1JXGA

The 1.6 a resolution crystal structure of a mutant poplar plastocyanin bearing a 21-25 engeneered disulfide bridge
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
100
structure length
100
Chain Sequence
MIDVLLGADDGSLAFVPSEFSCSPGCKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN A
publication title The 1.6 A resolution crystal structure of a mutant plastocyanin bearing a 21-25 engineered disulfide bridge.
pubmed doi rcsb
source organism Populus nigra
molecule tags Photosynthesis
total genus 27
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1jxgA00
2IWEA 3X1FA 4QKTA 3CVDA 3UGEA 1PNDA 3T71A 2FT7A 4QLWA 2PP8A 3QJQB 4YSUA 1NPJA 1N68A 2VSMB 1IUZA 2AANA 3TU6A 2QPEB 1L9SA 2UXVA 3PCYA 4GP8B 3NJIA 4PAZA 2BZ7A 1BQ5A 1RCYA 2HX7A 4A2GA 4E9VA 2IDTA 4DP2X 5I5IA 4K9JA 1HAWA 3X1GA 2MTAA 1AZUA 4KNSA 3WIAA 3X1EA 3IE9A 2HLEB 2CCWA 4A2EA 3WNIA 3EH4B 3T6VA 2XV2A 2IH8A 4GY4A 2BP0B 3FSWA 4E9XA 2CAKA 3U25A 2PPEA 4M3HA 4MFHA 3NJGA 7PAZA 1MZYA 1PY0A 3DTUB 1DZ0A 2HX8A 2FT8A 4F2FA 1BEXA 2EINB 2GC7C 4E9QA 2PLTA 1TKWA 3FYEB 3CG8A 5B3SB 1RZQA 5I5JA 1W6LA 4DP7X 1J5DA 4PCYA 5TK2A 3FPYA 4YVNA 4DP4X 2FQEA 1NZRA 4A68A 3V9EA 1GSKA 3NJKA 2QDWA 1BXUA 3SBQA 2DY2A 2UXFA 1FA4A 2EILB 4P5SA 1HFUA 2BP8B 4N8UA 5D4IA 3EHBB 3FU8A 2HZHA 1AANA 1AZCA 1BYPA 1V54B 1A4AA 4BWWA 3NSDA 1QNIA 1TEGA 1EZLA 2HRHA 2XVBA 4E9TA 3AG3B 4YSEA 4G7SB 1SHXA 1PLBA 2J5WA 3JT2A 2DYRB 3WKPA 1AS7A 5I28A 4L0PB 2XLLA 2AZUA 4DP5X 4HHGA 2XXFA 2OJ1A 6PCYA 1PF3A 4HALA 1V10A 2JFCA 1NIAA 1T5KA 5PAZA 3PXLA 1ADWA 2Y1AA 3EH5B 4CSZA 8PAZA 3MX0B 1NIBA 1NPNA 5F7BA 2IWFA 3H56A 1AR1B 4G7QB 3NJJA 5B1BB 3GXUB 1MG3C 1W8EA 3FSZA 1M56B 2FJSA 5B7EA 4A2FA 2BWDA 3PPSA 3UADA 2VM4A 1SF5A 1AZRA 2W8CA 1WS8A 2VW7A 3AG1B 3ABLB 4A2HA 2CUAA 2OV0A 5F7AA 4JHUA 4YVUA 1J9TA 1AG0A 4BDVB 4BWUA 1ZIBA 2YAFA 1JZHA 1R1CA 4A66A 2GHZA 2Q9OA 1ET5A 2YAOA 1ZPUA 2EIJB 3S3CB 2A3TA 3T6ZA 3UAEA 4E9SA 1PNCA 2XU9A 3OD3A 1CC3A 5D4JA 4AZUA 2XX0A 2VMJA 5E9NA 1GY1A 3NSFA 3NT0A 2FQGA 3N55A 3FU7A 3T6WA 1E5ZA 2AVFA 3ABMB 3NSCA 1CUOA 2BO0A 4YSOA 3T6XA 3JTBA 1F56A 2FT6A 1SDDB 1GS6X 2XUWA 2J56A 3AY2A 1BXAA 4ZK8A 4GXFA 4DP9X 1OCCB 2R7EB 4NAJA 2H5UA 4YSTA 1ILUA 1JZGA 2IH9A 1NDTA 1SFDA 1YLBB 2X87A 2XYBA 3WI9A 4F7KA 1BQKA 4HAKA 3PAUA 4BWTA 1UATA 4KNTA 1ZIAA 1JVOA 1KDIA 3NP4A 3TA4D 4HCFA 9PCYA 1CYXA 2MRYA 5IY5B 2HXAA 2PCFA 2VW6A 4W1TA 3T9WA 2XV3A 4HCGA 2QDVA 2PPCA 4ENZA 5I6KA 2VSKB 1RZPA 2XV0A 1PMYA 2LLNA 2PPDA 4G72B 3ZIYA 1A8ZA 1I53A 1PLCA 4G7RB 2E86A 2PPAA 2XX1A 3SBRA 2EIKB 4DPAX 1GS8A 1PZAA 3X1NA 3FS9A 4YSRA 1FFTB 2YARA 3KW8A 1OCRB 4W9ZA 1NIFA 1E67A 2WSDA 2JXMA 1CYWA 1KYAA 4YSAA 5I26A 1X9RA 1DYZA 4FAAB 5I5MA 2WO2B 1WA0X 2UX7A 1MG2C 1SHWA 1AOZA 3WNJA 1SFHA 3ABGA 1VLXA 2Y69B 2TSAA 1XB6A 2ZONA 3QQXA 2AZAA 2J55A 3SBPA 2PP9A 3BQVA 1NWOA 3FQ1A 2DYSB 4AX3A 4JHVA 4KO5A 4RH4A 5PCYA 3AG4B 4P5RA 1AIZA 1NIDA 5I6MA 1J5CA 3CDZB 3IN2A 1A3ZA 4UAHA 2YXWA 2ZWNA 1BXVA 5B1KA 4NB7A 2TSBA 1JOIA 2GBAA 1OOWA 1IKOP 4CSPA 4BXSV 1JZFA 2FQFA 2VN3A 3DIVA 2YAPA 4E9WA 3N2JA 5ANHA 3OQRA 3EH3B 3FSAA 3UABA 3S3BB 2ZOOA 1KCWA 1ET8A 3S8GB 2IDFA 3ABKB 3G5WA 4YSSA 2GSMB 1ASQA 3RYMA 1NIEA 1JXDA 2WO3B 1TEFA 3QJSB 2IDUA 2FTAA 2YAMA 4G71B 4BK5C 1XMEB 4FA7B 2RACA 3AG2B 5TK4A 2VW4A 1KBWA 1AZNA 4KOCA 4WKXA 5LDUA 3H4FA 4NERA 1ZV2A 3KW7A 4F2EA 3OMNB 1SF3A 2VM3A 3DKHA 2UX6A 4N4YB 1SNRA 4WTQA 1EHKB 2IDQA 2BZCA 2DWSA 3NSYA 2DV6A 2P80A 3TBCA 3IEAA 2YQBA 2GC4C 1RKRA 2GB2A 2YXVA 3HB3B 2OCCB 3QJUB 1AZBA 1M57B 1V55B 4JKNA 3CVCA 1L9QA 1WA2X 1AQ8A 1WS7A 2AFNA 1PLAA 1CURA 3QJTB 1OCZB 2I85A 4KNUA 4UANA 4A67A 1A4BA 2R7EA 4AI7A 3ERXA 3UAAA 1KCBA 3S8FB 1ZDSA 5B7MA 3GYRA 1MZZA 1KGYE 5B1AB 1JXGA 2EIMB 3CZUB 1ASOA 3IBOA 3NJFA 1L9OA 1TU2A 3WKQA 2IAAC 3NJNA 1PZCA 2BP0A 1OE2A 2I7OA 4HHWA 4HZ1A 3NJMA 1GS7A 1J9QA 4KO7A 2CJ3A 5EHFA 1E30A 1FWXA 1M9WA 1JZIA 4TXVB 4E9YA 2JKWA 3FYIB 3FU7B 2FQDA 3H4HA 4YL4A 2YAQA 1OE3A 2GI0A 4DP1X 5B1JA 1BAWA 1XB3A 2UXTA 1J9SA 1URIA 3OM3B 3FT0A 2FNWA 1W6WA 3HEIB 1ID2A 1AAJA 2B3IA 1GW0A 1J9RA 2QT6A 1AG6A 2CALA 2W88A 4X4KA 1A65A 3PLYA 2IDSA 3ZBMA 1WAEA 1JVLA 2BP8A 4AKPA 1L9TA 2YAHA 3L45A 1OV8A 3QPKA 4KOBA 3TBBA 3IN0A 2FWLB 3FQ2A 4YSCA 2PPFA 2QPDB 1AS8A 1NINA 2H47C 4YSPA 1JERA 3MBWB 5AFAA 3C75A 1N70A 4EF3A 1GYCA 1ETJA 2BW4A 2N0MA 4UF7C 5I6PA 5I6OA 2XXGA 1GY2A 5B1JC 1OF0A 3CVBA 4GP4B 3CDZA 4G70B 3S3DB 1ET7A 4M4RB 3X2QB 3FPXA 1GR7A 1OCOB 3QJRB 1XB8A 3D12B 3TASA 2Q5BA 1QHQA 4BXVA 4YSDA 1ZDQA 2I7SA 5FC9A 2H3XC 3FSVA 3ASNB 6PAZA 4KO9A 4Q89A 4YSQA 5D4HA 4DP8X 2DWTA 1JZEA 2BWIA 1SJMA 1BYOA 5I6LA 4DP0X 4DPCX 2IWKA 3SQRA 1BQRA 4GYBA 5A7EA 3V9CA 4HIPA 1NICA 3ZDWA 1NWPA 2HRGA 3FU9A 3BVDB 1PZBA 3GDCA 1PAZA 2PCYA 2X88A 5B7FA 3OMAB 2B08A 2BW5A 2CBPA 3UACA 3AZUA 3NJLA 4BDVA 4GP5B 1L9RA 1AACA 1NTDA 2XWZA 2GIMA 3WG7B 3ZX1A 1IC0A 2P80D 1MDAA 2UXGA 1HAUA 1B3IA 7PCYA 3QJVB 4E9RA 1KV7A 5AKRA 4KO6A 1PCSA 3FQYA 4AKOA 4Q8BA 1OE1A 4A2DA 1E65A 3NP3A 1JZJA 3NYKA 1KBVA 5I6NA 4HCIA 1A4CA 2ZXWB 1AS6A 2YAEA 4DP6X 2J57A 1SDDA 1JXFA 1IBYA 1KDJA 1WA1X 3ASOB 1IBZA 3OMIB 1L9PA 3EF4A 3AW5A 2BHFA 4AKQA 1E5YA 3NJHA 2NRDA 2PP7A 1X9UA 5AZUA 1QLEB 3PAZA 3PAVA 4DPBX 1ILSA 3X1BA 2HX9A 1ASPA
chains in the Genus database with same CATH superfamily
2EDWA 3X1FA 3D33A 2P5EA 2EUWA 3ROLB 5J13B 3COOA 2VXUL 1JK8A 2HJLB 2NY4D 2XZAH 3ZUNC 3QFJB 2Z93A 2F0CA 1SPDA 3G6AB 2XFGB 4GSRA 1QRND 5DJ8B 3QQDA 1FHNA 2VZSA 1JGLH 3BWSA 3CFDA 4MAYC 1IGYB 1KJ2H 3FQXA 5D2NE 5AWNL 1AHMA 1DUYB 2XY2A 3PABA 5LG6A 1MWAB 3AREB 2YRBA 4H20H 1SJEB 2EDOA 3OKDB 3UTQB 3MJGX 4K9JA 3ZQXA 5C7XH 3GM8A 3TEYA 2W81C 3L4ZA 2Q8BH 3MODL 3NA9H 2K6ZA 1XR8A 5EC1A 1JF6A 1GPOL 3TPUA 1J7VR 4E9XA 2YPLE 1HEJC 3QORB 4KUZL 2P7TA 2NY5C 5F1SA 2ITDB 2JLPA 5MHSD 2HX8A 4UZUA 1T89C 5BMFH 3IDJB 1MCQA 5IB5A 2VLRA 4KY2A 3QJFA 3Q8EA 3TO4B 4ZDHA 3TO2B 3ZL1A 4ADGA 5HGHB 1MAMH 1T0NB 3WXWL 3AVEA 3BE1H 5T1MB 3MXWL 4XC3H 3OKOA 3B9KD 4B95C 3GSXB 3CHOA 3SKJL 3U4BH 2CQVA 3V9EA 1GSKA 4LFHG 3GZPA 4Y4FB 1FA4A 2XWBA 3HMWH 4AYMC 1FV1B 5C0EB 2IPKA 5FK9B 4M1CD 4QXWA 4NI6A 4HWUA 3RURA 5EBLA 1IILE 2IMNA 4HISA 1Q94A 1V05A 1AANA 1I4FA 4Q6IB 4LSTL 5FYKE 4XO9A 1CI3M 2G30A 2E8YA 3BQUC 3MCG1 4PS8A 5IT2L 5ACZA 4M7LH 2A73A 4YQXL 1ZT1A 1PLBA 1XXDC 3B7TA 3JT2A 2V7HA 1NOLA 3ZDXE 2E6PA 2XLLA 4G43A 5HDLA 2VQUA 1AMXA 1EEYB 1HVXA 2CGYA 4L4VB 3QC6X 1QTPA 1YEDA 3IFPB 2Z7ZA 4X9GA 1YECH 2BSRA 5HYSG 4ZTPL 3QIBA 3QCTH 3VXUA 1XF5A 1KTDB 1M4KA 3L7EA 4KC3B 2NUTA 1BAGA 1UKQA 1IAII 1G9NC 1HHJA 4FG6D 2X38A 3D1MC 1M6UA 1VPOH 2ADIA 2VL4A 4XX1G 2CBOA 2Q7AA 2MQCA 2WWOA 4BFNA 1M56B 4HXBL 4BA8A 1JD7A 2QPFA 1MCSA 1G9ML 3T0EB 1AZRA 5F88B 3O6FA 2GJ6B 2UV3A 3ABLB 1G7QB 4JLRB 3HHSA 3T0DA 2KUTA 3FCTA 3QH3A 5IF0B 1KY6A 1ICTA 4IOFC 1Z3GL 2EIZA 2DQMA 3PL6A 1AO7A 2YAFA 5KBMA 3D09A 3MA7A 2Q9OA 2AJZB 4UIKL 4XP1H 1XV8A 7FABL 4PJBE 3LB6C 1M53A 1NBQA 1YHPA 3MRCB 5FYLH 2WJ7A 2A3TA 5JORA 4FKKA 3P4MA 3WN5A 2NLJB 4QRPA 4U1GB 5DS1A 2FK9A 4DVRL 3NJVA 3T8XB 2DQFB 5BRZE 3QHFL 4GMSL 1WG3A 4HPOH 2CMRL 3RVVD 2WGNB 3DIFA 4EO5A 4RWYH 1XBRA 5B8CA 1MFUA 3FU7A 3QUZB 3T5WA 3PWUA 4GMTL 2WVUA 2EECA 5ISZD 1TQSA 1BQHA 3HC3H 1Z9SA 2FH6A 1I3UA 3D9AL 4PRIB 1U8PA 1YQVH 1SDDB 3L2NA 3LN5A 1U8OA 1QMUA 5BZWA 1KPUB 5DMGC 2ESVD 2H5UA 1G6RA 3L1OL 3ZYIA 4AH2A 1A4KA 4BA0A 5FEBA 3FO2A 4G80A 4HSAC 4UTBH 1IB5A 3UAFA 2KZKA 4TULH 1PJ9A 4JQVC 1XH2A 2APWA 3FF7A 2DS4A 4AIXA 3K6SA 4P57B 1D5BB 1KIQB 1C5BL 1A6ZB 4MNGE 5IY5B 2UVEA 3W9DA 5J13C 4LGPB 2O1AA 3FTXA 4CN1A 2VE6B 4BFFA 5L4FA 3QQNA 2X5PA 1BFOB 1XD0A 4OGXL 3RDJA 4EI5D 4HH9A 2EEDA 3SHSA 2PR9A 5I74B 4FXKA 5MEOA 3RFZA 2WCGA 2AEQH 1UZ6E 1ZANL 1E4KA 4JFSA 1IIIA 5DZAA 1JJUA 2EIKB 1TSHA 2APTA 3X1NA 5E8NA 2B77A 1HH9B 1NC2B 2XPGB 5E4EB 4AMWA 4LEOB 1IEBB 5EPMB 3W81A 4PJEE 4HBQA 5I0ZA 2ORBH 4U3SB 4O02B 1MY7A 2FVNA 2HTKC 5TDNA 1C08A 4X9HA 2HAZA 3QORC 4U6VL 3QUXD 2ARJQ 4TUKH 2QKSA 3WSQH 3U4KA 4D0BB 4RZCA 3RVXC 2A9BA 4XCNA 1D5ZA 1UWEH 1UG9A 2GT9B 3C08H 3OB8A 2AERT 4GI8A 5JA8B 3FFCB 5AOLA 4JFFD 4J3VA 1LQSR 4ODWB 4M3KB 5DD5L 4AX3A 2FWUA 4I2XA 1JZ5A 4RH4A 1SOKA 1OGAD 4ZAKD 2P52A 3E8VA 2A1WL 1KYOJ 3MOBL 3CU1A 1IJNA 4J8RA 2V3FA 3QIUD 4NO5A 5IQ7L 4UB0L 3DOIA 4OCSH 2DQUH 1P6WA 5F44A 4MS8D 1YEFL 2CJUH 4KJWC 5BV7B 1TZAA 4RGND 2FQFA 3D3VD 1YNTA 2YAPA 2L7EA 1SLWA 1MQKL 1Z5LA 4LCYA 4R5TA 5CLTA 4PRHA 1IGCL 2V2TA 1I8IA 4PR5B 1LP9F 4GFTB 2D9CA 1YNKH 2DJ4A 1JGVH 1BZ7A 4G71B 2ZG1A 4BK5C 1W16A 5EU6D 1PCXA 3JV6A 5J6HA 5JIQA 3FUJA 2VKWA 3HE6B 2N3JA 2GAZB 2I07A 1E9QB 5DLLA 3JVFC 5EO9B 3KS0J 3VH8G 3ZLQC 3N43B 1BHGA 2FLBT 2AXGA 5GGTL 1JMZA 2BHUA 2OCFD 1CGXA 5CEZE 4HGWA 2DV6A 2NY0D 1QA9B 1TYRA 3NZHL 4YOKA 2OCCB 5CAYB 5HDQL 4IKIA 2FWSA 5A2JH 3P11H 2VABB 1MRFL 4OCNC 5D1ZC 4K07A 4HAGA 2JIXD 3NN8A 3CVCA 1WA2X 4HWEH 3V0FA 4NO0B 2VDLB 2JB6B 3K71A 5BZZA 3JTTA 3VWJD 1EUTA 1ORSB 4OD2B 3ULUH 2K8MA 1QTYT 1RZIA 1KB9K 1DDHA 2FECL 1CR9L 3IWVA 1INDH 4OCXH 3WNPA 1JG9A 1B3JA 4X5WB 1QWNA 2FD6H 4I1RA 1AD0A 4JY5L 4Y4KA 3KS0H 3D51A 1SGKA 2ZOWA 3SDCA 1YUHA 1CFSB 4YPGB 4FS0A 4X0KA 5HDOA 4P4KB 4PRNB 5DFVD 1CT8B 2P5EB 1BBDH 3SDYH 1A7OL 5AD0B 1JK8B 3RTQD 3ZDYE 4Q2ZA 3LEVH 1TG8A 5TQ2L 3P30L 4B96A 1BZ9A 1QRNA 3L3JA 5E1AB 5LJYH 2L7JA 1T7ZA 1S9VA 4YGVA 4FC3E 3FQXB 2GTWA 1HINH 2YMOA 5E2VH 2ZUTA 4B9JA 2FB4H 1XF3B 1A2YB 4PCTA 3PABB 3NCBB 1Q9KB 4GUQA 3MLVH 5AL8A 5IBTH 4X50A 1K2DA 1OW0C 3H3KA 4GXUM 3RDTD 1KB5B 2IDSA 3BWAA 4OJFL 5AUMB 2IH3A 5DZOA 1PBYA 1P1VA 1XR8B 5A7BA 5GXBB 1IARB 5F1KC 1AHWB 1ZS2A 2R1XA 1Z3RA 4L05A 5JXAH 1CO1A 3MRJA 3SY6A 1NMCC 3EYSH 5EBWA 3HS0B 1EBAA 1HSAB 3MBWB 3T3PE 1UZ8A 1HHHB 4XCCL 3VG0H 2XNAA 3BESR 4QRRE 2MQGA 1EEQA 1I1CA 3KWWA 5AWNH 2QGCA 3BP7B 1QG3A 3FHQA 4RRPA 5F1OB 5I18H 4LSQL 3UYRH 4HKZA 3VGHA 1ZHLB 3CVBA 1JF5A 3I9GH 1HZKA 4AUJA 1RZJH 5E4EC 1O6SA 1MFVA 1UA3A 1TZIA 1IFGA 4A1RA 3B9KA 4I0PD 3IPEA 3L5JA 4XAKD 5B38A 2I7SA 4Z7UE 1TXKA 2YK1H 3D0AA 1XTLA 3BPCA 1U8NB 4KO9A 4OFIA 3NCMA 4ZO8A 3S3JA 5I1IH 5K59F 1G7HA 5ECGA 4W9IC 1MCJA 3VXMB 4F92B 4QHUB 3MOAL 5ACZB 3FT3A 4R90H 1T66D 3VFVA 3BSGA 2HRGA 3CVHH 5GHWH 1PFOA 1G4RA 4HH8A 5J56B 3FUMA 3FQWB 2IALB 2AQSA 2B1OA 2E6JA 4M9PA 4RETB 1QLEL 3SQOH 1OTTC 1YEDB 3MJWA 3L9RA 1UM5L 1Z1WA 5IQNA 1AGFA 3MUGB 4ZFOL 2YWYA 1CTMA 4DKEL 3ZX1A 5DJDB 1FZKA 2W60B 3AUWB 4U1HA 3QDHA 4Z7VA 1A7RH 1TYJA 3BVXA 1TJXA 3L7EB 4TKWA 1NCCH 4N9GA 3QFDA 3CMOL 2HH0L 3CE1A 1EZSA 3T8MA 1XQ4A 3FF8A 4KMTL 2D3VA 1JPSL 5HPMB 4XR8C 1YAIA 2ATPB 1I1FA 2Y1VA 3O2WH 4Y88A 1SOQA 4EZMA 2DMGA 1R17A 2E0PA 1OE1A 3CHXA 2Z4TA 4HCRL 5SWSE 5KEZA 4KVNH 3CN1A 3TF7C 2O61B 4FXTA 1U8IA 1KFGA 5E2TL 1I9RH 2WWMC 3OQ3B 2WXPA 3O6FB 1ULVA 4WI0B 5CD5D 5DXWA 3SPGA 4B60A 2OTWA 1IBZA 2CH8A 3GJFK 1DVFC 5FGBC 3FCTB 4YO0A 1NUDA 4LAQL 2OL3A 4HXAH 3IBEA 3WS3B 2B15A 2OJEB 3RY6A 4KZEH 4NPYA 4Z18A 3QUGA 1ZV9A 1R5WA 3BISA 3LRSB 2WXMA 3HI1A 5JZ7D 2C4FT 5JORB 3NIDE 4JDEA 1CF8H 3C8KA 5HI4D 5C3IA 4TL4A 5K5YA 2SODB 4R4NC 3UJJH 3BDBA 1RUPL 3L7FA 5HSFA 2FIRT 4BZ1A 1HYRC 2NR6D 3VQMA 5I1JL 1JZ6A 2IADB 1FGNH 5DMIH 3RA7H 3Q9PA 5ISZA 5T1DL 1E6OH 4EN3B 1TZOA 1UD6A 2ZXCA 4N5EC 1BQHB 4Z3JA 2EJ1A 2LE9A 4QRAA 1FFNA 3M17B 1Z3GH 2XKSA 3LN5B 1HAWA 1QR4A 2FX8L 4X8CA 3F7QA 7FABH 2ESVA 4GW5A 3V6OA 3P1VA 1NPUA 2G9HB 4BIKA 3V4VL 3FO2B 4IDJH 3S36X 3IPBA 3K80A 2OR7A 4PJ6A 1X5YA 3B4NA 4DVRH 3MRDB 3UTSD 3QHFH 3PP4H 3QEHA 4N8PA 5IP4A 4Q9RL 2XA3A 1LK3L 2NSMA 2H0FA 4MXWL 4CMMA 2FT8A 4JRYD 4ILDA 4PJDE 2ROYA 1D5MB 2CHNA 2G60H 3MSPA 4TYUA 4I3GA 1TJHL 2ITCB 2P5WE 4MKMA 4CVUA 4EI5A 2HFGL 4HH9B 2AJXL 1YPZB 1PGRB 1R3HB 4P9HL 2AP2A 2VO8A 3T0VA 2KI6A 1HTYA 4PV8B 1UURA 3L1OH 2OSLA 2R29A 2FQEA 4FQJH 2CGZA 3VSTA 2Q6WA 4OI7A 4HLZG 4XBEL 1X3DA 4Z8FH 4AL8C 5EB9A 1G9HA 1LO5B 1USQA 3KYOB 2EILB 5DUPL 1RZGA 2DI9A 5D2LA 5D4IA 3R7RA 1FO0B 9CGTA 5CBEA 2NSXA 1V54B 3QUXA 1QNIA 1CIUA 4F57L 3NCWA 1IBGH 5IOKA 4MSWB 1O7VA 1Q0XH 1LWRA 3QNYA 4X7CC 1SEBB 4EAEA 4Z3IA 5C08B 3PWVB 2Q86A 3O11B 4G7SB 4KJQD 4K3JL 4PJFE 3CSGA 4XCNB 4NM4L 1ZANH 3AY4A 1Q9OB 4F3FA 3H8NA 1SUHA 1GKOA 4NP4H 4JFFA 3U4EA 4F27A 5EUOB 4KKAD 5C07E 4B5ZA 1CDYA 1NIAA 4PJGF 5PAZA 1KCSH 1OGAA 4ZAKA 4CSZA 1WE5A 1BD2E 1FL6B 2WQWA 1RZFL 4FYQA 4LQFL 3KYMA 5GZOD 3ZE0B 2J5LC 1MNUH 1UWGL 4U6VH 3QIUA 1DQJA 2E5EA 4AQAB 3U9PL 1HILA 4AGOA 1YC7A 2XBTA 1SHMA 2QTEA 3D3VA 2BWDA 3WFBL 4U1KA 4JUTA 4M6ML 3CTTA 3BAEL 3BLBA 3LDBB 1ZXQA 4GBXD 3RNKA 4WFFE 4RA0C 4QTIL 3KPLA 4X9BA 3NG5A 5IVXA 3KLHD 1RSYA 2OA9A 2NDFA 1Q9LB 3L4YA 4KUCF 4PI2A 3VFPA 4A2HA 4JDTL 4E5XG 3Q6FB 4OF3A 3D18B 5JHDD 5C71A 5EIQA 2A1WH 4Z7QF 5EU6A 5JPMB 2OCJA 4F8LA 2IF7A 3JV6B 1R1CA 3MOBH 4AGQA 1NFDE 5TDPB 1DP0A 3QE5A 4HBCH 2R1YB 5IQ7H 2I07B 3QIBC 3CD4A 1PX8A 2AXGB 3AABA 1GZPA 4OGAD 5H94A 1CC3A 4HGWB 4M8VA 2H6OA 3RIAK 1A1OB 4NOFA 4WUUE 1DBJL 1FBIL 3ZPDA 2VMJA 1JPEA 3IFNH 3GMOB 1IGCH 3A4AA 1IKNA 1PKOA 2AJUH 3ZZ1A 4LBAA 2JIXA 4HZLA 4F1SA 2P9RA 2VQ4A 3GLDA 4HGKC 5F1NB 5TDOA 5HHMD 3O6FC 2VO5A 1DEDA 3RX5A 3F01A 3V0DA 1FH5L 4GXFA 3VWJA 5J57B 4GAJL 4A6YB 3RUGF 1VFUA 3REVB 1UB6A 4IU3A 4Y19E 1QFOA 3PL6C 4ZOAA 4A55A 2IH9A 2NCMA 2YXMA 3CC5B 5FW6A 4WWOA 2XYBA 2M2DA 4TVPE 1ZGLM 5GGTH 3GUTB 4X5XA 2YOAA 5B22A 2ETWA 2QGBA 4XVJH 1MCEA 1ZTXL 2BX5A 1LD9B 3CN2A 1BVNP 3NP4A 4ONOA 4MZRA 2VAJA 1R46A 4Y4KB 3WN5C 4EIZC 1UWYA 1XCTA 1HCFX 5L88H 2XV3A 4RAUA 3BO8B 3RPKA 1THAA 1YUHB 4MBRA 3FK3A 3BUDA 4K4KA 4X0KB 3CPLA 4PBXA 3QDJD 4HS3B 5E5MA 5B8CC 1P7KA 4KK6C 3RTQA 2LLNA 2PPDA 2AHIA 2WZPD 5EOCJ 1KXQA 4FMFA 1UYWH 3L3JB 3A6CL 3X13A 2XX1A 1BVOA 4XCEB 3KEDA 4A2LA 3QZLA 4N68A 5ALCL 4ZPVA 1CR9H 3EJZC 3P9LA 2W9DL 1FIGL 3ALXA 3SDDD 3PFQA 1OCRB 5GS1A 2R2CA 3ULVF 1U8CA 2WLHA 4MCMA 4L1HA 1QZNA 3RDTA 3GPSA 2IO5A 4JQIA 1S3RA 5C3TA 2IH3B 3GD1C 1AGDA 1A0QH 4PYHA 3ABZA 1CLOL 1A7OH 3VXQA 4GG8A 1VFBB 2G2RB 1DEEA 1YN6A 4A7GF 5TQ2H 3MNVA 1OAUL 4H0GA 4PJXA 1XSKA 4HIQA 1UZ8B 2C26A 4KRNA 5I73C 2NXYC 4FXKC 3RP1A 1I8UA 4L8BB 3RFZC 1IGIL 3BQVA 1E4KC 1IC7L 1WFJA 2Z7UA 3KXFE 5EWIL 2J73A 3GHEH 5EOCH 1LO3L 4DKAA 2Z1KA 3OAZH 5DT1L 2BIMA 4HKBB 4APQD 3BFWA 4JFDB 3GIZL 4LKCA 4J2XA 4XXCA 4I0PA 5ALBL 4ZW6A 2BVOA 1LL1A 5B38B 1CGSH 4PMEA 3WEXA 3P3SA 2OBGA 4Q74A 3DSFH 5IB3A 5GS3A 4DQAA 3F7RA 1SVCP 3N41F 3APNA 1XEDA 3NCJH 2JNZA 3T0AA 4PJHF 1U9KA 3RAJL 3LN4B 4L8DB 3TL5A 2MKWA 4UQ2B 4RWHA 3RHWF 2TRHA 1GCFA 2VAAA 4OZHF 4OT1L 4PTTB 5DWPA 5D71H 4JFPB 3NIFE 1UWFA 2R2EA 3SZKC 4KQ0A 5F3HA 4N2EA 3IVKB 2CHZA 3D07A 4Y7OC 4AV5A 4BGDA 5K9KA 3IDUA 3QW9A 4MMYB 2D4DA 4O5LH 2JKSA 1SF3A 3DKHA 4GFXA 5HTSA 2E47A 4OAWB 3VGFA 4ZMTA 1IBBA 5EZOL 1FZKB 4LHJB 4I1PA 2DPKA 4U1HB 1RKRA 2CIIA 1JHLH 1LMIA 3PYCA 3V6BR 3GSOB 1RI8A 1KXVA 5IHUH 4GQRA 5I1DB 3BCDA 3Q1SL 1I1FB 3MREB 3D0VB 3PXHA 5AG9A 4JKWA 3T65B 3HNTL 4UANA 1XGQA 4G11A 3I84A 2VIRB 1A64A 1D6EA 1QLEH 4MQ7B 1EDQA 2EKJA 2Z91B 3S8FB 1WIPA 3A67H 3QJXA 4AYID 4JY4A 1DBMH 3QS3A 2VJ0A 5GGUA 2ZXDA 4KY1H 1ASOA 5EF1A 2AV1B 4YBLB 1P1ZA 1AC6A 4XN7A 4EBQL 5IR1A 4JFQA 5EZPA 1VACA 5FHBH 1S5HB 4RBPK 4ZUUA 4EQ2A 4NM8H 3PNWA 4ZSOA 3LXCA 1NBVL 1RZKL 3WE1A 2OTUB 4S2SA 1JPSH 3FBQA 4QY8A 1T1ZA 4JHBA 2YUWA 2IIJA 3FYIB 3KPPB 2C3HA 2P45B 3GUFA 4NWUH 5JXED 5F3BA 1MH5A 1XB3A 3KLQA 5E2TH 2NR6A 4U1LA 3FT0A 4LRNL 4K94C 4M56A 4P2RB 5ISZB 3T1FA 3MGOA 4G9FB 5DZJA 3FBKA 2R4RL 3BH9A 1J9RA 1FFNB 3CFEA 1E4WL 3O6ML 3HZVB 2ESVB 2QKIA 4ANKA 4GW5B 1R3IH 1T5XA 1T5WB 4PLOB 2YS4A 4Y4KC 3KPTA 3I9AA 2GW5A 1CFQB 6FABL 1N59B 2MCAA 1XGPB 3OXRB 3SDCC 3BAJA 5AYUL 4PW9A 1RQ5A 3LZOA 1AXSA 3UTSA 1RUPH 3MNMA 3AQXA 4GAAA 4XRCA 1U58B 5G5DA 1BFVL 1B0GB 1MI5B 2NY4C 2PW2B 3ZMNA 5I1JH 4JRYA 3S5YA 4KGLA 3IMTA 4MNHB 4XB8A 2FZ3B 1QI3A 5DHVH 1GY2A 4ACPA 1WHOA 3W9EB 4C4KO 5BW7A 3WE6B 2P1YA 4J3TA 4XODA 2VTFA 4MDRA 3NZSA 3HZ3A 1TF4A 2FX8H 4NDMA 2BSTA 3QJRB 4L4TB 2BNQB 1G0DA 2OSLB 3WNNA 4JN1H 3KPOA 4YWGL 1XGRA 1ZT4B 1ZTXE 4LU5H 2VUOA 1QFHA 3O3DA 4JFHE 1NGQL 5D2LB 2LR4A 4FKEA 2JVUA 5D4HA 2WYZA 4NYLA 5LNGA 1JZEA 4MXWH 3H1ZA 3HRZB 5I15L 4G6FD 1KBGL 3KL0A 4K9EL 5I30L 3M88A 5DJCB 2DDQH 3MZGB 1F5WA 1TJHH 1EV2E 1OARL 5KVFL 5FHAH 2HFGH 5AOZA 2EVIA 1T1WA 4TQEH 3X11B 2NNCA 1JK9A 4F3FB 3N5AA 4UT6H 4D3CL 3OMAB 4FNSA 3BHBA 4JFFB 2Y0SA 4NZRL 5L8LB 1J8SA 2E9JA 1V3LA 1QLRA 1MLBA 3OAUL 2NW3A 2X2UA 1OGAB 4ZAKB 1E6JH 3LQAL 5DUPH 3B9KC 2BSCA 4WV1B 5F7LB 3GLAA 5J8OA 3UDWA 5GZOA 4LARL 3QUMH 3MLXH 1ACZA 2WLIB 3QIUB 4XVUD 4E9RA 4M1CC 2V5SA 1FE8L 1ZHKA 4AG4H 1UJTA 5BQ7B 5E8EB 4G8EB 2ZSWB 1KMGA 1VFAA 1U33A 1HEZB 4K3JH 2F18A 1EHLH 2OR8A 3LH2L 4GBXA 1UKSA 2MMXA 4XWOD 5KSBB 4OVVA 5IVXB 4YXHL 1MRDL 4G6KH 4WTXA 2ZCLH 3WFDH 2Y9RT 3DX3A 3OMIB 4XMLL 4F7TA 5JHDA 3FO0H 1H3TA 3ZT7A 3AWEA 5D7LB 4OVUA 1CD0A 3D0LB 5IZ7A 5DK3A 4X7TA 3HAEA 3U48A 1W72A 3GHBL 1MXGA 1MJ7H 3VH8A 1UWGH 2W9EH 4QRUA 2NY6D 5T3XH 5A3ID 1ILSA 1ZA3A 3FU5A 1D7BA 1OAXL 3TVMB 3RWCA 1R3LA 2CKBA 4FG6C 2VZVA 4GKNB 4N0YL 2Y3NA 3VSQA 4FTVD 4M6MH 1J8HD 2AQ3A 3BAEH 3FH8A 5HY9A 3E0GA 3RIFF 3GWJA 3DJSA 1F90L 5E2UH 1YEEL 4HLJA 2VLJD 4BFOA 5A43C 1OP5K 3EBHA 1EAOA 2DWXA 3RPBA 2ALAA 4F7PB 1FJ1A 2BZ7A 3F58H 1KOAA 3FO9A 3MRHA 1BEYL 1WTGT 2OMUA 2P47B 4E42B 1KJ2B 4I85A 1BIIA 2O5YH 4PRBB 3S2AA 1TSRA 2ICCA 4YBLC 1NL0H 5BXFA 1UGNA 3MCLL 2Q76B 4JFEB 3EFDH 4LSPL 1KT2B 4PUBL 3MN8A 3JWNG 2FSEB 3NGBC 3N42F 3DVNB 4X5XB 3RY6C 3WEBA 5F9AC 4APXA 4B3EA 2CAKA 4FFYA 5IBLD 5HJ3A 2JTDA 1DBJH 4IRSD 1YYCA 4HUCA 4AZ8A 4C57C 4ZXBD 4DETA 4NNPH 4RAUB 3CPLB 3MV9D 2CO7A 1GZQA 5JQIB 5A2AA 4OZGB 1QSFE 4HIXL 3DC0A 3QDJA 3QJOA 3LV3A 5E5MB 4IDLA 5TF1L 2QR0A 5DD0H 2VSDA 4J8QA 3CG8A 3RNQB 5L4MA 2WZPA 4EI6A 2P26A 2VERN 4H8QA 4QAMB 1FH5H 1W6LA 3IAPA 3SKOB 2QMKA 2WNGA 2EH8L 3BUQA 3CBJB 4F1ZA 3NAAH 3P9LB 4FGMA 4N2NA 3V6OC 3SDDA 4PIBA 5C0RL 3QXVA 2IANE 1HFUA 3JWNH 3ZHLA 4AENB 2WOYA 3Q01A 1F02I 2HZHA 1BW8A 5D70L 4QEGA 1A5FL 3CUPA 5KW9H 4EVNB 5BOZG 4MCNA 5DURD 3B8YA 2Y6SD 2DLGA 3VXQB 1Z0MA 1MWOA 1DEEB 2MTPA 3VXRE 1FNEA 2CO6A 1QBLL 4AYSA 1EXHA 5E6SB 5I24A 4PJXB 3VNZA 4EI5C 3A6CH 1IVLA 4XBPB 4GO9A 3MLYH 5ALCH 2XKNB 4BZ2A 2R8SL 4X7EC 4QHLB 2W9DH 4MYPA 4FQQA 5I1CL 4TLUA 2HPOA 4APQA 1NIBA 4JR9L 2X6BA 2DWEA 2YA1A 1KYDA 3GBLA 4NCC2 1HE7A 1RHFA 3S3PA 3NJJA 1NLBH 1WAAE 1DQKA 4IIQA 1JP5A 1IEHA 2ZXBA 1N67A 1UOKA 2ENQA 2H7WA 3FSZA 4NPKA 1J10A 2PR4H 3QUXC 3E6HB 4NC1C 5IB3B 5E99L 1PX4A 1OAUH 4F33A 1FUNA 4AT6B 4PREB 5FO7B 1WS8A 2PWHA 1ODUA 3S35X 4OQTA 5FO2A 1QBML 3AY4C 3G5YB 1TTRA 2VAAB 5EWIH 3VFOB 1DVQA 4HC1L 3MLSH 2R2EB 1U4EA 2P24B 4XP6H 4J27A 5DT1H 5F3HB 1INEH 4BWUA 1F4XL 4EEEA 4X4YA 5E9DE 1DVXA 5KVMC 2GHZA 4ZAKC 5K9KB 4HFUL 2OSWA 5I1GL 1KYFA 3DXAB 4ZFGH 4NOBA 3HI6L 5EEYA 3S3CB 1OD7A 3GMPA 2WBJD 3T6ZA 3QIUC 1NCHA 4P23B 1EH9A 1RU9L 1SM3L 2O5ZL 1PD6A 1RIHL 4HSCX 4MS8C 1LWHA 1WEJL 3VUAA 1FC2D 3NSFA 3MC0A 1BVZA 4PLJD 5EEZA 3DPBA 1R4XA 1NGZB 5HXMA 3RAJH 3C5JA 4EDXB 2ZYRA 3OB0H 5KVFE 2OR9L 4KRPB 4DFHA 1F56A 4OT1H 2CRIA 3JWDH 2VDOL 5E1IA 4JM2B 2E9BA 2XUWA 1KEML 3QI9D 1QVOA 1XGQB 4ZK8A 3FAXA 5BOPA 2PYED 1RK1A 2H1PL 3F04A 1SOSA 4YSTA 3KYNB 3V7MA 1QNZH 3V6FA 5I6XB 5FGRA 2GFBB 3O0RL 3DX6A 1BQKA 4FHJA 4HAKA 4D0DA 3IJ9A 3POCA 4PHZA 4DW2H 3H9SD 7TAAA 2W0KA 4ZPTB 5BZDA 5E08H 3HPLA 2NY0C 1LP9A 3DWTA 3JZYA 4W6YB 4ZSOB 4J6IA 4KUCD 5DEGA 2ENSA 3KL3A 1A9EA 4RISL 3MRQB 1LVEA 2LU4A 3EW3B 4QLRA 1IKNC 3HNTH 5JXEA 4PJIE 5D1XB 1PLCA 4L3CA 5C0FA 4B0MM 2E86A 2FR4A 2PKDA 2V7NB 1HCYA 4R2GB 3VWJC 2YARA 4BM7A 5FO8B 2K3TA 1OT4A 3BH9B 5IJVB 4PW4A 3CFEB 1NIFA 1PZ5B 2XTJE 3AQDA 2QKIB 1VZGA 3QZWA 5H8DA 3OG6B 3N3EA 5EOTB 3WNJA 1G5GA 2AK4E 3IGAB 4G6JL 4GG6E 4NJAL 4N6QA 5GSVB 5DFVC 4F2MB 2ZWLT 4LVHC 4E9LA 1WISA 4G8GD 1JL8A 3FN9A 4ZUWB 2OJZH 5BVJB 1D2OA 1DUZA 3D52A 3RTQC 3IJ8A 4OZIE 1U95A 1UXSB 3OAWA 2A2QT 5FW7A 4OM0L 5A40E 2H2SD 3G6JE 2BMKB 1NIDA 1JXJA 3BW9A 3Q5TA 5EU7E 3N44F 3GSUB 4IQHA 2YPKB 1WBXB 1E4WH 3II1A 2C7UA 2IGTA 4ODBD 2BSTB 3HZKB 4DUWA 4M5ZL 1KLGB 3QEUA 4BRJA 2CXKA 3JV0A 2QQQA 5DUML 5GS1C 5ANMB 3K4DA 3V10A 3KPOB 4X42A 1L7IL 1B4LA 3AROA 3RDTC 2EDMA 6FABH 5FLVA 3QNZA 2CLRB 5AYUH 3M1CA 1E4XH 3DJZA 3EH3B 3KYKH 1FYTE 4NYLB 1NC4D 1BFVH 32C2B 2X3BA 3G5WA 4C54A 4NRYA 3C2AH 4Y2DD 3LKQA 1TEFA 3DRQB 4BUHA 4KBPA 3ULVD 4ONHB 1BWMA 3RWJA 4BGLA 1AQHA 1FL5A 4ZUVA 4ZI8A 5J7CC 3FUIA 3PV6A 1A66A 3R18A 4E41D 1TEYA 2Y1ZA 3ZR5A 4FF9A 3ZDXF 3QRGL 4XXCC 3BLKA 2VWEC 2EACA 3DX4A 2VLLA 4I0PC 4UOW0 1P7HL 2WSKA 1J88A 1SJHA 4OLWL 1KBGH 4EOWL 3TNMA 2YGQA 3ILPB 3OLIA 2IVFC 4PS4H 3ZHFA 2EDQA 3QHTC 4HULB 4J3OF 2ZPKH 3R4DA 4F24A 5IFAH 1N10A 5KSUA 3ARRA 3IKCB 2BS71 3V4PH 3CCHA 2JWYA 4LLYA 1T66C 1EVUA 4WEUD 1MCRA 3WLWD 5F6HI 2R7EA 4DT2A 1HSBA 2ZYHA 4NZRH 5F7UA 3AWFA 1JRHL 1ZDSA 4E5XA 2WBWB 2Z65C 4JW3A 2APFA 3ZRSA 4F7TB 4J1UA 1YAZA 5AYQA 1ZHBB 3STLA 2VXQH 1RJZA 3IDMA 1X5MA 3BI9X 3EO9H 4FEIA 2FATL 4LARH 4MKTA 3M86A 4X4XB 3VH8B 3SE3A 2ZX6A 4F15C 3JXAA 4QRUB 5EBMA 1ZA3B 5BS0D 5LCVH 1QWUA 3WKMH 1NCOA 3RVTD 4PLNC 5DLMH 2CKBB 2Y7QA 2CZNA 1KXVC 4KAQL 4UTAA 4FTVA 3ZN6A 1J8HA 4FQ1H 1BVNT 2VXSL 4PJBF 4QPEA 4EDWL 4Y4HD 2X4SB 2X70A 5DRNA 2VLJA 1MRDH 3OAYK 1RK7A 1FJ1B 3GMMB 4MMZA 5IMKA 4HUVA 5IVZA 2F7IA 5CD5C 3CFBB 1ZVSA 3MUY1 1KC5L 4TRPL 4LLUB 3I6LD 1IO4C 2CIKB 1XGYH 3TLRA 5DGRA 3IJYB 4ZFFB 4HJ1A 5DYOA 2DMCA 4DGWC 1OAXH 4V1DB 2YAHA 2LFGA 3FONA 1B4RA 4P05A 4EXPX 1OGTB 2YR3A 5TH2B 2PPFA 5HJ3B 5JZ7C 4IRSA 1GW6A 1DJXA 5HI4C 4ZXBA 1F90H 3NRQA 1YEEH 4HK0B 3KGSA 4I89A 5CSZB 3MV9A 5EC2B 3E9UA 4LCWD 4KTEL 2X6UA 4I13B 2EVHA 2NR6C 3LV3B 2QR0B 4HJSA 3P0VH 1HL4A 4G70B 4JJ5A 2AJSH 4JO4L 2D0HA 1HWHB 3T2QA 1GR7A 2F1EA 4LSUL 2WYHA 4GKOA 1TETH 3MCLH 3PJSA 1WBYB 4LSPH 4PUBH 4LCUA 1P2CA 2EDDA 4JGNA 4NQDE 2QKIC 4I3RH 4ZOBA 1UZ6F 1QPKA 2XJLA 4S10A 5EIIG 4YSQA 4N2CA 4DP8X 1B4TA 4WJ5A 1KGJA 5BO1H 1SJMA 3CUPB 4JPQA 3WENA 1QHOA 4PJEF 5DO8A 3GRBA 2YUVA 4HIXH 4HUUB 1G1KA 1E4XI 5TF1H 3GDBA 4P2QE 1HYSD 4HS6A 3BKCL 3K72A 4A38A 2WXNA 5BW7C 4MDIA 3LNDA 1M42A 3CVHB 3FH7A 3UO1L 43C9A 5C70A 2HJKB 4UM9B 1RJYA 1EHAA 3SKMB 3TH4T 4L4JA 4N2LA 4OFPA 5C0RH 5GJSL 4HG4K 4IJ3B 4AK1A 4N2IA 5MENE 4OI8A 1CXFA 1HAUA 4B7IA 2DWEB 1Z5YD 2GK2A 2Y06L 3FSOA 1A5FH 3K2UH 4IIQB 5GGSA 2J2ZA 5DHDA 4NWTH 2V8MA 2CO4A 4MD4A 1WT5A 1IT9L 3MRIA 4HAFA 3DOSA 2PF6A 1NA8A 2WJ5A 4UMSA 2WWKT 3HZMB 5AOKA 2P8PA 4KJQC 1V7NH 1JXFA 4X7SL 2H6PA 5E8DL 5T5FA 3LZPA 2ED7A 2YC1B 3N6YA 3T04D 1JWUA 3S88L 1MF2L 4L3FA 2CK2A 1G43A 2CM6A 1WZMA 4KKAC 3TONA 4NPJA 3DX9B 1PFCA 4NRXB 2ZF8A 2Z7YA 3TBWA 2HWZH 4QRSA 2VDKH 4Q9BA 3EH2A 2HKAA 3X14A 1CGTA 3UDWC 5GZOC 3GMPB 3JWOL 4JDVA 1QBAA 4Y5XA 4MJJA 3EJPA 1WICA 3BMVA 2F54D 4XP5H 3PP3H 3PV7A 5E99H 5L7XH 2WB7A 2LVEA 1OWWA 1P9MA 2JCWA 1LQBC 3DPBB 2HG5A 4N20A 1E9PB 4H13C 4PJGA 4XO3A 1FLRL 5KYYA 5DUBB 5K39B 1BQ5A 4GBXC 2EXWD 3QS2A 4PBWD 3UJTL 3VCLB 4A2GA 4H5SB 2R23A 4DP2X 3KLHC 3KCWA 3QI9A 4Y5VA 1YMME 3VXNA 3WIAA 2PYEA 4HFUH 3ATAA 5C0BE 3SYAA 4GAYB 3T6VA 4KHXH 4N0FB 4QRQA 4GQZA 2DMBA 3HG2A 4LIQE 4D0DB 1UQSA 3SYOA 1KTJA 4P59L 4MJIE 3H9SA 4TM9A 4OGAC 4OFVA 5BZDB 5HD8D 1Z0NA 2EVFA 4KKNA 3L5XL 3V7AE 5KOMC 5KYWB 2H0JA 5IOPB 2PABA 2QADB 1GJIA 5FKAA 5CEYB 5GRVK 1EWHA 3KLAB 1O7DE 2LLLA 4HKJB 4KK8D 5F93C 3TIDB 5CGMA 1UZGA 5LAXA 4PCYA 5AOJA 1A8JH 1XZ0B 2TRYA 1GC1H 1JZ7A 1X5JA 5ICZA 5F96H 1A3QA 4KVCH 3ZDYF 3N40P 4ZMVA 3NK3A 3SBQA 2UXFA 5EDSA 5F9WB 3P2TA 4Y1SA 2UZPA 1I85A 1JTPA 5FXCH 2BPBA 2HMID 3JVGA 2AC0A 1FNGB 4HIEB 4RISH 4LGRB 2R2HB 4IBTA 4H1LA 5CZKA 4HX1A 3NOIA 3HFMH 5EZJB 3WKPA 1LEGB 4XN1A 2VC2H 5C0AD 4G8GA 3RUGA 4G8FA 5T8IA 4QYAA 2XXFA 5KSAB 1KCKA 1U8JA 1IFHL 1PLGH 3TCTA 5CHNA 2KDYA 4ZBJA 3NABH 3O8XD 5IJCC 5D6CA 3C8DA 4JPIB 4LLMA 4QCIB 3S5LG 3ULAB 3T3PF 3DIDA 3UJIH 2ICWA 4WU5B 1BM3H 1YYLH 1DR9A 4WJG3 3SDDC 4OKVA 2JQMA 3RB7A 1F3JA 5E9AA 3GXUB 2ZOLB 1FGVL 4MA8H 3EO1B 5C9KA 1P7QD 3QNZB 2YSSA 4G6JH 3UADA 4D7PA 4ZW5A 3NCEB 4ATTA 2MNWA 3HS8A 1NC4A 2NY1B 5MERA 4K8RD 2DF3A 3I74A 1QEWB 5FOBA 3VWKD 4DGUA 5I1AB 4M1GL 4NRYB 4Z7UF 1T0MA 4Y2DA 5J12B 3J8F7 4RRPM 4U7MA 3LIZH 4ERSH 5FUCC 4ZMPA 5DJAA 1O7SA 2BOBB 5F89B 1QAWA 2UY7B 3LZFH 4IOIA 4N5UA 4PSPA 4M5ZH 2DI8A 3E3QE 4IJ3C 3FO1A 3PV6B 4KV5E 4APQC 3HMXL 5TE4L 4E41A 1FHGA 4UOJA 3S34L 5IUCA 3VDBA 3CNKA 4I3SL 5CBAB 1FAIL 3CU7A 4A7GA 2XU9A 1J5OL 5TD4A 3L3HA 4OF6A 1I1YB 2VLLB 3OGCB 4IIQC 5IESL 1XGUB 2XX0A 4L3ED 4DEUA 3C5ZD 4LP4A 1Z6JT 1ZMYA 5MI0B 3H9YA 5GRUH 3L3DB 4G7VL 1E5ZA 2EVGA 1IL1A 2R1WA 2BVEA 4MWFA 3ABMB 3UPRA 1QR1B 3JTBA 4I87A 2G3ZA 4K7PH 1XF2B 1J9CT 5E5LA 3PUCA 1UASA 3F84A 3QZMA 2M1KA 3PDOA 1FL3A 4QHMA 4HQQL 2F2HA 1SOXA 3QDMB 2R7EB 4Z3GA 2G5RA 1GYVA 3GRGA 3VGAB 3WELA 2PO6D 1S7WB 3TM6A 2AQ1A 2Z6FA 4E5XB 3H0TA 2FJHA 1NDTA 4Q7DA 1YLBB 5FECB 5AB1A 3QRGH 3STLB 5I9QB 1LO2H 1I1AB 3QQ9D 4NI3A 4DK6A 1LE9A 1GYAA 4PJHA 3T9WA 4EOWH 2NY6B 2L4OA 5BS0A 3GSNA 2O93L 5I6KA 4ENZA 4OZHA 3OBAA 2CDGB 5DZ9A 4G72B 4FTVB 4UIMA 3QHZH 3PWPB 2XIBA 1H15B 4P2OD 4Y4HA 5FA3B 3SZ6A 2X9XA 4KXDA 4N1CA 2FL5B 3TT3L 3Q5OA 4TSAH 3NIDF 1NFIB 2X4TA 1O5PA 2JMRA 3M7OA 3QEGH 5IVZB 5ICUA 3L3GB 1MCWM 3D05A 4H2AA 1BZ8A 3DETD 3VQLA 3PDDA 2G4EA 4R7NB 2W07A 4YHPB 5I2IB 4D9RD 1XHHA 2IFFL 5I26A 5E70A 1KLUA 1QSED 3S5ZA 4FAAB 4F7EA 2QFRA 5JIIA 3EGSA 2QGDA 1MG2C 1NGPL 1Q72H 4RA3A 4ABUA 2OK0L 4PJCE 2NUPB 4KAQH 5IVOA 2UWEE 5JNYB 1EGJH 2BNRD 4BKLA 4Y16B 4ELKA 2AZAA 5JPNA 2XQ0A 4S1RL 5JXEC 3ECVA 3OJDA 3E8UH 5FYKU 2JJWA 4LCWA 3L1FA 2DWDA 1YYMH 4NO3A 3F7VA 1J5CA 2LTQC 1KC5H 1KTRL 3OVUB 4PJDF 1YCSA 1ZS8B 2DEYX 2V5RA 1YUKB 3TN0D 2GY7B 3OJMB 5CJ5A 1U91A 4CRPA 4YXLL 1ZLVK 4E0RA 4LCUB 1YEIL 3HB3D 3AC0A 4RQQA 4O4YL 4X6CB 3NUKA 5D7IB 4BXSV 3L5HA 4DN3L 3NA4A 5HHQA 5J1TC 2VN3A 5EV7A 3VVWA 4NQEE 5CJQH 4BHUI 1MJUL 2BOCA 4YDJA 3T77A 4WJ5B 1ET8A 1UD3A 3WAJA 4M7KH 1KJMA 3CFCH 4PGBA 5BOJA 1MCKA 4W9JC 4PJAB 2FGWL 5EH1A 2WLZA 1NGYA 2EAEA 2CGRH 1HHGA 4M4PA 3A24A 1S8DB 2XZCH 4LAJH 4FMVA 4RFNC 4RGOL 1C12B 4NNXA 3KWUA 3I9IA 5L9DL 2WKLA 1C5DB 1L7TL 4JL1A 3APDA 1RJYB 4NQCE 3OMNB 1CLZL 2VM3A 4PJFF 1EHKB 4QO1B 4MJHA 4P0DA 5B21A 3TBCA 2O5XL 1U3JA 1EO8H 1K8DA 4OGYH 3VRJB 2P3YA 2C5DC 1P5VA 5A2CA 4CDGC 2GSIA 1XT5A 2YPLD 2E7HA 5DTFA 5LGJA 1QLFA 4QWWD 4JKNA 3SE6A 4MD4B 4PV1C 2N7AA 4MGXA 3H7BA 5F6IB 4GUPA 3DOSB 2E8ZA 4YHYB 2BH0A 2I85A 3BKCH 3QQ4B 3Q1EA 4JVUA 4JCLA 4WWKD 2A6KA 3KJ6L 2OYPA 1I3VA 1JFHA 4IBUA 4RGNE 1JXGA 3IMVA 1IAIM 2E7DA 3EYFA 5GJSH 3KM2A 3AXLB 4ZFOB 1ADQL 2B7DT 1Q9WB 4QRSB 2I7OA 1QUNB 1WFNA 4U6TA 2CJ3A 2AQTA 4X5PA 3ZE1E 4LOFA 8FABA 4NIKB 1MCCA 1GMIA 1PG7W 5LGYA 4XVUC 1T2QH 1MCOL 1NFDF 3BUPA 2FQDA 1EEZB 2F54A 4HWBA 4ZOCA 1QSZA 5FYKD 1E27A 4YL4A 2YAQA 5DZVA 3T4AB 1D7DA 3R0MA 2JCCB 5BO0D 5C09E 3HBPA 4HFWA 2YMXL 3ETSA 4XWOC 1MF2H 2EEFA 1NAMA 1JNNH 3WLBA 3ZRFC 3IJEA 1GW0A 4Z7WB 4DKFH 5DSCA 3QI9B 2AEIT 3TTSA 2AABL 4QIRA 2WBXA 4FQPA 3VXNB 1XCXA 2I26N 2WNXA 3KPNB 1G87A 4QXUH 4U33A 1RIVL 3HLKA 3LY6A 4K73A 5E7FA 2PCPB 4DGVL 3EGXA 5BJTB 1L9TA 1IAOB 4J3OD 3U1QA 5E0QA 5CMAB 3SE3C 3IN0A 5SWZB 2NY6C 3ZK0A 5A3IC 3LPFA 2FWLB 1JPTL 3RX9A 2QPDB 3OSKA 3MBED 3DVFA 3O9WD 1WC7A 5DJZB 2RTTA 5AFAA 4EF3A 2IGFL 4FYTA 5LHDA 5F9JB 3D4GA 4YIQB 1MCDA 1FLRH 5IEHA 1N0XL 2N0MA 2EIDA 5I6OA 3FUDA 2EQDA 5FKAB 5I8OH 4BH7A 1IC5H 1MPAL 1S3KH 4Z7QB 3C60B 2OMTA 4LMQE 4GP4B 3TBTB 3CDZA 1U6AL 4Z7NB 4KROB 4MMZC 4OB5L 1QO3A 3SO3C 1JV2A 5T3ZL 1XWVA 5CP7A 3L3IB 1FVEA 3NCYS 1MIEL 3HG1E 3LKOB 5ICZB 1WJ3A 1GYWA 4JFYB 4NZJA 2K9FB 3EBIA 4FNTA 3WD5L 4U1NA 2NX5E 3ISRA 2BINA 5HYQA 2MPAH 5J1AA 4L1TA 3J27A 1DN2A 4QKXB 5IBLC 1GIGL 5BRZD 3D2UB 4IRSC 4LLAA 4KRLB 3VX0A 4ZXBC 4JANA 2DEXX 4HX1B 5A16A 3GDCA 5C0AA 3RUGB 2PTUA 4AITA 3GB7B 1PY4A 1ZT7A 4X8JB 1MNNA 5CHNB 3IDYB 4FJZA 3O8XA 1RPKA 3E7JA 5D6CB 1MFCL 4ACTA 4CVXA 2FBRA 4TQPA 2B9BA 2WXLA 4A39A 2AJVH 2J4WL 4OKVB 2Z0BA 5A2LH 1WIUA 4IS6A 3VGBA 5IQ9A 1PCSA 2MSPA 2X4RB 4AKOA 3QUMB 1DO6A 1P7QA 2YSSB 3T3MB 1MWAL 3J07A 4GEJA 4HCIA 2JKXA 1G7JA 3EOTL 1JGEB 2Y6SC 1DSYA 3ZOAA 1AP2A 1Z5HA 3DX8B 3VWKA 5D96B 1CBJA 4RMQA 4X5QA 4AYBA 2Y5QA 1F4WL 3EZ8A 3HTLX 4FNLH 4RIRB 4R5VA 2IFGA 4N3TA 1WCQA 4X6EB 2KKQA 5C9JB 3S37H 4HUXB 3Q43A 3DGGA 1TQCB 1R0AH 3KPMB 5ETUA 2ZJSH 2AQRA 2HX9A 3FB5B 4YDLC 3OKYA 3NIFF 3VD3A 5FFOA 1FGVH 3CVDA 3HJEA 4YC2C 4X98B 3GINA 3OR6A 3FXIC 4L3EA 3BSZL 3C5ZA 4PJ8B 3QJQB 1ZJBA 1WT5C 3MO1B 2VH5H 3NFNA 4M8RA 4OLYL 5ENWA 4W9EC 5F6IC 1W80A 3E9TA 5D7JD 4B97A 1ESOA 2ZNWA 3CXHJ 5JLZA 2QPEB 4MHHG 2Z31D 1NCIA 2WLLA 1RCYA 2MJWA 1C9SA 1KBKA 3QDGE 5ABAA 1SZNA 1FL3B 2G5BB 3DO7A 4NKDB 4KNSA 5ESAA 1AE6L 2CCWA 2PO6A 4F37K 4CADA 3EH4B 3S34H 2ICEA 4ZX3A 4O2FB 4BSVB 5IMMA 1TUPA 3B2MA 3INUL 5IB1B 3ASWA 2Y24A 5CNHA 4D0CB 2HLFD 2N0KA 4Y5XC 1D9KD 4FQIL 4PJHB 2XN9B 2ZT9C 4G7VH 1KIPA 3A21A 2ZCKH 3GSNB 3S48A 3CLFL 2DQIL 2KQMA 1T1XA 1QFUL 2IC2A 5JYMA 3D30A 1P9MC 1TKWA 4PLJC 2HB0A 4P2YA 4UIMB 1SJVA 2EVJA 4HWNA 4DP7X 5LXGH 3EIFA 2WQXA 2H26A 3OZLA 4TUJA 2OX5A 4DP4X 1BMWA 3QI9C 4Y5VC 1SXCA 1NZRA 3GRWL 3MRLB 3OZKA 4M93C 1JHKH 2WUBL 3GBML 1OALA 4MLSA 4ALAH 2W07B 4ECNA 1OPGL 3ESPA 1BYPA 1QSEA 1A4AA 2BFVH 4JDZB 3NSDA 2EDBA 4LASL 3ARUA 4MB1A 3WO4B 3HC4H 4F7EB 5KBPA 2XVBA 5I0VA 3TCXA 3VJ6B 1KELL 1OTUC 5AKTA 2J5WA 4OD3H 3K4AA 2BNRA 2E9WA 4YDZA 2HPTA 4ELKB 4F58L 2YQGA 4ELME 2W5PA 1CN4A 4H8WL 3TBYA 4FFZL 4C56A 2HYMA 1MFMA 3OJDB 3TFKD 5AW0B 2QV4A 5TTRA 4L1DA 3PGDA 1UACH 4DNLA 2EE2A 1IAKA 4FXGB 4KZ0A 4NO3B 5INCA 3ROOA 5DHMC 1N64L 2ZUXA 5D5MB 4N25A 3VVVA 1YEGH 4LSRL 1PG7X 3WJMA 3TN0A 2CDFB 2HVKB 1BSIA 5MEPB 3RIAF 2XWRA 4E0RB 2VXVH 2X42A 3ARGD 1NGPH 4FOMA 2JKJA 3ZHKA 3S8WA 2X6CA 2BIQA 1I85C 5SV4A 3PHQB 3O4LE 3PPSA 5LBSH 3JVGC 1CZ8H 4LHQB 4YDJB 3T77B 1B0IA 3NCCB 1RUMH 3UTTB 1KJMB 3JYCA 3MRMA 4Z0XA 2Q10A 1UB5A 4YDNA 2Q0ZX 4L8CA 1F4YH 3LEXA 1KF9B 2HKFH 4L29B 4L37A 5AVTB 5D93B 1X9LA 4ZMQA 4PI0A 3PF2A 4OJCA 3UERA 4AQZA 1V3JA 3HNSL 2EKSA 5D2NA 2W91A 2H2SC 3MJ7A 4NNXB 1R5VA 1RURL 3BKYL 5CU5A 4YXLH 1S7XB 3UH8A 2ADFL 1DE4B 4K15A 2VKXA 1YEIH 5F8QC 5G55A 4UTCA 1MUJB 2J1XA 3S3SA 2BRRL 3IJSA 1I7ZA 4LPUA 4OLVL 2YPLA 2FO1A 1E5CA 5DTFB 5LGJB 4ZTOH 2EDYA 4NZFA 3G7TA 2R0WL 3ISYA 3G08A 1H5BB 3DMMD 4JN2B 4PG9B 2YD1A 3H7BB 4DSYA 5JHAA 3C6LB 3UZQA 5C7ZA 1GS6X 4O02L 4QRRD 4Y2DC 2B59B 3AU1B 3AT8A 4LHUD 2WTRA 5IV2A 4YX2L 3ULVC 1FNAA 3MYZA 4WWKA 2A6KB 5FLUA 2DICA 2OQJB 4GSXA 4U0QB 4Z76A 2JI2A 1CLZH 2NY5H 1G7IA 1SFDA 2X87A 1TQCC 3BN3B 1ZPLA 1SYSB 3C6EA 2YQ2A 4M7ZC 1JVOA 3VFTB 1OQXA 2V17L 35C8L 3ARSA 3QFJE 1N2RA 2NZ1A 4W9DC 2YZ1A 3TA4D 3WXVH 5ICXA 1CYXA 1SXZA 2H41A 2OI9C 1AFVL 8FABB 2VSKB 4I9WE 5HI5D 1FCCA 2BSED 2YPVL 2DQ6A 3QAZC 5BVPH 3P40A 2EC8A 5LNDA 1I53A 3ECWA 5HGBB 1JCVA 1M2VA 4G7RB 1BJ8A 4ZMAT 5LUMA 2NY2D 3OLEA 3KJ6H 3QO1A 1PZAA 3WLWC 5ITBH 1T04A 4C4KT 5BV7L 4MHHI 3DVGB 1TNMA 3TJEL 3DSNB 1CYWA 5DFTA 4D8PA 4CU7A 3ZYOA 4YSAA 5JW4M 2XQBL 4G83A 2MH4A 3AS0A 4GXVL 1L3NA 1NDGA 4MXVE 4MQTB 4XOEA 5J3HD 5DJ6A 4TTGA 5CD3A 4JO2L 5EN3A 4XHQA 2YEZB 3MBEA 3RVTC 3Q06A 3LKNB 3O9WA 4MZ2A 5SWSD 1JPST 2P4AB 3K5RA 4Y4HC 4UV4L 3WIHL 3V5KA 3PHSA 1PDKB 4KO5A 3UCQA 3QEQB 1E43A 1OSPH 1G9NH 2F53E 2XPYA 3RE0A 3CDZB 3FTSA 3MFGB 2VDRH 2YRPA 1A3ZA 1NMAH 2AABH 3F2LA 5GSRA 4DN4L 3ARDD 1JV2B 4NB7A 5JHLA 1RIVH 2RA1A 5DO2D 1FVEB 4DGVH 3MJ9A 3AAZB 4JKKA 1SEQL 3TEUA 4YMPA 1BLNA 3F12A 4BE6A 4G6MH 2VDLL 4PJBA 4ONFL 4JO5A 5D7SL 3BSHA 2QELA 3DBSA 3N2JA 4U1NB 4YK4C 5ANHA 3WO4C 1HXYA 2ZX7A 4L4VE 2CO1A 2YJLA 1MCNA 5ESQA 1WAPA 2IGFH 1TZ8A 4MJ4A 5BRZA 4W93A 2AAAA 3U7WL 5C0IA 5HDWA 4PN6A 5DMJB 4AM0Q 3TYGL 3IB4A 1U2YA 4JANB 4TMPA 1F4HA 5JPNC 1EPFA 1ES0B 5T3ZH 4NKIL 1GGIH 2Z8VC 4PWGA 5I71C 4KHTH 1ZV2A 1F1DA 3KW7A 4HPYH 1SY6A 3DJTA 5E0FA 1GOGA 2FBJL 4MRCA 3GJEB 2VN5A 4X9YA 3IEAA 2R56H 3A0OA 2HT3D 1EO7A 2EDRA 3BKJL 3T0EE 4NIYE 3FL7A 1AZBA 2GJ6E 2C3VA 1LEIA 5IHZB 4QT5A 2CLVA 1BQLL 4MNGA 5BRPA 4MX7A 2HTLD 4RNRA 5D1QB 4LNVA 2P5WD 1WAAF 4CNIA 4NUQA 1KB5L 1KTBA 3I50H 5IK3A 1JYXA 1HYSC 2VISB 2W80C 1VSCA 3QNXB 5F3FA 3V4PB 1MZZA 1HCVA 3W56A 4UT9L 1MFCH 4G3YH 2XACC 3UXFA 3F83A 4PJ9A 2J4WH 5ETUB 1LK2B 4PJEA 4W9CC 1WIOA 2Y07H 4HOZA 3RU8H 4XP4H 1NCNA 2JF1A 1IQWL 4QAWA 4U31A 5J6SA 4D9LH 3VA2C 4UQIM 4PRIE 3JT0A 1OQOA 4OFYD 5FUZH 1MWAH 3OR6B 2LVCA 4ODVL 3MLWL 3EOTH 3NQIA 5ENWB 5B1JA 1M71A 4L9LA 2NSQA 5D7JA 1I1RA 4XZ4A 1EAPB 1X4YA 2Z31A 3AMKA 1I8KB 1YJDC 1GAFL 1WYJA 3O45A 5I66B 2B3IA 2NNAA 4UNTA 5HHXL 1A6VL 3M1BA 2OXGB 2PCXA 2ZP9A 1OAJA 1N5YH 1BOYA 1M7DB 2UZXB 4MASA 3V0GA 4XE0A 4IOSD 3MLTA 4JY6A 4QMEA 1TJGH 3W39B 3PWNA 4CADB 2N1KA 1BD2D 4KZCA 4PB9L 4ZS7L 5IMMB 1E28A 3IGFA 2FO4A 2N01B 4MCZB 1A6WL 4ZX6A 1VF5C 1MCBA 3BSZH 4GJTB 2H47C 2OKMA 4P07A 4YUEL 1D9KA 1WCBA 2CJTA 3OGOE 2A9NL 4X6DB 3ZJAA 1ZD6A 2I5YL 3EOAB 1K8IB 5FB8B 4F5CE 5DQJA 1HL9A 3ZDZB 3T4YA 4HT1L 4TS6A 4WFFD 2E9IA 3B2VH 4Y5YB 4MMXB 4CKQA 1O9VA 4L0YA 1Q4NX 2ZTBA 2EXWC 1DSFH 1AE6H 1MVYA 3GXMA 2DLHA 3KH3A 4IKJA 4TUJB 3UOAB 6CGTA 1FAKT 5HVHC 1KEGL 4JPSA 5KZCD 4DZBA 1NAKL 2TAAA 1ZDQA 2Y6TE 4PJIF 3RZCD 3SE9L 3V4UL 3NACH 1OM3L 3RKDD 4IK7A 2AJYH 3FFCE 4FQIH 2QPUA 3VI3B 3IDNB 1QSEB 2E4FA 5AOIA 3FCSB 4OJAA 1A3RH 1HHKB 4WUUD 5EO1B 1QFUH 3VD0A 2AI0L 4LXFA 4QXGL 5HD8C 1T3FB 1PAMA 2HA1A 5DC9B 3VFSB 2X9ZA 3WHXB 1PZBA 5KS9B 3IF1B 5LDSA 4GKZB 3TZVB 1WFMA 2UY6B 4ZUTB 3B9EA 1M7XA 4KK8C 2X4PB 4C56B 1DFBL 4GG6F 3MRGA 1OHQA 2C4XA 1F1GA 3CSYB 3PQYB 4P3WA 4N2OA 4RFOL 3ZQWA 5INDB 4Y19D 4IKNA 4NHUA 3S6CA 3GXNA 4OZIF 2G2NA 1MY5A 3QO0B 5EOQL 4TVPD 4QJ3B 1FNSL 3WJMB 1OPGH 3RFRA 2F5BL 4LASH 3EG9A 1RPUA 3G6JF 1HIML 3ARGA 3FT2B 5GRZA 3SGDI 2H9GB 4I18B 3QISA 1CFTA 4LLWA 5EIIB 1I8LA 1KELH 2DWYA 5BRQA 5EU4B 4CU8A 2HMIC 4NKMA 1A4CA 4IRZL 1FNHA 1BX2B 1TTBA 2EUXA 4F58H 2ERJC 4BQ6A 4YLQT 1B2WL 3RWDA 4Z0XB 2DBJA 1KJ3H 1I3RB 3CFTA 1HXMB 2HFFA 5FOJA 5DRWA 4ODHL 5C0CE 1L9PA 4GRWE 3QB7C 3SBWA 1T6BX 1WP6A 2PETA 2VQTA 3CFJA 5ITFB 2P46B 3CHPA 3O8XC 2EKSB 1ZEAH 1X9UA 4LSRH 3MJ7B 2J6WA 5C8JB 3KWXA 1MVFA 1ASPA 2HRLA 3VI4B 1NCBH 3LTVA 3UGEA 1NUFA 2VDKB 1F11A 4D9QE 1NEZG 1B2YA 4LLVA 1PNDA 2DM3A 2IOMA 3BPLB 5I0DA 2O6DA 4FQ2L 4N2AA 3WTUA 4WRLA 1OOAA 3K91A 3NIGB 1SMAA 3RPIB 5CCHE 1GGBL 3DMMA 4K8RC 3STZB 3GKZA 3VXTA 3VWKC 3O2VL 4QRRA 1HX0A 4XI5D 5I5IA 4BFIA 2Y36L 3HNSH 3KXFD 4LHUA 2MTAA 2XETA 4OTXL 3V79C 3HC0B 3RIKA 4WWKB 3HN8A 2DZEA 4MJ6A 4HJJL 3AM8A 2RMNA 1G7IB 5CP3A 4OJDH 2PPEA 1YZZA 1N3NB 3C9NA 1N2RB 4YH6A 5DS8B 1KBPA 1SN2A 4OLVH 4Z7UA 1U92A 3CX2A 4ODTH 5D9SB 1J5HA 3C5ZC 5CEXB 4UDTA 5IEKB 5CGBA 4HIHB 2BSEA 3DRTB 1H0DA 4KGJA 5IQLA 3Q0HA 3GNMH 1V7MH 1XF4A 1RUKL 2Y7OA 5DJXB 3O2DL 1J1OL 1S7QA 5DD6B 4EJ1C 4KDVA 1ZLEA 2J21A 1FIEA 2D03H 5CUSL 1TFHA 5HHNB 4X6FA 1B90A 3NMEA 1E9OB 1CDHA 4G42A 3G5ZA 4MQSB 2V2XB 2PO6C 3WJJA 2XQYK 1AR1D 3FDWA 4N2HA 1BGXH 2ICEC 3R1GH 3EHBB 3FU8A 4HUKB 5JIHA 1HNGA 1OCWL 1QSVA 2D7QA 2GJPA 3FZUD 4ONGL 3QQ9C 1KGCE 4NRZA 1TPXC 5LWYL 1AFVH 3H3PL 1OSZB 4WY7L 5HVWA 2X7LA 2ZX9A 3PHOB 4GIPD 1UCBL 3SYPA 5L0QB 5C6TL 5M94B 3UIYA 1DANT 3O9WB 2ZD0A 2YRLA 2A83A 5T1LD 1FF5A 1KTCA 1II4E 5SWSA 3LD8C 3L13A 4HALA 3V5KB 2VC2B 5ESVB 2OXHB 2IBZY 1L0PA 2HKHL 4TV3A 3GXPA 3OKKB 4KI5E 1DQQA 2MOQA 5EZLA 5LBGA 5AW2B 2CHXA 3ARDA 4NQUA 2YKLH 4AGLA 3UBFA 3DETC 1LO4L 3VXME 4F9PA 4GRLB 3AB0B 1MG3C 5LQBL 2A4ZA 3MPCA 1LLAA 3EJYD 1P4LA 5D1ZI 3W38A 4K94L 5AW3B 3G9AB 4P5KA 2JKIS 3FB7A 5CJ8A 4A6YL 5F2FA 4ZUSA 1BMZA 2YEVB 2E7BA 5C0IB 1U8KA 2D3LA 5HI3D 1T4KA 3LKSA 1ED3B 1CL7H 3P77A 4IW4C 3FMGL 2ATKA 1JWMB 2R0LH 2AQQA 3VMOA 4Z7OE 1U8MB 4DN4H 1LYQA 4YFLF 1KWKA 3KGTA 4XMKL 3V52L 1A4JA 1BFSA 4JZNA 2CR0A 1A3LL 3OKLA 2CO2A 3QPQD 5FYJH 1XSOA 3S5LB 1EO5A 3TN0C 1KYUA 3ZTEA 5JMRA 3MRKA 3QXDA 1IM3D 3D39B 5D8JL 4PJ7B 5E9NA 3NT0A 2AEOA 1OLZA 3DTXA 3N0PB 2C3VB 3MTRA 5EMYA 1LEIB 2GJZB 5E1GA 2ITEA 2AVFA 3KPRB 3ZMRA 2CJSA 4FTDA 3IDGA 2FT6A 2J8HA 3KLSA 4NX0A 4Q0XH 1SXAA 2R27A 2WOBA 2UZIH 4PJDA 2J56A 1ZSDA 2BSBA 3FUEA 2P5WA 4CNIB 4NO2B 1JWSA 1EDYA 3C8HA 5CZVL 3VB9A 1KCRL 4HOWA 2CA3A 5D2NC 3HNVL 2FBJH 2R0ZL 3WI9A 4QRFA 1WD8A 2C1PB 5T1JA 2F8IA 4L48A 4ENED 1X6NA 4ORGB 2PCFA 4PJ9B 3PIQA 3H6JA 1MFBL 5ADPL 1HT6A 1F6AA 1J87A 2EIBA 4Z3TA 4JFHD 1MSPA 2VERA 5C2BH 1CICD 2OMYB 1CGWA 5EO0A 3FTVA 4XCYA 2DJMA 4OFYA 5JW5A 3OJVC 1U2CA 2Q7YA 4QWWC 1DQTA 3TEZA 4GQPH 2QV2A 4IU2A 4BD4A 2B1AL 3BP4B 3CFKA 4AGNA 4AL8H 2PPAA 5D7JB 1I3GH 3QPXL 1HXKA 2FUQA 1L6PA 2WK2A 4PJFA 1C1EL 4U1SA 1YG9A 3UYPA 1GCYA 5BNXD 4P3DA 2NNAB 3MJ8B 1JNHA 1PY9A 4WWKC 1PX3A 3DOHA 2Q8AL 4PP2A 5C07A 1KN4L 4MCYA 1YNLL 12E8L 5AG8A 1X9RA 2XFXB 4IOSA 3MLTB 3RJOA 3RL1B 1BD2A 3R19A 1SHWA 5DDHB 1N6QL 3EO0A 1YPZE 3L6FB 4P46B 3ARFD 1ZA6A 1WTLA 2VDPH 2NW2A 6TAAA 1ORQB 1BAFL 2EADA 4M02A 3FAWA 2F19L 1D9KB 1WCBB 3H2PA 4JK0D 1J1PH 2BJMH 4HJ0D 4NCDA 1RZ7H 1ACYL 2DYSB 5DQJB 5ICYB 3X17A 1GAFH 4MAUH 1OXYA 1ZHNA 4YDVB 5DI8B 3ZKND 1ZLDA 5FM4A 2IH1B 1QQDB 4FZ8L 4XPFH 3F7PC 5L2KB 2ZUQC 3KNBA 4GAGH 5E94B 2A6IA 5GJTH 4CJ1A 4ZQTA 1YEHH 4R7DB 4OLXH 4WK2B 3EHBC 3KH4A 4ZS7H 5C08E 4IEFB 1NFDA 2C9SA 4XZUB 3RZCA 3Q8BA 5DYFA 3IGKA 4OLUL 2DQHL 3L17A 4J3OC 3MUHL 2BCKA 2OPCA 3TBSA 3LRMA 4YUEH 3LQMA 5EUOE 2DBLH 5HHOD 5L0QC 1RERA 1TQWA 1E4HA 3MBEC 1A1NA 2KERA 4WUUA 5DA0B 3FC8A 2WUCL 3O9WC 4JPWL 4DJMA 5IFJA 1BQSA 1RSFA 4HT1H 2AK1L 5TK4A 1UH4A 2VITB 5CLWA 2OL3L 4PD4J 5DJ2A 3PS6A 5I76A 1S7UA 3TWCH 3FCUB 4WGKA 4BKSC 4P2CG 1CL7I 2UX6A 3QJHA 4PGJA 1LDSA 1N7ML 2IDQA 5DR5L 4W6XB 1OM3H 4Y19A 2B9AA 2CRYA 3QJUB 1IZKA 5SX4H 4NENA 5IM7A 5AW6B 1ML0A 5CGTA 1SDAB 1RULH 1PZ2A 1K5WA 2X2YA 1TYEB 3EG9B 1MHCA 3QQ3B 4GS7B 4KKCD 2XA8H 4YR6B 1N8ZA 3ARGB 3B7SA 3IJ7A 1OP4A 1CFTB 2AI0H 2PNDA 4P2AA 3L5WB 4L23A 4QXGH 5TGBB 4FDWA 1NCWH 3N85L 3MRBB 3BJLA 2SEBA 2WQSA 4TF4A 1QSFD 1TENA 3MBXL 2AITA 4HCRA 4KKQA 1AXIB 1JPGB 4LLQA 1DFBH 1SVBA 4U3HA 2OMWA 4I1NB 2FX9L 4W4OA 5KAQG 1E5UI 1X5GA 3L4VA 4NXKA 3EAKA 4GINA 4PGDB 2V3DA 3V6ZA 3H3BC 2BP0A 3MV7B 1MFDH 4AW7A 2X1OA 2IAND 4LBEA 1B4JH 5FKPA 2UZYB 4XTRD 4XVSL 5FYJU 4I77L 1FNLA 1G1YA 2F9BT 2JKWA 4AC2A 1F11B 5FW8A 1P6AB 3GJFA 4PWJA 3L95A 4QYOA 4KV5F 4PVMA 2UXTA 1J9SA 3FQTA 3MA9H 5DVPA 1G6RH 3D2TA 2R29L 3VXRD 3LZQA 4NNYA 4ODHH 3DMMB 4WI8A 1EX0A 2ODHA 3QCVL 3TT1L 2QT6A 3GC3A 4NUJA 4WO0A 3UAJD 2Z35A 4IJTA 1PZDA 4WW2F 3KXFA 1DQDL 2DKSA 5E2JA 5T1KD 4U1JA 3ZL2A 2CRZA 4ZO6A 1T7VA 2CK0L 3CDGA 4UQCA 4Z7VF 1FZOA 4PJ9C 4FYSA 3BEVA 3JV4A 1ETA1 4FABH 4QRTA 3V4VA 2JKNA 1BBJB 4AVKA 4F7CA 3FTGB 4AEEA 2J6EL 1JERA 4UQDA 2DM7A 2VM9A 4Z7UB 4J6RL 1UEMA 1MFEH 4MD0A 2I9TB 2LAAA 4UDTB 5B1JC 3ML9A 4BH8A 1OF0A 4L9LC 5HDBE 4N0UB 5D7JC 3FFOA 1H0DB 1IAIL 2ITFA 3A4EA 2Z31C 1K9TA 3ETTA 5TPWH 2Y36H 4IRJD 1Q90A 4NQXB 4QOKB 1S7QB 3TPKA 3D12B 1A7BA 2Q5BA 4HJJH 5ADOL 2OM5A 3M6DA 2FE0A 4PS3A 4HZAA 1I9JL 5E9DD 4C59B 3G5ZB 4DZ8B 1T0PB 1KB3A 5AVRB 5JMOC 1S5IL 5GISL 5FFLA 5AW1B 1KIUA 1QPXA 4NRZB 5TE7L 4FERA 5CILL 5KUKA 2HLFC 1CS6A 3U79A 2XJKA 1D9KC 4HUNB 4ZYKA 2GEQA 4JGJA 2E6QA 2EZ0D 1XZWA 5C92A 4KKLD 1PAZA 4JFDE 4LVOC 1S9XA 3VTTA 3I6LE 4NQSA 4X80H 1HH6A 3H54A 5T1LA 2A83B 4YXKL 2FH8A 3UACA 4Z23A 4UUJB 4OKDA 3WFHA 1BMGA 1FN4A 4PJCF 3U0WL 4UINL 2UWEF 4LLDB 4W9GC 3U9UB 3CQFA 2A4EA 4AXWA 4ETQA 4DVBB 2XWJB 4FN0A 2VL5A 1QOKA 2BY2A 2QVKA 2E59A 1OCWH 2Y7SA 4P5TD 4BUQA 1NFKA 5F7NC 2XZAL 1ACXA 2WQRA 4TNWK 3H3PH 5LWYH 1JYNA 3FQYA 1UUSA 2ZKHL 3BUYA 3NDZE 3NP3A 4JMNA 3MGTA 3R8QA 5I17A 1UCBH 2ATAA 1JGLL 2V4LA 1KJ2L 3TYFA 4Q9CA 3OV6A 3V7AG 4JS7A 4MJ2A 3CZFA 1PEZA 3FU3A 4X99B 4H20L 5KVDH 3W82A 4KU1A 3FQ4A 1P0SE 3ASOB 4C83B 5KYUB 4FG2A 2C1OB 1OHZA 3MLUH 1PS3A 2D3JA 2Z9TA 2Q8BL 3KHOA 4NAMA 5TQ0H 5A1AA 3NA9L 1YQ2A 3TFKC 5ILTH 2EC9T 4Y9BA 4FJ6A 2WINA 5DZNA 1D5IH 3FN0H 3X12A 3IXAB 4RX4D 5IWLA 4UAOB 1VHPA 2JSFA 2XTJD 4UWQB 5BMFL 1IM3A 4K94H 1W8OA 3WIFA 3ARGC 3NVQA 4J3XA 4QUOA 2EDFA 3RX7A 1I8LC 1PZSA 3LS5L 2AK4D 4PAZA 1HZHL 3BE1L 3CHQA 1MRCL 3N1PC 3UYOD 4UM8B 3SDAB 1G94A 2J12B 3BZFA 3FMGH 2IDTA 2WCSA 3U6RA 1MCFA 3VTMA 3NH7H 1T21B 1G9MC 1ZSDB 4WHTA 3X1GA 4XPAL 3U4BL 3G04A 1MJ8H 4OSUH 2APBA 5FM8A 4MJ5B 4XMKH 3SBWC 2HLEB 3HMWL 1TU2B 2H3NA 1NCAL 1YY8A 2A9DA 3VACA 4OIFA 1M7UA 1D5XB 4IGBB 1URLA 1XIWD 1L5GB 2I32A 3GQFA 3U0PA 3KMDA 3DTUB 1CXHA 1AQKL 3CQPA 3PIQB 1L0QA 4GW4B 4M7LL 1XH3A 1FC1A 4RRPG 2GTZB 4P2RE 3KR3L 4XPTL 2RQEA 4G9FE 1CICA 2Y7LA 2APSA 3VXSE 1FYTD 4WVRA 1QWHA 2P8LB 3GI9L 1N6VA 1NBZA 3C09B 2Q7YB 3DHPA 1RZQA 3DMMC 4IU2B 3ZE1F 1YECL 3CFKB 1J5DA 1IEAB 1RZ8A 4YFLI 1OAZH 2D31B 3LKRB 2Y5TB 3QCTL 4XNAA 4MZIA 2HCZX 3HNVH 3VXPA 2R0ZH 2CU9A 4HPHA 1W91A 4KFMA 3MFFB 1OP3H 4P5SA 3GSVA 1VPOL 3AM8C 1K6QH 3H42H 4PP2B 5J6GA 5C07B 2OAAA 3IETB 4XN5A 5F7EH 5DVOA 1MI5E 1N6UA 1X9QA 2MPVA 5AL0A 3SKUD 1AYOA 1MFBH 5JR1L 1F1AA 1INQB 3V5HB 1RMFL 4ZMXA 2VZTA 1JGIA 3AG3B 3NPSB 3MRFA 3D5OF 4FQXD 2Y3AA 3ARFA 3ZL4H 4YEEA 2CUHA 2H3KA 3P73B 5CKAA 1AQDB 1AD9B 5HI5C 1MLCB 2N1TE 4L4TE 2BNQE 2WXKA 2OJ1A 1I8MB 3QPXH 2A9MH 5F7MC 2VCOA 1C1EH 1A6TB 2JH2A 3ME0B 4JO3H 1KN2H 3FT4A 3O4OC 4PCSA 3WL9A 4XP1L 2NY2C 2BNUA 3D69B 2RFXA 4KNQA 5CLZA 4F8NA 2KYIA 3HE7D 3WJJC 4AVIA 1WITA 2D7TH 2N4IA 4XVTH 3BFOA 3EYUH 1YMHB 3K0WA 1L9NA 4HPOL 4JRXD 5DHYB 3RZCB 4RWYL 1Z9MA 5I19H 2M83A 5J3HC 4H7VA 4XP9H 1P5UB 4YHNA 5IW1A 5F0MB 1D7CA 1KZYA 3HI5H 3ZE2B 1FCGA 3DDFA 1LGVA 4H26B 2FHBA 1ACYH 5EN2A 2OMXB 1USZA 2FIKB 4DO5A 4TNEA 3D48R 4N1HB 4BDVB 4G1MB 3ARBB 2LABA 3FOLA 4Y1AB 1S7RA 4UTBL 3GSWA 1R33A 2W94A 2IXQB 4TULL 4JX0A 1ZGLB 1X4ZA 1H3WM 3L16A 2EDHA 1UXWB 3D8MA 3WGVB 5I76B 3F64A 3RRQA 4AQ1A 3HR5A 1FSKC 1U3NA 5DMKA 5HGAA 3QJHB 3ARDC 3FQRB 5IW6B 3TBVB 3OKMA 4UYQA 5DO2C 1JZ2A 3OD3A 4JVWA 1V5JA 4LCIH 3DV4B 1ZE3C 3TNNA 4F9PC 2ODIA 3ECQA 4XNQB 4XMWA 3VMNA 5KSBE 1JPFA 2XRAH 3T6WA 3TXAA 3FQUA