1CQKA

Crystal structure of the ch3 domain from the mak33 antibody
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
101
structure length
101
Chain Sequence
PAAPQVYTIPPPLEQMAKDLVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Folding and association of the antibody domain CH3: prolyl isomerization preceeds dimerization.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords CH3 DOMAIN OF MAK33 ANTIBODY
total genus 18
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cqkA00
1MWAL 1D9KA 1JPSH 3DVFA 3MRBA 3D9AL 2DYPA 4APQD 4I4WA 2JJUA 3ZDZF 3SKOA 5JORB 3TBWA 3FTGB 4OM0H 2B7DT 2DLTA 2QSQA 5F3HB 1TZIA 2EKSB 3MXWH 5IW6B 3O6FA 3VXMB 2MPAL 4R9HA 4ZFFA 5DUBB 1UH2A 2NQCA 2R0ZL 2PW1B 1BZ7A 1OARL 4XP9H 4NRXB 3QH3B 1RVFH 1UGNA 5I1IH 1YYMH 3RBGA 2A9ML 3TV3H 1NFDF 3LY6A 5GS1A 2N4IA 4JHWL 4M7LL 1C12A 3AXLA 5SV4A 4LQ1A 3ARDC 3ECBB 5DJ0B 5A16B 1C1EL 4NHUA 3WFEH 4K7FA 5KN5B 3B9DA 3CU7A 2HN7A 3T2NL 5F3BB 4ZTOL 4DWHA 3MV7E 1LEGA 4PJDE 3STLB 3GB7A 4TVPL 1XCQA 1DN0B 3GEWB 3SO3C 4BFBD 1FFNA 4YR6B 4EI5B 3FO0H 4YUEL 3HI1A 1OB1B 4JQIL 3L3HB 5CD3A 4RX4A 1L9MA 2EO1A 2Y6SD 5DEFB 5GHWH 5GS0C 1CDBA 4KDVA 4L5FL 4WW2C 1KJVA 1HIML 1WLHA 4NQXA 3RVVD 3V2AR 4YEFA 5A2LH 4LOUD 3RGVB 2IANA 3A6CH 4L29A 5E5RB 1D5XA 1E4KC 1YNLL 5SWSB 2HT4D 4HZLB 2HT3D 1NUDA 4EDWL 3MRIB 4J3WA 5I1AA 3C6SA 1PY9A 4G8EA 4LLMB 3WL9A 4FXKA 1OAZL 4DFHA 2AJYL 2RBLA 4DN4L 3TN0C 4FTVB 2FR4A 2XTJB 4RWHA 5GIRB 3O3AB 1RD6A 5JXAL 5TQ2L 3SCMA 1RIUH 4NUJB 3N1MC 4MJID 3PWJB 2NXYB 4ONFH 4OI8A 3SDCB 4RAVB 1A6UL 4JM2D 4HPYL 1A2YB 1G6RL 4JO2H 35C8H 1T22B 4XCNA 1FYTD 2MQ3A 1YQVL 1PG7L 5D1QC 5DK3A 3QEQA 4N1HB 4PIRF 1FAIL 2VZOA 1JGUH 3MXVL 5D7LB 1PZ5B 1EO8L 3UJJL 3KS0H 4U1KA 4QTHA 1JCKA 2HN7B 3AS3A 3WS3B 4E9LA 4P5TD 2FHFA 3V6OE 3IKKA 5E8PA 1T0NA 3C8DA 2VDRH 2BJMH 1S7XB 3H7BA 1NGQH 1WCBB 1BM3L 3WFBL 5LGJB 4L8BA 4I77H 1M7IA 1A22B 5D6CB 4X5WA 3H7LA 2NW2B 2CJUL 1ONQA 5KOMC 1FFNB 1TZIB 2EKSA 1ZLWK 4H1LH 4I0KA 4XWGH 1SJHA 1EGJL 2AABH 4QRRA 3QDHA 2DWEB 2XFXA 3RJQB 4Y16C 2JJWA 4EN3C 2QADB 4PRAA 4Y2DB 4UU9B 4AIXA 1QRNA 1YPZE 4OCNC 5EBWA 3JUZA 2BSED 5DMGD 3UTSE 2UZIL 2H41A 2XG4A 4HUXA 3O9WA 3AS2A 4PJ9D 3FZUC 1XF3A 4PJXA 1R3HB 5EULV 1OGAD 4PFEA 5I15L 2VXUL 2EIEA 1T3FA 3W11C 2PR4H 5I1HL 2J4WL 2D2OA 4XT1C 1RULL 4WU5A 2IGFL 4FOMA 5I16A 4MLSA 5E70A 2R0WL 3ULUF 2BFVL 4YHIB 4WWKA 2VZUA 5CIPB 5IG7B 1QSVA 4LCWD 4PRHA 3UTPD 3OXSA 2DYPB 3RWGB 5HHOA 5IBTH 2NY0D 4KZDH 1NDGB 4KUCD 4M02A 1CGSL 2Z35A 5L9DL 3RY6A 3GJFH 3LQAL 5C0DB 1I4FB 1W8OA 4YIQA 1JZ4A 4I3RL 2DI9A 1AO7B 1QLEL 3NACL 4X7FC 3SDDB 4Z6AT 2ICEA 2PW1A 3OKDA 5ACZB 4FQPA 3KYOA 2KUTA 5LWYL 4X0KB 4NM4H 4MS8C 3EHBD 3AUVA 4BZ1H 4OT1L 3VFOA 4PGBA 3WJLC 4ZSOE 2P47B 2HTKC 3NCJL 3MBED 1MCCA 5JOFB 4IMLA 1CFSB 1FFQA 5DC9B 5DJAB 4BYHA 4UINH 2XRAH 3MBEC 3UC0L 2A9NL 1J0HA 1NC4B 1ROWA 4NWTL 3IS0X 4N1CA 4HK0B 5FK9A 3VGAC 3RJDA 3FFDB 4NQDA 4S1QL 4P5KB 4Y2DA 3B43A 1VENA 3P4OA 3KYKH 4LLUB 2ADJB 5IESL 4KXZI 2O5YH 2IG2H 4PJCE 1A4JA 4LQFL 3IKCA 2X40A 5C08B 4LARH 1F97A 1FZMB 5A2JH 1PEWA 3H3BC 4KI5E 3TA3D 4LPTA 3AAZB 1FNAA 2DM4A 3JWOC 4QOKA 2Q76A 4O58L 3MFGB 3G5ZB 5GXBB 2VZ1A 4S1DC 5DHXB 5J1SC 4TUJB 4FFVC 1IAII 2WWMC 4D9QD 1D5ZB 4G5ZH 4PV8A 1PG7X 4HXBL 3B6SB 1KTDB 2EE9A 43CAB 2GSGB 4XHJC 4BSJA 2X9XA 4G6KL 4I0PC 4P49A 1YEFL 2AV1B 1P7HL 1CFBA 3QIWD 4EUPH 2YN3A 5TE7H 1IZKA 5CINL 2VLKA 4NZJA 1C5CL 4M3KB 5B22A 2CKBB 4FNLH 1C7TA 4PJFA 5HYJA 4UQ3A 5EBWB 1QLRB 1D6EB 3HE7A 1OGTB 1N0XH 4YE4H 4BFGA 2JF1A 3VD4A 3T09A 4I0PB 5FFLA 1G7QA 2L7UA 4IMLB 3BE1H 4ODXA 4OZFG 3IJHA 4IM8A 5T1LA 4HS8L 4Z8FH 1OTSC 1KIQB 4LVHC 4D0CB 1AD0B 4MNQE 2XZAL 1OSZB 2FBJH 4HWEL 2FGWH 5IBUG 4Y19D 4HLZH 2FX7L 2EH8H 4JFDD 1ACYL 4PJXB 5E08L 2AJ3A 5SX4I 1NCDL 3ZHLA 4QRQB 3BEVB 5INDA 3GIVB 1T1ZB 4K3EH 3D0LB 3HC4L 2X89D 2YA2A 4GFTB 4YBQD 2XACC 3K1KC 5IHZB 1ZA6A 4ZS6D 1V7MH 2D7QA 4UTAL 3VI3F 1BWMA 4GOSA 5EOCJ 2DLHA 3G6JA 5A2KH 5ESQB 2IANE 3G5YB 4JRXB 3CDGB 1HI6B 1REIA 4PLOB 1EVTC 4URTB 4OZHB 1LNUA 4XVJL 3W5MA 1YQ2A 3MRKB 3VFSA 3DWTA 4M8QA 5C09D 2BY2A 5KJRL 4ODXB 4M43H 1ORSB 4PJDA 4TNVK 4UT6H 1NMCB 3PWPB 3L3IA 5CP3H 4XNMA 4JJ5A 1IKNC 3DYPA 4LCYA 5FUOL 5IHUL 3RPKA 5T1MB 4U2YA 4OLXL 4Z7WE 4F7TB 4LASL 5F89B 3DHJA 1LK2B 2LV4A 4HQQL 4YH6A 3CK0H 1T2QH 4Y2DD 2VXUH 4Z77B 1Q94A 3MA7B 4GO6B 1G7LA 4ZODA 2NY4B 3MX0A 2YSSA 1A3RL 4OLVL 2GSGA 1EUUA 1AO7A 1ZA3A 5ITFB 2VISB 4N0UB 2VXTL 4OF6A 3BWUC 2V5RA 3CNKA 4LCCB 4RGND 1FC2D 1RUML 4OCLC 1Q9WB 4V1DB 3WEXA 3FQTA 3O4OC 1FO0A 4Z7UE 3SKJL 2WBKA 3QUMB 3OZ9H 4YWGL 3IDGB 3KLAA 3VG0H 1SYSA 4YDJB 4NQDD 5EA0L 3K81A 2P8MA 2FLRT 5D2LB 5C0AE 1A4JB 1HH6A 4PRIB 2E3VA 1OCWH 4UIKH 3VCLA 5D5MF 5AZ2L 1OB1A 4KDTA 5I17B 4L8DB 4F9LA 4PREB 2GTWA 1UWEH 4GKNB 5ESAA 5GRXG 1FRGH 2EZ0D 3LEXA 3QO0A 3RP1A 1MI5E 4L3AA 1O7SA 4OZHE 1NC4A 4C4KO 4OD1H 4BQBA 4XCEB 4GW4B 3DUUA 5AG9A 3I85A 5HDBF 5D7JA 1NCAH 2QR0A 1VFBA 1YQVH 3NN8A 2LU3A 4ODSH 3DVNA 3MRNB 1W0WB 5IHBA 3WUZA 2QQLH 2CO7B 5DC0A 2QL1A 3MOAL 4UV4L 5GGUA 1CIUA 5BZWA 2PYED 2YOCA 4X4ZA 3BZEA 4QHNB 1OSPH 4LSUL 5DD3H 3GGWB 5J8OA 1JGLH 3HR5B 3QDMA 3OKEA 4MJ6A 3MLSH 4ELME 5EU7C 1E28A 4U1HB 3NAAL 5HYJD 3I6LE 1UXSB 3SE4C 1QNZH 4D9RE 4LPUA 2VISA 1SM3L 1KUMA 3K4AA 2VDPH 1Z9SA 5HHXL 3H6JA 4ZS7L 5C08D 1XH3B 4P2RB 3S35X 4O4YL 5FYLE 1OGAB 3ILQD 5CCKL 1S7TA 3BHBA 1N6VA 2EDDA 4O2CA 2W07A 4ODHH 4I18A 4OZGF 3U7WH 2DWDB 1D3CA 3EYVB 2YD8A 4JR9L 1G7JA 4U49A 3PQYA 1KNOA 5C0GA 1CCZA 1MCDA 4G7YH 1RZIA 1RZ7L 2F53A 5E95B 3SEPA 4AM0A 2H8PB 1MHEA 4LGPB 1E6OL 1UM6H 5EO1B 4PJHA 4JJ5B 4YC2C 1H3UA 4QRPA 4H26A 4PJIB 2APBA 4U6TA 4I0PA 2XXMB 2BOBA 4JM4H 1LNUB 5TFSL 3LEYL 4P23C 3RKDD 1K4DB 2Z31A 2YPVH 1EBPA 4K3JH 3O11A 4M8QB 2NW2A 5LCVL 2AXHA 4U05A 1ITCA 1O5DT 1F4XH 1TZGH 5DQ9A 3QIBB 1ZHNA 1MFAH 3OAYK 4ODSL 3QXDA 5JUEL 4Y4FC 1UA6L 2ED8A 5IHZA 4P59L 1S7UB 4MDJB 1YEGL 5DSCA 5JDSB 4KQ4L 2XQBH 5JLZB 3D85A 3MFFA 3QHFL 4MZ2A 3W5NA 3DLQR 4LLWA 3DNKA 5B38B 5DVNA 2HFGH 4U1KB 1U8LA 2VMFA 1MAMH 3HE6C 5C09B 3EDDA 5F7FA 3KPNA 2AXFB 1JF5A 3TJHD 1LK2A 3SDYH 5JXEC 1QRKA 2PW2A 5D1XC 5KBNC 1U6AL 4JRXE 4J4PC 1WSST 2H3NB 4JFQA 3RWEB 1CFQB 1CU4L 1VADB 5T1MA 4J1UA 3DXAA 1JPFB 5TDPA 5LBSH 1MIEL 1MCEA 1GPOL 1AI1H 1TZHB 4Z7QE 4WO4A 3RUGB 1HSBA 1LO4H 2VE6A 1Q72H 2IC2A 3VXRB 5I1KL 2DWEA 2XFXB 4J7RA 3QSKB 5CJXC 4U0QB 3P2TA 3RU8H 3L3DB 1FZOB 1N6UA 4KRMB 4QYOA 5JIIA 4YAQB 4N0CC 4U1IA 1XCTA 1T2QL 4HKJA 2IAMA 3QXDB 4ETQA 5JOFA 2DKSA 3LKQA 3GMQB 4LASH 4KTDL 4RMQA 3QQ4B 4LEXL 1QVOB 5HHQA 2JIXD 4YR6A 2ZCKL 2EE2A 3IDIB 3W9DB 5JHDD 1NUNB 1L0YA 2WUBH 4MA1C 3DMMB 2B1AL 2Y72A 5BW7A 2JB5H 5C0FA 3IETA 3O3EA 4LL9A 4CKVX 1QBBA 5JLZA 1ZT7A 4LDLB 3CFDB 4KTYA 1FNGB 3H3PH 5B39A 4Q6YA 4DGYH 4ZAKD 2IQAA 4R3SB 1PW3A 4UBDC 1KLUA 3QJHA 4FQHB 2EDQA 4DTGL 5HI5C 3LOWA 2WM0A 1QBLL 3HPLA 3IU3A 5IV2A 4OJFL 2XPGB 5GJTH 3L3GB 2Z91A 3SGJC 4Z7WA 5I9QB 3G6AA 2EKJA 4Q58C 2HTLC 4U1GC 4GAGH 2BDNH 2NPLX 1XGYL 4XTRD 1MHPL 2L0DA 1JYWA 4N8PA 1JYXA 4NQDB 3EOAB 1SBSL 2J5LB 4MNGA 4PJFB 4JREB 3S5LB 3L1OH 1DE4A 3ULSA 5HHVL 1YDPB 4C83B 1UQSA 5AAMA 1UM5L 2E9WA 4WTXA 5JW5A 2FO1A 4OFIA 5I16B 5KVEH 1DQQB 1J05A 1S9VB 4LSRH 3FO9A 5D5MB 4Y19A 2CDGB 1YA5A 1BFVL 3RVUD 3OKKA 2Z31D 4JZJA 1OQOA 3P4OB 3UTTA 4UT7L 3OF6D 2QSCL 4PJIA 4YAQA 3U0PB 2ICEB 4YXKH 4Z7UB 1TQBC 5FGSA 1KJ3L 3ZKXC 4LHUB 3OJDA 4P4KA 2D3VA 4ZPVA 32C2A 3MACH 3ECBA 5DJ0A 4JQVC 5JOEA 5IJKA 3HI5L 1MCBA 3OKMB 5L6YL 3QCUL 4GBXA 4KXZH 4DVRL 4J3OC 4FABL 2QEJA 3TA3C 5T3XH 3EYFB 3WYRA 2OI9B 1CXLA 2V2XA 5CD5C 2NYYD 3E6HB 1CD8A 4HFUL 2A77L 2H3NA 3RUGF 1VPOH 2W1NA 2X1PA 1RFDL 3VH8A 1CU4H 2YXFA 4I8DA 5AWNL 4QNPE 5C9JA 1MCOL 1WZ1L 3L95A 3QIBD 4NWUL 2IH3A 5CZVH 3ZHKA 1NGQL 2C4FU 3VXSD 1FL6A 3NCMA 4L1HA 3RIFF 2Q86B 4YDIL 3UYRH 5BJTA 4N9GA 4PJAE 2FH8A 5EU4B 1KJ3H 4L3EE 3V7MA 8FABA 2BCKB 2ZUSA 4FZ8H 4IBLT 1YMMD 5IOPA 5JPNA 1LILA 1WWAX 1PKQE 1WWBX 2D7MA 3P9WB 3QQNA 1U8MA 4OD3L 1HNGA 5LXGL 3AROA 3BKJL 2F5BL 3GMQA 1P7QB 2BXYA 4MVBD 4ZOBA 4M93B 4U33A 5KS9E 1DEEA 3PWNB 4NQCE 1WFUA 1JNHB 3HC3H 1FFOB 3VXUE 3C5JB 4JFOB 1JI2A 3T65B 1X7QB 5EZIL 35C8L 2VLJA 5D71L 5LJYH 4HCRL 3SKNA 4LLYB 1R3KA 2BK8A 1PKOA 4CU8A 4IS6A 3S7GA 2PYEA 2F58H 2LTQB 4GQPH 3EOTH 3GSQA 1WAAE 3G6AB 4GAGL 2D03L 2PCPA 4U1JA 1QLRA 4OT1H 4WFHE 4OJFH 1TENA 1DQJA 3RTQA 4DVRH 1TVBB 1WCQA 3DGGB 4P5TC 3SE3C 3WFCH 5LQBH 4FP8L 3F7RA 2VQTA 4IIQB 3TZVD 1X5GA 4F80A 1ZGLA 3MYJA 1B0WA 4L5FH 3E6HA 4D0DA 4C56B 3TZVC 3C5SA 1YMHA 3BIKA 4IHOB 3DV6B 2K9UA 4XP4L 3PWJA 3PWPA 2J88L 5B4MD 4GRLD 3CFKA 4X9GA 2EDWA 3N9GL 1IVLA 1MFNA 4WW2B 2QQKH 2WWKT 4JFDE 1ZKAA 3M1BB 3MRIA 3O2DL 1V3JA 1ZANH 2Q76B 3P30L 3RGVC 1I1FA 3HI6H 5EIIB 2GSIB 3BD4A 5AUMB 1NCBH 3QH3A 5FDYA 2J8UF 2XKNA 3FCTB 4TRPL 3LKOA 2W65B 2C1OA 4JFHD 4TSAH 1FNSL 5TH2B 4Y4HA 3MNWA 2J3SA 1XR9A 2V7NB 3TP4A 1R3JA 4EN3B 5J3HC 3LQMA 1D5MA 2UZIH 4HUNB 3ZE0F 3O3DA 4GMTL 2PYEB 5GGRY 3V4UH 3CDCA 2YD4A 1QRNE 1YPZA 1ADQL 1LEGB 3MXWL 1DUZA 4ZPTB 4LDEB 3T65A 3SY0B 2C7UA 4UQ3B 4PRHE 4Z7VF 2XTJD 4KV5E 1FZJB 4LIQL 5BMFL 1MF2L 3EGSA 5FV2A 4ISVB 3D2UA 1KC5H 5D5MA 4WTZA 2GTZB 4HKXA 2B1AH 3VRLE 4QHLA 2DJ4A 4YDJA 4WUKH 3S4SG 4WWKC 2VDPL 5CKGA 3QXAB 5E1AA 3VWKB 2PTTA 1HQ4B 4P46C 2ITCA 1MFDL 4HBQA 3NCYP 2ED7A 3DI3B 5I1CL 2R2BA 1M6OB 3L5WB 1FNEA 4GG6F 3FTGA 2HG5B 2FWOB 1WBYA 3VXTA 3UBXI 4GRWF 4NN6C 1JHTB 2A9MH 4X6DB 5ANMB 4ELMF 4F37K 4HZAA 4OGYL 1S3KL 4KROD 5E9DE 3MGOB 1BBJB 4RGNE 2EYSB 3AS0A 4WWKB 1N6QL 1EAJA 5BZWB 2ADJA 2CDEB 2A1WH 4JFDA 3JTTB 4CVXA 5HHPA 3LN5A 1NJ9B 3QULB 4E42B 2YUZA 5HPOA 3DVNB 4P48A 3NCEB 4U1MA 1A9EA 4M7JL 4CL7A 4NQDE 2I5YH 3ULVH 1CK0H 5CP3A 2IH3B 4KKAD 3O2WH 3PWUA 1NGWB 4XAKD 5FYJD 5KG9B 1JPSL 2GY5A 3RVXC 1MCQA 3TPUA 3LN9A 5D7LD 3C6LC 4H25B 2H26B 5ESAB 4NO0B 4Y2DC 5F88B 2X41A 3MRFA 1CFSA 3MGAA 4I18B 1FZKA 1FLRH 5D96C 5FYJU 1RUQH 4CVZB 4JQIH 1MF2H 1CGUA 4GRLA 1FLRL 3QBTB 5DZOA 3MYZA 3FAWA 3IVKA 2Q8BH 4P5KA 2XY1A 2R2BB 2G9HB 3OXRA 1SJEA 2XWJB 1JK8A 3Q5TA 2Z35B 3QUXD 3LPWA 1A1MA 1U8LB 5HHOE 4FQLH 3VXQA 5D96B 4Z7NE 3EHBC 4CNIB 3P4NB 1L7IH 2ITCB 1YY9C 4Y0GA 3V0WH 4Y16A 1WFNA 5CSGA 5BQ7A 4HCRA 1A6AA 2O26U 4HWNA 5JHLH 1QKZH 5E2WH 4D0BB 4ELKA 4X4ME 1RIHL 3TWCL 1FVEA 4MB3A 4ZAKB 1BBDH 3TT1L 2XZQL 4XC3H 3ET9F 4I2XB 3T8XB 1INDL 1VEMA 2D0HA 5FO9B 4NKQB 5DHVB 4IMKC 1HOCB 3EO0B 5C08E 1ZGLM 1BVLA 3LS4L 2PXYA 4AEEA 1WUNT 1NGWA 5MERB 3PIQA 4BELD 2DQJH 4KK8D 3CU1A 1BFTA 5HHNB 2VLRE 3IAQA 4N1EA 4F58H 2D0GA 3PNWB 2AJXH 5J1TC 3QI9B 3BDXA 1MRCH 4R7NA 3WIIL 3BIKB 4WUUE 1IEAA 4AM0B 2YUVA 3BE1L 4ZS7H 1XR9B 3HPJA 2NY0B 5AZ2H 3HRZB 1J86A 2IBZX 2I9TB 4ONGL 3EJYC 5FDWA 4M7KL 4HUWA 2AS5M 4YIQB 3IF1B 1AE6L 3DBXB 43C9B 2Z31B 4BQCA 3NPSC 4DJMA 1C5CH 2ORBH 3G5VB 5CJQH 5TE7L 3QWRA 1D5ZA 3F6LA 4PJHF 2OL3L 3QIUC 3QNYA 4WHTB 1I1CA 3TN0A 2G2RA 3AU1A 1RUMH 5AEAA 4Y4KD 1AJ7H 3W2DH 2A1WL 2G9HA 4M6NH 4ZUWB 3QNZB 1R3JB 4EN3A 1AY1H 3OKEB 3SDCD 2C5DC 4PYHA 3I2CH 1IGYA 1ZT1B 4HIIB 4M7ZC 4R90H 5TF1L 2XKNB 1FZOA 5LXGH 3UTSD 3CMOL 5GIRA 1XZ0A 4OLXH 2AEIT 1CQKA 4NZUH 2A0LD 5DD5H 3F12B 1MPAL 1NGXA 3EYOA 3QUYC 1Z5LB 4WHDA 1AGEA 1WBXB 3S98A 1HXYA 1JWUB 1D5MB 4NO3B 4XP6L 5DEGB 2XN9B 4DUWA 2B1HL 3RX7A 1MVFA 3PIQB 4KPHH 3MRCB 1WBZA 1I9IH 3ZL4H 5DLML 1YEKH 4Z95H 3MJ9A 1VPOL 1JMXA 5CD3B 3K74B 2EDEA 3CVIH 4X6EB 1OAUL 4HKZA 3QAZB 4UTAH 4XBPA 5E8PB 2NY5C 1D5BB 3S96B 4FQXA 5CAYB 3WFHB 4JG1L 1A47A 1U93A 1UYWL 4P9HC 2G2RB 2IFGA 1FVDB 3ILPB 4NDMA 1E0OB 3LRSB 2FCBA 3IT8D 5GS2H 1FCCA 5K9JH 3BDYH 2HLFC 1DLFL 1OLZA 1CT8B 2VAAA 5DSCB 5MENB 3H9SE 5J7CC 3CFBB 4WI8A 3HC3L 4IDLA 4GAYB 2AJSL 4KKLD 5IVNA 2OR9H 5F3HA 3IFOA 3L5HA 2IEPA 3H9ZA 3BD3A 4PB9L 3P73B 4PJCF 4JRYD 1UM5H 5F88A 5FYJH 1VKXB 3N1GC 2NLJB 5D1ZA 5D2LF 3FQUB 3T0EB 4P46D 5SWSA 1IGCL 4UDTA 2UZYB 1S7SA 3O6LH 1KPRB 4GXUN 4KRPB 3V7AG 4X9BA 4S0TD 3DVGA 4NQUA 3SDDD 3I84A 3V5HA 4PTTB 4LCCC 1FFRA 2HLAB 1EEYB 3NACH 4G6KH 1Q9OA 3VWJA 3GSXA 5L0QC 2WUCL 3G6JB 4LKXB 4TSBH 2EDTA 1MJ8L 2ED9A 2EH8L 4NO2A 4EN3D 5FIEA 3TZVB 2A6DB 2VDQL 3M17B 1NC4D 4C54A 3G6DL 5MENA 4OCYL 1JF1B 2KKQA 2E7CA 5DTFB 2W9DL 4LKXA 5CBAA 5FOBA 5HGAB 2DKUA 3QWRD 4X6FA 4M3JA 3UZQA 3ILPA 1GOGA 2YUWA 4ZSOB 5E7BA 3X13B 1ADQA 3VD3A 3VRJA 3ORJA 2W60A 2JTDA 3OKKB 1HDMA 3TH2T 4NQTA 4PLNC 5JHDA 3HNTH 5CJBA 1WBZB 2BVQB 1TCRB 2A74B 1WZ1H 3AVEA 5ERWB 2JCCE 4AIOA 4ZPVB 5FB8B 3FQTB 2DJUA 2R15A 4JGJA 5HHVH 1BX2B 2DRUA 5GZNC 3PQYE 2WQ8A 4JGMA 1ES0B 1WZKA 3ES6A 3D1MC 2Y36H 3G9VA 3DX7A 1LEKA 5CEZH 1RI8A 1Z0NA 1S8DA 3D39E 3QUKB 4R96B 4UZGA 1U91B 4AMKL 2C1OB 3CDGA 4L4TD 4N0YL 3VXSE 3FRUA 3WMSA 2NW3B 4X6BB 2FSEA 4X80H 5C3LD 1BIIB 2D9CA 3QDGA 5LWYH 3ULSB 3KLHC 1UZ6F 1HHGA 2VDRL 3GMPA 5HVHC 4WFGD 2ADFH 4PR5B 4MNHB 4P4RB 4JKMA 1BF2A 5L9DH 4FQIH 4OB5H 4LARL 3PP3K 8FABB 2QSCH 1U92B 1KFAH 4NQCD 2NY2C 3MBXL 1BLNA 4GKZA 4OCMC 3W82A 3UJIH 5BV7L 5E1AB 1YMHB 3F58H 3R0MA 1GZQA 2DDQL 4Q6IC 1SY6A 1J1XL 3U9UB 2A6KA 1KXTB 4S1QH 4MD4B 1V7NL 4HBCL 4LFHD 5ACMA 3K8KA 3OX8A 3M45A 3FOLB 4ETQB 2JJSC 1OAQH 2IQ9H 1UFUA 3L6FA 3T0XA 3BDYL 6FABL 2A6JA 5HVGB 3UC0H 5JQ6L 4NRZA 4PRBB 4JAMA 4DGVL 4XNXL 5K9KB 4G9DB 1RPQA 1MRCL 4D0CA 3BP5A 2FIRT 5JW4N 3VXNB 5INDB 4GW5A 4UU9A 3V95A 3RQ3A 4EEEA 1DANU 4G8IB 1F4YL 2PTVA 3QPQC 2ADIB 5HY9B 1HYRC 4YGVA 1NANI 4UUJB 5HXMA 4U1SB 4P3DB 3X17A 1ZHNB 1CWVA 5HYJB 4OZFA 1Q8MA 4NNXA 4XC3L 5FYLH 4Z7OE 1I9IL 2VZSA 5F6HJ 2ARWA 1RIVL 3EO9L 4KJQC 5CFHA 2Z8SA 3DETC 2AXFA 2BVOB 3VXRA 1B4RA 2X4PA 1P2CA 1JRHL 4BA8A 5DRZA 1XGUB 4JM2A 3MREB 3VRIB 4NN7B 4NZUL 3FHAA 1HKLH 3M07A 3NCFB 4Q2ZB 4PJFE 4MA7H 5FA3A 2ENYA 5FYKH 2YKLL 5D1XB 1P7KB 4JHWH 2A74A 5ERWA 2PR4L 4PR5A 1F45A 1JFQL 1RZJC 3ZDZE 4MQTB 3FMGH 5F8QC 4XBEH 1JE6A 1WZMA 4M9OA 2F5AH 2H9GA 1OSZA 1UA6H 1RY7B 4JQXA 4OF3A 4NNYA 2NY4D 1ORQB 2PXYD 3BGMA 4CW1B 2J12B 5IF0B 5BV7B 3MLYL 4AG4L 5FOBB 1KN2L 3P11L 5IIEA 4Z5RA 1I7UA 2OL3H 2AABL 3R8BB 3CFDA 2YD3A 4U1HA 3P3YA 2N56A 4MMXC 3Q6FA 4A2LA 3IDYB 4FQ1L 4MB4A 3LSOB 3IJYA 1HHGB 5F6HI 4MA3B 1T89C 4NQSA 3PGDB 1NKOA 1CIDA 3ZLQC 3BH8A 1V8HA 1DBJH 4ZAKA 1M05A 2QHLA 5DJYA 3VE0B 2VDKL 1CICD 4CVZA 4PD4J 1XGPB 3OL2A 2Y7QB 3TVMB 4R4BB 2AQ2A 4J3VA 3S88H 1U0QA 2FIKB 4KHXL 3ZYOA 4D9RD 3X13A 3RZCB 3OGOE 5I73B 2R56L 5DQJA 2APWA 4OUOA 5ALCH 1YDPA 2VKWA 4C83A 1A1MB 4BK4A 1YYLL 5CGYC 5B21A 2CIKB 4PBWD 3L95B 1FNFA 1S9XA 3QUXC 1OW0C 1MFEH 3U48A 4K71C 1G6RH 1A9EB 1AR2A 1WEJH 2VZTA 1UJTA 3IU4H 5TDNB 3V4VL 2DQUL 4QCIB 3GSVB 2X7LA 4PREA 1ZA3B 1TPXC 4NFCA 3TV3L 5CIPH 4AZ8A 3SGKA 1QFWI 4E41A 3LEYH 4CVXB 3IU3B 4RBPK 3KPMA 3KPQB 4DOHE 4Q9CA 1R24B 3W0WE 5D7LE 2HMID 3P0GB 5L2KD 3JBG7 1WWCA 1MCRA 4G8GA 4EDXA 1MFEL 5SWSD 3V0VA 2QR0B 3EGSB 3G04A 3W81A 5J12C 1E27A 3KLAB 3VXUA 1F4AA 5KG9A 3FB7A 2IAMC 5MHSE 4CMHB 5F7EL 1HIMH 4XNZB 5KS9A 2YRZA 1XF4A 4KKAC 3DVIA 3HZVB 1ORSA 3TBSA 1F6FB 5GRJH 4Z0BL 1MFBH 5D8JH 5I1EL 3U7AA 2Q8AL 1Y0LB 1DBBL 3DROB 4N5UA 2DL2A 5J11B 2UYLB 4PLKD 2HTLD 4HS6A 5J12B 3A67H 1M7IB 4P9HH 3ALWA 4XTRC 3SJVD 1N64L 4OAWA 3VXRE 2KZWA 4POUB 5K9QI 4UIMB 5J89A 1NPUA 1NDMA 5GGVH 5E0QA 2XTLA 1QBML 4RFOH 4HS3B 3DX6B 1BQLH 4KK5C 3OG6B 4PJHB 3KPSA 2AEQH 1AKJB 4Q7DA 1BQHB 1R0AH 5E2TH 2WIMA 2FX8H 4LPVA 5IIEB 4QXUH 3FRPG 4YBLC 3T1WA 3GIZL 1T0MB 1Y18B 1M7DA 4O5LL 2QSTA 2F15A 5HDOA 5E5MA 4PJEF 1NCAL 5EBLB 5GRVL 1U8OA 3JTSB 1KJ2B 2K3TA 1JFQH 2YPKB 4IOFD 3QJFA 1G7IB 4MXVE 4NJAL 3MOBH 1T83A 5F89A 3DV4B 4N0YH 4PJFF 4QKXB 3STLA 3LKNB 5HVFB 2A83B 3MLTA 2D03H 2I07A 4HS8H 3INUL 4U1NB 1T21A 4B0MM 4JGUA 1UB6B 2QJDA 3W39A 4AEIL 4JM2C 4YDLB 2ESVA 3BAEL 4HCRH 1NFIA 3QB7C 5GSRB 3H9HB 4HLZG 3SE9H 3RGVA 3L3KA 3RY5A 5JDSA 4R2GB 2BOCA 5C0JA 4B53A 2NY1D 3GSOB 4WHCA 5MP6H 4OAWB 5KVFH 1RFDH 1U8PA 4L8BB 1RK1B 1R6VA 4RMUA 2VLJE 3L3KB 5C92A 4Y4KC 2BY0A 2ZCHL 3U36A 5ISZA 5BQ7B 4LOUC 3DSFL 4NQCA 4FZ8L 1N7ML 3UYRL 5EZJA 3AU1B 1FPTL 3BKMH 2X9YA 2J6EH 3C2AL 1MHEB 1A14H 3N06B 4UAOC 3TBYA 4C56A 1WC7B 3G6DH 1PKQA 3MACL 3BPCA 3CSBA 3DURB 5E00A 4HG4K 3RHWF 3PJSA 1KGCD 3Q3GB 4Z78B 1SJXA 1MOEA 2XXCB 2DMBA 3SCMC 4JDVB 4P2RE 5C0IB 3MJ7A 2FX7H 3MOQA 4JDTL 3BH9B 3WNKA 2C26A 2IG2L 4Y5YA 5D2LA 4S2SB 4F9LC 4DKAA 4LGRB 1I8MB 1FCGA 4HJJH 2BXZA 1IBGL 3X11B 4RMTA 5I74B 5DTFA 5CBAB 5F7HA 4MCYA 2ADFL 2CMRH 2W9EL 1P4LB 4TUJA 1X5XA 3C5JA 1U8IB 3QDMB 1T1XB 3PL6D 3MUHL 3WE6B 3FB8B 5DEZA 3AY4A 1RK1A 4X6CF 4U7MA 1LO5A 1EJ6A 3QWOA 3CSYB 3I6GB 4Y2OA 1IGFH 4PJAA 3RWFB 1EGJA 3BGFC 5D6DC 3FQRB 1HZHH 1AXTL 4NZDA 3TBSB 5J6HB 4JHAL 4KZEL 3EW3B 5F72S 4X5XA 3H3PL 8CGTA 3LQAH 4X6DA 3N50A 5GRUH 2GFBB 4X5LA 4MJIB 4DVBA 3E0GA 1RZIB 4EDXB 5JIHA 4U0RC 3MJ9H 4E42A 5D7JD 1FYTB 1YY8B 4XPBL 5GJTL 1U8OB 1FP5A 2OL3B 3IFLH 3T0EE 4K3HA 3IFOB 2P24B 4Q97A 4KTDH 4PJ5B 2JELL 1S7VA 1BVZA 4ORZC 4U6YA 1YY8A 5F1IA 3LZFL 4R4FL 1X4ZA 1CLCA 1KCVH 4O2FA 3MRMA 4L3ED 1YEKL 1UCTA 3KYNA 3CZJA 1KOAA 1OW0A 2HG5A 4NO0A 1MCOH 4HS3A 1FNGA 4ZUVA 1YNKL 5GGRA 4LSVL 1ED3A 3RX8A 2OTPA 2PTTB 4UILL 1OP9A 3UAJD 4BH8A 3D0LA 3VG9B 3K4DA 3KYNB 2F54D 5CJ5A 4WI6A 3ZKNC 5C0FB 5EU6E 3P4MA 3WO4B 1U36A 1AFVL 3ROOB 1U2CA 2M2DA 3WS6C 1M71B 1N26A 4JDTH 5JMOC 4XVUD 2AW2A 4NZTL 2NX5D 2PYFB 3BMWA 1CFTA 1XR8B 2RFXA 1DUYA 3MOBL 2NY7L 1BEYL 4Z78A 1A3LL 4OZ4A 3R4DA 1W72A 3WFBH 2V2TB 3MR9A 3ISWA 3S5LA 4WHYH 1T1WA 1DL7H 1QHPA 4LPCA 4BSVA 2F53D 5FO7A 4PJ9B 4M6NL 5EBMA 3GZKA 3BI9X 3FZUD 2E8ZA 4UNUA 4JHAH 2FX8L 4N0CD 5FYJL 2NLJA 1HQ4A 2F8XC 5KS9F 3MLTB 3T3PE 2BMKA 3MRKA 3VFSB 4JFEB 1VGKA 2ESVD 4MSWB 2R0KH 3BP7B 2H2PC 5J1AB 1MVUB 3SDAC 2GT9B 4H5SB 4PJ9C 4MX7B 1Z3GH 4ZS6C 4N5EC 1KV3A 3LS5H 1F4XL 1TZGL 1WC7A 4ZUUA 4TQEL 3BPOB 3P9LB 2HJKB 4Q2ZA 5JXAH 5FA3B 3QZWA 3LMJH 3V8OA 3JV4A 1VEPA 1WGOA 5GGSY 4LRIC 1LEIA 1TZHA 3D18A 3U36B 3SGJA 1JRHI 1TVHB 3GMPB 5E8DH 3MZGB 2HJLB 4POYA 4S2SA 4HZLA 4W4NA 4JPIA 5EFIB 1X4XA 3A6CL 4I1NB 5ABDE 1QHOA 3TIDA 4P59H 4X6BA 5JUEH 4I3RH 4GRMB 1PYWB 4U1IB 5FF6B 4LP5A 2NY2D 1U8PB 4I3GA 2JIXA 3TVMC 3HPJB 2FHBA 1I8LC 1OP3H 3P77A 4F7EA 1JGDB 3TVMD 2XA8H 1A14L 1BFSA 1NBVH 4LCWA 1L0QA 4PRHD 3RZCC 5I73C 1KENL 1LE5B 1EH9A 2BSRA 3VD9A 2IPTH 3DSFH 3FT3A 1VFUA 4LNRB 4NRZB 4YLQT 2X6MA 2WWKO 1EEQA 3L7FA 4JO1L 5ETUA 1JWMA 3A67L 2P5WB 3WDJA 2F19L 4HSQA 4MX7A 1Z6JT 5ALCL 1HE7A 3VFRB 1RURL 3BQUB 5C1MB 5K59F 3ARGA 4CVUA 4KPHL 1BZ7B 1GC1H 3SJVB 3TJHC 5I9QC 1JWMB 3MRJB 1I1AC 1VGKB 2IALB 1M71A 2D7TH 1LO4L 4NUJA 3MV9E 1K3IA 3OKNB 4FFVD 2DKMA 1KB9K 1T5XB 4OM0L 3C09B 4KC3B 4LHJB 3G5VA 4JO3L 4D9LL 4XWGL 1JGVL 2Z4QB 4LF3B 4K7FB 5GS2D 1H3TA 3QEQB 1AKJD 5D7IF 3UZVB 2ZUVA 1U6AH 3O9WC 4IRSB 3RWCA 2OJEA 1R24A 2X4NA 2F54A 1DVFD 3TH3T 2RFXB 2YA1A 4PGZA 1BZ9B 1AGDB 2ZSWA 3MOAH 1MAML 5KSBE 4CU6A 5FYJE 4X7CC 1J05B 1S9VA 3E8UL 2UV3A 1LE9A 1NSNL 5J56B 1M05B 3BD5A 3ROOA 1FAKT 2AJXL 2AEQL 4PJ9A 2ZUTA 5KS9B 5I1LA 4FFWD 3NN8B 4HK0A 5FK9B 4RFNC 1EO8H 1N0LA 4KY1H 1OWRM 4WI7A 5E2UH 2R56H 3MRQA 5GRZA 4NO0D 2OSLA 4OFVA 5DD0H 1NDMB 4JO1H 4C56E 2D4DA 1FRGL 5DJ6B 5FYKL 3P9LA 3HUJF 3WIFA 3JWDL 3B9AA 1TJGL 4LRIA 2NYYC 1P4IL 3BYTA 4LVNC 3PHSA 3VXOB 4RAUA 3UAJC 1NBQA 1ONQB 2HVKB 2AI0L 2CDEA 3E3QC 5HHOD 5ESVA 1QZ1A 1E4XH 2R0ZH 2AAVA 3MNZB 2BRRH 1NAMH 1IAMA 4MJ5A 1EO5A 3RTQD 5I71C 3QRGL 4XH2A 3K46A 3OMZA 1MLBA 5D7IE 5AYUL 5GJSH 4L8CA 3ZMRA 4FFZH 4QGTA 4NC1C 1JHKH 1TFHA 5LVEA 3H9SB 3SGEH 4K2UL 5T1LD 4HH9A 3V4UL 5IROA 1RIHH 1RUQL 5JHLL 4HC1A 2O61B 2F74B 1MFCL 5I2IA 2JKXA 3CFCL 4OCXH 1KSRA 3WN5C 4KK6C 1J8HD 4EOWL 5ICXB 1FN4B 2IQ9L 3VJ6A 3QDJB 1A8JH 2H6PB 5AG8A 5K59E 4F57H 3WJJA 4GW4A 3QFJB 4R26L 1JHTA 2ZNWA 3RY6C 4YHPB 4JRYB 4MS8D 2EYTB 1TQCB 5DD0L 5AAWA 1YYLH 1NBVL 2VE6B 3CFCH 2EZ0C 4OCXL 1T04A 4XVTL 3DHMA 3BGMB 4CW1A 5KJRH 1D5IH 1E4XI 4QRUB 4L9LC 4PJGA 1CL7I 4GRWE 3FT4A 4Q0XL 2C1PA 5DS8A 4KTEH 5EOTA 3V6BR 1LD9A 3FO2A 5MHSD 4XHQA 5HGBA 3CX5J 5C0ND 4ODTH 4YHZH 1FORL 4PJ8D 2DICA 4GUPB 4G8FA 3F7VA 5EFIA 4LK4A 4XCCH 2EDYA 1QPPA 1CXKA 5JZ7C 4OD2A 1KCKA 1OD7A 2X1XR 3D2UD 5C09A 4L8CB 1UKQA 3FFCB 2NR6C 2X4UB 2V2WB 4WCYL 3VXRD 2NY2B 2C3XA 1SMAA 4N0UA 2ICCA 2EDRA 2CD0A 3K2UL 3QPXL 5CIPA 5IG7A 2A83A 1OCWL 1UJ3A 3NFPB 3V6OC 4QHLB 4UILH 3STZB 2ENSA 1X6LA 1QG3A 3WO3B 4PJ7B 4RRPG 1N59A 3LQAC 3UTSB 4G6AC 4OGYH 5CP7A 1LO0L 3FMGL 2C7UB 1RZGB 5L88H 4K9EH 3UTQB 1PZUB 5KTEL 2XZAH 2VO5A 3MBXH 4KGLA 2A2QT 2DLFH 3BO8A 1HHHA 4F7CA 2BOBB 4Z8FL 1CG9B 1VSCA 4HW6A 2IPTL 3KPSB 2VXTH 5FYKE 1YZZA 5DURD 9CGTA 1CE6A 4G6FB 2KBGA 3AM8A 5A40E 4ELMB 4F15B 1MHHA 4J3XA 3CSYA 4WI5A 1HOCA 3EO0A 1CDUA 2QADC 4E0RA 1EDQA 1TXKA 5EZOH 2YD6A 4J3UA 2YRPA 3TF7C 4PRPB 4U6HA 4H8WL 1JZ5A 5EUKB 5I1DA 3V5KB 2Y23A 1NFIB 1GZQB 5F7KC 2WBJA 3EYSH 2C1PB 5DS8B 5FM5O 1CLZH 1ZA6B 5FUCC 3K1DA 4MD4A 4QT5B 3SN6N 1NEZA 2ZG3A 1KCRH 1HILB 5H94B 1AR1D 1FJ1B 4CJ0A 3V52L 2CLRA 5JNYA 1DTUA 1LO3L 4N68A 3IAPA 3DMMD 2VLJD 3S35H 3E2HB 2FGZA 4EQ3A 3I3BA 4QF1A 4TULH 3LV3A 5KW9L 2F19H 4JLRB 5DRNB 4JFQB 3LZFH 4R4FH 4G80A 5MEPB 4IJ3C 3QEGL 1IKNA 3H2WA 1F58L 4RAHA 4HWUA 5DWUH 5T3XD 4HBCH 3ULUH 3BPCB 2FECL 4PJ7E 5IESH 5DFVD 1GZPA 4G43B 5L0QB 1ZLUH 2JJTC 5DUPH 2OR9L 2R39A 1JF6A 2F58L 4PGJA 1I3RB 3GK8L 4ZDHB 1FL3A 1LP9A 3DUUB 4FTVD 1OGTA 4TSBL 5J9PA 5E2VH 2VKXA 3EFFA 1WV7T 1WTGT 2D4FA 1FN4A 1ETZA 3VH8B 1BREA 1B2WL 1IEBA 5J13C 1KYOK 2P46B 4X80L 1K3ZA 5FGBC 3T0DA 5F7WC 4FG6D 1HDMB 3QHZL 3ILQC 4NBYB 2R9HD 1N7MH 7FABL 5DZNA 2RHEA 4FRWA 1Q9LB 4XXCA 4AQOA 3KPMB 3EOYG 3RI5K 1DQQA 2J8HA 4NM4L 4I2XE 1K6QL 1U8HB 5CS7A 4DKDC 4KWUA 3WE6A 3T77A 4AL8L 3RIAK 5DJDB 2WP3O 5FEBA 1UWXK 2CRZA 4ORGB 5D71H 2FEEI 5CJ8A 1KCUH 2NY6B 3WLWD 3OJDB 1CD1B 3GUTB 3WEXB 5C9KA 4QHUA 4K7PH 1BQHG 1MLBB 2DI7A 1MLCB 2ZOLB 1FIGL 2ARJB 1KIRB 2UWEA 1KTKE 5CEYA 3P73A 2KL6A 5DQDH 5HHOB 3BMVA 2W0FB 3WJLA 1SY6L 2GJJA 1KIUA 3ZE1E 4JQXC 1IM3A 3VH8G 5FO8A 4PJGB 5T3XL 2N1KA 1FYTA 2EXWD 1GGBL 5DA0B 1F00I 2B20A 4N0UE 3WIHA 3CAFA 4XVUC 4GH7B 1SVZA 5DK2B 3B2UC 1LDSA 3MLVL 2EDOA 5M7QA 4NO2B 4YHPA 4BKLB 3L3OB 1KPUB 3HE7C 5MERA 1L4IA 4YXKL 1AR1C 1DBAL 1EHAA 4QHNA 5T3ZE 4PRHB 4NZTH 4MA1B 4AH2B 5JOPD 4PJXE 1G84A 1FBIH 4Q6IB 4RGNC 1I3UA 2O5YL 1SYVA 4Z7VB 5LBSL 4MNGE 2MCG1 2F54E 3O6MH 4HXAL 3RL1A 4D9QE 4X98B 4F33A 1WCBA 3O0RL 1QPXA 3NMEA 4JZJC 2DTSA 4HPYH 5BRZB 4W4OC 1NDGA 1I8KA 3O45A 3LSOA 4CN4A 2AK4E 4FA8A 3DGCR 2VAJA 4QY8A 2CUMA 1NUFA 1I7UB 3GSWB 1T5XA 1MJ7H 3CDFA 7FABH 4F58L 4QT5A 5INCA 3D69A 3LKSA 3SHSA 4RFEB 2XZCL 1OD9A 1YEGH 4JPWH 1CFQA 4OBRA 4PJDF 4JREC 4QCIA 5DURB 3D2UB 4K71B 2UWEB 4BFIA 3UTSA 4XZUA 4XPTH 1MWAA 1N2RA 5B39B 3BH8B 4HPOL 3TT1H 1IEBB 1GIGL 1KB5A 5E2TL 2ZKHL 2WBJC 3KR3H 5E94B 1IQDA 1ZLVK 3VRIA 3IDMB 4HX1A 4MNQD 2YPVL 5TQ2H 1RMFL 3TNMB 2JLLA 3JSSA 1KEGL 4H1LA 1CGVA 4HDIA 5D2NA 3V0WL 5J11C 1U8HA 4JY5H 1HNFA 3S96A 4F7EB 3TYFA 5C71A 1CDGA 1QBLH 1QSZA 2IAMB 5IGXH 1OAKH 2B2XH 3I02B 4P9HL 1CDCA 4NQVB 1IGIL 4Q9QH 1W72H 1DVFC 5IJVB 1IEHA 4TTDC 5GHWL 2ATPB 3KPSD 5ETUB 3W0WA 4KK5D 4U7KA 4P9MH 3RAJL 3U46B 4Z7NF 1MQKH 5MEPA 2V9TA 5ADPL 2BHUA 1SMOA 3TIDB 1GHFL 2MCPH 5CEXB 1Y6MR 3SCMD 1K4CA 2IAND 4QRPB 4PJ8A 3D18B 2J8OA 3RWJA 4ZXBB 1GZPB 4G43A 4K8RH 3WUWG 4QRQA 1B0RB 3HCVB 5EIQA 3ULVF 2FHCA 4CN6A 2QADD 4R90L 5TF1H 2VR9A 1G7MB 1OSPL 3KPNB 1DDHA 3LB6C 3RPIA 1OTSD 5INCB 1BLNB 4GKZB 5I1KH 2MPAH 3MV11 5CEYB 4FFYH 4GLRI 1PG7W 2OTWA 3N1FC 2XKUA 5C6PB 3IJHB 2Q3AA 1CD1A 4XVTH 2Q8BL 1T0PB 2H8PA 2W0KA 1VFMA 1QSFD 4X7EC 3B5HA 3DIFA 1JHLL 1UEYA 5E6ZA 4MA7L 4R26H 4P2OA 1YN7A 4QRPE 1UCBH 3JVGA 4R2GD 5C0JB 1PFCA 1KG0A 5CBEA 1BD2D 4JFDB 3O6FB 1NGYB 4NKMB 1J18A 4J3TA 4AH2A 4Z0BH 5D1ZD 3OTTA 4NYLA 1RIVH 4FQ1H 4MZ3A 4G9DA 3UO1H 1T04B 3B9KC 2UZXB 4KK9D 3WLBB 1BQUA 4WI2A 5GRVK 3QFDB 1U3YA 3PWLB 3ARYA 4JN1H 3I9GL 5DHVA 5IF0A 2MHAA 4ZUTB 1NL0H 4KDTC 3SDXA 5F6IB 1TTUA 2W38A 2PYFA 5KSUA 2IQAB 1P1ZA 4XNXH 4HH9B 5D1QB 4C56D 2DQHH 4GRWH 4GMSL 3T1FB 3BH9A 4KAQH 5KVDL 3DXAE 1A21A 1OAQL 2V2WA 3VFPB 4XNYH 1XF5A 3G5XB 3BPLC 1F6AA 4I4WB 2Z8VC 1SJEB 4G7YL 1ZANL 3O2DH 1A6ZB 1AHWA 4W4OA 1TCMA 5E2UL 3GMRA 5DRXA 4OCRL 1DLHB 1EVUA 1MFCH 2OMNA 3QULA 1NJ9A 1NUGA 5F1IB 2Q8AH 1K4CB 1DP0A 4XGZB 3RWFA 3D39B 1NSNH 3LH2L 1G7LB 1YEEH 3MCLH 4Z7VA 2VJXA 3FQNB 3Q1SH 4QRUA 4CDHA 4YNYB 1EEZB 1YEHH 4JY6A 1DBJL 3LD8B 2HFFB 1DE4B 2R69L 1YN7B 3D3VB 4NQSB 1KJ2L 3KPOA 3TO2A 2VXVH 1FO0B 3RWJB 4FQQA 4U1LA 1JGLL 4HHAB 1J8HE 4HJ0D 3TYFB 3VGDA 3ZSSA 3QDJA 3MV9B 3ULVD 4OLWL 4IDJL 5LAXB 4PGEB 3RFZC 2P1YA 2R2HA 4JANA 3QEUB 3BIBX 5I2IB 3BZFB 5KSBA 5BO1H 1G0DA 4ONHA 5IJVA 4YFDB 2K7QA 4M62H 1A7QH 4TNWK 2P5WE 1Q0YH 1PYWA 5T3ZL 2DDQH 3DO3A 2ZCLL 1X5LA 4KY1L 4L8SB 3VXSA 2DQCH 4X4XB 3RL2A 5D72H 2YPLA 4NFDA 5SX5H 3CFKB 32C2B 4MJ2A 4NCDA 1MAJA 4KHXH 5E4IA 4OZFH 3BESR 1KTLB 4W6YB 1UWEL 3FT2B 1P9MC 3N0PB 4N8CH 5KZCB 3OAZH 4OKVA 3MPCA 4HKZB 2WK2A 1ZWIB 1CBVH 1XZ0B 3KLDA 2OMBA 3VG9C 4F7PA 4ZOAA 4PD4K 4GAYA 3O4OB 1RZ8B 1IGYB 5BMFH 3VFRA 4IRZL 2P5ED 4CJ1A 1H9VA 4JO3H 3BP7A 4D9LH 3RDTD 3EO1B 3WXVL 1KGCE 3GMMB 4R7NB 4J3SA 4MCYB 1M1SA 3H8NA 1NGXB 3F12A 4LSSL 3C08H 4HXBH 3DYMA 2EDLA 1H8SA 4JRXD 5EU4A 3BVNB 3TT3L 3LRGA 4NN5C 4OLVH 2LABA 3VFTA 1ZGLB 4Y5VC 1RURH 3BO8B 3JV6B 1U3HA 3KWWA 1MI5A 2BNQA 3RA7L 2ID5A 2KZ1B 1B3JA 4PRNB 3RWCB 1RZGA 4PJBF 2ADGA 3KVQA 3REVB 2C3VA 4P4KC 3JWOL 2YC1A 3VU2A 3HI6L 3J7HA 3PWPD 5IHUH 3KPQA 1GYAA 4CAGA 4LSTL 2IBBA 5KSBB 4PB9H 3MV01 3QHZH 1F11B 2V2XB 2GYSA 3H0TA 2AK4B 3MRLB 5KSAD 5CZVL 2L7JA 4RMSA 1F8TL 4DKFL 4YBHA 1R3KB 3UJIL 2P42B 5TE4H 2IMNA 5DD1H 1P53A 1CD9B 2ARJA 2R1XB 5JQHC 3QDMD 1MJ8H 3MV8B 5IVXF 1NKRA 4RSVA 1T83C 3FONB 3GGWA 2X4TB 5DZLA 4MQXD 3CH1B 3C9NA 1JP5A 4UI2A 5KSVA 3MLUL 3NH7L 3DGGA 5LQBL 4RGNB 5C08A 2WZPD 2GKIA 2E7MA 1U8MB 1J8KA 1K2DB 2LU4A 4FMKA 2E6QA 5L2JB 5LAXA 3ULUL 3OR7B 1UADC 1BP3B 3GSVA 5IB1B 1A6AB 4GJTB 3Q0HA 3O6KL 2ESVB 3BZFA 4U3XA 3RKDC 3ZDXF 2VLKE 1XGTB 3FQXB 5B3JF 1LEIB 3L3JB 3QI9D 2NZ9C 3ZT5A 3VW3L 3I75A 4L3CB 1BX2A 1KXVC 3T0ED 3U2SA 5KN5A 2D31B 2YMXH 3S35L 4FXGB 1KNOB 5C0GB 1V7NH 3O6ML 4HXAH 1KULA 2YPLB 3VFPA 2H2PD 2AV1A 2ERJB 3MO1B 5HSFA 3ZKND 1IM3B 5FO8B 2HFEB 5JZ7D 5EDXA 1H3GA 4PGBB 2ZCKH 4OSUL 1XIWB 3VFUB 4GG6B 2WLYA 2OJEB 3N1QC 3O41B 1AKJA 5T5FH 4PGEA 2X4RA 4YHNA 5F9DC 3KXFD 1WITA 2G5BB 3IRPX 4TNWF 4ODWA 3VXQB 1G6RB 1JGEA 1UYWH 2GITA 3OJMB 3SQBA 1F42A 2Y5TA 1GGBH 3O3UN 4GSDL 4YHNB 4AMKH 1AP2A 2G5BA 1Q72L 4H8WC 3TNNA 4ONHB 2J8UA 3GMOB 5C0CB 4WVRA 5HYFA 1AFVH 3U6RA 1G9NH 3QQ4A 5HHQB 3PHQA 3S37L 1BECA 3W11D 2H45A 5EIVA 1E6JH 4LEOA 1DVFB 2BNRA 2FATL 4FN0A 3STBA 3U4AA 1YNKH 3Q5YA 4K8RC 1JWSA 5H35B 4QXGL 1S7SB 3QCUH 2E7LA 2I26N 4M00A 5EC1B 1WJ3A 3VW3H 4O00A 3FOMB 2ESVE 5IT2H 2BJML 4LPWA 4G7VH 2DLEA 3BJLA 3PWUB 5I1LB 4FG6C 2E9IA 4Z7WB 5DD5L 4G6ML 3EYOB 1YJDC 4K07A 3LN5B 3IVKB 2FLBT 3CMOH 4O2FB 5HYSA 5IVXE 5EO0B 4ZXBD 3QHFH 2VLLA 1JZ7A 5CKAA 3UJJH 2VSCA 2XQBL 3KYKL 4NNXB 4EXPX 1QO3B 3DETD 3MJ7B 1H0DB 2KDGA 1KYOJ 4YGAB 1I7RB 2AKRA 4M1CC 5E2VL 1A4KB 4Y5XA 1U95B 3EDJA 1A6UH 1HXMB 4D3CL 2Y5TB 3QISA 3MV8A 1N5AA 1XGUA 4JM2B 1AXTH 3MUGA 5EZLB 6CGTA 5DUPL 2GFBA 4RFOL 5I66A 4JG1H 4NQCB 4R2GC 4U6YB 4G6JL 5D9SA 3T0EC 3MCKA 4HGWB 4OUUA 1E6OH 3V6OA 5D7LA 1I8MA 3KYMB 1Q94B 1HEZA 2P8LA 4M7KH 1U9KA 4OQ1A 4XPGL 3LDBC 3WNPA 2C3VB 1UC6A 2YZ8A 3EYUL 5IKCA 2P7TA 1ZHLB 1U8QA 3PJSB 5I1DB 3Q48A 3QEQE 1LO3H 4QRRE 5LG1A 4WFHD 5C86A 3QDJD 3C08L 3U2SB 4B5EA 4UAOB 4WY7L 4MXVF 5B39G 1CGXA 2DQJL 5F1NA 1JTOA 3C6SB 5D1ZB 4G8EB 4CUCA 4LSPH 2R0WH 5CEXA 4L4VD 2Q3ZA 1IQDB 1B9ZA 1MFAL 1SJHB 1TQCC 4RMWA 5E24E 4K3JL 4OZFB 1CK0L 3VJ6B 2J5LC 1NLBH 1XEDA 1NC2D 3OKLB 5HGHA 3PGCA 2OCFD 3L3HA 3C8KA 2F74A 3U4EA 2L4OA 3MCG1 1KLFA 1K8DA 1XCQB 4EBQL 3LRSA 5D1QD 4N9GB 2ZCHH 3TBTA 1XF2B 4AQ1B 5JW4Q 1YPZF 5I66B 2BC4B 4JFHE 4R8WL 4DQOL 3LIZL 1U95A 1JN6A 4OD1L 1F6AB 5DLMH 5GGTH 5F71A 3WHE1 4ODHL 1EV2E 3HMXL 2W65A 3ZKXB 1MY5A 1MWAH 3BP4B 5FDWB 4X7SL 4WI9A 5J1AA 3BQUD 3S3JA 5IMMA 4UB0H 3IDXH 1EFQA 1HH9A 3KNBA 2JJTA 5HGBB 2GHWB 1BJ1H 4LLYA 3WUWA 1UXSA 3DRTB 3MRHB 4QWWC 1MJUL 4K3DH 3UPRB 3NFNB 1WBXA 1T66C 2DI8A 4NJAH 4EXKA 1HHHB 4LLQB 5FO7B 5EG6C 1ITBB 1YC8A 2XA3A 3C5SB 4V2BA 4Y5XB 3TO2B 1NCNA 5HYEA 4PLJC 4IMKA 2CLVB 1W72B 1UM4L 4ZG1A 3KDMB 1FNHA 1EEZA 2OX5A 1ZE3C 4EI5A 4JO4H 5DJZB 2QHRH 4CVWA 2FB4L 4F15C 4OGAD 1N6QH 1RSFA 3B83A 4LEOB 4JM2F 1S8DB 1CLYH 4KHTH 4PRIA 1PX4A 2EIDA 5DO2C 1FYHB 2BNRE 1RJYA 1L7TH 3SDDC 5GGVL 2DS4A 2WW8A 5EZLA 2EEDA 1WEJL 3WN5A 4OI9A 1QYGL 3EFDH 2XNAB 4BKLA 4ZUVB 4IRJA 2N7BA 2X4OB 1V05A 2GITB 3NZHH 1JWSB 5H35A 1KENH 1BQSA 4UT6L 4ENEC 4B7IA 2YZ1A 3BW9A 2EDHA 3PABA 1KPVA 4M03A 3T0VA 3ZKMD 2FL5B 2DMKA 1J8HB 4PV9A 4TTGA 3VXOA 3UTTE 3MRNA 4XRCB 5C0CA 2BMKB 3VD7A 3OWEA 3S37X 3HNVL 3KYAA 4ZTOH 3ZKMC 1QNZL 3C6LA 3VWJC 1IC5H 4DZ8B 5I6XC 5B38G 5J13B 3EFFB 5E8DL 1F4WL 3GSNL 2BRRL 4K94C 5I8OL 4YXHH 1JPGB 5CEZD 2D7OA 1FL3B 1LP9B 2ZUXA 3T0AA 4MXQC 4XPAL 3MV8D 2DN7A 2EIBA 1U3HD 3UXFA 4GG8A 4DZBB 3CK0L 6FABH 5J4MA 1G1YA 3RWHA 1MY7A 4PS4H 3V4VH 1JGDA 4OF5A 1A1NA 2NZ9D 5E08H 4F8TA 5EZIH 1HI6A 1D9KC 4RRPA 4X6FB 1BZ9A 4OBSA 2FO4B 1FNLA 1S3KH 3H9SA 2R0KL 4AJ0A 5D93C 3PV7A 3ZE2E 2FWOA 4PGCA 4KKLC 1C5BH 1WBYB 1A6ZA 1AHWB 4QHUB 3T04D 4KVCH 5GZOD 1FQ9C 4RDQF 4Z7WF 4GKSA 5DHVH 2JCCA 4FQCH 4HDIB 4LCIL 3KNBB 4PG2C 5ESVB 2WQRA 5EN2B 5DYOA 2O5ZL 2ZUWA 1OT1A 2QTEA 2OP4L 3OPZL 4EQ2A 4X6DF 4CGTA 4OKDA 1A3LH 2W0FA 1V7ML 3VG0L 1MQ8A 4Z77A 5FAAA 2RQ8A 1XIWD 1LDPL 1AD9B 3DOSA 3FFDA 3ESUF 3DURA 3GI9L 3DUSA 5E00B 1JI1A 3BIAX 1NC2A 5MENE 2CLRB 1T89A 2Y36L 3TBTB 4YHMH 2BSTA 1EO7A 3O3EB 2CRIA 4G8IA 3KXFB 2OBGA 4HUVB 3CFJA 1EAPB 1ACYH 3T77B 4X8XA 3EO1A 5FOJA 1I85C 4N8VA 1WZLA 1ND0A 4M5YL 4BH7B 3A6OA 4P2QD 2FBJL 3ZKSD 1BZQK 1I1RA 4XB7A 1YN6A 4XCFL 4NSKB 1KCVL 4F33B 4JFFA 4LLDA 1LO5B 4OD3H 1MREL 3UYOD 5IM7B 1C5DA 4M1GL 4PJBB 5BS0B 5ANMA 1MFDH 3BEWA 4LIQE 4M5ZH 3U9UA 3JZ7A 1K85A 1CXFA 3IFLL 1U8IA 1BFVH 4WUKL 3RUGA 5BVJB 3UBXG 3UPRA 2W9DH 5DR5L 3QXVA 5CMAA 4YC2B 2OZ4H 5JA8B 1G9NC 1FGNL 1DANT 1KC5L 5IMKA 4JRWA 3GIVA 5E94A 4P23A 1ZTXL 2VDML 5FYLL 4NKOA 5M95B 3KPLA 3L1OL 4X9IA 4NQEE 3HE6D 5LGHL 1AGCB 1ZT4B 4LSQH 4WEBH 4BFIB 4BK5A 4XZUB 1OM3H 2EDKA 2ZPKL 5FV1L 5C0IA 4NKOB 2VIRA 3IDUA 4J8RA 3EYQC 4XP5H 3TC9A 1S7VB 1IM9D 2VWEE 2R2HB 4P3DA 3PV6A 3HRZA 1X5AA 2VXSH 3NFPA 3MLXL 2VN4A 2MFNA 1EAPA 3EOTL 2ZUQB 5A2IH 2BZDA 3IDIA 3W9DA 3MNVA 3VGHA 3BZDA 1W0VB 3HA0A 4KU1A 2BVOA 5IWLA 4Z7UA 2WBJB 1CE1L 5BRZA 3IDJB 2J1KA 5E56A 4LQFH 1RUKL 2A6JB 3P30H 4NSKA 4IRJC 1MCLA 2R8SL 1IAIL 2H6PA 5T5NF 2NZIA 3X3GL 5DGQA 1DVFA 1YC7A 5C0BD 1LD9B 2NY3B 4I48A 4MAUL 4NPYB 1T6WA 4YBLB 5EN2A 4XP4H 2LAGB 4RBPH 3V6ZB 3LKPB 4ZNEE 3V5DB 4KRPC 1J7VR 2YPLE 3HC0A 2AEWA 2R1YB 1FL6B 2BX5A 2Q86A 2G5RA 1KIPB 4NT6A 4QGYA 1FE8L 3OV6A 3MLZL 3HG1D 1D6EA 1N0XL 3HE7B 4YE4L 4YO0B 3TESA 3MJ6A 4NWUH 2X4QB 5TJWK 1ZVYA 4LFHG 3OGCB 3F7VB 1ZHBA 3RWDA 3BDBA 1ZEAL 4ZXBC 1CDIA 2F8OA 4HV8B 1QLEH 5DI8A 2FJFB 1J8HA 1J0ZA 3ARFD 1LO2L 4OLUH 2H2SD 4YEEA 4PBVC 3FO2B 3WJJC 4JDZA 3AC0A 1VGEH 3QEHA 3OBAA 2Q20A 1VESA 5JTWA 3H9YA 3C60A 1J11A 3ULVC 4OIIL 2X05A 4NBZB 4KROC 2KPNA 4GKSB 2YWZA 4GLRH 4HJGB 4WENB 3U0WL 5GGQL 3LEXB 5CILL 5FHAL 1CICA 4Z7VE 2EYTA 4JFOA 2IADA 3SOBL 3TCXA 1IGCH 4RGOH 3S3SA 1HHKB 2NY1B 1MPAH 4BUGA 2JELH 3INUH 3NIFE 2IGFH 4WUUB 2GCYA 1BAFH 1U42A 4UT7H 1KG0B 4DOHB 1IL1B 1JPST 4I48B 4DZBA 3QIUB 1UXWB 1XGPA 5C6WH 4WNQB 4WUUA 2MHAB 3HAEG 5AWNH 5EWIL 4OCWL 3PGDA 1FG2B 4F3FA 1AJ7L 1MHHB 3O6FD 5T1DH 2WUCH 2VQUA 4KZEH 5C0CE 3SE4A 1JTPA 4NKDB 1RZKL 4ZDHA 2RIKA 3DYOA 1EGJH 2BHYA 4YQXH 4RQQA 5IB4B 3FQUA 3CCHB 1F3DH 5CGYD 5I17A 4TPRH 3LKOB 2FJFA 3ME0A 2VIRB 2EE3A 4J8RB 1LO2H 1BWWA 5EU3B 1BM3H 4ZFZB 4DTGH 1QR1B 3PQYD 4E41B 3K7UA 3NTCL 1JZ8A 4DGYL 1I9RH 1NEZG 3H3KA 2JJSA 4JR9H 4FFWC 3L7FB 1CICC 3VWKC 5BRZD 2Y07L 3V6FB 3WLBA 4F37F 4LU5H 4L4TE 1BD2B 3SY0A 3GSQB 5E6YA 4X7TB 1OT2A 4O4YH 1YEJH 4XP6H 3H42L 4KFZC 5DT1H 1HILA 4UTBL 5E8OA 3DARA 3SJVA 3G08A 1JNNL 3WFHA 4HIHB 3T2NH 1KB9J 1A1OA 4H20L 1MRFH 5CSBA 3WFEL 3V5HB 1A7NL 1MCIA 2Y25A 1UXWA 4HKBA 5HHME 3K2MC 5IMMB 3BJ91 3RPIB 2HFTA 1U3JA 5HJ3A 3BP6A 1I7TB 1JV5A 2AQ3A 3TCLB 5I1HH 3TWCH 4WV1B 2HYMA 3DUHA 2P8MB 4AT6A 1MHPH 4P0DA 5J6GB 2ZP0T 5L7XL 3VXMD 3HE6B 1SEQH 1NQBA 3GNML 2AJYH 1JNLL 1I9EA 5B8CA 1KELL 1FNEB 4J6RL 5F21B 4UV4H 2BC4A 3RNKB 3E2HC 5C7XH 4GKNA 4GAJL 3TJEH 3EJZD 2DIJA 5ISZE 5IBUB 2BSRB 2GEEA 2H1PL 4RISL 3QEQD 3U4EB 3PP3H 1B0GB 4FQJH 2FECI 3CUPA 3CVHA 3KJ4B 4PJAF 3BP4A 3AREA 4OCSL 3FOLA 2ICWI 1U8QB 5JHDB 1RZJL 2E6PA 3FO0L 4YUEH 4NQVA 2JB5L 4UOW0 3CUPB 3CVHB 3SDYL 2MQ0A 5C70A 2WBJD 4K94H 2HT2C 4ONGH 2I60L 2WUBL 2DQEH 1YY9D 3FFCE 4QY8B 5IMLA 5CWSA 3KG5A 4HIEA 3FT2A 2VDMH 2HJLA 1JYVA 2BVEA 5F1NB 2R23A 1MHCB 3FB5B 2X4SA 3MLSL 4QRPD 1BQHA 1TNNA 2LTQC 2EC9T 2VH5L 4OTXH 3V6ZA 4UMGA 2NX5B 1BD2E 3D3VD 5GS0H 3GJFB 3U46A 5CUSL 1LWRA 5F9AC 1FORH 1ZLVH 1HQRA 4P5TA 3SE3A 5C0NC 3WKNA 4K9EC 1KJ2A 2FSEB 2CRMA 1INQA 3GSOA 1QR4A 1EIBA 3L5JA 1QBAA 1ZVSA 1SYVB 3I6KB 1NBZB 2DTML 4U31A 1GGIH 4U1SA 4AYFA 3L3IB 3CFIC 1MNUL 2ITDB 1QKZL 5E2WL 1CXEA 4HGWA 3NIDF 2NY5H 4JFXA 5FUCE 1WTLA 4MWFA 4K23H 4QLRA 3VGFA 1JPGA 3QHTC 3BKCH 1I8KB 5IB2A 4JAMB 1QSFB 2PO6D 1N64H 3GBMH 3WFDH 2IFFH 4RWYL 1IILE 4F7PB 3NPZB 4PJEA 3HFML 1OQXA 5FO9A 5DUBA 1RU9L 1Y18A 1ORQA 3LKSB 1URLA 1TITA 3U6RB 5EA0H 5FYKU 3QJHB 5FCUL 2Z31C 4LIQH 4RQQB 1S9WA 1J1PH 4Q9BA 3IFNH 4M48L 3AB0C 2Z93A 1UEMA 4OIAA 1SM3H 1JUFA 2ICWB 3LS4H 3TPUB 4X6CB 5C0EA 1MIML 2X4UA 5GZOC 1IM9A 4LLVA 4Z5RB 1CGTA 1NEUA 1N5YL 2Z93B 1RJYB 4XXDB 5HDLA 4X5XB 3SGDI 4RDQG 1J5OH 1P84K 3QRFM 3TVMA 4K3EL 5EU3A 2WBWB 3DRQB 4KQ3H 1OARH 2DM2A 4TSAL 4XP9L 1DUYB 3GSRA 2HA1A 3SDXB 3MRFB 4RGMB 3IU4L 2GK0A 4LDOB 1TJGH 2WIIB 3KHQA 3C60C 1OP5H 1NCBL 3ARFC 3MO1A 2V5SA 5K33A 2C4XA 5DUMH 3VMOA 1U3HC 4AIZA 4LVOC 1AP2B 4CN1A 5DJ6A 4LPXA 3EBAA 1BOGA 1EFXD 2QQQA 4GBXD 3N9GH 4LRNH 1AQKH 4Y4HD 3QIBC 1F3DJ 1D7FA 3WNOA 3QO0B 2WINA 3W0WD 4ACPA 1XGTA 2J8UE 3SGKC 3L3JA 2ZUYA 3L5IA 5L2KE 2X4RB 2P5WD 1CL7L 4LCWB 1LE5A 1DQDH 3M8OL 5IFHH 4NKIL 1EJOL 4MQSB 4ELKB 4OZGA 1KB5H 2GK2A 5HHXH 4LVOB 4NZRL 3QNXB 1CDJA 3D39A 3X3FH 3S34H 1IAKA 1KEMH 1I1YB 3THMH 3QO1B 4OZGB 4IRSC 5SWZD 4JKPH 4MNQA 3SQOH 3NZHL 3SKJH 5CEZL 1IM9B 3GBML 2CLZB 4HLJA 5B4MC 2PYEE 2EE6A 3SJVE 5F96L 2ZUUA 4ODWB 5DMKA 1EBAA 2D7TL 3RZCA 3OKNA 1PSKH 4LAQL 2P5EE 1L6ZA 3B5GA 4MD0B 3QQ9D 1NAMA 2LQRA 3MYJB 4NOBA 4I18C 4PRPD 4EUPG 5HYJE 2GK0B 2G60L 2V6HA 2YC1B 1JL8A 5TQ0L 1A02N 1S5IL 1QSFA 1G0YR 3QWOB 1JBJA 2F5BH 3HCVA 3UJTH 3EDKA 3QCTH 1LP9E 3ARSA 4DAGH 1PDKA 1KCSH 1RK0A 3ARGC 5E6IA 1AIFA 1DJSA 3BWAA 5CUSH 3IS1X 4NRYB 2PO6A 2VXQL 1JRHH 3IGAB 4L3EA 4HC1H 4Q9RL 4UIKL 1WICA 3OR6B 4K3DL 3TA3B 4MXWH 1AIFB 4LHQB 2YD9A 5BOPA 4OV6F 4E41E 4DCQB 5CZKA 5KANI 3RVVC 2EYSA 3HKFA 3B9KA 1G7IA 1J0YA 4ZAKC 3ZDYE 2NX5A 4DK6A 5I75B 3WFCL 3ABZA 2E7HA 4QF1B 2FJHB 1H3VA 4GMTH 2ICWA 4OZGE 5IOPB 4HUVA 4DQOH 1CYGA 5EU6B 4IHOA 1F3JB 1UKTA 3I50H 4WEMB 5JQ6H 3T4AB 4LCUA 2VLJB 5BVJA 1CGSH 1G7JB 1LK3L 1CF8L 2YHGA 5E4EB 2NY1C 4L8SA 3VXSB 1EPFA 3QQ9C 5A1AA 1L9NA 2CUIA 1QO3A 2AJUH 5T1KB 1F6LL 1J5OL 2XT1B 1NGPH 4H5SA 3GSXB 4U1JB 3KPLB 5HYSB 3SGEI 3IB4A 5CJOH 2J88H 1T0MA 3JV6A 3QPQD 3DX6A 3O3BA 4I9WD 4XVJH 5EO1A 1G9MC 2QQNL 3QCVH 3TBWB 3DTXB 4ZD3L 4XVSL 2JB6B 3MRDB 5ISZB 5I15H 4FQQB 2GUOB 2X70B 2X89A 3DV6A 2NXZB 4LU5L 2CKBL 4NNPH 4KDWA 1I9JL 4XPHL 1HINL 1ZHLA 3UPAA 1K9TA 2YPKA 4UQ2A 4U2ZA 5DRWA 3ARDA 4D0BA 4A6YH 3M1BA 4NUGH 4XRCA 3MCKB 4OUUB 3VMNA 1QTYT 2R2EA 3WXWH 1NCDH 5ICYA 1Y0LA 1GRWA 2BERA 3DROA 3Q6GH 4KKCC 4OV5B 4W68A 1MUJA 3OAZK 1XFPA 1CICB 2UUDH 1I8IB 2CSPA 3MMEB 1K8DB 1YEIL 2DIBA 2JCCF 4HUKB 1UKSA 4QOKB 4D3CH 2X1QA 2DTMH 5JHDE 2YPLD 5T1DL 4GRLB 3SKMB 3F5WB 2NW3A 4NCC1 5EC2B 4CMMA 1V3MA 4NQXB 2H32B 3HG1E 2V7HA 3MLPA 1Q9OB 3DVGB 3V4PL 1KLUB 4FQHA 3RVTD 3GHEH 1ZS8B 3QAZC 3CPLA 1JVKA 4LSRL 3WIFB 3S5LG 3ZYIA 1FZJA 1X5IA 3VXMA 3SKOB 3OGCA 1CDYA 4FMFA 4HFWA 3JUYA 3QG6B 4LLMA 3WL9B 3HUJB 1G6VK 1HN1A 4X99A 3TBYB 2I27N 4EI5D 4HWBA 3V8CA 2DQEL 1B4JH 1P4BL 2V17H 1SBSH 3QG6A 3WD5H 5DJAA 3U0PA 1V3LA 1AXSB 5CJQL 3SDXF 2BVUA 3T0WA 4EI5C 3RUGE 3IDNA 4EDWH 4OLZH 5F1KC 4IOSD 1HHKA 3GDBA 4L8SC 2IPUG 3PL6C 1VHPA 4XI5C 1CGWA 4IRJD 3MGOA 3MLWH 5F3BA 4ZYKA 2HKHH 1ZT7B 3QUZC 5J3HD 3BUYA 3WSQH 2CKBH 1JWUA 2BHZA 1PQZA 1C16A 4ZYKB 5L7XH 1IKFH 3CLEL 4IIQC 2EEBA 3AAZA 4HIEB 2HKFH 1CI5A 1FJ1A 5KVEL 1JGUL 4LHUG 4ZD3H 4GXUM 1PG7H 5IR1B 3L3GA 3QXUA 2DD8H 4PP1C 4K8RD 4BSWA 1GL4B 1PGRB 4YHKL 4YPGB 5EOCH 4ONOA 3OKLA 1KPVB 2HFEA 5HGHB 2M1KA 5JXED 1JNNH 4ISVA 3U7YH 3P0VL 4ONFL 5KSAC 3KDMA 2PUQT 4G9FE 4X83A 5HYQA 5DFWH 1NGPL 2P48B 2R29L 3MLRH 2VABB 1B0RA 2VB5A 3SCMB 5DJCA 5E8EB 3E1F1 1F3JA 1CE1H 1P7KA 2IJ0C 4ELMA 1X44A 5I1GH 3MTRA 3Q6GL 4PJHE 4AK1A 2VRAA 4MWFB 5C6TH 5GQBA 4IOFC 1RZ7H 5SV3A 1GH7A 5DRZB 4JVPA 3I50L 3OR7A 5EB9A 1MJJB 2J6EA 4POZD 4APQB 3I6KA 3WIHH 3ARDB 4BZ2H 4R7DB 4WHYG 3WDIA 3QT2A 3OHXA 3CFBA 4NNPL 4KI1A 4N0RA 5F9OL 4HEPG 1ETZB 4F8QA 2P4AB 1WT5A 5BXFA 2XWTB 1T0NB 4KMTL 1P4BH 2V17L 2EH7H 5HHMD 1DR9A 4N8VB 5JMRA 1T1YA 2YS4A 3QCVL 1FHGA 5T1KD 3HN3A 4Y16B 2XWBB 4MQ7A 4X7TA 4LCCA 1DQML 1TVHA 2K1MA 1NCCH 1UT9A 4LVEA 3MNVB 5ITFA 1RULH 1NMBL 5CWSB 1T1YB 4KMLB 3VXME 4MAYB 4EI6A 4OM1L 2VZVA 4GG6A 3U30B 1YYML 3I2CL 4KQ4H 4XB8A 3ULUD 3S4SA 3KJ6L 3GSNA 1AY1L 1PD6A 1TETL 5H8DA 2AV7B 5DJ8B 5ISZD 1DDHB 1PLGL 5DFTA 3GHBL 1AQDA 2CGRH 12E8H 3F8UB 4E0RB 4KUZL 1DQLH 3DJ9A 3O9WB 4KUCF 2C3HA 5IB3B 1INEL 5MI0B 1BQLL 3OAYH 2AK1H 3NFSL 1ZMYA 3HC0B 3TT3H 3RGVD 3O3BB 3B3IB 1Z5LA 2E7BA 4HMDA 1PSKL 3QUYD 5F8RC 1D5XB 2DBLL 5DJCB 5F96H 4Y4HB 1JNHA 1T2XA 1GVIA 4X5WB 3KS0J 3MRRA 2GT9A 1A6VH 4PJBA 4RFNB 5E5UB 5BS0A 1H5BA 1DEEB 3PWNA 4M1CD 1HEZB 2R4RH 3DSNA 2COQA 3KPTA 1YN6B 1KBGH 3NZ8A 4RA0C 3D3VE 4JPIB 1FVEB 4HIHA 4APQA 5DJXA 3GMOA 3A6BL 5I19H 2P5EA 4NO5B 1KLGA 3KXFA 4TUKL 1MCJA 4XMLH 3UDWA 1A0QH 1MHCA 3FB5A 2QBWA 1EHLH 5D2LE 5C0AB 3T08A 1AD9A 1N5AB 4JO2L 4HIXL 4M7LH 3VXUB 1QFUL 4QOKE 1BBDL 1JUFB 3GSNB 4NFBA 4LRNL 4LSUH 2IMMA 5DD3L 1I7RA 3EAKA 3QXAA 1EZVX 4JFYA 2ATKB 1OGAA 4MHHG 4ZTPL 4DN4H 3KYMA 1QSEB 1RUKH 3K8MA 1MI5D 2AP2A 5GGSA 1JPTH 1CF8H 3D69B 1B0GA 4M1DL 4P46A 1GOHA 1WVZA 2DLGA 2VLLB 1B6DA 1SYSB 4XMPH 4PJEB 5M94B 3TFKC 2V5YA 3IXAB 5FUOH 1P5VA 5I0DA 5I1JL 3GRWA 3J8F7 2MJWA 2JCCB 1GAFL 1H8NA 4ZNCD 3HMXA 3U7WL 2R1YA 4KJPD 4R97B 1KJ2H 1BOGB 4XX1G 4UBDD 4JY6B 3ZYZA 5TGBB 1QRNB 1IAIM 4PJ7F 5CCKH 5I8CB 4TVPH 1IJ9A 3N1PC 3LPFA 2V7NA 2ZJSH 3ETBF 3O11B 4PTUB 1F90H 1SJVA 1J1PL 4PJCB 5TH2A 2AGJH 3D25B 4X6DE 1SQ2N 2Q6WB 3UTZB 5KVGH 2OK0H 4ZO7A 5I8CA 4XHJD 4KV5F 4MGXA 4U3CA 4OKVB 5BV7C 1V3KA 2H26A 1QEWB 3WKML 2RJMA 5GS3A 3BSZH 5HI4C 2Q7NA 4DZ8A 3ULVL 3C8HA 1JJUA 1I3VA 3GO1H 4MA8H 5I1IL 4Y89A 3IDYC 1KJMB 3NFNA 5IW1B 2C3GA 4M1GH 3T0EA 2EDBA 4IRSD 3ZHDA 3OXSB 1A7OH 2VZ3A 3T1FA 3BZ4A 2LFGA 2ZOKA 3LDBB 4YXLH 3VXPB 4MB5A 3VFVA 5D7IB 1EK3A 5D6CA 3WLWC 5IR1A 5MEND 3HG1A 3R0NA 1ZHKA 5IMOA 5DVOA 4XPFL 5F44A 1EEUA 3REVA 3BZ4B 2P8PB 4Y8DC 1N5YH 2FB4H 3PE9A 1Q0XH 5EU7E 1BF8A 4WFEE 1KIRA 2YKLH 3ARVA 3VFMA 2C4FT 5I1CH 4U3HA 15C8L 3LRHA 3BPNC 4P2QE 4OLYL 5GRWA 2VDOL 1NLDH 2WNGA 3T4AA 1C08B 3S9DB 3ALPA 1TJHL 3PGFH 4QHMB 3V5DA 4NO5A 2SEBA 2HLAA 3LEVL 4FZEL 4YNYA 3RVWC 1CXIA 2OQJA 5HHMB 3C60D 2XOTA 4L9LB 1KEML 5DMGC 4PJCA 4YWGH 4NZRH 3LKRA 4E5XA 5IEHA 4RWYH 5FHBL 4KMTH 2OR8A 2A77H 4HFUH 4LLQA 1DBKL 3VGGA 3VFTB 3VGEA 4NQEB 3WBDA 1FSKC 1W2KT 1JHLH 2B4CH 4PRPE 4QRTA 2A6IA 3QYCA 1KN4H 1A1OB 4G5ZL 1YJDH 4NGHL 2B0SL 2FJGB 2FEEL 1HH9B 3EIFA 4DEPB 4DGVH 2X4SB 2UWEF 5DUML 3VDBA 1KB5B 3TM6A 4MD5A 3EJZC 3ZT7A 4U0RB 3K4ZA 2B5IC 1ZLSL 5C7XL 4QO1A 4P2QB 1J12A 1PLGH 1QSEA 1TETH 3S8WA 2O5XL 3QIWC 3UROR 3PDGA 3NIDE 3BT2L 2FGWL 1RJLA 3STZA 4WUUD 4V1DD 4E41D 2OLDA 3CMGA 2APXA 5C3TA 1FGVH 2Y6SC 1T1ZA 4LCYB 5K9QG 4OQTH 5L2KA 2A0LC 4O9HH 3V6FA 3UDWC 3ZDYF 3M17A 1A0QL 5ADOH 5HDQL 2V9RA 5EORH 3BEWB 4DFIA 5B3JE 1GGCH 4JN2A 1I75A 4WWID 3OAUL 2EC9U 4UQ2B 5ADPH 4IOIB 2PXYB 4TUOA 3RAJH 3LKRB 4E5XB 5CHNB 1KBGL 3QQ3B 4FNLL 1QFWH 4Z7UF 3VWKD 3PXJA 4GUPA 1NMAH 4KRNA 2B8OT 3T8XA 4YHYC 1ZT1A 4HGMA 4HIIA 4RIRB 5E8NB 4JN2B 2OQJB 1WAAA 1OAKL 3ZTNL 5HVHB 2ZNXA 3F7QA 1N4XL 2AXGB 4XBGA 1ZLUK 1G9EA 1IZJA 5FCSH 2VL5A 4Q74A 1ZV5A 1DN0A 5I1GL 4KRLB 4OFKA 1LP9F 2BSTB 1C12B 3ZO0A 4K23L 3D3VA 4YHYB 2AK1L 5DF0A 5K9KA 4HWEH 3VDCA 4L4JA 3FN3A 3L6FB 5T1KA 2BFVH 3HB3C 1XGQA 1JV5B 3TCLA 1R5IA 4IJ3B 2VDLH 4XPTL 3U83A 2ICWJ 1KXQE 3BRGC 3BUTA 1ZSDB 4WIQA 4JANB 3CLFL 4FQXC 2J4WH 4JKKA 5TGBA 4NC1E 3GM8A 3QNYB 4WI3A 1PQZB 3RU8L 4YHLH 4QXTB 2Q87A 2IWGA 5CD5D 2PN5A 4XMKH 5IB5A 4RGOL 4YO0A 3RVTC 1H0DA 3O8XB 2OTUA 4OGZA 2A9NH 4I0CC 1F2QA 3SE8L 4Y8AA 3O0RH 1S9WB 2P24A 5JR1L 4EIGB 1QR1A 1PX3A 2CJUH 5HTSA 3FHQA 3UTTB 5C0CD 5GGTL 5JR1H 1IFHH 4M6OH 1UQSB 4OFDA 2Y7QA 4P2OD 2MQCA 3H9SD 4F7MA 4F7TA 4JPKH 4QTIH 3ROLA 3B9VA 1KPRA 1X5KA 1QFHA 1BD2A 3G6JF 4G8GE 4OZIB 4ODVL 5C2BL 4BQ9A 4XPHH 4ZOEA 2CLZA 3LQZB 4JHBA 2R0LL 4HJGA 3MLVH 3DUSB 4U4BA 3QP3A 1CFNA 1OTTC 4Y16D 2CDFA 3VFNA 2NXYC 1QSEE 4NNYB 3K8LA 2DQFA 5C2UB 3QEHB 1XR8A 2YA0A 4P99A 1FAIH 1NH6A 1IL1A 5D7IA 4OF8A 1H3PL 3BGFB 4QNPF 1A7NH 2RGSA 3GMLB 1DN2A 4OLEA 3FRPA 2Z9TA 4TYUA 1RV6X 3QFDA 1HQRB 3U0WH 5LCVH 3S4SB 1NGZA 1RIUL 1DSFL 4PRID 1XF3B 4OFPA 1X3DA 1IKFL 3CLEH 4LLVB 4MMZC 5IB2B 2OTWB 2A6DA 4I5BB 5JPMA 5T33L 1XF2A 3CXDH 3GJFK 2XY2A 5DJDA 1DBML 5C2BH 2FIKA 4F2MB 3VXUD 1Z9MA 1IT9H 5DMJB 4NUGL 5FM5M 1TLKA 1Q9LA 3V79C 5C6TL