL 1G7JA 5F9OH 3R8QA 3HB3D 4J6RH 3D25B 5I73B 5DD5H 4XMPL 4GG6F 3IK2A 2G0KA 4J1UB 3BSHA 1PJ9A 2X4PA 3FU9A 4BE5A 3EJCA 1P9MC 1J8KA 5EUOF 5A40E 2FATL 4QXGH 3Q01A 3NIDB 2NY1B 3UBXB 2DRUA 3BX7C 1QVOA 1S78D 1K8IA 3DO4A 4HZLA 3FRUA 4NRXB 5HDBF 5I8CB 4P23A 2F5AH 4WKXA 5C0FB 3HG5A 3IFOB 4DAGL 5DJ6A 3H4HA 2QPFA 1LQBC 4PJEE 4IIQC 1USZA 2X09A 2Y4SA 4GUPA 5AW9B 5A3IC 3KPNA 1CIDA 3CSYB 2UUDK 3OPUA 5L2KE 1L7TH 5J1AB 5D7JB 2OSLB 1CI3M 2NOYA 25C8H 1KWGA 3TS8A 4GRLB 1MVUB 3AREC 3N41B 3U2IA 4Z0XA 4IKNA 4JRXB 2J6WA 5F89B 1IL1B 2XKSA 2DDQH 3QHFL 32C2A 5F7UA 1ESOA 1N7MH 4NO3B 2OTUA 2ZXGA 1NWOA 4G80A 3VI4F 1OLLA 4IMLA 3QUHA 2F54B 3X14B 4HIJA 1KT2A 1YSOA 3ETSA 4MNQD 4LLDB 3ILQD 5HHVH 2W9DL 3MNZA 1FZOA 2XVKA 3O81A 4OZGE 3SKOA 2ZNXA 1TQVA 3ARDA 3Q2CA 1A1OA 3TPUB 1NCDH 4JFQA 5FOBA 5IVXB 4AV5A 5KSAA 4Z7OF 2RD0A 5AYQA 1F56A 2MSPA 3GHEL 4ONFH 1DUYA 1HL4A 1QPXA 4OJYA 4WFGE 3O9WC 1FAIH 3VGFA 5DJ8A 4NWUH 1BVZA 3EDJA 4YDVA 4KQ0A 2BC4A 3MVSA 3QCVH 5L2KD 4GUCA 4OJFH 3STLA 2EE2A 2P46B 1KZQA 2ATPB 4LSVH 5AW3B 2E4TA 3LPGA 3SKUD 3MX0A 4XGZA 4GMSH 1ODAA 3PWPA 3EYOB 3IDJB 3NT0A 2O6CA 2Z91B 3RA7H 3MI6A 1IAMA 4JO3L 4K7PY 1TNMA 4QWWD 4OV5B 1BG1A 1ETJA 5GZOC 4ZAKB 5IEKB 5TF0A 5HDQL 3NK4A 4ZMLA 1I3RA 5IB3A 1DBJL 3DRQA 1PZCA 3RWCB 2L7EA 4CC1A 3UC2A 1ACZA 3TT1H 2YQ3A 5LCVH 1NOAA 3NEOA 4FERA 4ACTA 1HJBC 2HT3D 3I3BA 3QG7L 2ZXCA 1VDGA 1WIPA 2UZPA 3BD5A 1YDPA 3EJQA 3L3HA 2N01B 4OZHF 2AZAA 4P46B 5BV7H 5K9OB 1OKEA 2RB8A 1QFWI 3DUUB 1UT2A 4MMYA 4QHLA 3SPVA 4JDZA 4CU6A 1QA9A 5EOCH 4NZTH 2E0PA 1JCVA 4MAZA 5BUGA 3LKSA 2TRYA 1C5DA 3DARA 1SBSH 4PR5A 5FUCC 5I8KL 2HVJB 1KBGH 4LCYA 1EA9C 3LRSA 5KVEE 3EYUL 1JWMA 3CXFA 4OU3A 2KL6A 3QI9A 1PCXA 2WTRB 1HWHB 4M7ZB 4OLWL 3SZ6A 1G9ML 5DHYA 4NKIL 3DO7B 2I24N 2DM2A 3UAJD 1FRGL 1IVTA 3IAQA 1HZLA 2A6KA 4K7PL 4G8GE 2QDVA 1NC2B 3TO2B 2FT8A 5AUMA 1DUZA 3NFSL 4HIHA 1TVBA 4WFFD 5GGRY 1V3KA 4G7RB 2DMGA 4JO8A 2XWXA 3JV4A 3K6NA 4N0YH 2E8ZA 5E1AA 3WV0A 1WAAA 1YRKA 1P5UA 2CR6A 2F8VA 4DK5A 3EFOA 4I1RA 3HBZA 5MEOA 2IWKA 4RWHA 2CNYA 5ICXA 3V0EA 4PGZA 1M7XA 1D6VH 3REWA 3SY0A 4HEPG 3RZCC 1HOEA 2L7JA 1NBZA 1G9NH 2BZCA 1KFAL 3UJJH 1R5WA 5D5MF 3ULUC 1P6FA 5A7EA 1KYAA 3O8XA 2CGZA 1GGIH 4QRTB 4JFHE 2VDKB 1YQ2A 1DVFB 3ISYA 1H3UA 3GSQA 3RKDD 2WN3A 1XTMA 4G8GD 5GISH 2MOGA 4UT6H 2IV9A 3KPRB 1JGUL 2ZAGA 2Z64C 4F7CA 5FCUH 2PABA 4QMEA 1EQWA 3CVIL 4JPVH 1JXKA 2JELH 3RAJH 3ULVF 2DW5A 2EJ1A 2VR9A 3ULAB 3S48A 4PJ7A 1MREH 1DFXA 2QVMA 3BPLC 2QR0B 1FYTB 3APFA 4HSCX 4JBSA 2O61A 2ZUQC 1FC2D 1B90A 2X2UA 2JQZA 3BUDA 3HE7B 1IBYA 3QHTC 3ALPA 4RIRB 1IKNA 2IQAA 1F6AB 4IKLA 4TQPA 2P80D 3VFSA 5GSRB 4NAJA 3T04D 3VFNB 2E47A 1M6UA 4FQLL 1IEBA 1X44A 1BFSA 4RZCA 4POUB 1L9SA 4PJ5D 2BS9A 2Z7YA 4JFHD 5HHNA 4D9QE 1S5IL 2K9FB 2Y72A 2JI2A 2QQQA 3TA3B 4MD4A 2W38A 4BHUA 2LGNA 1MI5E 1NMBH 1H0DB 2JQMA 4OF3A 2AJ3A 2WXIA 4JFYB 4BZYA 1L9MA 1EEUA 4XC3L 2M2DA 2E3VA 1KGJA 4GKZA 5AW0B 3VFTB 5KSBF 2Y36L 3FUMA 4HETA 3BP7B 1DANU 4XX5A 5EULV 1LDPH 3FT2A 3MA9L 2CO3A 4AK1A 4WI3A 4PJ9C 4I7ZC 1Z9PA 2DWEA 2VWEE 3ARGC 1F90H 4KK9C 3U7WH 1D5BB 1ADQH 3ULVD 4BZ1A 4PJDF 2BIMA 1LO2L 4XP5L 4UIKL 3W39A 4J8QA 3PWPE 2CA4A 1ZHBB 1T7XA 4PG9A 1AH1A 2IIJA 2PWDA 3PNWA 1ZSDA 3CDGB 2YBRA 3LH9A 5DHEA 2XWZA 3IAGC 4MLIA 1SY6A 1YEKH 2VO5A 3ARDD 4ONGL 3ASOB 1T2JA 3C5SA 4JFFA 4UQIM 3IU4H 5L0QB 3P3TA 3OB0K 5KSAD 1INDH 1XFPA 5DHVA 3BPNC 5EORH 1SHXA 5B8CA 1U92B 2W81C 3PAYA 2Q7YA 4X8JB 2FO4A 3RGBA 5AAMA 5IOPB 3QWRA 4RWYH 2PXYC 5KZCB 1EAJA 3QNYA 3SYAA 3VXTA 1G7PA 4AEIL 4RGNE 4ZFQA 3WCYA 4Z3IA 3TTYA 1RFDH 3QIWC 4XPTH 4PLKD 3RIKA 1MFDL 4H8HA 4XB7A 4QR7A 4BEIA 3HMXL 3PWPD 4OD3L 3MUZ1 1A14L 3BN9C 3TASA 3VFMB 3DYPA 3RDTA 1KB5B 1HXYA 3QPQD 5DURD 1K3ZA 1TCRB 1R3JA 3P9LB 4KKNA 1KV7A 2P8MA 4G5ZH 4TPRH 4UM9B 4NX0A 1FZKB 2YAMA 4TL4A 5CCKH 3WNKA 2V5TA 1BSIA 1NCAL 1MJ7H 1ORSB 2EKSB 2VLLA 3E8UH 1HNGA 2B5IB 4Y1SA 1IMHC 3ARSA 1I3VA 1P69B 2FGZA 2PCFB 2WBWB 3AU0A 3H9HA 3SZKC 3IGFA 3T6QC 2H8PA 2BS71 3LN4B 3VI3B 3F84A 4X8CA 2WBKA 4CGUB 4RGND 1WICA 2YA2A 3O6FA 1A4JA 1V54B 3Q5TA 3IJ8A 4PD4J 3KNBA 3EGDB 5D1QB 2OW6A 5JPMB 8FABA 1WAAE 4Q9QH 4UQ2A 5EOTA 5IMKA 3UTSB 4BCZA 1IEHA 1YEGL 3L08A 1F2XK 3D9AH 3DX4A 5ADOH 5DRNB 1WJ3A 4JREC 3ZZQA 1T1ZA 1QYGL 4H8WL 4XAKE 5HHQA 4OCYL 3CFEB 2WWOA 4MA8L 3MNVB 5AYTA 4ZX5A 3V5KB 3QI9D 3ZRCC 3HG2A 3TH4T 1YMHB 3BKJH 3K0YA 1T66C 3CFCH 3QQ4A 4NUJA 2CBTA 1A5FH 4JJHA 5ES4B 4MMXA 2ITFA 5E9DA 3K80A 3OX8B 4LP4A 3O2VH 5KVDL 1LD9A 2F7IA 3B3BA 1UYWL 1NCNA 5I18L 2ADGA 2C9AA 1XIWB 4L18A 1C12A 1BQKA 2PF6A 4F8TA 4JHVA 1R3HA 1SEQH 4LLQB 4UOQA 3IFLH 4PJ7E 1T04B 5CINL 5K1VA 4FNRA 2H1LM 2Y5TA 3VQ1C 3F6LA 5M7QA 1HHIB 2RQEA 1AAJA 1RVFH 3LS5H 3MJ7B 4GY4A 3VXOB 4E42B 3HAEG 5DMGC 2ZZUT 3X2QB 4QTIH 3F58H 5FUZH 4EZMA 3R4RA 2BY2A 2F6AA 1CT8B 1WH0A 5C71A 4NCC1 2FQFA 2BWQA 3CLEL 4P4KC 3CVHA 2IV8A 3O8XD 3DMMC 4HEMA 4Y8AA 3CUPB 3D48R 3KJ4B 5EIIB 1FO0A 4UUJA 3T3ME 2ZCKL 1U8QB 4JDVA 2CIIB 4RSVA 4DNLA 4CILA 2ORBH 1UD5A 3D69B 1URIA 3IKCB 2P5EB 5HI3C 2ZSWB 4ZXBB 1XD0A 3GBLA 4MJIA 2Y7LA 3RHWK 4YHIB 1YEIH 2HKHH 1IGCH 3DX9B 4F8NA 5KG9A 3EJUA 3P4MB 4IS6B 3FQNA 1ILSA 3BLPX 3N1GC 4KFZC 3VXQB 2HYMA 2OP4H 3K6SA 4XT1C 1UUNA 2TSAA 1UOLA 3S36L 2DIBA 2OULB 3JYCA 3NCWA 3QQ9C 2YKLH 3WGVB 3F7KA 1FZMB 4YH6A 3VB8A 2NUTA 4JFDA 3HHRB 3IMWA 2BFVH 2EC9U 3MCLH 5GRZA 2GITA 4Z5RA 2PP9A 1T21A 2HLAB 3G3LA 3GTVA 3T0EB 5L9DH 4L8DB 1DJGA 3ZKND 1FYHB 1Q9LB 1Q9OA 4LEXL 2OL3B 3WEAA 4CW1A 4HG4J 2GIMA 3OGCA 1CG9B 4JFFE 2NXZB 4M48H 4U49A 3NCFB 1EEQA 4NRZA 3ZZ1A 4CSSA 3BVTA 2BW4A 1ZHNB 4HXBL 4ODWA 1RCYA 5ALCL 4IBTA 4IOFD 3KLAA 4NOBA 5E8NB 5AKVA 4AIZA 4HKXA 5K9QG 4I48B 4UM8B 4PV1C 1II4E 4YSTA 2X41A 1ZE3C 2ICWI 4HS6A 5AL0A 3TURA 2VLRB 4MD5A 1YQVH 3AITA 3QXUA 1QSFA 2IEPA 5CZXC 5FDYA 5E6SB 1PJWA 3ZY7A 1O5PA 2A6IB 3SJVA 1GTFA 3VDAA 4PB9L 4DGWC 5INCB 5ID0B 2ZP9A 1H9DA 5J6GA 5F9WB 2YBGA 2FYYA 2UZYA 2DLTA 2EDWA 5TDNB 1OCWL 1CQYA 2YA1A 1UACH 2WLHA 3O6ML 1ES0A 3KPOA 1OCZB 3NN8B 1EHAA 1JNJA 4U1SA 4JFFD 4N68A 1S7SB 1AI1H 3BZFB 1LDSA 3KYNA 4K71C 4CUCA 2YSTA 2IAMB 2XWBB 4I77L 2WKGA 1KIPA 1DVTA 3GFUA 4S1RL 4YHKL 5CLWA 2VAJA 1QI3A 1AG6A 4M1GH 2VN7A 2PYEB 2QJDA 4X7SL 1WS8A 4BM7A 1J1PH 3EO0B 5FDWA 3QWRD 4LLVA 3RWJA 2VIRB 1KPVA 3MJWA 4KKAC 4XNXH 1R3IL 4LLUA 5IBLD 4IDJH 3QC5X 5D2NB 2YPVH 1HSBA 4N9OB 3DNKA 2E7LC 4IRZH 1RU9L 4X5LA 3DBXA 4R6UA 1VZGA 5HYFA 2IBZX 4DQAA 3BEWB 1QEWB 3CDCA 1JJUA 2AHIA 5IQLA 1UH3A 5ECJE 2ZT9C 3W56A 3WIAA 1ZK5A 5C92A 1CD8A 3K71B 1LJMA 3ZVVA 1N8OE 1IC4H 3ARBA 1V55B 2XPGB 3ME0B 4IIQB 1XCQA 4X42A 3RNQA 3NTCL 5AW2B 3RUGB 1MCPL 1A4KA 1V7NL 4JFVA 5DJCB 3AREB 5GRWA 4NQDB 4BINA 3N6YA 1P7BA 3RVXD 1EHKB 1ID2A 1J18A 1EHLH 3OC5A 1BCIA 4PUBH 3RL1B 3BAXA 4R90L 5B7EA 2CQVA 3E2HC 3IDGA 5E9DE 1GAFL 5IHBA 1PZ3A 1UZ8B 3OKEA 3BZEB 3K8LA 4FE9A 4OZFH 5IW1A 5BVPH 3O6FD 1NBYB 3FOLA 3X3FH 4KV5E 3ZIMA 5KVGE 3BGFC 2C9UA 4AYEC 3UTPE 4JHWH 4O2CB 3T9WA 1OP3K 3WJMA 1JZ6A 5F93C 1E4JA 1UADC 3IXTA 1YA5A 5JMRA 4DKDC 4P2RB 1B0WA 3B2PA 4QUOA 4X9FA 3AM8C 1MHCA 5LCVA 5K1JA 1A02N 2J55A 1G6RB 3ABKB 2KLTA 2MPAL 3I9GH 5KBNC 2JKJA 3O9WB 4C58B 1R5IA 2WLMA 1U8MA 1ZT1A 3C6LC 3IS1X 3IU3B 1WHPA 1KCWA 3UP1A 1JFHA 2H3NB 3MRJA 1KN2L 2MQ0A 3INUH 2RAMA 3PWJA 3FN0H 4GRWE 3MMEB 4KTDH 4TSAL 5E9DD 3GSVA 2DTML 4IBYA 4IU3A 3A6BH 4UNUA 3F6IA 4PWIA 1NCJA 3ZTJH 1XSKA 4MJIE 3SSGA 1GXEA 2ZKYA 4A7GA 3O6LL 2YRZA 4MCZA 1Q94A 3MRNB 3T0XA 1E9OB 4I18C 4TSBL 2QKIC 3GC3A 3UTTE 3MDJA 4DT2A 4HK0A 1UXSA 1S8DA 3P73A 4FZEL 2WO4A 2Z93A 4WWOA 5TH2A 2R0WH 5FYLH 5DZOA 3VGDA 4N86A 1BXXA 3ARWA 2NY3D 1UXWA 3LV3A 5B1KA 3IGAA 4UTBH 3CBRA 5JHDA 5KSVB 1AIFA 3VA6A 1G4RA 1S7QA 2WVVB 5G5DA 1IGIL 2BVOA 1HILB 3GSRA 3H7LA 1G5GA 2G2PA 3HMWH 4AYFB 4YHZL 3CLWA 1RUPH 3A4DA 4UZUA 4V1DA 4GKNB 4NQCB 4JY6A 5E6ZA 4ZUVA 3BP4A 5JW3L 5AVRB 5DC4B 3QUYB 5EU5B 3PJSA 3AQZA 2XVLA 4DH2A 1AC0A 5TE7H 4GKSA 3FFCA 3GRGA 3LKPB 4FFWD 4OKVA 1GS8A 3LB6D 4ZUSA 3SD5A 3QUKA 5LGHL 3TZVC 4KK8C 4NQVA 4UT6A 3MXVL 2H45A 5F3FA 3OKMA 3G5ZB 2EO9A 4LOUD 3STZA 3CXDL 4JFDD 3H85A 3SJVE 3WMQA 1J5OH 2IMMA 3NIFE 2LW3A 3U7YL 1DQDH 4MZ3A 3U1SL 1VJSA 4XXWC 2ZUWA 3KXFA 3Q05A 1QFOA 2WMPB 3I74A 1O75A 2YAQA 5EN2B 3QWOA 3BT2L 3FFDB 5EDXA 1HL9A 2EYTB 1TQBC 3GSWB 5AB1A 3MLSH 3ERXA 1FHGA 1MFMA 2WUBL 3QEQA 3SBPA 2VXQH 3VXSA 1IBHA 4QLWA 4S1SH 3LSOB 1OW0C 3QIUB 4HISA 4XCEB 3WKPA 2K45A 1RIUH 3RGHA 5IW6A 1X9RA 3RZCB 1ZMYA 4OF8A 3HKZA 1AD0B 1XO8A 5CWSA 4QRSB 4YO0A 1ZSHA 5EBWA 4KZEH 5I23A 1E8WA 1S9VA 1T22B 3Q3GB 4F1SA 3UC0L 4A38A 1EGJA 2WZ0A 5LB1A 1T3FA 2LLLA 3PWUB 3KG5A 1QSFD 3NDYE 3V95A 3TJPA 2ZKHH 1FL6B 5KW9L 5LN4A 1OY3B 3SJVD 3ZE0F 1INQA 3K0WA 4LCWB 1L0YA 4ZQKA 4P59H 4BH8A 4GAJL 4N85A 2IALA 4AJWA 1KGUA 4UV4H 3RWHB 2XKNB 5C0AA 3VRIA 3L3IA 3W57A 2DL9A 1MW2A 3TBWA 2HFGH 3TFKC 1RKRA 3M07A 4Z7QE 4HWZA 1I7TA 1F5WA 4KBPA 5I16B 2ROXA 4KZ0A 1LO3H 3NQKA 1ADQA 2X1WL 4B41A 1SJVA 4AJVA 5LDUA 3BPLB 1JPTH 2PTVA 3MTRA 3H6JA 1H6FA 3BUYA 4AQ8A 2ZUQB 3F3HA 1TZAA 5K93A 5G4MA 4P4RA 1SFHA 1JGEB 5KVFL 4LRIC 2NY6D 3SDYL 3NOIA 4HIXH 1I7UB 5DMIL 1JIBA 1ECYA 1DJXA 1JV2A 1ANUA 3CZSA 3GMRA 5ENWB 4G6KL 3NABH 5AAPA 3F6JA 4AIEA 4XVJH 4TUOA 4BZ2L 3HNTH 2G60H 1G7IA 2AV7B 1RUQL 4CKQA 3FCBA 1JYVA 3NA9L 1MN4A 3BPOB 2ISDA 3IN2A 3QIBA 2DBLH 1L9RA 3KS0J 1VFUA 2G3XA 5FM5M 3RGVB 3V6FB 5C07B 1I7RB 4QLRA 1NAKL 4TNVF 3G04A 1PPIA 5DTFA 1RXLA 4EUPB 2RQ8A 1CDBA 2XWCA 5IHUL 1AQ8A 3ARBD 3ASWA 4H88L 4B7IA 1JXJA 1I85A 1MCCA 4U3HA 3SQOL 2DQ6A 2VLJD 3CFJA 3CZLA 4HC1L 4K7PX 3VCLB 3ZL4H 1JN6B 4PJ9B 5JLZB 1T5XB 1U6AH 3ARGB 3OJ2C 3X12A 2AEPH 2ZOOA 4FG4A 4UT9H 4NC1C 4M6NH 2FQEA 2ILLA 3B2MA 4PJGB 1N8ZB 2ENSA 2H26A 1TNNA 4HCGA 5F7EL 3SDDA 3W9DB 1FA4A 1G7QB 2K0RA 1F3DH 1FGNH 1N70A 5IM7B 3BESR 4NQEB 2RHEA 2I32A 3DX1A 2A74C 1DLFL 1ZA3A 4O4YH 5DQJB 1MCBA 1B6UA 1FVDA 1Q0XH 1MRCL 4HK3J 3IGLA 1QHPA 5AYUL 1A6WL 2YWZA 4L8SC 2VB5A 2Q8AL 5IB2A 4N90E 4W70A 1JZ3A 2GJ6B 1UVQB 4H8WC 4QOKB 2WIIA 4HZ1A 2J1WA 2W92A 4WENB 1W72B 5F3BA 2WQUA 1OSEA 4AKPA 4ES8A 1IM3B 3HLKA 3GZPA 2QMJA 4F7PA 5C0ND 5BZDB 2PXYB 1VFAB 4QXTB 3FT9A 4QJ5B 3ULSB 5JYMA 1P4IH 4R97C 2W07A 4PREB 5JHDE 2PW2A 2OMUA 1H3XA 1J11A 3QUMB 4UILL 3QIWB 5G4OA 2GBVA 4FNLH 3P9MA 3TT3H 4V1DE 3C5ZA 5JMOC 4PRBB 5A2CA 1M6OB 1OXYA 2WGXA 2NLJA 4LHUG 1SVBA 2AMUA 1E27A 3F00A 5E6RB 4FYQA 3TN0A 3AT8A 3SDCD 3ZE2B 4OLXL 1DVSA 3FFCE 3PWLB 3GT6A 4KUCD 1MIEH 4OCWH 3SPIA 4RMBA 4Y7OC 2IF7A 3D39B 3T1FA 3HUJB 2DBJA 3L5XH 4AH2A 3DROB 1EO8H 1X5KA 2P43B 1OD7A 4WTZA 4ANVA 3TA4D 2IANB 4GG8B 5K33A 5L2JA 2WGNB 1U0QA 3G5YB 1TLKA 1EXGA 1GYVA 4LDLB 1NUFA 5JHDD 4EI5B 1FL5A 2CKBB 4IRSA 2UXTA 5FW8A 2Q6WA 2AVGA 3KXFE 1BG9A 4I9WD 4LLMB 3WSQH 2ZUSA 2YFNA 2V2XB 3E6HA 2DQGH 5DC2A 2O93L 1S7WB 5I24A 2Y1ZA 4N2EA 2F74A 1OGAA 3QRGH 3WAKA 3VXSE 1U8PA 2WW8A 2Z3FA 3DV6B 4N0FB 4X80L 1QTSA 2OYPA 4N2HA 3PWVB 3FFCD 1JRHL 3FU7B 4X6DF 2XU9A 1YPZF 4JY4A 4QGYA 5C8JB 1CLZL 2YJQA 2XWTB 1AZBA 2MKLC 1EDQA 1SJHB 4G83A 1R47A 1HH6B 2FX9L 1U4EA 2XRAH 2ZP8A 4MKMA 4N0UA 1WFUA 3TF4A 4QAWA 2WYHA 5D2LF 1TKWA 2XWRA 5EBGA 3GHBH 1UFUA 5KTEL 4I2XA 2K4WA 2OV0A 3PGDB 2R39A 3FB6B 5LBSH 3RIAF 4DETA 2O1AA 3A21A 5KBKA 4LRNL 3I02A 4AY0A 1E9QA 1U93B 4HUWB 4FMKA 5I8EB 3VD2A 2ED8A 2A6JB 2Z9TA 1QNZL 5L4MA 2EXTA 4CVXA 3HHSA 4X7EC 3QA3A 2AJSH 4NOFA 5IF0A 4YFLI 3BMVA 4L1HA 1G87A 3NSXA 4HGWA 3QEQD 3VXSD 1QAWA 1XCTA 2J56A 5E6IC 5CEXA 4ZRGA 4G82A 3BH9A 1J8HB 4U1HA 4Z3FA 4HXAL 4NM4H 4OFIA 3V4UL 3CQFA 4FULA 4F80A 1MH5A 4F9LA 3MRPB 4W9GC 4CVZA 2DKSA 4P4KB 1KLFB 5C0RH 3CFBB 3DMMB 4A2MA 2EH7H 3ETTA 4FJ6A 5J0BA 5IMLB 3WTUA 5F9AC 3V0DA 4M62H 4XCNA 2P49B 1NGWA 4DPCX 1GC1L 2H41A 5HI5D 3GO1L 4JZNB 4L29A 4HHAA 4KHTL 4PBXA 1JF5A 4LMQE 5ESVB 4S0SD 5MP6H 5C0AD 1OAQH 5DFVD 1IIIA 3T4AA 3TEYA 4KMQA 2BVYA 4HT1L 1F13A 1GJWA 5IB4A 4Y2DD 3U4EB 3LZLA 4NXKA 3NIGB 5E24E 4GFXA 4H8VA 4C83A 4XO4A 4KXBA 4Q2ZA 1GIGL 1L9PA 1LEKB 2DQCH 2FBOJ 3L1EA 4KHXL 3EBHA 4TOYL 2BY1A 2Y6SC 4PWKA 4R7XA 3RKPA 4UDTA 4A6YL 1UXMA 3CGTA 2YLKA 5DSCB 1ZTXH 3L1OL 4L3CB 5A2LH 3SDXF 1ZIAA 1WA2X 4IIZA 5EZIH 4L9LC 4NDMB 4DW2L 4AVJA 4TUKH 5KYXB 2YUWA 3QIBD 5IQ7H 2R1WB 3OHXC 1MCLA 4XTRD 5CJQL 4PRIB 1GGCL 4NP4L 1K8DB 3KD4A 2V5MA 1A6TA 2UVEA 3W0WB 5TE4L 2WQXA 1X5AA 4EOWL 3D05A 4MQ7B 3P0VL 4ZTPL 2XICA 5IG7A 3NCBB 1Y0LB 5CEZE 5GRJH 2YPVA 4U2ZA 4P49A 3GUTB 4IRZA 5MHSD 3TWYA 2E4FA 2VQ1A 5HDOA 4CKVX 3P0YL 2JK5B 3SDDD 4D9RD 3D0VB 4WW1B 4YHPB 4NWTL 3M1OA 4GT7A 3V0VB 3B9EA 1E5BA 4LSPH 2OYKA 4DN3L 3GMQB 1DQJA 4D0BA 3I50H 5D4JA 5C86A 2OJZH 3LQMA 1GZQB 5ICYA 1XB8A 3NJHA 3GRWL 2WXNA 4KXCA 1FH5H 5PAZA 5B3JF 4PN6A 2LABA 3FTGA 4K71B 3K1KC 3NZ8A 5H37A 2JNZA 2P45B 4YL4A 4Y4FC 3G7TA 4CNIB 2FIKA 1LNUA 2H0JA 2IFFL 1UA3A 3DX2A 3NZHL 4OQTL 4F2MA 2WWKT 2TAAA 4MQTB 4OFVA 5D93B 1S7UB 2EH8H 4XX1E 3CSFA 3S88L 1CE1L 1OF0A 4R84A 3ARYA 1OP9A 3ZDYB 1RURH 3H9SD 2Z0UA 3CDZB 4APXA 1NBQA 2R8SL 3VFWA 3U4AA 4U1JB 1KIQB 4HGKC 1U2HA 3U48A 3C5ZD 1P4BH 4ELMA 3LZOA 1KYOK 1OGAE 3CDYA 4G5AA 2Z31D 4S2SA 5CU5A 3TN0D 4G2AA 5AD0A 15C8H 1EBPA 3VXRB 3KR3H 5CD5C 2BRRH 1JPST 1IFHL 2IC2A 1OE3A 3QXDA 2AGJH 5FKPA 4IKJA 2XTSA 3HPJA 1XF4B 4TNEA 5AWNH 1PKOA 3H53A 1XGZA 1A7BA 1DCEA 2VXSL 5GGTL 3N04A 5LXVA 1DEDA 1OZUA 2L8AA 5H94B 5KYNA 1WAEA 4V33A 2GC7C 4OLYL 3ES6A 4LSRL 1UKTA 2WLJA 3M46A 4QRUB 2LE9A 3ILDA 1I1FA 3E2HB 3JWOL 1BAFL 2ZG1A 3HJ0A 4IRSD 3RBSA 5AAWA 1A7PH 3ULVL 1CDHA 5B4MD 1DBKL 3FB8A 3AG2B 3W11D 1ZV5A 1QFWM 2WSKA 1B0IA 1BX2B 1OCCB 3QNXA 4OFQA 5JUEL 3PQYA 3UXFA 3WEMA 2F15A 4DGUA 4PYGA 5ADPH 2YPLB 1OGAD 3LN9A 1FI8C 1DP0A 3HZYA 2JJVA 3MRBA 4MBOA 3RVWC 3SPJA 5K69A 1BOGB 1M1XA 5JPNC 2X70A 3L5JA 3LMJL 4UTBA 3MCKB 1HEHC 5EH1A 3HR5A 1CFTB 4E41A 3MZTA 5JHLH 2I60L 3HZMB 2DQFA 2AEIT 2FECI 2WAHA 4KO6A 3C6LB 4O02H 3QT2A 5FYJE 3VYPA 5J12B 2F53B 4OD2A 1EANA 4WHCA 3VGGA 5T5FH 1ACYH 2R7EB 3KPTA 5E00A 4HOZA 1CXHA 1M7DB 2F7QA 1UJ3A 4KO7A 4IK6A 3RI5F 3R19A 2PW1A 1N5YL 1AR2A 4ZD3L 2OMVA 1KF9B 4HJTA 1IGFL 3F7VA 1E4WL 4PGDB 4A2GA 4BRJA 4OI8A 3OAZK 2K8QA 3U36B 1FVEB 2J8OA 5C0GA 4X9IA 4TTDD 5DO2D 2RGSA 3O4LE 2QGEA 1CGXA 1C16A 5FR3A 1H5BA 1XF5A 5E7BA 5LXGH 5IGXL 4I18B 3MO1A 5A16B 3CBJB 1N6QL 1KLGA 4BFIA 3PGFH 4JKWA 1RJYB 5GS1A 35C8H 5HHOB 4XCCL 1OHZA 1VEMA 4FI8A 1ZJBA 5DR5H 2DQDL 5IV2B 2D3VA 3APMA 2XJKA 3TBVB 1USQA 5AVXB 4R96A 1BD2A 3HA0A 4D3CL 4NKOA 3S8GB 3D1MC 1U8OB 4TQ8A 5EBMA 1IX2A 3OKNB 3OMAB 4E9RA 3TGXA 1FVCA 4R7LA 5IFAL 2CKNA 2VO8A 4UB0H 2VXQA 3EH3B 4WSKA 3T65A 1ZTMA 4R0LA 1A7OH 4LKXA 4X5WA 2P8PA 1IGTB 1WE5A 3I6LE 4XB8A 4J7RA 1BYNA 5I6XC 4AYID 5I8OL 3S5ZA 1D5MA 5KN5A 1LWHA 3PP3H 3ZYZA 3EF4A 5I1LB 2VN3A 3WLBA 2YAFA 2E7CA 3NPSC 5GGRB 1MCJA 1EEZA 4KROD 2NRDA 4XHJC 1MEXL 4WUUB 5LAXA 3RL2A 3ZRFC 5DFWH 3CFDB 4LLWA 4X4MA 1D5XB 4HKJB 4OCRH 5IROA 4NQXB 1ZEAH 2K7PA 4WU5A 5B1AB 4B9IA 5D1XD 4N0RA 4JM4L 1QBBA 2Q5BA 4YAQA 3L3JB 1I8AA 4AZUA 3RPIB 1HNFA 2OXHB 4S1QH 3QEGL 1WZ1L 2EDFA 3T3PB 1AKJB 4WKZA 4BSVB 3LNIA 2A9CA 5ITBL 3KYMA 2UYLB 4TRPH 3ORJA 2DD8L 5EZLA 2NW3B 4HBCL 3SCMB 1U2YA 4CN6A 3A67L 5FYJU 3EG9A 4GG6E 5FYKH 3UBGA 2FE0A 1LWJA 4X83A 1E4KA 3PHOA 3BZ4B 1CI5A 4LEBA 2KZWA 2Y7QB 3T0WA 1CDUA 1B4LA 5F7NC 4PIBA 2M26A 3QZLA 1CGYA 1KB9J 2GUOB 4ZODA 4F2ME 4POYA 1UM5H 4TYUA 5DK2B 3KPLB 4Y5VB 4XBGB 2NXYD 1RIHH 5GHWL 1C8QA 1G9HA 3SY6A 3WHE0 4FA8A 3LXAA 3ILPA 2WKOA 5BMFH 2ZWSA 3TVMA 4HQQL 4D2NA 2I7SA 4N0CD 3JBG7 1NPJA 3CC5B 2BCKA 2DI8A 2D7OA 3QE5A 5IVXF 2W8CA 3ZT5A 1WBZB 4PJ8C 5BOJA 1ZT4B 3H42L 2WZ6A 2HH0H 4B9CA 4M56A 4ZW5A 1MNNA 4Q14A 3ZE1B 1GPOL 4G7QB 3VH8A 4AENB 4MDRA 3Q0HA 3ZDZE 3VI4E 2VDPH 4UT9A 2WYZA 1BM3H 3QHZH 5D9SA 3KYKH 1Y6NR 3EOAA 4KI5F 3KEHA 4J3UA 5GS3A 1A8ZA 4G1EA 4LLAA 1E5AA 3FQTB 4AM0Q 4UF7C 2R2BB 1VADB 5TDOA 3SGDH 3HAEB 1E3ZA 5AZEL 1VKXB 4UBDD 3HB3C 1TJIL 3Q8EA 2YD1A 3WFDL 1XB6A 1UD8A 5EEYA 2Y2YA 2HG0A 1PLBA 4NGHH 2Z92A 4NYLB 1S7XB 2VDML 4DP5X 2XY1A 1DVQA 2HTKD 2NZ9D 4OLUH 5A2JH 2YOAA 3UMTA 2E7MA 1E40A 1KPUB 3JYBA 3GBEA 3PQYE 3DJZA 2D31A 1S78C 2J8HA 1M2VB 3P11H 3V5DA 3MRRA 4PJDA 2CBQA 2Q86B 4NZUL 4X7TA 5IFJA 3NFNB 5JW5A 2YZ8A 3PFQA 1UD4A 4KOBA 4KJQD 4LQFL 2V7HA 4DZBB 3FQUB 1LEIA 1NEZA 3LEXA 4W6WB 2EZ0D 3NSJA 2C9PA 2G4EA 4FG6D 2GKIA 1H6UA 5F7KC 4NENA 5GS2H 3FAWA 3SE4A 1DYZA 1F4AA 1ZIBA 3BHBB 3GBDA 3UG4A 2YN5A 4J23A 1TJGH 1P4LB 4PJHA 2WXLA 1NCWL 5A6LA 4AC4A 3M88A 5IT2H 2GABA 2LOEA 2ICEB 2D3JA 3VGEA 5F70A 4NNXB 3KBEA 2YARA 2A74B 2C9VA 3BH4A 4BZ1L 1CXEA 3IE9A 3FUFA 3ILQC 1RK0A 1WIOA 4PRPA 4TS6A 3E6FA 3M8OL 4L8SB 4U6VL 2UXFA 4HW6A 2BP3A 3AW5A 3PQYD 4LBEA 5JHMA 1EERB 3KH4A 2JTYA 1G0YR 6FABH 4HFUH 3C08L 1JHKH 2JJTC 2PO6B 3EGXB 2YQ2A 3LOWA 3R18A 4K7FB 5ANHA 2MCG1 3OXRB 2D2OA 3ZKSD 3MLZL 3ZYIA 4KUZH 4L8BB 4LARL 4BCYA 2W0KA 1A9EA 3KW7A 2A9AA 4LGRB 4LK4A 3SGKA 3WXVH 3DVNB 5DFAA 1WZKA 4E41D 4I3GA 1BD2E 1X3DA 4PTTB 2W0LA 3DTXB 4OM0H 3VE0B 4JJOA 4R97B 1F1AA 3MLWL 2BJML 4NZRH 2HPTA 5CJOH 4JJ5A 1L5GB 2VUOA 2PWEA 4EJ1C 3LTVA 3ISRA 5JOFA 1ZDSA 4Y19B 2DPKA 2NX5A 1ET7A 8CGTA 1V8HA 4S1DD 4QHUB 2FEEI 2V8MA 5I30L 4WWKA 2FJGB 4P5RA 4NT6A 4QWWC 5ABAA 4LDEB 4KDTA 4TLKA 3QUZA 2FH8A 2X4OA 1U9KA 3B8SA 4X4ME 5KBPA 4EQ3A 2W0FB 3RWFA 5J6HA 2XC8A 3DURA 5I1AB 2K6YA 4OGQC 5LBSA 4FDWA 4XOBA 5GIRA 4MB1A 3AY4C 3ROOB 3WKML 1JPGA 2EEAA 1GC1C 2HT3C 5FO2A 3PIQA 5ALBH 1KXQA 3PV6B 1FG2A 2YXVA 2Q8BL 1F1GA 3VSTA 3G5VB 4YGVA 3BVVA 4BFNA 4R7VA 1R3KB 2BOBA 1D5IL 1O6TA 2J2ZB 1CGSL 2WO2B 1BMZA 4GQRA 2R4SL 1IBBA 4Z3TA 4PVNA 1QI4A 2OR9L 3L9RB 3LQAH 4MMZC 5EMYA 2XX0A 4BH7A 1KNOB 4I0KA 2BSDA 5C0BA 4EBQL 4XPAH 4B9ZA 4QD2E 5CHNB 1A0QH 1DZBA 2AQ1A 4PRHE 1CL7L 2DM4A 1Q72H 2C1OA 3JT2A 3VRLE 1QRNE 2X1OA 3BEVA 4DKEH 5IROD 1U8CA 1F4WH 4KTGA 2K1MA 1NFKA 1JPFB 3GMNB 3B7TA 3DI3B 1JHLL 1KGWA 1EJOL 2ICCA 1T0PB 2Y25A 4NNYA 4OVUA 2Z34A 1QBLH 3BLBA 3DOIA 3SO5A 3TNMB 3UAJC 1DSFH 4AGQA 4XOCA 1T0NB 2C1PA 1OCOB 5G55A 1JVOA 3OKKA 3MJ8B 2OMBA 5C1MB 4K3JH 1JVKA 5C0CB 5FO8B 3I75A 1WZLA 4XN9A 4MSWB 2AJUH 2N7BA 3M1CA 4FXTA 4MCMA 3PABA 4JO1L 4K3EH 1A3QA 1K2DB 4DO4A 2FNBA 5E6IB 4DHLA 1EHXA 3BAYA 3QDMD 5SWSB 2OMZA 3MQIA 1AGEB 4UQEA 1TJHH 1OWRM 4L37A 3CN1A 1HESA 3D87B 1A7RH 1E4XI 3GXUB 2X4NA 4LEOA 5GS0H 4M7JL 1S7RA 3P77A 1KCRH 1Z3GH 3FT3B 1CD9B 4CU8A 2DQJH 4Y2NA 4XOEA 1A47A 2A4ZA 3RKDC 1LO5A 1JL8A 3PJNA 4MDJA 4YLCA 5HY9A 3R8BB 3WDHA 1EX0A 3CVHL 4YDIH 2J12B 5IQNA 4JKLA 5DJDA 4XMUA 3MU3A 4W68A 5LLIC 5DD3L 3SYOA 2XWDA 3RX8A 4PJDE 1JS4A 4X4YA 3WE6A 4MJ6A 4Q9RL 3UX9B 1DANT 1Z0MA 2J25A 1U8NB 3S2AA 3VWJA 5DA4A 1RD6A 1LLAA 5JDSB 1PKQB 1IC7H 2YGPA 3O0LA 3OKOA 3VFGH 1V7MH 4UIMB 5AW8B 3K72A 1M7IB 2FWOA 2J4WL 3G6JA 1KIUA 4PSRA 4CJ1A 2DJSA 2AXJA 5F96H 2EUWA 1M05A 2J88H 2KLRA 3BKYH 4PJIB 4B96A 4G7YL 4J39A 3FTVA 1L0PA 1Q0EA 1UA7A 4HUVA 1BVNP 3GNML 2QZQA 2YRLA 4XH2B 1T5KA 4PRPE 5JIMA 1ZA6A 4OGZA 5EO9B 4I3RL 3TIDB 1DTUA 3OHXB 3FHAA 4JUSA 4N9GA 5HVFB 3CCHB 3MACH 3AXLA 3QPKA 1HOCA 4P23C 4UZSA 3VMPA 4BCXA 3ELAT 4EKJA 3BWAB 5C7ZA 1CFVL 3WL9A 4DZ8A 3CVDA 3IETA 3N42B 1VHPA 4K23L 4KMLB 1W0VB 3WE1A 5F9OL 3BH8B 4J6RL 2B9BA 1ZLSH 2V3EA 4JGNA 5DD5L 4CBPA 1C1EH 3JWOC 2XOTA 3T71A 3SE9H 4QXGL 2H0EA 1DO6A 1TVHB 5IB5A 3ZK0A 3DJ9A 3OJDB 1K3IA 2AQQA 2F5AL 2Y5EA 4PJXB 2YWYA 3V0WH 3U1PA 1ZE3H 1G7HB 2IH8A 1BQ5A 4JEGB 4PRPD 4PGCA 4YXLH 4XNQB 4BUGA 2VSMB 3KHOA 1DE4A 3ARDC 4FLRA 5DWPA 5FC9A 2WBJA 3VXME 5KSAC 1EK3A 1L7TL 3V0IA 4PRAB 25C8L 2FEDD 4MS6A 1E28A 5I1KH 3BQUA 2JB6B 2K8MA 5HPMA 3AMLA 5E2UH 3OB0H 2D3NA 2WLIA 2DDQL 2PN5A 2EINB 1U8IA 3L7EA 3SQBB 4DUXA 1DVXA 3FUHA 1N7ML 4P9HH 1YG9A 2VWEC 5D7LD 3CK0H 4IJTA 4UQCA 4NO5B 3T08A 1BXAA 1QFWH 1KXQE 4P05A 2GJZA 5F6HI 5HHVL 3QB7C 3VFUB 3GJFK 1AJ7H 4PLKC 3WNLA 5T5NG 2VLME 2AXGA 2CMRH 2AEWA 2NX5D 2VE6B 1NCDL 4P9MH 1BV8A 2HP4A 2P24B 3HFMH 5D7IA 4OBRA 4LIQE 2XT1B 4O02A 1FFTB 3QPQC 4WWKD 5C0BE 3G6AB 4ONFL 5T5FA 4G8FA 2UZXB 3MBWA 1FAIL 4NWUL 1X4ZA 4U33A 1BLNB 2A9MH 3QUZD 4U7SA 1MFBH 5EU3A 1W16A 3QCVL 4R8WH 1A6ZA 4OJFL 5FK9A 4L4TA 1BXUA 2QELA 2VABB 5TQ2H 2EAEA 4LSVL 2WXOA 3V4PH 2GTWB 3LD8C 2YC1B 1H6TA 4YQXH 3F04A 4GMSL 2YUZA 4XN8A 3AWFA 5FA3B 3P4LA 5AKTA 4RGMC 4DOHE 1G1CA 1ED3A 4RGNC 3RA7L 2R23B 1NGXB 2ERJC 4GSUA 2CHNA 4HOXA 2J71A 2VLMD 1U8LB 2V6HA 2HA1A 3IMTA 1CDYA 3GF8A 4K4KA 3HIZA 2BCMA 3RX9A 1X4YA 4KJYB 4ELDA 5EF2A 4PD4K 4LPYA 1VACB 5JPNB 2N0MA 2XX1A 3KDMA 3B8YA 4XWGH 5C0BD 4Q7DA 5I5MA 4YEFA 5T1MA 4TNGA 4GAAA 5LAPA 1JWUB 3ESUF 3TT1L 5LCVL 3WMSA 4UOZA 3QI9C 1EUUA 2EIDA 3OPZH 3QDGA 5E6UB 1KZYA 3A23A 2IVFC 1IBDA 3FB5B 2VH5H 4Y2OA 4AT6B 5BV7L 4O00A 4DVRH 3LKNB 2ZOLB 1CXKA 4QO1A 3QK0A 5CJBA 1U3HD 3FN9A 5EOCL 4NZTL 2DY2A 4YE4H 1PDKA 1RI8A 5CBEB 1FFNB 5DGQA 3TH3T 5I66B 5BZZA 1SBSL 1Q4NX 4H13C 3BCDA 4JLRB 1B4RA 3MYZA 3PGCA 1YEEH 1KBGL 4QHNA 4AYMC 1P5UC 3Q2NA 1YNTA 3CBKB 1E4HA 4ONOA 1IAKA 2AS5M 1TFPA 2KZ1B 4E9XA 3RWIA 5MERB 1T6BX 4YR6B 1KJMA 4D0DB 2FJHB 2ODHA 2EC9T 2JIXB 1T1YA 3MOAH 1BZDA 1ZWIA 5BCAA 1WWAX 3O8XC 3HFFA 3GI8H 1XVSA 4D0CB 3K2UH 4F8LA 3TNNA 2XG4A 1BMWA 5TJWK 2H9GA 2YIHA 2R83A 3P3RA 3MLPA 4ZMOA 1T5WA 2WPGA 1MVYA 1NPUA 4N0YL 5E8EA 1QWUA 5I6XB 1NFDB 4KY1H 3NAAH 1FJ1B 2CLVB 2YAEA 1BFOA 4JFEB 1SDAB 4AOFA 4R5VA 4LHUB 2NNRA 1HI6A 2IPTH 3VWJD 3NPSB 4ZSOA 1D6VL 4G72B 1E8ZA 3HEIB 5B39G 1F41A 1G9NL 3DXAB 3UJJL 1SDDB 2FB4H 4KMTH 3WELA 5AVYB 1MNUH 3RWGB 3AROA 2EE9A 1EAQA 2A2QT 4Z7NF 1GTNA 4H20H 2ROYA 4MFHA 2XXMB 1AP2A 3HPLB 3TBBA 3Q2WA 5GISL 4UT6L 4R3SA 4ZDHA 1A1MA 5JIHA 4JX0A 3QUXD 3MV9B 2IPUG 5FCUL 5SX5K 1NUNB 3M45A 5EBLB 3UZVB 1WBYB 5IJKA 1RK1B 1RZPA 2VISA 2JELL 3IFPB 4JPVL 4RAUB 3RAJL 3TJHD 3FO9B 3BUIA 3ZKNC 2WLLA 1YLBB 4H44C 3RUGF 4X6FA 1MREL 1PF3A 2DI9A 5SWZA 1D5ZA 1U8HA 3DHMA 5I0XA 1JUFA 1TSRA 4PS3A 1OE2A 2Z8WC 2I7OA 3QXVA 3SDAB 3ABLB 4HG4K 5DRXA 2P7TA 4IOFC 3LRGA 2JKNA 5ANMA 2E56A 2F5BH 3BUTA 3VQLA 4OTXH 3OLDA 3K4AA 2BZDA 3OM3B 3LH8A 5DS8A 4JPKH 1U21A 1PQZB 3CZGA 3GM0A 3WNNA 3CZEA 4HS8H 2QMKA 1E2ZA 3OF6A 2J5WA 1F1DA 2R1XA 3APNA 1TZOA 1AYRA 2WAQA 3ZT7A 4PJ8B 4NLAA 1Z32X 1NMBL 3BWZA 2F61A 5MENA 3AFLA 5FX3A 5D7IE 4M5SA 3NSDA 4KH9A 3MJ9H 3T77B 1IBZA 3FPYA 3B5HA 3WY4A 5B7MA 3QQDA 1IE4A 2CHWA 2DWDB 2WBJD 1LDPL 3LN5B 4L4TE 5JO5B 1GW6A 4CN4A 1THAA 5ICUA 1F90L 2A0LC 4I87A 3U7WL 4BD4A 2KH2B 1UA6H 1ADQL 4WJG3 4ZMVA 2NNAB 5B8CC 7PAZA 2R2CA 4KKCD 4HGMA 2DF3A 1AZZC 4KRPD 4AZ8B 5AAMC 2VUKA 1QPKA 2BP8B 1NCHA 3MV01 3NCEB 5IBLC 3L5IA 1Z1WA 3IJYA 5L88H 2ZKXA 4R4BA 3U9UA 2NNCA 3QZBA 4WW2A 3SPGA 3ASNB 4BELD 1YEKL 3UOAB 1UB5B 2DL2A 2FJUB 2EYRB 2VSDA 3IU4L 2WXPA 4G1MB 1NFIA 4MD0A 1QUNB 2XVGA 4N3TA 2JCCA 1JNNH 1INDL 1TF4A 4QXUH 4P2QA 5B1CA 5KWYC 3MYJB 2P8LA 4FQ2H 1NDMB 5EORL 1QATA 5EU4A 1C08A 3L3OA 4Q9CA 4Z1PA 4OQ1A 4RWYL 4J8RA 5I1DB 3BLKA 3QDGE 3WD5H 3V7MA 3O41B 4YHMH 5CIPH 2MEJB 4WGKA 3SYPA 3BP5B 4ZUWA 3RVXC 1RFDL 1WLHA 4U1GC 4QT5B 2ZOUA 4XPTL 2WLYA 4Q4IA 1JAEA 1KTCA 5FHAH 1LEGB 1S9XB 1U3JA 4ORZC 5SV3A 1QQDB 5JW4Q 4ZFZB 1TZHA 2FJFB 1XGPB 1CZ8H 3O6FC 4MNQB 1PZ2A 4FHKA 3HG4A 3U0TB 4HJGB 4PJAB 1RZIA 2ZWKA 4NXSA 4WEBH 4Z0BH 5KYWA 4AEEA 4BKLB 2XTLA 1VCBC 3HLAB 4TPRL 4HIQA 5FW6A 5MEPA 5HHPA 2EEXA 3IPFA 1CUOA 2DJMA 5CCKL 1OP3H 4PW9A 4Q6KA 4B50A 1G7LB 1QWNA 5DEFA 1MJ7L 4DGVH 3E8UL 4PJEB 5T3XE 1HHGA 1HH9A 2HG5B 1A25A 2H47C 2PCPA 1P1VA 5HDBB 3QDGD 5L2KB 1ZPUA 2EVGA 4FFZH 5FYKE 1UQSA 3MV7A 3OWRA 3TOPA 5I82A 2BVEA 2XLLA 4HKZA 1MJJB 4OCMC 3HTLX 3NFPB 3OJVC 4AVHA 3VFOB 1IAOA 4LMQI 3UEQA 5I28A 1CE6B 3KE0A 4MMXC 5EZPA 2DH3A 2UX7A 3JXAA 3GZOA 5HYSB 1A6VH 2VM3A 2XVBA 4Q9QL 2XETA 3DHJA 2FDBP 4GW5A 3EFFA 4P04A 4ZO7A 2LVCA 5ADOL 4QF1B 4WTXA 4CRPA 3ULUF 2CHDA 4ZSOE 1NANH 2WQRA 3FRPA 3AVEA 1A9BB 1JF1A 5M94B 2EDLA 4M4RB 1TENA 4PWEA 2C3XA 2O72A 3BKJL 4I4WB 3CFCL 2HFEB 4ISVB 2OQJA 2DKMA 2NY3C 5T3XD 4X6CF 2AK1H 1RZGB 2ZTBA 3Q2VA 3CZKA 4IBUA 5FYKD 4OFYA 3O2VL 2AMGA 4LVHC 1JZGA 3JTSB 4OIFA 1SEQL 1M9SA 3IFLL 4F7EA 3H9YA 2X4UA 2VW6A 1B9ZA 1F11B 3LPOA 4NO2B 3U46B 5SWZE 1FV1A 1AFVH 1OGTB 1RVFL 3LS5L 1OARH 4MMZB 2C7UB 1IQDA 4QTIL 3F58L 5FUZL 4B6ZA 1AGDB 4IU2A 4CSPA 1S7VA 4NSKA 3WJLA 4NB7A 5EZJA 5ANME 4FFWC 2OTPA 3LB6C 4B9GA 3BSZH 4KVNH 1OB1B 2VR6A 2VQTA 1FIGH 3PG2A 5EWIH 1XGQB 3C9NA 3KAAA 4FMFA 4A6YB 5CMAA 1OAKH 3KCWA 5CBAA 4LLYB 1J5CA 4LPWA 3FQRB 1MELA 1FGVH 4LOUC 5ACLA 5T1LB 5C6TH 3D09A 4YNYA 2AAAA 3C09C 4PRDA 2ORBL 3WKNA 1D7DA 3L4UA 3VD7A 3MUGA 4KTEH 2YR3A 3QQXA 5MENE 2VL4A 3MAWA 3GSNA 1YEIL 2HKHL 3S5LA 1IGCL 2YS4A 4NJ9H 1TO4A 3VM7A 1DFBH 2BNRD 3EAKA 5FYKU 5K59F 1LK3H 5SWZD 2OP4L 1MUJB 3F85A 1IBGH 1MW3A 2HB0A 5ICZA 4BFOA 1QW8A 1NZRA 4PJGF 1XF2B 5F7YC 2YMTA 5DMJB 2YKLL 1SXNA 5CCHE 2C7FA 3X1NA 3IPBA 1JNHA 4A39A 2E9GA 1D9KA 2BSRB 4QHMA 2EDJA 1DQIA 1AGBA 4EDXB 1H8NA 2BFVL 3MCLL 5HP5A 2XTJE 2DJUA 3UPCA 3VWKA 3IVKA 3VRJB 2BNQA 2Z0BA 1FORL 1F4HA 5FECA 3FO2A 5GRXG 3OF6D 3R7QA 5L9DL 2RALA 5CO1A 4ILDA 1S7TB 5F8QC 4BFKA 3QC6X 4J3WA 4Z76A 3CFNA 4M48L 4XNMA 1P2CA 1IC1A 2DM3A 1MDAA 5E94B 2JCCE 1WD9A 2OLDA 5F0MB 3TU6A 4AVIA 2XQYK 3KVQA 4LNRA 1AGFB 2WVSA 2XV3A 5M95B 5GS2D 5TQ0H 3HS0A 4PIRF 5A43C 2Y06H 2EICA 3X1EA 3G08B 5E8PB 2J72A 3EBGA 2Z6FA 4UINH 3CAFA 4WTZG 4XHQA 5EU7E 2X4TB 3L16A 3U4KA 3UTZB 3QYMA 5B38A 1E90A 3CIQA 1YQVL 4FTVA 5E6YA 4G43B 1X5IA 4Z7AA 3MR9B 1DSYA 4P5KA 4PJ5B 3ZE2F 3H3PH 3KLQA 4NN6B 1AS7A 5SWQB 4HV8B 4M6MH 5DYOB 2A9BA 3F01A 4PLNC 5ID1A 1UACL 2XI9A 2YAHA 1NGZA 3HG0A 3QNZA 4QY8A 1QVOB 2YJLA 3FRUB 4HJ1A 5EC1B 2VL5A 4U1MB 5BO1H 4P2QD 2D2CC 2B14A 3WN5A 2QGBA 4QNPF 4LVEA 3ARBC 3TV8A 4M1GL 4F91B 1WV7T 3IF1A 1J1PL 3BDBA 5GJSH 5HVWA 3D7PA 3MV7E 2GK0A 4XNXL 3NRFA 2IGFH 1V3JA 4IDJL 4BQ8A 2DS4A 2YPVL 2X9ZA 1YY9D 1DO5A 32C2B 5EEWA 4IRZL 2OTUB 4PFEA 2XWJA 4IMLB 4ZX6A 2GBAA 4GP4B 4N6QA 4YBQD 1VPOH 4XZ4A 5J1SC 3DOSA 2CAKA 1FZOB 4U05A 3LQZB 2KC0A 3FT4A 4KZDH 2XN9D 3SKOB 1IC4L 2P5WB 3ARDB 4B9JA 3V4PA 1AXIB 3PL6B 3MTXA 1DJSA 1F4XH 5KSAB 4Z7IA 2CO6B 4JZJA 2GI7A 4OH2A 3U9PH 4YIQA 1DUYB 4AK2A 4RSYA 2NPLX 2OXGA 5DJ8B 1EHLL 5BV7C 4PUBL 3OZ9H 2BC4B 1HWWA 4RH4A 3STLB 3W3BA 3A47A 3T6ZA 4L5FH 5IJVB 2CBPA 5KSBB 3QH3A 1AGCB 5BVPL 3X3FL 2J20A 4HCRA 5DYFA 2YEZA 4KKQA 4JHWL 3NBNA 1JGDB 1U58A 2YUXA 3GM8A 3PWPB 3ESVF 3GMLA 4XWOD 3RWDA 1I9RH 2VJ8A 1KTRL 1FCGA 4TN9A 4LDCA 2C3GA 4NLHA 3RVUD 4AYDC 3SDCC 4Q74A 3L3DA 2AI0H 2BOLA 1DBML 3UAFA 2E46A 1JV5B 2CIKA 4L3ED 5LBVA 1IIKA 4RAVA 1I3RB 5IB3B 4XI5D 4ZS6D 3HN8A 1JPSH 2PMZA 5FGBA 3UYRH 2HKFH 5EZOH 4DK3A 3LD8B 3INUL 3NZSA 3FN0L 4KTDL 1PX3A 4BQ6A 3IBOA 5F1IA 2IJ0C 3OKDA 5CFHA 5HXMA 2FL5A 4N28A 4TVPH 4OFYD 2VMDA 2L04A 4QHKJ 2WJ5A 3HE6A 5AKRA 3A6BL 1Y6MR 4RGNB 1YDPB 5DF0A 2OTWA 1GGBH 3L3HB 2ADYA 2ERJB 4LOVA 3BP6A 1W9XA 5CJXA 3Q43A 4AV4A 1L9NA 4QHLB 3CXHK 3N0AA 4JDZB 3SPVB 1QA9B 4IKKA 3REVA 4PEEA 3LKSB 6PAZA 2EDRA 4UANA 1G9NC 1N0LB 4K9JA 2ZWZA 3FUEA 5GS0D 5FYLL 1YAZA 2Q87A 1RP9A 5IJBC 2AP2A 3ILEA 4LCYB 4GKLA 1XL4A 3FO0H 2X2JA 4IRJA 4PY8J 3QI9B 4HIEA 4UTBL 3VW3H 1MCDA 3ECWA 5DHYB 2BNQE 3UZEA 3HMWL 3TEZA 2EDYA 3KPSA 3KH3A 1RUPL 2A6KB 5KOMC 4IGBA 1AZVA 2ESVA 1OHQA 1YYCA 3JUYA 4G70B 5AUMB 1TVBB 3T8XA 5C3LD 5CR8A 3MROB 1W0WA 3JV4B 3ARZA 4KWUA 5TE7L 5IQ9A 4DVBA 4NHUA 5H37G 4UNTA 1NDGA 2A1WH 3O2WH 3LXUX 2NY4D 1P5UB 3SDXE 1FFOA 1UATA 3EFOB 2AEQH 5MEOB 1FDLH 2CHXA 3EIFA 4IBZA 5DFTA 3REWB 3SY0B 2OS7A 4FTVE 1K4CB 4DP1X 1NBZB 4DP4X 2QGDA 5AB9A 1D9KD 2QVTA 3ZR5A 2EVHA 4YBHA 2BDNH 2NY5H 3DVIA 1R5WB 3IMSA 2QGCA 1J5OL 4JG9A 3O8XB 5T3ZE 1DQDL 1OTUD 1N2RA 1SOXA 4BWTA 3VWKD 3NPZB 2XYBA 3GSQB 1XBDA 5AOLA 1Z5YD 1EAPA 3G6DH 2DM7A 5FCSH 2E86A 1KCLA 2N3JA 3BGAA 1RPKA 3MLSL 2VC2H 4F7CB 4W9FC 4AQAB 2VXQL 1OT1A 1SN5A 4S1SL 4NRXA 5AW1B 5DFVC 4HD5A 1AXSA 1K6QH 3Q6FA 5C0FA 1RIUL 3D2UA 3IFOA 4U7MA 4FQ1H 3ZDYF 3FYEB 3QJHA 4HUXA 2MCPH 2BHYA 3FQWB 4MJHA 4KZEL 1I3GH 2YD3A 2AC0A 3ZTJG 4AQ8C 2WWNA 4DKFH 2XFXA 2Z4TA 5IOKA 2JKTM 5E8DH 2IQAB 2OSLA 5D7JA 3BI9X 4LCUB 5ISZA 2QLVB 1Q1JH 3VFSB 2VDMB 1CXFA 1NDTA 2ZKHL 1OGSA 1FCCA 4C54A 5F89A 5FA4A 2IH3A 1IL1A 3LH2H 4P59L 4YOKA 3P40A 4GMTH 5T3ZD 5HHNB 4UV4L 1BJ8A 3JTBA 2X9WA 3BIKA 4IBLT 1JF6A 2HFGL 3T3MB 1LTXA 3X14A 2DLFH 4XBEH 5J56B 1DBAH 1WEJH 2WQWA 3ZO0A 1LO3L 3NEEA 3QIBC 3MN8A 3FTWA 4QRRB 5F7DA 4XTRC 4PGEA 2QTEA 4JUTA 1KV3A 2AJ3B 4J2XA 1ZV2A 2NQ3A 1FC1A 1JPTL 5J1TC 5JHBA 4G6ML 5L8KB 5IVXA 3QZOA 4A7UA 1A6AA 2NCEA 2B15A 1K9TA 1I85C 3FT2B 4HIXL 2OCFD 1QABA 1NCCH 4ZS7H 2DWEB 3NABL 4HUNB 1FNFA 4XVJL 3JTTA 4X98B 3HNTL 2G60L 2ATPA 2EACA 4IM8A 4MS8D 3SDDC 4ZW3A 2VITA 3W39B 1P4UA 3F62A 2DBLL 1AD9B 3PLYA 1BMGA 3JV6A 4PG9B 4YHNA 1KTLA 4KK6D 5I19H 2L4OA 3IDJA 5HJ3B 1J5IA 4HJJH 1GZPA 2D0HA 4ZT1A 2LAGB 3IJEA 4H0HB 4WI5A 3N9GL 4PWJA 1QLEH 3C5SB 3EJJX 1E50A 2B59A 4LO9A 4OV5A 2VNCA 4ZNCD 3MLYH 3ZL4L 2ZOWA 1U6AL 5DHVB 2AEPL 2D9CA 3MRHB 4UT9L 5F1OB 5B8CB 1CGTA 3LNGA 4M6NL 2Q7YB 1T7YA 2FO4B 4H5SA 1XT5A 4NKQB 5LQBH 1H3PH 5DC0A 1Z9MA 2PR4H 2UXGA 1FGNL 3PXJA 4BA8A 3K6OA 3VXTB 4J27A 2CUMA 4O4YL 1ZHKA 1Q0XL 1KYDA 5GRUH 4EXPX 2HLEB 2R4RH 4P46A 4B3EA 5K9OA 5TF1H 2FSDA 3FH5A 1NICA 3C5ZC 4X6EA 4OLVH 4YEEA 4N8CH 4C56D 4DGIH 2H6OA 4G6FD 2ZSVB 2W60A 4ORGA 1UEMA 3TN0C 1WDAA 2EKJA 2GIXA 1HXYB 3X13A 2WLKA 4PPTA 3TV3H 1TYEB 4C55A 5LHDA 2P8MB 3HR6A 1CFBA 3FDWA 5DZVA 5DJYA 4NKDB 5I0VA 1P4IL 3MV11 1P7QA 4XPHH 1M53A 1WG3A 1YEDA 3GXTA 4U1GB 3KPSE 1GHFH 1H8SA 5F0JB 4FNLL 3H9HB 4U6YA 2VW7A 1RIVH 2ESVE 5EFIB 3TT3L 5LGJA 2AJYH 3HE6D 4IRSC 3TO2A 5B4MC 5CGTA 3CLFH 1A4JB 1D6EB 3CMGA 3W11C 2E5EA 3SE6A 3O3BB 3T2NH 4ETYA 3IKKA 3EDEA 4KNUA 4YC2C 1XB3A 1GYAA 4JFTA 1BREA 1BQUA 1MIEL 5EOTB 4OCWL 5IMKB 1S9WB 2NY7H 2NY0B 1LO0H 5AB0A 3IGKA 3L5XL 1MF2H 1EO8L 4WQOA 1TT6A 3ZO9A 3IB4A 3ZUCA 5HHQB 4JRYA 4IRJD 3F2LA 3U9WA 1ZHLB 2AJXH 1WITA 1HHKA 1SEBA 3VX1A 1FLRH 3V10A 1I8LA 3QQ4B 4NUJB 4QRTA 1HCZA 1FZJA 3WSQL