1CQKA

Crystal structure of the ch3 domain from the mak33 antibody
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
101
structure length
101
Chain Sequence
PAAPQVYTIPPPLEQMAKDLVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CH3 DOMAIN OF MAK33 ANTIBODY
publication title Folding and association of the antibody domain CH3: prolyl isomerization preceeds dimerization.
pubmed doi rcsb
source organism Mus musculus
total genus 18
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cqkA00
3QUZB 5FGSA 2YD4A 4HXBH 4G80B 3LQAL 1T04B 2FSEB 4JFQB 3M8OH 4PJFF 1MNUH 2J5LB 5J1SC 1P69B 3CCHA 1X6LA 3RTQC 3EKCA 1GGYA 1FQ9C 5FYKE 1AQDA 3PQYA 4UTBL 3E1F1 2QLVB 1ONQA 3U4EB 2YZ1A 4J6RL 4RRPG 2VISA 3BAEH 5K93A 5C70A 3OAUH 4HD9A 4C54A 3T2NH 3S3SA 2X1XR 4HUWB 4KUCD 3H3KA 3VE0A 5IWLA 4ZDHA 5HYIA 3MJGX 1VFAA 1HSAB 4OZFA 4OIIH 3MO1A 1A1OB 2WINB 1L7IH 3MLYH 2DQDL 5LVEA 3X11A 4OCSH 3BH9B 3EFDH 3LHPH 5E8DH 2V7NB 2JLLA 3WFZA 3FFCD 5DJYB 4DVRL 2R8SL 1RV6X 1SYSB 1L0YA 1NGWA 3V7AG 2CJUH 3EDJA 3V8CA 3BN9C 4NNXA 1GIGH 1RK1B 1HSBA 5IKCB 5D70H 4EJ1C 3ES6A 5T1KA 4LPWA 3MRJB 1QACA 1TQBB 4PJAA 1XF2B 1IC5L 4Y5YC 1GC1H 3HNVH 3GI8L 5D5MF 5DD0L 2A9NH 4LPXA 4X6DE 3MA9H 1N5YH 4XRCA 3GSRA 4XPAH 4LCUB 4RSVA 3U0PB 4UBDC 5KVGH 1I75A 2FX9H 2P8PB 3HPLB 3GSUA 3LOWA 4LLWA 1VKXA 4YPGA 4MNQE 3QRFM 4CBPA 1YUHA 5CINL 4YXKH 2AJXH 1KCKA 2XKSA 4YE4L 1DN2A 5JQHC 2WBJC 3IRPX 5D96B 3ULUC 2A83B 4RDQF 5D7JC 5ILTL 5I17A 1RZGB 1EX0A 4NQTA 4XNMB 3C60C 4OZHF 2BNUA 3ESUF 1AGEB 1XAUA 4UT7L 3TZVB 3BHBA 3A67L 1UADC 3I75B 4Q9CA 3VXPB 4Y4FD 5JIKA 4Q9BA 4DN3H 3QDHA 3LCYA 2R69H 4NO2B 4J3WA 5JR1L 1FG9C 4NQSB 4GW1B 1OARH 2MHAB 3P77B 3HTLX 4L8DB 4X8XA 4H1LH 3RL1A 4RBPK 3ULUE 1EHXA 3L1OL 5I1IH 2DLIA 1CXEA 5L88L 5KOMC 1DQJA 3HMWH 4ZUVB 4IHOB 1QSFB 2CMRL 5GJSL 2ZWLT 5D2LF 4BFBD 3GB7A 1LE5B 1S3KH 1RIHL 3T2OA 1K2DA 2XZQH 3BWUC 1R3HA 3BPCA 4NZJA 2VUOA 1MAMH 3VRLE 2YUZA 4TUJA 4ORZC 4Y2DC 1LO3L 3ECBA 4OLYH 2R29L 1ZWIA 4AQ1B 1HNGA 3DSFL 4XCCL 2GEEA 5C0GB 2OMBA 3OSKA 1JGUL 1FFPA 3PGDA 1C5CH 5JIIA 1BF8A 1MFCL 3GIVA 4U1HA 3DROB 4WCYL 4K8RC 5ANMA 3HAEA 1BVLB 2YR3A 5EORH 5LGKA 1YPZF 2DB8A 4GG8A 4XBPB 4ZFOL 4F2MA 1BIHA 4YR6A 3LQZB 3FCTA 5L2KA 1A6ZA 1XFPA 3MNVA 1J0JA 4NNYB 3LN4A 1O7VA 4PD4K 1NC2B 1ZAGA 1ZGLA 2FH6A 4Z0BH 4P4KC 1DSFH 3W2DL 5BRZE 5I0DA 3KYOA 4K94L 3QCUL 4F7MB 4OFIA 3KPRA 4WWKB 1KOAA 2CXGA 1BOGA 2ZUTA 2P49B 3DXAD 2HKHL 1WIUA 1JGLH 4H8WH 4YWGH 2YD7A 2GITB 3ZTNL 5DVOA 4LLVB 4XBGA 2J6EL 4IJ3B 1HIML 1U93B 2VKWA 2ZOLA 5DZOA 4GG6E 4KWUA 4LHQB 1UCBL 4MQXC 3EO0B 4OCMC 1FL5B 3H42L 5HHXH 1K4CB 1M71B 4FQCH 5DRWB 2W92A 3S5LA 2BSRA 5I1GH 1XH3A 2VLKB 5HYJE 1FC2D 3L5WA 3L3DA 1VGEL 5DHYB 4LRNL 1KN2H 1KN4L 3QJHA 4PJCB 4HUVB 2H41A 1T03L 3RL2B 3GFUA 1FORH 3QEQA 1MLCA 4ZUSB 3F12A 5IBUB 5HHVL 3MBEA 2FJGB 1ZGLM 5CEZL 2FO4B 1GYAA 4HMEA 3U36B 5C0FA 1NAMH 2B1HH 3CMOL 3TLRA 4UV4H 5BS0A 3ZYIA 4F7CB 4LSQL 2AJSH 3VWJC 3RI5K 3UJJL 4JFEE 1F42A 4M61B 1R6VA 4JFHE 1IM9D 5EOQH 3VFNA 4L8SA 3PJSA 1EHAA 4P2RB 3FO1A 4ESKA 4MJIA 5CSZA 4YDLB 3RVTC 4LRIC 1OD9A 4D94A 1WWCA 5GS1A 3HMXL 1EHLH 2IH3A 3TA3D 3H9HA 1EEYA 1AGBB 4JKKA 3ZSTA 3MLXL 4LEOB 1J18A 2Z8RA 4KKLD 2Q86A 4R4BB 4X6CA 2BJML 1HQ4B 3QFDA 1Q1JH 4JFOB 5EPMB 1T4KA 1GZPB 2YMXH 1BQHA 1VFBB 4CVXA 2DQEL 4L29B 3G5XA 3PWVA 3EZJB 1BVZA 1IGML 4S1QH 2H1PH 4FQQB 2ZCHH 5J12C 3IVKA 1FBIH 1DL7L 2CKBA 2RBLA 2W9DH 1MFAL 1OSPL 3MRGA 3T0EA 4JPIA 4KTDL 4MA7L 4P5TB 4MA3B 4R8WH 2VIRB 4JVPA 1E4WH 3VGHA 5E2WH 4ZFFB 1FJ1B 1MHCB 2YEZA 3F7QA 4JZNB 3RTQB 5CKGA 1EFXB 5TPWL 4J4PA 5EO9B 3LB6D 5E9DA 3D85D 1WBZB 4KMQA 3RX8A 4X4XA 3T09A 3B4NA 4LARH 5CMAB 1C5BL 2K9UA 1F11A 3QUKA 3MRNA 2XI9A 1PZ5A 3VDCA 1HKFA 5F6IC 1SQ2N 2PXYA 2D03L 3E8UL 3G6AB 4KHXL 2BC4A 2X10A 1E4XH 4PRHE 3I50H 4Y1AD 5IFJA 2DWEA 5CIPH 5IJKC 3WD5H 4HC1H 3WFEH 3FOMB 3MACH 5ELIA 2Q6WB 1KNOB 3BDYH 2CLRB 4M6OL 1EAPA 3MV7A 4ZO9A 1QKZL 4FQXC 3RVXC 5E2VL 1T5XA 4POZD 2JJUA 4G9DA 4XX1G 4EIGB 2NXYD 4X6DB 1VDGA 1EO7A 3O11B 5JNYB 3CXHK 4PJDE 2D7MA 5FCUL 3W9EA 3RAJH 4PRPE 1PG7L 4WJ5A 3S97C 1U6AH 4HXAH 3B6SA 3NPSC 1EZVY 3VH8A 1TENA 1BBDH 2Y6SD 4Y5YB 4OLWL 1U8PA 4XAKD 4XVJL 4H0GA 2DQHL 4M5YH 5JXEA 2LABA 3IFLL 3AC0A 3MLWL 3QO1B 1IM3B 2DLEA 3IU3A 1JPSL 2GCYB 4FP8H 4X7TB 4CDGC 3DUHA 3S34L 1VGKA 3FN0L 1YEJH 1UH4A 5JUEH 3X12B 3WDJA 4JO3L 4JRYD 3BGFC 3AMKA 4CVZB 4Y5XA 4Z7WF 1FNGB 3IDGB 2H2SC 2WBJB 1FNEA 3ARSA 4PTUB 4N1HB 1J12A 5AAMA 3C60B 4XB8A 1PGRB 1T22B 3PGCB 4GSDL 4M7JL 2IPKA 4H20H 4S1SH 3V5DA 3B2UD 4KKBD 1FL3A 4QXWA 5TDPA 1LMKA 1T1ZA 1RJLB 3KPPB 4JHAH 1W8NA 43CAB 4Z7NF 5C08D 1RZKC 1KELH 1YN6B 3P4MB 5DRXA 1ACZA 1MY5A 2NXZD 2XZZA 3GMOA 12E8L 1RHHB 1WTGT 2VDKL 5CGYC 2V5MA 2B2XL 2J4WL 4P2QE 5F8RC 1CCZA 5FOJA 1HHIB 5E7BA 3S4SB 4N1CA 5I75C 4YH6A 3QBTB 4UUJB 5DF0A 5FDYA 5E6ID 4NYLB 3DX8B 1BZ9A 4PJBE 1Z3GH 4ODHL 5F1OB 3SKMA 2WZPD 5GGSY 5IBTH 1MCWM 2NY2C 4Y16A 3QQNA 3WLBA 3PWNB 3UTQA 1HKLL 1ZK9A 3V6ZA 2ADIA 3N1PC 3DSNA 3PXHA 1QSED 4FRWA 5H94B 5BRZB 5F7DA 1UWGH 4L9LB 1LO5A 5J3HD 1P7QB 1D5ZA 3ABZA 3BN3B 5KVFL 3CLEL 3K8KA 2JJWA 2Q7NA 1EJ6A 2FGWH 2OI9B 3KS0J 5JOFA 3IDIB 3QI9D 4K2UL 4F9LA 2NY7L 1PKOA 1NDGB 3SGDH 1G7LA 2NY5H 1IAKB 4GG6B 4P4KB 1ZHKA 4KPHL 3REWA 3O6KL 1LNUB 4IOIB 5DVMA 4O2CA 5DFWH 4N5ED 4B7LA 1P4LA 3Q2CA 5K9QG 3VXME 3NCEB 1JVKA 4APQD 3LQMA 5HYJB 6FABH 3WDHA 1ES0B 5GHWL 2V2XB 3DYOA 4I1NB 2QSCL 3CU7A 4JANB 5IB3A 3U2SB 4K23H 3HRZA 4U6VH 1K6QL 2RCSL 1BJ1J 3MCLH 5AUMB 4FZEH 1Q9OB 1GZQB 43C9A 3W5NA 1YYMH 3KYNB 2PTTB 4O02H 2GAZA 2AK4B 3EFFA 4JFEB 3IXAB 3RWEA 3MJ6A 1MSPA 3O3DA 2B0SL 5IW6A 4PGCA 1MFDH 4JY4B 5ACMA 4I8DA 4NSKA 1S7WB 3TNMB 2Z4QA 2ZCKL 1P7HL 3WHE1 1RY7B 4X7DC 1KJVA 3WHXB 3QPQC 2E7BA 4OCYH 2NY0C 5D7KD 2Z92A 4TNWF 4N0FA 1CDBA 2VLJE 3VWJB 4JR9H 2A77H 4FXGB 4NRYA 1I85C 5D7IE 3MROB 5DJ2B 1URLA 2XQBL 2C4XA 3S35H 4OGYH 4LVHC 4MDIB 1IGFL 4URTB 5DJ0A 3MFGB 1QLEH 1DBMH 1S9VA 3CIQA 3D48R 4K07A 2W0LA 4PLJC 4EBQL 4G42B 3DUUA 1KIQB 4HUXB 2G9HA 2YK1H 5E4IA 1CL7H 3HB3D 1AQKH 2FCBA 2IFFH 1UM4L 3JWOH 2ZUUA 3ZDZF 4OSUL 1WF5A 3O4OB 3RVVC 4WU7A 3MOQA 3IKKA 4I18C 4C83B 1MPAH 2I07A 1TPXC 1TJHL 1OWRM 4WEBH 1C08B 3BISA 4JGJA 1RZGA 2FBJH 5A40E 5LQBL 3QSKB 5T3XL 2H26B 4Y4KD 2KH2B 2CKBL 3D18A 4E0RA 3VXPA 1LDPL 3GRWA 1IT9H 4UT9L 2BX5A 4WU5A 1MRFL 4PRHB 3RJQB 3CX5J 2X70B 5DA0B 4LSPL 4HG4J 4I0CC 2R0ZH 1YY9D 4AH2A 3AS0A 4WI6A 5IEHA 1JGEB 1CFBA 3GMQA 3U7WL 1GC1C 3ZE2E 4AIZB 5F6IB 1LEIB 1DN0B 4TNVK 4JQIH 4PGDB 5FOBB 4HWUA 1M1SA 1PY4A 2AQ2A 1EEUA 4PTTA 3P9MB 1QBAA 3EOBA 2B7DT 1CF8L 2EDKA 3MPCA 4PJGA 4D0BB 1G7MA 4PG9B 5DD1L 1U2HA 4BQCA 3ZSSA 1JWMA 2HRPH 2R0WL 4FQXB 4FFYL 2D4FA 2BXYA 3BI9X 5F9DC 4QTIH 5SX4H 4R4FL 5AZ2L 4X6BB 1ZLWK 4ZUWB 4XPFL 3NABL 3SDDA 5HJ3B 5IMOA 4HLZG 4QGYA 4OTXH 1WV7T 1S7RA 1CD8A 3L5XL 4DTGL 2HTKD 5ESAA 8FABA 3IYLW 4DZBB 1F6AB 3NPSB 1ZHLA 2H8PB 3DHMA 4OGXH 1SJHA 2P5WE 4OFPA 3D3VB 1QR1B 4DGIL 5FV1L 1PSKL 4K3EL 1FZOB 5HHNB 1JTPA 4LEXH 4HULB 4XPTH 1F45A 4HIXH 5JDSB 4F7MA 3BGFB 1GGCH 1U92A 5TF1H 1XR9B 4NM4L 5TE7L 3UTTA 3QXTA 1N6VA 3GSNL 1R3JB 3SPVB 3L3GB 3VJ6B 3QFJB 5KS9A 2P5EA 5CUSL 2Z31C 4OM0L 4YEFA 3D2UA 1H3TA 4R7NA 2YD9A 3OKOB 1DBJH 2WV3A 3THMH 2ESVA 3QDGE 4P2QB 1YMMB 1RUQH 4MXVF 1SJVA 2JK5A 3ZMRA 2NLJB 3WYRA 1GPOL 5E2JA 3KAAA 2R1XB 2Y06H 3Q1SH 3FHAA 5JOPD 4PJBB 4HUVA 3CMGA 4G9FD 1FVDB 4HPOL 3VXNA 2O5ZL 3GKWL 5IVZB 5CBEB 2YKLL 4GAFB 4W6WB 2Q87A 5T1LD 2FO4A 5KANI 3BVNA 3IJSB 5I75B 2IBZY 1KB9J 4M1DH 4LSTH 2HT4C 1IQWL 1D5IH 2E9IA 2AP2A 4M61A 4H0HB 1KC5H 2DQJH 1DQTA 3HS0A 2X05A 2D31B 1BFOB 4N9GA 1IKNA 4X6DF 5C0BA 1GVIA 2KUTA 4U6YA 4H8WC 3OKEA 5GSRB 3WUWA 3X3GL 1BQSA 2HTLD 1IEAA 3KLSA 1WLHA 3Q3GB 4OLZH 1P4BL 1WZLA 3VXMB 4PGEA 5D2NA 4NUJA 4EN3D 3LPFA 2ZJSL 5E8OA 4Z76A 3I6LE 3OJVC 1LK3H 2YWZA 3MJ8A 2AGJH 5ITFA 4LFHG 4DGYH 2HJLB 5DURD 2IGFL 4FG6C 2O5XH 1J05A 1N6QL 1XF1A 2AEIT 1BWWA 2E7HA 3EYSL 4KKAD 2JF1A 5JHDA 3ZE1E 2GFBA 4F33A 4MXQD 4NO0A 3X13A 4CW1A 2X4RA 3BSZL 1I7UB 1CFSB 3VXRD 3OX8B 1RZ8A 3V5HB 5FKAA 1E4KA 1EH9A 4M43H 5DDHA 4J2XA 2HKFL 1OAXH 1RZFH 1NCTA 1IGJA 1OPGL 3HI6L 1ORQB 4O51B 5KSVA 3O2VL 3VFGL 2P48B 4TVSa 4Y19A 4AENA 2YD2A 5JW4M 4EI6B 3O2DA 1NLDL 3VXUE 3KLAA 1HCFX 3FT3A 2C9AA 5GISL 2MTPA 5D7IB 1MI5E 1CD0A 4ZG1A 3FB6B 2Y5EA 3BQUC 2X1OA 1RU9L 3CD4A 4MB5A 4OGAC 4TUOA 3EO1B 2QSVA 3LSOB 3SGKC 3QUXA 3NZ8A 4Z8FH 3O2WL 1YNLL 5L7XL 2NY0B 2WSKA 2PO6A 4PY8I 2BXZA 4QNPF 4XHJC 2EYSB 5D7LA 3MRBA 1ZT7B 4XH2A 4GRMA 3HR5A 2DJ4A 3EUUA 3OR7B 2Z93B 3SCMD 1NEZA 4OCRL 4LVHB 4MNQA 1UT9A 3ORJA 1O0VA 3OAZH 5KZCD 4YHOL 3O8XC 1CI5A 4I0KA 1T83C 5J11C 5GGTH 3PP4L 2VXQL 3N06B 3UO1L 3QHTC 2PYFA 2XZCL 3VD9A 2V9QA 4XP9L 1R24A 3TBTA 4XNYL 3VFSB 2FRGP 3Q6GL 5F1IA 5EO1B 4RQQB 5ISZE 3QWRA 4H25B 4I18B 4BH7A 1J5OL 3QH3B 4NHUB 1TPXB 5D7JA 1M4KA 3ROLA 3BPNB 4YDKL 2BOBA 1VEPA 4ZAKC 1JWUB 1S7XB 3KHOA 3MUY1 4PRDB 1W0WA 4QXUL 4EKXA 4ETYA 3VDBA 5DLMH 4I5BB 4NRXB 3AXLB 5DJ8B 5CKAA 3S35X 2V7HB 3ZL4L 4BSVA 3NFPB 3GSOA 1ED3A 3CLFL 3VD5A 3KLDA 1A6VL 4UAOC 3VW3L 1HEZA 1X5IA 4XXDB 1BD2A 1QEWA 2QBWA 1WISA 2J1KA 4ZMAT 3QWOA 3NFNA 4G7YL 4YFLI 2J7LA 1M7IB 1CE6A 5DK0A 1LEKB 3VXTB 5DJ6B 1NCCL 2W65B 4EI5C 3SKOA 2GJ6E 1Z0NA 1MOEA 5TJWK 1YA5A 4UIMA 2FX7L 4KRLB 2Y9RT 3ULVL 1JCKA 4Y2DA 1I3RA 4XMKH 4NKMB 3BESR 5DVLA 1Z9OA 3DBXA 5EH1A 5EIIB 1ZTXL 3PWNA 4O2FA 4D9RD 2E7CA 5DXWA 1MH5A 3NIGF 4U1GC 5C09D 1TMCB 2AJ3A 4F7EB 4I9WD 2DTMH 4HF5H 4R4NC 5DHXB 3MC0A 4OZFG 4Y5VA 1JK8B 2Z91A 1X6NA 3O6MH 1C1EH 1TNNA 3U82B 3BW9A 5C9JA 1FVEA 3FOLB 4M8VA 2PTUA 3CUPB 4NCC2 3EAKA 2BNRB 1I1CA 1JHTA 1KFAH 5C0AD 4H1LB 1J1OL 1NDGA 3RGVC 4HJ0D 1AKJA 4BM7A 3D5OF 1EUTA 1IAKA 1IAOA 3C8KB 4NT6A 1YYLL 4KHTL 2OBGA 1FZMA 3DTXB 3QDGB 3WIFB 1VENA 5JQ6L 5ALBL 5T5FH 2VDRH 2Q8AL 1BFSA 1A22B 1F2XK 3NIFF 1OAZL 2F9BT 2AXFB 3VFPA 4JQVC 2J3SA 4XCEB 2FIRT 3ZYJA 1SBSL 2YSSA 4OBRA 2FR4A 2Z31B 3RNKA 2IADB 2OL3H 4PJ5D 4UU9B 1KG0B 2Y5TB 4HPYL 4TUKL 1Q0YH 5DQJB 3RHWF 6CGTA 4FTVB 3UBXB 4JO1H 4XVUD 1IL1A 5GRUL 1EJOH 1XZ0A 1JYXA 1XR8B 1KXQE 3Q5YA 5DUPL 4I2XA 2APWA 2HH0H 1HZHH 1JV5A 3N50A 1AGDB 1A6UL 3OG4B 2M2DA 1CLYH 3EO9H 4KMTH 3MRQA 1FG2A 4HX1A 2NY5C 4R6UA 1ZA6B 5FHBL 1A4KB 1NDMB 3DVNA 4HK3N 4HHAB 4ZPVA 4Z7VA 2IH1A 4KJYB 3NTCL 4NQDD 3WCYA 4XNZC 1CU4L 3ULSA 3H8NA 4NNPL 5HVGB 3NH7H 5ADOH 3HCVA 1KYOJ 1UB5A 1UZ6E 3BP7A 4EDXA 4PUBL 2HLAA 4YHKL 4B7IA 4OZIF 1U9KA 2XV6B 1RIVH 3CX5K 4QHUA 3UPAA 3MRKB 1V3KA 4MD0A 4HG4K 1ZLSL 4ZQKB 5DMGD 4GAYA 3CPLA 3M1BA 5HPMA 3PHOB 1DQDL 4IRSC 4OF3A 2VXTL 2MKLC 1HHGA 4OZ4A 1FC1A 2BSSB 4JKPL 3HZMA 5CP3A 1NC4A 3TYGL 3HAEG 4CN6A 1F4YH 2X4TA 5IEKA 2IQ9L 1JHLH 1SY6L 2VLRE 4O4YL 5T33H 1NGZA 2Q8BH 3OXRB 4M5ZL 4PJ7A 1RD6A 2CUMA 5FUCC 3VXUB 1NAMB 1RI8A 3K8LA 3IETB 2XTJC 4YNYB 2N7BA 4LLYB 2EECA 3WSQH 1MI5B 3TA3C 4JN2B 1I7ZB 1EZVX 3J8F7 2BY1A 5DFVD 2WP3O 3FQTA 5GJTH 5MHSE 1MJ8L 2WUCH 4ZOAA 4ETQB 1WITA 1T2XA 4NHCL 3MV9B 4ZNCD 3SE3A 3U6RA 1YMHA 3NCFB 1JHKL 1MUJA 5I76A 5EUOE 3MMEB 5FUCE 4DUWA 4PJDA 1A3QA 2XTJE 3BKMH 4PRPA 3OKDB 2ARWA 4JRXD 5ICYB 1MREH 1OSZB 3TV3H 7CGTA 3TBYB 4JY6A 3JWOC 3DUSB 3TO4D 1WZMA 4A6YH 3SGEH 2W9EL 5FB8B 3WNLA 2DYPD 4RFOL 3S5LG 1HXMA 4UQ2B 4L4VD 1A3LH 3LB6C 5DD6A 1EVUA 2QQLL 4QYOA 4ZNEE 4ZSOB 3HC3H 3ARZA 5FA4B 4LHUB 3SGJC 4WEUD 5DEFA 1KCVH 1ND0A 2R9HC 5ISZB 1OTSC 3O3BA 1QLRB 4WUUB 3O8XB 1UVQA 3HFMH 1UWEH 3ILQD 3I3BA 4F3FA 5CEZD 3WNPA 5LXGL 2H32A 5J11B 2EDTA 4PJXF 3WS6C 5DUBA 4LSVL 1KB5A 3AAZA 4YGVB 1KJ2A 1QSVA 4J12A 2ZOKB 1IQDA 5CWSA 3RA7L 2VQTA 4JO2L 1CQKA 1SM3L 1IC7H 1T3FB 3HE7A 4ONGH 4QRRD 1LHZA 4BZYA 5CIPB 3DRTA 1R3KB 5DD3L 3LD8B 3RU8L 4ZAKB 5FO7B 3VXSE 4G6FB 4GW5A 4Y1AE 2B4CL 4LNRB 4GQ9L 2GY5A 3K80A 4AT6A 1KB9K 2WW8A 5JA8B 3N1QC 1BQHG 1Y6MR 2HRLA 3QNXB 2WWKO 2GJ6B 5CJOH 1IAIL 5JPNA 2XWTB 1YEEL 3MUGB 2VABB 1A7PH 1XIWD 4UAOB 5EOCL 3LQAH 4U4BA 5HDLA 3ALXA 4UDTA 1JJUA 2Y07L 1NCBL 1FO0A 2A6DA 4LKXB 2JB6A 3O41B 1XGPA 4D9QE 5T5NF 3GBNH 3MJ9A 4Y2OA 3PABB 3STZB 3HZYB 1OB1B 3U4BH 5FYJH 4LCWE 3U4AA 1VFMA 4J6RH 2IPUG 4EI5B 5E5UB 3IJSA 3RWJA 5D7IF 2B39A 3MR9B 2R0LL 4WFHD 4M62H 2ZG2A 5CD5C 1T6WA 1OCWL 5GPRA 4UIKL 3EJJX 3BEWA 2UY6A 1JN6B 3DJ9A 2R4RL 3LV3B 3B2UC 2VN4A 1TIUA 1K5NB 4KKBC 4HLZH 4V1DB 4JRYE 5MEOA 1RUML 2DQDH 1KACB 4XCFH 4YJZL 4JJ5B 2ATPA 4DKAA 5GS2H 3IKCB 4FQ2H 5EBLA 3EHBC 1HILA 1M7DA 2ZG1A 1W0YT 4YZFF 4DVRH 5E8NB 4EVNA 3SDXE 5F96H 2ICCA 2VE6B 3MBXH 1OGAA 1JGDB 3H7BA 2CDEB 2CDGA 3QDJE 4LAQH 3V5KB 1X5HA 4Z77A 4RAUA 1NCNA 2VXUH 1E27A 1HE7A 3RGVB 5HGHA 3IDNB 2GSIB 5ENWA 3R0NA 3GI8H 2XN9D 3KPNA 5C08E 4YXLH 3LRGA 4XNXH 4JFFA 5DWUL 3WEXA 1KTKE 3TCLA 3VH8G 2WQRA 5B3JF 4G8IB 1XF5A 4X6FA 4IOFD 3RPIB 2AJZB 1JYWA 1FCCA 5CINH 1JZ7A 1HH9A 1L0XA 5J3HC 3ZDYF 5ILTH 1ETZB 4P46C 4OM1L 3QNZA 3T0XA 4UT7H 4LGSB 4B41A 5DD5H 2W0KA 2VLJA 5IOPA 2EDEA 4U6HB 3X14B 5FM8A 4Q9RL 5HI4D 1WGOA 1QSEE 15C8L 4IOSD 5F72S 4Z5RA 4YIQA 1GXEA 3BZ4A 4MQSB 4LSRL 2KZWA 3LSOA 4TSBH 4KI5D 1GAFH 3DMMB 1LVEA 2EIZB 1OP3H 4APQC 1T0MB 5L88H 2EYRB 4RIRA 1YJDH 5CJ8A 2F54A 2QSQA 4HV8A 4NWUL 4XC3L 2NYYD 1JZ3A 1MEXH 1RURL 2OTUA 2UUDH 3MXWL 4LAJH 2CPCA 2RHEA 4XNZB 4GBXD 3WLWD 5D2LA 5F8QC 3HZKB 1LO3H 2R29H 2X41A 2GSGB 5F6HJ 3TP4A 3OMZA 5JW4R 4XCCH 1A8JH 3L3HB 5GGVL 3JV4B 2YPKB 2VLRB 3U46A 1MFCH 2IMMA 2JCCA 3FQWB 3U9UA 4HSQA 2PYEA 5I8EB 5L0QC 1Q38A 5AZEH 2X4SB 2NZ9D 1KSRA 1MF2L 1QQDA 2VR9A 5B8CC 4N8PA 4ZD3L 4XNUL 4ZPTB 4NJAL 5EN2A 3CFDA 4IRSB 4PG2C 4LCCA 3P4LA 2H9GA 3CFBA 4NDMA 4KJWD 1F6FB 1ZE3C 3SDAA 3BUYA 1FYTD 4CMHB 2OX5A 1U91A 2IAMA 1N64L 1ZSDA 3LPGA 1UXSB 5EUOB 3HRPA 3SY0A 3W2DH 3TVMA 2XTJB 2A6KB 3RIAF 1MRDL 3VD3A 5D7KE 3S36L 1X3DA 1A6TB 5EBMA 3BWAA 1OW0A 2D7TL 1N3NA 1AO7E 3ZTNH 2G5RA 3UTOA 3HB3C 2J6EH 3S9DB 1HIMH 1KCRL 5CZXC 4CVWA 2W65A 1MJJA 4OGZA 3D9AL 4Q6YA 4OF5A 4OF6A 1QRKA 5DJXB 4JHZA 4G43B 2ZG3A 3KPRD 4ODXB 4QHLB 2FL5B 5DRZB 1CG9B 3CGTA 3STLB 2P5WA 3VFOA 3C6LC 1VGEH 4LRNH 1KN4H 1EK3A 3QUYC 3KPSB 1EXUB 3K46A 4OAWB 1T03H 4IS6B 1WC7B 3VGEA 1HCVA 4JQXC 3QHZL 4JJHA 2FD6L 3T1FA 3HUJE 5GRZA 4ZODA 1IVLA 1YY9C 1S7TA 5AD0A 3CMOH 3G9AB 4MAYC 2NX5D 1OGTB 3UJJH 1I3UA 1OAUL 5EDXA 1TVHB 4LSUL 2H6PB 2DI8A 4PLKD 2NPLX 2E6QA 5HHPB 5IMKA 3S37H 2JE8A 4KDVA 3VXSB 4AM0A 2YOCA 4Y1AB 3HMXH 4G8FB 4W70A 1NGQH 3GI9H 4CADB 1A2YA 2VDML 1D5XA 3MXVL 4JFDE 4JM4H 5CZKA 3RZCA 5IJVB 2BJMH 3C5JB 5K9KA 1L9MA 2IBZX 2WANA 4UILL 5DJDB 2NTFA 1NUGA 2WNGA 1R5IA 5F97E 4JREC 2DQCL 2HTKC 3KXFA 2HMIC 4LCYA 3VRJB 1AC0A 1DL7H 4PGBA 4GQPH 1TITA 4LCWB 1MFAH 1OSPH 1I9IH 1QBMH 4JKMA 4L3EE 1R5WA 4PRAA 5E2UL 1LO0L 1F5WA 1OTUC 3TWCH 5JLZB 4WUKL 3X3FL 5LAXB 4HJGB 4KAQL 1KYOK 3GIZL 4XX1E 1CXKA 2UWEF 5EZOL 1BHGA 1C5BH 1S78D 1DQML 5EA0L 4PRIE 3PL6A 2D03H 1PYWB 4OFYA 3BDBA 5DS8A 2EDBA 4I0PD 4YC2C 3ZO0A 2EDFA 4NKOB 1RJCA 5KN5B 2CLVB 3QDJB 4J4PD 3DX9B 5E9DD 2R1YA 1VHPA 1QKZH 3GMPA 4Q58C 4HDIA 3MLZL 4OZFH 3ZE0F 5DEZA 1U8JB 2R23B 3MLTA 2DQIL 3NA4A 5FCUH 3ARUA 5F9JA 5J6GB 5E2TL 3AFLA 2LE9A 4OCXL 2XNAA 3TIDA 1UYWL 3UPCA 2V2WA 5KVMC 1KPRA 5IHZB 4P49A 4PJEF 5IB1A 3SHSA 2DKUA 5K9JL 1GSMA 2AS5M 3FO2A 4XVJH 2DQHH 1UQSB 5ERWA 3IFLH 2K7QA 3RNQA 5DQDL 1JPSH 4G9FE 1ODAA 1JMZA 4J3VA 3VWKD 5IT2L 4PRNB 4PGZA 5LBSL 3WS3A 3M17A 1S5IL 3FN0H 1CFTB 4LF3B 4JM2F 4E41D 1NAMA 5I8CB 3IETA 5JW5A 1EGJL 2HTLC 4JO3H 2EO9A 3ARDD 1D5MA 4F80A 3KDMA 2EXWD 1QSEB 3MYJA 3TH2T 5DMKA 1M6OB 2A6JA 3VFWA 4RFEB 3VFVA 4P99A 4DAGL 1INQB 4P46B 2O61A 5JXED 4XNQA 4MNGE 4EN3C 1U3HC 4GSDH 1TFHA 1NMAL 3AU1B 1CD1A 4NZTL 3KJ6H 3FZUD 3HG1D 3CH1A 4PR5B 5AWNL 3MGOA 3PWPE 1KCSL 1OSZA 3BQUA 5FF6A 2F8XC 3MLSH 3DVGA 1C5DB 3FONB 3F7VA 1V7MH 3SGKA 1NCAL 1AXTH 4APQB 12E8H 1DBBH 2VDKH 3MRCA 1KIUA 2B2XH 4N9OB 5E8EA 3TYFB 3MNWA 4YBQC 3T2PA 3QQ3B 4MJ4A 2P4AB 1X5LA 4Y7MA 4QTHA 1U8KA 1NFIB 4Z95L 3EYFB 3BZFA 4ODUB 1T7VA 4EXPX 4KROD 5EBWA 4ODHH 1S9WA 4YDJA 2GTZA 5KSUB 1SVZA 1NFDA 4R97C 1SJEA 3WFDH 2XKNB 1D5BB 2HFEA 5KOVC 1PW3A 2YPVL 5F3BA 5L0QB 2HFGL 3V9FA 2ITDA 4C55A 4EXKA 3N9GL 5B8CB 2DJSA 1AC6A 3EYQD 3LKQA 4LDEB 3BRFA 1DCLA 1I1AD 4P9HL 3UC0H 3WUWG 4MLIA 2F19L 1RZ7L 3I3EA 4XBEH 4ZYKB 3FFCA 4D8PB 4HC1A 3AS2A 3HAEH 3EBAA 1AO7B 3MGTB 4FN0A 4JZOB 2WM0A 1LD9B 3L3IA 2ENYA 5KG9B 5IHUH 1R0AL 1QRND 4KPHH 3O6KH 3QIWB 5DO2D 1RUAL 5TE4H 3C5SA 4GRLD 1NQBA 5GGSB 4FQPA 5GHWH 4QT5A 2HFFB 2Y36L 3T4AB 1CS6A 1H5BC 3BP5B 1J0HA 1T0PB 1MHPL 2VXVL 2RCSH 3TPUA 3IS1X 3GO1L 3HUJB 4KRNA 3VFUB 4LU5H 1ZLVH 3VD4A 3H3PL 2HFTA 2VDQL 4H88L 5F7EL 4KY1L 3C08L 4L3CA 4RMQA 3G6DH 4R90L 2SEBA 2EC9T 3C6LB 3M45A 3QUYB 4AEIH 1U8MA 4K7FA 2D7NA 4Y4FA 3RKPA 3VFTB 4OI7A 4OLVH 4M6NL 1JGVL 1J0KA 3BIKA 2J88L 1F4WH 1TQCC 2ZCKH 4WW2A 4Q0XL 3UDWA 1BBJA 4RISH 4UOJA 2X7LA 1BAFH 5H37G 3O9WC 4JFDB 4Y88A 5FXCH 4MAYB 3GSQB 1WEJH 1INEL 1RK0B 4WEMB 1EEQA 3CXDL 1U8HB 1KBGH 4QRTA 3LQAC 4H5SB 1Y6KR 5INCA 3DX6A 4NQED 1JWSA 4EBQH 5KAQG 2JELH 2VAAB 4L3EB 4RAVB 4X5WB 4HWBA 3ZKMD 1NEZG 2FJFA 4OT1H 2VLLB 1EAJA 3MZGB 5BXFB 5EUKA 2CXKA 3GK8L 1FE8L 4G8IA 1J1XL 1Z9LA 1UM4H 4NC1C 3QEUA 4JREB 1U8QA 1TVBA 1UJ3C 3T4YB 1C12A 1LO4L 2FECI 4HEME 2BCKA 1TJHH 4ONHB 5LQBH 2FB4L 1KCLA 5BZWA 4HIIA 5TQ2L 3NN8A 4KQ3H 1Y18B 5T3XH 4PRIB 4DKDC 2CKBH 2F8VA 3LH2L 1OAQL 4U2ZA 4BK4A 2V17H 4S1DC 1NFKA 1ACYL 4UT9H 3S37X 4OCWH 5JO5A 3QQ4B 4NC1E 4D9RE 1MRFH 1CQYA 5C09E 3QZWA 2EKSB 5CFHA 3ARPA 4PV8B 4LVOC 4HIHA 4MCZB 4NQXA 5SV3A 1MCIA 1KPUA 4X6EA 2C3WA 5E1AB 4NCDA 3U9PL 3DXAA 3O3AA 4NQCD 1JFQL 4LP4A 1XGYL 3C2SA 5I0ZA 3S96A 1U58A 5IESH 2NY4D 2HVKB 2GT9B 4U1NB 4YC2B 4F7PA 4RNRB 5IVXF 5FECB 3ZT6A 1DLFH 2DQUL 1RZJL 2HG5A 4O2EA 4WFFD 5DD1H 3GBMH 1I3GL 5L2JB 4M4RA 4HZLB 4NPYB 3HNSH 2VDPL 5F71A 5HGGS 4C58B 3S4SG 4R4FH 2OL3B 3QJFA 2JIXD 4Q6IA 3R06A 3NABH 4U1JA 5A16A 4R26L 3EJZD 3PF2A 4G9FB 3T65A 4P3DB 2BRRL 4DGVL 3ULVD 1HI6B 4K3DH 3FFDA 1FP5A 4PJ5E 4UQ3A 3GHBH 5CBAA 1WTLA 4RMWA 2WIIB 3D25A 4KVCL 1XCTB 5JHLL 2EH7H 5C0DA 2AXHA 5HVWA 2BNQD 4XXCA 4X9GA 3EOYG 5FO9B 1UXWB 1B9ZA 3KPQB 1IM9A 2GTWB 1CICD 1PSKH 5DFTA 4OBSA 4KJPC 1S7QA 3MRLB 5FYLD 4HIEA 3UPRB 4OZGE 4QCIB 4RWYL 4NN6C 5F88A 1MJ7L 3TA3A 3PWPB 3RVUD 4NKDB 4NM4H 5JXAL 4C59B 5DT1L 2F58L 2CKNA 3I02A 1PD6A 4WO4B 3QEHA 5CUSH 1ZVSB 3ARVA 4KDTC 4OM0H 1U3JA 4EN3B 1U3HB 5DMGC 1IILE 4NQDE 5T3ZH 3T0WA 1FL6B 5IIEB 3LAFA 2DM3A 4JDVB 2CGRH 1VACA 3V6BR 2ADJB 4ZNEA 3QIBD 5DURB 3SE4C 3EDEA 3H9YA 5CEYB 4RZCA 3DO7B 1C7TA 5BO1L 2VSCA 3NFSL 1ZT1B 5ESVA 3BP6B 4HFWB 4DEPC 3X17A 3CVIH 1AR1C 5MEND 3RVWD 3FL7A 1U8LB 5FV2A 2E9BA 2O5ZH 5IM7B 1DVFD 4WDIA 3SOBH 3QIUD 1X7QB 4XPGL 3D85A 4GLRI 2XWBB 1SEBB 5DFVC 4OCLC 4R7DB 4X99B 2R0KL 4FS0A 4XMPH 3OHXA 4HUUB 2ILLA 5D7SL 3QCVL 2BK8A 1OGTA 3FB5A 3ARFD 4IMKC 4TQEL 4EOWH 2A6IA 3W39B 3T0AA 3ALWA 1BZ7A 3BE1L 4R97B 1GHFL 4WW1B 2F15A 5JORB 4HK3J 4HW6A 1IGIL 3U1SL 4Y8AA 1CFQA 1KLUB 5GS3A 2HT3D 1YECH 1JUFA 2FBOJ 3OTTA 1P4BH 2W1NA 3TO4C 5IW1A 4GOSA 1UZ8A 1DEEB 1J9CT 2CK0L 3LS4L 2FZ3A 1KT2A 4ZTOL 4F57L 4DVBB 3LKPA 1N0XH 5HGBA 3LKOA 1CE1H 4PREA 4JRXE 4A6YB 4ZS6C 5DYOB 2ZUVA 3LMJL 4ONOA 1UWXK 3DI3B 3K2UL 4XB7A 2P44B 1JZ5A 1D9KD 2EDDA 3EYSH 5C6TL 5HY9B 3CX2A 5AYQA 1Q94A 3IAGC 4MYWB 4WV1C 1I8MA 2BVPA 4L4VE 3BSZH 3V4PH 3JWDL 3NOIA 2C26A 2AJVL 1H5BB 2NNAB 2G2RA 2X4PB 2OZ4L 5I66A 4JRYA 5BOZG 2HKFH 2OK0H 2O5YH 4GMSL 5C07E 1OPGH 3ARQA 3HI6H 4M48H 5I1JH 3SDCD 3TO2B 2YPLB 3B2VH 5EFIB 1MCKA 3VFGH 3EGSA 3OKLB 5CEZE 1K85A 3NZHL 5E99L 3SDXA 1NLDH 1NCUA 1Y0LA 5F9OL 1P2CB 4RAHA 4KTEH 3MRFB 4PJIA 4QF1B 5DJZA 2EIBA 3TBSB 1SVCP 4PS4L 5JW3L 4FABH 2X6MA 4OB5L 4NN7B 1TQCB 2A74B 1JPST 3OR6A 4QRRE 3O2WH 1B2WL 1YNLH 5C08A 5L7XH 2JB5H 3JTSB 3O9WB 4JB9L 1U8NB 2VH5H 3RUGE 1UGNA 2RFXB 4YHZL 4Y19D 3UYRL 3I6GB 5AAWA 1IC4L 4UNTA 3KVQA 3FB8A 5IB2B 5H2BB 1I7RA 4OCRH 3RWIA 2DQTL 4WGVB 2EKJA 4Y4HA 1U95A 5E6IA 2WAHA 3F58L 5B4MD 4AMKL 5C0EB 1OP5K 1WIOA 2VXQH 3RWDA 3VFRA 3BIBX 1WBXB 4S10A 2XZCH 4U33A 4S1RL 4ISVA 1Q9WB 2A73B 3TFKD 3CDGA 4HCRA 4HWBL 5F1NA 5L6YL 3GMMA 4JFYB 1UJ3B 4I77L 3CZFA 4YDKH 1DQLL 5HHME 25C8H 3L9RB 5IWLC 3SKNB 4ZOCA 2AKRB 3QI9A 5HGDA 2ERJC 3LN5A 4LDLB 3IRZA 5SWZD 5A2KH 3IDMA 4BZ1H 1NKRA 4JFPA 4C56D 3ZL4H 2CK2A 4Z9KB 1A6VH 1I8KB 5EULV 4PYHA 4LVOB 4P4RB 3GRWH 2CR3A 3BEVA 1A1MA 1E6OH 3A6CL 4CGTA 3ARBD 3T77B 3BMWA 3KYKL 3FT4A 3HUJF 4NZUL 4ODTL 1FH5H 4QXTB 3U0TB 4G7YH 3JTTA 5LWYH 3ME0A 35C8L 2DLFH 4IOFC 4MDJA 3NCMA 4M93C 3UTSD 2HLFD 2YD1A 1HYSC 4PJHA 1IE5A 5IF0B 2G5BA 4W81A 2VSDA 2FX7H 3MTRA 3ROOA 5K9OA 1BD2D 1KCUH 4MQ7B 4P57B 4R2GD 2Q7YB 5A1AA 4P59L 1CR9L 3CDFA 1ZTXH 4Z0XB 1Q9KB 1CZ8L 3V6OA 4OF8A 3QEGL 3QDMD 2DWDB 2Z8VC 4PJAE 3SE8H 3VGDA 4OZGB 2L0DA 3G08B 1LK2B 2YA2A 4KI5C 1SJXA 1OL0A 5BZDB 1DQQA 4PG2A 5GGVY 2R2EB 4MB4A 5T1MA 3G9VA 4KK6D 1DDHA 4OKVB 3SQOL 2Q76B 3BKYL 3RWFA 3VFMB 3MGTA 4TULH 2IF7A 2BDNH 2C3VB 4HKZB 1J1OH 1YC7A 4GMTL 1CFNB 2MPAL 4NQDB 3IFNL 3WLWC 1QO3A 1TZIB 3JSSA 4NN6B 4QHMB 4KI5E 1T0NB 4WY7H 5ALBH 3ALPA 3HLAB 4FOMA 3GSVB 1OAZH 4LHJB 4GS7C 1QLFB 5DMYA 5LGJA 1RULL 1CXHA 2AV1B 2FYYB 2L7JA 2XTLA 3IF1B 4O9HL 4HKJA 4WI8A 5D6CB 4DKFL 3V0VA 5LCVL 4OD2B 2CH8A 4IMLB 5EU4B 3VI3F 1I9RL 2BFVL 3EJYC 4GXUN 3LKRA 2ITCB 5IHLB 4KJWC 5GRUH 2XKUA 4XC1H 1QA9B 1T1WA 1XF4B 3OGCB 1C16B 5D1ZD 5DUPH 3QQ9D 4MD4A 5D1XD 4DEPB 4Y4KA 4DCQB 1NBVL 4ZFOB 4CAGA 5GRXG 4GUPB 2NY6D 1BVKB 3PGFH 5JZ7D 4JQXA 3A6BH 4TPRL 2XPGB 5EG6C 2C7UB 5F3HB 3MNZA 1D6EB 4XCNB 1IGTA 3MV8D 4NWTL 4MJ5B 4MX7B 2DIAA 2VN7A 4CN4A 3N1MC 1FGVL 4YHIB 5I1HH 3ZT5A 1DLHB 5F44A 5EU6D 4X8JB 3SN6N 5SV4A 4DN4H 1IGYB 2Z35B 3N0PB 5MERA 1UM5L 4MNHB 4AJ0A 5ANME 3K4AA 1I3VA 5DTFA 1NBYB 4ALAH 2PR4L 3ET9F 2WWMD 1NAKL 4G8GA 3A6OA 1NGXA 5FDWB 2H3NB 2ZCLL 4PPTA 5L2KE 3TO4B 3H9SB 3O0RL 2P8LB 5HTSA 5ETUB 2FIKB 1ZT4A 2QR0A 1ZLSH 3LS5L 5GSVB 3KWWB 4HK0A 5C8JA 4OZIA 1DQDH 3C5ZB 2VXTH 4JZJC 5DC4B 3KPRE 2JJTC 5C07B 5IB5B 1CLOL 3IXTB 3IDJA 3REVB 3CC5A 2IQ9H 4O4YH 4YO0B 4PLKC 4O58L 4IIQA 3ZKQD 4WV1B 3DOSA 1G7PA 5E24E 1AIFA 4J3XA 3DIFB 1I7TA 2UVEA 3MBEC 5IR1B 4JAMA 3F7YA 1FNSL 3KPLA 2QADC 3HC0B 3E2HC 1MJ8H 4NHCH 2BVOB 4N68A 2DBJA 4NN5C 1M05A 3TBWB 1S9YA 3KPMB 4NC0B 1KJMA 2UYLA 3GSXA 3CK0L 3MJ7A 5GS1C 4OI8A 2W0FA 2IWGA 4J3SA 4D0CB 3S88H 5GGQL 3VXOB 3O2DH 1F3DJ 4N0YL 1NBZB 5BS0E 1FDLL 1W0VB 3C6SB 4P48A 5EZLB 5J7CC 1FRGH 4JG1H 3SJVB 5C0CD 4RFOH 4P3DA 5CJBA 5KSAD 4U6TA 4M7KH 4DUXA 3JUZA 2VQ1B 2PNDA 4M3JA 3I85A 5EO0A 5T1LA 5EU7C 3WXVH 2ATKB 3T0EC 4JG0L 4MDJB 5AYUL 4X6CE 4XVTL 4DOHE 3ARED 1A14L 1U8IA 3FMGL 4K9EH 2AABL 4XVSL 2KDGA 4XP5L 5LXGH 4C57C 5HHMB 3CCHB 4MNGA 4M7LL 1OM3H 2J8UE 4J4PC 4LSVH 1AQDB 2PCPA 3L5JA 3PQYB 4YDVA 5T3XE 1ONQB 3RA7H 2XRAH 4KFZC 4QRPD 5EU7E 5CZVL 1SM3H 2BY3A 2CSPA 4PJXA 3T0EE 2VISB 9CGTA 2R1WA 4P2OD 4UV7H 3FQNA 5FHAL 1OAYH 5CAYB 4EN3A 3VE0B 4ZDHB 3QG7L 2B4CH 4GQ9H 1VFAB 1FNHA 2ERJB 1U2CA 5E9DE 4OZFB 3MO1B 2Y1VA 1DUYA 3X11B 2Y23A 3BKJH 5CEYA 5EOCH 5D93C 3LN9A 2Y07H 1T1YA 4LPYA 2DRUA 1NGWB 2OJZH 4NNXB 3CVHA 1S7SA 1JI2A 1HSBB 3AM8A 1JIBA 3ARDC 2VXSH 4M93B 3VXRA 3ES6B 3R1GH 4UOW0 5T1KB 4R7DA 1HHHA 3HC4L 4PJAB 2YRLA 2ARJQ 2R2BA 1ZEAL 2VLME 1YZZA 1AXSA 5JXEC 3GUTA 1UACL 5FGCB 4UIKH 4XRCB 1BFTA 5K33A 3TJEH 4WFEE 5KSBE 2R4RH 4UDUA 2A1WL 3O6LH 4M6MH 4D0DA 3P30L 4JDTH 3FZUC 1TCRA 2APXA 4ELMF 2CUIA 1RUMH 5BJTA 3GSUB 4LLMA 4LLWB 1VKXB 4KJQD 1MCBA 4YPGB 3FAXA 4Y5XC 1YUHB 3D69A 1C8PA 2OR9H 5I17B 2FATH 2BNUB 4K8RH 3MV11 4F8QA 3KS0H 3OZ9H 2Y72A 4QKXB 1MQKL 2C1PA 3PDOA 3UJTH 1GGTA 2GK0A 3SCMA 3BPLC 5L9DL 2UZYB 5T3ZE 3RL1B 3BYTA 3K3QA 1UEMA 4XP1L 3OF6A 4ZXBA 1U3ZA 3MRDA 4GS7B 1DQJB 4A2LA 3RDTD 4LASH 3GB7B 2ZKHL 3ZYZA 3OKMA 3MA7A 2X4PA 3GMLA 1K2DB 1WAAF 3WN5A 1R3HB 3BPCB 1VPOL 3EYQC 1TJGH 4JLRA 3MRRA 4TUJB 3FO0L 4ORGA 4X7SH 1AY1L 3ECBB 3FJTA 1W2KT 1NLBL 1ZWIB 3P11H 1QFUL 4ONFL 2FJHA 4WI7A 4Y16C 2NR6D 4FQ1H 4EUPA 1HOCA 5HHOD 1FFPB 3PGDB 4BKLB 4GKSA 3MRFA 3GIVB 4U1HB 2NZIA 2UY7A 2BVEA 15C8H 2A2QT 3OXSA 4ZFGL 2VKXA 2LQRA 4MZ3A 5ANMB 3HAEB 1P1ZA 3DHJA 2YZ8A 5DO2C 2I60L 4YHMH 5DR5L 3WJLA 4IDJL 3CJJA 4GG8B 1ZLUK 1IBGL 1MWAA 4FQIL 3CSPA 4F2MB 2QKIA 4YR6B 3INUL 3FCTB 1MIML 5L2KB 1A6ZB 3MNVB 3V2AR 2RFXA 4I3GA 4NWUH 3LN4B 4F9LC 4QXGL 1ZGLB 1YQ2A 1MVUA 2V5SA 3MXWH 1QRNE 5FUOL 3QCTL 3KYOB 4WNQA 4GJTB 5HDQH 4W4NA 3KPRB 3ZKXC 5C0ND 4OZGF 1BOGB 5I1AA 3AVEA 3QUMA 5GGVH 5KJRL 3GMRB 2IFGA 4UNUA 4XBGB 4KV5E 3MUJA 1B3JA 2ZOLB 3ARTA 2OMNA 2DDQH 4WI9A 5C09A 2AQ1A 4ZD3H 1OF2A 3KYMA 4NFDA 4XNUH 4NJAH 4JN1H 3L6FA 1JPTL 2ICES 3S5LB 2BSRB 3D39D 3F6LA 1XH3B 1YY8A 3L5WB 5CGTA 3RIAK 1KLGA 3L3DB 3UYOD 4U1KB 5BVJA 3QJHB 3D0LA 5CP3H 2FNBA 5C0AA 1YC8A 1MLCB 4E5XA 1CBVL 3F12B 2EE3A 5CHNA 1P9MC 1R5VA 3MBEB 1G0XA 3DI2B 5C0FB 3VG0L 1R3LA 3BH8A 2QADB 2FWOA 3U0WH 3FB7B 3T77A 3ZKMC 3E2HB 5BS0B 5L8KB 3SDAD 4NN5B 2UVFA 3VFNB 4L8SB 1I8IA 2IAMD 3B5HA 3PJSB 3FO1B 4WHTA 4MJIB 5CSZB 4P5KA 1F8TL 4PJ5A 5KTEL 5GS1B 2IH3B 2AW2A 3DVFA 3H9HB 1E28A 2Q86B 4GXVL 4X6CB 3QFDB 4N5UA 4DOHB 4R96A 1I9JL 1T4KB 5C2BL 2DN7A 5C92A 5GRJL 4QOKD 4F58L 1BQHB 4CVXB 3QHZH 3G5XB 3PWVB 2FD6H 5ICZA 3IVKB 3C09C 4ERSH 1JPFA 2CKBB 3MRGB 2ZSWA 4NM8L 3T0EB 1MFEL 4JPIB 4KQ4L 1H3WM 5BV7H 2QTEA 2LFGA 4LSUH 1GOGA 1H15A 1BPVA 1TCMA 3K8MA 1U8OA 1KGCD 2YEZB 4HKZA 2ICEA 4GAJL 4JHWL 4NO3A 2G75A 4KK8D 3OGOE 5E9DB 4IRJD 4JPVL 4AEHL 4JO4L 5EZJA 1EA9C 2H32H 4X4XB 2D0HA 1LP9E 3HE6D 1KB5H 1KJ2H 1F11B 3QUKB 3MRNB 1MCCA 1PZ5B 2V2TA 3CFCH 4UZGA 2XA8H 3BT2L 2PXYB 4NCC1 2BC4B 1DR9A 3QG6A 4K7PY 5IFJB 2DWEB 5I1EH 1QSZA 5TQ0L 1INDH 4TSAL 5FGBA 4CVUA 1EAPB 3MV7B 4UT6H 5IROC 3JWNC 4HS8L 1IMHC 4N90D 5D93B 5F93C 1B4JH 4G9DB 4YGAB 1CICC 3SDDC 3WNOA 4NZRH 4WUKH 3W9EB 4KAQH 1CK0L 1EBPA 1FO0H 3W0WA 1S9XA 4HQQL 4WJ5B 5HDBF 5HYFA 3RVUC 3B6SB 2UZIH 5EZOH 3MJ9H 4Y8DC 3VH8B 2MKWA 4XPHH 2QHRH 3QZWG 1YEGL 2XWJA 2X4NA 5EA0H 1U8PB 5E4EB 5B39A 5ADPL 3B5TA 1RVFH 1V7NH 2IEPA 2UWEA 3NA9L 3T3MF 3O4LD 3IU3B 2GJZA 1G9EA 4LL9A 3V52L 4TSCH 1P7KA 1MRCL 1VGKB 1G9MH 2B1AL 4XTRD 1SEQH 1FAIL 2UV3A 1EO5A 4JRXA 1E6JL 5EC1A 2J6EA 4Y5XB 1OVZA 1JNHA 1MFBH 3HNTL 1T5WA 1FNEB 3JV6A 4PFEA 1TJIH 2W60A 2DQIH 5I9QC 4J23A 2DYPA 2IPKB 3MSPA 4U49A 4L4VA 3OB0K 2W59A 5E2TH 1PFCA 1Z2KA 3V5DB 3P2TA 5TDOA 5D1QD 2AEPL 1FL3B 3P0VH 5TDPB 4HXBL 1T1ZB 2OCFD 3BPLB 2ZPKH 4FFWD 5DMJB 1MNUL 1AP2A 2OJEA 3DV6A 5E0QA 5DRXB 5JPMA 1V3JA 5T1DH 5KS9E 3GMOB 2VDOH 5LBSH 4OV6F 3PWUA 1S5IH 1G0YR 3VG9B 1EGJH 2DIJA 4W6YB 4M03A 4JM2A 2HA1A 4DK6A 2P47B 1TETL 4PBVC 4QRRA 4QHKI 4DAGH 3OL2A 3HMXA 1BZ9B 5JTWA 2VWEC 4HWNA 2OXGA 3RUGA 4NO5A 1NMAH 3SKMB 4NZTH 1L7IL 5DK2A 4Y16B 1IKNC 3I84A 4P9MH 3WLBB 4OCSL 5GIRA 1G6VK 3UTQB 1KCSH 2BY0A 1JZ6A 3V6ZB 2ADIB 2AI0H 3RP1A 5IK3A 1DEDA 4WWID 3TNNA 5F7DB 1JI1A 1XIWA 2YD3A 1NCAH 2CJUL 1LO5B 2DKMA 1D5ZB 1GIGL 5I1KL 2VWEE 4PJ9D 1MAJA 5D2NC 5DSCA 5D70L 5JOFB 5C0BE 5IQ7L 1MWAL 5TH2A 5F9AC 1G7LB 1GC1L 3L95A 3QUZD 4JY5H 1KLFA 4J1UA 1WT5A 1QFOA 1UG9A 1ZHKB 3B43A 4X7EC 4X9IA 4Z95H 3REWB 4OV5A 3DLQR 2A9NL 4O2CB 1QFHA 1P4LB 3ZKXB 5IQ9A 1BLNA 5D2NE 1J0YA 2Y7QA 5KVGL 1GGIL 1JNJA 3ZKNC 3KLHC 5IB3B 2YBRA 2YPVH 1G7HA 1FPTL 1GGBL 4LSSH 4YXKL 3LPWA 3HRZB 3QUML 1E4KC 4ZTPL 3N9GH 1W8OA 4LBEA 3IU4H 3RY6A 1JPGA 4P9HH 2F19H 1RZ7H 43C9B 4U1SA 4Z7QF 5JHDE 3TF7C 4DN3L 1DJSA 2GAZB 3DX7A 3EFFB 3LZFL 3RWEB 1OARL 3O3DB 1E4JA 2XXMB 5IW6B 1R0AH 4PGCB 1DANU 1LO2L 3IS0X 4NSKB 2Z4QB 1A7QH 3QUXC 4G6MH 3FT2A 3HMWL 1RUAH 2EYTA 2XN9A 3FQUA 1KJVB 5DZLA 5I1CH 5B4MC 2PO6C 3C8DA 2Z92B 4Y19E 4N0FB 1U0QA 1WWAX 2Y36H 2XZQL 4M4PA 3RGHA 4NRYB 2V6HA 1NANI 5ESQA 1MAML 4K9EC 5GXBB 2VXVH 4P0DA 4X4ZA 1CDJA 4P5MA 1RFDL 3GO1H 1G9NL 2EDHA 5DJ0B 2QEJA 1ZGLP 1S9VB 5A3ID 4KY1H 1P53A 3DUUB 4R90H 4XP6L 1X5FA 2G9HB 5E8PA 5D7LE 2WBKA 2EIDA 4M6NH 5EORL 3F65A 1JGVH 3VRIA 4AYFA 2ZNWA 4Q0XH 4WU7B 4R3SA 1CDGA 1HNFA 2XYCA 1VADA 4OD3H 3V0WH 2B4CC 1JRHL 2I07B 3C09B 3TZVD 4U3CA 3DGGA 4XPBH 5FM5M 1INEH 1SYVA 2YC1A 1AI1H 2XOTA 2GHWB 4KUZL 5SWZE 3D18B 3B9DA 4E0RB 2ED7A 2HLFC 1YN7A 5C0IA 3BKCH 4C56E 4LPVA 3RWGA 2ARJA 4WU5B 1XMWA 3DRQA 4BFEA 4GBXA 4Z7UF 3OKKA 4RX4A 4QHNB 4H8WL 1QSFD 5EOTA 1T89A 1KJ3H 1QNZL 4RA3A 4BH8A 5FUZL 4AH2B 4GW4A 3GGWA 4PIRF 5IEHB 3GK8H 1FE8H 4I3SL 1J1XH 3GMQB 1H0DA 2KZ1B 3QA3A 3VXQA 3CZJA 3UTSE 4L3AA 5IB4A 1CT8A 2P46B 4FQCL 4PTTB 5I1GL 1LO4H 3EOBB 3P4NA 1BD2E 4ZOEA 4PJGB 1G7MB 3U7YL 1JWMB 1FYTA 1FORL 5E00A 1H3PL 5GGRA 1EO8L 4OUUA 1OAQH 3ARRA 3SDDB 4BKLA 3HPJA 5F7NC 3QDME 1FZJA 5IMOB 4MA8L 2MWCA 3TH3T 1S7RB 2E9WA 5ESAB 3QYCA 3TH4T 2B1HL 8FABB 4Y5VC 2AJSL 3J7HA 1ZHLB 3IJHA 5HPOA 2AV7A 1SJHB 3U9PH 1T1XA 4CJ0A 4BQ9A 3CH8A 3PWJA 2BERA 1IEBA 3RY4A 4NGHH 1T21A 5I73B 5C1MB 3E6HA 3ARWA 1NMBH 1J87A 2DQUH 4KXZI 1RUPH 3JVGA 4G8EA 1I3GH 4WTWA 1Q1JL 1DBKL 3CFKA 1U92B 2CLZA 2Z8WC 3UTTB 2VDPH 5IVXA 4KK5D 5J1AA 1DUZA 5HGAA 1ZHBA 5INDA 2IANA 3B83A 5D1XC 4XGZA 3L7EA 1QD0A 2NY1C 5KS9B 3GMRA 2P5EB 2H1PL 2FEEL 5I9QB 5GS0H 3BRGC 4OLEA 1PKQA 3D2UB 1FBIL 5DA4A 5DQ9A 4R7NB 3WUZA 2W9DL 4M9PA 3WFCH 5JHLH 2VLKD 2ESVB 3P9LA 4JZJA 2V5YA 3BO8A 3S3PA 2JK5B 2JJTA 1PLGL 2JJVA 2NX5A 5DEGA 4CMMA 2Y4SA 4U1KA 1PG7W 5JW4Q 1ULVA 5IGXL 5EU5A 2YD8A 3F8UB 3VXNB 1OQXA 3I3DA 2MQ3A 4RWYH 3V95A 2WWMC 3LRHA 4K7PH 1WJ3A 3BVNB 3MV8E 5JXAH 5DT1H 4N0RA 3FB7A 4P2RD 5J0BA 4JFXA 1N2RA 1H3VA 3F7RA 2P43B 4KGLA 5D8JL 2ADFH 2VYRE 3I50L 3MFFA 1AGCA 4PJ8A 3HS0B 3OPZL 4I2XE 5EU6E 3WD5L 1CGXA 3WFEL 3L7FA 1FFRA 3P0YH 4WFGE 4N9GB 3TIEA 3BDYL 5C0BB 4U6YB 3OKEB 3WUWB 4LOUD 4M1GH 1N7MH 1NL0L 1IEAB 3D1MC 4KH2A 4NFCA 5BO1H 3T2QA 1BEYH 2XA3A 5F89A 1MCHA 4PGEB 4Z7VE 3H6JA 5D2NB 4NUJB 3W9DA 4B53A 4Z76B 5E8OB 4HXAL 2J8UA 2F5BH 3NAAL 5I2IA 3RFZC 4XPGH 3GJEA 3MJ8B 1BBDL 4P5TD 5ITFB 2EEAA 5JA9A 1JF1A 3G6JA 1NBQA 2R0KH 2FLBT 3CU1A 1ZKAA 3HHRB 1WIPA 3ZDXF 1J05B 4FP8L 1ZS8A 3HI1A 4QRSA 4TQEH 3RTQD 1DBAH 1EFXD 1OQOA 1MCOL 5JHDB 3GMNA 1YEJL 4GKZA 3BE1H 2GFBB 5JUEL 4F33B 1GHFH 4I0PA 4NO0B 5D6DC 3IB4A 3X13B 1Y6NR 3CFJA 4CW1B 2X4RB 5DHVH 1FN4A 4NRZA 3KJ4C 3U1SH 1N8ZB 1W72A 1RZ8B 5FKAB 5FKPA 5DDHB 3PDGA 1GOHA 4GRWF 2BSTA 1IGJB 1FFNA 3C9NA 1H3UA 5KSVB 3SE3C 4H20L 3OJMB 4G6AC 3LS4H 4PJ7E 4Y19B 4AENB 4F57H 1T66D 3KLAB 3FT3B 5E08H 5KW9H 4JHAL 4X9HA 4X5XA 4U6XA 3NPZB 1Q9LA 4TUOB 5EIQA 3AREC 2PETA 3QUXB 3NZ8B 2HJKA 2PO6B 1RZIA 4MWFA 3VWKA 3PNWA 3IFOA 2VQUA 1B0RA 5KSBA 4E41A 5D7LB 2YA1A 5BV7C 3MRBB 5SWSA 4XH2B 5D71L 4GRMB 2AXGA 3ARDA 3EOTL 3FRUA 3HR5B 5BVPL 3VI4F 1UM6L 1NEZB 4P2OC 4WHDA 2NW2B 4MNQB 1Z3GL 2AAVA 4JPKL 4MQTB 3GSWA 3KPOA 2Q1EA 3IJYA 4I13B 2ORBH 5IBTL 3EYOA 3NZHH 2RQ8A 5J9PA 1NGYA 3BZEA 4UBDD 5F9OH 3BD5A 4GLRH 3MCG1 2PYFB 3LIZL 3GSNA 3G04A 3HG1A 1R24B 4QRPE 4RWHA 3TBTB 2WBJD 5F1IB 3HE7C 1B2WH 3C60D 2FGWL 4BH7B 3M07A 3T0BA 1IKFH 5D7JB 3ROLB 4YHZH 5B38A 2BOBB 4BFGA 2WMPA 1IC4H 1Q8MA 1XGUA 5BW7C 1W0WB 4J3TA 1XCQA 3NACL 4P23A 4ZFZA 3P4OA 4BSVB 3GSOB 1ED3B 2ICWA 1HEZB 3EIFA 1YDPA 1BD2B 5B22A 1GCFA 3MRHA 1QEWB 3F58H 4TN9A 5CD3A 4AMKH 3QWOB 1JMXA 5TDNA 3NFNB 4K23L 5C0RL 1CE6B 1I4FA 4HWBH 4ZO6A 5DK0B 2EDLA 5L6YH 4KJQC 3SKOB 1CYGA 4LK4A 1BOYA 1YYML 4UIMB 5IBLC 1QFWI 1WFTA 4I77H 4Y4HD 3GHEH 1G9MC 1IZKA 1I1AA 4Y2DB 1I3RB 1DQLH 2IQAA 2DL9A 4E42A 4KMLB 3DBXB 2YUVA 2ADGA 3VGFA 5BRZD 4PJFE 3LDBC 1YEFH 1YQVH 4O2FB 5I19H 4MSWA 3RWHA 1MH5B 4FXKA 1QRNA 1P7QD 2D7PA 2AJ3B 5L8LB 1YEDA 2A9ML 3O45A 4OCYL 3SKUD 4Y5VB 2CIIA 2Z91B 2BHUA 4YBHA 5F7UA 4GRLA 4JR9L 4CKVX 3BW9B 5C9JB 1FVEB 4HBQA 1NUDA 35C8H 4NBZB 3RDTC 2YD6A 1J0IA 1JHTB 5F1KC 3TT1L 2AJYL 1AKJB 1QLEL 1DBML 5JW4N 3PHQA 3G5VA 3IAQA 1IAOB 4NT6B 5DC9B 5DI8A 2WP3T 3SO3C 4MJ6A 2JJSA 5HYJD 1FZMB 5EC2A 2DMBA 4P59H 2YK1L 2E6JA 2VL5A 3H0TA 4IRZH 2R2HA 1CL7L 1ERNA 5C3TA 2IFFL 1OGAE 2NR6C 1A6WH 1I8LA 2YRPA 3VFPB 1CR9H 2NY1B 2YSSB 1CZ8H 2FR4B 4NBYB 3QEGH 1MPAL 2IJ0C 2K7PA 2LU7A 3RNKB 1K8DA 1T7YA 2AK4D 1KULA 4JFED 4JFFE 1IL1B 3IDYC 3SQOH 3BKYH 1XZ0B 1FNAA 1MVFA 2AERT 2BHYA 1MHEA 5IV2A 4I2XB 2MPAH 3IFNH 3QP3A 1JV5B 1ZVHA 1QFWL 5IMLA 2R0ZL 3KHQA 2P24A 3LY6A 4NQEA 1P9MA 2D7QA 3MRQB 1FG2B 3VWJD 5C0NC 1B90A 5IFHL 3LEXA 1CDCA 1EFQA 4HX1B 4U1LA 4PJGF 4O9HH 3RVTD 4JQIL 1NJ9A 2A0LC 3DVNB 4FZ8L 4MXWH 4ZPVB 4ACPA 4U1IA 4Z7VB 2IH1B 3KYAA 4DKFH 3TBVA 3ULSB 3MV01 2EXYC 5F7LB 5JOEA 2HRPL 3HCVB 4QTIL 2QQQA 3ARGA 1UB5B 4U3HA 4LLQA 3BP7B 3L3JA 4EDXB 2F54E 2YN3A 2HLAB 1U3YA 1MFNA 2AXJA 3DV4A 3K4ZA 4HFUL 2PF6A 4QHUB 1NBVH 1TDQA 3TESA 4P9HC 1FGNH 4MD0B 1KTRL 1ZA3A 3N85H 5D2LE 4K7PX 4GAYB 3CPLB 3M1BB 5HPMB 4EUPG 1PZUB 5J12B 4LCCC 1HHGB 5I15L 3MRMA 4OZ4B 1N59A 4B5EA 5IG7A 4XWGH 3HZMB 4NWTH 1LP9A 3SKJL 1NC4B 3SDAC 4NQCA 2OXHA 1FGVH 2X4TB 5TE6L 4PRHD 2APVA 2IAMC 5IEKB 2JCCE 1NGZB 5IHBA 4PJ7B 4X80H 2PYEE 4IDLA 3ZTJG 4HIXL 1A7RL 1UM5H 5KS9F 1ZOXA 1GGCL 3BP4A 3TVMC 5TF1L 2PR4H 2O93L 4B50A 1NAKH 3KJ4B 4QHNA 4YFLF 3K4DA 3TN0A 3DECA 3FQTB 3LRSA 4BZ2L 1OW0C 2HT2D 1X5XA 3O0RH 1YPZE 1EMTH 1W72L 1FHGA 3NCYP 2JIXA 5A2JH 3U6RB 3BPOC 1YMHB 3CSYA 3LS5H 1Q72L 1MUJB 5I76B 2IMNA 4PJDB 1RUQL 4PJCF 2ICWI 4PRPB 4FQXD 4G8GD 3RVXD 3T04D 1XEDA 5HHQA 3Q1SL 3R4DA 4JY6B 5FA3A 2BNQA 5IROA 3RWCA 1H3XA 4WI4A 4FFZL 2X2YA 4QOKE 1CICA 3MRPA 1AD9A 2DLGA 1HXMB 1DZBA 4KK8C 4IRJC 3PP3H 4ZUUA 5DD6B 5E5MA 3VGGA 5BV7B 4QYOB 1FNSH 3D3VD 2EICA 1XGTA 2VMFA 3HE6C 5KVFH 1IFHH 1KC5L 5DEFB 1ND0B 2AJUH 3BDXA 3O3BB 4OFKA 1NSNL 4UB0L 3UX9B 3QXDA 1UVQB 1AD0A 4F3FB 3BXNA 2H32B 1Z5LA 5DUBB 1KB5B 2FDBP 3AAZB 1KJ2B 2J8HA 3MODH 4OLZL 1IQDB 5GGQH 5CWSB 3QIBA 4XCYA 3RZCC 3QFJD 4OIBA 4YXHL 5CLWA 3FQXA 5CEXA 1AGFA 3FO9A 3HE7B 4FMFA 3SBWA 2OTWB 3DRTB 4LMQI 5MENA 1UFUA 2AGJL 1YMMD 4GW5B 1DVFA 3QIUA 4AT6B 3PIQA 2O5XL 1J1PL 1QPPA 2Q3ZA 4U0RC 5IMMA 1A7BA 5JPNB 4N90E 4XVTH 4XZUA 4H0IA 3FMGH 3S98A 5CGYD 2AABH 3ARFA 4XVSH 4UDTB 3DGCR 1FO0B 2A6DB 4LDOB 2JB6B 1NKOA 4M7ZC 1XGPB 5ALCL 1B4RA 3KXFE 1OT1A 2FGZA 1OAXL 1RZFL 1ZHNA 5CZVH 4EDWH 3JV0A 3RWJB 1A7NH 3G5YA 3L5IA 4HCRH 5FHAH 1YEKH 3PL6C 2YS4A 3O4LE 4XP4H 1OOAA 4YAQA 1MIEL 3QG7H 2P7TA 3BEWB 4XAWH 2NY2B 1MJUH 1JZ4A 5MEOB 1K8IA 4Z8FL 4KZEH 1XF3A 1OP5H 2ATPB 2OTPA 5KAQF 5GS0C 3VXMD 4M8QA 5JIPA 1NEUA 1D9KA 4HBCL 5EBLB 1HILB 1M7DB 3K7UA 2OSLA 4LKCA 4EVNB 1QUNA 4HMDA 5MP6L 1OGAB 5F21B 3H7BB 4DZ8A 2CDGB 4Z77B 4RAUB 2DD8L 4Q2ZA 1E27B 3FTGA 5HGHB 1A6AA 1SY6A 5ENWB 3SDCA 3KPNB 5GGTL 3MZTA 1UACH 4JFFB 3WEXB 2F53A 2VDNH 5J8OA 3TCLB 1KEGH 4J8RA 4L1HA 1A3RH 1A4JA 2E7LA 3P30H 3ULUF 1XF5B 2VR5A 3LEVL 3PXJA 5B39G 4X6FB 4Z78A 2XQYG 1N8ZA 4O5LH 5J06A 4LIQH 2BP3A 4ELMA 2EDJA 1HH9B 3QNZB 4GO6B 4PJ9C 1HWGB 1K9TA 3VRLF 3BX7C 5DLML 2VLJB 1BX2A 5IOPB 1KIRB 3L3OA 2X4UA 2EZ0D 1A9BA 3QNYA 3QPQD 4Z5RB 5L9DH 2NY0D 4YIQB 3BZ4B 1X5KA 1FNFA 5FAAA 3B9KA 2WLYA 5SWQA 2LVCA 2X4QA 4RIRB 4Z7WE 3TT3L 2F54B 2I9TA 4HV8B 4HWZA 3WHE0 2ZKHH 3O6FA 1BM3L 1YNKL 2OTUB 4H26A 5HYQA 4PLJD 4XMKL 4HJJH 5D2LB 2NW2A 1TZGH 1TTUA 1AY1H 1L6XA 1S7VA 4ODVL 1WAAA 1QFUH 3H3BC 3OF6D 4ONFH 4ZXBD 1S5HA 4K3JH 4Z7NE 3QXAA 4HWEL 3U46B 2JCCB 5SWZA 3U9UB 2PW2A 2PYEB 4HF5L 4C56A 1QQDB 1C1EL 2I60H 5DR5H 3WO3B 5HSFA 4IDJH 5D72H 5EN2B 3CFDB 3QULA 1IBGH 4LCCB 4GG6F 2H9GB 3CFBB 4NDMB 3ARBA 5TF0A 4G7VH 1BIIA 1CGWA 2RJMA 1MIMH 5F7MC 1NFDE 4KTYA 3BUYB 3SDAB 4C4KT 4QXGH 3IFPA 3MCKA 3V6FA 3BUTA 1U91B 2IAMB 1ZSDB 4MAUH 1XGQA 3ARXA 3F5WA 3UTSA 5FUOH 3QCTH 3SY0B 5T5FL 1PQZA 1A9EA 3TVMB 1RJZA 2R56L 1JTOA 3FFCE 5EBMB 3BWAB 5H35A 1N3NB 5KJRH 4PRBA 1A1NA 2CO7B 4FNLH 3MLPA 2OL3L 1FFQA 1MCNA 3BPOB 5LGHL 1EV2E 1Q0YL 3QDMA 1KIPA 1MJJB 3C2AH 1DE4A 2AK1H 1REIA 2UUDK 4RFNC 3TZVC 2IG2L 1A5FL 1JPTH 2WIMA 5GRVK 3UTZA 2P5WB 3JUYA 3VFOB 4PY7A 1IZJA 4Y4FC 3IDXH 4JRWA 4CU8A 3QO0A 3EO9L 2C1OA 1IAIM 4WW2C 4Z7VF 3UDWC 3T1FB 2BSED 3QPXH 1S7TB 5AD0B 3WDIA 2PW1A 1E0OB 2CIKA 4F7TA 2BNRD 2EDNA 5FYLL 4HS6A 4TTDD 1FVCA 4M00A 4YFDB 5IMKB 3NH7L 3QDGD 4AM0B 3LEYH 5KTEH 5ADOL 2LVEA 1T7WA 1VB9A 1HHKA 4CRPA 1A2YB 1TZHA 5SX5H 2OP4H 1D5XB 3RZCB 2EDQA 4GXVH 1RIVL 2QV2A 5K9KB 1U36A 1HINH 2F5AL 2Z31D 5I74C 5C2BH 3WIIL 5D1ZA 2NTFB 5GRJH 5D1XA 5FK9B 4F58H 3O3UN 1TTFA 4M1CD 4HGWA 1R5IB 2W07A 3OKNA 1G7IA 4FTVD 1FV1A 3KXFB 4LCYB 4PGBB 5KVEH 32C2A 5H8DA 2GUOA 2YWYA 4U0RB 1F4YL 2X9WA 3VMNA 1K4DA 1JHLL 1R5WB 3MV8A 4LPCA 4PRAB 4F15C 2Q8BL 1GOFA 5EU6A 1RJYA 4M7ZB 4JPVH 3S8WA 4JO4H 1Z6JT 2FLRT 4N8VA 2HT4D 2WUCL 4PJDF 3ZDZE 5I30L 4KK5C 4NQVA 1QP1A 2FX8H 2OR8A 3GDBA 1PDKA 5I1DA 2X42A 3BT2H 3PL6B 1S8DA 5DS8B 3VCLA 1R3IL 5TQ0H 4TSAH 2R1YB 1XGRA 1KTDA 4XHQA 4HS8H 4A6YL 2DBLL 3GMPB 4HDIB 1N26A 4X4YA 3DXAE 2VUYA 4OLXL 1ORSA 2W38A 2XZAL 4CJ1A 4Q6IC 2BMKA 5GGUA 3WXWH 2DKSA 1A3LL 2K3TA 3MLTB 3P9WB 1WFNA 1FFOA 5GZOD 5F9JB 4BSJA 1RMFL 1MHHA 3HC3L 4HQQH 2VLKE 4FG6D 5DMIH 2XNAB 1AE6H 2C3GA 4YQXH 3TIDB 1IRAY 1KCVL 2V2WB 1PX4A 1KPRB 2XFXA 2KL6A 3CVHH 5IB1B 4LVNC 4DW2H 4OD1H 3B8YA 4XXCC 3NBNA 3HFML 3FO2B 5ERWB 1P6AB 4XMLL 3VXUD 3RNQB 4ZOBA 1QBBA 1VCAA 2OQJA 3WS3B 3M17B 5D6DA 5DVNA 3B3IA 3MX0A 5D9SB 5CCKL 5JW5B 3UCRA 3W0WD 1FAIH 1D5MB 1E6JH 3T8XA 5ID1A 3MV9D 3KDMB 1A7OH 4X98A 3MYJB 1F58H 4KKLC 5DMKB 3HNTH 1N5AA 2A6JB 4I3RH 3VFWB 1UJTA 3VFVB 1IAII 5EZIL 1CFVL 2HN7A 2O61B 4TYUA 5F1SA 4NFBA 4XNQB 2QHLA 1UB6A 4Z7WB 5C0CA 5FGRA 2VZSA 1CD1B 5I16A 5KSAA 2X40A 4HS3A 4PJBF 5CJOL 2AEPH 2BZDA 1YEHH 3H2WA 4OGAD 4P5TC 3SE9L 1FLRL 3CH1B 3MGOB 1A7PL 2L7UA 3QXUA 4PV9A 3BQUB 5FF6B 3DVGB 3NCJL 1JNNL 3F7VB 3AREA 2VZVA 5DJAA 3GBNL 3EDDA 4XHJD 4GT7A 3ZYOA 3U4BL 3HZVA 1G6RA 2CDFA 3MRCB 1OAKH 3FQRA 5FYJL 5E8EB 3B9EA 4G5ZL 3IGAA 3MNWB 4NP4H 1HHJA 4LHUD 3AGVA 1LEGA 5TFSH 5ISZD 4QRPA 4QTHB 1U8KB 1J8HA 4M62L 4WUUD 1HDMA 3O8XD 4P2OA 1TETH 3BZFB 4FQJH 2VITA 5DHVB 4MXVE 1AHWA 5EBWB 1S9WB 4YDJB 2GTZB 4LLUA 1NFDB 1SJEB 1T66C 4XCFL 1CGSL 1XT5A 4HKXA 2HFEB 3WL9A 2VC2L 4BELD 5F3BB 2OLDA 2X4OA 4N0UA 4FQ2L 1LE9A 3W82A 2ITDB 1F13A 1UKTA 5J56B 5CJQH 4JM2D 4EUPH 5HVHC 3LKQB 4M7LT 4POZC 5F96L 4ZAKD 1BF2A 3MBXL 5I1KH 2OTWA 4G6FD 3FFCB 2NXYC 1HQRA 3C87A 4LAQL 3K0WA 2VXUL 4FMKA 3UZEA 4FA8A 1WSST 1MWAH 2GJ6D 2O26U 3ZTJH 5IQ7H 3L3IB 5BW7A 3ZHLA 4EQ2A 4YXLL 4XNXL 1EVTC 2Y6SC 4HGMA 4OJFL 3ZKSD 4ENED 3C5SB 5CILL 5EB9A 5DRNA 1GGIH 3DURA 4QT5B 2DM4A 2IALA 4BQ8A 2DMKA 4KC3B 4EI5D 1ZLUH 1FPTH 1GGBH 4AIOA 4UTBH 4NBXB 3ZHKA 4PJFA 3QUMH 3EYVA 4ZTPH 1MCSA 1CDYA 3TPUB 4RFNB 4XAKE 2Z9TA 5DD5L 1S7UA 4OFDA 2DM2A 4L3CB 4V1DD 2SEBB 2W91A 4WIQA 3LZFH 3OAYK 3CFEA 1U8MB 4K7FB 4OI9A 4Y4FB 1I1FA 4PBXA 4R4ND 1LO2H 4TSBL 3BIKB 1GAFL 1B0GA 4U1GB 5JMRA 1CIUA 4WW2B 5CLTA 5GZND 1BBJB 1X5JA 1YJDL 3F6IA 2X7LB 2XG4A 1UA6L 4RGND 5DZNA 2NXZC 2R8SH 1MEXL 3RGVD 3RDTA 4PY8J 4GAGL 4PJIE 3IDUA 4QRTB 5GGRY 4UINL 5HDOA 5MEPA 5GRVL 4L8CB 4FQHA 1RFDH 2JCCF 2V5TA 1G9NH 5INCB 1IC5H 3DX6B 4QRUA 4Y4HC 1JWSB 4HIJA 3UROR 4U1MA 5E6IC 5DD0H 1EGJA 4YHLL 3D0VA 2FJFB 4XP6H 5AZEL 5EUKB 5I74B 2ZUQC 3S3JA 5D5MA 5HHOA 4MCYA 4L9LC 2FHCA 3QEUB 3BMVA 4QNPE 1U8QB 3WFHA 1V8HA 3ZE2F 1BFVL 5BQ7A 1TVBB 1JRHH 4YE4H 2OI9C 1C12B 4HLJA 2BCKB 5KBNC 4M3KB 4F15B 3GJFK 5BZWB 4HIIB 1ZLVK 3MQIA 3NN8B 4BUHA 2QJDA 3A67H 3QI9C 4KUZH 1KIRA 3N1GC 4CNIA 4JVWA 5JO5B 3RIFF 1X5AA 4OZHA 3I6KA 3QZWB 5JR1H 5B38G 3DMMD 4N5EC 4HIHB 4NQXB 4MD5A 5ACZA 1QNZH 4R0LA 4MA1C 1KPUB 4X6EB 5FUZH 3L1OH 2LV4A 4Z7UA 3DXAB 3L3KB 3GJFA 3O3AB 2CMRH 3B9AA 4I3SH 5GJSH 3S96B 1U58B 1T2QL 2V9RA 3RBSA 1BZQK 1RIHH 4L4TA 2X89D 3WNNA 4F7PB 2IC2A 1MLBA 2NW3A 4Q74A 2M8XA 5MEQA 4RX4D 2HG5B 4O2EB 4MZ2A 3U7YH 2I5YL 2YRZA 2VLRD 5J6HA 3DSFH 3D39A 2VZ3A 3V79C 1NANH 1H3PH 1EO8H 3QJFB 4Q6IB 1JGUH 3R06B 4U1JB 5A16B 3T65B 3V6OC 4MA8H 4WCYH 4IRSD 4PJHE 3FFDB 2GY7B 4UQ3B 5CBAB 1Z0MA 4YHNA 5CP7A 3D25B 4X0KA 5MHSD 2AK4E 1T20A 5C0DB 4ODWA 4LVNB 1G7QA 1G7JA 4NQUA 4S2SA 3S37L 1VA9A 1YPZA 4LIQE 1IM9B 1AR2A 2XTJD 5ID0A 3V6OE 4L8BA 1NGQL 2BVUA 5D4QA 3GI9L 2ZUSA 1S7QB 1U41A 1AH1A 4HIEB 4OF7A 4JM4L 1KTLA 4JGMA 4K94H 1L7TL 3QCUH 5F88B 1QHPA 1DBKH 3TA3B 3NIGE 2IPUK 4Z7OE 5C3LD 2HKHH 3O4OC 2W0PA 4DFIA 2EE2A 3I02B 4KI1A 1ROWA 3QEHB 4QOKA 2N1KA 1F3JA 1UCBH 4LLDB 1I9IL 1F97A 1QBML 1OLLA 3QWQB 2MQ0A 3H42H 1VACB 5ICXA 3DPBA 5DK3A 3TWCL 1PLGH 3KPSD 3AROA 2KKQA 4RZCB 1KPVA 2EE6A 3V8OA 5ESVB 2PTVA 2HVJA 1TTGA 2IAND 4B0MM 4Y4KC 1O7SA 5IGXH 4BFIA 5KANG 3NIFE 4GKNA 3T0VA 4BSWA 3BGMA 4WDIB 5HHVH 4IRJA 1EEZA 4IM8A 5CEZH 3D85B 3LKNA 1WBYA 1YNTA 2NCMA 2R9HD 4HAFA 4QRQA 4V2CB 1G6RL 1OTSD 2DLTA 2HT2C 4QO1A 3OB0H 3OHXB 3HE6A 4LSQH 4JDZA 3UEZA 3K81A 5K59E 3FB5B 5D8JH 4NKIL 3VXSD 4X7CC 2A6IB 3OPZH 4RMUA 3ILPA 5DGQA 5E94A 1V3MA 1BZ7B 4OUOA 4OKDA 1H8NA 4QY8A 3CSGA 3ZE1F 1NL0H 4HH9A 1CFQB 2Q20A 3MLXH 4FQLL 4TRPL 4OIAA 3QDAA 1JUFB 3WJJA 5HVHB 5IW1B 1F3DH 1UZ8B 4D9QD 1X5GA 2NXYB 5FK9A 1WK0A 1UEYA 4PJ8D 1BGXL 2FZ3B 1KT2B 4LCWD 2DQEH 4KXZH 3NAAH 2DQFA 1IGMH 5HI3D 3LKPB 5HGBB 3LKOB 4PREB 4G8GE 3RKDD 3G5ZA 3QRGL 1I1YA 3WE6A 3O3EA 4L4JA 4KTDH 4MA7H 2J8OA 1MCOH 4S0SD 1A02N 4IIQC 1Q94B 3O4LA 3P73A 2APTA 1I8MB 1VSCA 2P8MA 4F37F 2BVPB 5TPWH 4OZIE 3KNBA 2G2RB 3IAPA 2ZSVA 5I66B 4JRYB 3D3VE 2CUHA 4LQ1A 4WTZA 5CD5D 1GGUA 3Q6FA 2GYSA 3EGSB 3QDJD 5C0JA 3KJ6L 2EH8L 3SDXB 3E8UH 4KHXH 3L5HA 1Y0LB 5EOCJ 2KBGA 1J10A 2BVQA 4PJIB 5D1QA 3MLSL 5DJZB 1HK6A 1FZKA 3PV6A 3VDAA 4F9PC 1V7ML 4M6OH 3EHBD 3QFJE 4YHPA 1AXTL 3QXWA 5FO8A 3OR6B 1DBBL 3LKSA 5E2VH 5J57B 2QQKL 5C08B 1F02I 3BFOA 2NXZB 4Z18A 2R15A 1YMME 5GQBA 4I48A 3FB8B 4KUCF 3MLVL 1PG7H 4I4WA 2BOCA 5D71H 1NFDF 3EOTH 5BVPH 1HH6A 1UM6H 1I7RB 3RWIB 2ED9A 5EWIL 2E5EA 5CSBA 1CVSC 4JPKH 3DYPA 4OLWH 4Y4HB 5FYKU 1U95B 5E6IB 5JOPE 3MLWH 3WFDL 1FLTX 1QVOA 4HGKC 3UXFA 3S34H 3KG5A 3RWDB 5C71A 3LIZH 3VFRB 2ZUQB 4ISVB 5D9SA