1NCBH

Crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
221
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLEWMGWINTNTGEPTYGEEFKGRFAFSLETSASTANLQINNLKNEDKATFFCARGEDNFGSLSDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INFLUENZA A SUBTYPE N9 NEURAMINIDASE
publication title Crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface.
pubmed doi rcsb
molecule tags Hydrolase(o-glycosyl)
total genus 40
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1992-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncbH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncbH02
3BAEH 2J88H 1ZSDA 5DA0B 5T1MA 1ZVYA 2QR0B 1GCFA 3LPFA 3NN8A 1EDQA 1AJ7L 1B4JH 5I74C 2FNBA 1NFDF 4NYLA 4HUVB 5GS2D 2PCPA 1Z9OA 4O2CA 2AXGA 5BOPA 2XQYG 4HCRA 1OPGH 4JKPL 5M94B 2BOBA 2G2RA 1IEBB 2E7BA 1G6RA 2DI8A 4P2RE 3M45A 4RAUA 4XHJC 1L0YA 4GAYA 3QPXH 1JF1A 2P47B 2A6KB 4HEPG 5FYJD 4YGVB 4LHUA 5C07D 4TSAH 4M5ZL 4PJIA 4JJ5B 1JNLL 2EE6A 3DRQB 2CR6A 4XCFH 4CW1B 1C5BL 4S1RH 2ZCLL 5TQ2L 3MLVL 2BY2A 4ZAKD 2Q3AA 3H9SA 4HH8A 5F7HA 2IFGA 2H26A 4KHTH 4YNYA 2E6QA 1U8OB 3GZKA 5DVNA 3MRBA 1U8NB 3QXAA 4O2EA 4X4XA 2VDKH 1NDGA 3BT2L 3DTXB 4KK5D 5LAXB 4UBDC 4OCWL 4WGWB 3VXUA 5ICZA 5IOPA 3NZHL 2WQRA 1UC6A 2I27N 3E8UH 2DI9A 1GVIA 4Q97A 3ZE1E 5GRJL 2F53D 3L6FB 4KJQD 2H2PD 4YHPB 2EDQA 3MV8E 3U0PB 3NCMA 3FT4A 3E2HC 1JNNL 5BZDA 1BP3B 1G7LB 5JIPA 4H20L 3LH2L 3CXDL 2ENSA 2XPGA 4AQOA 4Z0BH 2CK0H 3TBSB 5EBGA 4PLOB 4LSVH 2MKLC 4RGNB 3W39A 2C4FT 3IDMB 4M1DH 2B4CC 1J1OL 3MV9B 4D9LL 3C5JB 1CR9L 1OP3K 3G5XA 1I1RA 1Q38A 1IC5H 4ODSH 1F3JA 2GCYA 4YC2B 1XMWA 2AK1L 5EO1A 2C7UA 1YNKH 1D9KB 5HI5C 5LQBH 4P3DB 4X6CA 2R0KL 2UY6A 1NCAH 4OZHA 2MPAH 1NEUA 3M07A 1BQLL 1FFPA 3VFNB 3ECBA 3LEXB 4S2SB 3DMMA 5CZVH 1FYTB 3LKQA 2ZUQC 4L8CA 1KJVB 5GISH 2DS4A 3GHEL 5I2IA 5IFJB 2JIXD 1QOKA 1NEZA 5IMMB 2B1AH 2WMPA 4NQUA 1JCKA 3CSYB 3FFDA 4POUB 5HVGB 4U49A 2MKWA 4LEXL 3HCVA 3RRQA 1FVDB 4HUXB 4YBHA 1A64A 4YIQB 5CJBA 3RWHA 1RZJL 3PHOB 4JFOB 3HMWL 3LRGA 5TF1H 4L9DA 3EZJB 5FGCB 1I3GL 4NSKB 3S98A 2HT3C 2E7HA 4K9EC 3KAAA 2BOCA 3EOAB 4JFEE 1FPTH 4WEBL 3OB8A 2CGRH 4PJ8B 3VA2C 3AUVA 3MZGB 3M17B 2YRPA 1LEKA 1L4IA 4OAWA 1A6AA 1EEZA 4W6YB 4JO1H 3S5LB 2VQTA 1H3XA 3EJYC 1JL8A 1VFAB 5DQDL 5I1HL 4G9FD 1VADA 1UJ3B 2O61B 3DWTA 4J12A 3RTQC 1RK1A 2BMKA 4BFIB 5IQ7H 1CT8B 3HC4H 3RA7L 1C08A 1MJUL 3QRGH 1ZVHA 1TZGL 2HJFB 2WP3O 4BH7B 5F1IA 4YHZL 1FL5B 3D18B 4GMSL 4G8IA 4QHNB 5HGAA 1KCUL 1KLGB 4XP9L 5C0BA 3ZDZF 4XAWL 5DMJB 2IBZY 3GJFB 1AXSA 3WEXA 1DN0B 1O7SA 1EO7A 1YQVH 1XH3A 1KIRB 1YEJL 1HOCB 3VXOB 5TDPA 2AJZB 1H9VA 2W91A 2CO7B 2L7JA 3ARDD 3CVHA 3TPKA 4W4NA 2B0SL 5TFSL 3ZKXB 5DD0H 5IW1A 1FHGA 3RWGA 5DJCB 4ZUVB 1NAKH 2FH8A 4OLZL 4KZEH 4MJID 3TO4C 3PP4H 4WTZA 4ONOA 4TVPL 4KVNL 1G1CA 3VFPA 1F6AA 2AABH 4MAUL 4KV5E 3T2QA 2P44B 1T2XA 2MMXA 4PJBF 3NPSB 2IH1A 1J5OH 1SM3H 5E1AB 1QZ1A 3PL6C 2XA8L 1K8IB 1RD6A 3QUXD 3SEPA 5JHLH 1EVTC 2YA2A 5IVZA 2D0FA 4ZSOE 2NX5A 1FLRH 3QXDB 4NWTH 1CF8H 5AAWA 1JP5A 1RIVH 4H8WL 5C3TA 3AREA 3NCCB 1NQBA 3PHQB 4J3VA 3RWIB 5D93C 3UTQA 4I3SH 4WFGD 2NY2D 5HGDA 1A0QH 5JOEA 2JELL 4GUPA 4S10A 1IGYB 3WLWD 3IDIA 1C12A 4ONGL 4X7TB 3QNXB 4HJJL 5DR5L 5TH2B 1Q9KA 1FZKA 2JB6B 1RJCA 5GSRB 1UM5H 3PGFH 4NQCA 5MEND 1TVBB 4L4VD 2HKHH 1CICD 1J18A 2EE3A 4LEOA 3SE9H 4KZDH 3SCMB 2FSEB 4R90L 1T04A 2YUWA 5ANMA 4IRZL 1JI2A 3L5IA 4U1SB 3U0TA 1N0LA 4HKXB 4EUPA 2VLMD 5IJVB 5HHPA 4X6DB 1IGFH 2OR8A 4WV1B 5F70A 4HIEB 7FABL 4J3WA 1I7UA 4A2MA 3OXSB 4TN9A 3VCLA 3B5HA 1H5BB 2B8OT 4F58L 2Z8SA 3VWKB 4D9QD 4OLYL 1IGCL 3MJ9H 1EAPA 1TPXC 3Q1SH 1Q9OB 3OR6B 4QWWD 4KRPD 3GSOA 3KLHD 4Q2ZA 5IBUG 4N9OB 4PGEA 3GMOA 4C4KT 3LSOB 4LSQH 3GRWL 3C6SA 1J0JA 4YQXL 3TNNA 1VFMA 3C2AH 4TNWF 3BWUC 3BKCL 1VGKB 3P4LA 3BP6B 4QHMB 2JF1A 5T33H 4PJEF 3A6BH 3ZKSD 2MQ3A 5EBLB 2DMBA 4C56D 1YECL 5CJOL 3L1OH 1QSFA 3HB3C 4EEEA 4Z7QF 1WBZB 4YHYB 5GS1C 3KLDA 2ATPA 1QLFB 5EFIB 4M9OA 5ERWA 4KMTH 3B9KA 1B4RA 1Q94A 1BVKA 3RVWC 1XGYL 2OI9B 4P3CH 3VXMD 1UM4H 3QUZA 1O5DT 2BJMH 4LIQL 1S7VB 5DJ6A 3B3IA 4JREB 4MNQE 2NQCA 4NPYA 1MJJA 4LPYA 3SKMA 4OLUH 1MHEA 5GS0L 1CTNA 1DFBL 2CRMA 2OMBA 1FNEA 3HR5B 4V2CB 1Y0LA 3KYKL 5FUZL 4U1HA 5J13B 4DVBA 5I6XC 4HXAL 1JNHB 1BREA 4PRPA 1E6JH 4KUCD 3SDDC 4FFWD 4KKAC 4NM8H 4P5MB 5D2LB 3T65B 3EO9H 5JMOC 3SKOA 3NIFF 1IFHH 2DTMH 5JW4N 4KPHH 3GB7B 5A3ID 2DKMA 3MC0A 1I9IL 4F7CA 2F9BT 2XICA 3MGTA 3OKDA 4KJYA 4Q6IB 2R9HD 5L8KB 5EOQL 3MRKB 4FP8H 1QYGL 1N3NB 5J1AA 2VRAA 4XRCB 5D7JB 3ZYZA 1F4WH 1XGRB 4U1NA 2VR5A 2CLRA 3ARZA 3GMLB 4MX7B 1C16B 4PY7B 3NOIA 3VXRE 3S4SB 2OSLB 5IMKB 2BXZA 3SGKC 2CMRH 2D03L 5DMGD 2DM2A 5DJAA 3IDGA 1K8DB 4WUUE 1J8HE 1KCVH 4TRPH 3HR6A 1NAMA 1SEBA 1WITA 1PKOA 1BGXL 4JZNB 5DUBB 4MCZA 2JCCE 4PRHD 2BNQA 3VA6A 1S9VA 4D9RD 3KPQB 5L8JB 3VW3H 4MAYB 2XOTA 5CWSA 3SDXB 4J1UA 1Q0XH 4EN3A 5BS0B 4LPTA 4MHHI 5HYQB 3PDOB 1JJUA 1LVEA 4M6AA 2NMSA 3QAZB 2NY5H 2B1HL 1TJHL 3QXTA 4NM4H 5ILTH 4YDKL 4HXBH 1S7WA 2G60L 3OHXA 5C07A 1UXSA 3WIFA 4OM1L 3CSPA 4U6HA 4WI6A 1Q9WA 2DQHL 4H88L 1UB6B 5DJZA 5T1KD 1NFDB 3B2UC 4HLZH 4EXPX 1J10A 3W9DB 2APFA 2F74B 4ZAKA 3RX5A 4JFHD 4BSWB 4J3XA 2QKIA 3MA7B 5BZWA 4LKCA 2D4DA 1QTYT 5EIIB 4PTTA 3OL2A 4HK0B 4XHQA 5E8OB 3B9VA 4M7KL 4EIZC 4PFEA 1IGMH 2F53A 1QLRB 3NFSL 1I8MA 4CNIB 1TJIH 1FGVH 4GFTB 2GSIB 4GW5B 1VENA 2YEZB 3RNKB 2GJ6E 5LGHH 1YYML 3PWLB 5D5MF 2MCG1 2HLFC 1QBML 2DQTL 3LQAL 3MBXH 5DT1L 1L7IH 4Y5VC 5I76A 4L4TB 2BSTA 4YBQD 4MHHG 5A16A 3SOBH 4LSSH 4UT6H 2PW2A 2D7QA 1EFXD 3RVUC 2FB4H 1X5AA 1U42A 2BK8A 3RWDB 3LN5A 2MTPA 3MCKB 3RX8A 4G6ML 1Q8MA 3X17A 3TO2B 4KROD 4ETYA 5D70H 2NXYC 1RULH 1TLKA 2R29L 3QIWD 4HS8L 4FFYL 1GOHA 4N0UA 3ETBF 5HTSA 1I9JH 5L8LB 5IGXL 2APBA 3RAJH 3IXAA 2NY0D 2YPLD 2IPTH 5BVPH 4Y4FB 3PUCA 4KQ3H 2HVJA 1OP9A 1MI5D 1P5UA 4PJXB 3IU4L 2WP3T 1AD0B 3CMOH 3G6JF 4RFNC 2DOCA 3QG6A 2P5WB 3QWOB 3IRPX 5JXEC 2JIXA 3O6FB 4HIHB 2VLRE 1QHPA 2AQ1A 2ESVE 5K59E 4KFZC 1OLLA 2WNGA 1G1YA 5IB5A 1BOGB 5GPRA 4OGAD 1RUAH 3TNMB 3HUJE 3OAUL 4TVPD 2C3WA 1F4HA 3HPLA 4WO4C 1BJMA 4X4ME 3C60C 3K7UA 3WL9B 2VE6B 5CKAA 1FO0L 3OG6B 2VXTL 4BYHA 2P24B 2H3NA 4F3FB 4G9FA 4TVSa 1QKZL 1DVFD 3Q3GA 4QHLB 4PGJA 5DDHB 5K9OA 4PJ9D 4E41E 4LLQA 4M7LL 1S8DB 4OSUH 4PV8A 3U9UB 1OCWH 3BZ4B 1HDMA 2NYYD 2BVQA 5GGUB 3S4SG 1SYVB 2DMCA 1AGBA 1S7XA 2QHRL 3QNZB 4FZ8L 4JFPA 4LSUL 1BBJB 5ADOL 5BOZG 4M7JL 3MRFA 3O2VL 2ZCHL 1XGQB 2AV1A 5ADPH 4QNPF 1TZHA 2DF3A 3ZHKA 3BN3B 1CWVA 5E6IB 5EDXA 4ZTOH 3GMPA 1DANT 1JGVL 1JFQL 3ARDA 2YBRA 5D9SA 4LPUA 3HHRB 5F71A 2VABB 4AT6A 3EYUL 3IJHB 1MY5A 2RR3A 1TXKA 4MJIA 5ITFB 5F21B 4NQDE 1Z0MA 1BZ7B 2OZ4A 1P4BL 2MHAA 5I66B 4N90D 3VWJD 4I2XB 4PPTA 4PD4J 3VH8G 2XXCB 2KPNA 4OB5L 4Z7WA 1S9YB 2ICCA 4PJ5D 4X6FB 4HS6A 1JPFB 3QEQE 4M9PA 4KTEL 2WBJB 2BHUA 3QUXA 5EC2B 5DJYB 4WI2A 4RBPK 5FM5M 4OQTL 2Z8RA 2BSSB 1CXKA 5B8CB 2GT9A 4FTVD 5MERB 1P84J 1JI1A 1LP9F 5I8OL 1C5DA 4OD1H 4X6BB 1LO0H 1J86A 2Y5EA 2AXFB 4KGLA 1K4CA 1NGYA 4DKEH 4JG0H 4P2QB 1G9EA 3L9RB 2BVEA 1ZLSH 3U4BL 2G5RA 4WCYL 2C4XA 3LS4L 3GJFH 4ZOAA 2HFTA 5B4MC 3VXNB 5MENA 4BM7A 5EU3B 2C3XA 1CICA 1HHHB 3MCG1 1V7ML 1JZ8A 1F3DH 2KBGA 4OKDA 1RZ8A 1P7QD 2BNRE 2HFFA 4HWZB 5DHVB 2H41A 4O02L 4WI9A 2LAGB 5H94B 3DUHA 3DMMC 4ZXBD 3MFFB 4RDQG 2E3VA 5T3XL 2YD8A 1G9NL 4GKSB 4HQQH 3UPCA 3P4MB 5GJTL 3FO9A 5C0IB 4HDIA 1J05B 4KAQH 2AJUL 4NN7C 5GS0D 5I1KH 2V17L 5KTEL 5SWSB 3VE0A 5C0RL 1W72A 4L4JA 5TGBA 4ZYKA 5EZLA 5MEOA 1CD9B 4HJ0C 2RJMA 5KG9B 5HYJB 1BWWA 1F2XK 1IRAY 1S7QB 2E7LA 1FJ1B 5I1LB 2R1WB 3JWNC 4ACPA 3KJ6L 1EGJA 2UWEB 2FJHA 1YEDB 1VCAA 4X99A 5I17A 1INEL 5ENWB 4P9ML 3O41A 4NOBA 4K8RL 3O3EB 4G8GD 3MSPA 4Y19D 4IOFC 4LCWB 3SKNA 2IFFL 4JFXB 4C56A 4JCLA 1KTLA 5A2FA 5F93C 4KK9D 3JTSA 4RGNE 3T0XA 3BRGC 4TYUA 1YY8B 3MV9E 3IFOB 1C1EH 3NBNA 3EFDL 4WI4A 3GMQB 3STLA 3FTGA 4K7PL 2IQ9L 4JPWL 3VXMA 3KHOA 5KSBE 4P57A 4WW1A 1P1ZB 2PXYB 4PRBA 1YPZA 4PJEB 1MNUL 1DQTA 4QTIL 3IDNB 1S7TA 4JKPH 3FFCB 4GH7B 2VL5A 4UU9A 2PETA 1U0QA 2Z31B 1MWAB 1ITCA 1KB5L 4Y89A 3LKOA 3O2DL 1D7FA 3OKNB 4K94L 1M71B 1BFTA 1A7QL 3QHZL 2XV6B 4M5ZH 1MCBA 3MNWA 1JNLH 3C09B 2LABA 1T6WA 5D71H 4LVOC 4I48A 3PWPD 1AQKL 3ZSSA 4YGAB 3QULA 3G9AB 4XPHL 1C5BH 2F19L 5TQ2H 4YR6A 2K1MA 4Z76B 5FGCE 2OLDA 4JR9L 1HH6A 2YUVA 2HP4A 1DQJB 2A73B 5I30L 3AREC 4HFWA 1HINL 4OCWH 2ZSVB 5EUKB 5DUPL 1M6OB 4YHOL 2VZSA 1DLHB 5GRJH 1YNTA 2XWJB 2XZCL 2CDEA 5J6HA 1HILB 3SDAC 1VHPA 1JNNH 3PIQA 3LH2H 2Q86A 3BP5A 3UYRH 3BSZL 4GSDL 2YD6A 3NA9H 1P7KB 5JW4M 5DMKB 4X80L 2AAVA 4PUBL 1J1OH 1GGYA 1JYWA 1ZLWH 1PDKA 4LMQE 1FFOB 4MA7L 3EYFB 3VI4E 4NP4H 2XTJC 2SEBA 4JE4B 3A0OA 5GQBA 5T1KA 4EQ3A 4M1CD 4LF3B 4JKMA 3VJ6B 3OQ3B 5FKAB 3ROOA 3D5OF 4E9LA 5EPMA 4L4VE 5EUOF 4HKJB 3VFMB 5ESAA 4UNUA 2CKBB 4Y16C 2R0KH 4HUUB 2YUZA 5ALCH 1DQQA 2EDOA 3K81A 3RUGB 2PW1B 3OV6A 1A6TA 3QG7H 3FO0L 4PG2A 3ARUA 3U48A 2WWKO 4HUWB 2OR9L 1R3LA 3GHEH 2Q8AL 4OZGA 5CJQL 3FB7A 2HAZA 4LVNC 2V7NB 4X5XB 2F5AL 4M4PA 5HGHB 3W81A 3KNBA 1NH6A 3KPPA 3UAJC 5HHQA 3K2MC 4LEXH 4Z7UA 4BSJA 4LSPL 2Y72A 2YZ8A 3MUJA 3LS5L 3ZE0E 1RIUL 1JZ2A 3WFEL 1KPUA 1RZJH 4O9HL 3DIFA 2Y36H 3HMWH 1UGNA 4WWID 5DJ8A 1NDMA 1I7RA 1X4YA 1ETZA 1EFXA 3P0GB 3TBTA 1KYOK 1T1XA 3B9KC 5FCSH 1BD2B 4DQOH 1KIPA 2N4IA 3GUTA 1GH7A 1VPOL 2CUMA 3QIWA 3NIGE 1JBJA 1AIFA 5F72S 1KGCE 5K9KB 5DJ2B 5D5MB 4HC1L 1AGCA 3E1F1 1FVCA 3QIBD 4NKOB 2YPLA 5I1HH 4ERSL 5JOPD 1KJ2B 4HWUA 5GJSL 4M93C 4QHUB 2YMXL 2ZSWA 2FIRT 3EBAA 5C0GA 3SHSA 4E5XB 4ODWA 2XZZA 3RZCD 1MJUH 1H3GA 1TZGH 4RRPG 3VXPB 5ACZA 3CLFH 1ORQA 3MLRL 2IBZX 5KZCD 4YHZH 3CDGB 1R5IA 4R4ND 9CGTA 4JLRB 4XP9H 5ICYB 3GI9H 3U79A 1ZVSA 3EOTH 3MLWH 4LSRH 4XNZB 2EDYA 1XF4A 4GG8A 5HYSB 3U4AA 8FABA 3NCJL 1NGXA 4U2YA 3QUMB 4U0RC 3V5HA 5IM7A 1WSST 2GK2A 4CGTA 1CD1B 5T5FL 5TFSH 1PYWB 4OLZH 3H7BB 4MA1B 3KG5A 3WHE1 3G6JB 3G6DL 4HV8A 4JRYE 5F1OB 4MZ2A 3K80A 3LKPA 4PY8I 2AI0L 3EHBC 3X3FL 2WSKA 5EO9B 1PSKH 2CO6B 1YA5A 4MDIB 5E5MA 5GGSY 4EI5D 1L9MA 2DICA 2X89A 3I75B 3CH1A 1NCDL 3QDMD 1P6FA 2XA8H 1WWWX 1HHIB 4KI5E 5BMFL 2XN9B 3DARA 1WZMA 1DVFA 3GBML 5IEKB 1TITA 4PJ9A 3V7MA 1JRHI 4XPTL 5KVEL 4EN3C 3HE6D 4OD2A 1G7QB 4FS0A 3TH4T 4JRXB 1P4IL 1T03H 2V9QA 5GGTA 4PB0L 3DUSA 2OMNA 1RFDL 2ARJA 3TYGL 5KN5B 2JELH 4G7VH 4ONGH 3P9LB 4OCSL 5DR5H 4HJJH 3MGOA 4PRHE 4WNQB 2XXMB 1V3JA 3WFBL 5K9QI 1XR8A 4NGHL 4JPIA 5C08D 1FYHB 3JV0A 1WVZA 1CDYA 12E8L 1AI1L 2IF7A 5FO9A 3WNNA 3RX7A 1LK2B 3HRZA 1WIPA 2NLJB 4ZAKC 1U9KA 4L9LB 3AAZB 4DK3A 3KHQA 3TZVD 4KK5C 4JVWA 2EDDA 3IKKA 3T0VA 3VWJA 1IMHC 3PGCB 5GZOD 2R1XA 4HPOL 4CVUA 4PIRF 4PJ5A 1IBGL 1NANH 3GSWB 4PTUA 1UXWA 4N9GB 5E00B 5F6IC 2Y25A 5A2JH 5GGRB 2H2PC 5DC9B 3W0WE 3RVXD 1E0OB 3LKSA 5SX5H 4FTVA 2AGJL 4U4BA 1ZT4A 2C1PA 1IGCH 3MXVL 3QFJB 4ONHB 1PZ5A 1HYRC 1QFPA 4U33A 1WEJL 1A3LL 1GYAA 5F9OH 3N1QC 1FNSH 2HKFL 3GRWH 3P11L 1KPRA 4K23L 4M4RA 1QRND 2FYYA 2A74A 4MCYB 3MZTA 3LDBC 4RZCA 5L6YL 3HG1D 3JV4A 3DRTA 5K9QG 4PY8J 1PGRB 5I73C 4FQPA 3GSNA 2B5IB 2WW8A 1IC1A 3W2DL 1UCTA 5EBMB 1AO7E 1P7QA 4ELMF 4M43L 5IQ9A 1LP9B 1YYLH 1U92A 3BP4B 3A6CH 3KLSA 3V6ZA 4ZXBA 2EDBA 4M8QA 1XGYH 4X9BA 2F15A 1Y6KR 1WC7A 1NFDE 1FDLL 3PXJA 4I4WA 1KTDB 1FZJB 1GL4B 1M05B 4LIQH 4XCCL 4FQXB 5ESVA 3KJ4C 3VGHA 1MCQA 4LNRB 3LN4B 4APQB 2V2WA 4LFHG 1WIOA 3L95B 1PLGL 1DFBH 5J11B 1SYSA 1ZT1B 1R3KA 2JB5H 1UACL 3DVFA 4WHTB 5IVXF 4HXAH 1MI5E 3H42H 3X14B 5F1NB 2IWGA 3ULVD 3NFNB 1XF5A 3WFCL 2VERN 4LCUB 3IU3B 5DUML 2EYRB 1FL6A 1H3WM 2B7DT 4KKLD 3QPQD 4G8GA 1PAMA 1RHHA 4P5KB 1AFVH 4Y19A 1ZGLB 2N1KA 5IVNA 1S5HA 1ZHKA 5BO1L 5T5NF 4P59L 4MJ6B 2CPCA 2H9GA 4L4TE 2LU3A 3L3KB 5IV2A 1QYGH 4OGYL 2FX8H 3ZHLA 4FHBD 5CD3A 5FUCC 4M48L 5DS8B 5AYQA 4ETQA 4PJGF 2X4QA 3SY0B 4N8VA 4WFFE 5CCKL 4JZJB 2D03H 5DJ0B 1EHNA 1SJXA 3IYLW 4HG4J 3BO8B 3QH3A 1DUZA 4OM0H 5I1JL 1SVZA 5JHDE 2OM5A 1PQZA 3S88H 1XF1A 1BGXH 4JY4A 4XH2A 2XZAL 5CMAA 3ESUF 3U0WH 3S35X 2DJ4A 4PP1C 5C0CB 2RFXB 4UB0L 3G6AB 3OJDA 4JFFB 1CDGA 1P9MA 1WBYB 3U1SH 5LKNA 2MSPA 4HZAA 3EJJX 4DN3L 5LJYH 2OTWA 3ARDC 1EO8L 4N8PA 3FOMA 2VSCA 2XQYK 4Z77A 5DZLA 3AU1B 1MCPH 1LNUA 2B1HH 1TJHH 3QUKB 4WWKB 3OAYK 1J8KA 1M7XA 4MDJA 1MHHA 4GW1B 3RJDA 4F37K 2DJUA 4HH9B 4V1DB 5J57B 4HHAB 1U8JB 2GTWA 1T83A 2DQHH 3DUUB 4YHKL 3OX8B 3BZDA 1Y18B 1X3DA 3PWPA 3EZ8A 1OW0C 3QUXC 5CZXD 3MV7D 2AXJA 3TIEB 4ZNCD 1OAXH 4DZ8B 3BUTA 4R0LA 2YSSB 3MJ8B 2ITCA 5AEAA 3BEWA 2EDHA 2I9TA 5DVLA 3GJEA 3L7EB 1UKSA 2IAMD 2X1QA 5FF6A 1U8PA 1EXUB 3U36B 2WWKT 3EW3B 2GAZB 1HI6B 5CZKA 1OTSC 4M7KH 3SN6N 2NY2C 2R0ZH 1DQLL 1C5CL 1PFCA 2C3VB 3T04D 4MD4A 3NFSH 2A6DB 3EO1B 4Y8DC 1MRFL 3BESR 4Z7VA 3EYSL 5MI0C 4P49A 1QBMH 2YC1B 1FYTD 5DT1H 5HI4D 1P6AB 1F42A 1NCWH 5C9JA 4NKQB 2XQBH 4PGBB 4IRJB 2DDQH 4H25A 2VDQL 4ZDHB 3DPBA 1MWAH 3WNLA 3F6IA 1D5XA 4P2OB 1N5AB 3UTTB 1A7BA 2Q1EA 4MXQC 4QRPD 1DBKL 2BZDA 2E8YA 4EBQH 4CMMB 2AV7A 4G6MH 2Z91A 2VL4A 2R29H 3IFLH 4G6JH 4F8TA 4IEFB 2CR3A 4P4KD 4JM2B 3QHFL 2FBJL 1U8IA 3PV6B 2R2BB 4R97B 1CE1H 4KKNA 1MJ7L 32C2A 1WICA 4H26B 4PJ8D 2HT4D 3TJEL 3IU4H 4LASL 4I2XE 4WRLA 4KRPC 4QY8B 4XCYA 1G7PA 1GC1C 4NKDB 4DZBB 3DX8B 2E7LC 1CDUA 3P0YL 3ILQC 1K6QH 4LIQE 3PABA 5IMOA 1AGFA 4WW2C 3RPIA 4Z5RB 4ELKA 2DWDB 2AJSL 3ES6A 3VRJA 5BCAA 3V5DA 2W9LA 4OIAA 2FGWH 4Z0XA 3MRQB 1NFKA 4U1LB 4U6YA 1WIUA 3OR7B 1ZS8A 4BZ1H 4O58H 3TCLA 1X7QA 5FOBA 1IAMA 3SGEH 3MREB 3PGDB 5BV7B 5I8KH 2YD9A 4CDGC 4JZOA 3CAFA 1AR1C 2AJYL 1X5IA 1WZKA 3MODH 3DROA 4P2QE 4PJBE 3DX7A 1NBZA 4D3CH 3HPJA 1FO0A 1ITBB 5FB8B 3OKOA 4LHJB 3LMJL 2W60A 5FO7A 1QG3A 3EYOB 3MGAA 1NC2B 2VXQL 4J7RA 4MB3A 4QXUL 5B39A 3QIBA 3PWVB 2PTVA 1NC4B 4AMKH 1F8TL 3P0VL 1QKZH 1A1OB 3JZ7A 1RJZB 3WUWB 3KGRA 1JF5A 5CEYB 3KPMA 4MJ5B 4OQ1A 3CFJB 1QA9B 4F2MB 3RZCA 1U91B 3EOBB 5EN2B 5AUMB 2OYPA 1IAIL 3P9MA 2EYTA 5F7FA 5JO5B 2NTFA 4RWHA 5A3IC 3MJ9A 2JTDA 3AS1A 4LSUH 4NCC1 5HI3D 3O2VH 4XP1H 3OAYH 1EHLH 2ZCHH 2VZTA 1FCGA 4I9WD 5F3HB 4CN6A 2WM0A 4XVTH 5C0AB 1JFQH 3GI8H 5HYJE 4L3ED 3EYUH 5DWUL 4XMPL 3BUYB 2KH2B 1P4BH 1NL0L 5DRWB 1KSRA 1LO5B 1RQ5A 5E2UL 1K4DA 4MNGB 4EI5A 5CAYB 5DMGC 5I1DB 3MROA 3NGBB 3T4YA 1XR9B 3QDMA 1RJYA 1I7ZB 4LCWE 4WEMB 3O3DB 4KTEH 2HVKA 1DL7H 4PREB 4LLDB 4OQTA 4Y2DA 3QDJB 5D2NA 4XNQA 3BZEA 1G84A 1PJ9A 1KJ2H 3I6LD 3HE6A 2FO4A 1PKQA 3ARYA 1FV1A 5DRNB 5FUOH 2WQ8A 1J1XH 4XWOD 4NN5C 2Y9RT 5FGBC 1FZOA 1KG0B 4P23B 4GBXB 1OGAB 1HIML 1MFNA 1T5WB 4PJEE 2BSRB 1T1YA 3LS4H 4X9FA 5DGRA 5C08A 5E9DB 5C2BL 1KT2A 1SEQL 3EGSB 3B6SA 4Z7QE 5D6CB 5L2KB 3HNSH 4AM0A 1V7MH 4EVNB 3QA3B 1JV5B 5AZEH 2ICEA 2OXGA 5B21A 1D6EA 2VMFA 2CLVB 3UJJL 4HS3B 5FM5O 4WY7L 4M8VA 3TZVA 3I50H 1ZHNA 4OCLC 1A7RH 3DYPA 1EEYA 4BFGA 2IEPA 2DN7A 4XGZB 1QO3B 5T3XH 2WINB 2NY6B 2NW2A 5TE4L 2DD8L 5GJTH 3WLBB 5BVJB 1TNMA 1U8HB 3RIAF 2AJUH 1WFUA 3O3BB 1NMCC 2B4CL 1CLOH 1U41A 5EOTB 2H8PA 3DX6B 5CBAB 5BXFB 1QQDA 1FAIL 1HSAB 3BP7A 4M5YL 2GIYA 3ZKQD 4YBQC 2WLYA 1SY6A 4LCCA 3H6JA 2OL3L 3ZKMD 1T5XB 4PBWD 1T7WA 1QRNA 4P46B 3TYFA 1MUJA 3O4OC 4UTAL 2G75A 4K8RH 1ZA6A 3QNYA 4L29A 3HG1A 3DV4A 4O4YH 4NO3A 1CDJA 5AWNL 4PJCF 1ND0A 3FMGL 3QIWC 3UJTL 1AR2A 1D5MB 2FEDD 2P5ED 4PGDA 2LTQC 4U1MA 1NEZG 4K55A 5CHNB 5GGVL 1JGLL 1HNFA 2L7UA 2FZ3B 1F11A 2NY0C 2DB8A 1ZANL 5DVKA 1G0DA 3IETB 4R4BB 4YWGL 3BVNA 4XNMA 5JDSA 2N56A 4GRMA 2IQ9H 4K7PH 2E6PA 4H5SB 4PRNA 5KS9F 1U3HD 2W38A 4DKFL 5D7IB 4FQIH 5H2BA 5D7JD 4W6WB 5CUSH 4Y4HD 4QTIH 4K9EL 3SE4C 1N6QH 2X2YA 3SJVE 4ELMB 5BQ7B 2QR0A 3LEYH 4UIKL 4Y1AB 5IVOA 4NFCA 3X12B 4N5ED 4OGAC 3L5XH 1KCRH 3B4NA 1KB5H 1GGIH 1S7RB 4X8JA 4HUVA 4HBQA 4OFVA 4NJ9L 4K94H 1FZMB 1A7QH 3QHZH 1LGVA 5JMRA 5HDBF 1YN6A 3I6KB 1IEBA 5BS0D 4OZIF 1BZQK 3WFDL 4UTBL 3D1MC 3DHJA 2R2HB 4XC3L 3BN9C 5F6HI 3T0ED 3V5KB 1AQKH 1CFSB 3QCUH 5D1XD 3WNMA 1GXEA 5EU6D 3OXRA 4XPFH 4YGVA 2XIDA 1IAOB 1S5IH 4JJ5A 4PJ9C 4R7NB 1MFBH 1FFRA 5I30H 1RUKL 3UYOD 1G7MA 3CLEH 1Z5LA 1GGCL 3IFPA 2NYYC 1GOGA 2ERJC 2GTZB 4YHOH 1LK3L 1CVSC 5D5ME 2I5YL 4RNRB 2DQGH 3F58H 4JY6B 1U8NA 3LCYA 1A3QA 2DBLL 1HSBB 4LPVA 5LAXA 2R56L 3SGJA 2GITB 1R3HB 1OARL 2JJSA 4LLUB 4GSDH 3L6FA 1BECA 1H8SA 1G9MC 2GFBB 4QRSA 4YHPA 5FO8B 4PJGB 4X80H 3U0PA 3MLSL 4ZQKB 1FFNA 4AEFA 1DN2A 1G7LA 3CC5B 4JQVA 3ULSB 4IS6A 4MZ3A 5MHSD 4U6TA 1JHLL 3VD5A 4JG1H 4MA7H 2VDML 3JWOH 3FB5A 1M4KA 5I15L 4NZJA 4F7TA 4TUJB 3UPRB 2ZG3A 4U7SA 3U4EA 3MV7A 3MV9A 3FOLB 4OFKA 3C5JA 3UTPD 4XCNB 4Q0XL 4U3XA 5E4IA 4NC2B 5CIPA 3QCTL 5J12B 1TIUA 5HHOD 2IAMA 4PJDB 4PLJD 3G6JE 3V0WL 4NWUL 5I1AA 2J6EL 3MACH 2EO9A 5T3XE 3INUH 1PY9A 1G7JA 4ORGB 1NLDL 4BQ9A 2OR9H 1INQB 4ODBD 4ZMAT 1JRHL 2Q8AH 5DK3A 5CJQH 2PR4L 4EUPG 5ALBH 2EC9U 4ZFOB 4YHNA 4S2SA 1I8LA 4LSPH 3VXQA 1FYTA 1Q9LA 3MLYL 3SE8H 1KJVA 3NACL 2P5WD 5F7WC 1RIUH 3C5ZB 4XNYH 3WFEH 3MFGB 4JFDB 2X4TB 4JRXE 2CKNA 5F6HJ 5T1LB 4EQ2A 3O6FD 3Q5YA 5IMMA 2YD2A 3CSYA 3PHSA 3HLAB 3RQ3A 4QRPA 4I3RH 3FQRA 4ZXBC 4HUXA 4FQ2H 4XX1G 2VDOL 1OD9A 4HKBB 3PHOA 4OZFB 3GSUB 1E4WL 2VKWA 4P4KA 4HC1H 5IB1A 1MVFA 3QO1B 1BBDH 1T80A 5INDB 3HAEB 4PGCA 3KR3H 4ERSH 2VZ3A 3VFTA 1MFEH 4PJ8A 1FE8H 1NGWB 5GJSH 3E6FB 2YMXH 2ZPKH 3O9WD 3T77B 5BRZB 1XCTA 5HVWA 3CFDB 5DEFB 3MLRH 4LARL 2DTSA 3SDCB 1N0XH 4QNPE 4QHKI 4OD3L 2NXZD 4CU8A 3TWCL 1CT8A 5IW6B 1BX2B 2V9TA 2ZUVA 5CEXB 2AW2A 3O4LB 4N1HB 2Y4SA 4OUOA 1I3VA 1XGTA 3O6KL 3QZWG 4QYOB 4KK9C 1FL5A 3D18A 4QHNA 3GNML 2DKSA 1VACB 1KLGA 1QR1B 4HWBH 1E28B 2XNAB 5T3ZL 4JAMB 4OGXL 4NQEB 3WN5A 1GZQB 1DN0A 3E2HB 3G6DH 2DBJA 2VC2L 2W0KA 3HC3L 5E6ID 1I3UA 2VDLL 1AE6L 3BDYH 3SGDH 1QD0A 1EMTL 3AVEA 4LCYB 5FGSA 7CGTA 1NCDH 5DJCA 5HY9A 4UMGA 2G9HB 3RKDD 1IGIL 3ZZ1A 2WANA 5CGTA 3WKNA 4HUNB 4U1GC 2J4WL 3EFFA 1I3RB 3BWAB 1RU9H 1MCNA 1BM3L 1LP9E 1P9MC 1WQVT 1FC1A 1B0WA 4NRZB 4XPTH 5KVEH 2WBJD 4PD4K 5HPMA 1P4IH 4PJHB 1MJ8L 3BKYL 3WV0A 4L3AA 5HVHC 3V0VB 1RFDH 4DW2L 1DEDA 3K0WA 4OCSH 5I1IL 1I8KA 3WFBH 3PHQA 2YXMA 4NUJA 4UBDD 3SQOL 4NGHH 2ZUQB 4CMHB 2Z93B 5IJKA 5EOCL 3DBXB 3MRCB 2A38A 4L3EA 4G8EB 5HHXL 1PG7L 12E8H 1AI1H 2VAAA 1TCMA 1I8IA 1IC4L 3O2WL 1EFQA 3BPLB 3QNXA 4MA3B 5TH2A 4HFUH 5KSAD 2VIRA 4NHUB 2Y07L 3O11B 2JB6A 5GSRA 1C7SA 5J1TC 1R5VA 4HWEL 1BJ1H 4HJGB 5FHBL 1TVBA 1YEIL 2D9CA 1KB9K 4CAGA 2Z92B 1A1MB 3MYJB 1WAAE 3Q6GL 4LAJH 5IHUH 4LQ1A 1DP0A 3SCMA 2XWTB 5E94A 2FJFB 4RGMB 3DVGA 1F3RB 4YXHL 4U1SA 3LQAC 4QHKJ 3GKZA 4DEPC 3WIIL 2W1NA 4HKXA 1F4YL 3MXVH 5IJVA 1X5KA 3MX0A 4NC1E 1MSPA 1IQDB 3MRLB 4N1CA 4X6DA 4WV1A 4MWFB 4HIEA 4OUUB 3E3QE 2VWEE 1A3LH 3P11H 4K23H 2KZ1B 2YPVL 5T1DL 1MH5A 4YFLF 3QWQB 5JIKA 5C0CE 5L6YH 2IBBA 1QNZH 3OR6A 1UQSB 4NN6C 4M1CC 2NY4B 5I1EL 2XYCA 2V7HA 4Z95L 4P48A 3BRDA 1U8LA 5HHNB 2DQJL 3BP6A 2WIMA 5DD1L 5EBLA 1OB1A 3KLAB 4M3KB 4YK4C 5CILL 3PNWA 1FRGL 4CU7A 4J2XA 1FDLH 3LRSB 2VISB 2QADC 4MXVF 2FD6H 4W81A 5EFIA 1RURL 3OKLB 4N0CC 1LO3L 4GW4B 4BZ2L 4MQ7B 3O0RL 1QFWI 3D39B 4RIRB 3WO4C 3CVIL 1KPVA 4XXDB 1MEXL 4S1DC 1DBJL 4FQQB 3WFCH 1BLNB 1S7VA 1CFVL 2PXYD 4KUZL 3F7RA 3JVGA 4GAJL 2APWA 1T1WA 3IF1A 3HR5A 3BJLA 3UP1A 3HC0B 2R15A 2FL5B 3RTQD 1CGWA 2B39A 4LLYB 3L3JA 4X6CF 4U1JB 1JNHA 4K3EL 5F96L 4OZHF 5HHME 2P5EA 5BO1H 4P59H 3P4OB 4HX1B 4P5MA 1EJOL 5D2LA 5GRUL 3T65A 3UDWA 3SO3C 4BA8A 1CXEA 1UZ6F 3QIBC 2CK2A 4OGYH 3GB7A 4RA0C 2Q7YB 1ZLVK 2R2EA 1RIHH 4Q9RH 4M48H 5C1MB 2RIKA 3CMGA 1VEOA 3BX7C 4HAFA 3RZCC 1CU4L 3MRGA 5IMLB 1EZVX 5CCKH 2JK5B 1U3HA 4KTDL 4QOKD 4R96A 4H1LG 5I1JH 2VXVH 4FNLL 3KPSE 5D7JA 3OKYA 1XGRA 4R4NC 4Y4HA 2JJTA 3PQYD 4M62L 4UT7H 4PJCB 3TO4D 5IF0B 4GAGH 1AGEB 4GKZA 4MX7A 2XZAH 4PY7A 3MUGB 3S4SA 2OSLA 4UB0H 2PYEE 4TNVF 4LQFL 3BQUB 2W65B 2O5XH 4U1IB 3T08A 4DN3H 3PL6D 1YEEL 1EO8H 2VLJE 5DUBA 4JZNA 4L8BA 1KULA 5EWIL 3GIVA 5KS9B 1UKTA 3BH8A 3SDXA 1YDPB 1DBBL 1TPXB 5BS0A 3PP3H 2ARWA 3NAAH 4HCRL 3D0LB 5EUOE 4LLMB 5HYQA 4UQ2B 5C09B 4ZUWB 3T0EA 4IOIA 4HIXH 4HGWB 3NFPA 5D1XA 1QVOB 2IAND 1G6RL 4NO0D 1A9BA 5EU6A 4IDJH 3MO1A 4Y2DC 4PJFB 1NGZB 4IDLA 5D2NC 5FYLL 1DDHB 2UZIL 1QFHA 3K3QA 1UB6A 1ZK9A 3EO0B 2F8XC 1E27B 3S3PA 1OWWA 1V8HA 4ZFGH 1JTTA 4NZRL 2F74A 3CPLB 1DQLH 1C5CH 4O5LH 4BSWA 5DFWH 5ETUB 2EH8L 1KF9B 5GS1B 1KCLA 3PJSB 4OZIB 3UC0H 1MRFH 5EIIA 2X9YA 1Z6JT 2IPKA 4HK0A 5SV4A 3EYSH 1FVEB 1YC8A 1U93B 5E8OA 3NABL 4IIQA 4C55A 1PG7W 2WBWB 1QLRA 2AQ3A 1N64L 4HW6A 5EA0L 4CNIA 2YRZA 1IGTB 2YWZA 3AXLA 1AC0A 3RNKA 3PWLA 1KN4L 4R2GC 2E7CA 3TZVC 3V4UL 1QSEE 5GZOC 3BD5A 2PO6B 2D7TL 1UEYA 3X11B 3UYPA 4AH2A 4QF1B 2A9NL 4IBLT 2VZOA 2PYFB 4BKLB 4S0TD 4N0YL 2DQCH 3RVXC 3V7AE 2AEQH 3QHFH 2FBJH 4GRLD 5HHOA 3RWDA 4HIIA 1MJ7H 1TTUA 3MCKA 2ZG2A 2FX9L 2MFNA 1CL7H 1MAKA 2A1WL 2P8LB 4X4ZA 4OLXL 4G6FB 4LFHD 4M61B 3TJEH 1NSNH 4WFED 4R7DB 2F54E 4MNGE 1DQDL 2XKUA 1AY1L 5M7QA 5DRXB 3QDGB 3HZYA 3KPRD 4CN4A 3V6FB 3R4DA 1BQHB 3OKEA 4G3YL 1NCCH 4NNXB 1NGQL 1HYSD 2CRYA 4PJXA 4BH8B 1UVQB 3RVWD 4QLRA 3R0MA 4PP2B 3C08H 1MRCL 1N59B 2P5WA 3QWOA 3ARXA 43C9B 5FECB 3UROR 5T3ZD 3L5WB 2EXYD 2HFGL 2M2DA 3FN0H 3O6FA 2VITB 4HIHA 5ICXB 1AHWB 3QT2A 2XY2A 2AJYH 4FFVC 1G0XA 1ZGLM 4P9HH 2I24N 1ED3A 5JR1L 4KHXH 2CDFB 3ARRA 1D5ZB 3HKFA 1BOGA 1VDGA 5DEGB 2VXQH 4QXUH 2Q7NA 4O51B 4JQIL 4UINH 1B3JA 4XT1C 2R0LH 1R24B 3STZB 1KJ3L 3WL9A 3I3DA 2GUOA 4PB9L 1ACYL 1KBGL 1YNLH 2CD0A 3ULVC 5ISZB 4ISVB 1UCBH 1IAIH 4TPRH 5HGBA 2P24A 2XN9D 1H8NA 2VLLB 3E6HB 3QPQC 4QHLA 4Q6YA 4ZS7L 2HMID 2KZWA 3RWJB 3BKJL 3OMZA 3T8XB 1ZT7B 4M6ML 4XNUL 3BZ4A 4TQEL 3WD5L 5EIVA 5GGUA 4X6EB 5B22A 1SYVA 3GSRA 4ZO6A 3QNZA 4NDMB 1BBJA 4XMPH 1KFAL 2X42A 4O2FA 4W68A 5GHWL 5F8QC 1XGQA 3IRZA 1NL0H 3CCHB 5E6IA 1RV6X 5E2UH 4OKVB 1T0MA 4P2YA 1JZ7A 4XP5L 3D2UD 1LEIB 4OCRH 3IJHA 1K5NB 4OZFH 1J0YA 2EIBA 1BZ7A 2FX7L 2X7LA 1BIIB 2UUDK 5DJDA 1FNGB 3QEGH 5I66A 1NCBH 4G8FB 3IDJA 3HAEH 2VZUA 3IDYC 4OZ4B 5C7XH 2GY7B 5FV2A 1JPFA 1NUNB 2DLFH 2JJSC 2WBJA 4OLVL 1DBAL 5EC2A 2ZUUA 3QO0A 1ZTXH 4MD0B 1P4LB 2GK0B 4X5LA 4XWGH 4ALAH 2VDNL 2BSSA 4JQVC 1T3FB 3RY5A 1FNAA 2PUQT 5AG9A 3GK8H 5MEQB 3QFJD 3RDTB 1CLYL 1O7VA 2ZNWA 4JDVB 1SEQH 4RGNC 4S1SL 5CZXC 4B53A 4ZPVA 4ELME 2V6HA 3IJYB 3NTCH 3KDMA 1NBVL 4LKXB 4Y1AE 5DD3L 1VEPA 1KCSH 4FXKB 3L5HA 1CFBA 3L9RA 5SX4H 2QSCH 3P30H 3UBXB 2LE9A 5KSAA 1CS6A 4WY7H 3RIAK 2HLFD 2AXHA 2OK0H 2DYPB 3VXNA 4YC2C 4X7FC 5EU3A 3I02B 5JPMB 2OS7A 1BJ8A 1HHHA 4JHWL 4L5FH 1D9KC 1XZ0A 2DD8H 1GZPB 2AK4D 3BHBB 5D7LD 3T1FA 4HWZA 4RMWA 5DHVA 4B41A 3QBTB 5HJ3B 2CIIB 3S35H 5IVXE 1BQUA 2X70A 1I8LC 4GKSA 5HI4C 2NXYD 6FABL 4LVHB 4M5YH 3S97C 3I85A 1F90L 1J05A 3NN8B 3HMXL 4FQXD 5SWSA 2DLTA 2OL3H 3S96B 4UUJA 2NY3B 4APQD 4N1EA 2C1OB 2RBLA 4ODVH 4K7FA 3OSKA 2A83B 4UTAH 2PCPB 4O2CB 2AXGB 4XZUA 2CQVA 4LGPB 1IEHA 2Y23A 1KNOB 5JPNB 1RMFH 1BF8A 2V5SA 1WISA 2R1WA 1A14L 1SJEB 2IG2H 1IKNA 2X4NA 2UWEA 5GGVH 1B88A 1JGLH 5ENWA 4PBVC 1JF1B 3R06A 2VLKE 2C9AA 3O3EA 1NCTA 1YJDC 2DL2A 5SWZD 3FRPA 2Q3ZA 4LHUB 4PJ8C 2HT4C 5BW7C 4JEGB 4YWGH 4YHML 2AQ2A 2HJLA 3BW9A 1KV3A 3S36X 4XVSH 4ZSOB 1BF2A 2W0LA 5FDWB 1CDBA 2ZUXA 4NQXA 1YY8A 3FCTB 1I1AD 4MLSA 5HHVL 3VRIB 4RRPA 1G7HA 3IFOA 3GMQA 3MRBB 1CK0H 4K9EH 3C60D 3ZTNL 4BSVA 3PWUA 4PR5B 3VXUB 5ICZB 3BE1L 3ARGB 3D9AH 4UIKH 2PXYA 5GGSB 4URTB 1T6VN 1MCEA 5EIQA 1RZIB 1L7TH 1RVFL 2BERA 3ALPA 3RTQA 3GDBA 1BQSA 4JFFD 1DUYB 4NJ9H 2XPGB 1RUQL 1N6VA 1ZEAL 2D3VA 3FFCA 4Y5YA 3WFDH 3ZKXC 4UTBH 4XC3H 1ZHBB 4DVRL 4PLNC 3K8LA 5FYLD 1RZ7L 3OKNA 4G42B 1WUNT 4V1DD 2UUDH 5D7KD 2HWZH 3NPSC 3THML 2GCYB 3VD3A 2QQNH 2ADFL 4QOKA 1RUKH 1RZGB 5EO1B 4C83B 2C7UB 1GGCH 1MPAH 2X41A 2YK1L 4S1QL 5DYOA 3PQYA 1RJLA 1X5YA 1LK3H 2UV3A 3TO4A 3UEZA 3VGAC 2I5YH 4X9GA 1EERB 5HI3C 4E0RA 2FRGP 1VESA 3ARBB 2DBLH 35C8L 1FFPB 2GW5A 3ECBB 2ZUSA 3DMMB 4HT1L 3TFKD 5EUKA 3M8OL 3PL6A 4L8CB 5BRZE 3HI5H 2H45A 4RCAA 5IJKC 1DLHA 4KVCH 1OAUL 3FONA 1CQKA 2XWJA 1N7ML 4YHIA 4U05A 3X3GH 3MLSH 1NAML 4YFDB 3T09A 5E08L 3FFDB 3R0NA 2LVEA 1JHLH 4OV5A 1HXYA 2BHYA 1GGUA 2VDMH 4QRRD 4Q9QL 3RWHB 1P7KA 3O4LE 3LQZA 4OI9A 5DMKA 3IT8D 2E5EA 3NPZB 2IANA 4NO0A 4ODHL 4L1DA 4R8WL 2XFXB 3SCMC 4OFPA 3F7VB 2BOCB 3DXAD 4UOJA 4NQEE 5H35A 3UTTD 1FFOA 5FYJL 3S34L 1U6AH 3V0WH 1UWEH 5B4MD 3VFRB 5J3HD 2NY7L 2UYLB 4WV1C 1MLBB 3MRHB 4LF3A 1MCKA 5FKAA 1LEKB 1A6AB 1EEZB 1NLDH 1MCJA 3U7WL 1BEYL 1RK0B 2J3SA 4JM2D 2CKBA 4HUUA 1XF2A 2X4SB 4AG4L 1H5BC 5B38B 2EE2A 4YXLL 1CGVA 3VWKC 1IAKB 1RK1B 2BMKB 4GLRH 4F80A 3RUGA 2PW1A 4QXTA 3N85H 1QPXA 1C08B 4TUKH 3MLYH 2DQUH 4RMVA 4HUWA 3NACH 3SKUD 5DSCB 1HHJA 4K7PY 5HGAB 1HZHH 4Z7WF 3P77A 2DLIA 2V7NA 1AXSB 4JKWA 4ZNEE 4QCIA 5GGRY 1ZV5A 2MQ0A 4I5BB 1XH3B 4M1GL 5E6ZA 5I8EB 3ZYOA 5ACLA 1T89A 3OGCA 3MOQA 2VDOH 5IT2H 4BUGA 4WTWA 3CVHB 3LHPL 5F88A 5IW1B 3HE7B 4G7YL 3EKCA 4ZFFB 4GRLA 1BD2A 3VFPB 1F6AB 5KW9L 1UWXH 4LLVA 1V3LA 2FJGA 2OI9C 3K2UL 5HYEA 2VXSL 5K9KA 1NC2D 5JUEL 1IKFH 5DJ2A 1TJGH 3KPRA 3JVGC 3KS0H 3ZKMC 4PBXA 4LARH 1NC4D 2JCCB 5IVZB 5FYKL 1XGPA 4ZPTA 4QHUA 4YH6A 5J13C 2ATKB 2MJWA 3CFBA 4E5XA 5D72H 1EAJA 3KYOB 2HJKB 2X4UB 1ADQA 2FEDC 3O6KH 4OIIL 3TM6A 3UDWC 2R69L 4BQ8A 3AB0B 4RMRA 4JLRA 5ICYA 3RY6A 43CAA 2LV4A 3RWFB 4Q7DA 5HYSA 1FZKB 4GKOA 2DL9A 3HC3H 2F58L 1QRKA 4JHAH 2VDLH 3QUMA 4Q6IC 5C0AD 1FNLA 1U3HC 5L0QB 3MNVA 3GMNA 4LLAA 3FZUD 1PYWA 4N8CH 5D7JC 4LEOB 4Y4HC 2JJTC 3H7BA 5TDNA 2J4WH 1T0NA 1UWGL 1HKFA 4XNXL 5EO9A 3WKML 1GHFL 4MDIA 1DCLA 1IL1B 2VH5L 5DTFA 3I75A 4AZ8A 2OJZH 4K07A 5HHPB 1GAFH 1HHIA 4JO3L 4N5EC 2XN9A 2R0WH 3V8OA 1I7UB 4GO6B 4RFEB 1MJ8H 1QFWL 3VXSD 4ZUSA 1MREH 2GJ6B 3QDJD 5IEKA 5I71B 4N8VG 4DW2H 3MBEB 3DJ9A 4MAYC 1UB5B 1EAPB 5KVGH 4L8SA 1G7QA 3SQOH 3GSOB 3SDYL 3QAZC 1KLUB 1OAZH 2WBKA 3IJSA 1RZFL 5D1XC 5EOCH 1ZLUK 5HHXH 3C6SB 1OSPL 3GSQA 5DURB 1OGAD 5TPWH 3WS3A 1IC4H 3O2WH 4OCYH 3SDAD 2R4SL 2Y07H 4AL8H 5L7XL 1TFHA 3AS0A 2W59A 4XP6L 5E9DD 3FRUA 3S36L 4NQCD 5L2KD 5FHBH 3D2UA 4AEIH 1CTOA 3FQNB 4UAOB 3TESA 1QSFB 3NCEB 3HNTL 1MQKH 3RL2A 2W0PA 4L9LA 1NCUA 2XKNB 3ILPB 4AJ0A 1NPUA 4KUCF 5E8PA 3L3GB 3B9KB 2OZ4L 1YMME 3S3SA 1NMAL 3G5VA 1TQBC 1TENA 1BVKB 1IAIM 4S11A 3WSQL 1HK6A 5I8CB 3VDBA 4MB4A 2B2XL 3OPZL 1F4YH 4N9GA 5E00A 2NY6D 3O6LH 3QUZB 4IIQC 5E2VL 5TE7L 4MS8C 5DJ6B 5C71A 5J4MA 2IQAA 4NHCH 4NPYB 2VLRB 5LBSH 2ESVB 4MYWB 4Y16D 5F7NC 1HEZB 3MOAH 4PJCE 3V52H 5T1DH 1FNEB 4CVXB 4M93B 1OQOA 3QFJA 3L7FB 4DVBB 1T66D 4PV9A 5ID0A 4U0QB 5E6YA 4RQQB 5I1EH 2ZUYA 3OKMA 4PRPB 2I07B 3K4AA 1E4XL 1LE9B 4P46D 4K3DL 4MCYA 4PLJC 3MRNB 3L3DB 1UH2A 2DQJH 5B3NA 5I75B 2FR4A 5KS9E 4MB5A 3U83A 3MXWL 3T0AA 3MGTB 3GBLA 4YAQB 1CLZL 3OKDB 4KJYB 4U0RB 2AK4A 5CILH 5C09E 1CDIA 5D7LA 5TE6H 1QEWA 3BD4A 5J1AB 4FMFA 1DJSA 3BP4A 2CIKA 1T21A 2M8XA 2JLLA 2EC9T 1EVUA 1WCQA 5E2TH 5KANI 3KPOB 2J8UE 3KPTA 1MIMH 3CVIH 4NZDA 1MEXH 5GGQL 1DBJH 4F7MB 3DOSA 1FZJA 1M05A 4KUZH 4FQXA 1CFVH 3NVQA 1X5LA 3O6FC 3LN4A 2XZQL 4LNRA 4APQA 1SEBB 3IXTA 4YDIH 5HDBE 5GRYA 4JO4H 1ZT1A 3RHWF 3U7YL 4OZIE 1JWSB 1W72L 3DO3A 3QXWA 5IB4B 3H9YA 3X14A 3NFNA 4LCUA 5DQJB 4K3EH 1LO4H 3IU3A 1GC1L 1UADC 2YPKB 4TTDC 4Z8FL 1EGJL 1GIGH 1S7WB 3OHXB 5F9WB 4PJAE 3WIFB 3KPNA 3MCLL 4U6HB 1Q9WB 1XEDA 4MJ6A 1GSMA 1T22B 4KTDH 3L3KA 2ADJB 4Z7UF 4FNLH 1IT9L 2ED7A 4K3JH 4Q9BA 5IFHL 2V2TB 5EU4A 1I1AA 3QFDA 4NKIL 5C8JB 5F1SA 2QQLL 3H0TB 2Y06H 4FRWA 2QKIB 5BZWB 2VDPH 3BKMH 3C60A 3EHBD 5KANG 1V7NL 4IRSB 5B39G 4M6OL 4I1NB 3F6LA 5JW5A 3BO8A 1IM3B 4KRNA 5F97E 1HXMB 2F53B 2GJJA 3QDGE 4NO2A 3C5SA 1P5VA 1A6ZB 4JN2B 2XTLA 3T1WA 2BNQD 2RFXA 4NJAL 3PWJB 5EWIH 4JFFA 1WBYA 2HLAB 5E6IC 4YPJA 3TH2T 4EN3D 1JYVA 2HRPH 4HCRH 3ULUL 2N7AA 2BNRB 3AU1A 3RKDC 3C87A 3QUKA 2PW2B 3WXWL 3D69B 3F8UB 4GW1A 1U8KB 3UTSE 3T2NL 4HH9A 4V1DA 4HHAA 3LN5B 1AQDA 2YN3A 5HDQL 2EDFA 3DUUA 3OX8A 2WBJC 4PRID 1OOAA 1MCOH 1VFOA 2O5YL 2EE9A 4NZRH 2YSSA 2EH8H 4JO2H 3FB8B 5KOVC 1F45A 2EXWD 3OAZK 3U36A 1JWMA 1UM6L 5TJWK 1CG9A 3QG6B 4IOSD 3NABH 2EDEA 1MCCA 3ZTJH 5ISZE 2C3VA 1ORSA 5GRXG 1N64H 1A7NL 4DAGL 5C0FA 1QLEL 3P73A 3TLRA 2A6DA 3EO1A 3KJ4B 5KSAC 5E8DL 4ONFL 2FLBT 4YDJB 1WCBB 4ZTPL 4JJHA 4QRRA 2D7TH 2XACC 3ARTA 1FSKB 3C5ZD 5CEZL 4PJ7A 3BIAX 4JFDD 3IFNL 2A9NH 1JGEB 2PKDA 4WUKL 1J7VR 4N0YH 3HPLB 4NZTL 3DXAA 3UTTA 2BP3A 4QT5B 4P3WA 4AK1A 4JPKH 4LK4A 5KSBB 4MJ4A 4OJFL 4UT9L 5ID1B 4OLXH 4N5UA 5KSVB 3OZ9L 1AY1H 3OG4B 5FYKD 4JM2A 4G9FB 2ZZUT 4LAQL 4WGVB 3Q3GB 3V6BR 4H26A 3VGGA 1NGQH 3IB4A 3HI6H 5DD5L 2KQNA 4LLQB 5KVDH 4QY8A 3TT3L 1ZE3C 4FG6D 4NKDA 2Z9TA 1B0RB 4KQ4L 2C26A 1IKNC 1HDMB 1MCWW 2BVQB 3P9WB 3LEVL 3FT3B 4X0KB 3ZL4L 4Z5RA 2ARJQ 2BVUA 5CJ8A 5J1SC 2AV1B 1TZHB 3SKJL 1YN7B 5AD0A 2YBRB 3MREA 4ZO8A 2EIZB 5K9JL 3PGDA 1BFSA 1L0XA 4MJIB 4YDLB 1LILA 2R8SH 5SWZE 3K4DA 5FB8A 4G9DA 2DQDH 4Z7WB 3KYNB 4PB9H 5DK2B 3EYOA 4HS6B 1NC2A 3LKNB 3A67L 3KXFE 2PXYC 3NCBB 4RISH 5KBNC 4U31A 4OIBA 1F97A 4NUGH 2C4FU 3PWVA 3TV3H 1IE5A 1NC4A 5GIRB 2ZWLT 1U2CA 1RJZA 1JPTL 3TBVB 2FECL 2GT9B 5CEYA 4TSBL 3CFJA 3O3AB 1QA9A 1AD9A 2WIIA 3T3MF 4F2MA 1CFNA 1U91A 5EN2A 5CBEB 2OCFD 3BKJH 1C5DB 4Y5YC 1KIQB 4M6MH 3VU2A 1GPOH 4TQEH 2NY2B 4NC0B 3V6OA 2Z31C 3KWWA 4NZUH 1UA6H 1E4KC 5JO5A 1K4CB 1QFOA 1NGYB 4MNHA 5D7SL 4FXLA 2E9WA 4KJPD 4PP1D 4I0CC 4DGYL 3C09C 5F3HA 5MI0B 4WEUD 1JPSL 5C0AA 4DGIH 3FO1B 4L4VB 1CICB 2QTEA 1WJ3A 1CGUA 2FATH 2GY5A 1RZ8B 3BUYA 3CVHH 2HFFB 2Q8BL 3CGTA 4HK3N 5DRWA 4IMLB 1NKOA 4BUHA 5I1DA 5DQ9B 2X1XR 4PJIE 3O6ML 3BYYA 3OAZH 1ONQB 3O3DA 4OLVH 3CFIC 2WLZA 5GRVL 4PREA 4LLDA 4KRLB 1GJIA 4HBCL 1MQ8A 4B5EA 2PF6A 3VXSA 1WLHA 3QDJA 1TQCC 4TUOA 2VDNH 1X5FA 3H9SE 4FN0A 5J8OA 3R1GL 1J11A 4WFHE 5MEOB 1S9XA 4CJ0A 1NUFA 1BAFL 3VXUE 1RUPH 1OTSD 4IJ3B 3RNQA 4DCQB 5EU7C 1KG0A 5GGTL 1OGAA 1A1NB 5I17B 5K33A 3RIFF 1T5WA 4M7LT 4EKXA 3SDAA 3O41B 1M1SA 1DQML 4D0BA 5AYUL 2BVPA 1OP3H 4KRMB 4RGOH 5E9DA 4GQPH 3EGSA 4J8RB 5L2KA 5IWLA 2NY4D 1KTLB 4MXVE 3I9GL 2DIBA 4M6NL 1F58L 1Z3GH 3QA3A 3UZQA 3JTSB 3RFZC 2AJXH 2A6IB 3V95A 1G9ML 2CLVA 2Z8VC 4KH2A 3RZWA 3X13B 2P8PA 4XVUC 5JORA 3HN3A 4MXQD 3STLB 2HG5A 3WIHL 1CXHA 3ZDYF 4G6KH 3VXMB 1WTGT 4P57B 3HMXA 3WLBA 5HVFB 1U8HA 1ZMYA 1F90H 4EUPH 2JJWA 4KXZH 4MXWL 3MRDA 4Y16A 3BAEL 4X6CE 3DX6A 5CSZA 2E9JA 5CBAA 3WFHA 4OZHE 5BXFA 3D39D 5KVFL 1T89C 3K8KA 1UZ6E 2A9MH 2VL5B 1OLZA 5E7BA 2Y5TB 1A14H 3ILQD 2DRUA 2JE8A 3IKCA 4MGXA 5K93A 3WDJA 4P46A 4JRYB 3ZSTA 4GRLC 3LIZH 4NQSB 1OPGL 1C7TA 2DQIH 5DA4A 1UH4A 3BPNB 4LMQI 1N5YH 4ESKA 5DVMA 5CKGA 5CHNA 4Z7VF 1NGPH 4I48B 4S0SD 3QI9B 3GSNL 3QULB 2FZ3A 5EO0B 2D9QB 2I9LA 4F15C 2RGSA 1AR1D 4LSDA 4L3CA 4TSAL 3IETA 1HYSC 5CP3A 4R3SB 4R4BA 3F7QA 3UX9B 1NLBH 4HFWB 4H5SA 5F7EL 4WJ5A 1EA9C 4S1RL 5D7IA 2EXYC 3K46A 2NY1B 3F7PC 2CDEB 3L3OB 3FAWA 4KHTL 3QZWA 3RY6C 4PRHB 2VDKL 4XNZC 4LU5L 5L9DH 3S5LG 3BQUD 5BQ7A 3B2VH 3ULUD 2VQUA 3C8KA 3BP5B 3W11D 3E8UL 3X12A 1CZ8L 4OF3A 4R26H 4NN5B 3IDUA 4MA1C 1CLCA 1T7ZA 3MOBH 1RZ7H 1C8PA 5C0BE 2ZCKL 3UTZA 3V79C 2QQQA 4U7KA 3T2OA 4Z0BL 1CXIA 3I6KA 1SMOA 4LSVL 2ADFH 3D0VB 1F4XL 5DHYB 3MJ6A 6CGTA 4M1DL 3V5KA 2D2OA 3W0WB 5EPMB 5ESAB 2J2ZA 4D0DB 3IS1X 3S8WA 5C0JA 1IC5L 3DX9B 1S3KH 2NR6C 4ODSL 1MFAH 1DQQB 2HMIC 4QXGH 1SBBA 1W0WB 35C8H 1A6TB 4L8SC 3VDAA 4F57L 1YNKL 3M8OH 3MMEB 2XWBA 1ES0B 1AXTL 5LQBL 1R3LB 3AS2A 4JCMA 1N7MH 2MPAL 3D3VD 1NMCB 1NAMH 5I9QB 3ROLA 4G6AD 2NX5E 1HSBA 3KNBB 3KPPB 4BELD 2GITA 5GS2H 2YR3A 5CEZD 4Q9QH 4MSWA 3GMRB 1AO7B 1TZIB 3VFSA 5DF0A 3DIFB 4PJGA 5FV1L 4ODHH 1NDMB 1ETZB 1EFXB 4L9LC 4F33B 2B1AL 3CC5A 2YKLH 3TN0B 1R3JA 1H3PH 2Q6WA 4AQ1B 1F3DJ 5FYJH 2PO6D 3ALWA 4D94A 3QYCA 4KROB 3VGEA 4PRIA 4F37F 1AIFB 3UPRA 3EDEA 5TF1L 1Q1JL 2UVFA 2BNUB 2IGFL 4NQCE 4RSVA 3FOLA 3RP1A 3B43A 4DN4H 2NY0B 2YPLB 3LRHA 4AG4H 5GGVY 4PJDA 4BQCA 5E4EC 2CGRL 1Q0YL 1GGBH 1MI5B 2VUYA 5ANME 4HZLB 2VR9A 1FBIH 5DI8B 4K7PX 1FH5H 5E5UB 1FC2D 2XTJE 4JO1L 5ACZB 3AC0A 1ORQB 1XF3A 4YO0A 4F7PA 4ZUTB 1ZVSB 4ZFOA 3JTTB 2X10A 5F8RC 3CDYA 1WFOA 2BSED 4GG8B 1UG9A 1W0YT 3MR9B 4P2RD 8FABB 2W0FB 3V5HB 3C5ZA 5IM7B 4JFDA 1JUFA 2YD5A 1A22B 3GMMA 3LHPH 2FLRT 2X4PB 4G7YH 5DZOA 5I16A 1MRDL 3HLAA 4HV8B 1YQVL 3LKPB 4JN1H 4JY5L 1TCRB 3RL1B 1XCQB 1MHCB 5E5MB 1U3YA 1UH3A 3K2UH 4LRNH 5E03A 5JHDB 1QFUH 2VXSH 1CI5A 1WWCA 2GSGB 5JUEH 1NAKL 4FQXC 2EDKA 4XBGA 5D1QB 2DQFA 4APQC 2L0DA 1MHPH 5FA3A 1QSFE 3BD3A 3HAEA 1DVFB 1K3IA 2AABL 1CCZA 1NGWA 1VKXB 3CFCH 3E6FA 3T77A 1J5OL 1SM3L 1A6WH 3FO2A 1Z9SA 4OD2B 2FCBA 1U2HA 4NBXB 3MV8D 1MAJA 4AEHH 5DEFA 3MRRB 4OIIH 2BC4A 4XVJL 2ERJB 2X40A 4NWTL 2ARJB 3DGGB 1RIVL 4JB9L 1AKJD 3MGOB 4NIKB 2UZYB 5CEXA 2F58H 4N0FB 5IK3B 4JPIB 4I3SL 4QYOA 4RA3A 1VACA 2E27H 5JA8B 1QR1A 3GIZH 2XNAA 4PRPE 1I1AC 4JAMA 2RCSH 4H1LA 4QKXB 4KDVA 3I2CL 4X98A 1UWGH 4LP4A 2AEPH 4XMKH 4P5TB 3VWJB 1GHFH 2R1XB 1UM5L 3N9GH 3PGFL 4XMLL 3E3QC 2VH5H 3ARFD 4PJ5B 2X89D 4Z7NF 1EHXA 1EPFA 2G9HA 3ARVA 3BN9D 2VXUH 3SE9L 3CJJA 4B7IA 5GXBB 1W0VB 3BWAA 4J3SA 3LKSB 4FTVB 5LGKA 5FKPB 3QCVH 4ODXB 5IG7A 2DJSA 1RPQA 1OP5K 1AXIB 4FQHB 1PZ5B 3ZT5A 4GXVL 3SDYH 4PJHA 5A2KH 2YZ1A 1RZFH 1SJHB 3ORJA 1OSPH 2FYYB 1MIEH 4CVZA 3MJ9L 1DLFH 5I1CL 1KEML 2BNQE 1QR4A 2R4SH 5E0QA 5L7XH 4XP6H 2VN7A 2J12B 3S36H 5CP7A 3DBXA 3MRCA 4R6UA 4LSQL 5GZND 5E7FA 2XRAH 1EX0A 1P7QB 4X5WA 4MMXC 3V4PH 4JFED 3HNTH 1JTPA 3MA9H 3ULVF 3F5WB 1U92B 3EDJA 4NHUA 3O11A 1I4FB 5T33L 4UOW1 5FYJE 2OZ4H 2V2XB 4OLWL 5C07E 3D25A 2WUBH 3O81A 1J1PH 3VFVB 4NKMB 3WSQH 5LWYH 4M8QB 3TFKC 1A1MA 4Y7MA 2MCPL 3MYJA 1BFOA 1OAKL 1CDHA 1OW0A 3L1OL 4HPYL 5E2VH 1A4JA 4I4WB 3VXTA 2YRLA 1O0VA 3NIDF 2FJFA 4PRAB 2OJEB 4U2ZA 1KXTB 4KMTL 2V2WB 3ARWA 4X7SL 1SYSB 1R3KB 5MEPB 4GG6A 4P3CL 5IIEA 1IQDA 4IHOB 2ITDA 4MWFA 4OUUA 2BJML 5BJTB 4IRJC 1LEGB 3RJQB 1TTGA 2NY3D 3GGWA 2F53E 1FL6B 3HNVL 4PJBB 1JPGA 1E4XH 2CXKA 1AP2B 4P2OC 3VRLE 2ILLA 2Z4QB 5HDLA 1UQSA 3AY4A 5J3HC 3ARSA 1S5HB 1E6JL 3QIUB 3CX2A 1CLZH 2H9GB 4NM8L 3HZVB 3BDBA 3EO9L 1U8QB 3WS6A 5IV2B 4WHCA 1FNHA 4JM2C 5LGJB 2CDGA 4F7EB 4R97C 4UZGA 5HHNA 2C3HA 4JGUA 4OT1L 1TMCB 3KLAA 2X4QB 2OR7A 1DANU 2IALA 3GBNH 4FP8L 4D8PB 4DUVA 3RHWK 1FN4B 1DUZB 3LRSA 4I18A 3BISA 4TTGA 1NANI 3MLTB 1QBLH 1OHQA 1JHTB 4HD9A 4N0UE 4ZG1A 2XZQH 3OKLA 1WAAF 3OB0K 4XH2B 4G43A 4GW4A 2YD3A 2AJ3B 3U7YH 3QJHB 3D39A 4RIRA 3U2SA 3QXUA 4RWYH 1W72H 2CMRL 3U6RA 4OTXH 4CVWA 5JLZB 2DM7A 3ARGD 1OAYH 4FQQA 4TRPL 1BLNA 4EDXA 5F3BA 4Z77B 1GC1H 5BV7C 4O00A 1SY6L 1U95B 3EYVA 4WW2A 5I1GH 5FA4A 5IKCA 4Z8FH 3BFOA 2IJ0C 4MDJB 3HC0A 2FL5A 4NT6B 3VW3L 5IBLC 4E42A 4LLYA 4R4FH 3S9DB 2GTWB 4A6YA 3P4OA 3QQ4A 4HX1A 2NY5L 4DOHB 2X1PA 3PWPB 4NBZB 5ECJE 1JGDA 3O8XB 4QRQA 4HXBL 3ZO0A 4R0LB 1A21A 2ITCB 2I9TB 4FABH 3GJEB 2X4RB 5FF6B 1U8PB 1P53A 2VB5A 5IMLA 3UZVB 1XIWD 2JK5A 1H3VA 3TBYB 3V6OC 1CQYA 1AJ7H 3VFWB 1DBML 3DSNA 1J12A 1AGEA 2VAJA 2EDXA 4XPBL 4G9FE 3ARBD 4XTRC 5FUCE 2X4OA 4DEPB 3QRFM 3BQUA 4U1IA 4GS7B 1IGML 3ULVL 1AGDA 3C9NA 3FZUC 5C9JB 3TGXA 3HS0A 4ZFZB 1TJIL 1FGVL 4LNVA 1VFBB 3N0PB 5LGHL 3T2NH 4CUCA 5C9KA 5IW3A 1ULVA 4HMCA 4KK8D 3MBXL 1BFVL 1P2CB 3LY6A 2AV7B 3NGBC 4LLMA 4UQ2A 3JSSA 4Y8AA 4UT6L 4RAHA 2ZCLH 2AEWA 2FB4L 3MLVH 1JMXA 1DSFL 5JZ7D 4PJFA 1NBYB 1DDHA 1OTTD 5KOMC 4MJIE 3VG9B 3BMVA 3D87B 32C2B 3MV11 4RBPH 4FXGA 5J9PB 3BT2H 5D70L 1E27A 5GRVK 3NZHH 1G7PB 4YK4B 1I9JL 4Z7WE 5JNYB 4MNQD 3RAJL 3CPLA 4OF7A 3G08B 5CJ5A 4KKCC 1A7NH 1AGFB 2IPTL 4JGJA 4GBXC 3PJSA 3DO7B 3D3VA 1QLEH 1HH9A 1YC7A 3H3PL 1SVCP 1INDL 4ONFH 4H20H 3VRJB 1FVEA 3CXDH 5IHBA 3WO4B 3CMOL 4U6YB 1LO2L 5IWLC 1EO5A 1IC7L 5FOBB 1HHKB 1KYOJ 3IFNH 4H0HB 1IGTA 5FGBA 2QSVA 1BVLA 4WFGE 1LE5B 4WUKH 4D9LH 3TBWA 3FHAA 1CR9H 3LAFA 1JZ6A 3RVVD 1SHMA 2PO6A 3HPJB 1FO0B 3OKOB 4OJFH 2VOTA 2NY6C 4UT9H 2W60B 2AK1H 3U46A 3GSXB 4WVRA 2PYFA 5MENE 3UO1L 2NPLX 5D1ZB 1FG2A 2FH6A 3VXRD 4ZOEA 4LAQH 3BIBX 3V2AR 3SJVB 1BQLH 2P8LA 3WJJA 5EBWB 1T66C 1J8HD 4WUUD 3RZCB 3TT3H 1KC5L 3HTLX 5DRXA 2VLME 4KQ4H 3P9MB 4Z78B 3V6FA 2QADD 3LEVH 1A02N 4P46C 2NTFB 1LDSA 2FIKA 4N0CD 1J88A 5GRZA 4D9QE 4P2RA 4PP2A 4ZOCA 1OCWL 4S1DD 4C57C 2YD4A 3B5GA 1UYWL 3L5WA 4Y0GA 3JWDC 1AHWA 1I3GH 3BXNA 3U9PL 4NRXA 5F9JB 4WEBH 5FK9A 2CDFA 4M3JA 1K4DB 4EI5B 1N8ZA 3ZDXF 1D5ZA 1KCKA 3MROB 4Y5XB 1RI8A 1GGTA 2DKUA 3A67H 2HVKB 3FRPG 4C56E 4O51A 5DQDH 2EKSB 5ITBL 4JFYB 5D2NB 3G5YB 1R24A 4XNQB 1IGJB 1JPTH 3STZA 1A6PA 3K1KC 4KK6D 4KGJA 1YJDL 1A5FL 3RA7H 3HE6B 2FO4B 4KWUA 4ISVA 4U6XA 3MV8A 1WTLA 2YWYA 3VXME 3WJLA 1DZBA 1ZKAA 3LOWA 4GMSH 3GO1L 1H0DA 1KCUH 1FZOB 2VLLA 2GJ6D 3E6HA 1YPZE 2EEDA 4XAWH 1AKJA 3MBED 4NNYB 2IADA 3SE4A 3L3HB 3RWCA 3RWJA 1T1YB 3T8XA 1YEJH 1FL3A 1CFQA 1KT2B 1LO0L 1JPSH 5TDOA 2X44D 2B0SH 4AM0B 4RAVA 5E1HB 4NDMA 3BJ91 4YLQT 3SGEI 5DURD 2H32A 5FFLA 1EBAA 2D7PA 1ZLSL 3O45B 4TVPH 5I18L 4KVNH 5DZNA 4YFEA 3CCHA 2OTPA 2YS4A 4RX4D 4AY0A 1ZHNB 5D96C 3F65A 4MAUH 5J6GB 1BPVA 3Q6FA 1T1ZB 4OKVA 3MRMB 2V5TA 3ARFA 3O6MH 5DK0A 4HBCH 3GM0A 4Y2DD 5CD5D 3CX5J 5F1KC 2H8PB 1A6UL 4G8FA 5D2LF 4H8WH 4OZ4A 2OQJA 4HQQL 3WHXB 4AIZA 3CK0L 4DJMA 3RIFK 3OBAA 1S9WA 5IB2B 1BAFH 1DEEB 3H9HA 3I6GB 4LCCB 1P4LA 2GK0A 2VLRD 2ESVD 5GGTH 1K2DB 5MEQA 1LMKA 3RDTA 5JQHC 1ZA6B 3QNYB 4D9RE 4K2UL 4JDVA 1CGXA 2OP4L 4PGDB 3IJYA 4U1MB 5IESL 3DYOA 2YUXA 4ENEC 4LKXA 1UKQA 1F58H 3D48R 4ORZC 2DWEA 3CDCA 4JFEA 4QRTA 1G9MH 4R90H 4WTXA 1T2JA 2EXWC 4R2GD 2EYSB 4IRZH 3WIHA 3MNZB 3K1DA 1V3MA 4U3CA 5F7UA 2R2CA 3BVNB 4XNMB 5C0DA 5JDSB 1CFTA 2ZJSL 2CUHA 4PRNB 1F5WA 5C0EA 3LV3A 3SDXF 7FABH 4XI5D 1RZKC 3FQUA 4J3UA 4MXWH 1OGTA 2CIIA 3KYMA 1OTUC 4E41D 1HKLL 4JFHE 4F58H 4OLYH 1A9EA 5KVFH 1I1YA 2IMMA 3C5ZC 3TA3D 1KB5B 3S96A 3QQ3B 3G04B 2C1OA 4FQJL 4YQXH 5FYJU 4BFEA 2A83A 4X8JB 1FCCA 5FOJA 3BGAA 4OZGE 4AEEA 3BKCH 4FQLL 2ZNXA 4WU5B 1KNOA 5JPNA 3AMLA 1YN6B 4Z7UE 3VDCA 4EOWL 4I0PD 2EH7L 1CIUA 1SJEA 1VB9A 1YECH 5EZJA 4NQDD 3GSNH 5CJOH 3OXRB 4MD5A 3IGAA 3L3IA 1L6XA 3ZKND 4FFVD 3DLQR 3QEQD 1NFIB 4FG6C 5D71L 3PV7A 2J8OA 1G7MB 2XG5A 3QXVA 5F7EH 1Z5LB 4ZSOA 1OVZA 3IFPB 5FDWA 3FCTA 3SDCC 4QGTA 3VRIA 5CFHA 4X9IA 5GS0H 4ZD3L 1WF5A 2YPLE 4EXKA 5IR1A 4RDQF 3FQXA 4LU5H 3KYKH 2AKRA 4PR5A 5FUZH 3IDYB 4IRSD 3BPCA 2ICWB 3ARGA 2P49B 1MCWM 1HQRA 2A2QT 1CZ8H 3FAXA 4QRSB 5GGSA 2BRRL 1RZIA 1A6VL 1FFNB 2WUCL 3FQTB 2CSPA 4Q9CA 1DUYA 4DGVL 4IS6B 1I9IH 2ZCKH 3UYRL 5H37H 3FB5B 5HXMA 3NA9L 4F7TB 1F02I 2BNRD 1F4XH 5FYKU 4DKAA 5EOQH 4PJXF 3U4EB 3MV7B 1ZHBA 1T7YA 5HYSG 5A40E 1B0GB 3MRIB 4G42A 5DD6B 4TVPE 5CIPB 2IAMB 4NP4L 1G7IA 3TPUB 5I1AB 1XIWA 1RZGA 4C83A 2P8MA 1U8MA 5E8NA 4F57H 1G7JB 2ZOKA 2EKJA 3BOVA 5EU5B 1AXTH 1EZVY 5ALCL 5AG8A 3NCYP 3C6LB 4KJPC 3ARBA 5IBUB 2J5LB 4PG9A 3QG7L 3RGVB 2G5BA 4YHNB 5HPOA 4CBPA 4NQVA 1D5BB 5CGYC 4JFZL 3VXQB 1Q9LB 4CMHC 5EULV 1U36A 4CADB 3U30C 3V0AC 1CBVL 2V5YA 3BPLC 4W70A 4YDKH 1FP5A 2G60H 3T4AA 1JTOA 4I77L 4EIGB 5JOFA 5JW4R 4OM1H 4QRPB 3FQRB 2Q87A 4H88H 3CXHJ 3BH9B 2Y36L 4RGND 1BVZA 1Q1JH 2XFXA 5E24E 2IGFH 3MV9D 3F7YA 3F7VA 1QBAA 5CLTA 1M7DB 4P4KB 4RGMC 5IB1B 2ZOLB 3DURA 1R5WB 1JK8A 4PGCB 4DQOL 3VFTB 3D85B 1Q0YH 3CFEB 3ABZA 4N90E 1IILE 3VFRA 2UYLA 1ZXQA 1MLBA 3MRHA 1XCTB 1QACA 2R1YB 4MNQA 4PJ5E 3WE6B 1D9KD 1RK0A 5L2JB 2BVOB 4L1HA 2X4SA 5B38A 1IAKA 1M7IA 3B8YA 1YYMH 4FTVE 1EIBA 5HHMB 3AY4C 2DQTH 3LQAH 3WUZA 4WHYG 2NY4C 3N06B 4GRWF 4M02A 5DSCA 3ZHDA 1XGTB 3CLFL 2M26A 3WS6C 1WWBX 2ICWI 3GI9L 1MRDH 3EOTL 3WN5B 3MLWL 4LSRL 5EC1B 4I5BA 2E8ZA 25C8L 4JY5H 5I8EA 1HE7A 1H15B 1NJ9A 4UDUA 3KPSB 1YMHB 3EUUA 4FFYH 4HS8H 4RFOL 3HE7A 4I18C 5HY9B 4X8XA 4ZFFA 5IGXH 1I7TB 4GKNA 4X7CC 5LCVL 3VXRA 3T3ME 3EFFB 2QBWA 1NBQA 2PYEB 1PSKL 1NCNA 4WUUA 1J8HA 1S7SB 2O26U 5FIEA 2VLJB 1MVUA 4DFIA 5HPMB 1OT2A 2JCCA 4JANB 3PWNA 4XVJH 2K3TA 3KPLA 3VGAB 3TC9A 2ATKA 4JB9H 2P48B 4M7ZC 3KYOA 1RSFA 1I8KB 2BCKB 2FEEI 1BWMA 5EUOB 2HJKA 2X4UA 4NUJB 2H6PB 1T03L 3DVNA 1LWRA 3QJFA 2FWOA 3TJHD 4L3EB 2VAAB 3OAUH 1I8IB 4G7VL 1MFCL 3M1BB 3RWFA 2VIRB 3LKRA 3I2CH 4G8GE 3PDGA 1R5VB 5C2UB 4Y19E 1YUHA 4XMLH 1FO0H 5DMIL 1JGUL 1PBYA 1F6FB 2VXTH 3QEHB 3MYZA 5ABDE 5E94B 2EDWA 2Z35A 3DVGB 1II4E 1XGUB 1OF2B 2UWEF 1IL1A 3BQUC 3ULUC 2A0LD 4M7LH 3W11C 1OD7A 2QL1A 3FN3A 1KUMA 2DLEA 4GXVH 4RFEA 3BGFB 1HHGA 2BXYA 2GJ6A 2QHRH 1ZA3B 1VSCA 4FZ8H 1QSEB 2PN5A 5ADOH 3MBEA 2ICWJ 4M7JH 1BZ9A 1MH5B 1NMBL 1UB5A 4WDIB 5I1CH 5CSGA 1KEMH 5INCB 3N1MC 5E2WL 4GAFB 1JGVH 3RU8L 4YBLB 1KLUA 2V7HB 5F9OL 1FNSL 3VI3F 3CUPB 4ZODA 4QRUB 3MLUL 1U8LB 2HFEA 3RBSA 3REVA 2I60L 1JYXA 3ZDYE 2ZUWA 4RX4A 1UEMA 4XCEA 4OLWH 2F54B 1KGCD 2ADGA 2APVA 4X83A 4OB5H 2HTLD 3FKUS 1OB1B 5FM4A 3FQNA 1QUNA 2NTSP 2MCPH 2PTTA 4MJ2A 1OAKH 3PNWB 4HPYH 3SGDI 4DOHE 3PWPE 3P2TA 2CH8A 4KDTC 3SCMD 1YYLL 1FG9C 2XKNA 3ILPA 1ZHLB 3MRPA 3UTOA 4XP4L 3A6CL 5GRWA 3QUYB 4G6AC 3L3GA 3NZ8A 4OQTH 3WYRA 1CDCA 2AJVL 2ORBL 4X7SH 4OGZA 4NFDA 5I8CA 3EJZD 4G80A 1KPVB 5I8OH 4FQCL 4JDZB 3F12A 5IEHA 2VLRA 4YEEA 2ESVA 3VFOA 4X4YA 2BRQA 2H1PL 3HNVH 1HEZA 1T1WB 1LD9B 3IF1B 3VWKD 4CVXA 4YE4L 5CS7A 3U4BH 2JB5L 4WCYH 3L7FA 4CL7A 2PO6C 4Z7VE 5JXAL 3H42L 1T7XA 3L3JB 2A77L 3RWEA 1Y6MR 3SBWA 4RQQA 2P5EB 3HUJA 4JFQB 4HUMB 1EK3A 1W2KT 2I07A 1LE9A 4JRYD 4X4MA 2HN7B 3HRPA 2R2EB 3MRNA 3L3DA 1AFVL 4O02H 3KYAA 4ZUUA 3WJJC 1QSVA 3BMWA 2XT1B 4OT1H 4YAQA 4KI5D 3MRGB 1G9NH 2MWCA 4RMQA 2AS5M 1U3HB 3QI9D 4R96B 2FX8L 4Y4HB 3W5NA 4L8DA 2V17H 5KTEH 4E41A 4NO5A 5C0RH 4GKZB 4K71C 2M1KA 3KPOA 2ID5A 5E99L 3N50A 5DRZA 4F7MA 2EDNA 4FMKA 4OM0L 3SPVA 4CKVX 3TA3A 2EDTA 4Y4KB 3DECA 2NY1D 3RPKA 3S88L 3KJ6H 1AHWC 1SY6H 2V5RA 4L8BB 3U0WL 1INEH 1N2RB 4P9MH 4YPGB 3GIVB 1JWSA 3U1SL 3BH8B 5IB4A 3TVMB 2FO1A 4AENA 4NQTA 4EI6A 5DQJA 5CLWA 4I0PA 3I3EA 2IFFH 5EZOL 3MUY1 4NQDA 2NW3A 3T0EB 1MCPL 4IOIB 3RUGF 3NFPB 5D1XB 3VH8B 2YPKA 3R8BB 1A9BB 1PG7X 5EU6B 3MO1B 4YX2L 5JA9A 4C59B 3EFDH 3QEQA 4BJLA 4JKKA 1T22A 4JPWH 2ADJA 3T3PF 3WJLC 3W0WD 1X9QA 2V2TA 1OAXL 5C8JA