2B1AL

Crystal structure analysis of anti-hiv-1 v3 fab 2219 in complex with ug1033 peptide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
215
structure length
215
Chain Sequence
QSVLTQPPSASGTPGQRISISCSGTSSNVENNYVYWYQHLPGTAPKLLIYRNDHRSSGIPDRFSASKSGTSASLAISGLRPEDEGDYYCAAWDDSRGGPDWVFGGGTKLTVLAQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 2219, light chain
publication title Crystal structures of human immunodeficiency virus type 1 (HIV-1) neutralizing antibody 2219 in complex with three different V3 peptides reveal a new binding mode for HIV-1 cross-reactivity.
pubmed doi rcsb
molecule tags Immune system
total genus 46
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2005-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2b1aL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2b1aL01
1KYOK 5EOCL 3ZTJG 3IJSB 4OKVA 1B0WA 5F7MC 5IEHB 5IVXA 1QVOA 2XFXA 2OI9B 2KH2B 3MV9B 4ODXA 4N0UB 3VFPA 2IQ9L 3HI5L 4OFYA 5CD5C 5DJZB 2VXTL 4XI5D 3BH9A 4NWUH 2Y23A 1K4CB 3QNZA 4MDJA 4NZUH 2R29H 5IM7B 1MJUH 3ZE2F 3KPMA 3LSOA 4NNYA 4QRRA 4JM2C 4K8RC 5DJ2A 4FABL 5TQ2L 2X41A 4FFVD 4YDLB 3W5MA 5JNYB 3ZHDA 2NY6C 4K3DL 1K6QH 5L9DL 1H3XA 5DRXB 3ABZA 5DEFB 1FRGH 1U8QA 1K8IB 5AZEH 3MBEA 1WWCA 1WBZB 5EUOA 5DRNB 5J13B 1KJ2A 1XGYH 1QLRA 5EZJB 3TZVC 4QYOA 4D0CB 4WV1B 4YR6A 2FB4L 4MVBC 4QOKD 4NKOA 1F90L 2FIRT 1E28B 3SE8L 5TDOB 4L9LC 3I6GB 5GIRA 1JMZA 4Z77A 2Q76B 4KDTC 4PV8B 4QGTA 2WP3T 2X40A 3VI4F 2R1XB 3IFLL 1KPUB 1XCQB 1QO3A 4Z7UB 5D2LA 4I13B 3FZUC 3MBXH 1QR1B 1MF2H 4EI5A 5I9QB 3EYOA 1BOGB 3PF2A 1D5XB 1EGJL 4J4PC 1AGCB 3AREA 2HT2C 3BRDA 5DEGB 5GGUA 1MRFL 4JO2L 4HIJA 4JFZH 4TSCH 4PJCB 2YN3A 1VADB 3N50A 3PV6A 4MMXC 4D9LL 5HHMD 3PQYA 1HHIB 4XBGB 4WCYH 4N9OB 2R56H 3KPNA 4H26B 4QHLB 3BPNC 4KXZH 5FK9A 5KW9H 4NYLA 4NO0B 4H0HB 2Y72A 5BJTB 3FTGB 3AS3A 5I1CL 5DJCB 2DQTH 5DFVD 5ID0B 1S5IH 5E0QA 3RGVB 2FX9H 1I1FB 3JWDC 3QUXA 2I9TB 3HNTH 2VLJD 1VFBB 2GIYA 2C1PA 2R0WH 4APQB 2ZSWA 4QXTA 3U9PL 1DDHB 2P47B 3KWWA 4K07A 3RHWK 1CLZH 1UVQA 4NPYB 5KSVB 4DZBA 4ZPTA 3O9WC 5C70A 4NHCL 4MCYA 2GT9B 4KTYA 2MCPH 2DLIA 2ESVD 1TVHA 1MNUH 5HJ3B 5JHDB 2LQRA 3RWCA 1RUQH 3CFEB 3ECBB 4Z76B 3O4LE 1FL6B 2VN4A 4H0GA 5T1LD 1MSPA 1WFUA 2PXYA 1AQKH 3LKRB 4FQIH 4NN5B 3F7YA 4RX4A 1A6VH 1RK0B 1U42A 2YZ8A 1DLFL 1A4JA 1FNEA 1NAMH 4OLUH 5DUMH 1I7RB 3VFUB 5LGKA 2HFFA 4TYUA 3DROB 2D03H 4DVRH 1XEDA 1AQDA 5CMAB 1IEBA 1KXVC 4FFYH 2CD0A 3WIFA 1DBMH 3VXUB 4BQ8A 4ZXBB 4X9IA 3ZDZE 3MUHL 1A6TA 2ZKHL 4YHPB 3PWPB 3AREC 1U58A 2Q6WA 2UYLA 2VLRA 5CEZD 3B2UD 2P8LA 4Z5RA 1PBYA 2H8PB 3TBSB 5IB1B 2L7UA 1RQ5A 1YUHB 4MQSB 4MJID 4IMKA 1AY1L 1QKZH 2GAZB 3LKPB 3U4EB 4TOYL 2VDLL 4U1NB 4LLAA 3BUYA 5DT1H 3UJJL 3GMRB 5HYSG 2OJZH 2DIJA 3HE6B 4JFYA 3VXSA 2DAVA 2ZG3A 1TZGL 4IRZH 3GM8A 4KHXH 1S7TB 1IT9H 2VZOA 1T21B 5FO7B 1KCVL 1NAMB 1KTDA 5L8JB 2DQDH 4NC2B 3S36X 3CC5A 1FHGA 1MJJB 2GTZB 5D6DC 5DK0B 4G80A 4LMQI 4PJ9C 2CGRH 4F7PA 4JM4L 1YPZB 2VLKE 5L2KD 5E4IA 1YEKH 1FNAA 2D7MA 5I16B 4RBPK 3QQ9D 4W81A 1QNZL 3WEXA 5I74C 2JIXB 4X5WA 2CLRB 4UB0H 4UDUB 1FGVL 2R23A 3BPLB 4RISL 4J6RH 1T5XB 1VSCA 1LO2H 1JV5B 3KXFE 3ARDD 3CX5J 4TVSa 1PY9A 4KRMB 1AHWA 3VFVB 43C9B 2R8SL 4XPHL 3P9LB 3T0ED 4X8XA 3CFKB 3TVMB 4UTBH 5EWIL 2ICWI 3LIZH 4ZO9A 4Z7WE 3V2AR 1MFDH 5DVOA 4PJXF 4OIIL 5H2BA 3QIUA 5C0DB 3CMOH 1H8OA 3BO8B 5DD6B 2HKFH 5JO5A 3GK8L 3IFPB 4KY1L 4OFYD 3ZDXF 5ACZB 4P9HC 3RA7H 4RNRB 3QXDB 3MXWH 4A6YB 1MUJA 1RUAH 4H25B 1EFQA 4P3CH 1JNLL 1CXKA 5J3HD 1AJ7L 2VMFA 2FWOB 5CBEA 1BOYA 3QNYB 2Q7YB 5DD1L 2Z0BA 2OR9L 3ZZ1A 2MOVA 3Q2CA 2ADFL 2K7PA 1OSZA 1QR4A 2W9DL 3MBED 3S8WA 5SX5K 4C4KO 2ZG2A 3DX7B 1AI1L 4O58L 1M71A 5IEKB 4Y4KB 4DGVH 2P5WE 1XH3B 3WBDA 3GMLB 4KDWA 1PX3A 1NGXB 3OF6D 4NN7B 1TJIL 4Z0XA 5IOPA 2DYPB 3VFTB 1OSPL 4FZ8H 1EHLH 3HC0A 3HMXA 4HBCH 4K9EC 4R2GC 4P3WA 3ARGA 1CDCA 2F53A 4HK3N 5FIEA 3LV3B 5ESAA 4Q6YA 4YQXL 1I8IB 1CIUA 1MCWM 3Q6GL 5DJAB 1U41A 1EEQA 1QFWH 1W72L 4EI5D 3UYRH 3FB8B 3QUYA 1AHWC 4JO3H 5EZLB 5IESH 2C9AA 5D7LA 1SVZA 2YK1H 1BX2A 3BW9A 3KYAA 4JY5L 3WE6A 3PQYD 1NCWL 5CILH 3WFCL 2ORBL 3CDYA 5K59F 5JQ6L 4NBYB 2PW2A 1GAFL 4GG6A 4OFPA 4HWBL 5EOCH 2C4FU 3O4LB 4OGYL 1D3CA 1V3MA 1GZPB 2Q1EA 3HI5H 1JWUA 1J1PL 1NCDL 1CZ8L 3GMPB 4G6MH 1CD1A 4AIZA 4YDJB 2R2HA 3OKMA 3QUXD 3DX6B 3MRMB 5TF0A 3L3OB 4K3EH 4NO3B 4P57A 3TH3T 4OIAA 4ELKB 4P2OA 4AYFA 4G6KL 4CMMA 5HDLA 2R15A 1MY7A 5GGRB 1ES0B 1LO5B 3F5WA 4FABH 5TQ2H 5DDHA 5DHYA 1ZGLA 3JTSA 3GMOA 4K3DH 4OQTA 5L9DH 1OHQA 5T3XE 1ORSA 2NZ9C 4JHZA 5IHUL 3H3PL 3OKOB 1A2YA 3MYZA 3QWOA 2X9WA 2V17H 1U8PA 4Z9KB 5FYJL 3C6LD 1CE6A 3HR6A 3GSQB 3QDHA 3KPTA 1ZA3A 3SBWC 2MCG1 2FB4H 1PKQA 2PXYD 1JWSB 4LLUB 3P9MB 4MJ5B 4S1SL 1GYAA 1F90H 4NC1C 5I75B 4RX4D 5I6XB 3E8UL 1Q94A 3WNLA 1X5HA 3SE8H 3G6JF 4CRPA 3MZGB 1NEZG 5EU5A 3HZVB 4HMCA 4KK6D 2FECI 1WLHA 4ZFFA 5C0AA 5HXMA 5HGBA 3CJJA 1RZIB 2APVA 4I0KA 2V2XB 9CGTA 1T03L 1QSFD 1PZ5A 4XNUL 4RAVA 1N4XL 1EGJH 1FVCB 1P7HL 3L7FB 3QYCA 1N7MH 1HCVA 5ISZA 2R4RL 3IDJA 4JO2H 1O7SA 1YNTB 4D9LH 3IU3A 1UT9A 4YHOH 3KHOA 5IIEB 4RDQF 3IYLW 3OKEB 1KCLA 3ES6A 1EFXA 1KFAH 1WC7A 3VXSD 2VITA 3LRHA 3K4DA 5CLTA 3RUGF 3L3JB 1LE9A 4OCWL 3EYQD 3KXFB 4HS8H 3HAEG 5F7DB 4JRWA 4HIXL 3WS6C 4Z7WB 1S7QB 2OTUB 4IIQA 4MSWA 4LSTL 5KSAB 1K4DB 2EH8H 3MLZL 1J0JA 2AJYL 5D2NC 3TCLA 4JFHE 1BJ1J 1YYLL 4HXBL 1R3LA 4NHCH 2DM4A 1HNFA 2V2TA 1S7RA 1HI6A 1RJZA 3DUSA 1T83A 3EYFA 4FOMA 1P7KA 2NX5A 3FB6A 3IDNA 3H7BA 1OF2A 2SEBA 2F5BL 2PYEE 1TZHA 1VGKB 1YDPB 2DIAA 1V05A 4PJEF 2XWJB 1IQDA 4OM1L 1T66D 2NCMA 3F7VB 4LHUB 4OFKA 3A6OA 1NCTA 1DLFH 2OQJA 5DJDB 3ULVL 4NZTL 3BUTA 3SE3A 2RAMA 4P46A 3L1OL 2IPUG 4FQXB 4U1MB 5IG7B 1A9BB 1WBXA 2XKNB 1UXSA 2BVOB 5C6TL 3H8NA 4IOIB 3RVUD 4G5ZL 4OT1L 1A1OA 4U3HA 2QSQA 5CEXB 3STLA 4TSBH 1P4BL 2P46B 1FP5A 2WINB 3LVEA 2YWYA 4MXQC 1G6RL 1F11B 3VRIA 4B50A 4YH6A 2VZTA 4LGSB 4UUJB 2PUQT 3T65B 5HYSA 2FRGP 1YN7B 3D3VE 1AY1H 2AK4A 4TOYH 3UTQB 4DKFL 1G7HB 5T3XH 1ONQB 2ED8A 3OXSA 4B7IA 1MI5A 4PJGF 1KULA 2CRMA 1TZGH 3TBWB 1TETH 4OZGE 5GRYA 1OGTA 3SKNB 4U6YB 5C07E 2QHLA 2BFVH 4OF8A 5DO2D 4I0PB 3I50L 1JNJA 3TYFA 1KCVH 3V5KB 2A73B 5JW4Q 1N2RB 5FF6A 1RZKC 4MX7A 4ELME 3ARGD 1JPST 4JM4H 2F53D 5T1DL 2OTWB 2MPAL 4Y4HC 1T83C 1UKTA 5FOBB 1QNZH 4HK0A 4OZIE 1INEL 5IV2B 1DUZA 2MNUA 1F5WA 1FGVH 4K71C 4L8CA 3QUYD 2IBBA 4C54A 4H8WC 5C0EA 4G7YL 4RISH 1J8HD 1VFUA 2PO6B 1YY8A 5JW5B 1CFVH 2ZOLA 3PHOA 5D7LD 1ZHKB 5D6CA 2X4QA 4PREA 2NY4C 4P46C 5HHPA 5EWIH 3HG1B 1UZ8A 3MA7A 3L6FB 3BGFB 4LPYA 4JDVA 5A1AA 5EBLA 1MFAL 4OIIH 5J11B 3DJ9A 4JFPB 7CGTA 5DTFA 5JOFA 4KY1H 3DUUB 5FCUH 4FTVE 1A3RL 5EUOF 2OS7A 4G8GA 1U2CA 3GMMA 1JNLH 1CFBA 4P2OD 1AJ7H 2W0LA 2ADGA 5SWZA 4YWGL 5C8JA 5DD1H 3H9SA 4JN1L 1MPAL 2R1YA 5GS0C 2OR9H 1ADQL 1T7WA 4PGDB 1REIA 3WSQL 4NFDA 2ADFH 3MV7A 2WWMD 1J0IA 1GOGA 1A1MA 2W9DH 3CZFB 5J6GB 4NM8L 3MLRH 1AI1H 1RZFL 4O58H 5D2LF 2BNRE 1N59A 2J8OA 5TFSL 3FT3B 4I8DA 1KGCD 1OAZL 3RZCD 2YEZA 4O00A 3FO1A 5E00A 4HPOL 2YD1A 2QADD 3DUHA 3I2CL 1TJIH 3P9WB 1WK0A 4JFDE 1ACZA 1OSPH 1FGNL 1JUFB 3KPRA 2X9YA 3S34L 1DVFC 4HBQA 5GGVL 2QJDA 1SEBB 3Q6GH 4YQXH 5T5NF 4XNXL 5EPMB 4C59B 2XPGB 1QA9A 2ERJC 4X8JA 1SBBA 5DQJB 1T3FB 5IB5B 4YXLL 1NFIA 2APBA 5ISZD 2I25N 1UADC 4AH2B 5IBUB 4L3EE 1Q0YL 1X5KA 1UB5B 2ORBH 3O11B 4G9FA 3WFCH 5BVJA 3VFGL 5JQ6H 3MLVL 3MNWA 1EFXD 5IW6B 1GAFH 4I3GA 3PWUB 1MHHB 4HWBH 3CFDA 4KVNH 4MD4A 4J3XA 1G1CA 4OGYH 1J0YA 4YDVB 1N5AB 2BVPB 5JA9A 2PYEB 3G5YB 1DANU 5DEZA 4DVBB 3EUUA 3U9UB 4PRIE 1RUPL 2QQKL 1CZ8H 4QNPF 3W9EB 2QSTA 4WUUD 3B3IB 1NQBA 1JPSL 4G6KH 4DJMA 2APXA 4Y16B 5JZ7C 3PWJB 4K94C 4D9RE 1U8NB 2VLMD 3L5XL 3T0XA 3UZVB 4FG6C 3MRRB 4LLDB 4OZFG 5HHVL 1UB6B 4FQ2H 1J5OL 5IHUH 3WLWD 3H3PH 5D7JA 3GIVB 5EU3B 5H37G 1C1EH 2NX5D 1IAOA 2WK2A 4LCWB 1BP3B 1U3HB 1LP9A 1JNNL 1NEZA 3WO3B 3O8XC 1BVKA 4S1SH 2X4SA 2NY5C 1P6AB 2R39A 1IKNA 4UV4L 1A5FH 2I9LB 3E8UH 4F8QA 3BZFA 3RWEA 2W38A 2FL5B 4U4BA 1S9WB 5F1IA 4PLJD 1H3PH 5C07B 3VXTB 1DFBL 2EC9T 3V0VB 1CR9L 1EO5A 1KPVB 3H7LA 4JCLA 3TO4C 4HWEL 4YXKL 2NNAA 4J8RB 1MELA 5F3HA 4LL9A 4F9PC 4NUJA 2DQGL 4K7PL 1I9RL 4XNUH 3C5SB 1N4XH 2NMSA 4XTRD 1CWVA 3RVWD 2R4RH 2AK4D 3ESVF 4F33B 1H5BC 4OZIB 5F9AC 1WFNA 1Z9MA 3HAEA 1ZVYA 3F12B 4HJGB 3VRLE 1MI5D 3DYPA 3M17A 4WDIA 3C8KA 2B0SL 4OCWH 4YBQC 3UTSA 1YEDA 4NGHL 4D0DA 5I1JL 1X5LA 1I85C 2C5DC 1LEKA 2WBJB 3PXJA 5F72S 3K1KC 2ZNWA 1R5WA 1HHJA 2E9BA 3B9DA 4LSTH 3TBTB 4PD4J 3MLZH 4PGJA 2FJFB 3O2VL 2AJYH 4GBXB 4L8BB 1ZLVK 4HXBH 1YYLH 5HGAA 1BQUA 3V5DA 5CEYB 2F15A 1RZJC 4M4PA 4RA0C 5DMIL 4LBEB 2AXGA 2YMXL 1MH5B 3EJZD 3U4AA 4RBPH 2F5BH 1TXKA 4F7MB 1IKNC 5C09D 1VACA 1JN6A 1TZIB 4OM1H 4GRWE 5D1XA 1CT8B 2ZCKL 4GW5A 3QNXA 3ULVH 4NZTH 1T22B 3L1OH 2BNRB 2BNQA 4MLSA 1Z3GL 4KH2A 2XTJE 1YQVL 5DMGC 3QCTH 4OT1H 5C0FB 3TNNB 2F8OA 1P4BH 4G8GD 3BGMB 2EIZB 1G6RH 2HTKC 5F88A 4XMPL 2RFXB 3BMVA 1JF1B 4OBRA 1CFQA 3OGCB 1N0XH 3DMMB 3H9SD 1WIUA 4H1LH 3FQUB 2XACC 1FIGL 5EO0B 3IAGC 1TTGA 3WUWG 4POYA 4R0LA 3MV7D 1NLBL 1HH9B 4C4KT 3K46A 3BP7B 4J1UB 1A7RL 2BHUA 3RQ3A 1P84J 2EXYD 2FO4A 3UAJC 3UTPD 1FFNA 4Q6IA 1INDL 2IBZY 3N1PC 3SDCA 1HINL 4OCLC 1ZHLA 1J11A 3I50H 5SX5H 4KAQL 3QWRA 4YHKL 1DSFL 2BOBB 2PNDA 3UX9B 1ACYH 3HRZB 3KPRD 3N85L 4S2SA 2D31B 4WEUD 4RGNB 5HY9A 1X5AA 4JY6B 4WI9A 4LCCC 5T1DH 4PRIB 5KJRL 1MFBL 2Y6SD 1UEMA 4GG6F 4M62L 5FGRA 3HB3C 1G6RB 3FONA 3Q3GA 4HS6B 4QF1A 1Y18A 1QFUL 3RKDC 3B4NA 2E5EA 4WFFE 1DUYB 3ZE2E 1CLOL 4G7YH 4LCUB 1KENL 1S9KC 3VWKA 4Y5YB 3FAXA 5D1XC 3ZKQD 5H35A 1IGJB 4JEGB 4LLMB 1L0YA 1FQ9C 1KEGL 3DRQB 3NFPA 1JF5A 2AQ2A 2XZQL 4M6OL 2GJZA 2MJWA 4DTGL 4XX1G 5DJYA 2A38A 1MFAH 4ACPA 3LEXB 2QQLL 3BQUA 2HFGL 4EI6A 3H3KA 3ARBD 1JZ2A 5DK3A 1CXEA 3OKDB 1A3RH 4K55A 5CD3B 3T1FB 1TCMA 4QWWD 2D7QA 1Q0XL 3LHPL 4XP4L 4YWGH 3CCHA 4JN1H 1MPAH 1U8OA 3WHE0 2JB5H 3DECA 3MR9A 1ADQH 3DBXA 4PJHB 3DHMA 1UA6H 3CLEL 4UINL 1ZT4B 5D7JD 5EIIA 3DV6A 1BD2A 5IW3A 5EORL 4X6BA 2P45B 2WIMA 1P5UA 3QEGH 5C1MB 2EIBA 5LBSL 3WUZA 2V9TA 3L9RA 4P5TA 2A74A 4HPOH 5B8CC 1B4RA 3VXRA 4XH2A 4GRWH 1IZJA 2VJXA 1JGEA 1IGTB 1CVRA 2H26B 3HUJF 4DCQA 3GSVB 1YMHA 3O3EB 1FJ1B 4LKCB 4O9HH 1CU4L 3S34H 4R4FH 3S96A 4FQCH 3QIWB 4XNXH 2NY0C 4PBXA 4MS8C 3AXLA 1FIEA 5E2WL 4YXLH 1OY3B 1GGIL 3OL2A 1TIUA 4PJ8D 4NUGL 4F2MB 1BGXL 2J88H 4MNGA 2C4XA 4NM4L 4MA7L 3V6OA 2X9XA 2DQEL 5E56A 3VFGH 3MLVH 5EG6C 4HIIB 5A43C 4HF5L 3S37L 1IAMA 1X5ZA 1A6WL 3X17A 3QH3A 3ARFA 1IGFL 2HLAB 3TFKD 1RUPH 2MKWA 4PJFB 1ZWIB 4GRWB 4OLXL 1Z0NA 4HX1A 5IVNA 4OZFA 1LK3L 4GRLB 3ROLA 1JPSH 4DFIA 1EEZA 2BXYA 5I1DA 3HE7B 3L5XH 3RPKA 1MREL 5HHVH 1D5MB 5EH1A 5GSRB 1HHKA 1J5OH 2B39A 4ZUUB 3EO0B 4Y2DA 3K8MA 4L8DA 4CVXB 4X7EC 2DBJA 2GTWB 1Y0LA 3RTQB 2YC1B 3HZKA 1K3IA 1JNNH 4LSUL 2BCKB 4KKBC 3E3QE 4UV4H 2AV1B 4H88L 4OZHB 1MCEA 1NC4D 3O6KL 4KU1A 1SYSA 2R9HD 3FO2A 2I07A 3NCJL 1A47A 2YA2A 1A9EB 1OTTD 1T1ZB 1DFBH 3SKMB 1CR9H 1A14L 1MEXH 2ADIB 1K85A 3OKKB 1TJHL 2DQGH 1I9RH 1RIUL 2NTFA 3T0AA 1EH9A 4L8SB 4I2XB 1KBGH 3V6OC 3IAQA 3V95A 2CO6B 1HEZB 2KPNA 2F8XC 4GAJH 5I1HL 1QBAA 3MRQA 4JPVL 4HH9A 1P6FA 5GGSY 1T2JA 2NZIA 2VLLA 4Y4FC 3C5JB 4PPTA 3MROA 3VFWA 2X70A 3IF1A 4OSUL 2B0SH 2X4TA 2O26U 4L29B 2IAMC 2XN9B 1VFOA 1ED3B 4X4ZA 3QWRD 2GCYA 5CJOL 1XIWD 2EDEA 4G8IB 1SMOA 3CPLB 2FDBP 4RGMB 3WJLC 1BIHA 1AP2A 1D5ZB 4JGUA 1KCRL 3IT8D 4PJXE 2F54A 3QUZA 4DW2L 3E6FB 1ZSDA 3O2VH 4OM0H 3REVA 1HSBA 2CJUL 3G5VA 3L3KB 5I0ZA 5J6HB 3U6RB 1QFWI 2YUWA 5DMKA 3ZDXE 4LPUA 4FFZL 1E6JL 1ZANL 1YNKH 5FCSH 5DMIH 3D6GA 3HI1A 2YMXH 3LKQB 4JQVA 2VDNL 2GK0A 2ZWLT 4HFUL 1U95B 3B9EA 2DWEA 4JFFE 3VWKD 2ID5A 5DQ9B 4WI8A 4NQEB 3BXNA 3ULUC 4JKKA 2CDGB 2ZCKH 5MP6L 1CQKA 1CDUA 1FL3A 5JMRA 5FHBL 3ELAT 4RCAA 3BQUD 1Z3GH 3UBXB 3ZKMD 2V7HB 1BLNA 5E6IB 5FO9A 5I1GL 3D39A 1U8LB 3ARSA 3WUWA 2JKXA 1NDMA 4ODHL 4XMPH 2Z31A 5ICYA 3QUMH 4LU5L 1XGUB 1U8JB 2BSSA 43CAB 4E0RA 5EOTB 1V7ML 2F74B 2XRAL 4DUXA 5IBTL 3UPAA 5E8OA 4LVHC 4X6CE 5B39A 5D8JL 1IGIL 1EDQA 2EKSA 2QKIA 1YMME 3C08L 3O2DL 1MCCA 5IP4A 3JUYA 1HSAB 1XGQB 1RZGB 1FDLL 4AIXA 4WHTA 1A7RH 1BD2D 1I7UA 4LLYB 1MCKA 1TJGH 5A16A 1QLFB 1INDH 2WANA 3V5HA 1HINH 4U7KA 3FQWB 5FHAH 3IDYB 4P5TD 3IJSA 3VXRD 3MUJA 5IEHA 1KUMA 3O41B 1DSFH 1FBIH 2XT1B 3MV9A 4N0UA 4N0CC 3N85H 5DJZA 5A2LH 2EXWD 4WWKB 5E2VL 4ZUWB 3ZSTA 1F45A 2NY2B 1K4CA 2EIDA 5KJRH 1ITCA 5ILTH 1MFBH 5IM7A 5L7XL 4M62H 4KKAC 1XGPB 1QFUH 4MCZB 4PP1D 1J12A 4PRDB 1MCJA 4UQ3B 5JNYA 3BN9D 3R1GL 1CLOH 1KENH 4QOKE 3MMEB 4WENB 5DRXA 4IMLB 5DEFA 4Q9CA 1K8IA 4M5YL 4I18C 4PTTB 1EHAA 1WBZA 2YD9A 5DRNA 5SWSD 1PFCA 1KEGH 5JHLH 2YZ1A 3N1GC 5EZJA 4D0CA 1WWBX 3LEYH 4MA1C 4WV1A 2DRUA 4D8PB 1VGEH 4KK9D 4F3FB 1A1NB 4ENEC 1E28A 2ILLA 2QQLH 5F7KC 3ARFD 3C60D 5TDOA 2RGSA 3I6GA 1R5VB 1UWGL 2NW3B 1WT5A 4OGZA 2Q76A 3ILPB 4C58B 2CMRL 4PV8A 3D2UB 1LP9F 3MJ6A 1VFMA 1Q0XH 1FG2B 2R1XA 3G6JE 3LHPH 1KPUA 1XCQA 4XP4H 4Z7UA 5EOQL 2ITDB 1GH7A 4M6NH 5ADOL 2EDLA 1NGQL 1QR1A 1U8MB 1T0MB 3SDXF 3VD7A 1BOGA 1CD0A 3CLEH 4UINH 1D5XA 4YC2B 4MAUL 1KF9B 3ZT7A 1AGCA 1WWWX 1M6OB 1U9KA 2B20A 2GUOB 5DEGA 4Y2DD 4GMTH 4NKMB 4PJCA 4LPCA 5EORH 1VADA 2DM2A 5DD0L 1B6UA 1L7IL 1HHIA 4XBGA 1Q8MA 4UMGA 2EKJA 4KKNA 4H26A 4QHLA 1LMKA 1CXIA 2CUIA 3K80A 3BP6B 2OI9C 5GRVK 5J0BA 2VLJE 4NO0A 2VWEC 5IBLC 5BJTA 4MNQB 3FTGA 2NY6D 5ESQB 3N1FC 2YXFA 4LP4A 5IJKC 5DJCA 2X4OB 5ID0A 4HZAA 5KVEL 3RGVA 1I1FA 5ACLA 2I9TA 4PGZA 1R3KB 1VFBA 5D1ZB 2ESVE 3TZVD 4APQA 4EQ3A 1DDHA 4BK5A 5HTSA 3G6AB 3QIBC 4NPYA 5KSVA 1JVKA 3F6IA 3LH2L 4DKEL 2AEQL 1A6ZB 5E2WH 1TQBC 2GT9A 1LHZA 4NUGH 2HT4D 3DYOA 1EO7A 4ODWB 1BGXH 5HJ3A 5JHDA 4WV1C 4NM4H 4MA7H 4QHNB 4U0QB 5F8RC 5IKCB 4OKDA 3ECBA 2DQEH 3CFEA 1I4FB 4Z76A 1FL6A 1X5YA 3B9KB 4LARL 2BZDA 3E0GA 4Z7NF 1TVDA 4JFFB 3D85B 4R26H 3S37H 3LEVL 2PKDA 3LKRA 1QG3A 5F93C 1RK0A 3BSZL 5C08D 3AY4A 3EZ8A 1I7RA 3VFUA 4YBLB 4OLXH 4PJEE 2EEBA 4U1GB 5CEZE 5DJXB 3DROA 2HVJB 2Z8RA 3HC3L 3QP3A 5CMAA 4WW2B 2O93L 1GGCL 4LHUG 4MJIE 3VXUA 2F54D 3QUZD 4ZXBA 3KPSE 3SKOB 4RIRB 4YHPA 3ZE1E 3PWPA 1V5JA 3WFBL 3BKML 1MREH 4U49A 1OAXH 4TUOB 1WZ1L 4YHYB 2H8PA 5IB1A 3TBSA 4P49A 1YUHA 2GAZA 2QSCH 3LKPA 3U4EA 2ZOKB 3TWCL 5ITBL 5LVEA 4U1NA 1ZLVH 4AQ1B 4NNXB 5BRZB 4X6CB 2KUTA 3GMRA 2Z93B 4HEME 3WDIA 1YMMB 4LSUH 3U4BH 3UJIL 3HE6A 4NQCE 3O9WD 4Y2OA 3RGVC 1S7TA 5GS1C 3SKUD 5L2KE 1T21A 3NCJH 4M7ZB 4APQC 4XWOD 5FO7A 3S35L 3FFDB 1NAMA 4HULB 4AENB 1MJJA 1ZE3C 2GTZA 1OTSC 1UJTA 2CKBL 3B8SA 3D39D 1EMTL 3MNZB 2J6EL 4KTEL 4FZEL 4XPAL 4D0BB 4F58L 5DK0A 5DVKA 4QO1A 1OWWA 5CZXD 1YPZA 4FQQB 2Z31D 1GGUA 4P2RD 1RIUH 5D7IE 5I16A 2VIRB 2W60B 5T1KB 3EW3B 1J1XL 2JIXA 3T0EE 1R3IL 3GBMH 3FO0L 2CLRA 5IGXL 2XQYK 4HUKB 4UDUA 3TV3L 3MRNB 4JPVH 1T5XA 1JV5A 1N8ZB 1QD0A 4NN5C 3QDMD 1Q9LB 3VFVA 4OSUH 43C9A 3P9LA 3I02B 3CFKA 3TVMA 2X2YA 3T2OA 1JTOA 2OXGA 2ZUQB 5CJOH 5C0DA 4AT6B 5GRJL 2JE8A 3SO3B 3BO8A 1EERB 1ROWA 3KLDA 5DD6A 2C3WA 4YAQB 3MV9D 2R0KH 3IFPA 1A7NL 1KCRH 5ACZA 1XZ0B 4EDXB 3L7EB 4RNRA 3QXDA 3W5NA 2CJUH 2FNBA 4A6YA 3Q5TA 4H25A 1ZVSB 4UZGA 2FWOA 4FFZH 1ZANH 2Q7YA 3QNYA 5EUOE 4U0RB 4TNVF 2YUVA 3G6JB 4HFUH 4JPWL 4U33A 4DGIL 3NIGF 3DETC 2YPKB 4J3OC 5JIPA 1MVUB 3HPJB 3DX7A 1F3RB 1ERNA 2KZ1B 1LEIB 3RJQB 1J0KA 5IEKA 4Y4KA 3W0WD 5GSVB 1XH3A 2Y36L 3GMLA 5MP6H 1NGXA 4LCIL 1X3DA 5FHBH 1ZKAA 5KN5B 3SDDC 3CUPB 5D2LE 5HVGB 2DYPA 3VFTA 3VFMB 3MOQA 1NUGA 4DGYL 5CEZH 4Z6AT 5JOPD 4LGPB 3TJEL 4ODHH 4O2CB 3LV3A 2WAHA 1KIPB 1I8IA 3BPLC 5DJAA 3WS3B 4CJ1A 2XRAH 2AXJA 3QDGD 4Z7QF 3ZHLA 3VG9B 2ESVB 5I2IB 2GFBB 3FB8A 1IGIH 4B41A 1F13A 3C08H 1N5YL 1FDLH 5EZLA 5T1LB 4OD1L 5TGBB 1R3JB 5DZLA 4KWUA 3R8QA 4HWZB 5FM8A 4YUEH 4POZC 3F62A 5C6WH 4NO0D 4FMFA 3QXVA 3O4LA 3C87A 4QXUH 5IBUG 1GZPA 1KLUB 3GMPA 5GRVL 4YDJA 2NY1B 5E2VH 1X4YA 3VD5A 3DX6A 3MRMA 1SYVB 2B5IC 3L3OA 4GKZB 4NO3A 3O3AB 3QJFB 4ELKA 3MJ9L 1T4KB 4HG4K 5GGRA 5BV7L 1NAKL 2DLEA 1ES0A 1LO5A 3FQRB 4QNPE 2ATPB 1P53A 4MJIB 3AB0C 3KPSB 3R1GH 3WYRA 4KROC 4GQ9L 4MA3B 1EUUA 4NFBA 1C5DB 3OKOA 4GH7B 4M5YH 3RI5F 4TNWF 1Q9WB 1G6VK 3GSQA 4LPTA 3E6HB 2X1XR 4NN7C 3ZYIA 3RX5A 4GAGH 4LLUA 1JWSA 4MJ5A 3P9MA 4G8EB 3LN5B 4XNZC 4NQCB 3T4AB 4MXWL 1QSFE 4JRYB 2IANE 3HZVA 2XYCA 5E6ZA 3TLRA 2FX8L 5L2KB 3VXUD 2DDQL 2CLZB 4WO4B 4ZXBD 1RJLB 5CJQL 2YRLA 5SV4A 5ADOH 4MQTB 4IDJH 1RZIA 3PWPD 5EU6B 2V2XA 2KQNA 3O6ML 4MAUH 1FVCA 3L7FA 3VXSE 3MO1B 2D4FA 3FMGH 1HCFX 5D7IB 1YNTA 3GKWL 5DD0H 4YFLI 5IIEA 3T0EB 1L7IH 3RU8L 3SCMC 3OKEA 3REWB 4AEHH 3HE6D 3JV6B 4ODTL 3L3JA 1KNOB 4DAGH 3TN0D 5JXED 4FQLL 5JW4R 3KXFA 4ORZC 1CXLA 5F7DA 4ZOAA 3TBYB 4XWGH 2F58L 4Z7WA 5HDOA 1S7QA 5GGTL 1S7VB 2OTUA 3DOSA 3WN5B 3WNMA 2I60L 1K4DA 4P4RB 5KSAA 5FUOL 2YKLL 1IC4L 1OAKH 3LH2H 4DKEH 2AEQH 4EXKA 2VZ1A 5FYKU 2YD5A 2JIXD 4JR9L 4Z7VB 1EGJA 3MRPB 1KN4L 4JRXB 1L0QA 4XXDB 1F00I 3U83A 3TC9A 1DQLH 4R97C 2FEDD 1GXEA 3OX8B 1YDPA 1VGKA 4LNRB 2XWJA 3LEVH 1EUTA 4ODVL 1I3UA 3TVMD 1XR8B 3F7VA 4LHUA 5B21A 3Q1SH 1BF2A 4LSQL 5DJDA 1JPGB 2H6PB 5IFAL 1HXMB 4L9DA 4FQXA 3BT2L 3EYUL 4U1MA 5IG7A 1A9BA 1KLFA 2XKNA 3JV4B 4JREB 4KKLD 2BVOA 4HDIB 1GGCH 4IOIA 3JSSA 4WNQB 5CEXA 2WINA 3QPQD 2BOCB 1MCLA 3WFBH 1A6PA 1F11A 3BKMH 4UUJA 1WZ1H 3T65A 1HNGA 3MRDB 2XZCH 1YN7A 3WFEH 1D7FA 2V7NB 3UTQA 3TWCH 5ITBH 4AG4H 2NW2B 3MGTB 3P4NB 1G7HA 5HYEA 3WL9B 1DBJL 2JCCB 4WI3A 5B4MC 1ONQA 4NRZB 3VFOB 3JXAA 3UJIH 3PGDB 1IC5L 2DLHA 3TBWA 2BY0A 4Y4KD 1U93B 3I6LD 2VDRL 2GSGA 5EU7C 3SKNA 4U6YA 2F53E 1OP3K 1QSVA 4I0PA 3SGDI 2H32H 3S35H 2E7BA 4U2YA 4RRPG 5F1SA 2VNCA 2CKBH 3I9GL 3V5KA 1EMTH 2A73A 2J6EH 4Y5VB 4F58H 4XPAH 1N2RA 3KJ4B 1PY4A 1J8HE 2NYYC 5CINL 2OTWA 2LVCA 5D7LE 5FOBA 3O6FC 1J1XH 5IV2A 4CADB 1R3IH 5IGXH 3FO0H 5M94B 2FIKB 2VAJA 3LPWA 2PO6A 3C6LB 1BZQK 3IJYB 1S3KL 5JW5A 4HUMB 1TQCB 1ZHKA 5HSFA 2N1KA 3HG1A 3L6FA 3B83A 1DQJB 4CW1B 4EZMA 5GRJH 4GXVL 4JFPA 2H32B 1U36A 3DUUA 1CBVH 4YLQT 3CVHL 3N0PB 1U3YA 2CKBB 2HVKB 1FV1B 1QSFB 3NACL 4L4VE 2IANB 2IFFL 2BVTA 1OAUL 2AABL 4YE4L 1CK0L 3S35X 4PGDA 5FV2A 1AH1A 3S3JA 4JPWH 2WQ8A 1DEDA 1I8LA 1KGCE 4K3JL 5ALCH 3SGJA 4DGIH 3CZFA 5J6GA 4UT6L 4JZJC 3ILQD 1ZAGA 5GRUL 4Z7UF 4RMRA 1JL8A 1H0DB 3FT3A 1FAKT 3GI8L 1V3JA 2Y36H 1GHFL 2WMPA 2CKNA 3UZEA 4ZAKC 4XVSL 5B38B 4X5LA 1JUFA 4PJCF 1JE6A 1BREA 4DGYH 4YNYB 4WY7L 3PGCB 3HUJE 1SEBA 1UFUA 1FH5L 4U2ZA 2XPGA 5EPMA 2P7TB 2PO6C 4OLWL 1T3FA 1T5WB 3EJJX 1DL7L 5DQJA 5IB5A 1N0LA 4M00A 1KIRB 1MQKL 3WJJC 1J86A 3A6BL 3DSFL 4P9MH 1M1SA 5CHNB 4OD1H 4AH2A 3BGFC 2Y1VA 2J5LC 5F8QC 3O11A 1UB5A 4HLZH 5F9WC 3DVFA 1UM4L 5HYJD 3SEPA 3ZYOA 4WUUE 15C8L 2EEDA 5IW6A 3PWUA 1MHHA 3IB4A 2JK5B 4ZS6C 25C8L 1I1RA 3VU2A 4YDVA 1N5AA 2BVPA 4ZUVB 4W6WB 4XMLH 2PYEA 4AJ0A 1CI5A 1AD0B 5JR1L 3G5YA 3HMXH 3P2TA 4DVBA 4QTIL 3U9UA 2IPKB 2VLME 2IBGA 3W9EA 4HC1L 3B3IA 1KELL 1A7QL 2HMIC 5C9JB 3HLAB 2CRYA 3MJ9H 1F8TL 5KSAD 5DA0B 3RNKB 4Y16A 6CGTA 1NAKH 3KNBB 4LRIC 3PWJA 1U8NA 1KJMB 3MNVB 3GSNL 3MRCB 3MRRA 4LLDA 4HKXB 1UB6A 4GQ9H 1EZVX 1RV6X 4KQ4L 2VDML 1CICC 3GMQB 3KR3L 4XP9L 4TNVK 3HNSL 3FQXB 3GIVA 3QQ4B 4PJAE 4ODBD 5EU3A 2YS4A 4LCWA 1U3HA 5C0ND 2D9CA 3UBXI 4M1CD 4HWBA 2I9LA 2QHRL 5HI5D 2FL5A 1S9WA 3GSUB 4MXWH 5HVHC 2K9UA 1QZ1A 3OKNB 4FQXD 3RL1B 2FD6H 1B6DA 4UDTB 3UPRB 5E5UB 5C07A 3VXTA 2FX8H 4XT1C 1XCTB 3RIAK 2QEJA 3NFNB 3V0VA 1TLKA 2AK4E 1KPVA 4IRSB 5CJQH 3W39B 4Y5XC 2XQBL 1LK2B 4J8RA 1QBBA 5FFLA 3SDAC 3O6MH 3C5SA 4WEBL 1MI5E 2E7CA 1HZHL 1J8HB 3THML 5DJ0B 4UBDC 3EYVB 5KVFL 4F33A 4X6FB 1HYRC 2H2PD 2K7QA 3GKWH 2VUYA 3QB7C 1L0XA 5HGHB 4OZIA 2DI8A 5JMOC 3RU8H 3F12A 1HN1A 3NCCB 4HJGA 1YPZF 3RVVC 3STZB 2BC4B 4ODTH 1F4WL 2LU7A 3QFJB 4QY8B 3B9VA 4FG6D 4ONGL 4FQLH 3TBVB 5CWSB 3EAKA 2B4CL 4I0PD 5K9QI 5I71C 1UYWH 2HYMA 2WBJA 5GGTH 2V5MA 2IMNA 2WIIB 3GSXB 2UZYB 3TBTA 3BGAA 3OG4B 2FJFA 4MWFB 5FUOH 1CIDA 4GBXA 4L8BA 1IC4H 3AU1B 1OM3L 4UAOB 3NCEB 3DXAE 3LMJL 5E9DE 3B9AA 5C09E 1YZZA 1RUKL 5CEYA 2A77H 1SJXA 4LBEA 4QRPD 1SY6H 4L4VB 4H20L 4JR9H 1IL1B 4GW1B 1U3HC 2A6JB 1KN4H 1MH5A 3GNML 4XMKL 1CTNA 4I3SH 3EKCA 4F7MA 5D5MB 4EEEA 4AEFA 2ZUUA 4HS3B 3ULSB 3RZCB 3RI5K 2FH6A 1QACA 4TNWK 4ZYKB 4ODVH 1TZIA 3HG1D 1CT8A 4J3TA 5DD5L 4LSQH 4G8GE 1NJ9B 5I8EB 5F1KC 2FO1A 2YBRB 3I84A 1T22A 3D5OF 1BEYL 1P5VA 2BNRA 4UILL 4ERSL 1C12B 3BT2H 3EYUH 1UM5L 3S6CA 3H9SE 4K3GA 2DB8A 1FPTH 3BIKB 1JFQL 1ITBB 5C0FA 2HFEB 3TNNA 3PWLB 1P4LB 3BGMA 2PR4H 2QBWA 2EIZA 2GW5A 1FYTB 5CGMA 2RFXA 1JF1A 3UBXG 3OGCA 1G9NL 3DMMA 3NBNA 3FQUA 3V0WL 3HUJB 3JWOL 1LDSA 5EO0A 5DRWB 3BRFA 1B2WL 2NPLX 4WHCA 1DBBL 1HH9A 3BP7A 5E8EB 4J1UA 3NGBC 1EEUA 3CSPA 4JFXB 3QT2A 1IC5H 2A83B 4I3RL 3EDDA 2VC2L 3BDXA 4RRPA 1I75A 2F19L 3KPRE 3MCLL 2VDRH 2XXCB 1ZMYA 3EDEA 1HWHB 4JB9L 3MCKB 1D5IL 5HHQB 2X6MA 3T2QA 4WUUB 1MLCB 4RA3A 2E27L 2YWZA 2BOBA 3HRZA 3EGSB 3I9GH 2D31A 4UT7L 2DBLL 1EPFA 3UJTH 5JDJA 4JY6A 2JJSC 2D7OA 5CINH 2Y5TB 2Y7QB 4PRIA 3FOLB 1WCBB 4HJ0C 2LU4A 2LTQB 1WF5A 2HAZA 1G6RA 1JP5A 4ZD3L 1I9JL 4HS6A 4CN1A 2DLFL 4BQBA 4F7TB 5IF0B 1DUYA 3EHBC 4LCUA 4UTAL 4JFHD 1DBKL 4PY8I 1S3KH 2AI0L 1MHCB 1TITA 4P23B 4Y5YA 1IGJA 4LLMA 1I9EA 4P0DA 3PL6C 1W2KT 5CUSL 3DRQA 5C92A 4PJAB 2XY2A 3GIZL 4ZO6A 2F9BT 1RU9L 3QHFL 3ZDZF 3NVQA 4LSSL 3LEXA 2PYED 1BQLL 2OR8A 1QFPA 3OKDA 2W0KA 4S1RL 3SKJH 4P48A 1JRHL 4OCRL 5CD3A 2FSEB 1NL0H 4ZDHB 3T1FA 5E2UL 3NACH 5FYLD 1OAUH 4TTDC 2EIEA 4Y16D 5DR5L 2YD4A 2AABH 1CK0H 2ZSVB 4X4ME 1I1AB 2X10A 1LP9E 3OKLB 4PRHB 1Z6JT 4PJHA 1CGSL 5JPNB 1GVIA 1ZT4A 2BY3A 3VDAA 1NBYB 4CU6A 3IKKA 3O3DB 3PG2A 4OGAC 2AGJL 4UT6H 3SDXE 4S1DC 5GRUH 1JHTB 4LCWD 1U91B 4JHWL 3RDTB 3GI8H 3HB3D 5I76B 4CVZB 1GHFH 5MI0C 3UO1L 3KGRA 1X9QA 1IGTA 3NH7H 2H26A 3GSVA 2XG4A 5LGHL 4EOWL 3O3EA 1FJ1A 4LKCA 3QQNA 4MAYC 1W8NA 4OF0A 4GRMB 4FQ1L 4QHUB 4WY7H 5I30L 1JZ5A 3MA9L 4WI5A 3QIWA 1FH5H 1I3GL 3AVEA 2A0LC 4DUVA 2XG5A 4FFWC 4OLWH 1DL7H 1VCAA 1MQKH 1ADQA 3DXAB 4F2MA 5E9DB 4Z7WF 3DSFH 5C09B 4BJLA 5BZDB 4YPGB 3W2DH 4PJIF 4X9FA 3M07A 5IROA 5E7FA 5FYJD 15C8H 4HIIA 4LOUC 5E8DL 25C8H 1B0GB 1R24B 3KYKH 4LSRL 1T04B 4HIEB 4QRSB 5JR1H 2EE6A 5ALBL 3D25B 1Q1JL 4NQVB 4QTIH 4Z7NE 4GJTB 2HLAA 4PJFA 1ZWIA 3NCFB 4AZ8A 4HC1H 1KELH 4GRLA 1F8TH 3V4UL 1AE6L 5L0QC 4LPXA 3HE7A 3GSNH 1AFVH 2IH3B 1D5MA 4OFVA 5GSRA 1QSZA 3U7WH 4HCRH 4KQ4H 2VDMH 4ZUUA 3KR3H 3WLBB 3OHXB 3EO0A 2BDNL 2DJUA 4C56B 4CVXA 1DQDL 2GTWA 3RTQA 2XIDA 3K7UA 4R9HA 3SGKA 2HLFD 2M2DA 3FRPG 1OGAD 2YC1A 4AY0A 1FCCA 2XWBB 1Z2KA 3C9NB 3BH8B 5B3JE 2FX7H 2BCKA 5K9KB 2AV1A 1IRAY 5E2JA 4OZHA 4WIQA 2QHRH 4KI1A 4KZEL 1MIML 5K9OB 2HTLD 1GC1H 1UJ3B 3VDCA 1A9EA 1T1ZA 1RVFL 3SKMA 4F15B 1SJEB 2HT3C 4YIQB 2ADIA 1EX0A 2XQBH 3OKKA 4RMWA 5D7KD 2UZXB 3ZL4L 4CBPA 1MWAH 4WEBH 3DMMD 4L8SA 4I2XA 3GSNB 3THMH 5KVFH 2CR3A 1HEZA 3BHBB 1JJUA 4OZ4A 2Y06L 4K8RL 4L4TE 4YPJA 3C5JA 1WZLA 3MOAL 1AR1D 3DHJA 5HI3D 1F4WH 4JKLA 3T3PF 2VZSA 3LRGA 4ONGH 3C5ZB 3K8KA 4QGYA 4RAHA 4L29A 3K0WA 5CJ5A 1CGXA 1D9KB 2XN9A 3HHRB 2B4CH 3ARBB 1ED3A 2MQ3A 4J7RA 2P4AB 3S97C 2CK2A 4G8IA 3ULVD 3DIFB 2VUOA 3CPLA 1AC0A 2XTJC 1D5ZA 1IGYB 2VZVA 1DTUA 3HE7C 3MODL 1YJDC 3GJFK 4RGND 1OP3H 1HKLL 3E6FA 4PBWD 4PLKC 3L3KA 3OG6B 3U6RA 1OM3H 5J6HA 4PRID 3LMJH 2B1HL 1RUKH 1NSNL 2ED9A 4DQOH 1MWAB 3LKQA 1E4XH 4H20H 1VERA 4X7SL 2ZPKL 4X83A 3GNMH 2ENSA 1U95A 4XMKH 1URLA 5ETUB 5FA4B 5DQ9A 5FYKL 1OD9A 5HI4C 1ZHBB 1WEJH 1H8SA 2AJVL 4NQEA 4PTUB 1JGUL 5GGSB 3QA3B 5KOMC 3CVIL 1GCFA 3QDJE 2CDGA 3LQAC 5FOJA 4N5ED 2VZUA 4W4OC 4XPFL 3SDXB 3NIGE 1WISA 1U8IB 4LFHG 1BEYH 4UILH 4ERSH 5F9JB 3QCVL 1UM5H 1RULL 3U2SB 3UBXA 2BP3A 2V7HA 5E6IA 3GHEL 4W4NA 2FHBA 2XV6B 2JJTA 4OF6A 1U8LA 1MFEL 1XGUA 1U8JA 4Z18A 43CAA 1T89A 5EOTA 1IILE 2F74A 3JWDL 4PJ8B 3V0WH 2Y5EA 1CLYL 4N1HB 1OTUC 1HSAA 1XGQA 1IQWL 1RZGA 3IXAB 5HHXL 1DBBH 3VXRE 32C2B 5IWLC 4Z7QE 1HWGB 4LLYA 2Z8WC 4I3RH 3ZKSD 1QLFA 2VC2H 2W92A 4X7CC 2F19H 2ED7A 4NKIH 3MCLH 1O0VA 4OI7A 1EHNA 3P4OB 3FQWA 1T0NB 3R8BB 3CU1A 4JB9H 2NY3C 4EN3B 4LVNB 3O41A 2E27H 3MRFB 5C0BD 3WFDL 4KKCC 3V79C 1LDPL 2DBLH 4PGBB 4WWKA 4ZUWA 2XZAH 1YEEL 3LB6D 2NLJB 3SGEH 1J9CT 2DTML 3QIWD 1S7UB 1C16B 1XGPA 1F2QA 5SWSE 2DLFH 4MCZA 1UACL 4PRDA 3BD4A 4UQ3A 3A6CL 4UTAH 1DBKH 3MMEA 4IMLA 4HMDA 1FAIL 3O4OB 4HW6A 2V6HA 4PTTA 2YD8A 5CUSH 3CH1B 1AD9B 5SX4H 3BISA 4KMTH 1NC4B 3VWJC 3ARXA 4D8PA 1RU9H 2FEEI 3QHFH 1CG9B 4F3FA 5F1NB 1A1NA 4LSSH 1BQLH 3LPGA 3FOMB 4S1RH 2GKIA 3O45B 1JRHH 1R5VA 2NW3A 3FT4B 1T89C 3ILPA 4GRLD 3D2UA 4IJ3B 1MJ7L 1OL0A 1OPGL 4S0TD 1FG2A 2O5YH 2YN5A 5DR5H 2ITDA 4MDIB 5J8OA 4FRWA 3S4SB 1U8MA 2PW1B 1T0MA 4U1HB 3F7QA 5C3TA 4NQXB 2P5EE 4N0CD 2EDNA 1M6OA 2GUOA 4TN9A 4CDHA 4NKMA 4PRNB 1KSRA 3N06B 4XVUC 1T1XB 3RTQD 1S9XB 1NUNB 1JK8B 1VHPA 4JHWH 1JPFB 2EYSB 1FVEB 4KKAD 2DMBA 4XAKD 4L4TB 3BP6A 3UC0H 3UO1H 4MNQA 1XIWB 2CIIB 5ESQA 4NWTL 3P40A 4N8VB 1TNMA 4G3YL 2X4OA 5LGHH 4EOWH 1GOFA 4U05A 4JQXC 3MRGB 3RHWF 4FQ1H 2HA1A 1R3KA 4R4NC 3INUL 3MA9H 1BBDL 5MEPB 2AJXL 3I85A 5D1ZA 3VFRB 1I3GH 4HUXB 4S10A 5I73C 5IFJB 1E4KA 1H3GA 3G6AA 2K1MA 2FJHB 1A6ZA 5T3ZL 3G08B 1BECA 4PIRF 4GSDL 2YD6A 4ODWA 5C08E 3E2HB 4QHNA 5IKCA 1NCAL 3MLUL 3VXNB 1I4FA 3B9KA 5JLZB 5LXGL 4JFFA 3D85A 5E8DH 4KDVA 2UY7A 5LCVH 3E3QC 1CS6A 2F54E 4JFQB 3VGGA 5ALBH 2XN9D 1Q1JH 1OP9A 2IADB 3QDJB 4E9LA 4RWYH 5DJXA 2HVJA 5J7CC 5KVDL 1JPTL 3SDYL 4OQ1A 1AXIB 3A0OA 4WW2A 1N6QL 3CMGA 3QI9C 4XNQB 3V4UH 1F2XK 3SKOA 2G60H 1L7TL 4RIRA 4UNVA 4IOFD 3V52L 3FRPA 4TUOA 5D93B 4K9EL 2XTLA 1HQ4B 1GIGL 1WICA 2BDNH 1DQDH 5JUEL 2ZOKA 3C6SB 2QTEA 4NNXA 5BRZA 4HV8B 4X6CA 4FHBD 4F9LC 2Z93A 4NQED 1EV2E 3ESUF 1YMMA 2P44B 5IQ9B 1UCTA 5A40E 5IT2L 5IQ7L 4TPRH 1WJ3A 1JNHB 1UZ6F 2EE2A 3D39E 4BFIB 5GISL 5C2BL 3LPFA 1WWAX 1NKRA 3VMPA 2APFA 4XVJL 1MIMH 5TDPB 4EIZC 1WAAA 4LK4A 3FFDA 4P2RE 5T5NG 3U0WL 1DCLA 5GZOC 1RVFH 5GGVY 4AENA 4V1DE 3TYGL 5E6ID 3SE4A 1RURL 3MNZA 5IR1B 4D0BA 1G0YR 3CSBA 4GG8B 4IRJB 1FO0L 1VFAB 4NJAL 1ULVA 5D1QC 1DQQB 4FQQA 3VCLB 3MLXL 1FZJB 3QDME 2VIRA 4KRPC 2W60A 5T1KA 5GHWL 1BWMA 3ULVF 4N68A 2BHZA 1PZUB 2Y06H 4QRTB 3M1BB 3MRNA 1I3VA 4K8RH 5SWSB 2N7AA 4NFCA 3CFCL 5EBGA 3RFZC 1N8ZA 5LGJB 4OD2B 3CXHJ 1Q9LA 3MV9E 1CDGA 4N0UE 3OB0K 4KJPC 3I02A 1E4WL 4WW1B 4PUBH 3BPOB 3C60B 2HG5B 2NXYB 1AXTL 4IHOB 4XCCL 4AT6A 3PABB 4YAQA 4P4KB 1XZ0A 4EDXA 5T33H 3L7EA 1HKLH 4WWKD 4JLRB 4P2QD 4PJ7B 3ZKND 2QR0B 5EO1B 1ZVSA 2B1HH 1QRNE 1NPUA 3D69B 4X7SH 3G6JA 3W0WE 1IAII 5KSBB 2I5YL 4JFEB 4P5MB 2AJVH 3EYSH 3MX0A 1JGUH 2X7LB 2YPKA 2P5EB 1MVUA 3CVIH 3HPJA 4WUKL 4E42B 1LEIA 1BZ9B 1MAML 4XI5C 2NY6B 5E70A 4XC1L 1WIOA 2E7MA 5GSVA 3AAZB 4XPFH 5JOPE 1EA9C 4Q0XL 4PJHF 5KN5A 4Z7UE 1RULH 3CUPA 5BMFH 1S9VB 3KPOB 2P8MB 3QDGE 4FFVC 3TZVB 3VFMA 3GHEH 1NLDL 1LWRA 4KVCH 3OB8A 1AXSB 3X11B 1EHXA 4Y19B 4O2CA 5F7EL 5T3ZE 1KIPA 3WIHL 4K7PY 5B38G 3WS3A 4L9LB 2ESVA 5I2IA 1CLYH 3UEZA 2GFBA 4XGZB 4TQEL 1OAQH 1IQWH 5HHXH 4KI5D 4OQTL 3KLHD 5T1LA 3LD8C 5A3ID 5TGBA 1R3JA 4P99A 4FQJL 1R3HB 3LN9A 4PB9L 1F3DJ 4HWZA 3RPIB 2ZUSA 3B6SB 5C08B 4XZUB 3TT3H 4MNQD 4HQQL 3PNWB 4LASL 1KLUA 1FLRL 3G5XB 4HUVB 3H9HB 3WFDH 2MQCA 1S5HB 3BPNB 1LDPH 1SEQL 1YEEH 1SYVA 5DVMA 4GKZA 3O3AA 3QJFA 5D1ZD 1T4KA 5JOEA 3FQRA 2ATPA 4MJIA 5EZIL 1JTPA 1MCFA 4KV5F 1YEIL 2VABB 3KPSA 1D5BB 3A6CH 4PJFF 3TO2B 4MA3A 3BJLA 5F89B 3ARQA 3ZMRA 1C5DA 5LAXB 1G9EA 3O2DA 5AWNL 1HYSD 1VB9A 1Q9WA 4LSVL 5DFVC 3E6HA 3O9WB 3S98A 5TE4L 3B9KD 4WI7A 4NHUB 2HN7B 4JFFD 4EIGB 4N0FB 1O7VA 3VXUE 2Q8BH 4G8EA 3LN5A 2CUHA 3NZHH 2VE6B 3CU7A 1NMCC 3PWPE 4W68A 3PV7A 4NQCA 3T4AA 4JRYA 2XWTB 4HLZG 1XMWA 1MJ7H 5L2KA 1OPGH 2CLZA 4WO4A 2OK0L 4P2RB 1RJLA 4Q9BA 4V1DB 5GZND 5EU6A 4OZHF 4ZMAT 3OXRB 4U1IB 1PG7L 3DV4B 1RZKL 5I1KL 1JMXA 3MO1A 1J87A 3KAAA 4MD5B 5E24E 3MGOB 3QDMB 2X4PA 5D7IA 3T0EA 5BRZD 4JHAL 5E6YA 3V4PL 3REWA 2C3VB 4M48L 3S9DB 3JV6A 5MEQB 1N26A 1KNOA 4WFHD 4NWTH 4W70A 2E6QA 4G3YH 5DD3H 1YPZE 3NPSB 4P59L 3QXAB 4WEMB 3TBYA 3B2UC 4KUZL 4YGVB 3P3YA 2EDKA 1S7VA 3INUH 3W11D 3OBAA 3WN5A 4P4RA 4PLOB 3VW3H 1S78D 3OWEA 2EH7L 3M8OH 2JJVA 5T3ZH 4X7TB 2Q8AL 3RWHB 5T1KD 5DRZB 3JTTB 3EBAA 4GSDH 4ODUB 1QRNB 4Z7VA 3MRPA 4XVTL 4PJ9B 4JRXA 4XXDA 1DN0B 1NCAH 2WWKO 3MLUH 4G42B 5GS0L 3X3FL 3FQTB 3W0WB 1MCBA 2X1PA 1MAKA 3OX8A 5I74B 5LXGH 4LNRA 1YEGL 3OF6A 3MOBL 1RD6A 1XR8A 3ZLQC 1JIBA 4GFTB 5LG1A 1JPGA 3D0LB 2H6PA 5CP7B 4LEXL 1HXMA 3B5TA 1K2DB 5KVDH 3QQ9C 5C0RH 3SDYH 5ANME 1NGPL 3JV4A 1KXTB 1H8NA 2LABA 4HDIA 4BH7B 1N6QH 2G5BB 3FN3A 4WNQA 4YGAB 1L7TH 2BOCA 2VQ1B 3QDGB 3V52H 4QCIB 4EUPH 4K2UL 4HD9A 3JV5A 3GEWB 4WJ5B 3ARDC 3T0DA 3GJFH 3K4AA 3MRDA 1GIGH 3T0EC 2V7NA 5JUEH 3SJVA 3I6LE 2JF1A 4X0KB 1NBZB 2NW2A 3MGTA 3P4NA 1NMAL 3WL9A 2JCCA 2CLVB 4LFHD 4HKJB 3ZTNL 4NRZA 3KYOB 3VFOA 4ZUSB 3PGDA 5IT2H 1H3VA 5IQ7H 3VE0B 4LQFL 5GISH 1C5BH 1U93A 5C2BH 1B9ZA 4XVJH 2Q3AA 5J3HC 3WN5C 1UGNA 3U0WH 4JGMA 4FXLA 1EBPA 3H6JA 4Y1AD 3TYGH 4G6JL 2XQYG 4Y5VA 2UZIL 4NJAH 2O5ZL 1FO0H 4PG9B 4HLJA 5E5RB 3SQOL 3MLXH 3BN3B 4GUPB 3MBEC 4F80A 4JJ5B 3HA0A 1QBLL 2LU3A 1A64A 2BERA 4EUPB 4CADA 4AEIL 3GJFB 4R2GB 4Z78B 2FIKA 1AGFB 1RJYB 3C6LA 1UCBL 3IJYA 3CFCH 4ZNCD 3BWAB 4K94L 3DGCR 5E99L 1S7WB 4LGRB 3LKNB 3EIFA 5C0CD 3SOBH 5FECB 3QISA 5ICXB 3NIFF 1DEEB 1MCDA 1E4WH 1DQJA 4HUWB 1HHHB 4U6HB 5CLWA 5J56B 5TJWK 2A6IB 1AXTH 4XCCH 5D9SB 4CW1A 2E8ZA 1HIML 3UYOD 2H32A 2NY5L 3F6LA 2IALB 3PDOB 4EI5C 3D9AL 3LS5L 1P1ZB 4MZ2A 2NY1D 3X14B 4C83B 4HAFA 2J8UF 2CKBA 2HVKA 1X4XA 2J6EA 1FV1A 1QSFA 1FO0B 2IANA 4TSAL 3MTRA 3PWNB 4JO4L 4UNUA 3HS0B 1KJ3H 2UV3A 2JELL 4BSJA 3KPSD 4ZFZB 4CJ0A 2I5YH 5HHOD 3CSGA 1CDBA 1TPXC 3V6ZB 2DQJL 3Q5YA 1NGZB 3R06B 4WUKH 2CDFB 1LVEA 2VOTA 3FFCD 12E8L 1MAMH 5KANI 3TN0B 1H0DA 4XC1H 3WFHB 3QUXC 3VMNA 1NFKA 4M8QB 4Q0XH 1MCOL 5DUPL 3LS4L 4KI5F 2R2BB 5B38A 4A6YH 4NQCD 1ZVHA 1RHFA 2AXFB 4JRYD 2ICEB 1PGRB 5TE6L 4YNYA 1NLDH 3CDCA 3VD9A 3PGCA 5F7EH 5T1MB 5FGBA 4WO4D 3WIHH 4W6YB 4RFNC 2CK0L 2HRPL 2P7TA 3RWGB 4JVUA 1DBAL 5EU6D 1FZKB 4ODSL 4R4BB 2G75B 1Q72H 5HYJE 4JN2B 5KOVC 1T5WA 3UTTD 4TQEH 1KIRA 2PXYC 5I1AB 3MACL 4O2FB 1QBML 4M9PA 5CHNA 1RZJL 4PB9H 4M6AA 3MRJB 1JGLH 3FB7B 5IMOB 4KK6C 3H42L 5JDSB 2YD2A 2JK5A 5F7LB 4TRPL 4PJIE 4HQQH 4ZUVA 2VSDA 3BESR 1AD0A 4LASH 1FLRH 1G9MH 3Q5OA 5INCB 3QG7L 2V5YA 3MLSL 4G9DB 2IPKA 2DM7A 1SEQH 8FABB 5C9JA 3HLAA 4IMKC 3RNKA 4KK5D 5I15L 5ANMB 3KNBA 1BBJB 1WCQA 4QXGL 3P0VL 5EZIH 3K3QA 1KJMA 3MNVA 3MRCA 1SJVA 1YEIH 4HKXA 4QRQB 4RZCB 3GMQA 1NCBL 4GMSL 4U1KB 3CLFH 5BS0E 3W81A 3FQXA 3QQ4A 5AWNH 5D2NB 3EYQC 1KT2B 4JRXD 4WW2F 1R0AH 5BW7A 5TE4H 3WIIL 1F3JB 3ARVA 1EBAA 4BA8A 2IF7A 5HDBF 1KOAA 1OD7A 5ENWB 3U46B 3SY0B 3GSUA 3OKNA 4PYGA 2GITB 2WW8A 2C26A 3V4VL 3RL1A 2HP4A 3HZMB 4UDTA 3UPRA 5FYLL 4X6CF 3VG0L 1XCTA 3NFNA 2OK0H 2CH8A 4KJQD 4IRSA 4TUJB 3W39A 1LK2A 3MJ9A 4ZS6D 5KANG 1E4XI 1PG7H 1RZKH 5I1KH 1J8HA 1CTOA 4FXKB 1FG9C 1WAAF 3FB5B 5DJ0A 1LO3H 1T66C 1F4AA 3EYVA 2LAGB 3SJVD 4X6FA 4JAMB 5HGHA 1JYNA 4JHAH 3V4PH 3QIUC 3Q6FB 1OW0A 3QHTC 3MC0A 2G5RA 1U92B 3STZA 4NBZB 2Q87A 2BC4A 3U7YL 3RVUC 3QFJA 4QY8A 2RR3A 4WHYH 3RL2B 1Z5LB 3DTXB 3TBVA 5CWSA 2IQ9H 3VRJB 2BHYA 3GKZA 4M7JL 4P59H 3BKYL 2H3NB 2VXTH 4NO2B 3WMSA 1MCRA 2VL5B 4RMQA 4KUZH 2P8PB 2PCPB 3T3PE 3MLPA 1EXUB 3VXME 3WXWL 3FKUS 2DWDB 2FGWL 4QRPE 3GUTB 2WIIA 1IEAB 3GSXA 3KG5A 5C0JB 5IVZB 3DVGB 5D7SL 4OCSL 4MWFA 2EH7H 5F70A 1A7PL 3AU1A 5I1EL 2Q8AH 4CVWA 4UQ2B 4KJWC 1CGVA 2NXZC 4L4VA 1IL1A 4GW1A 1HKFA 3HG1E 2A1WL 2A6JA 1A7BA 1BFTA 5DO2C 4LAJH 4Y4HB 5DMJB 3U0TB 3X3FH 5GS0H 1LE5B 4GT7A 5D5MA 3IFOB 3BIBX 4FQHB 4HS3A 3TPUB 3ULSA 3RZCA 1YEGH 2OZ4L 4ZYKA 3MOBH 4K71B 1FZMB 2M8XA 4OF5A 3ARGC 1NJ9A 1ETZB 4NCDA 4JPIB 5I8EA 4UBDD 2YBRA 1C12A 4G6AC 5JORB 2VDKL 3OB0H 3LY6A 3QG6B 2NY4B 3SGEI 1CE1L 4XCNB 2P42B 1NEUA 3IFLH 4HWUA 5GGTA 3BIKA 4KRLB 3VGAC 3QUYC 3CD4A 2HFEA 3PWLA 2JJWA 1P4LA 4BFEA 5KTEL 2WUBL 5ECJE 5JIKA 1FYTA 4NOFA 2IAND 4K2UH 1V7NL 5DI8B 3BP5B 1MRFH 3HUJA 3QZWB 3F7PC 5IUSA 5DRWA 4M7KL 1SY6A 4I48B 1NMAH 5SX4I 5E8EA 2QLVB 5HYJB 3ZTNH 4JFXA 1KCUL 3ARRA 3B43A 3OAUL 4HGMA 2A83A 4MXVF 4H5SB 3ZKXB 5I1CH 1WQVT 2R4SL 4R7NB 4YEFA 3MCKA 4P2OC 5HHQA 3VH8B 4F37F 4WUUA 1MLCA 5EC2B 3T8XB 5J12C 3EGSA 4PJIB 1KN2L 3U9PH 2O5ZH 3RWIB 5MENB 3NOIA 4U6VL 2Y5TA 1CYGA 2WWMC 2Y7QA 1T7ZA 3IDMB 3SQOH 5GS2H 3FOLA 1WCBA 1GRWA 1QBLH 5BQ7B 1ZLSL 5E94B 4F7TA 5IF0A 1G0XA 3ZE0F 1DVFB 1CVSC 3RZCC 3T08A 4L3AA 2E9JA 1UCBH 1MHCA 2QADC 4P23A 4HUNB 3VXPB 4LNVA 2ERJB 2LV4A 3RX8A 2MHAB 4QXWA 5BS0B 4PJAA 1CGWA 3KHQA 4YHIB 1PX4A 4N90D 3ZE1F 4XNMB 1PDKA 5FYLE 3IU4L 4F8TA 3LQZB 2NY5H 3LS5H 1X5FA 3D9AH 3HTLX 1HXYB 5CGYD 1MJ8L 1B0RB 3MRBB 2FSEA 2ZKHH 4ZDHA 2Z8SA 3MUZ1 4JO4H 3WNNA 1OAYL 2HKHL 2JELH 2ZSVA 5GXBB 1G7JB 1A22B 4LCWE 1IAKB 1I1AA 1Q9KB 4WWID 3OKLA 4PRHA 2VDLH 5ID1B 3VFSB 4JKPL 3TA3D 4NZRL 5JPNA 1UWEL 2MQ0A 3NCYS 4V2BA 1NBYA 3UJJH 5MERB 3O3DA 2DQJH 1UXWB 3S4SG 1INQB 3MZTA 1JHTA 5E4EC 1U91A 12E8H 2MKLC 2NR6D 3RDTA 4XP5L 3CK0L 3UROR 5I76A 2GSGB 4CVZA 4IIQC 1MCOH 3GFUA 2X4RB 5DUPH 5IMKB 3LS4H 1J7VR 3EHBD 3UTZB 2YPVL 5IB2B 5D7IF 4OLVL 5GQBA 5TE6H 3O8XB 4GRMA 3PL6D 4QHUA 3IDUA 1B4JL 3WLWC 4N8VG 1JGDB 4IRSD 5ICZB 2HRPH 4UOW0 3VXMB 3SO5A 4BQ9A 4P2CG 4QRPB 3TH4T 1KCKA 3BKCL 5FYJE 4L5FL 4LKXB 2OJEB 1BFVL 1F97A 1ZV5A 3MACH 5EULV 3HZYA 2YXMA 3DXAA 5E9DA 4YFEA 5C09A 1QBMH 3TO4B 5BZDA 1Y6MR 1RZJH 2R8SH 4YPGA 4XPHH 3SE3C 4ZUTB 4PLJC 2EE3A 4EBQL 1PJ9A 4JDTL 4HT1L 3QFJD 1B0GA 1R24A 3VXOB 5DS8B 1H5BB 1T04A 4HIEA 4QRSA 3HRPA 4KUCD 4BZ1L 1NCCL 3GK8H 3D25A 3QG7H 4NQVA 5A2JH 3MLSH 4Z7VF 4F7CB 3ULUL 4WFGD 4M61B 4U7SA 4XTRC 3BAEL 3RVWC 2ICWB 3FAWA 4ZOCA 2HJFB 4Q7DA 4DEPC 4P3DB 1OGAE 5MEOB 3RIFF 1VEMA 2IH3A 2DOCA 3VGFA 4GMSH 1NCBH 3UYPA 4L4VD 3OHXA 3WLBA 4C56A 1TENA 2WWKT 3VD4A 5HPMB 5JW4M 3DNKA 4LEOB 4PGCB 3WIIH 2XWBA 5I18L 3C9NA 3BH8A 4NIKB 1JHLL 5K9KA 3QHZL 1PSKL 4J3VA 3GDBA 4WI4A 4XNYL 5K9OA 1T2XA 1H3UA 5D7KE 3V4VH 1JI1A 4XHJD 1UJ3A 1UZ6E 4N8PA 5FYLH 3VG0H 2JCCF 4R6UA 3QO0B 1SJEA 4HC1A 3RWJB 4YIQA 2A9ML 4X4YB 4XPGL 1W72H 1FYTD 4PS4L 4RSVA 4U3CA 2I24N 4A2MA 1CDYA 35C8L 2ENYA 1BJ8A 3GSNA 3BHBA 4HCRA 1NMBL 2IMMA 3RJDA 4JY5H 3OR6B 1NCWH 4B53A 5T5FL 4CMHC 2OM5A 3ULVE 4XPBL 3C09B 3U7YH 3DLQR 3KVQA 5ERWB 3C5ZA 4JE4B 4RGNE 4UOJA 1FN4B 1FFQA 1CFNB 1D9KA 3BJ91 5FKPB 3ARBA 4UT9L 1J1PH 1NCDH 4DFHA 3TESA 3DIFA 4PG2A 5TPWL 3WXWH 2FGWH 2GJ6E 1IGYA 4BSWB 3KDMB 5D7SH 3HR5B 5DVLA 4OCSH 2AJ3B 1AO7D 3ZO0A 3BKJL 1A7PH 1G7LB 5I1EH 1EAJA 4WU5B 2OCFD 1QUNA 1W72B 1MWAA 1QSED 4WRLA 3BZ4B 2A1WH 2MFNA 1ZEAL 5A2KH 4LCCB 5ETUA 3ARTA 5FYJH 3K2UL 5FA4A 4X4MA 4EQ2A 4P23D 3TJHD 1A7OL 1ZHBA 3WCYA 4PTUA 5GGSA 2Z9TA 3QA3A 3FQNB 4OLYL 2OZ4H 3SDXA 1U8IA 4HMEA 5F9JA 2VDKH 4KK8D 5ADPL 4P5KB 3U2SA 4RWHA 3L5WB 4MQXD 4JANB 2DF3A 1AKJD 5DC9B 4PJHE 2Z91B 2J4WL 5KTEH 3R0MA 1T03H 5JIIA 5FDWB 5DA4A 5CZVL 4ETQB 1IC7L 3BDBA 3RVTC 5F9DC 4PJ8A 1I1AD 4NNPL 1F6AB 3MRIB 4PRHD 3MRLB 3PGFL 1BAFL 2RCSL 4M5ZL 3IXAA 3U0PB 3V7MA 4FNLL 32C2A 3QEQD 3OAUH 3DO3A 5C0BE 3G9AB 3ARBC 1ORQB 1MLBB 3RDTD 5CAYB 2R4SH 3P4OA 4ZFOL 1T0NA 5DZNA 3DGGB 3U30C 4HIXH 4QWWC 4EN3A 1GC1C 1LNUB 3P0YL 3MRFA 1KN2H 2YPLD 4O02L 4PGBA 1RK1B 4U6VH 3AS0A 4HEPG 1K5NB 1FORL 2NLJA 4OCNC 1BHGA 2ZUTA 5B8CB 5SWQB 5D7JC 4M6ML 4NWUL 4OLEA 2GEEA 3ALXA 1M7DB 1S7UA 2ARWA 1C16A 4NZUL 2CUMA 1CXHA 1OGAB 3DXAD 5E9DD 4JZNB 2IG2L 2NY0B 4KV5E 1I3RB 1Z9SA 5EOCJ 3CH1A 1AD9A 4PJFE 5AZEL 4X9HA 2HJLB 1NC4A 3PDDA 1CG9A 2IEPA 1MHEB 5F1NA 3LCYA 5C6TH 4BSVB 3FOMA 4G5ZH 3MV11 3O45A 1MJ8H 3L3GB 3JVGA 3FT4A 3QFDB 4X6DB 5CZKA 1KIUA 1OAYH 2HKHH 4MDIA 2I27N 2NY3D 1YECL 3S4SA 4N0YL 2PW1A 2AEPL 4U1HA 1FSKC 3EO9L 2AV7B 1L6ZA 3PE9A 4JKPH 4NQXA 4NZRH 4XAKE 1UWEH 1SMAA 5I1IL 1X7QB 4KMQA 1FFOB 1RY7B 4C56D 1OARL 4OZHE 4F57L 4PRNA 1T1XA 1S9XA 4LVOC 4BH8B 5B39G 3TFKC 2DQHL 4L1HA 1JK8A 4XP5H 1JPFA 2EYSA 1FVEA 3CK0H 4LVNC 4L4TA 4UU9B 1JTTA 2R56L 1XIWA 2CIIA 1X6LA 1IC1A 4N8VA 5JA8B 4KJYB 2YPVH 2C4FT 4TVPL 4HZLB 2LE9A 1LGVA 4MLIA 3MRGA 4F37K 3NMEA 2M26A 5CGTA 5MEPA 4I2XE 1B4JH 2MPAH 4YXHL 3EOTL 1FC1A 1BZ7B 1NFDB 3RVXC 3VFRA 3ZYJA 3BEVB 4HUXA 5IFJA 1P7QD 1INEH 2GJ6B 3C2SA 1PKOA 2QSVA 4KUCF 4PRAB 2BVEA 2FJHA 3ALPA 4WGWB 3AC0A 2HFTA 4YDKL 3G08A 1BFVH 4NO5B 4RFEB 3L3IB 4KXZI 3UDWA 2R9HC 4WU7B 2XN9E 2MCPL 5CCKL 1P84K 1MIEL 3BOVA 3VXNA 2IC2A 4EBQH 5JLZA 4JDTH 2X1QA 1OTTC 3TIDB 2VN7A 3CFIC 4URTB 3S36L 3WO4C 2JB6B 4X9BA 2R69L 3C5ZD 2E7LA 4JFQA 2VERN 2EC8A 4BZ1H 1NCCH 1D9KD 1WFTA 2IADA 1IGCL 3QDJA 4IJ3C 4NBXB 3B5GA 4Y4FB 4AQOA 1A6VL 3HN3A 4JG1L 4IM8A 5DUML 3G04B 5D5MF 1T0PB 2D03L 4XNQA 2IAMB 3BP4B 3H9ZA 4XP1L 4R0LC 1DBML 1GOHA 3PHQB 3WSQH 4NQEE 4Q2ZB 2BVYA 4Q6IC 1HQ4A 2DIBA 3EOYG 3SDCC 2FJGB 4NM8H 4MJ6B 1KIQB 2WLYA 3C6SA 1DE4B 4OB5L 1YEJL 1RZFH 3CNKA 5TFSH 4HV8A 3N9GL 1XIWC 4LLVB 1OAZH 3V7AE 5IQ9A 3MV8D 3TGXA 1M4KA 3I2CH 1JNHA 2F5AL 2VKWA 1PSKH 3QHZH 4M93C 4BFIA 1FC2D 3CFJB 3V6FB 3OMZA 5C0BB 5E1AB 4R96B 1FGNH 1QHPA 4IRZL 5TDPA 1B90A 5GGVH 2YUZA 2A9MH 5IR1A 4WFED 4GG8A 4IRJA 3BYTA 2DQDL 1VFAA 4E5XB 3VWKC 4XPGH 1DQQA 1NC2D 1N3NB 4PS4H 5EB9A 3VGDA 3VCLA 2AQ1A 1FZJA 35C8H 1WSST 5KS9F 4QRTA 1NMBH 3M1BA 2EDXA 5SWSA 1Q0YH 5T5FH 4AM0B 2X05A 4UB0L 1IM3B 2Y07L 5EU4B 5FUCE 5LGJA 4OD2A 3BQUC 3X13B 4XPBH 4E41D 4EUPG 3ZKMC 5HPOA 1LO2L 1CFSB 5IMMB 4WW1A 4P2QE 1IARB 3C60A 3IDXL 5D96C 2QQKH 4EN3D 2HG5A 5C3LD 3KPQB 2Z35B 4QTHB 5E5MB 4IHOA 1NUDA 3NIFE 3PABA 2VB5A 1MFDL 5TPWH 3TPKA 4P4KA 4PJDF 2B7DT 3QWQB 5GJSL 1FNHA 2EDRA 4YZFF 1FNSL 4JLRA 3BKJH 4PJ7A 3OQ3B 2QR0A 4PJAF 5EO1A 2R2EB 3I3DA 3EOAB 3MXWL 3D69A 3VI3F 1MCIA 5GRZA 1PG7W 2J8UE 3RIFK 4J3SA 4HFWB 1ZEAH 3RWFB 4YHZL 5GS3A 5GZOD 5KSBA 4LAQL 3K2UH 4P5TC 3QJHB 4JFEA 3KPPB 4P5MA 1A7OH 2W65B 4IOSD 1Z0MA 2X7LA 4BM7A 2P5EA 4L4JA 4E42A 1BZ9A 2EXWC 4UIMB 4ZG1A 3AAZA 1QYGL 1CL7L 4FXGB 4I18B 4UIKL 4M7LL 4DGVL 1KYOJ 1UH3A 2RB8A 1S9VA 4MB3A 4FMKA 1G7PB 3KPOA 1LEGB 3J8F7 4MHHG 2P8MA 4DKFH 3MLTB 3NN8B 3MCG1 3TZVA 2ARJA 3BN9C 4MA1B 4HWEH 4YXKH 2J4WH 2VXSL 3X11A 1AXSA 4KI5E 4Y19A 4K7PH 3PP3K 1HQRB 5CZVH 4GS7C 4L9LA 2N56A 4OZ4B 4XGZA 3PGFH 4KDTA 1BAFH 4M5ZH 1QFWL 2WNGA 2BJML 4FNLH 1BJ1H 4MNQE 3ARFC 4ZSOB 1R3HA 3C60C 2A6DB 3U36B 3RPIA 2BK8A 4G7VL 3B6SA 1EO8L 4J4PA 5C08A 4L4TD 4NGHH 4XZUA 5I1JH 5KSUB 4U31A 5L88L 3ZDYF 3PNWA 3P0YH 3G5XA 4HUVA 3H9HA 1DQML 3C2AL 4O02H 1S5HA 4PP2B 4GKOA 2YHGA 1FORH 1GPOL 1JWMB 4Y2DC 4G6ML 4M6MH 8CGTA 2Y4SA 4L3CB 1I8KB 4DN3L 2D9QB 4K3EL 2ZUXA 1VEOA 2VABA 1D5BA 3TO2A 3U48A 3M45A 4NOBA 3MYJB 4HAGA 4GW4B 5F89A 5AAWA 1MFNA 5LAXA 2FHCA 2IG2H 2J2ZA 2V2WB 4ZS7L 3QIBB 4Q58C 4K7PX 2D4DA 3O9WA 3DARA 4NHUA 2HN7A 1TQBB 3LN4B 2V17L 4N0FA 4CL7A 1L9NA 4ZFOB 2VE6A 1SVCP 1YQVH 3QDJD 2FCBA 1ND0B 3O2WL 1X44A 1TVBB 5CJXA 2XWTA 3HCVB 1AIFB 5HDBE 3F65A 4Y8DC 2N7BA 2HT4C 1FNLA 4NQSB 4PJBB 4XXCA 5I8KL 4P2RA 4B0MM 2M1KA 1V3LA 5HYQB 1VESA 1YECH 4V1DA 1FIGH 4N0YH 5BRZE 3OXRA 2AEPH 4U1IA 3EO9H 4DN4H 5I1IH 3DV4A 2MWCA 1NLBH 1JZ4A 4MD5A 1OARH 4F57H 4WFHE 3MGOA 3QDMA 6FABL 1N7ML 2EZ0D 2DQHH 1WAAE 2C3VA 1Z9LA 5D70L 4YHOL 5MEQA 5DXWA 4KAQH 3QUZC 2ICCA 1KFAL 4QRUB 3QAZC 4YHKH 1FFRA 1QFWM 4TVPH 4PRPD 1J18A 3QXAA 3PIQB 3MQIA 4HS8L 4YGVA 1DANT 3QDAA 4P2QB 1QPXA 5HD8D 3VJ6B 3EJYD 5EUKB 5C0GB 4JQVC 4YXHH 3EOTH 3KLSA 3MJ8B 1FNGB 3OTTA 4IRJD 5GS1B 4ISVB 5GJTL 2OSLB 1MCSA 2BVQB 2EH8L 1JGVL 4X7TA 4YDKH 3LOWA 3RWHA 1SJHB 5DRZA 3JTTA 1AGEB 4ODUA 1I8MB 1QRNA 5D6DA 4UNTA 1NCNA 5I0DA 4PJ9A 5CCKH 1DN0A 1MIEH 2J8UB 4G42A 2XZQH 3QXUA 3FQTA 4M6OH 4XWOC 3W0WA 3I3BA 4CDGC 4DTGH 4CN6A 3IKCB 3RNQB 3D48R 1MCWW 3S36H 1BVZA 2R69H 4Q74A 5CJXC 3K74B 2HFGH 3GRWL 4YK4B 5CZXC 3D0LA 4PJ5D 1IGCH 5E7BA 5CP7A 4G6FB 2Z31C 2NXYD 4XXCC 5FGSA 1K2DA 5EO9B 4JG1H 4P4KD 1WIPA 4BH7A 2WV3A 2G5BA 4XP1H 4WHYG 2VQ1A 3PWVB 2Q86B 2FZ3B 3TNMB 3QDGA 4CU8A 1PYWB 1JI2A 4QCIA 5C9KA 5INDB 2YSSB 4TSBL 4WJ5A 5F6IB 5CD5D 1XF5B 1NH6A 2WQRA 2O5XL 4OB5H 1YEJH 3L5IA 4X0KA 1NBZA 5IK3B 4JFED 1BFOB 1YY9C 1MCHA 1YA5A 3N9GH 3O3UN 2CLVA 4JM2D 4HKJA 4K8RD 1UKSA 3KYOA 5LBSH 3OJDB 4ZUSA 2P5ED 4Y1AE 3QZWG 3VE0A 3EFFB 3NPSC 2F5AH 5T3XL 1QQDB 2AXHA 2DQIL 1TETL 4MXVE 1CU4H 5K33A 2BFVL 2EC9U 4YDLC 2NTSP 5E8PB 2X09A 4MVBD 4KZDL 4PG9A 4Y19D 3SDDB 3VH8G 4GUPA 4JJ5A 1GGIH 3PDGA 5C0CE 5J13C 4EUPA 4OFIA 2XICA 3GJFA 4Z78A 3EOBB 1AGFA 5H8DA 1RJYA 3O3BB 1CDIA 3BWAA 3NTCL 1S7WA 3VDBA 3VGEA 2Y07H 3I6KB 5FYKD 3LKNA 1KLGB 3FZUD 4HF5H 5B22A 3ZE0E 5FECA 5ICXA 1CFVL 1DEEA 4D9QE 1A6WH 4NSKB 1WT5C 4J4PD 2HT2D 3IDXH 1IGFH 1Q9OB 4HUWA 1HHHA 4U6HA 1FL5B 2A6IA 5D9SA 5FB8B 4YJZL 3QEUB 5EU7E 1LK3H 4BFGA 4JO1L 5AYQA 5GJSH 5DFWH 2IALA 3PDOA 5I9QC 1P1ZA 3X14A 4C83A 2KZWA 4HUUB 1FNSH 5HHOE 4DZ8B 1W8OA 5FCUL 1EEYB 1FO0A 2ZCLL 3T0VA 3PWNA 3UZQA 3HS0A 4Z95L 3ME0A 1I1CA 3FFCE 2X4UB 4QRRD 5B3JF 4YHZH 4ZFZA 2FLBT 2B5IB 1KC5L 4LAQH 3V6ZA 4OLZL 2D7NA 3SQBA 4PGEB 4EDWL 1EJOL 1NGZA 2VR4A 3WXVL 3R06A 3AB0B 2CDFA 4H88H 3JUZA 4JRYE 3TN0A 5JXEA 3O6KH 3WFHA 4KROB 1MAJA 3MLRL 3T0WA 2OLDA 2CQVA 4GXUN 4M8QA 1QYGH 1CL7H 4UIKH 4L1DA 2V5SA 4M7LH 1I7ZB 2DM3A 2EE9A 2R2BA 5EU6E 1A14H 2ZCHL 4X99B 3R0NA 2AXFA 2ICEA 3SBWA 3S37X 3C8DA 3UTTE 4PR5B 2VXSH 1TJHH 5T1MA 5IHZB 4XNZB 4ONFL 3RWGA 4V1DD 1FZKA 4R4BA 1U2HA 2G75A 1QRKA 4JN2A 2UWEE 5BCAA 3AROA 5I1HH 5I1AA 2BJMH 3IS1X 4O2FA 2Q3ZA 3ARED 3AY4C 4G7VH 1SHMA 3MRJA 3FB7A 1EO8H 5IMOA 4LSDA 3F58L 2VAAB 4NN6B 5JDSA 5L88H 4CNIB 2E7HA 4ZXBC 3QO1B 4KVNL 1VA9A 5INCA 1DQMH 4G9DA 3SCMB 3C2AH 1MCQA 4DW2H 1PW3A 8FABA 1GPOH 4QLRA 4OFDA 4Z7VE 1E6JH 4DN3H 4JRXE 5ANMA 4M9OA 1BBJA 3WIHA 3WS6A 2W07A 1U8KB 2VDNH 2HJKB 2Z8VC 4OI9A 3NIDF 4QRQA 4JVWA 3LKSB 1MRCL 3HE6C 4Z0BL 4XPTL 4RZCA 4U1KA 1QRND 3T3MF 4QEGA 3TN0C 5JXEC 4PJ9D 5D2NA 1KT2A 4ZS7H 4FQ2L 2ZUYA 4TTGA 3L3DB 3RKPA 1CD9B 1XGRB 2KKQA 1C1EL 1F3JA 5DURD 1RSFA 3S5LB 5CKGA 4JG0L 2XZZA 1LD9B 3OJVC 3ETBF 4DN4L 1OOAA 4S1QL 5ENWA 1MHPL 4Y1AB 3U46A 3RIAF 3SY0A 5IB4B 4R97B 5I1GH 3O2WH 1A5FL