1JXGA

The 1.6 a resolution crystal structure of a mutant poplar plastocyanin bearing a 21-25 engeneered disulfide bridge
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
100
structure length
100
Chain Sequence
b'MIDVLLGADDGSLAFVPSEFSCSPGCKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN A
publication title The 1.6 A resolution crystal structure of a mutant plastocyanin bearing a 21-25 engineered disulfide bridge.
pubmed doi rcsb
source organism Populus nigra
molecule tags Photosynthesis
total genus 27
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1jxgA00
2CALA 2I7SA 2PPEA 2JXMA 5EHFA 1XB6A 2YAFA 4DPCX 4E9QA 1JERA 4FA7B 1PLBA 1OCRB 2DWSA 3EF4A 1KBWA 4A2FA 3OMNB 9PCYA 3NP3A 4HCFA 3QJRB 3SBQA 3X2QB 1GS8A 2GB2A 2CJ3A 2HXAA 3NJJA 4HHWA 3SBPA 1ASQA 4HAKA 2XV2A 1BQ5A 2EIMB 4A67A 2AZAA 4JHVA 1I53A 3JT2A 2PPCA 2WSDA 5FC9A 2EIKB 2JFCA 3FSAA 4YSPA 2PP7A 2QPEB 4N8UA 2YARA 1PLCA 3V9CA 3KW7A 1GY2A 2UXTA 1OCCB 1SNRA 3T6WA 1OF0A 4A2DA 5ANHA 3NT0A 5I28A 1BXUA 4KO5A 2GSMB 1NTDA 2QDVA 1OE3A 4GYBA 3X1NA 2GC4C 3CVBA 3OMAB 3FYIB 3FU8A 4G7QB 1A4BA 1JZGA 2VW6A 4DP8X 1JZIA 1M56B 1DZ0A 1GYCA 3ABGA 1CUOA 2FTAA 1RCYA 2TSAA 4GP5B 2GIMA 1SFHA 3AZUA 4KNUA 4DP6X 3V9EA 2BW5A 3T6XA 1OOWA 3GXUB 2VM3A 3NJFA 3ABMB 4JKNA 1AANA 2Y1AA 3TBBA 1OV8A 5I5JA 3TBCA 2HZHA 5B1JA 3PPSA 4KO6A 2VM4A 3AG4B 4CSPA 1SHXA 1J9TA 2E86A 3SBRA 2LLNA 1IBZA 1MDAA 2IH8A 4YSEA 2CCWA 2FT6A 4YL4A 1WA1X 4YVNA 3H4FA 4NAJA 3BQVA 3DIVA 2YXWA 2HX7A 3CVCA 3NSYA 4YSCA 1CYWA 1PAZA 3OMIB 2NRDA 1KCBA 2IDTA 3CDZA 3ABLB 4DP9X 1NPJA 3T6VA 1ZDSA 3S3DB 4BDVA 4BWUA 1B3IA 4G71B 1AR1B 2FQGA 1KCWA 3L45A 1NIAA 1ZIAA 2BP8A 3FU9A 1PY0A 3CDZB 3QJUB 4AKOA 4A68A 2FQEA 5PCYA 1SF5A 1WS7A 4BDVB 1NINA 2FJSA 3GDCA 2IH9A 1E5YA 2BP8B 1L9PA 3CVDA 1A4CA 1FWXA 4NERA 3WKQA 2BW4A 1TEFA 4KOBA 2HRHA 3EHBB 4GP4B 3AW5A 1KYAA 2AFNA 1ASPA 1QLEB 1ET8A 4WTQA 2OV0A 1ETJA 4HALA 4BXVA 4E9SA 1KDJA 3ASNB 1UATA 4P5RA 1ILUA 2UXGA 2VSKB 4RH4A 4G7RB 1GS6X 2DYSB 1W6LA 2I7OA 2RACA 3HB3B 1BQKA 4GY4A 3OD3A 1BQRA 1NIFA 4X4KA 3S3CB 4PAZA 1NWOA 2HRGA 4YVUA 3DTUB 4A2GA 1OE1A 3DKHA 5I5IA 1A8ZA 5D4HA 3IEAA 1TU2A 2XV3A 2UX7A 3UGEA 4WKXA 1WA0X 5B3SB 1NDTA 1AQ8A 3FPYA 1ET7A 1TEGA 2FQDA 3BVDB 3EH5B 1GSKA 3PCYA 4E9TA 1E67A 4GP8B 2XU9A 4AI7A 3AY2A 2IDUA 2HLEB 4YSUA 3EH4B 2ZOOA 2TSBA 2PPAA 1OE2A 1WA2X 1BYPA 5F7AA 3ERXA 1KV7A 3FSVA 2Y69B 3ZX1A 2J55A 1ZIBA 6PAZA 1R1CA 2FT7A 1GY1A 1E65A 2IDQA 1WAEA 3PAZA 2BZCA 1SDDA 2AANA 4A66A 4F2EA 2B08A 1J9RA 2Q9OA 4EF3A 2W88A 4GXFA 2GI0A 2VW7A 1J5CA 3QJSB 4E9YA 2MTAA 1RZPA 1URIA 1AOZA 2EINB 1SDDB 1E30A 2PP9A 2XX0A 4KO7A 1A3ZA 2DV6A 2HX8A 4M4RB 2WO3B 5AKRA 3H4HA 4AKQA 2IWKA 1KDIA 3X1EA 2VW4A 3ASOB 1CC3A 2XUWA 1TKWA 3UAEA 1CURA 1JXDA 5D4JA 3QJVB 4BWTA 1EHKB 3D12B 1PNDA 1QNIA 1NIDA 3TU6A 3QQXA 4ZK8A 5F7BA 4JHUA 2JKWA 1BXVA 1GR7A 4YSTA 3CZUB 1NIBA 5E9NA 2X88A 1CYXA 3FQ1A 1YLBB 2YAOA 3ZBMA 4DP0X 2UXVA 4M3HA 1SJMA 2UX6A 1IBYA 4KNSA 1JZFA 3UACA 4W1TA 3OQRA 3UABA 1L9QA 2XVBA 2P80A 1L9OA 4CSZA 2A3TA 4G72B 2GBAA 1SF3A 1IC0A 3NJIA 2H5UA 2VSMB 3G5WA 2VMJA 3MX0B 3U25A 3WNJA 3NSFA 1EZLA 1ET5A 1N70A 2YAQA 2PPFA 2IDFA 1HAWA 2N0MA 5B1KA 1PZBA 1AS8A 4E9VA 4HCIA 4NB7A 3QJQB 3OM3B 2BZ7A 1PZAA 4UAHA 1SFDA 3NJGA 3H56A 2GHZA 2PCYA 2XV0A 5LDUA 1AZNA 3PAVA 5B7FA 4Q89A 1WS8A 1MG2C 4AZUA 2BWIA 1GW0A 2H3XC 2J57A 2PPDA 3MBWB 2QT6A 3N55A 1W6WA 3FQ2A 1F56A 1X9RA 4HIPA 2YXVA 4DPBX 4DP4X 3AG3B 2AZUA 2YAPA 1BEXA 2DWTA 1KBVA 2BO0A 1HFUA 1ZPUA 4YSOA 5I6PA 2CAKA 1BYOA 2R7EA 4UANA 2BHFA 4BXSV 4P5SA 1JVOA 1DYZA 4KOCA 4YSRA 4TXVB 4DP7X 3FPXA 1HAUA 1JZHA 2PLTA 3NSCA 1MZZA 3FQYA 2R7EB 2H47C 2X87A 2VN3A 2YQBA 4ENZA 1ZDQA 4K9JA 2OJ1A 1E5ZA 5I6MA 2EILB 3FSWA 1V55B 3NSDA 1PF3A 3S8FB 2YAEA 3JTBA 1AZRA 3SQRA 5I6KA 3S3BB 4MFHA 3FS9A 3WIAA 1IUZA 1PNCA 1L9TA 2EIJB 4FAAB 1M9WA 4YSAA 4YSDA 5B7MA 3AG2B 1L9RA 3NYKA 1OCOB 2CUAA 5B7EA 1AZCA 1AG6A 3NJMA 1PZCA 1XMEB 2Q5BA 5I26A 1V54B 1AZUA 4HZ1A 1W8EA 1JVLA 2BP0A 5I6NA 1JZEA 1RKRA 2DYRB 2J5WA 1NPNA 3IN2A 3EH3B 1AACA 1AG0A 3TASA 1MG3C 2IWEA 2WO2B 3FSZA 3T71A 4W9ZA 5AFAA 1PLAA 2BP0B 4Q8BA 3UADA 1XB8A 3WNIA 2FT8A 1ILSA 1NZRA 1JOIA 2QPDB 2W8CA 5B1AB 1MZYA 4DP2X 1T5KA 2FWLB 2IDSA 4E9WA 4DPAX 4QKTA 1NICA 2QDWA 1J9QA 5IY5B 1AIZA 4KO9A 3S8GB 4BWWA 3PXLA 2FQFA 4PCYA 1OCZB 3ZIYA 2B3IA 2XYBA 4N4YB 4YSSA 5D4IA 2YAHA 2DY2A 3FT0A 4UF7C 4AX3A 3IN0A 4L0PB 4HHGA 5B1JC 4E9RA 3QJTB 1NIEA 2ZONA 1V10A 6PCYA 1J5DA 1L9SA 1PMYA 2ZWNA 2UXFA 1J9SA 1GS7A 1JXFA 1AS7A 1FFTB 2J56A 1JXGA 1QHQA 1A4AA 2XXFA 3T9WA 4DP5X 3NJHA 7PAZA 4F7KA 3NJNA 2GC7C 3GYRA 4G70B 1X9UA 3FYEB 3UAAA 2BWDA 4DP1X 2I85A 1FA4A 2XXGA 3ZDWA 2MRYA 4E9XA 3WKPA 5TK4A 4AKPA 1VLXA 3NP4A 4G7SB 2PP8A 4KNTA 3X1FA 3X1GA 1AZBA 3RYMA 2P80D 3IBOA 3WG7B 4BK5C 2FNWA 1A65A 2YAMA 3PAUA 3NJKA 4QLWA 2OCCB 3C75A 3T6ZA 5I6OA 1PCSA 3PLYA 5B1BB 1RZQA 5I5MA 8PAZA 2ZXWB 3AG1B 4A2EA 2IAAC 3NJLA 2XX1A 4YSQA 4F2FA 1BAWA 1ZV2A 1ID2A 1XB3A 1KGYE 5AZUA 5A7EA 2XLLA 1BXAA 1ADWA 1JZJA 2CBPA 3QPKA 2PCFA 1ASOA 1AS6A 3ABKB 1NWPA 5PAZA 1SHWA 3HEIB 5I6LA 3X1BA 2XWZA 3FU7A 3TA4D 4A2HA 2AVFA 4HCGA 3IE9A 3WI9A 5TK2A 1IKOP 3CG8A 2IWFA 1N68A 7PCYA 2HX9A 3N2JA 1M57B 3KW8A 1AAJA 3FU7B
chains in the Genus database with same CATH superfamily
2CALA 4HS8L 5C0AE 4U6VH 3NOIA 3WENA 2YAFA 3BAJA 5FYKU 4AMWA 3CPLA 5FO8B 1K3ZA 2BRRH 5J6HA 2NPLX 1BX2A 1NBVL 3HS0A 5E2VL 3OMNB 3U4EA 5CUSH 2DQHL 3EO9L 3CJJA 4YIQB 3FTXA 4HCFA 4FFYA 4XP4L 4B97A 2X10A 3FNKA 2GB2A 1Q72H 2DQJL 2NYKA 3BHBB 3BGAA 1HNGA 2HXAA 2BSCA 3KH3A 5IVXB 4JFSA 2EKSA 2XV2A 3X13A 1OARH 3BAIA 3C08H 5L8LB 3DXAD 4JHVA 1CU4L 5DS8B 3FO9A 4N2NA 4R4BB 2VDMB 5IMOB 4LSQL 4N8UA 1PLCA 1JAEA 2E59A 2H6PA 1KCSL 4RCAA 5G2NA 1IM3D 2WZAA 3CSFA 4XVSH 1P4UA 5D7LE 1QW9A 3QQNA 3T6WA 4CKVX 3OPZL 5J89A 5IW6A 4L4TA 1IIKA 3CVIH 3EKCA 3F6IA 1BECA 2M83A 5D2LA 3L3IB 2BOBB 3V5KA 1KYOJ 1ODUA 1QATA 3ZIMA 4KKNA 3TVMA 5DSCA 1HEJC 1T0OA 3FYIB 1WCBB 2VR9A 4U1GB 5FA3B 4ABVA 1A4BA 1S7WB 4LXFA 3I9AA 2R0ZH 1UD4A 4R7DA 1BEYH 4EVNB 5CFAA 5DFVC 1RV6X 3O3EB 1CE1L 1GW6A 1YN7B 1FPTH 2Y2WA 4MNGB 5IIEA 4HMEA 3IDJA 1K5WA 1X5LA 2HFFA 2L7JA 5DEJA 4HKJA 1BAFL 5DR5H 1OOWA 5ICZA 3ME0A 8FABB 2Y1AA 3AXIA 4MAYB 4RMUA 4JO2L 4JG0L 1G9NC 3V52L 2G2NA 2VZUA 4CSPA 5BXFA 1UXWB 2JB6B 1SHXA 2GJJA 4UIMB 3SBRA 5C9KA 1CLZH 3G6DL 4LASL 1M53A 1U58A 4R7LA 1UACH 3MLYL 4XPFL 3IETA 3TZVA 1FVEB 3FU6A 3B2VH 1N6UA 2WXHA 2EVGA 1OWRM 4GKSA 1QABA 4YSCA 5I6XC 5KSVB 3OMIB 4UB0H 3ZYIA 3ABLB 5KSAD 1TSHA 1ZDSA 4WHYH 2WN2A 7CGTA 3MRJA 3OG4B 1KJVB 4TNEA 3QQ9D 1DANU 1KCWA 5DO2C 3OKDB 4HAGA 1ZPLA 4P4KD 5IVXF 3L4UA 4I48A 4FL4B 3B9VA 2FIKA 2G75A 5TQ0L 3TFBA 4F8NA 3GDCA 3VWKB 4XCEB 2YGVA 3RZWA 2BNUA 2EACA 1MCQA 4P2RE 3P4OB 3GPSA 1U92A 3AGWA 2YBRB 3HZYB 4KOBA 3ZO0A 3I3DA 5E51A 5CJ8A 3WEBA 4GAFB 2GUOA 2W91A 4NKOA 2OQJA 2YKKA 4RRPM 5M94B 4AV5A 5IB5A 1OB1A 1DQDH 1KLFA 3ASNB 4WU5B 2K1MA 4ODXA 1DLHB 3S9DB 4HYTB 4KKLD 1KV3A 4F7TA 3KPQB 4AYEC 2J43A 1W6LA 2ADJB 3TF7C 2P8LA 3GLAA 5ESQB 3RB7A 5FO9B 1BQRA 3LIZL 1Y7VA 4BH8A 4NFBA 2C4FT 5B22A 3BAXA 4RRPG 3Q05A 4KXZI 5MP6L 5FO7B 2H4EA 1XF5B 4X4MA 3X12A 1UURA 2ICWB 5DJ8B 4PP1C 3ARUA 3ZXAC 3I3BA 3CHXA 4NI6A 3NG5A 4YAQB 1KBKA 5SV3A 5A2IH 3KLLA 2NXZB 1JD7A 3B3BA 4Q9RL 1WP6A 5C07E 3O4LA 4YXLL 4LVHB 5EO0A 1QVOB 5F6HI 4L8SB 3CH8A 4GP8B 5E4EC 1QQDB 4L3EA 3DX9A 1JNHA 3QW9A 4P2OC 3HTLX 4XNYH 5I1HH 4MXVF 3B9KC 4BFIB 2R2BA 3Q01A 1DFBL 3HRZC 5ABAA 1OE2A 3MUZ1 1BYPA 43C9B 5JW4N 1ULVA 1JGLH 3UTQB 1HZHL 2EIDA 2A6KA 1OP3K 3UYPA 2OA9A 1MI5E 2HLAA 2P24A 2J7LA 4WTZG 1ZGLP 2WMPA 4GIOA 1NGWB 3CBJB 3QDMD 1KYFA 5EU3A 1U3ZA 3FB8A 1TQCC 2XPYA 4KI5D 3BJ91 4Z3JA 4EF3A 3FC8A 1MJ7H 4X98A 3TBSB 4E9YA 1P4LA 1DBKH 4C83A 3MBXH 1KJ2H 1MY5A 3CUPA 1C1EL 1E30A 5D6CA 3WN5C 5DRXA 2ZICA 2AI0H 2HX8A 2JKSA 3MRRB 3MLZL 3WTYA 4WSGA 4QPEA 5C08D 4BFEA 4KWUA 3O45B 1TKWA 4KMTH 4XXDB 2ED8A 5KAQF 4FQHB 3CMOH 1WBZA 3DO4A 1YEIL 4J4PA 5LBSA 4HMDA 4N24A 2RGSA 3H7LA 4NGHL 2GSIA 3GRWA 3QJFA 2NQDA 3MJ7B 4HJ0D 1PDKA 1WZKA 2AJ3B 3NCYP 1QUNA 3QJXA 1U6AL 3PWJB 4A7GA 1K2DA 4QIRA 2NY6D 3SKNB 1FORH 3WS6C 3LIUA 1MW2A 3IJ7A 5JOFB 4ZQKA 2UXVA 4M3HA 4AYGA 4WJ5B 4KRLB 1IBYA 2B39A 1MVYA 4JKLA 2C1OB 1AHWC 2VDKL 1KB9J 4LIQE 3VWJA 3C5JA 3OL2A 3LZRA 1TCRB 3L6FA 2VMJA 3WNOA 1KXHA 1EZLA 3MRDB 5HDBB 3U1QA 2EDXA 2P3YA 2AP2A 3WXWH 1BVKB 5IHZA 3GXPA 3FOLA 4M5TA 4L8DB 5DEFB 3GUTB 5HI4D 2H32A 2DWXA 3QIBC 2XN9E 1UFUA 1MFBH 4RGOL 3IGUA 4DERA 1D3CA 3QDHA 5F7DA 4U4IA 1QSEB 4OCXH 1JYVA 3QZWG 2ZX5A 5DRWA 4EOWL 1BJ8A 4OCNC 3BH8A 5C9JA 2VLKE 4O2EA 2W5PA 5T1KB 1UA7A 4WI0A 1TPXC 4ILDA 5DI8B 2VOTA 1NUDA 4MJ5B 5C0AA 1YEEH 2ENSA 3QUYA 5L7XL 1S7XA 1B2WH 1TMCB 2B1AH 1AGDA 2ZNXA 3GGWA 3A21A 3ILDA 5AVYB 1UT2A 3BO8A 3EJZC 5D6DC 2C9RA 1QUPA 1A5FH 1IAMA 1UWEL 3VFTB 3P40A 5I1LA 4G7YH 4YZWA 4DP7X 4YHZL 1JZHA 1YEGH 2VDNB 3BSGA 4M03A 3WFCL 5I1GH 3SE3A 3MREA 5D96B 3L4ZA 4NKQB 3PL6B 3RZCD 4HBCH 2MKLC 3RWCB 5IP4A 1F11A 1DUZB 2NX5E 2LFEA 3FTSA 2ZNWA 1TQBB 3BPNC 4JAMB 1AD9A 3E38A 4Y8AA 1DVUA 3DMMD 2QZ5A 3IDNA 3P0GB 5CBAA 3BISA 4HUWA 3DX8B 1KN2H 4ODUA 3TPUA 2R0WL 1AHMA 4YDZA 2B1HL 4GKOA 3O2WH 5IROD 1PNCA 3EJRA 4UAOB 1U8MB 2HKHL 5D7LA 4P9MH 3DJTA 5CD3B 2NW2A 4ZUTB 1KCLA 2FO4B 1W0VB 5L8JB 1TENA 5EDSA 2HJKA 1WDAA 2P7TB 3JTTA 4U1NA 4DO4A 2MQGA 5FLUA 3SDCD 3W5MA 1SVZA 5F8RC 5I8CB 2K4WA 2RH0A 5EZOH 1EHLH 4M1GH 5HDBF 5IWLC 4D0DB 4YMPA 1J8RA 4J8RB 1NFKA 2J5WA 1INDL 5KANG 2WJ7A 4WKZB 3HC4H 2QKIC 2WO2B 3LNEA 4H7VA 5E2TH 3A6CH 2ZOLB 2ZTBA 3LS5L 1MCCA 4B41A 3U0TA 3MLUL 3F7PC 4NWTH 3R18A 4AUJA 2B7DT 3KAAA 4GI6A 4IKIA 1XB8A 1CLYL 2J4WL 5CLYA 4DEPC 5HJDA 5BVPH 2C3HA 1JMZA 4JO4H 5B1AB 4MA3B 3KYMB 4HH9B 2V5SA 4XH2A 2AXWA 4KUZL 2G3XA 3Q8EA 2ATPA 4QKTA 1F6AA 3D2UD 1AIZA 5D7IB 5IVOA 1YMMA 1RK1A 1OCZB 2H26B 3NCJH 2XBDA 1LWJA 2FE0A 3MXWL 5LG6A 4IBLT 4RWYL 4L0PB 1FJ1A 3NGBC 1IQWH 1A4JA 1A6PA 3QJTB 1OY3B 4GW4A 5DVMA 2CUMA 1MLCB 4H26A 4R83A 2DQGL 5GS3A 1S7TA 4PRPE 4HLEA 3STBA 1OP3H 1U8OB 1S3KL 3CZLA 1A3QA 4Y19B 1PCXA 4CVZB 2VL4A 3KBFA 1QHQA 4CVXB 4N2KA 5HPMA 1OM9A 2A74B 5F88B 3GYRA 1K9TA 4ETQA 4G3YL 2EECA 1T5XB 4A63A 4NFCA 5EEVA 4FYQA 2BSBA 4AKPA 1FZMB 3QFJD 4X6DA 3GC3A 3QCVL 5C09E 1RHFA 1G4MA 1NM4A 4TNFA 3SOTA 4EN3A 3PU7A 4D94A 4QCIB 2YOAA 1MWAH 5F3HA 3MO1B 1XGYH 3NJKA 3TIDA 1F4HA 2MMXA 1G1CA 4U6HA 2CA3A 1PCSA 5I6OA 3TX4A 4F93B 3ZUCA 2CR6A 5AZEL 5K39A 1NCCL 3LEVH 4UTCA 4TSAH 2P1YA 1Y1DA 5IJVA 2IAAC 4UWQB 4JFFE 4G5ZH 4LL1A 2R0KH 5EU7E 4BH7A 2OMVA 5D70L 3IFPB 5B38G 1A7PH 1MAJA 4UYQA 5TDPA 1CLOL 3UTTD 1ASOA 2R56H 1WIOA 4PJHE 1RUKL 5C07A 2LU4A 3JYCA 5C3IA 5PAZA 5FGCE 5H35A 3V0VA 3RY5A 3AROA 1OW0C 4QD2E 4Y4KC 5AVQB 5LO7A 1E2WA 2AVFA 1KLGA 3T2NH 2PCFB 4OCLC 4ZDHA 2BS71 5F6IB 2IWFA 2F68X 1QYGL 2WQWA 3P11H 4FG6C 5D7IF 4ZW5A 5LHDA 5I75C 2UZXA 1J18A 5FKPB 2B8OT 2C26A 2GJ6E 5EHFA 1XB6A 1LJMA 4Y1TA 1NKOA 1E9PA 1ZHLB 1NC2A 4N0CD 1EJOH 5E00B 5E8EA 1KBWA 3WIHH 3CFNA 3BT2L 3NIGE 3FSOA 2NY7L 3CSYA 3O3DB 5D1ZD 4E2OA 2CLVA 5CCKL 4H0LC 4WNQB 5HDQH 2WXIA 4P3CL 1N64H 1I1YA 2KYIA 4IHBA 5D1XE 5EG6C 2YO3A 1YJDH 2F8IA 3GO1H 3R0NA 4ZAKA 5J12B 3BN3B 4NSKA 2BSRB 4P2OB 1D7BA 4IK6A 4J6IA 3D4GA 3QARA 3HFML 3COOA 3GZPA 4PBDA 5C0RH 3B9KB 4UT9H 4JM2A 1BLNB 1A7QH 1SMOA 3DIFA 3W38A 2X4QB 5AVXB 5KS9E 2QADD 1BBDH 2VLRD 2GVYA 2KZBA 5JXEA 1F1GA 3BQUB 4R2GD 1DJZA 4CUCA 3RFZB 1U8QA 1WRFA 1RU9L 4K7PL 1D5IL 1E4KA 1NPUA 1OE3A 2YPVL 4AEIH 4N9OB 5SWSD 4HT1H 5TDOB 5HJ3B 4TM9A 2CJTA 5FV2A 1JZGA 3F84A 1P5UA 3MSPA 2WXPA 5DD6B 3HI1B 1IM9B 1OAZH 1IL1B 3L4XA 3SEPA 4E36A 3H9SB 4GP5B 4NQCB 5DXWA 1VEPA 2V3DA 4PJEA 3D3VD 4TLUA 1CFVL 3ABMB 4JKNA 1UT9A 4HEPA 4YK4B 5AOKA 2W0FA 2R29H 1AQHA 2YPLD 2WINB 3CLFH 4J3OG 1CXEA 1UZ6F 2KS0A 4AZ8A 3EGDA 5C86A 1J9TA 2YKLH 4UILH 3TXAA 3WTSA 4DK3A 3DVNA 1IGTA 2GG1A 2XVLA 1TJGL 2WGXA 3MRBB 2NSXA 4ODTL 4XAWL 1M05B 4AUYA 4PRIE 4XBEH 2VLKA 3U1SH 5HPOA 4I0CC 1P9MC 2J88L 2VR8A 3HJEA 3N43B 4X83A 2IDTA 4OB5L 3VQMA 3LQAC 2CO3A 2XZAL 4YXHL 1NUGA 3MRFB 2EDJA 4RNRB 1TIUA 5H94B 2JH2A 4A68A 2MHAA 2XFXB 3ES6A 3QS3A 2I5YH 4WV1A 4B5ZA 1L7IH 2A7BA 4IBYA 1MIML 4QXGH 2B3RA 1YY9C 4JRXE 2XKUA 3QIBB 5J6GB 3L7FA 4JFYB 3GIZH 3L17A 1L7TH 3QB7C 1L9PA 3QUGA 2RJMA 2H9GA 5T1DL 4XP9H 2F2HA 3L9EA 5ITFA 1EUUA 2N59A 2NZ1A 1F4XH 3UGUA 3KLDA 2VMEA 2NX5A 4Y4HD 1P84J 4WEEA 1QLRA 2Y06L 5BCAA 3MRIA 4IS6A 4PIRF 1ZLUH 3SY0A 3IT8D 3A4FA 1DQJB 5KVGH 5DUBA 5CBEB 3PWLB 5AAMC 4OJCA 4HWBH 4M7LL 4Z18A 4Y4FA 1F8TH 2A4CA 4KH9A 3KDMA 4B9IA 3QDGE 3FQNA 2P45B 4RMSA 2YS4A 4LLUA 5CR8A 4MJIE 3QORC 4PLOB 2G0KA 4XXWC 1PZ3A 4L8BB 4NN6C 1X5AA 3SGJA 2HN7A 2NCMA 2O5ZH 2DLEA 4JPWL 4WRLA 5DFTA 3F7YB 3WFEH 1HJBC 4DN3L 5CINL 3VXUE 2MKWA 3BSHA 3UAJA 3VXSE 1LHZA 5AW0B 2J8HA 2PNDA 2FQDA 3D33A 3D6GA 4L1TA 4WJKB 4OZGB 3ETSA 3BPNB 5CXPA 5EU4A 4L5FL 4YR6A 4I0PC 3T3PE 3U7YH 3O3AB 1ML0A 2Z7UA 3PE9A 3EXJA 2A73B 4CVUA 3I2CH 3V0WL 4G42A 1XTLA 3ARFB 1JHLH 3MJWA 1INEH 4TSBH 4AUUA 1RZFL 3KYNB 4FQPA 1BW8A 1MFEL 5EUKB 1IZKA 4GKNB 1RZIA 1D5RA 2H6OA 3DVIA 3T77B 3V8OA 4PLJC 1X4XA 4HPOH 3ZX1A 1AGCB 4R96A 2CIIA 3BP6B 3C6LD 2WIMA 3N43F 2YMXH 2FECI 2H3KA 3VG9C 5IVXE 3Q8BA 2OAAA 3RU8L 3U0WL 5DQDH 4RGNE 2ORBL 2X0UA 1NDGB 2ZG3A 2FO8A 4KRPD 2BSTB 5K9OB 3Q2LA 4NNYB 1EEQA 4HGMA 4ZD3L 5F0LB 1URIA 2MSPA 1XO8A 2PP9A 5EO9B 4KO7A 2BINA 2DV6A 4YNYA 1XCTB 5CWSB 4NM4H 4AKQA 4D9QE 3NVQA 4WEBH 4F3FA 5JHDD 4AK1A 3PYCA 1HKLH 4ZX3A 4Z3GA 4L48A 2X7LA 1I1CA 1TVHB 3N42B 4KPHL 4UM8B 3N3EA 3QJVB 3ABZA 2WOBA 3LEYH 4DW2L 5IBUG 3RKDD 5IR1B 1OCWL 5I1JL 5FHBL 5LCVL 3VTAA 1AO7E 2F7RA 1H5BC 1KTBA 2DOCA 3GRWL 2O26U 3C09B 4N28A 4NO0B 1I8IB 5LGJA 1RIHH 3LPGA 4KITB 4MZRA 3SGKA 1ZVSA 3M6DA 4MNGE 2H2SD 3F85A 5C09A 3VRJA 4DZ8A 3N85H 4Q9BA 1CDJA 1KELL 3FRUB 3WO3B 2E8ZA 2JI3A 4FP8H 4P5KB 5EC2A 4M7JL 3RX5A 1KB5A 1L9OA 1ORQB 2G60H 2OTWA 4RSYA 1MVUA 2GBAA 5F7EH 1SF3A 2XKNB 4W4OC 1CFTA 2C9XA 3GSQA 4HU2A 3ZMNA 5DZAA 1RZ8B 2ZOKA 3HVDA 3O3BA 4OZGF 4W9FC 3MZGB 5LQBH 5IB4B 1NAMH 1AS8A 4H8WC 4E9VA 1G87A 5ILTH 2H1PH 4DKTA 2G3ZA 1R3IL 4MXVE 3FB5B 4UU9B 3OM3B 1LILA 5SWZB 5TH2A 1ZA6A 3I6LD 2RCSH 5D7JC 3QZBA 1FE8L 3OKOB 4PJHA 1XD0A 4GG8B 1MCOL 2X3BA 5BQ7A 3VD5A 5KVEE 2XTJD 4CMMA 4BEIA 1WFNA 3EFOB 1QNZL 5H4YA 3C6EA 3C9NB 5BRZB 2ZXEB 1W6WA 3IMUA 1X9RA 2PR4L 3O41A 1N0LA 3UTPE 4XCNB 5I74C 3A6OA 2GJ6A 1AE6L 3SDAC 4BA0A 2AHIA 4A6YB 5CGBA 5FO2A 4EI5D 2DWTA 1KBVA 2AK4A 1ZPUA 2BO0A 4Z76B 2X0VA 1CGVA 5IT2L 4DGIL 4ZX5A 4XHQA 1IT9L 2C9SA 4P3WA 5CLTA 3NSCA 3V6ZB 1KXTA 1SYVA 3KDPB 3N42F 2WPGA 1UFGA 1AZVA 2I32A 2VN3A 4IJTA 1G43A 4ENZA 3MBEB 4PV9B 4YBLB 2OJ1A 4O2CB 1ICTA 1PZ5B 1FCGA 4O58H 4DTGH 2VWEE 4ANXA 1CR9H 3KPNA 1HXYA 3AAZB 4K5LA 2ZKWA 5JIQA 5I75B 1Z9LA 2OSLB 4KV5E 2APWA 3S96A 5KS9A 2QGEA 3M86A 4ODVH 4WCYH 1IC1A 3PWUA 2EIJB 5DJYB 1OM3H 2YUXA 4JGJA 1R3LA 3F7QA 4F5CE 3VW3L 5GISL 4CRPA 2GBVA 2R4SL 3SPJA 2FWSA 4IEFB 3U48A 3OKNB 1I4FB 1YEJL 2ZXAA 3FQUB 3RHWF 5JNYB 1F41A 4J7RA 4OD1L 4Y1AA 4MMYA 3KEDA 4NAMA 3AB0B 5I18H 1NPNA 1Q94B 3EH3B 1S9XA 2JMRA 3CE1A 3IJSA 2J1WA 4XMKH 5ID1B 4XVTL 5KVFE 1VADB 3GLEA 5F7NC 3UADA 1DN0B 1ZD6A 3VFRB 3QRFM 2Y7QA 2PCPA 3FKUS 4L9DA 3DK2A 2UY6A 4N26A 1KN4L 3G08A 1T2XA 4RISL 3L5XL 1XXFC 3SQOH 1VZHA 3ALPA 3FB6A 3WEOA 2E27H 1PPIA 4DKFH 4PH8A 2W0PA 4OJDH 4JR9L 4P23B 4PB9L 1QFWL 4JHAL 2B3IA 5HYSA 2CLRB 5D4IA 3G7TA 4JFDE 1TTUA 1Z1WA 2G2PA 4M8RA 3RIAK 2NTSP 2XVGA 1P6WA 3JWNH 4X7TB 1NC4D 5F7LB 4HHGA 2FX7H 2N7BA 1XCQA 1G1OA 1E6OH 2OP4L 1TZ8A 2ZONA 2V2XA 5FF6B 3SKMB 4PW3A 5MEQA 3WNLA 4I0KA 4JRXA 1JXGA 2XXFA 1CN4A 3IDYC 4TVUA 3NJHA 5JOEA 5F97E 5AVSB 3I3EA 4Q58C 1V05A 1W91A 2BMKA 1JPFB 2V2WA 1X9UA 4M6MH 4LGPB 5FUOL 5T3ZL 1QSZA 2WNGA 3BDYH 4JFUA 1WBYB 4QHKI 4U1HB 3RP1A 5BS0B 4MXWH 3MRKA 5KVFL 3MGTB 1ZXQA 4RAHA 5DHDA 5FYKH 3POCA 4L3CA 4UQ2B 1A9EA 3X1GA 2CRMA 2VDPB 5MEPB 3WFDH 2MQ3A 2VIRA 2FNWA 4TVSa 1FAIL 2CR3A 4L4VE 4TSCL 5HDBE 5CD5C 4TPRH 3UMNA 4C56E 1N8ZB 5D8JH 2HCZX 4KVNL 1GOHA 5B3JF 5E5MA 4ZTPH 1C7TA 4NN5C 4J6RL 4PGCB 4P2RD 1IGIL 4MJIA 1YA5A 3O0RH 3UH8A 5T5FA 3VFPA 4WWKB 1LE5A 1QSEE 5HHXL 3L1GA 1UCBL 3UO8B 4X5RA 1JI1A 5ECJE 4G83A 3TOPA 3CZFA 3TV3H 1EFXB 4XN4A 3VXUA 3LRGA 5DHEA 3VXSA 1KTLB 1CVSC 4LHUB 1IBGL 1UADC 3ROOB 1FL3B 3ULUH 3OR6B 2AXGB 3QPXL 5FYKD 2FK9A 5GRJH 5LCVA 3VFOA 3ZKNC 1KXVC 1M6UA 4Y16B 1SHWA 2EYRA 1Z9SA 3JQOB 2BSSA 2QHRL 1JP5A 1Z9NA 3BAYA 5D1QC 2NOYA 1BSIA 3LOWA 3II1A 4NKIL 4BJLA 4HGWB 5FO8A 5AEAA 3IMSA 2J8UB 5GRZA 3RY6A 4IU2B 2HJFB 3OC8A 3OPUA 2PMZA 3V8CA 3ZDZB 1UJTA 4MYWB 4QO1B 4XVOA 4YIQA 5T5NF 4OUOA 4PS8A 4RFOL 4ZFOB 3D85B 3ZR5A 3BHBA 5FB8B 1MCFA 1PVHA 3CDFA 4IBVA 5IVXA 5I8KL 4R8WL 2EXYC 4IOFD 2O61B 3C5ZD 4JREC 5DS8A 1PTZA 4JNXA 4R4BA 1HXMB 1G6RH 4RDQG 6CGTA 5IMOA 2ZCLL 3RE0A 2K9UA 3GBMH 4R4FL 4TQPA 5JIMA 5KWYC 1O6TA 3HI5L 3DVFA 1H19A 3UG4A 5CKAA 1XCWA 5MENB 3VQ1C 2VUOA 4ETYA 1H8LA 3ZYZA 3O6MH 4PGJA 1MFNA 5INCB 4NHCH 2A1WH 3BN9C 4J1UB 4UMSA 1BVZA 2MPAH 3REWB 1AZZC 5CSGA 1GC1C 2YARA 4NUMA 1MI5D 3MACL 3L3IA 2HT2C 2J73A 1PZUB 4ORZC 2ZX6A 3ORJA 3TN0B 4NC0B 4TUKL 1WCBA 5FA3A 1XCXA 3VG9B 1S7WA 1IFGA 2OLDA 2NXYD 4PGBB 4HSQA 3O3EA 3FZUC 4NUQA 3VD9A 4XZUB 1KWKA 5LJYH 3CVBA 2X9YA 5EN3A 4MNGA 4ENEC 4UDTA 1CBVH 1OHZA 2E76C 3CN0A 4MA7L 4EVNA 2O1AA 1KY7A 3ARED 2J1YA 2VDNL 4U1JB 3LY6A 8FABA 1DZ0A 1T0PB 3SDYH 1KYOK 4MAYA 1F4AA 3V6OA 3QEGH 1JCKA 4LGSB 4DGUA 1TJIL 4LARL 1UXWA 2JB6A 5J11C 4UIMA 1N6VA 2YD5A 3QEQE 3MV8B 1TF4A 1DVXA 1IQDB 4L9LC 3B7TA 4N5EC 5D7IE 4X50A 1FVEA 1EHNA 2UZPA 1M3IA 1CF8H 3AG4B 3JWDH 5EV7A 2BNQB 5GS0H 5KSVA 4KUCD 4AL8C 2J8UF 1KIUB 5AYQA 2TRYA 5I2IB 3ZDZF 4X80H 2YRBA 4IBSA 1KJVA 3MPCA 2WBJC 4POYA 2KHAA 4TL5A 3IU3B 3GHPA 1J0IA 3OKDA 2Y36L 5IOPB 4IDLA 4EPSA 1Q1JL 4HFWB 4GJTB 4Y19E 1A0QH 5SWQB 1HK6A 1VACB 1KMGA 3DHJA 3T2PA 3VWKA 4XCEA 1XF3A 3W0WD 4GEJA 3SB3A 1Q38A 3QJHB 4UZGA 4OLYL 3P73B 2XN9D 2C3XA 1VGKB 3HZYA 1NBZB 3VYNA 5EA0L 2P44B 2VN4A 2NUTB 4Z78B 3V0GA 4U1KB 3HUJB 4M5ZH 2XHNA 1X5XA 3B5HA 2Q8BH 2XQ0A 5JIIA 4WU5A 3EYUL 1DLHA 2VDOH 4JPVL 3KPQA 1QRNB 4JFHE 4FG0A 1I1AC 3MCG1 2ADJA 4KHXL 1ETJA 5ESQA 2G9KA 3WEXB 2JJTA 4J3OD 1SBSL 5FO9A 4BZ1L 2Y6SD 4GNKB 3NESA 4HXBH 5I74B 2Z0BA 4G7RB 5IOKA 3SDAB 4WSKA 3RNKB 1XF5A 3MLRH 2ICWA 4RMWA 5DJ8A 2DI7A 2IAMB 1LO0H 2P9RA 1UKTA 4YVUA 1HQRB 2I25N 4YAQA 4F5CA 4PEEA 3DKHA 3MOBL 3X3FH 1M7IA 1OVZA 5D4HA 1OTUC 1QPPA 4IU3B 2VN5A 3UGEA 1QVOA 4QF1B 2R69H 3O2VH 4W9JC 4L8SA 3V7AG 4A37A 5LXGL 4RFNB 1QQDA 1UA3A 3IJHB 4MB1A 5GJSL 3L48A 2Y2TA 1DCLA 1U2CA 2NR6A 4WHDA 1UZ6E 4N8PA 5FK9B 3MRCB 1RLBA 1C7SA 2L7EA 2DJ4A 4GB9A 5AOIA 1VEMA 3EBIA 2FD6H 1EJ6A 2WV3A 2VR5A 43C9A 2LAGB 3U2IA 3UTQA 5DWPA 2WBKA 2F7PA 3PHOB 4JHBA 3KGSA 4YZFF 2CM6A 2VLJB 3IJEB 3KPMB 1KLUB 1NGWA 3KM1A 4KQ3H 5ACZB 3FU3A 5TF1H 2AAVA 3ZKXB 1RZKC 3QIUB 5JXAH 1ZIBA 1YVLA 1ES0B 5C3LD 2X38A 5JR1L 3TH2T 3FT2B 3TBSA 4HCRL 1RP8A 2EDTA 2IDQA 3HMWL 4HJJH 4FC3E 1HHIB 1T83A 3HN8A 3WGUB 4JFTA 5KW9L 4E41D 5KZCD 4QXUL 1IAIH 4WGKA 3A5VA 5FYJL 4PJXB 2Q9OA 2AJVH 2ZYHA 3MRRA 3GHBL 3L1OL 4LCWB 3L3DA 3S34L 2F0CA 2LU3A 4MB5A 3O45A 4XXDA 2W9EH 4JANB 2QSVA 2NZ9D 4FQHA 3ZZLA 5F9DC 3VMOA 5HGGS 3HUJF 3IU4L 4X5WB 5CZVL 1Q9OB 3AABA 3TEUA 3LN4B 3MJ7A 5C0BB 3ARQA 3DOHA 1NCWH 3V4UL 3G5YB 4W93A 1CURA 3PWJA 1E4XH 3RTLA 3SKNA 3QUZC 2VXUL 3TU6A 3N0PB 5IJDC 3EZJB 1BZ9A 3HNTH 5JOFA 4XMWA 4WJ5A 1BXVA 4WK0B 4XO9A 3HE6B 1T7ZA 3OZLA 2C1OA 2WWMD 3SPVB 3GSNB 4JKPL 3FTUA 3I74A 2YSTA 3LRMA 4KK5D 1TCRA 3H9SE 4FQCH 5JORA 1KULA 4PRPD 3MRDA 4KDTC 4NM8L 3S2AA 3T0WA 1YYLH 1PLGH 3BOVA 1BVKA 4L8DA 5DEFA 1IC0A 2NNRA 3RQ3A 2V5MA 2FHBA 2ZKHL 4X8JB 4DGVH 5CIPH 2AF2A 4F58H 2EXWC 1QD0A 1QSEA 3C8HA 1KB9K 3WCYA 4IRJD 1NUFA 3QR2A 4OF7A 2Q7AA 1BP3B 1JGUL 2D0FA 1OAJA 2YD3A 3R1GL 5SV4A 4XP5L 5HJBA 5IB1B 1B88A 5T1KA 1PFCA 3FOMB 3UTOA 3QE5A 4IBZA 3T4AC 5DI8A 1MG2C 3GSRB 4LDLB 5JQ6H 3QWOB 1E4JA 3A4DA 3AMLA 1RJYB 1HWHB 2HKFH 5FW7A 1L3WA 3SYOA 5C6TL 1QWUA 3VFTA 4YLBA 1B9KA 4PJXF 4JFFD 3VXOB 4NKMB 4GRWB 3SO3C 4OFPA 4IGBD 4QXWA 3ZU8A 5MEOB 1HFUA 2L7UA 3QNZB 1MNUL 1GIGH 1LXMA 3FUMA 4IW4C 1BYOA 4NLHA 3L3KB 2ZUUA 3QT2A 4HJEA 4PRHD 2YD0A 3RWCA 1HOEA 5F44A 1DUZA 3NA9L 3KGRA 4XRCA 1BBJB 4NZUL 2Z92B 4JAMA 3W57A 3ZTDC 3CVHB 3T2QA 1ZCRA 5C0EB 2PO6C 5E7FA 3DX8A 3ZKQD 1A7BA 3REVB 5TE7H 4DKAA 2OR9L 3DIDA 4ES9A 1O0VA 1U8MA 3S8FB 5ESAB 5CD3A 5DVLA 2F54B 4JFZL 4ZUTA 3D51A 1EEYB 2FO4A 3C8KB 2GI7A 3LKSB 3NCCB 1W0VA 1N6QH 1Q9WB 4J3BA 2ED9A 2P7TA 4W9KC 4X2UA 5EB9A 5I71C 3V4PH 2OXHA 5I8CA 2ZKYA 3ECBB 3TT1L 4MNHB 4YSDA 5B7MA 4UQAA 3NYKA 2XETA 1FC2D 4D0DA 2XQBH 4J8RA 4OLUL 4YHOL 5D1XD 4DHLA 1U33A 2BNRB 3GXNA 3OC5A 4WKZA 1AZUA 4DFIA 2AW2A 1DBBH 1DBAH 1I3GL 4HZ1A 5F7KC 2ZOLA 4HUKB 5KOMC 1P0SE 5D7SL 1KT2B 2ZXCA 1VHPA 3CC1A 2NNCA 3HE7C 4AEFA 1DQQB 5EWIL 5CFHA 5K93A 1ITCA 1ZTXH 2XG4B 4JW3A 2AMGA 3OWRA 3IJYB 3KYMA 1PLAA 4HH9A 4BZYA 1NCGA 2BP0B 2W9LA 2O6PA 2WQAA 4BZ1A 2Y5TB 3D48R 2FT8A 1VEOA 5D7IA 2H26A 3RKPA 4KQ4L 2B4CL 1GPOH 1MJJB 2ROYA 3DHPA 4R9HA 4TVPH 1LWRA 2VDRB 3ZRCC 4Z7WE 4JGUA 1BM3H 4Z3HA 1J11A 5DMKB 2O5XL 3PDOB 1J9QA 4OUUB 4ALAL 5I0ZA 4W9CC 4KGJA 1L6ZA 3QZOA 1HVXA 1MHHB 3ZIYA 4B5EA 1CICD 4GRWF 3UPRB 1MLCA 1CFNB 3ESOA 4FNLH 5CAYB 5CILH 4ZMLA 1U8OA 2I26N 3E3QC 2B0SL 4HQQH 1T7WA 4Y19A 4CVZA 1UM4H 3IRZA 1HH9B 2O5YL 4E9LA 5C0GB 4Z7UB 5DS2A 4PJ8C 2ZWNA 4B9CA 4TNWK 2A74A 4P5MB 1EV2E 5F88A 4BFOA 2FX8L 2R23A 1ERNA 4L9LB 4TVPD 5HGAB 3R8QA 1T5XA 4RA3A 2YEVB 5DK2B 4XNAA 3WJLA 1YECL 4I87A 4ZYKB 5F9OL 1FZMA 4FA8A 1OPGL 4PRID 1CDGA 3NZHL 2X1QA 3GIVB 4QCIA 2VXVL 3MO1A 2VRQA 2WBJB 4HCRA 1RJCA 1DUYB 3QH3A 4XC1H 1AI1H 1CL7L 3EHBC 4OLZH 2KL6A 1C12B 4GKLA 5BV7B 4H88H 3QAZB 4H0IA 2PWHA 1IARB 2ZXDA 1RZ7H 5KSAB 2BFGA 2QKSA 4XMLL 2V9UA 1OGAB 3LJ3A 4NO3B 2C9PA 2J1KA 1DDHB 5I1CH 5I5MA 2G3MA 3U7WL 3E1F1 4PRDB 2EDFA 5ALCH 3T3MB 3TFKD 5C2BH 1R75A 2E3VA 4OH2A 1DZBA 3I9GH 4Y88A 1G7QB 1WE5A 3QIWB 5E99L 1XF2B 1DQLL 2PCFA 3V2AR 5BRZE 4LAQH 4UQBA 3ABKB 3BMVA 1FGVL 1RHHB 4C4BA 2D7QA 5FKPA 3QDJD 1TZHB 1HCVA 5C0NC 1B6DA 2VRKA 3QDGD 4LCIL 1ZHLA 6FABH 4X7CC 1CBJA 4GMSL 5E00A 3RDTB 2BY1A 2Q2LA 3JWOC 4BZ2L 2VJXA 1RZGB 3ECWA 4R4ND 4KK8C 1DANT 2W0KA 4LFHG 3O3DA 1N7ML 3NCFB 2ZQKA 4J3XA 1SOKA 2DWSA 4HX1B 4WNQA 3VXTA 4I9XA 3L1EA 3I50L 5GRYA 3T2LA 3TCLB 1X9QA 4Z7UF 4D8PA 3ARTA 4JCLA 1U3HD 3LB6D 2BSRA 3O8XD 4GXUN 4P2OA 4YDLB 4NOFA 1NGPL 1NCAH 1XQ4A 4ZSOB 1Y0LB 4ADIA 1BLNA 4K94H 1DLFL 1LK3H 3RAJH 4U6XB 2NY5H 2OSXA 2X4QA 4M8QB 3KVPA 1GJWA 1SMAA 1T80A 5AOZA 5T1LA 5T33L 3X11B 5F0PB 2XWTA 3BQUA 3RFZA 3TURA 2Y07H 4OJEH 5DJXB 1XZWA 3OJMB 4JRYD 4RGND 1AXTL 5B39G 1SN2A 4Q6IB 5M7QA 1XBRA 5TDOA 4M7ZC 5JW3H 5HJ3A 3QG7H 5CGTA 3LZPA 1CTOA 2DB8A 3QUMB 2QDVA 5C8JA 4F8OA 1J1PH 4F8TA 1I9RL 3BIBX 4M43H 4PGZA 5DD6A 4GIAA 3HI1A 1IM9A 1G9ML 4UUJB 1PS3A 3BKYH 4D9QD 3H9SA 4G7QB 1HNYA 1NCNA 4NQCA 3T3MF 4BCXA 4LQFL 1T2QL 2D9CA 3FBKA 4OZHE 5DC0A 2JCCA 2IMMA 4XCCL 4B0MB 5F7YC 4F27A 1S8DB 2OULB 1UYWL 5JYMA 1SFHA 4U0QB 3M88A 2WINA 4EBQH 3EF7A 4JHWH 4WW1B 3DX0A 1UA6L 2NMSA 3N50A 1AO7D 3IGLA 3WS6A 1EBAA 3MRBA 1SEQL 1OV8A 1A6ZB 1M05A 3KWUA 3KPRA 2MIZA 3UOAB 3ALWA 4XI5D 1J0YA 5AW2B 4I3RL 3ZHLA 4WY7L 4QHKJ 4YGVB 2XICA 4P4KC 3ZDXB 3MRFA 4KGLA 2WCGA 4P5TD 5E2WL 4LSUL 4RNRA 2CJSA 3LV3B 4DEUA 4NJ9L 5H94A 4BD4A 1BFVL 2XFXA 5FW6A 1NPJA 5AVZB 2WYTA 4BK4A 1F58L 4TOYL 3QDAA 1KZYA 4V2CB 4XPHL 1ACYL 2COQA 2JKRM 2YBGA 1T0NB 4HKXB 4QYOB 3FU9A 5IMLB 1G5AA 4WUUE 4IRSD 3UGXA 5DRNB 1F00I 4PBVC 4FQXB 3TA3D 3HKZA 4BK5A 2V8LA 4TULL 2FJGB 4HOZA 1MCJA 4NP4H 3NRFA 3TO4A 2JTDA 4WZ9A 3DYOA 1FZKB 2JV6A 5CBEA 3D39D 3SJVD 3T4AB 4NN7B 3VYOA 5F7FA 4M9OA 3UTPD 1BREA 4E9SA 4M3JA 1E7UA 4KKCD 1BJ1J 2QTEA 3WGVB 4C55A 5GGVY 1QAWA 1P84K 4L8BA 2I7OA 4Z7NB 3ML8A 3F7YA 3CXDL 2LE9A 3OD3A 2NY2B 1FNAA 1NIFA 4WWOA 1I7RB 2AC0A 3LXUX 3T65A 4QOKD 4RBPK 1XSJA 1XFPA 2ICEC 4ZI8A 1JV2B 1YAZA 4OZGA 2DQDH 3O3AA 4WKXA 2A73A 3EJYC 3ARFA 1TZAA 2PO6B 4YE4L 1EO8H 3KYNA 3VG0H 4D9LH 2XG5B 3QPQD 5EUKA 2J8UE 4QWWC 4GKNA 1RL1A 1TJMA 1UKSA 3EDJA 3T77A 3MODH 1QO3B 3ZDZE 1EGJH 1AGCA 5C6PB 3CU1A 3MLSH 4OGYH 5GPRA 3ARBD 3CXFA 4YSUA 1YRKA 2ZOOA 5EOQL 2Y25A 2N7SA 4H20L 3ZDXF 1NDGA 4FQLH 5J3HC 2VDPL 1TTCA 3WHE1 4B95C 2BSTA 1M1XB 3CZGA 1P1VA 4F7CB 4Q2ZB 5K9OA 3NJVA 1WAEA 2QZQA 4ZUSB 2BVYA 3MJ9A 1RIUL 2HTLD 4K15A 5EO9A 4A66A 1TFPA 4KZDH 4QTIH 3L08A 2ZD0A 4XNUL 4UTBA 2B08A 2GTWB 5CWSA 2QQNL 1KGXA 1RERA 4KVCH 4HG4J 5MENE 1ADQL 1BF5A 4HC1H 3DSNB 4OSUL 1IE4A 5DQJB 3TJPA 5CO1A 3VD1A 1YEKH 4UM8A 1TVHA 2H1LM 3SKOB 1UUNA 3IFLL 4JDTL 1DVFD 4DEWA 2WTPA 3B3IB 1OQXA 5IR1A 4I77H 1QLEL 5GSRA 3RILA 2F18A 3WTTA 3II3A 2D03L 1R3HB 2BIHA 1OLZA 1PNDA 3FTGB 1N0XL 2ENPA 4NO0A 3C6SB 3GZOA 1I8IA 5HYQB 1A9VA 4OD3L 2XACC 3QGVA 3SPCA 1ZGLM 4F7EB 1EUTA 4JFDD 4PBXA 1LTXA 2PN5A 2XRAH 1A3RH 1FDLH 1A3LH 3FRUA 3SDDC 3ULVD 4P5KA 3B34A 2CO2A 1ORQA 4Z7NF 4AMKL 5JLZB 4ZFOL 1FBIL 1UOVA 1WISA 2XKNA 1XT5A 1YEHL 3OXRB 1LWHA 1LMIA 4UV7L 5HI4C 1RZ8A 2DLIA 4IDJH 5C92A 1XIWC 3QNXB 4CU7A 1L9QA 4Y2DB 5DO8A 5IB4A 2HKAA 3MV8E 3TYFB 2BS8A 5HD8D 4UM9D 1ZRUA 4PJ8B 1H6EA 4KKPA 4B9JA 4ELMB 4UU9A 2AGJH 1SHMA 1NMCC 2B2XH 5EOCJ 5SWZA 5I76B 3BUPA 3R0MA 1YQVL 2LAAA 1IFHH 4G8FB 4FLHA 5B1KA 4GG8A 1DVSA 2F5AH 5E2UH 3FL7A 4YZFE 2CBMA 4P06A 3HW7A 3EYSL 1MQKL 3NJGA 1XTMA 3C9NA 5BRZA 3U9PH 4AQ1C 5BO1H 3APCA 5LDUA 3LZQA 4A04A 3QYNA 1NCBL 3MUUA 2J5LC 4L4VD 4XCNA 1W15A 1J0KA 2XWDA 2QVIA 3K2UL 1EEUA 1GW0A 2NNFA 5FXCH 1FGNH 43CAB 4A6YA 2WVSA 4K71B 4Z76A 2RTTA 5ANMB 4Q9CA 5HHMD 4I85A 4DPBX 2VDLH 4FE9A 3AG3B 2DAVA 2KZKA 3RZCC 1BEXA 5KYXB 4NYLB 5I6PA 2IGFH 3HUJE 5J1SC 3T0XA 1FO0B 1PX8A 3V6ZA 1ZV9A 4XZ4A 3DJRA 4BXSV 4HFUH 4LOUD 2DM2A 5IQ9B 1QRNE 1PX4A 3VUAA 1MF2L 3MBEA 4PV9A 3HNVL 4O2CA 4RMRA 5C6WH 1PZ5A 4FXKC 3TEWA 3UROR 3UYRH 1AY1H 2IVFC 3AAZA 2PWEA 4FFYH 4OBSA 2OSLA 2IOIA 4XC3L 4DIXA 2EDBA 4AV0A 4OIIH 4DVBB 3ML9A 1PF3A 2BDNH 4H5SB 4UINL 5DJYA 3OXSB 1DVTA 2X2UA 5KJ4A 3DX2A 3PGCB 1OTTC 2YSSB 1C5BH 4XXCC 3O4OB 3PL6D 4N0YH 4NIKB 3VYPA 4IEFA 4PI0A 3OKNA 4OGZA 3GMPB 2BHYA 4RAUB 1I4FA 2J6EL 3WY2A 1JN6B 2C8NA 3FQUA 3GBNL 4FAAB 7FABH 5JNYA 1CDHA 1F2XK 2ICCA 4GAGL 5HSFA 1GYAA 1T89A 2C34A 4LLAA 3DDGA 1JNNL 3K46A 3KPLB 1R3KA 1Q94A 3ELQA 3H8NA 3HAEB 3QRBA 4ELMF 4E68A 1RPUA 5L2KB 2PYFB 1IM3B 2Y2YA 5ID1A 3L3JB 3S37L 1P4IH 1VADA 3LS4L 3VXMD 1GJIA 5K69A 1DN0A 4MZ3A 5J1AB 2VLJE 1A6VL 4GFTB 3NK3A 5AFAA 1SY6L 2OSYA 3OMZA 3QULB 1UT1A 3PDDA 3BKMH 3F8UB 3S4SG 2OMUB 4RBPH 3SOBL 1T03H 3BVNB 3K2IA 3ZN6A 3HS9A 2QPDB 3K0YA 1UM6H 4P23A 3HI6L 4R26H 5C7XL 1FZJB 3S3PA 4HHAB 5KSBB 4DPAX 1NQBA 1D9KC 5IY5B 3TTSA 4X7TA 3KLHC 3HHSB 3ZYOA 5LWYL 3GBEA 4CJ0A 4CBPA 2BY3A 4FQ1H 1DN2A 4FFWC 1JF5A 4NZFA 2FUTA 3N0AA 4UF7C 5FF6A 3SKMA 2V37A 3CIAA 5C0BE 4ZT1A 5CHNB 2E7LA 2FX9H 4E9RA 1S9VB 3QEQD 4LSVH 2DMHA 3RTQA 1VIWA 3LZFH 1CZ8H 5FCUH 2W94A 1JZ3A 4POZC 2AJXL 1JPFA 2FYVA 1AS7A 2YEQA 3FQTB 2EC9U 1ZHKB 2J56A 2ZOWA 5LUMA 1A4AA 1OP4A 4GW5B 5DFVD 1WBYA 5F89B 3ARRA 4U1HA 5HHVL 5BS0A 5DK0B 3MGTA 4F7KA 2I07B 3GBDA 4UQ2A 4AM0B 5MEPA 4P4KB 1EXUB 3WKPA 4XBPA 3UBXI 4AQOA 5JW4M 2FCBA 1N8ZA 3WIFB 4M3KB 3P3TA 3LVTA 1OALA 4YUEL 2H2PC 2P80D 1KBPA 5JW4Q 4ODWB 5CKGA 4PGCA 2K70A 5GRUH 3TV8A 1HX0A 1ADQA 1BJMA 3FUNA 3W81A 1HSAB 4WWKA 3PNWA 2OL3L 4D8OA 1D6EB 3DGGA 4CVWA 3RVXC 2UV3A 4X9GA 1DBJL 1EFXA 4FQQB 2QSCL 1TLKA 1I9JH 4OLEA 1B0IA 2ZUSA 1KTLA 3AG1B 4LHUA 3ROOA 4XP6L 3HB3C 1FL3A 3OR6A 2FR4B 2AXGA 5LN4A 2AJYH 4Y89A 4O51B 3VRIB 5KJRL 3QRGH 2AEWA 4Y16A 5SX5H 4KKBC 1I8KB 4JFHD 5D9SB 5ICYB 4QHNB 1KNOB 1EXGA 3FCUB 3OV6A 3DV6B 1JZJA 4JO1H 4HGWA 1J12A 4N2HA 2J8UA 4P2QA 5L9DL 4IU2A 4N0CC 2HJFA 3HG4A 3KYOB 5ID0B 3TJEL 2D9QB 5FHAH 1X5GA 1ZLVK 4QO1A 1BVLA 1DQMH 5MI0B 2EDDA 4GRWE 5KSBF 4ZFOA 3D85A 3VA6A 4YDKH 2EZ0D 5FB8A 3CH1B 3F5WB 5IJBC 4ICXA 1ZLWH 1JXJA 5GZNC 1A6WL 4AEEA 4LNRA 1RK7A 3HG0A 4HIIB 4YX2L 2O61A 4MX7B 2WVUA 4XMTA 5T3XE 1ECZA 1HXMA 3S36X 4IQHA 4JL1A 3B4NA 2ZXGA 5GGUB 1QZ1A 1A6TB 2ERJB 2WQRA 1KPVB 3TYGH 3G5VA 1BG9A 2JXMB 1E8WA 3ESNA 5EH1A 1X7QB 1YY8B 2N0KA 4XOAA 4JFED 3ZY7A 1WITA 4HHWA 5INCA 3SBPA 4J1UA 5IJKC 3REWA 3CLEH 2F54E 1RURL 1K72A 5EORL 1NH6A 3OAUL 1ACZA 3QDMB 4NRXB 4ZUUB 2UZIL 4HUXB 4I18C 4PP1D 4V1DD 1QEWB 3TN0A 3VXQA 1JGIA 2G9HB 2CHZA 3F2LA 4HETA 1YJDC 1GGCH 3LH8A 4HGKC 3VSUA 1IU1A 4PGBA 4HDIB 1G7JB 1KGUA 1OCCB 3F7KA 4HJ1A 2BNRE 4XZUA 1XEUA 2Y24A 1JPSH 1SNRA 1FI8C 3FFCD 4PN6A 1FYTD 3RGBA 2MCPH 4P2OD 5C08B 2GSMB 3QCTL 1MRFL 3GRWH 4FHKA 4U1JA 4WFGE 3B9KD 4LFHD 1ZLEA 4RSVA 3FU8A 1NMAL 1ODAA 3IDXL 4FKHA 1NBVH 2BFVL 3S36L 5I19L 5E2VH 4N90E 4XMZA 4OLXL 1JZIA 3ATAA 2DQHH 1T4KB 3EO9H 4XX5A 1PSKL 3VAEA 3ZR6A 2FGZA 3MV8A 1IQDA 2P26A 1WZLA 4XP4H 1GCFA 2DQJH 2NY6B 3CVHL 3VDBA 2V2TA 2YD8A 3BZEB 5JW5B 2BNQA 1OF2B 1LQBC 4W70A 4X9HA 1F1DA 3S5LG 3W5NA 1KIUA 2F58L 5I2IA 5JPNC 2Y1ZA 3QWQB 1CU4H 1C5CL 4QAMB 4U3XA 2Z8VC 4ISVA 4F8QA 2FBOJ 5TDNB 4LSQH 3OR7B 5EU5B 1SXSA 4KX7A 3II2A 5IOPA 4R5VA 3LRSB 5E24E 4Z0BH 3FHAA 2PW1B 2CK0L 4W4OA 5SWQA 4HUCA 1VACA 4S0SD 1E28B 1VJSA 4YVNA 3OPZH 1WAAF 4Z7UE 1QFPA 1PAZA 1XIWB 3L3OB 2Z7ZA 2Q20A 3QJHA 4HAFA 4OJYA 5DZJA 5KUKA 3P73A 2CGRL 5AOLA 1VGKA 3T6VA 1NBZA 2E7HA 2BJML 3RPIB 1SXNA 2NUTA 5DJCB 4Z78A 4AYBA 1NMCB 4LCVA 5F9WB 3HUJA 3LKQB 4AKOA 3EH1A 4LLWB 3IDGB 1CE1H 3M7FB 3M8OL 4LL4A 1BVOA 1N5YL 1LO5B 2WGNB 2DL2A 5CS7A 2KLRA 4B9FA 1QRNA 1E9QB 4NPKA 3N1QC 5GS1B 3L7EB 3MJ6A 2JSFA 1E90A 5KOVC 1BAFH 2IBZX 2OSWA 1XEDA 4KI5F 3WEXA 3UERA 1FWXA 3WKQA 2DICA 4Z7OB 2Z8SA 2HRHA 2J5LB 1MJUL 3GINA 5LNEA 2VXTL 3IXTB 4JO2H 4BSWB 4JG0H 3TEYA 2VDRL 3RNKA 4QGYA 5EZPA 5HGBB 1OGAE 2YOCA 3WV0A 1G7PB 2NNAB 3QIBD 3G6DH 2IAMA 4LASH 1HQRA 3MLYH 3HN5A 4U1MB 3T3ME 3QQDB 2DYSB 3RZCB 1WBXB 1W72B 4J3VA 4IOSD 4IU3A 1BQKA 4QF1A 3DGDA 3Q6FB 3VFMB 3GLZA 3IJHA 3UMTA 5JO5B 3DMMB 2K3HA 4XNZC 5FK9A 3MRCA 1D5XB 1TYJA 1J5IA 4QXTB 4ECNA 3GZQA 4UV4L 5IREA 3Q1SL 3H6AA 1P2CB 5TQ0H 3EJZD 5G4OA 3V95A 3PHOA 1BM7A 4G82A 1E67A 1UB6B 2ARWA 2VLJA 3IJEA 1TOXA 1KLUA 2VKXA 5ACZA 3OKMB 3VM7A 3NPSC 3QIUA 3SDCB 5EDXA 4FQIL 2XA3A 4PJDB 3FT2A 2IIJA 2DM3A 3NRQA 1HHIA 2Y69B 1ROWA 4N0UB 2OL3A 4NOBA 4PJXA 1NEZB 5BV7L 1GHFL 4I89A 4ERSL 3CHPA 2W81C 4WF7A 4LCWA 4RX4D 3KJ4C 3OQ3B 1OHQA 1TETL 4OJFL 5IMMB 1X3DA 3KPSE 4JANA 4BKSC 2WQSA 1OT2A 3RNQA 3AQXA 3LIZH 3WKML 1RZJL 3OAYH 2ZF8A 4X5WA 3MRHA 1INQB 1Q9OA 3RWFB 3LN4A 5KJ7E 5C0BA 3ZK0A 4QJ4B 2DQIH 3BUYB 3EFDL 4S2SA 3G5YA 4J27A 3D2UB 3GQFA 4N2BA 3MRPB 4UQEA 5TF0A 5F7HA 4MXQC 3DOIA 4RMBA 5FUZL 1JWMB 2VW4A 1X4ZA 4Q97A 4Z7OF 4Q9RH 3H3KA 4YXLH 1JXDA 4Z1PA 3HE6A 4BWTA 1UZ8B 1BIHA 4FRWA 2N1KA 3A3YB 3SPVA 3GSNA 5E1GA 4F9PC 2E47A 4TUJB 4B27A 2WJ5A 4N3TA 1MFCL 5E9NA 4IIQA 2Y7MA 1FH2A 1P4BL 4TLKA 3RGVC 5E08L 2M8XA 1HZHH 2Y7OA 2PWGA 1EANA 3ZHFA 2R0LL 1C5DB 3FQRB 5I1KL 2IGLA 4NXKA 1CIUA 5FDYA 3WTVA 2XPZA 4X8JA 3UJJL 5E0QA 3IGKA 4P2CG 5GZOA 4CSZA 5DZ9A 4G9DB 1JZ7A 4MBRA 1F4WL 2H5UA 4L1SA 5E9DE 4TRPL 5AL8A 1ET5A 1C1EH 3QFJB 5IB1A 4MQ7B 3DRTB 3WFHB 2N0MA 2DQCL 1WT5A 3CTTA 3FOMA 4HWUA 3MLZH 3WFBH 3GSRA 1PZAA 2X2HA 4PJDF 3QWOA 4HISA 4N22A 1QG3A 2CU9A 5LNDA 3UX9B 1AR1D 1YEIH 4JDVB 3ATDA 4Q4IA 4NGHH 3SDXA 2EP6A 4M6AA 1ZT7B 2J57A 2PPDA 3VXOA 1G5GA 3TBVB 4NKMA 4OZFG 3BMWA 4HP5A 4I3SL 1Z9OA 4DESA 1U6AH 3QNZA 3QUML 4RESB 1NLBL 3UTTB 1X4YA 3L3KA 1TEYA 5EULV 2E7CA 2LVEA 4PSPA 1BBJA 1V3JA 5DJ0B 2B16A 2WQVA 2Z92A 3MRMB 1M7UA 5GGTL 3CVHA 2VDKH 1HL9A 1JVOA 5C0EA 1NOFA 3EBAA 3OLDA 2EDQA 3QNFA 5FYJU 1DJWA 2F1EA 4LPWA 2BWQA 3IDIB 4HWZB 4G43B 2O93L 5L2JB 1MZZA 3UBGA 1U2YA 4N2EA 4EIBA 2DJUA 5ESAA 5I30L 2F54A 4JKKA 3QP3A 1EEYA 3B6SB 3C8KA 3LKSA 4AW4A 1DSFL 1IJNA 1Q9WA 1ZSHA 2VISA 4RGOH 3FSWA 3CZEA 5D1ZB 2HSIA 2BH0A 3MNDA 4HUNB 3H9YA 3ECBA 2YQGA 4MNHA 4OZIB 5I6KA 1UQSB 4EOWH 3FMGH 1ROCA 3UBXB 4FMKA 5KANI 2BNRA 4Y4KD 3LKRB 4FABL 2KZWA 1I7TB 5F8QC 4MMZB 1KT2A 1UD2A 4FG6D 1DQQA 5L7XH 3DX4A 4LU5L 1G0YR 3E9UA 4P3DB 5FM4A 4PTTB 4FQ2L 2XG4A 3GK8L 1MCBA 2QADB 2VLRB 4HF5L 1L3NA 3IJYA 1UWEH 2BP0A 5FM5O 3ZTNL 4YHZH 4NKDB 1VPOL 2Y5TA 4R2GB 3TASA 1MY7A 1MG3C 3WFCH 4I18B 5DLLA 2OZ4A 3FCGA 1JGVL 3QC5X 5TE6L 1MJJA 5SWSB 2AJUL 5DMKA 4OUUA 3KBHE 2J8OA 1EHXA 3D0AA 3DROA 2BVQB 5HXMA 1MZYA 1KWGA 4PJ5D 2Z1KA 3UPRA 4EQ2A 1T5KA 2FWLB 1CFNA 4PG9B 3T0EC 3GI8L 5GSVB 3N1MC 5E8DL 2R0WH 1SJEB 2B1HH 3S5YA 3LPOA 3GHEL 5A16B 3D3VB 1TMQA 1HH9A 4KY1L 5C0GA 4Z7UA 4XB7A 4G6JH 2YPLB 3KR3L 4MLSA 4P5MA 4BV1A 1EH9A 3UBFA 2VH5L 4L9LA 4Z23A 5HGAA 5ACMA 1F3DH 2EO9A 2DQFB 1SXCA 4JCWA 3JVFC 5DK2A 2CH8A 1CMOA 4NQXB 4ZYKA 3K5RA 1RP9A 4MA8L 2JKIS 1AMYA 1INDH 3JWNC 1JXFA 3GKZA 3CBKB 3GIVA 2WBJA 2K6ZA 3LKOB 1DUYA 4UOW0 5CEXA 2YA0A 2IQ9L 3MLUH 5AW1B 1VCAA 3VU1A 1MFDL 1C12A 2EIZB 1CLYH 2J4WH 1PYWB 2XZQL 3FYEB 3E3QE 4GRLC 4OZIF 4YEFA 4QRAA 2F61A 2MRYA 1OGAA 4NO3A 4XT1C 4KUZH 2Z91B 1DDHA 5D93B 4ELME 5E6IC 1OAQL 1AZBA 1NBQA 3GMOB 4PRDA 1A65A 2A6DB 4EEEA 3QO0B 3H85A 4WUUD 3MXWH 5EPMB 3EW3B 4Y4HB 2NTFB 4X8XA 1G7QA 1NCDL 4XPBL 2P5WD 3QIWA 4RWYH 1XF2A 1EDHA 2KQMA 1JSYA 1FNLA 4CAGA 5HBBA 1BVNT 2CKNA 1BZ7B 2DQGH 1XB3A 1EX0A 1RHHA 2GEEA 5A7EA 3KPPB 3CK0L 1TZHA 4Q52A 5DDHB 1S3KH 2WYIA 2FLRT 4ZMYA 1GGBL 3BRFA 3Q2NA 3DV4B 3RDTA 4JZNB 1RZGA 1YY9D 1SUHA 4YHKL 1JPST 4AQZA 3ZHNA 2EE3A 2LVCA 4G3YH 4H8VA 3ULUC 4ZUVB 4HX1A 1ZT1B 1Q0YL 4O02B 4DAGL 3TCLA 1H3GA 3FU7B 1X5KA 1J1OL 3P2TA 4HIXL 2WLKA 3WIIL 4XNZB 1MH5B 1OK0A 5DVNA 3QWRA 4ZSOA 5CF3A 4PJ7B 3JZ7A 5AZEH 2J1ZA 1PJ9A 3L3HA 4U3SB 4U6XA 4DQAA 1NCCH 4M8QA 4FTDA 3GMRB 1HI6B 5MERB 2XQYG 3VH8G 4YHYC 2PCXA 4NZ8A 1ASQA 2XOTA 3C6LB 4HZAA 3X11A 1XZ0B 3QORD 5BPPA 3SPGA 4G8IB 5D70H 1TTAA 5DJXA 5D4QA 3ZZQA 1JMXA 5I1IL 1OOAA 2OBGA 1WHPA 1CLOH 1JGEB 4FZ8L 4Q6IA 4KRPB 1T66C 3ZE2B 1RUKH 1N59B 3BZDA 5FS5A 3S3JA 1SVBA 1P7HL 4OF3A 4FLQA 5AW7B 1MUJB 3KW7A 3QUMA 4LCCB 4L1BA 4W9IC 4I0PD 5HGHB 4I88A 1Z6JT 2QPUA 3AACA 3GB7B 1G7LA 1AP2B 2E5EA 4IRZL 4UUJA 4EZKA 1UM5L 2JJWA 5L2KE 3QS2A 5EEZA 5JHDB 4KRMB 5I28A 5MEND 2BSEA 2MEJB 3F83A 3HG1D 4KO5A 5GGTA 4WO0A 3KYAA 4GYBA 4XOBA 4PLJD 3D30A 1S8DA 1FO0L 1QI4A 5ALBL 4XNQB 4DP8X 3BT2H 4WW1A 4YHML 2V8MA 1J5OL 2NY7H 5GGRY 4UNVA 1FVCB 2RHEA 1FLTX 2FTAA 1OAXL 5CCKH 1SQMA 4DETA 1A6ZA 2VLMD 2XI9A 4P3CH 4HV8B 3IGFA 3KPTA 2G0LA 3MV9B 5EUOB 2BVTA 3RFRA 1AANA 1F3JB 2VE6B 1MXGA 5CCGE 3C5SB 4YGVA 1VZIA 3HFMH 1HEZA 1IB5A 4LKCB 5KBNC 3G04B 1T21B 2MOGA 4Y5VB 4ADJA 5EEUA 1ZA3B 2JQAA 5EZLB 4ZZFA 4ZFFB 5D5MA 3ZJAA 2BXYA 3WOVA 3JWDC 4OV5B 1T0NA 3JXAA 4HKXA 4QYOA 4KXBA 5BQDA 3FW6A 5GS0C 1YQ2A 1RU9H 4K7PH 5J13B 1D5IH 5DJDB 2MWCA 3P3YA 4G8EB 2L4OA 2YPVH 5DRNA 1SM3L 1YMHB 5DLML 4PJ7F 4FQXA 4BWUA 5KTEL 2X1OA 4CMHC 3DDFA 2XTJB 2FJGA 3MTXA 1ZIAA 2VSDA 1QFHA 3L4YA 3SYQA 2OKMA 1FZKA 2EO7A 1WTLA 3DHUA 3T4AA 3GBLA 1I85A 3EOTL 3VB8A 1E5YA 4UYPA 4LO9A 3ZE2F 4NERA 1CFVH 1BHGA 3C08L 4MZ2A 4EI5B 3A23A 2G5RA 4OQTL 2X89D 4MJHA 3WNMA 3W39B 2ALWA 3B5TA 2OJZL 2XPGB 4C4UA 1IMHC 1IGJB 4JQXA 4WTQA 3IMTA 1CF1A 5HI5D 3BZ4B 4FNUA 3C60C 1UATA 1I7RA 5DFAA 5D7JD 3LRLA 1A1MB 1IEBB 1WC7B 1TJGH 2J20A 3ELAT 4ODTH 1WAPA 1GS6X 4XAWH 1MFMA 4OCSL 4UTAL 1JV2A 4GI9A 4AGLA 4PY7B 2J88H 5FV1L 1NWOA 2HRGA 4OB5H 1K3IA 1WTGT 4WFHE 5CZRA 4KH2A 2XZAH 4YXHH 1JVKA 2AXFB 1IAII 1KG0B 1H8OA 2XG5A 3QZWB 4HSAC 2CDEB 3PV6B 1DQKA 3SDAD 2NCEA 3TH3T 1QO3A 4GQZA 3ENEA 1NDTA 4NO2B 5CGYC 3SE9L 4X7SL 1IGYB 3CDGA 5EUOF 1MIMH 1TEGA 2X1XR 3BVDB 3T8XB 3V4VB 1WG3A 2F53E 3M17B 1E7VA 3VD2A 4ES8A 2F8XC 4NPJA 4Z7VE 2PYEE 1OD9A 1WAAE 1M1XA 2E7MA 4F7CA 4Q2ZA 3WELA 1IO4C 4OZ4B 2Y06H 1AJ7H 1E4XI 4ZUSA 2MPVA 1WA2X 2ODIA 1C08B 2GTWA 2ISDA 2DM4A 1GY1A 4M7LH 3ZUNC 3DSNA 5DQJA 3SKOA 4QRPE 1K4CB 2VR3A 1EZSA 1AKPA 3B3IA 3TONA 4CC4A 3QDME 4U6YB 5FGBC 4FTVD 4JFVA 4KI5E 1HYSC 3OF6A 4HWEL 2EINB 4JPWH 4PJGB 1G4RA 4DN3H 1R3HA 1XR8B 5CINH 1SEBB 2ZAIA 1EVUA 3FTGA 3P2BA 5AKRA 5HYQA 3C6SA 1CT8B 4FKKA 5FDWB 1WD8A 4HG4K 4YWGL 4F7EA 2VQUA 3MCYA 1UD8A 3WXVH 2OX5B 1JF1B 5GIRB 4L5FH 2PKDA 2OK0L 3V0WH 1KFGA 1A02N 4PCSA 3ZO9A 5JLZA 3WLWD 1BQLL 4M9PA 4WLCA 4ZNEA 1RZFH 4JHUA 3OXRA 4H25B 1GL4B 1MFEH 1R5IB 5FECA 3CGTA 4NRYB 3QNXA 1G9HA 4Y2DA 4E5XG 1UJ3C 3TYFA 2JWYA 4PJ8A 3BSZL 4ELMA 3EJPA 1NFDB 5FIEA 2CBTA 5I76A 4PJCB 3RU8H 3U0WH 4OGQC 3KMDA 4G8FA 2ORBH 3SPIA 2ZYSA 4MASA 5F72S 4DUXA 5K9JL 2OS7A 4HA1A 1C8QA 4ZD3H 3TCTA 1I7UB 1UB5B 1Z0MA 3ZHDA 4NZRL 2X1PA 1IC5L 1HAWA 1ORSB 4HJIA 3AWFA 3D5OF 1KGWA 3B43A 1X7TA 1MRCL 4HLZH 4EZLA 1E5CA 2HRLA 4CL7A 5ANMA 4P2RB 3GTTA 1LO4L 2WBWB 2AJSL 3BDBA 4DW2H 4H1LG 5HVHC 1OCWH 2CKBB 3MBWB 3DJZA 5FHBH 5LCVH 3KLSA 5I1JH 1DQIA 25C8H 3N55A 5KYXA 4NYLA 5I82A 5C71A 4XB8A 1FO0A 2W80C 3UCRA 4I4WB 2GABA 1Y18B 5TE4L 4LRIC 5IQ9A 5I0DA 3DETC 2UZYB 1KELH 4GAAA 4LLMB 2CAKA 4MVBC 3M7OA 3CZKA 4M7JH 3QEUB 1I3RB 4MD0B 4PJGF 2DQTL 2XQYK 2GIXA 5CD5D 1AQKL 1DBKL 2IPUG 4IJ3B 4DVBA 1B4LA 4OGAC 4PW9A 1W9XA 3O2DA 3LKNB 3OXSA 4H5SA 2X87A 3CFCL 4NQQA 3VGEA 3PGCA 2YSSA 1R3IH 4GQPH 3TO2B 3BAWA 1Q8MA 4RZKA 2APFA 4ANWA 1NOLA 5B8CB 3DJ9A 3GMPA 2X4PB 4RAUA 5TFSL 5DZNA 1FE8H 1JN6A 3MZTA 4GSXA 4O4YL 1MCOH 3DXAA 2VO8A 5E6YA 4YHNB 1I1RA 1KYDA 1HYRC 3ZKND 1QNZH 3KPLA 1VFMA 2H0PA 1OSZB 3HAEA 1F0LA 5L2KA 2PR4H 5D1QD 2PYFA 1IM3A 1NFDF 3A0OA 2ZX9A 2A77L 5DT1L 4YSAA 2QVTA 5B38B 4PJCF 5IUCA 4NUGL 4ZODA 3NJMA 1AE6H 1HHJB 2YUWA 4I1RA 5F1OB 5I26A 1MI5B 3P3SA 5J1AA 3TF4A 1U0QA 1W8EA 2A83B 5IT2H 4FNSA 1GC1H 2Y7NA 3QULA 2BVEA 5BW7A 4DGIH 2OMUA 3IN2A 5LGYA 4TUUA 3HC3L 1AACA 3BVNA 2NXYB 1IT9H 4XNDA 2EXYD 3UP1A 5C7ZA 4BQCA 4PJ9C 2A0LC 5IM7B 1FZJA 3CSGA 4N0UE 5FUCE 1BJ1H 1T6BX 4HHAA 2N7AA 3ZT7A 1F02I 2BIPA 5KSBA 4Z7AA 3HHSA 3AREB 4A38A 5K59F 4WFGD 3SSGA 4UTAA 3GXFA 5DD3L 2APSA 1UH4A 3H42L 2DIEA 3BN9D 3ET9F 3KPOB 1W72L 4JUTA 4N90D 4PCYA 5CHNA 5DEGB 1CYGA 2H0JA 2K6WA 3NDYE 2XYBA 2HT2D 4OR1A 2O6CA 2YAHA 3LHPH 3PQYE 3VGFA 5LN8A 1AGFB 3VW3H 1H0DB 3ZZSA 3K74B 5GISH 5B21A 1XXDC 2R4SH 3FQTA 4R6UA 1YEJH 1ZHKA 5KSAA 3HCVB 4GW5A 4JZJC 3FZUD 4QJ5B 4JN1L 4OD1H 5A2BA 6PCYA 4YC2C 5AYUL 5DK0A 4ENED 2X4SB 4M5SA 5B4MC 1EXHA 2AITA 5D7EA 2I07A 3HS8A 3PAYA 5GHWL 1YEGL 4LPCA 3BP7A 4ZMWA 2APBA 3GJFK 2WWOA 3KGUA 2YLHA 4P4KA 3M07A 2NY3C 1EXUA 3T1FB 2EC8A 3WIFA 4XVTH 4LLDB 3W0WB 3OWEA 1MCWW 5C0IB 5JPMB 2CO6B 4ODWA 2XN9B 1GZHA 4Z3FA 1HSAA 2K8MA 4LSTL 4N5ED 4RISH 1L0QA 1D6EA 3TFKC 1DR9A 3L5XH 4YBQC 2W65B 2PXYC 4FQQA 3IBOA 2V9QA 2E74C 4LKXA 3UC0L 5LGHL 3NH7H 3QFJE 2DKMA 3ILEA 4JR9H 1QFWH 4PB9H 4CMHB 2FR4A 2WVVB 3UG5A 1P7QD 5EF1A 2WY3B 4O51A 3VRIA 3PG2A 4H13C 4OGXL 1I8KA 5D9SA 1BD2D 5ICYA 4QHNA 1KNOA 8PAZA 2ZXWB 1V7NL 2HUEA 3K80A 3PJSB 3OBAA 1EAPB 1C16B 2IQAB 3DV6A 2V17L 3WUZA 5AYTA 2OP4H 2VR6A 3MNVB 2XX1A 4JDZB 1ZV2A 1ID2A 3KYOA 5ID0A 2X4UB 2X3AA 4PBWD 3ARGC 3BUQA 2A2QT 1BXAA 2A4ZA 1ADWA 4QT5B 2W1NA 4P9HC 4WI6A 4WGVB 4ZPVB 1JFHA 3CH1A 3D25B 3C2SA 3F5WA 4PS3A 2EYSB 3F7RA 3GSWB 3EG9B 1ZXKA 1JPGB 3LNFA 4HIIA 3D09A 1AD0B 1Y6KR 4ZO6A 5TK2A 3Q7JA 2VDOB 5FUOH 4MX7A 5T3ZH 4AIOA 4ESKA 3BSZA 4M62L 4KTEH 1M57B 4OM1L 5AW4B 1A6TA 1UENA 2I7SA 1KPVA 1XHHA 2Q3XA 2JXMA 1I1AD 2Y4SA 2OCFD 3KLKA 3UZEA 5CEZL 1X7QA 1TYEB 3MOAL 3SODB 5EOCH 1YY8A 1FAIH 1CB4A 4TSCH 4X5XB 3PFQA 4KUCF 3VFWB 4KVNH 3NJXA 1J48A 3NP3A 3RDJA 3TWYA 3SBQA 3X2QB 4J6RH 3QDMA 1IQWL 1ZKAA 4NRXA 4ZUUA 1IGIH 4KJPC 4HUXA 1A1OB 4JB9H 5HHXH 2WQ8A 1UCBH 2JJSA 2G9HA 2X3CA 4FQJL 1IVTA 4Y9BA 1OTUD 3DLQR 3LDBB 1B4JL 4LSRL 3NCYS 4UQIM 4HDIA 1G7JA 5A2JH 4E41B 3VFUB 1IBGH 5E8NB 4KKZA 4AG4L 4ZTOL 4L37B 3QPXH 5E0FA 1FFNB 5AW3B 5C08A 5F21B 1MDTA 2QHRH 4K94C 1OGTB 3KPSD 3Q43A 4NKIH 2IFGA 4G6FB 1ZVHA 3WKNA 2VLRE 1GJUA 2AEPL 5DHVH 1TO4A 1UEYA 4OTXL 4DKEL 4TNVK 1T4KA 2X40A 3DX6B 4UBDC 2WP3T 2BOCB 3IFNL 3U46B 5E5UB 4J3OF 5SWSE 4FEIA 4JLRB 3BZEA 5I8KH 2JE8A 4OCMC 5JW5A 3RURA 4R8WH 1OF2A 4LL9A 3RWGB 1A2YB 3NCMA 5ICUA 1QP1A 2FBJL 2IBGA 4JRLA 5TDNA 3T6XA 2ZCLH 5FYLD 3GXUB 4R4FH 3OR7A 1A6AB 5EU5A 3VXPB 3MR9B 3MTRA 3DVGB 3FAWA 3HI5H 4PGDB 1N5AB 5F3FA 4PRPB 1XSOA 4CNIB 3LRSA 3S0PA 3JV4B 2PW1A 5E4IA 2EE6A 3RIAF 1WVZA 2HZHA 5B3NA 4UIKL 2WLJA 4GG6B 2LLNA 1XIWA 2JCWA 3L3OA 1MDAA 4YSEA 3MACH 2BRQA 1PKQB 2D2CC 2CE6A 3FH8A 3KWVA 2QGBA 2FNBA 3RPIA 2AQTA 3ATFA 3QHFL 5DJCA 4IRSC 3DIVA 5TQ2L 3QUZD 3L16A 1NGZB 4IRJB 2ENYA 3NSYA 2W95A 4TUKH 4WI3A 3LKQA 5E9DD 1OP5K 1JHKH 3VE0B 4LLWA 1N3NB 3IDGA 3GDBA 2WLIB 2OYLA 4BFKA 4CGTA 5IMKB 1LO5A 5GS1A 1E9QA 4RZCB 3L7EA 3I84A 1EHAA 4MA7H 5IBUB 3LNHA 5DGRA 2OI9B 2IPUK 2VDNH 4NUJB 4OKVB 3H53A 2VZSA 3IXTA 2HG0A 2BP8B 3D9AL 3KVDD 4LARH 5HGBA 1G7PA 2NNAA 4X5QA 5CIPB 4HPYL 3C5XA 4IGBB 1THAA 4F15C 3S88L 4LCYB 1W0WB 3Q48A 4U1MA 3N40P 1UUSA 3QQDA 2EXWD 3RZCA 1GYWA 1WBXA 5KYNA 1W72A 2RA1A 4PRHB 2ZPKL 3IS1X 5KVDE 1KDJA 2XIBA 3SD5A 1A7QL 3Q6FA 4M7LT 2Q7YB 3VFMA 4FADA 2CDGB 3DMMA 5D2NB 3DRQA 1E3FA 3GJFH 1D5XA 2FB4L 4WI2A 5EIIG 3ARDC 4ZMZA 4QXTA 4GY4A 3DO7B 4PWFA 2K6YA 1X6LA 3S3CB 4MD4B 2Y36H 4JQIL 4AEIL 1P2CA 2E7BA 1JRHL 1IJ9A 1Q1JH 4R90L 3ZL2A 3V9FA 3HZMB 1A8ZA 1FZOB 3IEAA 3MA9L 4XR8C 3DX7B 4XCFL 1Q9KB 2EXTA 1LD9A 1UB6A 3ARBC 5LKNA 4HXAL 2L8AA 4OLYH 5C2UB 1J0ZA 3OKMA 3SDCA 2AQ2A 3U2JA 5AVTB 4PJDA 4W9EC 4U33A 1H3TA 2MNWA 3FXIC 3PUUA 3N44B 1UWFA 5D1XB 5HY9B 4NEHB 4LCUB 3FH5A 4BHUI 5KVGE 4N0UA 3EYUH 1IEAB 4X7FC 4JPVH 1NEZA 4GG6F 1Z5YD 4JUSA 5E8OB 4KHXH 5IMMA 2IF7A 2PO6D 1O7SA 5F7AA 1KV7A 1OAYL 1WFTA 3FSVA 4PJ7E 4BZ1H 5HHPB 1R33A 2VUKA 1INQA 2R9HC 3RWFA 2YA2A 5KVDL 3BUYA 3L5IA 4HJGB 1S5HB 4OT1L 4AQ8A 4EAEA 2FHFA 3D2UA 3WY4A 4K8RL 3EBGA 3MRPA 2HTKC 4UMGA 4D9RE 3P0VL 4RAVB 3CN4A 4KY2A 1JWMA 3MOBH