1NCBH

Crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
221
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLEWMGWINTNTGEPTYGEEFKGRFAFSLETSASTANLQINNLKNEDKATFFCARGEDNFGSLSDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INFLUENZA A SUBTYPE N9 NEURAMINIDASE
publication title Crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface.
pubmed doi rcsb
molecule tags Hydrolase(o-glycosyl)
total genus 40
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1992-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncbH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncbH02
5EZIH 4AM0B 1HHIB 4U2ZA 2XQYG 1JHTA 3WN5A 4KI1A 2P48B 1X6NA 3ARGA 3T08A 4GG8B 1I9RL 4JANA 3OR7A 3S5LA 3ROOB 1QFUL 1S7SB 5J89A 1AQKL 4S1DC 4XNMB 3BP6B 3D69A 4I77L 5ALCL 4OKDA 5GXBB 4BYHA 5CJXA 3W0WE 4Q2ZB 4I13B 5IMMA 4KWUA 3UYRH 3GJFK 1U8PB 5IW1B 1P7QD 1PQZB 3SBWC 3MLSH 4RWYH 3F7PC 4X6FB 4GS7B 1NDGA 4BK4A 2X1PA 4Y2DD 1TJGL 1JWSA 5CD5C 1FL5B 1R5WA 4MNGB 3IJYA 4JPWH 1NCCL 1P7QB 4P5TB 3SKNA 9CGTA 1JF1B 2YD6A 4ODTH 2RIKA 3CXDL 3HNSH 4PGCB 1EHNA 2A77H 5JNYA 3TH2T 3P73A 1RPQA 1AGCA 1KB9K 1A47A 2VXUH 5FM8A 4X4XA 1XH3A 1FNEA 2E7HA 5EC2B 4ZYKA 2EE3A 4KKLD 4M9PA 1JZ7A 1AI1L 4LCYA 1EV2E 4U33A 3ZKXC 2FJHB 4XWGH 1ES0B 5ITBL 1LP9A 3GMRA 4R6UA 3TVMD 1IRAY 2VLMD 4Z7UA 1P1ZA 4PB0H 4FQQB 3PWJA 3C5ZD 4JB9H 4RA3A 3V0VA 5HDQL 1KTLA 5DF0A 4ZUSB 2V17L 5D96C 3HAEA 1TZGH 3HRZB 3QFJD 5HHOD 2E9IA 1IM9B 3O41A 3TVMB 4KVCL 4MQ7B 4XGZB 4H8WH 5K9OB 1D3CA 4DUXA 5IV2B 2EDTA 3CX5K 3KLDA 5T1KB 2PETA 2R4RH 3JWNC 1M7XA 1NGPH 3I3EA 4GKZB 3C5ZB 4F15B 3EDJA 3IS0X 1XGPA 5C0BE 1KJ2H 1T04B 5DRWA 4CBPA 1ZHNA 5JW4R 2Y6SC 4MQXC 5DTFB 1UGNA 4HFUH 3VWJA 3QFJB 5HHOB 1BLNB 4HKBA 5DUBB 2R1YB 4PRPE 3GMQA 3FN3A 5ID1A 2QQQA 5CJOL 4OCYH 5SX4H 4QOKD 5AYUL 1ROWA 3GMMB 3D18B 5SX4I 4P49A 3WLBB 4HIXL 4MA8H 1S7VA 3BISA 2XKSA 4MDJA 4PJFB 4PTTA 1U8NA 1YECL 3NAAL 2EC9U 1M05A 4M7LL 4X5LA 1RZKC 3Q1SH 4NCDA 5C09A 4Z7QF 4OUUB 2CUMA 3HAEG 3BGFC 4M1DL 2GAZA 1RK1A 3VE0A 5JLZA 5C6TH 3I6GA 4QOKB 1A6ZA 2ZPKH 2AQ3A 4EJ1C 2ZCHH 4MAUL 2B7DT 5E2UH 3T0VA 2VZ3A 3TH4T 3HE7D 1WFOA 3SO5A 5C70A 5JHLH 4QRTB 2HN7A 1AGBB 1CGUA 3F5WA 3F7RA 4Y2OA 4APQB 2PTVA 3BVNA 4JHWL 3MR9B 4OKVA 5GISL 3IU3A 3D85A 3HZKB 4E42B 1YMMA 3LKSA 3JWOH 5IB1A 3BQUD 3IYLW 3O4LE 4LPWA 5FFLA 1OAXH 1G0DA 1KCRH 3HE7B 3FB5A 4OQTA 2BNQB 4MHHG 3P11L 4IRJA 5EN2A 3X11A 3OBAA 1IBGL 5HGHB 3C60C 1J1XH 5T5NF 4FXKB 2ADJB 1OPGL 5MI0B 3GSXB 1JYNA 5EZJA 4LLUB 3BQUB 3SQOL 4PRBA 3QWRA 4PLJC 2CUHA 5FGBA 2BVOA 4MMZC 5J6HB 2GSIA 3EYQC 5DZNA 1FNFA 5EIVA 4L8BA 4KRPC 3V79C 2IH1A 1HHJA 1KIPB 1ND0A 4GXVH 2A2QT 4U4BA 1E4XL 5D8JL 3CLEH 4HXAL 1LP9E 5D1ZB 1QFOA 1DN2A 1JHKH 2EIEA 3QWOB 3B83A 1J05A 4XNYL 5TE7L 1IGFL 3BIKB 3LSOA 1HIML 3MRQB 2VDLH 4Y4KA 4YJZL 5IBLD 4I3RH 3O8XA 5HGDB 1R3HB 5JPNA 1CN4A 3PUCA 3I75B 1EXUA 4NQXB 4ONGL 5DUPH 4XMKH 3FQRA 2HTLD 2R0WL 4LLWB 4RMQA 2QSCL 1RHHA 2W65A 3PABB 3LN9A 3M1BB 3SDDA 1E4JA 3KJ6L 5L88L 1DQJB 1X5LA 3MRNA 3ABZA 3PWPD 3OJVC 3NZHL 2F5BH 3MRKA 4JM2D 4Q7DA 3BUYB 2XG4A 3FB7A 4KK5D 3ZDYF 4KTEL 4UT9L 1BVLB 5DYOB 3TCXA 3HMXA 5T3ZD 4KH2A 5IG7B 1UB5B 1DQMH 2VDRL 1VFBB 2KUTA 3IFNH 4UUJA 1UXWA 4O2EB 1GJIA 2WANA 3VRLE 1INQA 3PWPB 4H88H 3BIBX 3EYSL 1QRND 3KYMA 4ZNCD 3IJHA 3DARA 1L7IL 5HHVH 4PJIB 1JHLL 2I5YL 5EFIB 2VQTA 5CBAB 3VFWB 3I9GH 2HVKB 1YEFH 4IEFB 1TPXB 2WUBL 1NC2D 4RA0C 2DTMH 2DQUH 3B9VA 4LAQH 1SQ2N 4KDTA 3IDGB 4J4PA 5C09E 5IESH 4G9FD 3WJJC 2B20A 4PJBA 3BKCL 3WIIH 5E8PA 5BZDA 5JOEA 5L9DL 4OF6A 4PJEF 1PDKA 1GIGH 2JJVA 3FFCA 4XMLL 1NUFA 2YEZB 3ZT5A 1LO5A 4HIIA 4D0BB 1NC2B 5DWUL 5LGHH 5DJDA 5HYSG 2BNRA 1R6VA 2X4OB 3SGDH 1TJIL 4G9FB 4FZ8L 1YMME 1YUHB 3SGDI 3HI1A 3D2UA 3IXAB 4KAQL 2PXYA 4OCNC 1E4KA 1UJ3A 1LO3H 3MRLB 1KPVB 3QXDB 2CRMA 4XCCL 3TIEA 3DVGB 1MRFH 1LEIB 5FDWB 2O61A 1R24A 4OGAD 3OKNB 1C7TA 2X05A 5C07A 4NC0B 4N68A 5EBGA 4Y5VC 2DMKA 3Q0HA 5HYJD 3H0TB 1H3GA 5JTWA 5A2IH 1QNZL 3WLWC 1A6WL 4OCRH 4FOMA 3ARVA 5KVDL 1RULL 2EXYC 1F4XL 4NQSB 3HI5H 2CK2A 1X7QB 2EC8A 2VLLB 4M7KH 3ESUF 4O2CB 1LEKA 3UC0H 4N0FA 5TJWK 1B0WA 2DM3A 1GGTA 4LRIC 3TZVA 1TCRA 1S8DB 2I07A 1B3JA 1YNTA 4NQED 1U8KB 4HQQL 3RWGB 5B38B 4NDMA 1WWBX 4JRXD 4F3FA 3AUVA 2NY4D 1BQHB 5JQHC 5CD3A 3P0VL 1NMCC 4BH7A 2IQAA 1L6XA 5IHUH 4DEPC 2F58H 4LHJB 4CU8A 1ZTXH 5C0DA 3SDXA 3TO4C 1ZGLM 3U0TA 4OZIA 3UTZA 4LPUA 4Z78A 5K9JL 2WP3O 1KUMA 2BVEA 3QIBC 4PJHF 2Q7NA 4JRXB 2QKIA 3MBXL 2KKQA 1KJ3H 2NY4B 2YK1L 2C3VB 2V9TA 2X10A 5DJ6B 4RFNB 5FUCE 2NXZB 5BRZB 1I1FA 4OV6F 4MCYB 2BSSA 4PJ7B 3VGAC 2FO4B 2AJVL 5ESAB 4LNRA 5ALBH 3W9EA 4UNVA 3CUPB 1GOGA 3MUHL 2GUOA 4WCYH 5TQ2H 5I18H 2I9LA 4J1UA 1XIWA 1QTYT 3ULVF 4G8IA 5I74C 2EE2A 4R97C 4NN6B 5EIIB 4C4KT 4XHJC 2HTKD 3SDCC 1T21B 2DMCA 4NKDB 1N6VA 1IGIH 1P4BH 2VAAB 1WSST 3CAFA 1F02I 3VCLA 2FD6H 1U8IB 2R2HB 4NNYB 4PJBE 5ACMA 5BZWA 4NPYA 3WUWB 4UV7L 2WBKA 1JWMB 1YJDH 5F44A 5HJ3B 1XGYL 2YR3A 2V2TB 3FFCE 4F9LC 3FFDB 3RQ3A 3QPXH 2CIIA 3CFBA 3TT1L 1X44A 3B3IB 3CH1B 5T33L 4XPHL 5DJ2B 3EBAA 5EU6E 2D7OA 3IXTB 3IETA 4A6YL 4PJAF 3HNTL 1ADQL 5B4MC 5DMKB 4W6WB 4L3ED 4R0LA 4L3AA 2B1HH 4DGYH 1IQDB 2XXCB 4AH2B 4O58L 1CXFA 4CW1A 2ZCKH 2BRRH 4WU5B 3VXMA 4X7SH 2FJGB 3L7FB 5MEPB 2L4OA 3BWUC 4ZOAA 3M8OH 4LCCA 2ZOKB 3I3BA 5EBWA 1FRGL 5I15L 4RRPG 2CKBB 1KFAH 3HZVA 4JDVB 3QIWD 4P9HL 3JVGC 5KSAD 1DDHA 2PTTB 2VDKL 3K81A 2YUVA 3VFVA 2VLRD 2DYPA 2OL3A 4X0KB 4K8RH 2AJZB 3LZFL 2VWEE 3C8HA 5D7LA 3FONA 4WEBH 4HLZH 2IMMA 4S1QL 3N1GC 1EJ6A 3WUZA 4GXUN 3WSQH 5CEYA 5KJRH 1GGUA 4OFDA 3QO0B 5B8CA 4FQIH 2ERJC 3UZQA 5EOQH 3VW3H 3MRHB 1I8LC 1CF8H 1BPVA 3RVUC 3UTTA 3K4ZA 4HHAB 4MQSB 4QY8B 4CGTA 4N0YH 5I19H 3SDXE 1KIRA 4PJCF 1QR1B 3BKMH 4LU5H 4IRSA 1BX2A 3BDBA 2BVTA 4KQ3H 4NN5B 3LDBC 4UTBH 5E8DL 4Y89A 5EUOA 4P3DB 5DJXA 1S7XA 3VH8G 3UTQA 1PW3A 2DAVA 3RZCC 4KTYA 5D6CA 3QJHB 1VSCA 4NFCA 3IT8D 3FMGH 1PY4A 2AABL 5MP6L 4WV1C 3QQ4A 1H5BB 4BQ9A 5I1AB 5DZLA 1S7QA 4KJWC 3LS4L 3BIAX 3ZE1E 3BZ4B 3MLRH 5JMRA 4DTGH 2P24A 2YPLB 1JNLH 4POUB 1MHPL 1KCSH 2YMXH 3LVEA 3PHQB 4G5ZL 1CD0A 1F8TL 3N85H 2NQCA 4NJ9H 4U0RB 3VGGA 2VDNL 1GGCH 4WEUD 5C0IB 2HJFB 2EIZA 3RL2A 3GI8L 4IRZL 4YHKL 3VI4F 5JOFB 3UZEA 4G43A 1W0VA 3PL6A 4IMKC 5IMKA 4PP1D 3BRFA 1A7PL 2R39A 4G8EB 3CK0L 4Z0BH 1JZ4A 1ZANL 2B0SL 1K3IA 2N7BA 4LSSH 3Q6GH 3SCMB 4R0LC 3P4MA 5TQ0H 3UDWC 4BFIB 5IR1A 2GIYA 5INCB 4AIXA 1MLCA 3UBXA 1KC5L 4Z6AT 1GAFL 4YFLF 1WC7A 1KCUL 2VZVA 4WHTB 2ESVB 3HKFA 4NFBA 1BJ1J 2X44D 3QUXC 4QRUB 4TOYL 1AKJB 1A4JB 3RGVC 3Q6FA 2H9GA 3BAEH 2UWEB 3S97C 3U46B 3GBNL 1S5HB 5T3XH 1A7QH 4ZAKC 5BO1H 2VL5B 3IRZA 3QUYC 1P6FA 5HPOA 3ZTJG 4QTHA 3QHZL 4KJPC 1NAMB 4UINH 5BOZG 5I9QC 4ZQKB 5E6IC 4P2QD 5IBUG 3UPAA 4JO3H 3ARFA 4OLYH 5CIPH 1KB5L 2GK0A 3GK8L 1UACH 4N8CH 1FFQA 3Q3GB 5D70L 1JK8B 3TP4A 1KEML 5GS1C 3TH3T 3ZSSA 2HFTA 5GRYA 1FVDB 4X80H 1E28A 5JQ6L 5D7LE 4P3CL 5HHNB 1PLGL 4NRXA 3VXSD 1HNFA 3GMPB 3K1DA 3SJVB 2B4CL 1BHGA 1DE4A 2Z91A 3UEZA 4P2QB 4ZODA 2MHAA 3U6RB 1H8SA 1XT5A 2HG5A 1WT5C 3KYKL 1I8MB 4NM8H 4PV8A 1VFAA 1OGAA 5IEKA 3CVHH 3RNQB 3UTTE 3H3KA 4JFXB 3MCKB 5FF6B 1OGTB 4BFBD 5CGYC 1SJEB 4M00A 3KPNB 1A4KB 1BOGA 3I6LD 3VXSB 3ZE0F 5D7JA 3KDMA 2DS4A 4L3CB 5IWLC 3CDCA 4XPAH 3LRGA 5J1AA 2YUWA 3LRSB 1RZ7H 5EUOE 1XEDA 5JW4M 1JGDA 4FQ1L 2H26A 5FOBB 4W4NA 4OM1H 4Q97A 4PGJA 4FABH 1NCAL 4OCWH 2D7NA 5C7XL 3EZJB 2FHFA 2Z31D 4JPVL 5IBTL 2XWBA 1JFQH 4JQXA 3OHXB 4BZ2H 5CCKH 2Z35A 2BSED 4HZAA 2FX8H 1SY6A 2AJSH 3X3GL 35C8H 2PTUA 1G6VK 1JNJA 4ZTPL 5D93B 2NTSP 5FK9A 2P43B 1C1EH 4GAJL 1J0IA 4JN2B 4RMSA 4O2FB 3DXAD 4UIKH 2ZKHH 5I16A 1JZ5A 1J0HA 2Z31B 3JZ7A 4Y4FD 3QIUA 1R3JB 2EDHA 2ZZUT 2BVUA 3G5ZA 5DMJB 1AE6H 2F54B 4TYUA 3RVWD 5C3TA 5IVXF 2WQ8A 4PG9A 2QQLL 1JGUH 4JVUA 3FRPA 1FVCB 4L5FL 3L3HB 4WO4D 1J1OL 4NQCB 5KANI 3DXAB 2OCFD 1MLBA 1JBJA 1RK0A 5KVEH 4LP5A 3V6OE 1E0OB 2J1KA 4Y4FB 1X5KA 4LSVL 1U3HD 1A3RL 2CRYA 4YXLL 1CLOL 2AV7A 2OSLA 3BPLB 2E6JA 1I3RA 5HSFA 4NO2B 5AWNL 1TZHA 4BJLA 4WO4B 1UZ8B 5DD3H 1SHMA 3QNZB 1KENL 3DUSB 4PJ9C 2EXWC 1LDPL 3WHE1 4KZDH 5KVFL 3GJFB 1K2DA 1NCUA 3QG6B 3DV4A 1WQVT 3QZWA 1YEEL 3UTSB 4NHCL 2FGWH 2WWKT 3BEWA 4XTRD 1OP5K 3AMLA 1FN4A 2QLVB 4I4WA 2XTLA 1X3DA 3AREB 2GJZA 1FL6A 2A6JB 4MXVE 4Y16A 4NN7B 1N7MH 3FRPG 5F88A 1C5DB 2NZ9C 1R3IH 4TUJB 1BOYA 3GM8A 5A2FA 3QXTA 2CMRL 5JXAL 2WBJD 1KBGH 1KYOK 1U95A 2ID5A 2NLJB 3G6DH 4CVXB 1AXTH 1FZOA 2W1NA 1V7NH 5HY9A 3IVKB 1QG3A 2DD8H 2DWEA 1HQRA 1NANH 1NMBL 1C16B 3MLUH 3O6ML 1NANI 1HEZB 4NQUA 3SE3C 4OCSL 5GRZA 3QP3A 1OGAE 2NY6C 4JGMA 1D5MB 3KPRA 4RGMB 4P0DA 1XGRB 1HH6B 5FUOL 2R56H 2DI9A 1MJ8H 1GGBH 3CIQA 1DLFH 2JCCA 1JP5A 5I71C 3MOBL 2J5LB 5ICZB 4XNUH 1TETH 2XKNB 4L9LA 3U82B 4U0QB 1ZLSH 5JZ7D 5L6YL 3DJ9A 4M8QB 4X8JB 2RR3A 1HQ4A 2VQ1B 1GVIA 3OGCB 4JR9H 2GW5A 3PDGA 3C2AL 4Y1AE 3RWHB 5DEFB 5MHSE 1MJUL 4OGYL 3P0YH 4OZGF 1LO4L 4Z95H 1HHIA 1WICA 4TRPH 4U1KB 4F7CB 5EA0H 2D2OA 5E8NA 4U6XA 2V5MA 3EOBA 3VG0H 2WNGA 2GY7B 4QHKI 4HKZB 1H3TA 3ROOA 5T5FL 1S7SA 5DJCB 4XNMA 2VL4A 5TDNA 1R5IB 3AXLB 3LQAH 3T1FB 5E08L 5GRJL 4N5ED 1I1AC 1YYMH 3HI6H 4UT7L 4JQIH 4FP8H 4EQ3A 1MAML 4QO1A 1BVKA 5KTEL 2OMNA 3MYJB 1BMGA 1U8PA 3QEGL 1F97A 4HPYL 1SEBB 4GMSH 5GGRY 1YQVL 4XP9L 3IF1A 2E27H 4NO3A 4X6FA 3W39B 4OT1H 5D1XD 4LPTA 4TUOB 1FYTB 1P4IL 2VLKB 3RUGA 1FE8L 1EA9C 3L6FB 1ZLVK 5FKAB 2FECL 1FP5A 5A40E 3AS2A 4MNGA 4P23C 4QXTB 1Q0YL 1P7QA 1IJ9A 1VGKA 2VH5L 1JF1A 3FOMB 3T0WA 3D39D 5D4QA 3DI3B 4DW2H 4PGCA 5I76A 3B2UC 2DOCA 4FFZL 4Y2DA 3EOTL 3RY6C 1JGVH 3EAKA 1P69B 1JN6B 4YBHA 2AEPL 5I1EL 2X41A 1MIMH 1QKZL 5EC2A 3NBNA 2XY2A 4RIRB 5FV1L 3VG9B 2ENSA 2YD7A 2FJHA 4YAQB 5GIRA 1ES0A 3GBLA 1J1PH 4F58L 4WHDA 4MJ2A 2D03H 3D39B 1CICB 3QBTB 3S96B 2P5WD 2FATL 5D2LF 3GNMH 3GSVA 5JW3H 1RMFL 1S9VA 1JPSH 2SEBB 2XN9D 3NIFE 5ESVA 3IDIB 5GGQH 3CU1A 3T4YB 2AP2A 2F5AL 3QI9C 1MIEL 2HFEB 2H32H 3U4BL 4ZUSA 4XCYB 4FFWD 1DBAH 2Y4SA 4PRNB 3KPRE 1B4JL 3HRZA 1ZEAL 1FNAA 3KJ4C 3ZO0A 3F7VB 3V4UL 2P5WB 2NX5B 4MQ7A 1UM4L 3TVMA 4E5XB 5K9OA 2F19H 5F6HJ 1JNHB 2H1PL 5IV2A 5IUSA 2HH0L 3QCVL 5T1KA 5IFHH 2QQNL 3C5ZA 3DMMD 1MI5D 4C4KO 4AEHL 3JUZA 5KS9B 2BSRB 4XRCB 5KSBF 3TN0B 1T04A 1IFHL 3E6FA 5D2NC 3QQ9D 4X7FC 3ZKSD 1WAAA 2ICWI 2MPAL 5DTFA 5TF0A 2HT2D 4DQOH 3QFJA 5HHOA 1BLNA 3V4VL 1AJ7H 2DQCH 1KN4H 4HWBH 5DUBA 2R1YA 1PAMA 1MFBL 5IQ7H 4HXBL 3RWEB 1MI5B 5HI5C 3D18A 1FV1B 2CDGB 3MRIB 5F7YC 1J8HD 3WLBA 5I1JL 4PJFA 3OSKA 1RZKL 1UENA 3QDMD 4ZUUB 1TZIB 4PJEB 3GKZA 1VGEH 1UCBH 5EWIL 2IEPA 4FFVD 4RMUA 5BXFB 3EDDA 1MFEL 5FA3B 3O2WH 2HT4D 2FEEL 4NQDB 4OUUA 1WLHA 3P9WB 4FQXD 5I8KH 4QOKA 3CFEB 1DBBH 3QDMB 3CMGA 1IQWL 1U8MA 4PJDF 2I25N 2VZOA 3BJLA 4QRTA 2ZNWA 3SN6N 5KW9H 5J6GA 2XQYK 1AGBA 4PTUB 4DKEH 4PGZA 2X6MA 1AGDA 3OF6D 3MR9A 1BM3L 3S4SG 1NDMB 4WFED 3HZKA 3T3PF 2W0FB 4E42A 4HFWB 1N26A 3NVQA 3S3JA 2DTSA 1CDHA 5D9SB 3WNOA 2AJYL 1VESA 1CTNA 2K7QA 4H0GA 1QFWM 4P5TC 1I8IB 1OVZA 3HE7A 3RUGE 1V5JA 1WZ1H 1JPGA 3JWDC 3UYPA 1GZQA 2DQDH 1TVBA 1F13A 4G6MH 1NCDH 4F7TB 3T2NH 3U9UB 5I1HH 1XF4B 4JRYD 5HGHA 5F7HA 3EO0A 4OF0A 2VR9A 4FXKA 2ADJA 1PBYA 4Y4HD 1A6PA 4JHAL 4JE4B 3X13B 5TPWH 3BQUA 1K5NB 3DUUA 1A9BB 3HC4L 4GUPA 4LLYB 4KROD 3OJ2C 4WWKB 4JRYB 3TA3D 4K55A 1KIPA 2FL5A 4ZO6A 1F4WL 4YQXL 3STBA 4ELMF 4UDUB 4Y4HB 2B2XL 3NA9L 4X5WB 4K7PX 5I8OH 1AP2B 3QWOA 5DFVD 3SE4A 1OAYH 4Z7VF 5TGBB 5DEZA 4UNTA 3BIKA 4NJAL 4FMFA 4OTXL 3T2PA 3FZUC 3KS0J 1CFQA 4K7PY 4PJHB 1PX4A 5HGDA 5A16B 3WO4B 4YDKH 3CXHJ 3TA3B 1R0AL 3I75A 4NQXA 3ULVD 1RIVL 1P7KA 2W38A 5JORB 3C6LD 1CDGA 3CZFB 2J6EH 4AQ1B 4EZMA 1G7QA 3PABA 3M1BA 5EZLB 4KDWA 4QHMA 1OARL 4OFKA 4X98B 3RGHA 4XP5H 1YEIL 4OFPA 3U7YH 3ARBD 5GZND 2VDOL 3SDAB 3BUYA 3GKWL 4TSCL 1BVLA 5DYOA 2MCPL 4TVPL 3MV8E 5IG7A 5KBNC 1UB5A 3C6LB 1WAAE 5H35B 1I8KA 5F7LB 4ODSH 4U1GC 5HHOE 1J9CT 1VFBA 4OSUH 1D5ZB 3NCFB 4S11A 3SE8H 4J3TA 1L7TH 1LWRA 3PWPA 4M8VA 1IC5L 4YR6B 2BP3A 5AZEL 3ARBB 1S3KH 2A6IB 4JM2A 4M93C 5F96L 4BELD 4GAFB 3F7YB 4P2RE 4LDLB 4PJIA 5EFIA 3MLVL 5CBAA 2ORBH 1MJJB 5TDPB 3VFWA 4ALAL 2HVKA 3QB7C 1OSPL 1S9KC 1AO7B 2H2PD 3MXWH 3IDGA 1TTUA 5GS2D 3V0WH 5E6ZA 1RVFL 6FABH 1QRNA 2YD2A 4APQC 3U0WH 4QOKE 3BPNC 4PBWD 5FM5M 1U2HA 1A6AB 1RUML 4PJAB 2A9ML 2AV1B 3UAJC 4OQTL 4XBEL 1FDLH 1RURH 2YEZA 1ZHKB 1NC2A 3EO9H 3CFKB 4X7EC 2X4OA 3HE7C 4G9FA 1PYWA 3QDGD 3MJ8B 1YUHA 2FHCA 5I66B 3IXAA 2FX7H 2OJEB 3EDEA 2X09A 1EBAA 1KPVA 3P30H 3QXDA 1MFAL 5FYKD 3DVGA 4YEEA 1LEIA 5MI0C 5FDWA 1SM3L 2DBLL 1S7UB 3S34L 1V7MH 4TULL 4XNZB 4PUBH 2COQA 3QDGB 3AM8A 1MWAB 1JUFA 1QSZA 4I77H 2Q87A 3HN3A 1X7QA 3IU4H 3RIFK 3U48A 2VLLA 4P59L 4MXWH 4QKXB 4O2CA 1I9JH 3EHBD 4LSRL 5D1ZC 2P8MA 4PB9L 5HYJA 1IGYB 3FHQA 1A14L 4HK3N 4ODHH 1S8DA 5CGTA 1VADB 1U8KA 3ARSA 2E9BA 4LHQB 3RWGA 2L7JA 1TJGH 4N1HB 4PJCB 1NGXA 5B38A 2OXGA 2GKIA 4Q6IC 3MSPA 2IPTL 1JZ2A 4OD2B 3X3FL 1NCCH 2F8VA 3MBEC 5I30L 1SYVB 4V2CB 3I6KB 3LHPL 3DX9B 3RIFF 2RBLA 1ZVHA 3HMXL 1D6EB 2R0LH 3QNXB 1C12B 4YHML 1JRHL 4NQEA 4LVNC 5DHVH 3GRWH 3W81A 1RZJL 4G6KL 5GS0H 4JRXA 4M6MH 4Z7WE 5DVNA 2C7UB 4K2UL 5C6PB 2F53D 5KOVC 3MRPB 5DJ6A 2MQCA 4K94H 2A0LC 4KI5C 4F57H 5HGGS 1HILB 3AROA 4Y7MA 1LNUB 3KPTA 1I3UA 3S37L 3FQUB 2FO4A 4X9BA 1RZGB 2WWMC 2YN3A 2JJWA 1X5HA 2EYRB 3PWPE 1TPXC 4GKOA 1U8OA 4HT1L 2FNBA 4RWHA 5I75B 5HDQH 2F53B 1ZT7B 4PJIE 4GO6B 1T21A 3E8UL 5E2VL 5T3ZE 4NCC2 5I1IL 3QWQB 4NKDA 1BQHG 1KULA 2VAAA 3WHE0 5SWQB 2HFFB 2YXFA 2E5EA 4XI5C 4H0IA 2R2HA 5KZCB 5BVPH 4NNYA 3LPGA 3ZZ1A 2AGJH 3KNBB 1QRNE 1HNGA 3WUWA 1JWMA 1X9QA 2BZDA 1P9MA 1XCTB 2HAZA 2HLFD 3GO1H 5HJ3A 3QQ3B 1HWGB 3O3BB 2MNUA 5D1QB 1BFSA 2Y07H 2LQRA 3FFDA 1FO0B 4M3JA 1R3LA 3DYMA 2WWKO 5BMFL 2V6HA 4JFEE 3B3IA 4HUKB 5CJOH 4G9FE 5DJ2A 1KLFA 5AYUH 3IXTA 4AY0A 4HIXH 4POYA 3OG6B 1T1ZB 4G6JH 1OF2A 3QDHA 1BVZA 5DMKA 1H8OA 1MCBA 3WL9A 3VFRB 4AH2A 3MRMB 1P53A 3RTQD 1W72A 4ZFOA 4P46B 3REVB 4M1DH 2FJGA 3L7FA 5MEPA 1DSFH 2EDRA 1DANU 2ZOKA 1SVCP 3FT3A 1HYRC 2O5YH 4MAUH 3LKRB 2CKBA 4JDVA 2PTTA 4FS0A 1RIHH 4L3EA 2OQJB 4LARL 3KR3L 3PV7A 1NL0L 3RTQB 4JY4B 5HYJE 1FCCA 1IAOB 3O4OC 4X0KA 1UADC 2HRPL 1Z9OA 1I3VA 5FV2A 4RAVA 4ZFZB 3QIWA 4R2GC 5KSAA 2EYTB 3P11H 5C2UB 4KK8D 4Y19B 3QO0A 1MY7A 2HT3C 1WIOA 4YPJA 2VLRA 3O81A 2ZG1A 3TBSB 1OPGH 1U6AH 4PLKC 2ZUXA 4QNPF 4QY8A 3SQOH 1QR1A 4NQEE 2D9QB 5CEZL 4YBLC 2NXZC 1OAUL 4TPRL 5L0QC 1UM6L 4GRWE 4OZFG 5DD0L 2NY1D 2E7LA 4YH6A 4YHOL 2A73B 2WIMA 3QJHA 4XB8A 3BGMB 4Z76B 1MF2H 3MRJB 4OI7A 3DVIA 4HH8A 4S1RH 1J10A 3U7WL 5IIEB 12E8L 4Y5YB 4PGDA 4WFFD 3KPSB 1HIMH 4IOIB 1H5BA 3P4OB 2NY3B 3LEYL 5IVXB 2R4SL 1VEOA 2NY1B 3HPLB 4ONGH 1T3FB 3WFCL 1CCZA 2QSCH 3AU1A 3PHQA 1IKFH 5FYLL 3KJ6H 4WUKL 1I7ZB 2BFVL 4MX7A 3VMNA 1KPUB 1K4CB 2XACC 3NZHH 4C56B 5C0IA 4HC1A 5JOFA 4UT9H 1CGWA 2IADB 4KU1A 4EN3D 4G8EA 1MRDL 2VDRH 2V2XB 4EIZC 1NBQA 3VMOA 5E4EB 1QSEE 4TTDC 2IMNA 4I0PB 3WDJA 4OCMC 4BFIA 1FGNH 2R8SH 1IGJB 1D5XB 1A2YA 1ZS8B 4KPHL 1HH9B 2I5YH 4LPYA 1KSRA 2BY1A 4OLWL 4WHTA 4MA7L 2ESVA 1CL7L 3UX9B 4EN3B 2WUBH 1E6OL 4QRUA 5C0AD 4AG4L 2UWEA 3U46A 3B4NA 3VFSB 2OL3L 1S5HA 3QHFH 3BKCH 1YC7A 4UIMA 5L9DH 1HCFX 1JYWA 2QSTA 2VL5A 3PXHA 4JFOA 1CK0L 4KHTL 32C2A 3T0ED 4G80B 1NAMA 1PSKL 4RZCA 5GGTL 4ZQKA 1OAQL 1EZVX 4L3EE 4PY8I 4W4OA 3MLZH 4Z7NE 4GH7B 1IAIL 3Q3GA 4P2CG 1JK8A 4M6OH 4ZPTA 1LO2L 1EZVY 1FVDA 2APVA 2EDYA 4EDXB 1MEXL 1RZ8B 5HD8C 4WNQA 1QYGH 4I3SH 1QZ1A 4Z7OE 3BT2L 2EKJA 3T0EB 5HHNA 2R23B 3TNMB 1TJHL 3RI5K 4P2QA 3AAZB 3MO1B 3U6RA 5ILTL 3THML 4KK6C 1I8MA 5A3IC 5SX5K 2VLRE 4ORGB 5EZOL 4GAYB 3WD5L 4DK3A 4P5MB 3ULSB 2BVPA 2FWOB 4LBEB 2O5XH 4JFXA 1UEMA 5FF6A 1OGTA 4XVSL 2RCSL 1SJEA 3MRFB 1K4DB 3C9NA 5I1GH 4LDEB 3KPNA 1A4KA 3SOBL 3VXSA 5DO2C 3FTGB 1M7IA 4LEXL 4L3CA 4AMKL 3LRSA 1FFNA 5CINL 1GZPB 4OZGB 2G60L 4OLZL 2Z9TA 3RI5F 3B8YA 4HQQH 3OHXA 4Y5XB 1DVFD 4ODVL 5BQ7A 4NNPH 1QSFD 3O6KL 4OZHF 5SX5H 4L29B 4XPBL 5T1LB 2Y9RT 5IFAL 4X4YB 1ZGLP 3LS5H 2QHRH 2AXFB 3P0VH 4CJ0A 2D31B 3GSQB 4JN2A 4O2FA 1DJSA 2J8HA 3WJLC 4OV5A 4YE4H 3WNLA 2Z31A 4MJ4A 3ZKQD 4NO5B 1R3JA 1L6ZA 1YN6A 1DVFB 5JXEC 1IARB 3CFCL 2H3NA 4LVHC 2V5YA 4RNRB 4XC3H 3TESA 4YLQT 4JM4L 4RISH 1M1SA 1GOFA 1NJ9B 3SCMC 3L3HA 1U93B 3VGDA 2CR3A 2V2WB 5DK0B 1FPTL 4RX4D 2IG2L 3DXAA 1YPZB 4NM4L 4WUUE 4ENEC 3U79A 2IALA 4Y4FA 5CP3H 3DX6B 2QBWA 4PJ5D 1FJ1B 3QEUB 3O6FB 1FGVL 4M9OA 4NO2A 4WO4A 3BZFB 1OT2A 1DEEB 1HZHL 4XT1C 1WFUA 3BRGC 3L3GB 3DUSA 3A6BH 4HEME 3GJFA 2ADIB 2NY0B 2NR6C 3NACH 1U3HA 2AQ2A 1U8QB 4PJ5B 3UTSA 2AEIT 4QRPB 3T09A 2VERN 1A1NB 1NSNL 4YDLC 1A1MA 4K71B 1T7YA 3VFGH 5D2LB 1A7OL 1AHWB 1EAPB 3MFFB 3QH3B 1GHFL 3DV6B 2E6PA 2W9EH 2CJUL 4TUJA 1OTSC 1RZIB 1X5YA 5D6DC 2CLRB 3FCTA 3T3MF 4KV5E 4XPHH 4CNIB 3MJ9A 3FB8A 1K85A 3VWKD 3F65A 2H32B 1QHPA 5LG1A 2NLJA 4A6YH 5JDJA 3HNTH 1ADQH 1D5BA 7CGTA 4NP4L 5KN5B 1MREL 4X9HA 3QAZC 5HDOA 5ETUA 2XFXB 2NW3B 4LCIH 4YFDB 4EI6B 1KB9J 4NZUH 4P2QE 3W9DB 1C16A 3O2DH 4ONOA 3VWKB 3NOIA 4H1LB 5KSBB 2WBJA 4S1DD 2ICWB 1DBKL 3PF2A 5IT2L 2VSCA 4HAFA 1HH6A 2ED9A 4X6BB 5B3JE 4UNUA 3F58L 3QG7H 1SY6L 1C5CL 4CU6A 5ICZA 1BBDH 3G08B 1MVUB 2J7LA 1Y6MR 2XKNA 2X4PB 4DN4L 1U2CA 4J6RH 4X8JA 1XFPA 1IZJA 2VQ1A 1KLGB 4ZUTB 1YY9C 2Z4QB 1L0QA 5CKGA 5EBLA 1CFTB 5ADOH 3I6LE 1A9EA 3RWHA 5DQJB 3MC0A 5FO7B 1FNGA 2PR4L 5CD5D 1L0XA 1YEKL 3CX5J 4EUPB 1IEAB 3VXUD 3RAJL 4FQLL 1MY5A 2F9BT 4PJDB 2ZCLH 4U1KA 4RFOH 5FYJL 3ULUF 3TT3L 2DQHL 1MHHA 3ULUH 2AK1L 2G2RB 4P4RB 4NGHL 5E8DH 4HKZA 2ZSVA 3TGXA 2HKHL 4PBXA 4F8QA 1K6QH 5DJCA 4AEIL 3T1FA 1A6VL 4OJFH 3DXAE 4DCQB 2CO6B 2AABH 5MP6H 2CPCA 3MYJA 3RBSA 1SEBA 4RGNC 2DLFL 4U1NB 4J8RB 3LS4H 4XP1H 3W39A 4IMLB 3STLB 1BFVH 2XIDA 3WFDH 4B41A 3R8BB 4TUOA 3U4EA 4PRID 1CZ8H 4ZD3L 5FKAA 1P84J 4G3YL 1XGTB 2AAVA 3ZYOA 1F8TH 3C08L 4Q0XL 2VDNH 4QXTA 5CAYB 4IDLA 3AREC 3KPMB 1SMOA 1XF3B 1C08B 1M71B 1U8JB 4JO2L 1F90L 1EMTH 4LGRB 5D1XA 4ELMB 4MMXC 1RJZB 4JN1H 2R1XA 5BOPA 3H3PL 4JG1H 1EHAA 4PRIB 5D96B 1A7PH 2HP4A 2Y6SD 1GGIH 1JN6A 3CK0H 1BQSA 4GBXB 4MQXD 5FO9B 1F58L 4M3KB 4EI5C 4R8WL 1ZANH 1DBJL 2O5ZH 1TVHB 4RIRA 4JQVA 3NPSC 4H8WC 3OAYH 5JOPD 5ISZB 3E1F1 2APTA 3QDJB 1RUAL 4HWEH 3D39A 1CICA 2CXGA 3S96A 1KC5H 1G6RL 5F97E 2VKXA 4QT5B 4NYLA 1ZHLB 2XTJB 2BVQA 1K3ZA 2SEBA 4TOYH 2ZG2A 1BWMA 3IDIA 2IAMB 5T5NG 1OSZB 3T4YA 4M1GL 2DL2A 3VFNB 2HFEA 3GBNH 5GGSA 4XCYA 1UQSA 2VN7A 4GLRH 4HCRL 4GLRI 2VDPL 3F7VA 2P5WA 4FQJL 4QXUL 4E5XA 3BSZH 2NY2B 1JNHA 3NN8B 4XBPB 2PO6C 2XN9A 1KB5H 1QEWB 4OFVA 3PWNB 5CILH 1KEMH 3UTPE 3JTSB 3K7UA 4NWUH 4TTGA 3BGFB 3PP3K 3V8CA 5I8EA 5DC9B 3CCHA 4D8PA 3QXAA 1RUPL 5FM4A 3OB0K 1T83C 5E99H 2B4CH 3RWEA 3DMMA 5IK3A 1CD8A 1S5IL 2JK5B 1MI5A 3S35L 4YHNB 1GC1L 1FV1A 2CDGA 3I3DA 3MRIA 5E9DB 4WI7A 2GY5A 3C60D 4J23A 1MCHA 4ZUUA 1N8ZB 1AH1A 1HHKB 1TZIA 4PJEA 1GPOH 5E8EA 1CBVL 4GW1B 3JWOC 3L5WA 5BXFA 5E1AB 1YA5A 1IL1A 3LMJL 2NYYC 4S0SD 5FA3A 4M48H 2FB4H 4PLJD 2UYLB 4L8SB 3GHEH 5CP7A 5BS0B 3O9WB 4NRZB 3EYQD 3OL2A 2D7PA 1CI5A 5JW5B 4KRPD 2ZNXA 1J8HA 3QDMA 2CUIA 1MCSA 5EG6C 1NCAH 1MCKA 4PTUA 3FAWA 1OM3L 1EJOL 2A6DB 5I1KL 5IB2B 2JIXB 3X3GH 4OF8A 2W0FA 5F7WC 4FQXA 4HFWA 4OIBA 3JWDL 5D9SA 3KLHC 2I27N 4KRPB 4GAJH 2YUZA 4LP4A 5DJAB 1EUTA 2YC1B 4F7PB 3E3QC 1CVSC 2VMFA 5TF1L 4EOWH 4F7TA 5C0CD 4IS6B 3U9UA 3G6AB 3OF6A 1XF4A 4AT6A 2DLIA 3HC3L 4LCUB 2YBRA 1G7HB 2OS7A 2JJTC 4L5FH 4R4BA 3X13A 5DVMA 3FO0H 4K3EL 8FABB 3VG9C 1OAZL 1K5NA 1NBVH 1J1OH 1A9BA 3S9DB 5HVWA 4LRNH 3I85A 4DFIA 4LLYA 2B39A 3BP4B 1CICC 3KPPB 3X14B 2V7HB 2DQJL 4TVPD 2PF6A 2X89A 3SKOB 4WU7A 4JRYA 2XPGB 3P2TA 3QUMB 1CLOH 2YD3A 1PFCA 5B3NA 4UDUA 5KSUB 4HKXB 4Y4HA 5AWNH 2CK0H 1MJ7L 3GSOB 2Q3AA 4X5WA 4DAGL 3H42H 3S7GA 4JREC 3W5MA 4B0MM 5KVFH 2AXHA 4GSDL 3QRGL 4EIGB 1YEEH 4NHCH 3TA3A 1LD9A 1RJLA 3OXSB 1IGTB 5JORA 4YK4B 3ZDYE 3QEHA 1PG7H 3CZFA 5I6XC 4PV9B 5F1NA 3TN0C 2P5WE 4Q9QH 4X98A 4Z9KB 2DIBA 1YNLH 3JTTB 2XN9E 3N1PC 1ZAGA 3O3AB 5B22A 1V05A 4X9FA 1NGZB 3SDAA 3WNNA 1T03H 2CMRH 2VLJD 5JXAH 4JLRA 5EH1A 1WCQA 3C6LA 4AIZB 1N5AB 1T1WB 5H35A 5EOTA 3TPUB 4JDZB 2EZ0C 5LBSH 3IFPB 2DIJA 1S7TB 1NGQL 3DPBA 4NKIH 4DVBB 4EXPX 3ARBA 1MI5E 4XB7A 1YMHB 2RB8A 3IDNB 4OCSH 3NCYP 1X4XA 4BZYA 3F7YA 3WLWD 3V0AC 4TSBH 3OB8A 4XPTL 1MJJA 3MUJA 5TDPA 2EXYD 1AD0B 3VJ6B 4PY8J 3KXFD 3F8UB 3WIHL 4L4VD 4JY5L 4R96B 2K9UA 4KRNA 4Y0GA 3VXOB 1CD9B 3D1MC 3PV6B 4K7PH 4JFZL 4Y5VB 4TQEL 2HT4C 1A6AA 1J8HE 5L6YH 4PJAA 2DF3A 3QDME 2AV1A 4U3CA 1ZHKA 2OBGA 5EU7C 5F9WC 4JGJA 3C2AH 1OAKL 5JA8B 3KXFB 2VIRB 2BRQA 1MJUH 1IKNC 3SKMB 2DQEL 4HJJL 4PGBB 1RIUH 4IOFC 3KLAB 4WHCA 3RWIB 4X99B 4X8XA 3W2DH 1HXMB 5F70A 3OKDB 4K7FA 1HWHB 3TO4D 4NRYA 3HZYB 1FFOB 3B2VL 4O4YL 3CSGA 3SDYH 4QYOA 3QIBD 4WFEE 1T5WB 3ARYA 2VC2H 3QDGA 2ZP0T 4YNYA 4WWKC 5HDBF 1MWAA 5K59F 3SQBA 2BHZA 1IAMA 3O3UN 2JLLA 5CJBA 5IW6B 5F71A 5IROC 3IFLL 2ITCB 4UT7H 5E5MB 1UJTA 4LSPH 2XWJA 1X5ZA 1MAMH 5C08D 3TO4B 2DMBA 5KTEH 3FL7A 3QEGH 3UMTA 1IGYA 4JRYE 4XP9H 3HNVH 3QIBB 3MV7B 4PLNC 3LRHA 1AFVH 1VADA 3LIZL 1JV5B 4FRWA 4XHJD 3EFFB 3MXVH 3K1KC 3GM0A 3SDCD 2Q8BL 4XVTH 4PJCA 1UKQA 3HFMH 2BOCB 2FECI 3GSWA 1UXSB 5BV7H 1E6JL 1F5WA 2D4FA 1KCLA 2P4AB 3VGAB 3MLXH 2X4UB 4OD2A 1LK2A 1F11B 1HHHB 3I6KA 3IAQA 2YA1A 1D6EA 3NGBB 5I74B 3SDAC 3QNXA 2GK2A 3S36L 3ZDZE 5DSCB 3SDCB 1A5FL 2FR4B 4HPOH 2AEPH 5I1EH 3BW9B 3KVQA 4ODXB 4WI9A 3NCJH 4U1JB 2LVCA 1UM5L 2C7UA 3DHMA 4HLZG 3OKEB 4HGKC 4RGOL 5EORL 1PX3A 5DRXB 3ULVE 4U3XA 5HI4C 5I17B 5DMIL 2FATH 2AJXH 1LNUA 1U3ZA 3PGFL 3NFSL 5B4MD 4XNXH 5C2BL 1YJDC 2MQ0A 2VZ1A 2Q86B 1B0GB 3VDBA 5IM7A 5DK3A 1MIEH 1WWAX 2KZWA 5E2WL 3W5NA 2NCMA 4LLQB 2F53A 2Y1VA 4OLXH 5IB3A 1ZT7A 4ETQB 1NC4D 1B4JH 4F2MA 3BN9C 2J4WL 3BO8B 3V4UH 4XCFL 1Q9OB 5DQDH 1X5GA 1BGXH 2H1PH 2XA8L 2HH0H 1MCNA 4CMHB 1F00I 1IT9L 4P5KA 1MQ8A 3BKYL 1KTKE 1SBSH 4AEHH 3T04D 4AL8H 4OIIL 1U8HB 1XCTA 3QQ3A 2OP4L 4PJAE 3O3BA 4KZEL 1WFTA 5D1QA 4XVJL 2MPAH 2XRAL 3HPJB 1A0QH 1FO0A 1KF9B 3V4VH 4RMWA 2ATKB 3BX7C 3PHOB 3PP4L 5JHDB 5LWYH 4WFGD 3P3YA 1CXIA 4WW2A 4I18B 4KTDH 4CRPA 1QBAA 4I8DA 4ZUVB 5I1JH 1T1ZA 3JUYA 4XNZC 1QBLL 3RVUD 4K8RC 3HG1B 3HLAA 2EH8H 3MRMA 3EOAA 3LOWA 4N0UA 3ELAT 3REVA 4MLSA 3C09B 3QDGE 3O3EA 1BREA 2DLGA 5CEZD 3K2UH 1Q72L 3I50L 4QRSB 1MFNA 3FO9A 3PQYE 3RZCD 1XF2B 3WNKA 1OTUC 2OQJA 3QFDB 1UCTA 1MSPA 1T1XA 1U91B 2EE6A 4O02H 4CUCA 4U6YA 3AY4C 4JVWA 3RTQA 3VD7A 1WF5A 2E7MA 4UMGA 5FOJA 1IAOA 5F3BB 3LDBB 4KJWD 4X9GA 3B5TA 1EFXD 4WTWA 3SY0B 4ERSL 4PRDB 1CE1L 5J12C 4ZFZA 1S9XB 2WM0A 3LQZB 1WZKA 2VISB 3RZCB 5J9PB 1EGJA 2EYTA 3WDIA 2OJZH 2PNDA 1BZ7B 1IC7L 5C6WH 4HKJA 2DI8A 4WV1B 3TBSA 3MLWL 2VABA 1FSKB 3S3PA 1FNLA 5FYLD 3U30C 3RDTB 3VMPA 2I9TB 4WHYH 4KI5F 2H41A 3DBXB 5FXCH 1D9KC 1T7VA 2BY2A 3ZDXE 4HBCL 43CAA 4GKNB 3KPOA 4S2SB 3RIAK 1CQYA 4OZHB 5CZVL 1F4WH 2A73A 3GEWB 4HBQA 2EKSB 3HAEH 1DQLH 1RUQH 2B2XH 1EH9A 4BSVB 3G5VB 4S1SL 2GTWA 4Z76A 3VFOB 1NEZG 3W11C 3EJYC 2VXQL 3QUXD 4IOIA 4OTXH 3RGVD 5DRZB 4YX2H 3MYZA 1QLEL 1QD0A 5ECJE 5EO0B 4NSKB 3HPLA 2ZUYA 3UJTH 1RIVH 1T3FA 4YHZH 1MCPH 4ZAKD 1AY1L 1DL7H 1LK3H 3QUYD 1I7UB 2Q20A 4KJPD 3RIAF 3VRLF 4OCXH 3C6SB 5E6ID 3O0RL 1I7ZA 5D1QC 3RWDB 4GRMB 4X83A 3MACL 1K4CA 3RGVB 4OAWB 2VDOH 3VRJB 1KXTB 2JB6B 4TSCH 1REIA 3INUL 2XQBL 1OTTC 1Z0NA 3VH8B 3FQWB 5EUKB 3SEPA 5E56A 4ZAKB 2IADA 3PDDA 3QUYB 3QYCA 2V2XA 1Q0XH 5I9QB 3MV9D 1X4ZA 5E6IB 5GSRB 1RJYA 4BFEA 5AZEH 1JIBA 1L0YA 3H9SE 4YHIB 1IGJA 1D5XA 3VRIB 2ITDB 3IDJB 2EDNA 2CKBL 2MMXA 1Y6NR 1HH9A 4P46C 4W70A 5E2TH 1TENA 3T4AB 5H94B 4ALAH 2K3TA 5CGYD 4EN3A 1OSPH 3NCCB 3UJJH 3DTXA 1BF8A 5F9AC 5DLMH 3V7AE 4N0UE 2ICCA 5KANG 5EU4B 1RVFH 1VPOH 5JR1L 1FAIH 5J56B 2JTDA 4WGWB 3V5DB 4F9PA 1JZ8A 4G80A 5B39B 2AI0L 5BCAA 5EC1B 5FUZH 1OT1A 1PZ5B 4L8CB 4OQTH 1NEUA 4TN9A 2C4FU 2O26U 2I26N 3LY6A 5C0AA 5I73B 4YGAB 4P4KC 3UJIH 5CJ5A 4EDXA 3VXQB 1YEHL 4AEEA 1K8IB 3BKJH 2XICA 3T0EA 4LFHG 2R23A 1QPPA 5DRNB 1SM3H 3FO2B 1LEGB 3MO1A 2WK2A 4TULH 3MCG1 3RWJA 1LE9B 4ORGA 1YY8A 3OR6B 4LBEA 4QGYA 1SVZA 4M62L 2VE6B 3MRFA 4JJ5A 1KYOJ 1K4DA 1Z5LB 3ARQA 5F1SA 5DD1L 5IJKC 4LKCB 4GG6E 2MQ3A 5DK2B 5F9JB 1T1YB 4OGZA 4OM0L 1GZPA 4Y5YC 2FJFB 3H7BA 3X12B 2NY3C 4XPFH 1WCBB 4GOSA 5DDHB 3NCYS 1T2XA 1KIUA 1B4RA 3K46A 4FQ2L 2CO7B 4NO0D 4PJ9D 2EXWD 2IPTH 4MS8C 4X4YA 4HC1L 1XGQB 3L1OL 1WZLA 5I30H 1VB9A 3LHPH 1S9YA 2D31A 5DFWH 3GSQA 5L7XL 2ZUVA 3HMXH 1Y18B 1H8NA 4M02A 3DYPA 1AC0A 1JPFB 4BSJA 4KVNL 1H3UA 5BW7C 4IHOB 1RZJH 1DVFA 4LCWB 4R26H 4G6KH 1A1OB 1QSFA 3AB0C 4LSUL 4NO0B 3MGOB 4PJ9B 4WFFE 2OK0L 4WENB 4Z5RB 4PG2A 2NZ9D 3REWB 1ORQB 2X1XR 1UWXK 4M03A 1HXYA 3ZHKA 3MGTB 1NJ9A 5TE6L 2X5PA 4I0PC 1ZLUH 2V2WA 1T20B 5DK0A 4X7CC 1CG9B 5INDA 2APFA 2QV2A 2CGRH 2EYSB 3DX6A 4P9ML 3A67L 1FJ1A 3BWAB 4Q58C 3HMWL 1RUKH 1JNNH 3K74B 4NFDA 3B43A 4AJ0A 4YXHL 3L3DB 5L2KD 1NAML 2NY6D 3BZFA 3GIZH 1DEEA 3E8UH 5E2VH 5F7EH 4BQCA 4RX4A 5I1IH 1XCQA 2X1WL 2Q6WB 1DUZB 2ADIA 5ICXA 4U1IB 4R7NB 4GQ9L 5EU3B 1U8QA 2OXHA 4PJ5A 3CSYB 1UWXH 1YN7B 2Z93A 4DOHE 4FTVE 3RWCB 1G9ML 2I60L 3TC9A 1BJMA 2NY6B 4NC1C 3DX7A 5FHAL 3E2HC 2XOTA 4YDIH 5D2LA 3NCMA 1ULVA 5C0AE 1ZHBB 4QHUB 2X7LA 1RZIA 2CLRA 5AZ2L 5I71B 4CNIA 1P2CB 1J0YA 2YKLL 1PKQB 1NBZB 4JFQB 1MPAL 1F4YH 2WIIA 3T0EE 4LHUG 1P5VA 2HWZL 2WP3T 2AEQL 4H26B 4EI6A 3EYUH 3C5JB 3W9DA 3TYGL 2JJSA 4F37K 2QQKL 4DKDC 3VWKA 4H1LA 3DSNA 5KSBA 4RDQF 4CVZB 2Y5EA 5EZIL 5H37H 3E0GA 1NFIA 5DZOA 2FBJH 4G8GE 4P2OB 3V6BR 5C0NC 1CIUA 1G7PA 1I1AD 3WFEL 1EVUA 1RZFL 3Q2CA 4EXKA 2N4IA 4LARH 4JFDE 4LEOB 1QACA 3LH2L 4M6NH 2IBZX 3WDHA 4Y5XC 1AC6A 3MREB 2X4PA 4NZRL 1BECA 1ITCA 1KLGA 5EU5A 2J8UA 1ZLWK 2DQIH 3JV4B 2MKLC 2KQMA 2R0KL 3RVVC 5LXGH 4HJGB 3LQAC 2DWDB 5DQJA 1W2KT 5FO7A 3UYRL 4F37F 4R3SB 4P23D 1QA9B 2GJ6E 2CLZB 1T2QL 4EUPA 3MLSL 1IEAA 3FQNA 1DVFC 2NMSA 3KYOB 4ZSOE 3SBWA 1DUYB 3OXRB 3FRUB 3JBG7 3B2UD 4PJ8B 2HJKB 4WY7L 4MD0B 2AQ1A 1N0XH 4RCAA 4D3CH 1OAUH 2G2RA 4P4RA 4AZ8A 1QSFE 2IANB 3ZE1F 3LEVH 5J4MA 1UM6H 2BMKB 4P23B 2C1OA 4R4NC 3V9FA 5DD0H 3PWVA 4HX1B 4KMLB 2APWA 3VXUA 1UA6H 2OR9H 1ZLWH 2DKSA 2J88L 3FT2B 3FN9A 4ODTL 3F7QA 2A77L 3O6FC 4DCQA 2VXUL 1RJCA 3PNWA 3CH8A 4E41D 3QO1B 3F62A 4X7TB 4U1NA 1YNKL 2NNAB 4J8RA 1JPST 3QI9D 1HHGB 2NY0C 4IMLA 4XWGL 3STLA 1BD2B 4YWGH 3WFCH 4H20L 3LKPA 5SWSD 1WBXB 1XGTA 3V7MA 2BFVH 1IGML 3EYVB 3LKQB 4C54A 1H3PL 2ARJB 1AHWC 3MJ9L 1XF3A 4PRHD 1G6RB 3VGBA 1C08A 1M71A 4XBGB 1U8JA 3QI9B 4X4MA 5E1HB 1MNUL 4ELMA 1TZGL 1RJZA 5FM5O 2CXKA 5TE4H 4PRIA 5IQ9B 5EBMB 5SWSB 5FO9A 1MRDH 1NCBL 4L1HA 5KVGH 3KJ4B 5IMLA 5T1MA 4Z7VA 1A7BA 1ERNA 3BH9B 2R4RL 1TVHA 1NGPL 1WJ3A 3RWFB 1S7WB 5HI5D 1I7RB 4KPHH 3VD4A 4OLEA 4QT5A 1WEJH 4U1LA 1ZHLA 4HFUL 2AERT 4OLWH 4MA7H 2QTEA 4HUUB 4YUEL 2MTPA 1JWUA 1OSZA 4W68A 4AG4H 3I84A 4OCYL 1XR9A 2MSPA 4X9IA 4E0RB 2OL3H 4PJXF 2ZUSA 5KSBE 4KKAC 4KHTH 5DJZB 3VXTA 1EEYB 3WS6C 4U7SA 1NPUA 2IQ9H 3NN8A 1T0NB 3T0XA 2X1QA 4RMTA 4XXCC 2NXYC 3PWNA 4YBQC 1LDSA 3MTRA 1LO2H 5C6TL 2YRLA 1FIGH 4LPXA 1MEXH 2DQGH 1AD9B 2ZCHL 3EKCA 5E2UL 3F12B 1T89C 2J8UE 1FZMB 5JHLL 4YHLL 5IVZB 4P5TD 1IGCH 4JPIB 4DZBB 3MRBA 4LQ1A 3MUZ1 5DI8A 2JK5A 4TUKH 3BFOA 5F8QC 3VDCA 3JWOL 5EZOH 3TNNB 2IFFL 1EEZA 5ANME 4B53A 4XVSH 1GYAA 1OAXL 3QSKB 4GW1A 5JIKA 4QRQB 2Z92A 2X4SB 4LEXH 1NFDE 3CPLB 4IDJL 4UZGA 4AMKH 1UH2A 1Q9KB 3G5YB 1J1XL 1A3QA 1WUNT 3QCTH 4QGTA 3VXUE 3C60A 4BKLA 4YIQB 4OLZH 4O51A 2OMBA 1KPRB 1NCNA 3W0WB 1N5YH 2A6DA 5IB2A 1R3KA 2JIXA 4XPBH 3OPZL 4LL9A 1IM9D 3FZUD 3DYOA 5FCUH 4BH8B 4GW5B 3C2SA 2YUXA 4RAUA 3DIFB 5T1KD 4XZUB 3HA0A 1Z0MA 1N0LA 1JHKL 2YC1A 4F7PA 3L5XL 4IS6A 1ED3B 3G6AA 3N0PB 4QHLB 3WXWH 2VDLL 5GJTH 1N2RB 4UU9A 4I3RL 1ZVYA 4GBXC 1MFCH 4LCUA 4HUVB 5J57B 3BEVA 4JM4H 5DUPL 1HSAB 4XMKL 4X4ME 4CN4A 1BJ1H 1MRCH 8FABA 4ELME 3UBXI 2AK4E 4PRIE 4LPCA 4LSQL 3BP4A 1FNSL 1DFBL 2FX9H 2V7HA 4Z7VE 4M7JL 1FZKA 5C0CA 2DKMA 3S4SB 5BV7B 4XWOC 3SKOA 3UCRA 2F5BL 4GXUM 2XTJC 3QUMA 3SGJC 4F7EB 4PD4K 1Q1JL 3BE1L 2DI7A 4ELKA 5KSUA 2IAMC 2FBOJ 4HKXA 3TO2B 3MRDA 4CDHA 1KCVH 5HHPB 3VXPB 1I85C 4G42B 4D94A 4MXVF 1KJVB 5AYQA 4U1GB 2ED7A 3ECBB 3Q5TA 4DJMA 3AS3A 4H88L 4JHBA 2NY2C 2P8LA 5F8RC 3WIFA 1IGTA 5JOPE 5CGMA 1GCFA 2WV3A 5HHVL 4APQD 1EHLH 5IB4B 1ZA3B 3HCVA 4M93B 4PV9A 1MCOL 4U49A 3C8KB 2OR7A 1OW0C 1AR1C 3DURB 3J8F7 3UAJD 4Q6YA 1HE7A 3JTTA 3RP1A 2DM7A 3HUJF 3RX5A 2CJUH 4UILH 5D7IA 5GGUB 1NGZA 3WIIL 2F8OA 5HGAB 2C3HA 2BNQD 3IJSB 5HI3C 3WJJA 1TLKA 1VFUA 5I1CL 1FAKT 3BPNB 2O93L 4AIZA 1KJMB 1MREH 1T1WA 4QCIB 3TPUA 2D7TL 4JDZA 5DD6B 5MEOB 3NH7H 3IFPA 3LN5B 3GIVB 3CDGB 5LGHL 4DVBA 5L8JB 1F45A 3RA7H 3IDNA 4MVBC 2VLJA 4PP2B 4L8SC 3ILPA 2AXJA 1A3LH 2FLRT 3O9WC 4NWTH 1DBKH 3ILQC 4HGMA 1Z2KA 1MRFL 3JXAA 5FGSA 4XPGH 1JL8A 3NABL 4FQCH 1SY6H 2GHWB 4R96A 3TWCH 1S7RB 1F3JB 1IC4H 5D1ZD 2VO5A 3BJ91 3PV6A 4Y5VA 4B5EA 1UVQB 1CXKA 2OTPA 3O4LD 2RGSA 4LOUC 3ORJA 3KXFA 3UC0L 3SKMA 4L4VA 3MMEB 4MNQD 3KLAA 1UG9A 3MBED 4PYHA 1NUDA 3MCLH 3RWIA 4CADA 4FQLH 4R4FH 2DL9A 4X99A 4Z7UE 2C4XA 2EH7H 3O4LB 1HXMA 4LRIA 1WTLA 3CC5B 3OKDA 4U1HA 5ABDE 1ZWIB 5IB5B 4C57C 4KJQD 4U6VH 5FYJH 1FFOA 1NLDL 4W81A 1R5WB 3TT3H 5C0EA 3PG2A 4MNQB 4Q6IB 4UT6L 3V52H 2HKHH 2D0HA 4AEIH 3BH8A 5DVLA 3MBEB 5EOCJ 1Q8MA 5IHUL 5CJQL 2PN5A 5GGVY 1ZTXL 2A0LD 2E3VA 4KI5D 5D7KE 3TO4A 3P9LB 1I4FA 1XH3B 4LVNB 5C0CE 5HYSA 4JFPB 2DLFH 2WWMD 5HHQA 4DZ8B 3QIBA 4LCYB 5F9OH 1GH7A 4K3HA 5GS0C 3KHOA 3QUKB 3DVFA 5JMOC 3GMRB 5F1KC 1T5XB 5KS9F 4ZD3H 4G3YH 4YK4C 3WFHB 4K94C 3WFBL 1P1ZB 4RFEB 3DO3A 5ALBL 5C08A 2JELL 1UXSA 3PWJB 4Q0XH 4ZS7L 2VXTL 4TVPE 5TQ2L 5I18L 3V0VB 4XI5D 1F11A 1HHHA 3B9KC 2W92A 3ULVL 4ZXBC 1YQ2A 3D0LB 4JZOB 4DGIL 1Y6KR 1X5FA 4XNQB 3SDCA 3NIFF 1P4BL 2FR4A 4YDVB 4ODXA 4U1JA 1A6TB 5K9QI 1QSVA 1DBJH 5E95B 5D7IE 1TTFA 3H9HB 1CDBA 1OCWL 3I02B 5DRWB 1QFWH 5DRXA 3TV3H 5LAXB 4HS8H 1QFWI 5I17A 1YEGL 3OX8B 1GRWA 1PVHA 3BMWA 2DJSA 3QPXL 3DSFH 4ISVB 4F9LA 1B0GA 1JGLH 3GMQB 5ID1B 3OV6A 4LVEA 2MOVA 3OKLB 3ARDC 1YYLH 4LLQA 2VLJE 4OF5A 4ETQA 4PTTB 2JB5H 1A64A 1U8NB 4U6HA 2VDPH 4KUZL 3BO8A 1WGOA 1H15B 4DGYL 3D9AH 3ZYZA 3QRFM 2EEDA 2ZCKL 3GGWA 4KC3B 4GFTB 4X7SL 2K1MA 3M8OL 1HI6A 1U8HA 5JIPA 1A6ZB 3BPOC 4HK0B 4P99A 1Q38A 1ZGLB 1NC4A 1KFAL 3NZ8B 4J2XA 3HPJA 4R90L 3J7HA 1OWRM 2ATKA 5JHDA 4NCC1 4R2GD 3JVGA 3F5WB 2D0GA 3KXFE 4OKVB 2WINA 4L4VE 3IDYB 3IU3B 3D85B 5E70A 1S5IH 2HT3D 1YMMB 1MWAL 1GC1H 4X6DF 4ZUVA 4C59B 3RJDA 5IB1B 5EO9B 4WEBL 3O4OB 4PLKD 1KV3A 5JUEH 5FYKL 3WSQL 1CBVH 1JPTH 3FB5B 3LB6C 3HRPA 5KJRL 3TCLB 3MNVB 2G5BB 4DVRL 3X11B 4R2GB 5IJVB 5GGSY 4FQIL 2NXZD 5BRZD 3VW3L 1F3RB 2OLDA 5MERA 1CF8L 2FRGP 3RUGF 1I8LA 4QRSA 3LEXA 2R29H 4ZMAT 4N0YL 5I19L 1XF2A 5E4IA 5TH2B 1NBYB 3QFDA 1OM3H 1U91A 4ZDHA 3BYYA 2OZ4A 4IIQC 4KQ3L 2P5ED 4UTBL 1DCLA 4YBLB 1AR2A 2ZJSH 5L0QB 1ONQB 3SY0A 1D7FA 4PRDA 1CT8B 5EB9A 2F8XC 3LQZA 2VISA 3RZCA 1J05B 3NGBC 1NAKL 5TF1H 1ZVSB 3L3OA 1FCGA 5C08E 1BZ7A 4Y4KB 3ME0A 4YC2B 3LV3B 2P5EB 1SEQH 4WV1A 5C0GB 3MLRL 4S0TD 1EFXA 4RRPA 2I9TA 3FQRB 4DTGL 1NCWL 3QHTC 3DBXA 4P48A 4OFYD 1KCSL 1D5IH 5GQBA 3SDDB 2DQJH 4GKNA 4S2SA 1GGCL 1UB6A 5D71H 5IW3A 4TTDD 1OD7A 4OZHA 3HR5B 4JZJC 3HE6C 5FB8B 2LAAA 1IM3B 1BBJA 1EO8H 4JZNB 4PY7B 2EKSA 3HB3C 2M8XA 1MJ7H 2XZCL 4UQ3A 5F6HI 4BSVA 3G5VA 2BNRE 3F6LA 4IMKA 3VFOA 4WIQA 3DVNA 5DRZA 2GCYB 1DEDA 3QRGH 1NLBH 5TQ0L 3EIFA 5EO0A 3KYMB 4NSKA 4CMHC 3IJHB 1J0KA 3UDWA 3CLFL 2BOBB 5C07E 1I7UA 1FO0L 2DLTA 4NT6B 4D0DB 3RWDA 5HYIA 3BAEL 2E8YA 3QUXA 2YD1A 1D6VH 3RGVA 3G9AB 4OZFB 5EU6D 4PJBB 5T3XL 3VRJA 2JB6A 3PGDB 1MH5B 4YFEA 1JGEA 3VH8A 1A7QL 5BO1L 4KKBC 5EUKA 4I18C 3I2CH 3QCUH 3TJEL 5HD8D 4UINL 4ZAKA 5TDOB 3FFCB 3QUYA 3TFKC 4OLYL 4HF5H 1NGQH 4JCMA 4AEFA 5E6IA 1UACL 4MAYC 5DJDB 3MOAL 1N64H 1F3DJ 2ZSWA 5GGTA 4KK6D 5EU6B 3VA2C 5A3ID 3ALXA 3VRIA 2ITDA 2ADGB 5GS1A 3D2UB 1JI2A 3CMOH 2CQVA 3IDJA 5KOMC 3T4AA 4CVUA 4K3JH 3IAPA 5H94A 3C09C 1DTUA 2FZ3A 4U1SB 3ET9F 3OJMB 5DO2D 4WFGE 3KYNB 3MV9A 1NH6A 5EU4A 2LVEA 1UEYA 3QEQD 1YEDA 4XMPL 1U58B 1WT5A 4QXGL 4OZIE 3LKOA 4OD3L 3QXVA 1G7MB 1U8LB 3V5DA 4D9RE 3MROA 1MCLA 5EC1A 1PZ5A 4L8CA 1GOHA 1EGJL 1YEJL 1NCTA 1P6AB 1I3GL 4PPTA 1B0RB 2XYCA 4G6AC 2CLVB 4DGVL 2YPLD 4ZS6C 3ZE2F 2D4DA 5IWLA 3SGEH 2ZUQC 2PKDA 2WSKA 3QEQB 3IDXH 3SGEI 5C8JB 3TZVB 1K8IA 1XGUA 3ARTA 5CEZE 4OM1L 4OCWL 5HBBA 5IGXL 1YNTB 3GMLB 1FLRH 1FSKC 5DRNA 2BC4B 1JFQL 3RDTC 3FO2A 4BZ2L 5CCKL 1LEGA 2FX8L 2AJSL 3ZTNH 3B2VH 35C8L 4O4YH 4F3FB 5JXED 3NFPA 4L1DA 1LE9A 4HJ0C 5E7FA 1WITA 5CD3B 4OGXL 1XF5B 1G9NH 5JO5B 4FZEL 1C1EL 4G9DB 1F6AB 2VE6A 3SCMD 1Z5LA 1I9IH 2M2DA 3KS0H 1INDL 2ZKHL 3LKNB 2IBBA 3RNKB 3UTZB 4ENED 2A9NH 4XP4H 2UY6A 4ZFGL 4LKCA 5ICYB 4U1MB 4GJTB 5HYFA 1ZSDB 5B39G 4OZHE 2LE9A 1TITA 2X70A 5DK2A 5F9JA 4LVHB 1T1YA 2ESVD 1JGUL 2FJFA 1AKJD 5FYLE 4Z8FH 1I75A 3TJHC 1F4AA 5KVEL 4QF1B 4HK3J 4JKKA 4LNRB 4Z7WF 1UZ6F 4JDTH 4K9EH 2NR6D 1XGQA 2I9LB 2XWTB 1BFOB 4ZOCA 4G8IB 3UO1H 1JPFA 2VDMH 4JJHA 1F2XK 5DD3L 2C3XA 1N6UA 5DT1H 3S36H 4G7YH 3VXME 3MA9L 2A6KB 4OCLC 4XH2B 4QLRA 1A1OA 3VCLB 5IOPB 2V5SA 4NO0A 3P40A 2Y7QA 1UM5H 4PJ9A 4W6YB 4Z5RA 2DDQL 4JM2F 4M61B 1OTSD 2FGWL 3REWA 1ORQA 4RGOH 3QNYA 4MA1C 4I2XA 3O6LH 3SJVD 3EYOB 4JFHD 1T20A 2FSEB 5T3ZH 1DLHB 2LFGA 3NFSH 3PGFH 4GRLC 3SHSA 4YDLB 4NQTA 4ZUWB 5C2BH 4M7ZC 3V2AR 2EYSA 4EVNB 5ELIA 3BWAA 3N9GH 4M43H 4MNHB 5E2WH 3MLYL 1CGTA 3G6DL 3L3DA 1LVEA 3GHBL 2YA2A 2JKXA 1QVOB 2Q6WA 2NY7H 4XCFH 5IEHA 4YZFF 2DD8L 1DUZA 2QL1A 4PREB 3QJFB 3QAZB 4O9HH 5EU3A 2DRUA 2CDFB 4UTAH 1IT9H 3MLUL 2DKUA 3MV9E 5GPRA 3BKYH 4N8PA 1YN7A 3RWCA 1QQDB 5I73C 4LCCB 4OIIH 3SE3A 3OZ9L 4YXKL 5L2KA 5DQ9B 2OP4H 4KZEH 3HZVB 3ROLB 4XVJH 1EERB 2XRAH 4OD1H 1MJ8L 1YY9D 3PP4H 2W0PA 1ZHBA 2X42A 4QHUA 5KSVB 3L5HA 5L2JB 5J13B 4H5SB 1RV6X 1S78C 2DYPB 2QR0A 4ZTOL 1ZLSL 1PKQA 3GI9L 2F54D 4PJXB 1QBLH 2E9WA 5D7LB 3GUTB 3FONB 3BDYL 2C3GA 4BM7A 1HOCB 1VFOA 4JR9L 4WI4A 4H26A 1QFPA 4BA8A 3C5JA 3WMSA 4YPGA 4WTZG 4ZOBA 4NQCD 3P0YL 2OTUB 1CFSA 2V5TA 4N8VB 4HWUA 4CVZA 4GMTH 5C86A 3UTTB 1Q72H 1UYWL 4Z95L 1DR9A 1CFNA 3PDOB 4TRPL 5EA0L 5LJYH 4LEOA 2PCPA 4J3VA 4RGND 1G1CA 3OKYA 2BNUA 1S7XB 3CDFA 3ULUC 2RJMA 1YYML 3JV4A 3HI6L 3L9RA 4MCZA 3UTSD 1I1AA 3KWWA 1U42A 2J2ZA 2DWDA 1IAIM 5DS8A 4JKMA 4GRWF 1IC7H 4R3SA 4GRWH 1QA9A 3QQ4B 5H8DA 2CLZA 1S7QB 2GITB 2EO9A 1BQLH 2E27L 3ARED 4RGNB 2YD9A 1KGCD 3D87B 3KYOA 2DBJA 4OT1L 3NTCH 2GFBB 3OXRA 5FGCE 1JMZA 1RFDL 5DD5H 1RU9H 2GT9B 3VDAA 3U1SH 2GI7A 4PJ8A 1FG2B 2P49B 4HBCH 1VERA 2YXMA 4EI5D 3U0PA 3EFDL 4KUCF 2EC9T 2BMKA 4DN3L 4P23A 4HX1A 5EULV 4K23H 4I2XE 4DW2L 1W0VB 3GMOB 4MQTB 2RHEA 4ODBD 3TBYB 4KQ4H 1JGVL 3HS0A 2BX5A 4ZO7A 3QO1A 1AGEB 1OD9A 3RY6A 2VXQH 4X7TA 2R1WB 4EI5B 1QLEH 1FG9C 3P4MB 1HHGA 5EPMB 3NPSB 5C3LD 2D03L 2RAMA 4RMRA 1WBXA 5IF0A 2ADFL 1JPSL 1Z3GH 5DURD 4M5ZL 1KJ2B 4E41A 3O0RH 3UPRA 2PO6D 4UI2A 2ARJA 5FO8B 2ZG3A 3FOLB 1G6RA 1J5OH 3PHSA 3FHAA 1JZ3A 4XBGA 3QI9A 3INUH 4NUGH 1YDPA 4MGXA 1DBAL 5CLTA 4QTHB 4LASH 5L2KE 5DJ8A 5EBMA 5SWSA 3OKKB 4HMDA 3EUUA 3BH9A 3BHBA 5DURB 4DKFL 1OWWA 1W72H 4HCRA 5E0QA 3H9YA 2PO6B 3ZYIA 1CR9H 4PRHA 5I2IB 1S7WA 1I7RA 1PKQE 2CKBH 1E28B 3OKMA 4J3WA 5D2NA 4NRXB 1AJ7L 2DQCL 4HUUA 3A0OA 1KN4L 2XZQH 4HWBL 4Z7NF 4P2OC 4P2YA 5I1LB 2NYYD 2Z91B 5IQ7L 3LCYA 4AM0A 3HUJB 2P7TB 1HKLL 5JR1H 2OTWB 1VFAB 2B4CC 1OGAB 1KELL 3V5KB 4U31A 4G7VH 3EDKA 3KYAA 1VGEL 2AI0H 5DJZA 4GG8A 2L0DA 3VGEA 1EEYA 2DB8A 1DQTA 3V4PH 3GDBA 1T0NA 4Y1AD 3O2WL 3BP6A 1CLZH 1M7DB 4MJID 1FYTD 1FVEB 4HLJA 2VLKD 1K8DB 2WW8A 4Q2ZA 1AD9A 1EX0A 3F12A 1DBBL 4ZNEA 1YEHH 3KLHD 3CVIL 3DO7B 5FYJE 4MB5A 3HC0B 4DUVA 5IW1A 1PQZA 5IVZA 4B7LA 5KW9L 4DKEL 2VXVH 2P8PB 4JPIA 4HG4K 1U3JA 3FQXB 2LU3A 4Y1AB 4HIJB 4MJIB 1JJUA 4PJ8C 1YPZF 3TNNA 1WVZA 5FK9B 1VHPA 1T7XA 2DLEA 3GSNH 1HYSC 4KKCC 1FL5A 1WZ1L 1LE5B 2DQDL 15C8L 3O3DB 4P5TA 4QRQA 1T7WA 3S6CA 1NCDL 4H25B 2X4SA 4HULB 3CPLA 3OGOE 1AGFB 1CICD 5I1HL 4HW6A 3G5YA 2BXZA 1KEGH 1EEQA 1U0QA 3DLQR 1E4WH 4N1EA 25C8L 5TPWL 3DRQB 4AYFA 1RAMA 1MLBB 1RK0B 1CXHA 3B5HA 3O2VH 1KG0B 1DZBA 4HC1H 4ZPVB 2NX5D 1P5UA 3L1OH 4BH8A 4XX1G 4MD5B 3G6JF 5C9JB 1I3RB 4IM8A 3DIFA 1TNNA 1N4XL 4FQQA 4XZUA 3WCYA 4JFYB 5I8OL 1OB1B 1OAYL 2FYYB 5E94B 3TN0D 2PW1B 4ODUB 2WZPD 1ED3A 4QHLA 4E41E 1K2DB 1C5BH 1N2RA 4JREB 3MZGB 2EDLA 4ORZC 2OK0H 4YDKL 4HUVA 1OQXA 1IM9A 2Y06H 4FXGB 4XGZA 1HSAA 5TE6H 3C5SB 5LCVL 2JCCE 2J6EL 1O7SA 4GKZA 1GGYA 5SWSE 3IFOB 4ZFFB 5I6XB 2GJZB 2EZ0D 3S4SA 4P9MH 3U7YL 2B1AH 3FN0H 2VUYA 3A67H 4NHUB 4F7EA 2C1PB 4PRHE 5K33A 2YRPA 2OI9C 3ZHLA 1U95B 2BVYA 1A7NH 4CKVX 4YXHH 4NQDD 1NAMH 3VXPA 1FZOB 1N3NB 3PXJA 4G42A 5HHMD 3A6CL 4ODSL 5D2NE 5BJTB 1KJVA 3GMMA 4ZO8A 3H8NA 4OSUL 3ECBA 1L7TL 2EE9A 4KV5F 1FC2D 1S3KL 3QUZC 3RVTC 3JSSA 1G9MH 5IB4A 1ZA3A 2I60H 2ORBL 4KXZH 4KXZI 5HHMB 2VZUA 3MXWL 4M4PA 3V0WL 5GGUA 1IE5A 4L4TD 5AZ2H 2ICEB 4JPKH 3IJSA 3U0WL 4BSWB 2F74B 4IOFD 4CN1A 4LQFH 4APQA 1PG7X 4ZNEE 1KJMA 3WIHA 5B3JF 4QCIA 4HUMB 1SBBA 5DD6A 5MEOA 4PS4L 1JMXA 2AEQH 3IGAB 4HIEB 3LN5A 3EO9L 3SE9H 3GIVA 3JV6B 5KVMC 5HHXL 3BMVA 5F9WB 3GBMH 4L4TB 2QQKH 2BNQA 1T66C 4KJYB 4WWKD 4MNGE 5LQBH 3P30L 2X89D 2BDNL 3WFEH 4DWHA 5HVHC 1RZFH 4WEMB 5J1TC 5E8NB 4U6XB 3GSXA 5CBEB 4A2LA 3EOBB 1S7RA 1F3JA 1V7ML 4Q9BA 3LH2H 4X6CF 4LLUA 4PUBL 4D9QD 2P1YA 4N9OB 1UVQA 4GW4B 2OR8A 4NZRH 4X6DB 5TDNB 5J6HA 1QLRB 3FB6B 3IU4L 1QLFB 4MXWL 2XZAH 2WUCH 2R0KH 4PJGF 1I9JL 4P57B 1BVKB 4W6XB 2YPVH 3MMEA 3MODH 5HGBB 5D1ZA 4Z0XB 3KPQB 1T2QH 5ACZB 3IF1B 4NO3B 1U92B 4ODHL 4JG0L 3OAZK 5HDBE 5K59E 3UTOA 4HIHB 3O4LA 3MRQA 1B90A 4KKNA 1W8OA 3RUGB 3CC5A 2R2EB 1BIIB 3SDAD 1R3HA 1ZWIA 4WY7H 5IB5A 1FZJB 4MJ6B 3DI2B 3WNPA 4LLWA 2Q7YB 3QUML 4MNQA 4Q6IA 4HUWB 4LLVB 1VGKB 3MBEA 5BV7C 2R0LL 1DQJA 2J88H 1MCJA 2VLME 3VD3A 5I76B 4Y2DB 3G9VA 5HI4D 4I0CC 3S5LG 3GRWL 3GJFH 3P9LA 5GS0L 3ARRA 4JFPA 4M6ML 3ARWA 1YNKH 4DZ8A 3NFNB 3OAZH 3QFJE 1AO7D 5ERWB 5GIRB 4K94L 3QUKA 5FEBA 5DMYA 4PGEB 4O2EA 4F57L 3S88H 1NUNB 1T5XA 4H20H 3N50A 3GSVB 3D48R 3WFHA 3BN9D 1S9VB 3L5IA 4RFEA 5A1AA 4PJFE 4PYGA 5ESVB 1XAUA 1IGMH 4OLUH 1H3PH 3MJ9H 1UWEH 4CN6A 3LPFA 3MV8D 4BQBA 1MNUH 3G5XB 3D0LA 4JZOA 4LGSB 2HMIC 2AJUH 1PEWA 5T1DH 5FGRA 4XNQA 1NCBH 1SJXA 4YDVA 1A6TA 3H9HA 2V9RA 1U36A 1WBZB 2LU4A 5BVPL 2AGJL 3I02A 2NY5H 4P2RD 5LAXA 2GSGB 3MV8B 4D0BA 2V7NB 3E6FB 3GO1L 4FQHB 5DJ0B 4WTXA 1LO0L 3OX8A 2V5RA 2Y07L 5GGVH 4WFHD 2A74B 4ISVA 5FECB 4YUEH 5ADPH 4K8RD 1BEYH 2C3WA 5FCSH 3MRLA 4IJ3C 3OKLA 4WHYG 1MCCA 4JY6B 3WN5C 1QBML 3ARGC 4M1CC 2BNQE 1MAKA 4G6JL 4P2RB 3OKNA 1WWWX 2WBWB 5DGQA 2A83B 1I9RH 3H0TA 1H15A 3B9DA 5F7UA 4YGVB 1OTUD 1QFUH 1AQKH 3AMKA 2YSSB 4NQSA 5ALCH 4WI5A 5CJXC 2VAJA 3U9PL 1DSFL 4NKMB 2O5YL 3CZJA 4HK0A 4PR5B 1P84K 1ZGLA 3NZ8A 1U8MB 3RVXC 4V2BA 1MFDL 4YHLH 3UYOD 2QSVA 1RIHL 4WI8A 5J6GB 1LGVA 1AGDB 5EOCL 2H2SC 1XF1A 2IFFH 4HH9B 3FT4B 4NQVB 5EO9A 3BZEB 2UUDK 4GKSB 4HS6B 1JPGB 1BQHA 1KOAA 1GZQB 1ZA6B 4N90D 1OQOA 1TVBB 3MNVA 3TCLA 5J12B 2G5BA 1D9KD 5J8OA 3B5GA 5IJVA 3CXDH 4IDJH 4UDTB 4MNQE 3EO0B 4KJQC 4ESKA 5C0JB 1CU4L 1U6AL 3MOQA 1T22B 3U30B 3VXRD 3DUUB 3LD8C 3MZTA 1AI1H 3M07A 4GUPB 2C3VA 1NBYA 5TH2A 3IS1X 7FABL 5DEGB 3W11D 1D9KB 3EJYD 4B50A 5ITBH 3OPZH 5BRZA 1ZOXA 1NGYB 2FL5B 1ONQA 4MCYA 4PJ7A 3AS0A 3OQ3B 5FYJU 2UUDH 5ESAA 3GSRB 1CT8A 4NZDA 3CUPA 5KZCD 3DOSA 1QO3B 3VXRB 1AQDB 1MF2L 2VITB 4KI5E 4S1RL 1ZVSA 3VI3E 3L5XH 1WK0A 1FHGA 5EIIA 2V17H 1F6FB 3LV3A 1CFQB 2P5EA 2X40A 5D1QD 1CE6B 3QPQC 5C0GA 1MOEA 4KVCH 1A7RL 8CGTA 1P7KB 3Q5YA 4LPVA 1OTTD 2MKWA 4Q9RL 1G7QB 1U8IA 4LSQH 1IKFL 4N0CC 4QHMB 5T3XD 1FNSH 3HTLX 1DFBH 3GFUA 4M7JH 5KAQF 3VWJC 4Y88A 3HR5A 4Z7WB 4L8DB 2V2TA 5DJYB 5FB8A 1IM3A 4JZNA 5IVNA 1Q1JH 4C83B 4PY7A 3BE1H 4N0RA 4XAKD 2E7BA 4F33B 1G7LB 5F7NC 1C7SA 2Z0BA 4HZLB 4O00A 3WNMA 4P46D 3CH1A 1I8KB 2VKWA 4OFYA 1CGVA 1CVRA 2GCYA 4NUJB 1YECH 1FGNL 1UC6A 3NAAH 4JM2B 2R8SL 4M7LH 1IQDA 1FLTX 2BOBA 3ES6B 4MDIB 1MCOH 3DGCR 5JPMB 5CIPB 5ACLA 4WU5A 1FC1A 4NT6A 1I1CA 4D0DA 4JFED 2IJ0C 3CDYA 4OZFA 3QHFL 1FNHA 5KG9B 1QRNB 3PGDA 1MH5A 4P4KD 5C92A 3P9MB 3IDYC 4HV8B 4Y19D 5ID0B 5I1CH 4LK4A 4JHWH 5TDOA 5GISH 2D7TH 5IHZB 1NEZB 3MLZL 3UZVB 4A2MA 2AJZA 4JFEB 3CVHB 4M6OL 1PYWB 1SJHB 2BHUA 4IRJC 1QRKA 5EU6A 2WLYA 2ADGA 2DM2A 4P4KB 1QYGL 4I3SL 4XP6L 3VFUB 4N9GB 2LAGB 2Z8WC 1IBGH 3K2MC 3MRHA 4U1SA 5D72L 3NABH 2OZ4L 3KYNA 4HHAA 4K3DL 2R2BB 1U58A 5FGBC 4GAGL 1T2JA 1JUFB 1G7MA 1U8LA 2O5XL 5CZKA 3KPSD 4MB4A 2NY3D 4JRXE 5I1GL 1QOKA 5DC0A 3ZKNC 3MA7B 3DUHA 4P3DA 1B0RA 1O5DT 1ACYL 4YHPB 2CLVA 1E4XH 2ATPB 2P8MB 4XVUC 5D8JH 2N7AA 1V3MA 4HXAH 1E4XI 1ETZB 5HYJB 5BRZE 3DROB 1HCVA 3QEQA 4MS8D 4XNYH 4Y4KC 4YC2C 5TE7H 4PJ7E 5C8JA 1IGFH 3O8XC 4I5BB 1CD1B 2RQ8A 3GMLA 4C56D 5I1AA 2BC4A 3BZ4A 3MPCA 5DA0B 1NGXB 4NNPL 1NLDH 2QEJA 1J7VR 2R0WH 2YPLA 2P5EE 3SDDC 3MRRB 4UT6H 3LS5L 2QHRL 1XF5A 3SO3C 5JO5A 3L3IB 4G9DA 5L88H 1F6AA 4LFHD 4I0PD 2P44B 5CJQH 3TBTB 4YE4L 3LKNA 3HR6A 5CS7A 4NQEB 3RNKA 2HJFA 3ALWA 3WJLA 2IPKB 5FUCC 2CH8A 2EO1A 4KTEH 5ICYA 2UZYB 2XNAB 4U1MA 1MCIA 1ZSDA 4XC3L 4GRWB 4KUCD 5JXEA 2X4QB 3PWUB 3AB0B 1RZJC 2WQRA 4MXQC 4RISL 3ZLQC 2AKRB 3ZDZF 1L4IA 3SCMA 2EDWA 2NW2B 3EYSH 3VFMB 4QF1A 3WFBH 5INCA 1MCQA 2JELH 3RU8L 4ZS7H 1L7IH 5A2LH 5DMGC 2VXTH 4RDQG 1JHLH 5H37G 2XWTA 2MFNA 1U8OB 1BFOA 4KDTC 4J4PC 3ULVH 1AKJA 1A4JA 2CR6A 4U05A 4DGIH 43C9B 1LILA 3ETBF 2A6KA 3A6BL 1H3XA 1QSED 4XH2A 5IOPA 3NACL 1VFMA 3VU2A 3RKPA 4M61A 4L9DA 1OCWH 1JYVA 4K07A 4XMLH 1XZ0B 3EYOA 2FSEA 5DWUH 2ZOLB 1DLHA 1YEGH 3FKUS 4TSAL 3VFGL 1TJIH 4FZ8H 1OLZA 4ZUWA 2PXYC 1R3LB 1E4KC 1LMKA 1QSEB 1UJ3C 2W9EL 3E2HB 4EVNA 4KAQH 5E03A 4NZJA 4I3GA 4MNHA 3GMPA 4XCCH 5D6DA