2B1AL

Crystal structure analysis of anti-hiv-1 v3 fab 2219 in complex with ug1033 peptide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
215
structure length
215
Chain Sequence
QSVLTQPPSASGTPGQRISISCSGTSSNVENNYVYWYQHLPGTAPKLLIYRNDHRSSGIPDRFSASKSGTSASLAISGLRPEDEGDYYCAAWDDSRGGPDWVFGGGTKLTVLAQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab 2219, light chain
publication title Crystal structures of human immunodeficiency virus type 1 (HIV-1) neutralizing antibody 2219 in complex with three different V3 peptides reveal a new binding mode for HIV-1 cross-reactivity.
pubmed doi rcsb
total genus 46
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2005-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2b1aL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2b1aL01
2AJSL 4P2QD 1LWRA 4PJCF 3BPCA 5B38A 2R2HB 4AG4H 5JHDB 2BERA 3RVXC 5HY9B 3O6FD 3QUMH 2A6KA 4KVNH 5I1LB 4BH7A 4NSKA 5J57B 4HKBB 5IKCB 3CX5K 3QUYB 4GMTL 2IH3A 3HE7B 1JWUA 5F97E 3V9FA 3IJHA 3S35H 1F4YL 4PRDA 3G6JA 1P84J 4JCMA 2IADB 2Q7YA 4AT6A 2Z31B 2OMNA 5C7XH 3ULSA 5SX5H 2M8XA 1G6RH 3B9AA 1UJ3C 2YK1L 2Z8VC 5HGDB 1IQDB 1OAKH 2PO6A 4P2RA 4KKCD 5TQ0H 3QDMB 1JGVH 4KI5E 4PJEE 3N9GH 4A6YL 1T1YA 5E95B 1N59B 1CTNA 2HLAA 4JM4L 2C26A 3GSOB 3EO1A 2ZG1A 1AIFA 3CC5B 4JFPB 5MEOB 2C7UA 5IFHH 5I66A 1J1OL 3VXOA 3BUTA 5IVXB 1MCJA 4M61B 2FJHA 2ZOKB 3NACL 4NP4L 4LU5H 4RCAA 1YEGH 3X12A 3P77A 3H7BB 1XIWC 1DZBA 3C9NB 5LQBH 2CLRA 2BFVL 1INDL 2HJFB 4RWYH 3BH8B 3S96A 2I9LA 3CU1A 5C09D 5T1KB 5B3JE 1ZTXL 2VDNL 1TETH 4NQDD 4OBSA 1BVLB 4KUCD 5T33H 3RL1A 4CN6A 3BP7B 4QRUA 5I15H 5AUMB 1CYGA 1JTPA 2FRGP 3AUVA 1MIML 4HS6B 3DUHA 3IXAB 1JBJA 3QIUD 4PS4H 2BOCB 1A7PH 3QDJE 2B1HL 3HI1A 2ED9A 4NZTL 4M1GL 3MZGB 5C8JB 3QCTL 1N6UA 2R2HA 1LNUB 5EN2B 5JHDA 5MI0C 3L5WB 5HY9A 3T0BA 5I1LA 4DCQB 4ODBD 4EN3B 1RIUH 2MHAB 4KHTL 1GL4B 4HKBA 4HFWB 2P7TB 3HE7A 1AGCB 4TTDC 2BC4A 2P5WB 2QSQA 1OTTD 4G9DB 5DUMH 3V6OE 4JB9H 1EHNA 2IADA 2Z31A 2AABL 1O5DT 5I9QB 1ZLWK 3I2CH 4XBGB 4FG6C 5FCUH 1OP5H 4HCRA 4PJ7B 4L3EB 3VXSE 4OZHB 1H3XA 3IDJB 3BQUC 3IKCB 1IQDA 5HGDA 3ULVD 2IPKB 1FLRL 4ZXBB 5DMIH 4KJWD 2R2BB 4DKAA 3B9KD 2YZ8A 2XNAB 5FECB 2EIDA 1N59A 3T0AA 3PQYE 5BMFH 3GSOA 2QQLL 3CC5A 4JFPA 5ILTL 5MEOA 3LPWA 3TO2B 5EB9A 5IVXA 4YK4C 1ZVSA 5IIEB 4K3JH 4M61A 5E7BA 2ZOKA 4YDKL 5GS2H 3KXFE 3RNQB 3QSKB 4RGND 4JZNB 3VGDA 3KLDA 3T2NL 4B50A 2ZCHH 1EGJA 4M43H 2HJFA 1WFNA 4U6YB 4JN2B 4HJGB 2A6IB 3BH8A 5EUKB 5T1KA 4OLYH 4TPRH 1X4YA 4F9LC 4KK5D 3SE8H 1IEAB 4O2EB 1BVLA 2EKSB 3T2PA 3BP7A 1E4XL 2QADC 1OGAE 3IAPA 5AUMA 4EUPH 3HNSH 5TFSL 4P2QE 5MP6H 3QHTC 3A6BL 3IXAA 4HS6A 3V6ZB 4N9OB 2BOCA 4OT1H 4QHUB 2AJYH 1BVKB 2FIRT 4PLJC 1P1ZB 3BP6B 4O9HH 3G08B 4K71C 5C8JA 4LASL 1UENA 1OAQL 2N1KA 1TTUA 1LNUA 4K7PH 5EN2A 2CDFB 2PYEE 3L5WA 1J05A 1QYGL 4DCQA 4GQ9L 3EDFA 2ZOLA 4EN3A 4RMUA 2MHAA 4RDQG 4IOFD 3HAEB 1QFWI 2WWMD 4HFWA 2WBWB 1RFDH 1IKFH 3HR5B 2P7TA 4ZD3H 3EDEA 1AGCA 3SKMB 2P5WA 4YZFE 2JLLA 1CLOL 4G9DA 5EU6B 1KLUB 5F9DC 4ERSL 3A6OA 4PJ7A 1Q94A 4L3EA 4PJFF 4OZHA 3IKCA 3IDJA 2IPKA 4ZXBA 5H35B 2VN4A 1W8OA 3H9SB 5HDBE 2R2BA 2OR7A 4PJAB 3V8OA 2XNAA 1KJMB 5LBSL 5FECA 3T0EB 2I26N 2AK4D 1TZHB 1X6LA 2BY2A 3LH2L 2APBA 2HH0L 4OFYD 2B2XH 4YXKH 3QDHA 3UYRH 3TO2A 1XF2B 1IGFH 4FNLL 3BUYB 3L5XL 5IIEA 2DQEH 1IAIL 3KJ6L 4HWZA 4I9WE 4KRPB 3RNQA 4FFWD 2I27N 4JZNA 2J3SA 4NQDE 4OTXL 3VFPB 1IGCL 4JN2A 4HJGA 2A6IA 4UMGA 4K8RL 4IDJL 3SDCB 5EUKA 1MWAH 4PV9B 2GK0B 3HKFA 4Z7UF 2ED7A 2LU4A 2Z92B 5DRNB 3UC0L 4OM0H 12E8H 4K8RC 1IEAA 4O2EA 2EKSA 2CRYA 3LB6C 3OXSB 4JFDB 4U6XB 5AWNH 2Q8AH 3HI5L 3QIBB 1PSKH 3V6ZA 3DSFL 4J8RB 4RMQA 4QHUA 3RVTC 1BVKA 2VWEC 1M71B 1P1ZA 2XKUA 3BP6A 4XNXL 4Z7VF 5D6DA 2APVA 2F9BT 3CUPB 3G08A 3MLRH 1IM9B 3W82A 4FZEH 5FIEA 4DVBB 2JCCF 5GGSB 4MNHB 3O2VL 2CDFA 5DD1L 3N06B 3DGGB 3BRGC 3AS1A 1AP2B 3T3MF 4NQEB 3HAEA 2D0HA 3LQZB 3L7EB 3HR5A 3ABZA 2FO4B 5L2KB 5D7JB 5AD0B 3SKMA 1LHZA 4N0FB 3B8SA 5I0ZA 3KYAA 5EU6A 2VDLL 1KLUA 5L8JB 3C60C 4NKMB 2X4OB 4XC1H 4DGIL 5DMGC 3SO3C 3QQ9C 3QHZL 2WLYA 4XB8A 1RQ5A 2ZJSH 4Y4HD 2SEBB 2WQ8A 3HLAB 4PJIB 4HXBH 5IMMB 2J2ZA 5H35A 1KPRB 3H9SA 3CD4A 5FDYA 3ZKXC 1KJMA 3HUJB 3T0EA 4U0RB 3CJJA 3HG1D 2WP3T 1XF2A 5GGRY 1VFMA 3BUYA 4W6YB 2AXFB 4P5MB 5D7SH 5LWYL 5SWSE 1ZLWH 4U6VL 4KC3B 4HWBA 25C8H 3GHEH 4M1DL 4CU6A 4PRAA 4Y8AA 1UB6A 3VFPA 4IIQB 4ZTOL 1UH3A 3RI5F 2E6PA 3SDCA 5CKGA 2HFTA 4PV9A 2GK0A 3V6OC 1XH3B 2Z92A 3HFMH 5DRNA 1RUPH 5GIRB 1S7RB 3OXSA 4JFDA 4U6XA 4ZTPL 5FGSA 1RUKH 3QIBA 4J8RA 5DJCB 1KCSH 3NCMA 1M71A 5IQ7H 5HYJB 4BQBA 3CUPA 1G1CA 4YHML 1IM9A 4DN4L 4ELMB 3RRQA 1J1PH 4DVBA 1NMAL 5GGSA 3M8OL 2MSPA 3MACH 2QEJA 4MNHA 2DDQH 4LLUB 1P69B 1HKLH 2ADGB 4Y4FD 4NQXB 1AP2A 1WJ3A 4P2OB 3QUXD 4S1DD 2NMSA 4NQEA 1J0YA 2MOVA 5AEAA 4QHMB 5B4MC 4KXZH 3LQZA 3L7EA 2FO4A 5L2KA 3JBG7 5D7JA 2NY6C 1GIGH 3M1BB 3QB7C 4KROC 4N0FA 4NKMA 2X4OA 3C08L 3B3IB 1IQWH 4UIKH 3MLVL 2SEBA 3KPMB 2F54B 3HLAA 3MV7B 4NQUA 2XZZA 1JE6A 4PJIA 4KZEL 5K9OB 3ARFD 5IVNA 5IMMA 1KPRA 2LAGB 1T04B 4B53A 5HGGS 3TLRA 1IAMA 4IMKC 3HUJA 1XR8B 4DEPC 2ZP0T 2BVUA 4OBRA 4PB0L 3WIFB 4M7LT 1FH5L 2QSTA 3N1FC 1KULA 4P5TC 4Q7DA 4NO0B 1IKNA 4FQXB 3MRBB 2AXFA 5MEPB 4P5MA 4E0RB 2FNBA 2NTSP 1A7QL 4EEEA 2MMXA 1ED3B 5CCKH 4TRPH 3TT3L 4YE4L 2Z93B 5EUOF 3MOBH 4IIQA 5CS7A 1J88A 5IFAL 5A2LH 4MJID 4Z7NE 3RQ3A 1XH3A 5DVOA 4PGJA 4WY7L 5GIRA 1EEZB 1S7RA 3AB0C 3QDGD 5C0GB 2B4CL 3MRDB 4YHLH 4AJ0A 1MEXL 2QQNH 3VRLE 3PHQB 3OWEA 4MXVF 1N64L 3MLWL 3ZE1E 1RZKL 1CGYA 5IHUL 5DJCA 1JCKA 4P99A 4CMHB 2W9DH 1KSRA 1NMBL 1Z5LB 3MLPA 4NZRH 3KJ4C 4ELMA 4KU1A 2J8HA 4LLUA 1EMTH 1LP9F 4PJ8D 5EC2B 2W65B 2ADGA 2OL3L 3RDTD 4NQXA 4P2OA 1AXTL 2OP4H 1KCUL 4D2NA 2VXVL 2J6EH 4QHMA 4Q9RL 4X7SH 3T1WA 5EZOH 3M1BA 4NN6C 4R7NB 2VLKB 3B3IA 3T4AB 5EZIL 2NY4B 2GTZB 5DR5L 4ZAKB 1MFBL 3KPMA 2ENYA 2F54A 3C6LD 3MV7A 4QO1A 1ADQA 1DL7H 4MA1C 5K9OA 4PP1D 1DQML 2CKBH 1T04A 5ESQB 4P9ML 4PJ5D 4OLVL 5T3ZD 1IJ9A 1XR8A 1Q72H 1BEYH 1XGTB 1YEIL 3ROOB 3WIFA 2P4AB 4MYWB 5I8KL 3GSWB 4PP2B 5F9OL 5D7IA 1KNOB 4JRXB 2E27H 4KTDH 5T1DL 4NO0A 2Q76A 4XI5D 3DOSA 4FQXA 1OAZH 3MRBA 5TPWH 4RAVB 4LSPH 1CFNB 4HKJB 1FFOB 5MEPA 3CZFB 1MFDL 4L1DA 1M7XA 5FYJE 4APQB 3P11L 1HOCB 1ED3A 4I3SH 1NAKH 1X5GA 3RY6A 3RTQD 3QIWD 2Z93A 4UZGA 3CU7A 3ZKSD 2XI9A 1U93B 3I6GB 3BPOB 1EFXB 2JELL 1EEZA 1AQKL 5GS0L 5C0GA 2O26U 4JFFB 3MRDA 4L4TE 1MHEB 1OPGL 3PHQA 2V5YA 5DI8B 3A6CL 5GS0C 1F58L 2W1NA 3MV9B 2Q20A 4H25A 4F7CA 1F4XH 1H8OA 3O8XD 15C8L 4L3AA 2B8OT 1Z5LA 4WO4D 2J1KA 1EJOL 2P48B 3X14B 3N1PC 2H1PH 1OGTB 5EC2A 2W65A 4Y1AD 3QAZC 4JAMB 4A2LA 3ZDZF 2WBJC 4HK3J 4HAFA 3IDMB 2D03H 3OZ9H 1EDQA 1RUAL 4NJAL 3WSQH 2O5ZH 2WANA 3ZMRA 2AK1H 5DHVH 4R7NA 4HCRH 1ZHBB 3EBAA 2VLKA 3TJHD 4OI7A 2GTZA 1F8TH 1RUML 4ZAKA 1GJIA 2WWKO 4LPXA 1N3NB 4MNQE 4YFDB 3UO1H 1CLYL 3TO4D 3JV6B 3BJ91 3GMQB 2XZQH 5ESQA 3LIZL 1WCQA 1XGTA 3ROOA 1NGWB 3NCBB 1LK2B 3GSWA 4PP2A 3BHBB 1KNOA 4JRXA 1J86A 2JKXA 2XKSA 3WFEH 1Y6KR 2HAZA 2XZCL 4RAVA 1RU9L 4MS8C 1CFNA 2QHLA 4HK0B 1FFOA 4HKJA 5IW3A 4BFEA 3VG0L 3CZFA 5DC9B 4OLUL 1EGJH 1CDIA 2HKHH 1SBSH 3AY4A 4APQA 1HOCA 5LCVL 5GRJL 5JQ6L 3C8HA 4HFUH 5JMRA 4IHOB 3QDGE 5IB1B 2C1OB 1NCBL 1MPAH 1XGRB 2AEPH 3GMLB 5FYLD 1U93A 3MJ9L 2JE8A 4WGVB 3ECBB 2IFFH 3DRTB 3I6GA 4S1QL 1BZQK 5KTEH 4NO3B 1EFXA 2ATPB 2EYTA 1FPTL 3IDGB 1EA9C 3GRWA 1DBJH 4JFFA 1MHEA 4FMFA 1ZMYA 3GI8L 3FFCB 1KB9K 5DI8A 1SEQL 2A77H 2MCG1 2XTLA 3MV9A 3QA3B 4ODXB 1A0QL 4PLNC 5J06A 4N8CL 4PJBB 3DYMA 4P46C 3ZE0F 5JOEA 3VXNB 3X14A 4YNYB 2EDTA 5EO9B 1OGTA 2OR8A 5J3HD 4JAMA 2DIJA 4Z7WE 3WO3B 1NC2B 3NCCB 2VXTH 3MODH 4XP9L 2FJFB 5HVGB 3IDMA 4NO5B 4UAOB 1UH4A 2GKIA 4I3RL 4ZNEE 2XQYG 4X6DF 4N0RA 1OARH 3DROB 4O00A 2PW1B 3KHQA 4MA7L 3BN9D 5DZOA 4IJ3C 2DLTA 1CL7H 5E8EB 5C70A 1N3NA 2J7LA 4CNIB 5CHNA 3WKNA 5I75B 5FHBL 3JV6A 3GMQA 3UTOA 2XQYK 3L3GB 4B7IA 4W68A 3WIIH 3DX6B 1MRDL 1NGWA 1LK2A 4MB3A 3V79C 4AL8H 3RKDC 4XNUL 4F7EB 1HQRB 1DUZB 3BHBA 1NCTA 4QHKI 3O4LB 5E6ID 4WWKB 2ZPKH 2H45A 4XPGH 1AH1A 4HK0A 1VEPA 2DQDH 4WWID 4ODVL 3CFKB 1GGTA 2BDNL 5TE4H 3DRQB 4UTAL 3WN5B 3BVNB 4Z8FH 3O3AB 4IHOA 3FQUB 5IB1A 4YEFA 5TE6L 4Z0BL 2C1OA 4LSVL 4WV1C 1ZLUK 1XGRA 1WWWX 3GMLA 1RUQH 3O6LH 3C5ZB 3ECBA 3GKWL 3DRTA 4BELD 4HG4K 4WCYH 3PL6B 4NO3A 2ATPA 4HIJB 4DGVH 3IDGA 5I1IL 2AEWA 1B2WH 3FFCA 2IQ9L 1A9EB 3RU8H 1AO7D 3FHAA 4X6CE 3QA3A 3R8BB 4ODXA 4Y16D 5E7FA 3BQUD 5IMKB 4RA0C 2P5EB 2R1WB 4UV7H 1TZGH 5DA0B 5KOMC 1TQCC 2VMFA 3VXNA 3EOTL 4YNYA 1YPZB 4NO2B 5GZOC 4L8SC 5EO9A 2OTUA 3HAEH 5FYJL 4PB9L 4LCIH 2AP2A 1NC2A 2FDBP 2MKWA 2N7AA 5IQ9B 2FJFA 3E3QC 4NO5A 4NKQB 1MI5D 3CXDL 4LHJB 2EEAA 2HTLC 4XVTL 3NCYS 3TT1L 3RVUC 5FGBA 1S7XB 3DROA 3LRGA 1EUUA 2PW1A 5DJAB 2GHWB 4OLEA 2NY0D 3TEUA 5KJRH 4X99A 4AIOA 1A9BB 1A3RL 5E8EA 3D48R 1CI5A 3C2AL 1CQYA 2E5EA 5AYUL 1OOAA 4CNIA 1F13A 3X3FL 3V52H 2E7CA 1IMHC 3L3GA 1CICD 1OAYH 3O11B 4K9EH 1I3VA 5HHVL 4D9LH 2R9HC 1FAIL 1UZ8B 3DX6A 3JZ7A 2VH5H 4WTZG 2YOCA 5CGMA 4F7EA 3EAKA 5C6TH 4YDIL 1HQRA 3EHBC 3KDMB 4PLJD 3ZDXE 2DD8L 3O4LA 4WWKA 3O3EB 1KIQB 3DWTA 5D93B 5IVZB 1BFSA 5FYLE 3CMGA 3F8UB 3CFKA 1B6DA 4G8EB 2BY1A 4I77H 5I0DA 4DOHE 5F6HJ 3DRQA 5FFLA 3RL2B 1PY9A 3CLEL 3WN5A 1LDPL 3ZDYF 3BVNA 4H20H 3O3AA 5KW9H 2YRZA 3FQUA 3DHJA 4UNTA 3U0PB 5AZEH 5TF0A 1NGPL 1I1CA 3UTPE 2Q7NA 1XMWA 1EXUB 3C5ZA 5LKNA 3U6RB 4DKEH 1B9ZA 3QCUL 4HIJA 5LJYH 2Y06L 2A74A 5FEBA 1A9EA 4LEXH 3QDAA 5F71A 4UTBL 3B2VL 5IMKA 3QXTA 3NN8B 5L8KB 2ICWB 5T5NG 1DVFD 2D7PA 2BOBB 2P5EA 4JO2L 4Y4KB 2R1WA 3QBTB 4X80L 3W2DH 3JUYA 1YPZA 1F45A 4NO2A 5DWUH 3CDGB 1RZFH 4JDTL 5GHWL 3BKYH 2DRUA 1UM4L 5J56B 4RMSA 5ESVB 4GLRH 3VWJD 2FH6A 4WIQA 4YWGL 3IRZA 2P8LB 5IQ9A 3WYRA 1TJHL 1T7XA 5CLTA 4AEIL 1U3HD 3N0PB 1CWVA 1ZLSH 3IDYC 4LSUL 1S7XA 2UZXB 3BKMH 5DJAA 1A9BA 4X8JB 4MCYB 3BFOA 1ITCA 4K8RD 2QJDA 3OSKA 5IB3B 4JN1H 3E2HB 1FZKB 3C09C 4JQVA 3O3BB 4FQ2H 1WSST 1UZ8A 2VNCA 5GGRB 4JFYB 3TNNB 4JLRB 4TUJB 5FHAH 4PJ9C 3KDMA 4WI8A 4X98B 4PJXB 4E42B 3WFCH 3SKNB 5J13C 4R2GB 4JQIL 3O3EA 1KIQA 5IVZA 3QWOB 5CJOL 2AV7B 5D5ME 2PXYC 2XY1A 2F5AH 3FT2B 5F1KC 3I84A 4G8EA 5JDJA 2ERJC 3NVQA 3RL2A 5EOQH 4H26B 1YY9C 1A21A 4MQXD 3U0PA 3NH7H 4RDQF 1FE8H 2BCKB 2ZUXA 4WI5A 1EXUA 3U6RA 1U91B 2V17H 2EDXA 3QI9C 4KVNL 3QQ3B 3SHSA 3WCYA 5ALBH 4JJHA 4ZFZB 1ZHKB 3S4SA 3V7MA 3OKYA 3NN8A 1ZT1B 2ICWA 2BOBA 4Y4KA 3VXMB 5CBAB 4KK6C 3S35L 1ZLUH 4TTGA 4Q6IB 4MA3B 4CUCA 3CDGA 5C7XL 1G6RL 5J1AB 5ESVA 1JHLH 2IAND 3U7YH 2QV2A 2DM3A 3SE4A 1OAKL 2FH8A 5TQ0L 2P8LA 4PJDE 1YYMH 3N9GL 2ITCB 4ZFFB 5GGVH 3MGAA 1A7OH 1VFOA 4FFVC 4ZPTB 1INQB 4M62H 1CR9H 4DN3H 2BRRH 4YFLF 3QPXL 2NXYD 4X8JA 4MCYA 2VJXA 4LVHC 1WBYB 4LU5L 3ELAT 5IB3A 1YEGL 1FZKA 1I7TB 2UVEA 3O3BA 3RWEB 2HT4D 2Y25A 5CJXC 3V95A 5LQBL 5GGRA 4JFYA 2EDKA 3TNNA 3U48A 5A2FA 3OKNB 4JLRA 4TUJA 3NAAH 4RWYL 4HJ0C 2EXYC 4RFNB 1IZJA 5C0FB 4O02H 5GRWA 2VLJD 4X98A 1TETL 4PJXA 4E42A 4Y8DC 3SKNA 4GG6E 3BZFB 3SGJC 1ZSDB 3QWOA 5T33L 3MRJB 3ZYOA 2AV7A 2BVPB 5I15L 3FT2A 3RA7H 3R4DA 4M6OL 4H26A 3ZZ1A 1A7PL 4MAYC 4E41D 2BCKA 3TBWB 4B0MM 1S78C 4GAGH 1SY6A 5KG9B 4NCC2 1S3KL 1U91A 1KTDB 1JNLH 1MLCB 3QH3B 4KROD 1T4KB 3F62A 1HN1A 3EYQC 2GUOB 3VXUB 2YWZA 3QQ3A 4FRWA 2ICES 3SDAB 1RIUL 4R97B 4PGBB 4WEBL 4ZFZA 2CO7B 3UCRA 4LCCC 1ZHKA 5D70H 1S7QB 5HD8D 1BGXH 1ZT1A 3Q5TA 2VDPH 3VXMA 1G7IB 5CBAA 1KXQE 5EULV 2ICEB 4QNPE 1AD0B 1E4WH 2HT3C 1IFHH 2YKLH 5DUML 1CLCA 4Q6IA 2CXKA 4MA3A 1BM3H 1CGVA 3IETB 5D2LB 3I2CL 5I8EB 4OFVA 5FCUL 4G3YH 5J1AA 4D0CB 4ZO7A 3MV8D 5IBLD 1BECA 2XICA 4PRHD 5DMIL 1T1ZB 2ITCA 4ZFFA 5ANMB 4FHBD 5EU5B 4ZPTA 5BMFL 5M94B 1WITA 1INQA 2NY2B 3BRFA 5D71H 2DLEA 3BKCH 4J3UA 1U8MB 3DNKA 3EYVB 1G7MB 1WBYA 4YO0B 3GSUA 5IBUB 1U8KB 3VGBA 1JZ3A 4FN0A 4HBCH 4LIQE 3LVEA 3OKEB 1FDLH 4TNVF 1I7TA 2NY1B 4JFZL 3RWEA 4QXGH 3MRHB 2ZCHL 3CSBA 5C0IB 2QSVA 4M43L 4QCIB 4OSUH 1P7KB 5L88H 1AKJB 5F88B 1CFSB 1NMCC 3ZO0A 5C0FA 4OLYL 1JFQH 1F97A 4TPRL 2YD4A 3BZFA 2WUBH 3SE8L 1ZSDA 4KK8C 1Z3GH 3MRJA 3NIDE 5KSUB 2BVPA 4YQXH 3HNSL 1NAMB 3TM6A 3ZYJA 5DD5L 3RVVC 1Q0YH 4YBLB 1FFPB 4MMZC 3K80A 5BW7A 2GIYA 3RBSA 4PREB 1LILA 4G8FB 1KV3A 4GRWE 4OT1L 3PDGA 2AJYL 3UP1A 1NDGB 3LKRB 3TBWA 5GRVK 1CDJA 5KG9A 2AEQL 1GGCH 3GRWH 4RMTA 1KTDA 5E00B 1MLCA 3QH3A 1T4KA 1B4RA 5I1GH 4K7PL 2GFBB 2GUOA 3VXUA 1U95B 1MNUL 1PEZA 1F2QA 4J3OC 4PGBA 3CIQA 4ODSH 5EU7C 1S7QA 1RFDL 1PKQE 4TUKH 1IKFL 4ZD3L 5I73C 2IANE 2CPCA 1G7IA 4G9FB 2ICEA 1EZVY 5E08H 1ZGLM 4F7MB 1CXHA 1UWEH 3B9EA 1A6AB 5K9QG 3IETA 1UCTA 1A4KB 3MA7B 5D2LA 1H3VA 5I8EA 4D0CA 1D6VH 1AR1C 2IBZY 1DLHA 4S10A 4IRSD 1C8PA 1T1ZA 4FOMA 2Y5TB 3VJ6B 1K9TA 4Y88A 1FZOB 1P7QB 2APWA 5EU5A 3MJGX 4ONGH 5D7LB 4OCRH 1OTSD 3HZMA 5CGYD 4V1DD 5A16B 4YXKL 3UYRL 1U8MA 2DQHH 3HC3H 5J8OA 1IGFL 3EYVA 1G7MA 3NIFE 3AM8A 4YO0A 5K33A 1U8KA 4PJGB 2VLJE 1MVFA 3OKEA 4OZIB 4M9PA 3MRHA 5DC0A 5C0IA 4QCIA 1X4ZA 2BNRB 4KMLB 1P7KA 1AKJA 5F88A 1MWAL 1CFSA 3LV3B 2X5PA 1JV5B 1NLDH 4OM0L 2X4TA 12E8L 4E41E 5I8CB 4Y5VC 3RWFB 5JW3H 2B1AH 1ULVA 1FFNB 5KSUA 2BMKB 3QXUA 4P2RE 5AWNL 1NAMA 4KPHH 1JF1B 2Q8AL 4RRPA 3NFNB 1FFPA 1PSKL 4PREA 4G8FA 4YGVB 5HHOD 1NDGA 3LKRA 2C5DC 3A67H 3MLRL 5MEND 4FZEL 4WW2B 1OLZA 5E00A 5I8OH 5T3XL 4LDLB 2HLFD 1NKRA 1QRNE 1SYSB 1JHTB 2D7TH 2GFBA 1U95A 1XF5B 1EAPB 1OT1A 4XMKH 3FRPG 3CXHJ 3TZVC 3MBED 4G9FA 5IK3B 3RIAK 2H32B 3MV8E 4F7MA 2ZNWA 4PRHE 2B20A 4XC1L 3RX8A 4HIEB 2XXMB 5D1QC 1A6AA 2MQ3A 4M02A 5EOCH 2ZJSL 3MA7A 4JGMA 1WT5C 3BIAX 4ZODA 5CAYB 4OI8A 2V9RA 5FV2A 4X6EB 4GAYB 4YX2L 2Y5TA 3VJ6A 4XPBH 3VMOA 1FZOA 5JXEC 1P7QA 4JM2F 3VA2C 4UOJA 3NOIA 3CDYA 4M1CD 5A16A 4KMTH 3ZE2E 1I1AD 3O4OB 2AGJH 5D7SL 4PJGA 5GJSH 1I85A 2IC2A 3L3DB 3GHEL 4RMVA 4OZIA 1T6VN 3CSYB 2NX5D 4EVNB 1ZVYA 1MFCH 4PJAF 1YEEH 3OJVC 3BIKB 3S97C 5BCAA 4JHWH 4S0TD 1JV5A 4YIQB 3TH2T 2AXJA 3HFML 4P46D 4KMQA 5I8CA 3RWFA 4OUUB 1HSAB 1FFNA 2BMKA 1HKFA 5E1HB 1RUKL 1JF1A 3FT3B 3NFNA 4I0CC 1HCVA 1RZ8B 4FABL 4YGVA 1KCSL 2GY7B 5IQ7L 1J1PL 3ETBF 3ALXA 4WW2A 5JW5B 5ITBH 4LLYB 1SYSA 1JHTA 2DDQL 4WFGE 1JRHH 4YHIB 3SKJH 3FJTA 5IVXE 1IGTB 1HKLL 4LIQL 3DUUB 2V2XB 3CSGA 5ITFB 1LDSA 3LS5H 1XF5A 2QADB 3Q5OA 1JPSH 4PD4K 3QEGH 1AJ7H 4PG2C 4LDEB 4M48H 3CMOL 4LVNC 5IK3A 5IROA 5AG9A 2H32A 2HT2D 3W9EB 1J0KA 1GIGL 3HMWH 1CDGA 5CZXD 1IQWL 4BSJA 3EGSB 5KBNC 3L5IA 2ZUYA 3TVMC 5FKAB 3MGOB 3SBWA 3VXPB 4X6EA 4N1CA 5KSAD 1J0IA 5D2NE 4O58H 4HZLB 1T89C 3OL2A 3R0NA 3FB7B 3KPTA 1FFRA 1J7VR 2EECA 4ETQB 3ULUF 3GSQB 1OCWH 4G6MH 3RWIB 2B5IB 4YUEH 1WWAX 3L3DA 5IHLB 2XQBH 4NN5B 1SVCP 5CCKL 4TRPL 1ZHLB 4EVNA 3BOVA 4JANB 2KQMA 3BIKA 3MOBL 5DMKB 2Y1VA 4OM1H 3SO5A 1P4IH 2QL1A 4FQCH 1UQSB 5EO1B 4UDTB 4HPYH 4OJFL 4YIQA 5JZ7C 3RVWC 2FHFA 3WJLA 5HHOE 4OUUA 5EO0B 1HSAA 1LK3H 4GH7B 4OZHE 4YHLL 5MENE 2QQNL 4RAHA 2VZ3A 4U49A 4ZOBA 1J12A 3FT3A 1RZ8A 2X4SB 3HNVL 2BXYA 4NZRL 2FECL 4U7SA 4Z77B 3BPLB 5JW5A 3Q6GL 3RVUD 4LLYA 4YHIA 1EMTL 2VABB 1Z9SA 4K2UH 4LPWA 1YMMA 1IGTA 4GAFB 3DUUA 5ITFA 2AKRB 2D4DA 4U6TA 3V4PH 2FR4B 4DWHA 1LEKB 2OP4L 3VFOB 3V7AE 4JREC 2J6EL 4ENED 1IC5H 5CWSB 4PJEB 1QR4A 2EYSB 5EZOL 4NBZB 4H5SB 4W4OA 2R9HD 3W9EA 3IDUA 3VGEA 4DZBB 1WIUA 4ONFH 1FZJB 4RIRB 4XAWH 3EGSA 2VDMH 4JQXA 4PG9B 3QWRA 5FKAA 1DL7L 3MGOA 3MNVB 3IJYB 3VXPA 3KR3H 3V0WH 4BQCA 4HZLA 2G9HB 1JUFB 3F7QA 3FB7A 1Q72L 4XMLH 3ZKNC 1BEYL 3BRDA 3INUH 1PW3A 4QHNB 2XZAH 4ETQA 1C08B 2E27L 3GSQA 4ZUVB 1JL8A 2HRPL 1OAZL 5TPWL 5DQ9B 4LSPL 4XCCH 3RWIA 4QHKJ 4I3SL 2R8SH 2I60H 2H8PB 3ZKXB 1ZHLA 4RFEB 4JANA 3QDJB 5DMKA 4P5KB 4PJFE 5DRXB 1UQSA 4JO1L 1KEML 4P4KB 5EO1A 4UDTA 1GRWA 3Q3GB 1HHIB 4O4YL 5CD5D 4KDVA 2CGRH 1RD6A 6FABH 1CU4H 5EO0A 1Q9LB 1I9IH 3FO1B 4OF6A 1KUMA 2EO9A 1YYLH 1SY6H 3V2AR 2X4SA 5AAMA 1F4XL 1UJTA 3T0EE 1OSZB 3Q6FB 3ZT7A 1P5VA 4WUUD 2EC9T 2IJ0C 4ODTH 1AI1H 1LE5B 1L7TH 4JY6B 4Z77A 4JKWA 2H1PL 2VABA 3AMKA 3TBYB 5I1HH 2AKRA 4BQ9A 2FR4A 1LEKA 3VFOA 2A73B 4KV5E 2R4RH 5CWSA 4PJEA 2D03L 5I6XB 3OZ9L 3HE7C 2LVCA 1KCLA 4H5SA 4GBXB 4TYUA 3WSQL 2O5ZL 2R0KH 1INEH 2AK1L 4DZBA 4HCRL 1Z0MA 3CFBB 2Z31C 1FZJA 2X6MA 4RIRA 3BAEL 1ZEAL 1F8TL 3FO2B 4V2CB 5FDWB 3RGVC 4PG9A 4Z7VE 2DQUL 3UO1L 3MNVA 4GO6B 3IJYA 2LAAA 1R3IH 2JCCE 3KXFB 3BWAB 2G9HA 1JUFA 3OMZA 1C5BH 3DVIA 2UY7A 4JEGB 4QY8B 3VXRD 1MCLA 1D6EB 2BNQD 1MHHB 5SWZB 1C08A 4ESKA 3LEVH 4ZUVA 1Q1JH 3WFEL 3QUKB 3MXWH 3QPQD 5DQ9A 2OZ4A 5SWQB 3RZCB 2HG5B 1EGJL 2HKHL 1OGAB 1SBSL 5C0AD 1EFQA 4P2QB 3MV11 4HFUL 2H8PA 4RFEA 3HS0B 5JA9A 3IB4A 1KG0B 3O6FB 1MPAL 3QDJA 4EKXA 5AAWA 4P5KA 2AEPL 2H9GB 1FL3B 5DRXA 1MJ7H 4P4KA 2VUYA 4WFHE 2JF1A 5T5NF 2VZUA 3Q3GA 1HHIA 5KTEL 4RWHA 4YDJB 5KSVB 3D85D 3FOLB 4NZUL 4XNQB 1Q9LA 2HN7B 1DBJL 2PYEB 3FO1A 2LU3A 4I0KA 1ZVHA 3O3DB 4OZFG 2A77L 2MQ0A 4MA8H 3S35X 1D5MB 4LCYB 4LLQB 5JNYB 3B5TA 3TFKC 4CW1B 1IC7L 1OSZA 3Q6FA 4JHZA 5JOFB 4Y2DD 4KRLB 5CIPB 3S34H 2Q8BH 1LE5A 4JY6A 1DBKL 2DICA 2IAMD 3TN0D 5GZNC 5JPMB 1KJ2B 3TBYA 3P0VH 5IJVB 3MREB 4PRBB 1HZHL 3WXVL 2DJUA 3MNZB 4WENB 4EN3C 2A73A 1EBPA 2VXTL 2FBJL 2I5YH 3FHQA 4KDWA 2NZ9D 1OM3H 2X9YA 4GBXA 1P7HL 2VDKL 2XN9D 3UXFA 1OARL 3P9LB 3CFBA 1KELL 5J11B 3FO2A 5FDWA 2HJLB 1CL7L 4NUGH 4ZXBC 3QISA 4LCWD 3KXFA 4N1EA 1IGMH 2JJVA 3BWAA 4WEUD 2BXZA 4NQDB 3L1OH 3WFZA 4K3HA 3WIIL 1OD9A 3ARED 4QY8A 1UM6H 1D6EA 1MHHA 5SWZA 3WO4B 4BFBD 1FNHA 1VB9A 2DBJA 3QUKA 1PY4A 3QIUB 1G7JB 5HDLA 4G6JH 5SWQA 4CRPA 2DQDL 2OBGA 2H2SC 3CLFH 4JFED 2HG5A 3B9VA 3RZCA 4MA1B 1OGAA 3K1KC 4X8XA 5TE4L 4P2QA 3SDDD 1RSFA 4HUWB 3TA3D 3HS0A 1YA5A 4WTWA 4Z8FL 3T77B 5IB5B 1FGNH 1KG0A 3O6FA 2AJVH 2H9GA 1FL3A 1RUQL 5C0DB 3O6LL 4H8WH 3PP4H 3SPVB 4WCYL 1TTGA 1NAMH 1BFTA 4YDJA 1MOEA 5KSVA 2W0FB 4DGVL 3FOLA 3HB3D 4XNQA 2HN7A 2PYEA 4WUUE 2JJSA 1B2WL 2ADIB 1OWRM 2BK8A 3RU8L 3O3DA 1D5MA 4LCYA 4LLQA 5JNYA 2PNDA 1ZV5A 4CW1A 4MNGE 1CD8A 1U8IB 5JOFA 3TH3T 4UV7L 4BFIB 5CIPA 2K3TA 5D7IE 3LOWA 1PJ9A 2DTMH 5JPMA 1KJ2A 3B9KB 2WMPA 3MREA 3DUSB 5IJVA 3MNZA 5EUOE 4LCIL 4R26H 3O9WD 1A7RH 1UA6L 3GNMH 3MRFB 2NCMA 3FB5B 3IFOB 1TCMA 3DXAD 1NUGA 3L3OB 4PFEA 3WDHA 2Y6SD 1CD1B 1BD2D 5JXAH 3P9LA 4PJBF 4MXVE 3IDIA 4R4FH 5KANG 5KJRL 4YJZL 5IJKA 2HJLA 3EOAB 3VXRE 4NKIL 2BNQE 4KGLA 1RZGB 3QXDB 5SWSB 4Y19D 4A2MA 5C09A 2EH7H 3WUWB 1NBQA 4LARH 4G6AD 4K9EL 4NQDA 5IG7B 4D9LL 1ACYH 1LP9E 3T0EC 3RVVD 2N56A 3NCJH 5HDOA 5C0AE 4NKOB 5C6TL 4QHLB 4ZOEA 3KHOA 5EBLB 4HWBL 3QIUA 1WEJH 3B5HA 1G7JA 4MLIA 3Q2CA 1KPUB 2NXZD 4XNYH 2AXGB 3RAJH 1HHGB 5C0NC 4KRPC 1VFUA 1FVEB 4HMCA 4Y5XB 3P73B 4HUWA 5KW9L 4H20L 1JMZA 1R3KB 3T77A 5IB5A 5T1MB 3G5ZB 5CP3A 3SDCC 5C0DA 2LQRA 2YHGA 1JGUH 1F6AB 5HHMD 3SPVA 2N7BA 4DKEL 5L7XH 1WFTA 1Q9KB 4KKAD 4NFDA 1FJ1B 2W0FA 1A4JB 3FTGB 1X5YA 4G6FD 4YBQD 2ADIA 4KRNA 3OPZL 4LEXL 3V5KB 5D4QA 4Y5YA 3S36X 5LGJB 3QIBC 3HC0B 3CSPA 2O5YH 1U8IA 1OQOA 3IRPX 4NGHH 4BFIA 2KDGA 3LHPH 4M3KB 5DWUL 3B9KA 1LEGB 1RZFL 3DUSA 3BKYL 3TGXA 1KCVL 2RGSA 4Y89A 4JR9H 5DT1L 2AK4B 8CGTA 2R0ZH 5GRZA 4MB5A 5GGTA 5KSBF 1RK1B 3MRFA 2H32H 4BYHA 3FB5A 3IFOA 3TNMB 5D7JC 3O0RH 3LQMA 4QF1B 1OSPL 3L3OA 5HI5D 3U4BL 1ZLSL 4PBXA 1CD1A 1F6FB 3SGEH 3QCTH 5ISZD 4R0LC 3X13B 1YPZF 3EOAA 3WLWC 4OZFH 2FD6H 4KHTH 1RZGA 3QXDA 4HXAL 4OF5A 5SWSA 4Z5RB 4JN1L 1X5XA 1U8OB 5IG7A 4FQ2L 2EYRB 2YWYA 4OKDA 4BZ1H 4U0RC 4CDGC 4JFEE 1G1YA 3CH8A 4NKOA 4QHLA 4XT1C 3ZDZE 1IL1B 5EBLA 1IKNC 2AABH 2MWCA 3WFCL 1KPUA 4HGKC 4NKDB 2AXGA 1HHGA 2F5AL 4XP1H 1FLRH 3QYCA 2XYCA 1FVEA 4Y5XA 3P73A 5EOQL 4F15B 1R3KA 4IIQC 1FE8L 5T1MA 3G5ZA 3TZVD 1F6AA 2QBWA 2VDQH 1NFIB 2V17L 1Q9KA 1FJ1A 1WAAE 1A4JA 3FTGA 3K81A 1J87A 4JVUA 4OLWH 3V5KA 5ALBL 5E4IA 3KLHD 5LGJA 3P30L 3HC0A 4QKXB 3MUY1 2WAHA 3O6KL 2FEDC 3W81A 1WC7B 1CFVL 3IT8D 1MCWM 4DW2L 3DXAE 1LEGA 3PV7A 2GYSA 4CAGA 1E4XH 1JHLL 3U7YL 2AK4A 4IM8A 1BD2E 4F8TA 4GXVH 4FTVD 2W9EH 4OFYA 1IEBB 1YYML 1AQDB 3TNMA 4QF1A 3RPKA 3I85A 5GGVL 2NW2B 2MQCA 3IKKA 2Z4QB 1TQCB 2CMRH 2W38A 4M62L 1CR9L 4DN3L 2BRRL 5E2WL 3X13A 1OWWA 2DLIA 2KBGA 2UYLB 1QYGH 2NY3D 5DQJB 3MLZH 5DJ2B 1FBIL 1MCQA 2RB8A 3SE9H 3KS0J 4WVRA 1FYHB 1T21B 4Z5RA 5CEZE 5HHXL 2H2PC 3ZE0E 2E9IA 3JVGA 1P6FA 1U8OA 4M9OA 2EYRA 1JPFB 4GKSB 2B0SL 5K93A 3NAAL 5F7NC 1KTLB 1S5IH 4ERSH 1IL1A 4O02L 4XPTH 2D9QB 4OF7A 4FQXC 3W9DB 2XWJB 4KKNA 1D5ZA 3DI2B 2E3VA 4NKDA 4L4TB 4X6DE 5A2KH 3EJYC 3RY6C 1I7ZA 5KS9F 3GSNB 1RZIB 1LMKA 3RY4A 5FM8A 4Y4FB 4JKPH 4FZ8H 1JHKH 4GAGL 3QUXB 1JNLL 4QOKD 3TBVA 1NFIA 4LRIC 5BO1H 1T5WB 4NCDA 4EJ1C 4XMPH 1CQKA 3ESVF 4RFOH 2OQJB 1TVHB 5DD6B 4OCWH 1NPUA 4OTXH 5D70L 1BGXL 4AK1A 1IM3B 3BP5B 3QEQD 1WC7A 2YKLL 3O4LE 5D7KD 4JCLA 1TVBB 2ADFH 4XXCA 4CADB 4G3YL 4MNQB 3UMTA 2L0DA 1PG7X 2NY5L 1IEBA 5FM4A 2DQTL 4OV5B 1M7IA 1TNMA 1AQDA 1O0VA 5ICYB 2NY5C 4X4XB 4S1RH 4D94A 5K59F 3KYNB 4BSVB 2Z4QA 4LOUC 3O81A 3OHXB 2NY4C 4EI5D 1Z6JT 3L3JA 3UZQA 4ZAKC 1U3ZA 5D71L 2UYLA 2OS7A 2IMMA 3BKCL 1S7TB 4U31A 5DQJA 2BY3A 1J9CT 5DJ2A 4S11A 3RVWD 1BJ1J 4JDZA 3U36B 1T21A 4HBCL 1FDLL 3MRIB 4QXGL 5BS0E 4RAUB 2P5EE 1JPFA 4GKSA 5D1ZD 3QDGB 1QO3B 4OSUL 1EHXA 5EPMB 4C59B 3O2DA 3BD3A 3VH8G 5L88L 2OZ4H 4FA8A 1KTLA 2BSTB 3I3EA 4DGIH 3O3UN 2BSRB 4XP4L 5HI4D 4WHYG 3KPQA 2WUBL 2XWJA 5DRZB 3W9DA 4BK4A 1Z3GL 3U9UB 3AY4C 4L4TA 4APQC 1Q0YL 3D0VA 3GSNA 1RZIA 5B39G 2IQAB 4PJ8B 2V6HA 4Y4FA 3PWVB 4ODWB 3RDTB 1Z9OA 1P5UA 4MVBC 3QUXA 4LLDB 1GGCL 3GRWL 1IARB 2WQRA 4QXUL 4MJ5B 4RGOH 5I1GL 5I30L 5J13B 2F58H 1T5WA 1CVSC 3DMMD 3HE6B 3WUWG 2OQJA 4Z7WB 1TVHA 5DD6A 2FX8H 2PO6D 1FZMB 4ODSL 1IM3A 4TUKL 1JP5A 3BP5A 5EG6C 4ZTOH 3C6LB 4NC1E 1MJJB 5E08L 3MRLB 4FTVE 3ARFA 3ZKND 4U1IB 2F53D 1TVBA 4Z78B 3ZDYE 5HPOA 1UWXK 1NGYB 4MNQA 3D39D 4UB0H 1D6VL 4H1LB 1Z0NA 5CSZB 3FN0H 4OV5A 35C8H 5GS3A 3SJVD 2FECI 3ARGD 5ICYA 2YR3A 1UZ6F 4X4XA 4ONGL 4YHMH 3KYNA 4BSVA 3IJSB 2CDGB 4EQ3A 2ZZUT 4YHYB 3OHXA 2V5MA 2Z8SA 2EIEA 3UEZA 4ONOA 3RTQB 3DURB 3QIWB 1H15B 3D9AL 1S7TA 3BMWA 3HC3L 1ITBB 5L9DL 3MRGB 1HDMB 1NEUA 1XEDA 3BWUC 3U36A 5BVPH 4DZ8B 4YXHH 4DTGH 3MRIA 4N8VB 4RAUA 1RZJL 1OLLA 2APFA 3MLUL 3QDGA 1QO3A 5EPMA 3K2UL 1Q38A 1RZJC 4XGZB 2BSTA 3KWWB 5C0RH 1DLFH 2BSRA 3K4DA 1NLDL 4KKBC 4JPVL 3MLVH 3RWDB 4WHCA 5DRZA 5E0QA 5JMOC 5JW3L 2B1AL 3O8XB 3U9UA 4WO4B 1QD0A 4KPHL 1P53A 1FVDB 3JWOL 4X6CB 1FFQA 2IQAA 2YD8A 1ZHNB 1MAKA 4PJ8A 3UJTH 4Y1AB 3QUYD 1CBVH 3PWVA 4ODWA 4PB0H 3RDTA 3JWOC 2Y4SA 3G5XB 4YPGA 4PBWD 5I8OL 1FH5H 4MJ5A 4HD9A 1BHGA 5FYKD 2D7TL 3QEQE 3HE6A 4R4ND 1A3LH 1JF5A 2JJWA 1TJGH 3MRQB 3CVHB 5ENWB 4XMKL 4Z7WA 3WNPA 4MQ7B 1FZMA 2GT9B 4YE4H 4JFHD 3QDMD 1A5FL 4HV8B 1KJ2H 3C6LA 1MJJA 3EZ8A 1BIIA 3MRLA 4ZNEA 3D69B 4U1IA 3TO4B 3FZUC 4J7RA 4PJXE 4WY7H 4Z78A 2PYFB 4JHAH 4MXWH 5EOCL 1NGYA 1MEXH 5E2JA 4H1LA 1I8LA 2CLZB 3CGTA 1N64H 5CSZA 3HHRB 4ODUB 4ZFOB 1RHFA 4XPBL 2VERN 4K3DH 4WDIB 2DQIL 1NMBH 5FGBC 3PHSA 5GJTH 3IJSA 2CDGA 1CDYA 5FA3B 1F3RB 4YHOL 1L0QA 4KMTL 5DFTA 5CBEB 3RTQA 3DURA 5LG1A 3QIWA 5IWLA 1H15A 3IYLW 5I75C 2AGJL 3C5JB 2NYYD 3MRGA 2DQJL 1HDMA 5JA8B 4KZDH 5GJSL 4DZ8A 1YC7A 3U7WL 2VOTA 3W11D 4DOHB 4N8VA 1MFCL 4K23H 3VXME 1YEEL 1D5XB 3DV6B 3TFKD 2XRAH 1EHAA 4XGZA 1G7LB 2FX7L 3KWWA 1NBVH 4JHWL 4NZDA 4UILH 3VGAB 3GSVB 4V2BA 5DR5H 3RWDA 2VUOA 2V9TA 3O8XA 4WO4A 1IT9H 2EICA 1FVDA 3WN5C 4X6CA 1OQXA 4OLVH 1ZHNA 1YEIH 4Y1AA 3C5ZC 3DJ9A 3GJFB 5F9OH 3G5XA 1CT8B 4YH6A 1K5NB 5GGQH 5ITBL 1JRHL 4P3WA 5A3IC 3P4OB 1ZANH 3MRQA 1JPSL 3CVHA 5DFVD 5ENWA 1CE1H 2F53E 3QEGL 4MQ7A 4M48L 3MRMB 4WJ5B 2GT9A 4GSDL 4ZXBD 3AS2A 1I7UB 3LDBB 3GUTB 4HV8A 3FQTB 3TCXA 3HCVB 4J1UB 3TO4A 1DDHB 1HCFX 3BGFB 3SJVE 4XBEL 3VGHA 3W39A 2PYFA 4GQPH 3REWB 1AQKH 1BFOB 3GBMH 4ZNCD 1HNFA 2CUIA 1X5JA 3A6CH 2CLZA 5F3BB 4O58L 4ODUA 3DYPA 5E6IB 2DM7A 4ZFOA 4OCNC 5DZLA 1MCBA 4R6UA 4WDIA 1IBGH 15C8H 3MRKB 3AXLB 1WZLA 4ZUTB 1BBJB 5FA3A 1LEIB 5CBEA 5F9JB 4W6XB 1OCWL 32C2B 2HWZH 2GSGB 1E0OB 4G6ML 3C5JA 2YSSB 3D3VE 4YUEL 5D5MB 3WFDH 1FORH 1CGTA 2VTFA 3PV6B 2XQBL 4JQVC 1VGKB 1GOHA 3MLXH 2V5TA 3QCVH 3VFMB 3T0WA 4U0QB 4NJAH 4HSQA 1D5XA 3DV6A 4OM1L 4QRTB 1P4IL 4FQCL 1BREA 1G7LA 1CL7I 4HPYL 1AO7B 1TTFA 5DEGB 5ICXB 4P49A 4Y16B 3GSVA 1FNLA 2OJEB 5D2LE 5HI3C 3JV4B 3SEPA 5D93C 1LK3L 1NBZB 3QFJD 5E6ZA 1HHKB 2GSIB 1KTKE 3F65A 5FYKE 5BRZD 3TIEB 3DBXB 2NNAB 2QHRL 1CN4A 1AGEB 2DF3A 3GJFA 4JM2D 1T7VA 5TQ2H 4ZS6D 1CT8A 5HYQB 1K5NA 4JFHE 4K2UL 3UAJC 3QUZD 3HA0A 3VDCA 3P4OA 3V4PL 2NY0B 1TJIH 3MRMA 3L3KA 4PJDB 4WJ5A 3GUTA 1I7UA 3H9SD 3D25B 4Y4KC 5FOJA 4MHHI 4F33B 5FO9B 2G5BB 3FQTA 4AENB 3HCVA 1K3ZA 4J1UA 3WLBB 1DDHA 2Y07H 4M4RA 1L6XA 4ONFL 4XAWL 2VDML 3REWA 5KZCD 1H3GA 4AQOA 1BFOA 1SM3H 3MCLH 3GI8H 3SE4C 3AU1B 1T66C 4H0HB 2VB5A 3BPNB 3KR3L 2FEEL 3V0WL 4DAGH 4M7LL 2YA2A 5E6IA 2ZUQC 5K9KB 2PF6A 4XMLL 3MRKA 2ZKHH 1YEHL 3AXLA 4U1GB 3INUL 2XZAL 4ZUTA 1BZ7B 4ISVB 1BBJA 1LEIA 4BM7A 5F9JA 1DTUA 32C2A 5KVEL 1I1FB 4GG6B 2GSGA 4NQCD 2YSSA 1J0HA 5D5MA 5F7HA 3E2HC 3PV6A 4JFDD 2R8SL 1VGKA 3VRJB 2I60L 3VFMA 4G9FE 4HKXB 4QRTA 1BMGA 3F7VB 4OIAA 3V0VB 1AO7A 5DEGA 2CK2A 5ICXA 4Y16A 2OJEA 4R2GC 2CGRL 5DK0B 3EFFB 3JV4A 4AZ8A 3T2QA 6FABL 4J3VA 3GEWB 1DVFB 1OB1B 1I9IL 1NBZA 1HHKA 4JPKH 4OCXH 4RNRB 1NCWH 2GSIA 1YYLL 4I13B 5DZNA 4IRZH 1L4IA 2EZ0D 1SY6L 3EDJA 3LQAH 1VDGA 3OJDA 1NC4B 5ACZB 4H0GA 3TIEA 3DBXA 2NNAA 4I0PD 1QNZH 4P23D 1AGEA 3VWJB 5BOZG 1AI1L 5DJYB 5HYQA 3ULUD 3RY5A 2ARWA 1U3HB 1S9YB 4FQPA 2FGWH 5I1HL 2J8UF 4PJGE 1N5YH 1ACZA 3MYZA 2CRIA 2E7LA 2R4RL 2CUMA 1FC2D 4OCYH 4PJDA 5E6YA 3NZ8B 4Z0BH 3D25A 3LEYH 5E2VH 5FO9A 4F33A 2G5BA 4F80A 2R0KL 5E8NB 1INEL 4AENA 3WLBA 4Q6IC 1NGZB 1CICA 4QWWC 4XX1E 5HYSG 4XP6H 4F57L 5I1IH 1IGIH 3GMOB 4F7PB 3GBLA 1Y18A 3UTSD 1BFVL 3AU1A 3MLSH 5DVMA 3WV0A 3V5HB 1R3IL 3GI9H 5C0JB 4LLMB 3VI3F 5K9KA 1C5BL 4XPFH 5FUCC 3HI6L 3VU2A 2F8XC 3LD8B 3HZVB 1BZ7A 4ISVA 4ZG1A 5JHLH 3DPBA 3LEVL 1Q1JL 1TZIB 4IOSD 4AEHH 5FYJH 2HMIC 4PB9H 1I1FA 4GG6A 3MXWL 4HH9B 4GRLD 1LQSR 4HMEA 1L7IH 4U05A 4AIXA 3K4ZA 3VRJA 3P9MB 3CXDH 2V2WA 3MRNB 3G6AB 4GRWB 3QFJE 4R3SB 3EKCA 4HKXA 1MJ7L 4RFNC 3IS0X 2WUCL 3F7VA 4C4KT 3V0VA 5HYJD 2H6PB 3QQNA 5KVGH 1REIA 4M8QB 1SEBB 1E6JH 2DLGA 3EFFA 5DK0A 5BRZE 5C9JB 1YEKH 3C2AH 1DVFA 2IPTH 1OB1A 4Y0GA 4YLQT 5JUEH 4U1NB 3UBXB 3IFLL 4RNRA 1T2XA 2DKSA 5I1AB 5BW7C 4MA8L 1FNAA 4P2OD 5ACZA 1NC4A 3BT2H 1ZGLB 4XAKD 4XZUB 2IANB 5IVOA 2P42B 3VWJA 1KOAA 5DJYA 2DQFB 5DHYB 5H94B 4I8DA 2H3NB 1IILE 3P0VL 1U3HA 5BV7B 1S9YA 1KIPA 1X5KA 1BPVA 3JXAA 4OAWB 3O41B 4R97C 1NFKA 3K4AA 4J2XA 4ZDHB 2F54D 3MV7D 1MREL 1S9XB 3OXRB 4EIZC 1LDPH 2I5YL 3NZ8A 5IF0B 2NXYB 2H2PD 1OM3L 2YD6A 1NCNA 5E8NA 3ILQD 4WI6A 2AW2A 1QBBA 4JFXB 1NGZA 4KY1H 3QCUH 1GYAA 3NCFB 1HE7A 4XCFH 3GMOA 1FCGA 4NUGL 4TUOB 4F7PA 1BWMA 2X4NB 4POZD 5IHZB 4P9HH 5INCB 3V5HA 3IGAB 2VLJB 5C0JA 2OLDA 4LVEA 1T22A 4LLMA 4LMQI 2BHZA 3IAGC 2HP4A 4X80H 3BE1H 1KBGH 3HZVA 4KHXH 2WNGA 2NY2C 3EDKA 4TVPD 1TZIA 1YMME 3MUGB 3U30B 1QLFB 4HH9A 4E41B 3AM8C 2NR6C 2CH8A 3CLFL 4P2RB 3VD5A 2NY1C 1KFAH 4RSVA 3OKMB 4OGXL 4XWOC 1W0WB 3P9MA 5D1XD 3P4MB 1JNJA 1QLRB 3MRNA 3G6AA 4L8BB 4R3SA 2AJVL 2L7JA 3CX5J 4S2SB 3PP4L 2MNUA 2H6PA 1KTRL 3VXTB 3RIFK 1TQBB 2EXWC 4U2YA 4M8QA 1NAML 5C9JA 4Z76B 5DO2C 1QRNB 1GOGA 2CDEB 3GM8A 5I66B 5JW4Q 3D87B 4OF8A 4WFFE 4KQ3H 4Q9CA 2VKXA 4U1NA 3ZHLA 4CU7A 5IEHB 1B4JL 1EO5A 5I1AA 4U7KA 4YBLC 3ULUE 1U8QB 3X12B 3NA9H 3P77B 4G6KL 2GCYB 3VFTB 1ZGLA 1I75A 2CQVA 3SOBH 2Z0BA 5IB2B 3T2OA 4XZUA 4X5LA 2IANA 4YXLH 3AC0A 2DI7A 5LAXB 3S37H 3MV8B 2DQFA 4MQSB 5CEXB 5H94A 4PRHB 2DTML 2H3NA 5E8DH 2VRAA 3NZHH 3T04D 1HEZB 2VLKD 2HKFH 3ARXA 4KK9C 1UADC 4QRPD 4U1KB 1URLA 4XVSL 4R26L 4OAWA 3ZT5A 3O41A 1A7RL 4FS0A 4ZDHA 3GNML 2QTEA 5DS8B 3QR2A 3OXRA 1S9XA 5KVFL 4XRCB 4OFPA 2VZ1A 4M6ML 5DRWB 5IF0A 3EO9L 3UTSE 2WINB 1IRAY 5HHNB 4GKNB 1NSNL 4GUPB 3F6LA 1A8JH 4JFXA 4QXWA 4R4FL 4H1LH 3BH9B 1JGEB 2VISB 5CJQL 4C83B 1R5WB 4TUOA 4DUXA 1A1MB 2X4NA 3DSNA 5IHZA 5INCA 2EH7L 3IGAA 1AXSB 2VLJA 4LARL 4APQD 2D9CA 4OCSH 1ACYL 1GAFL 1NFDF 3NCJL 1BAFL 2BC4B 1MFEH 1N2RB 5HGHB 5IHBA 1FO0B 1RVFH 2C3WA 3MUGA 1WEJL 3TPUB 5J4MA 1QLFA 3RGVB 4E41A 1PG7W 1HH9B 4XNYL 3RAJL 4C58B 1I85C 4JFFD 1C1EH 2CJUH 4I2XE 3OKMA 1W0WA 1T0NB 3DETC 3P4MA 1QLRA 4JJ5B 4F8QA 2P46B 3MV9D 5FYJU 5MHSE 4L8BA 2XG4A 4GKZB 4S2SA 1JGUL 2V2TB 5L7XL 1X5LA 3VXTA 5DF0A 4Z76A 3QPXH 4X4YB 1QRNA 2CDEA 1PBYA 5DLML 1B0GB 3HRZB 1ZVSB 3GBNH 5IEHA 3BGMB 2AJ3B 4HS8H 1U8QA 5T1LD 2LFGA 4GAJL 2GCYA 3VFTA 1MJUH 2O5YL 2FHBA 3K1DA 5IB2A 5A2IH 5IW6B 5F21B 1WUNT 4NGHL 5HDQH 4WW2C 5LAXA 3MV8A 4LPVA 4B41A 3LHPL 5CEXA 3FAXA 4IRSB 4PRHA 3CVHH 1HEZA 4HUVB 5F6HI 1W2KT 1WV7T 1X5ZA 3BD5A 4U1KA 1JI1A 4JR9L 3HRPA 2R0ZL 3SGKC 5DS8A 1DE4B 1MQ8A 4M6OH 5JIKA 4XRCA 5D2NB 5DRWA 3TH4T 3H42H 1BJMA 3O0RL 5IROC 2WINA 3U0WH 4KKLD 5HHNA 4GKNA 1DANU 4GUPA 1S3KH 2E8ZA 2CD0A 1CXKA 1IGJB 3BH9A 1JGEA 2VISA 2DB8A 1FHGA 1H5BB 4C83A 1J05B 1R5WA 3UDWA 2XWBB 4DUVA 5IP4A 1A1MA 2ZOLB 5I74B 3SBWC 2FD6L 5BVJB 3D2UB 4WEBH 3K0WA 3WBDA 1A6TB 4TVPE 4AMKL 1AXSA 2WZPD 4C56E 3U7AA 1CGSL 4BZ1L 3PWPE 1CDUA 1K3IA 2D2OA 2V5RA 1N2RA 5HGHA 3G9AB 3JWDC 2P44B 3L5JA 5FYLH 1FO0A 2AS5M 2FWOB 3TPUA 5D72H 3RGVA 5HHOB 3O4OC 1Q94B 2V7HB 1HH9A 1R3HB 4XP1L 5MENB 3IU3B 4QRRD 3X3GL 1ERNA 1T0NA 4JJ5A 4YDVB 4MX7B 2W0PA 2Q87A 4GKZA 3STLB 1FLTX 2V2TA 3BN3B 3WS6A 2VDQL 3WJLC 4ETYA 4X4YA 3MBEB 3BO8B 1B0GA 2FATL 3HRZA 1U3YA 4LPCA 3BGMA 5TJWK 4HWZB 2AJ3A 4OLWL 3DECA 1Y0LA 2OX5A 4RISH 4OV6F 4JFZH 4FQHB 4XVUC 2BVEA 4QRPE 5IW6A 3VMNA 2VQ1B 2XTJD 5I16B 5DK2B 3KPLB 4PLKD 1P4BH 5SWZE 2GY5A 3UPCA 3EOYG 1B90A 1UCBH 4IRSA 3ZTJG 1MAJA 4HUVA 4N5ED 1OAXH 5F44A 1R3JB 2RFXB 4WI9A 4FQQB 4GXVL 3OF6D 5DD5H 2W9EL 1MY7A 1DE4A 2GAZB 3T0XA 4OLZH 5D2NA 2ORBH 4LDOB 1I1AB 2X9XA 3VMPA 3LMJH 4W4OC 2AEQH 2CMRL 4F37K 5DMJB 4HUMB 1BF8A 4JQXC 1IGJA 4N0YH 4X0KB 3UBXG 1H5BA 5CEYB 3MUHL 4LEOB 1V7MH 3MLZL 2XWBA 3BESR 1M7DB 4WWKD 1MNUH 1S8DB 3QRFM 3SE9L 1KXTB 5BVJA 3D2UA 3RUGF 1A6TA 1VACB 3K74B 5FF6B 1C5CH 2XWTB 3S36H 4PJFB 1S5IL 4XPTL 2P49B 2FWOA 2X4RB 3MUZ1 3PL6D 1ES0B 5HHOA 3PIQB 6CGTA 2JIXD 2V7HA 4NM4H 2B5IC 1R3HA 2Y5EA 4NRZB 5MENA 3IU3A 4NN5C 4JRYD 1F4WL 4F9PA 4YDVA 5CSBA 4YBHA 4MX7A 1CGUA 4JKPL 2AQ2A 4FZ8L 5B38G 1JHKL 3STLA 1EVUA 4DQOH 3T0DA 1FIEA 5E4EB 2HTKD 5I19H 5BO1L 2P24B 3MBEA 4IRJD 4XPHH 3BO8A 4XMPL 3WNNA 5C09E 3HPJB 4RFOL 1YEFL 4OCWL 3KPRD 4M00A 4PRAB 4FQHA 4Z7UB 1F4AA 3RBGA 1UB6B 1QLEL 4O2CB 1NCAH 2VQ1A 4N0CC 5I16A 5DK2A 3KPLA 1AY1H 4HGWA 3BPLC 3DX7B 2MCPH 5C2UB 2DQCH 4XTRC 5KSAB 5EORH 3QRGH 1NUFA 2WW8A 2ADFL 1S7WB 1R3JA 1XF3B 3FOMB 2E7HA 2RFXA 4Z7VB 4FQQA 1SBBA 3EDDA 2GAZA 4KI5C 4KJPD 2JCCB 1JWMB 4HHAB 1OP9A 1G9NH 1I1AA 2HFEB 5E9DD 5C9KA 2B39A 1V3JA 4S1RL 2YMXL 1JRHI 3MJ9A 3NPZB 4M7JH 1G7PB 1GCFA 4PRID 5T3XH 1J0JA 1QSFD 1QVOB 2ZUTA 3K8MA 4X0KA 5F7YC 4NM8L 1W72B 3NIGE 3GK8H 2PKDA 5CEYA 4LEOA 1B3JA 1A14H 1XZ0B 1M7DA 1S8DA 1F3DJ 1VACA 5FF6A 1JYVA 1B88A 1H3TA 3SQOH 4LQ1A 1RJCA 1RPQA 4QRQB 4JY4B 3ULVE 2D31B 2XWTA 1CZ8H 4PJFA 2OZ4L 4QRRE 3W0WD 5I1JH 3F12B 5F72S 4AY0A 5E1AB 3PF2A 4R0LB 2X4RA 1ES0A 3PIQA 4H88L 5DTFB 4NRZA 3R1GH 1T0PB 2YRLA 4P59H 4YX2H 4G5ZH 1BQLL 1B0RB 4Z7OE 1A1NB 2XY2A 1ZT7B 4P4KC 1U36A 4EQ2A 4RGNE 1QFWM 4RGOL 1QSZA 5DURB 2V5SA 4TVSa 2F58L 2P24A 3G04B 5E99H 4HC1A 1KB5B 4UOW0 4IMLB 3HPJA 5JTWA 2FX8L 4G42B 4Z7UA 5F1OB 3MXVL 4O2CA 5K9QI 4MSWB 3DX7A 43C9B 4ZOCA 2EIZA 5KSAA 4HLJA 4PJHF 1S7WA 4ZPVB 1XF3A 1LO3H 3FOMA 1PFCA 4Z7VA 4UB0L 2BP3A 5CFHA 4OIIH 5BJTB 2EE9A 3ZTNH 3FN0L 5AYQA 35C8L 2JCCA 4FABH 3GKZA 1JWMA 5I6XC 4HHAA 4GBXC 2HFEA 2LTQB 1T83A 1HYSC 1G7PA 2OTPA 1BVZA 3OGCB 5I1EH 1QVOA 4PYGA 4JVPA 2CRZA 3ZSSA 4TN9A 1W72A 4LIQH 1KC5H 1XZ0A 2BZDA 4LRNH 5BVPL 4YXHL 3CMOH 4DTGL 1BQHB 2EDNA 4NCC1 4OGAC 3ET9F 4L9DA 4QRQA 4MAUH 4JY4A 2DL2A 2D31A 3ZTJH 5KSBE 4OD2B 5C0RL 1YQVH 3F12A 1DLFL 5E1AA 4R0LA 1MQKL 4M7ZB 3FONB 5E5UB 2DBLH 2AK4E 2A0LC 3ARPA 3PDOB 3RZCC 5SV4A 3OJMB 5DTFA 3ALPA 4WUUB 4GRWH 4ZQKB 1YDPB 1NJ9B 4LQFH 1B0RA 1A1NA 5C2BH 3UJTL 3O6FC 4MNGB 3MYJB 1CBVL 1ZT7A 1PG7H 5D7IB 2EEDA 1U9KA 3KPRE 3MMEB 4R8WH 2Q76B 3T3PF 2BVTA 3G04A 2JJSC 5EUOB 2VITB 1T03H 1KB5A 1A3LL 4LPUA 1TJGL 4IMLA 1NEZB 2UWEF 4U3HA 1J8HD 4G42A 4LP5A 3JV5A 3T1FB 3QFDB 3UYOD 5IMOB 2A6JB 4R90H 2PUQT 2J4WH 3CFCH 1QFHA 4MSWA 1KJ2L 3TWCH 43C9A 1EBAA 4OJFH 4ORGA 3TCLB 4JHAL 3AAZB 4MXWL 5FO7B 3AFLA 4LHQB 4ZPVA 5E9DE 4TSBH 1QHPA 5GSVA 3VXRB 1EEYB 2BNQB 2EEBA 4PRIE 5BJTA 1QSFE 3MFFB 5DJXB 5JR1H 3VWKD 4QTHB 1G7HB 1EJ6A 4M8VA 1PYWB 4H25B 4F7CB 4RBPK 4K3DL 3HNVH 1LP9B 1OT2A 1MCSA 5GJTL 1S7UB 1JWSA 5C0AB 5BOPA 3OGCA 3Q6GH 5J11C 3LKOA 5IJKC 4X7EC 3QUMB 3LKNB 1HHJB 1F42A 4KZDL 3S88H 3CH1B 2D0GA 1BQHA 1WBZB 4NNPH 3D85B 4K23L 2WBKA 4EOWH 2E7MA 1JZ5A 2DOCA 2XRAL 3WO4C 4OD2A 3P3YA 2CO6B 1NBVL 4J4PD 5A2JH 1WWCA 4ACPA 2IF7A 4UILL 3QIUC 4MHHG 5ELIA 3FONA 5JIHA 4PPTA 3PDOA 4LSRH 4Y2DB 4WUUA 1OHQA 3HG1E 1IT9L 1RK0B 5F96H 3BJLA 4ZQKA 1YDPA 4XNZB 1NJ9A 2IAMB 3SDAD 3TN0B 2XKNB 4MNGA 3MCKB 3MYJA 5L2JB 3I75B 4PYHA 3WXWH 5GGQL 3MMEA 1MELA 1IEHA 2HRPH 4WUKH 4ZS7H 3HAEG 5EUOA 2VITA 3U2SB 2IWGA 1ZANL 1NEZA 4Y5YC 1CE1L 1T2QH 3CAFA 4POUB 3T1FA 4DKFH 3QFDA 5IMOA 2A6JA 4X6CF 4Q97A 1WWBX 4U1HB 3EOBB 3WHE1 2W0LA 3ULVC 1I3RB 4JO1H 1KEMH 4ZO8A 4KJWC 4O4YH 2VR9A 3TCLA 3B9KC 3AAZA 5FO7A 2EYTB 2L7UA 4LRIA 3GBML 1N5AB 3AREB 4R96B 5I18H 3VXRA 2YA0A 1EEYA 2BNQA 5DJ6B 2VLRD 5F8RC 3MFFA 1ZT4B 5DJXA 3F58H 4QTHA 5K9JH 1G7HA 1PYWA 4QT5A 4D3CL 3SY0B 2VZVA 1IBGL 1LP9A 5GSRB 2C9AA 3CDFA 4OI9A 4EZMA 1V3MA 1XCQB 4JFEB 1S7UA 4LKXB 4LSQH 5C0AA 4RGNC 4KQ4L 2X89D 2YUWA 3TA3B 2HWZL 2W92A 3QUMA 1DN2A 1HHJA 3LKNA 2AXHA 4ZYKB 3WFDL 1FORL 3CH1A 1S9VA 1WBZA 5JIPA 4KK5C 3TJEH 3MLXL 1LE9B 3D85A 3QCVL 1FO0H 1KB9J 1K6QH 1KF9B 4BZ2H 4LP4A 3V4VH 3BAEH 1ZEAH 3ZDXF 2YRPA 3IVKB 4Y2DA 2DQUH 1RULH 5CHNB 5K59E 1RK0A 3HC4L 1PAMA 1A47A 3EJZD 5ID1B 1M1SA 4Y5XC 2IAMA 1D9KD 3RHWK 3TN0A 2LU7A 2XKNA 3MCKA 2VLLB 3O9WB 5E94B 5TQ2L 3BGAA 5L2JA 4IOFC 3I75A 4NRYB 1J8HE 2EH8H 1ZK9A 3DXAB 1EV2E 4EBQH 4UT7H 1GHFH 4MJIE 3U2SA 3RVXD 1BD2B 2A2QT 4L5FH 4HH8A 4OZGF 2Y7QB 5ALCH 1TJIL 4FQIL 4NNYB 5E24E 4U1HA 3EOBA 5GS1B 1E4JA 1I3RA 3CPLB 2Y07L 3QNZB 4LCWA 3U4AA 5D7LD 1LO4H 4DKDC 4R96A 3MCLL 1N5AA 1SM3L 3AREA 4NZUH 3GHBH 3UTZB 1MUJB 4X9BA 4UBDC 3LAFA 4U2ZA 5DJ6A 3EJJX 4J3XA 1ZT4A 5J0BA 4DAGL 4U3XA 1IC7H 3ARQA 2K1MA 3SY0A 3VFRA 3QZWB 2ZKHL 5GSRA 1GXEA 2NXZB 2KL6A 1XCQA 4JFEA 4LKXA 2YZ1A 4JG0H 1Z9MA 2BNRD 1DBKH 5CMAB 4FFWC 3VFVB 3VI4F 1LD9B 2OTUB 1HZHH 3TA3A 3WXVH 1TNNA 3H3KA 4HG4J 1WTLA 4ZYKA 4NHCL 1G9MH 1XGUB 3JVGC 4X6DB 2FBJH 5HHMB 3SDXF 4R7DB 1MCRA 3LS4L 1LE9A 2J5LB 4G6FB 2VDKH 5GISL 3RI5K 1XIWD 3BXNB 3E6HB 4RBPH 1HIMH 1T80A 4TSAH 1KELH 2OK0H 4PJ5E 3TC9A 4X99B 5T3ZE 1JIBA 1QFUL 4G7YH 2BJMH 2HVJB 1WAAA 2CIKB 3IVKA 3WMSA 4JPKL 4NFBA 4OCXL 3TYFB 3ARWA 1NCWL 5ID1A 4IRZL 4FMKA 4F15C 3I6LD 1ZOXA 3LQAL 1RMFH 2C3HA 5GRUL 4F7TB 3OKOB 1QNZL 2VLLA 3O6MH 5L6YH 5I17B 3O9WA 5E94A 3LQAC 4M6NH 1H9VA 4NRYA 3K8KA 3VFGL 2YPVH 2WP3O 3DXAA 3L9RB 4LL9A 2FGWL 2VR4A 4X7TB 1BQHG 1N5YL 2RIKA 1BD2A 3WL9A 4X7FC 1H3WM 2Y7QA 4OCYL 3GIZH 1T20B 4NWTH 4OCMC 4P4RB 5HBBA 3LEYL 2A9MH 4NNYA 4K7FB 5E2VL 4MZ3A 5GS1A 3CPLA 3GMNB 2VLRE 2APTA 3QNZA 4TTDD 3KNBB 4XXCC 2UVFA 4XP6L 1MFNA 3VG9C 1IGIL 3JTSB 3UTZA 1MUJA 1V05A 2A74B 5CJBA 4FG6D 3MLSL 4X4ZA 4K3EH 4AEEA 3GI9L 2F8OA 4JGUA 5E2UH 4Y1AE 3IDXH 3S9DB 5BS0B 1EX0A 3GFUA 4PY7B 4XPFL 3VW3H 3QZWA 1GGUA 4OQTA 2VZSA 3UJIH 3QHFL 5CMAA 5JHLL 3VFVA 3BZEB 5HYEA 2X2YA 3QNXB 1SQ2N 1LD9A 2MFNA 3AGVA 4KDTA 1WVZA 4AEHL 1NEZG 7FABH 2F74B 3C8KB 1J18A 1UA6H 1L6ZA 1L7IL 2R29H 4LVOB 1XGUA 4X6DA 4R7DA 5ECJE 3O2DL 2JJTA 4MD4B 4U1MA 4XVUD 5TDNB 1MCWW 2EE3A 3BXNA 1NDMB 3E6HA 2R15A 3UPAA 4S1SL 1PLGL 5KVGL 1E6JL 3DIFB 2HVJA 1YEKL 2IPTL 2CIKA 3CFJB 3GSNL 4NKIH 1ZKAA 5JUEL 3OX8B 1MCFA 3TYFA 4HZAA 4TOYH 1MFAH 2QLVB 2X4PB 2QADD 5F6IB 3BT2L 1MRFL 3MNWB 3TPKA 4Y4FC 4F7TA 3OKOA 3MLTB 5I17A 3QUXC 4S1DC 3QO1B 4FTVB 4WHDA 4HC1H 3R8QA 4NNXB 4HWBH 2OTWB 3VGFA 2WIMA 3L9RA 3K8LA 4RMWA 4X7TA 3WS3A 5J6HA 2YBRB 3QWRD 1XF1A 2GJ6D 1T20A 1U2HA 4RX4A 2R2CA 4P4RA 1DQTA 2VXSH 3GM0A 4K7FA 3ARFC 3GMNA 3C5SB 3T4YB 3KNBA 4KY1L 4QNPF 4JO3H 4MDJB 3JTSA 3QXAB 4XCFL 1YNKH 3QG6B 3UZEA 3OPZH 3EUUA 4P9HL 2NZIA 3S4SB 4KWUA 5BS0A 4PY7A 4P9HC 3H0TB 2X70B 1PD6A 1W72H 3BE1L 1KBGL 1VKXB 4KHXL 2AEIT 3BZEA 3QNXA 1E4XI 2ESVD 2YEZB 2I9TA 4FP8H 4X83A 1KCVH 2F74A 5DT1H 3C8KA 3SDYL 1GSMA 5EC1B 1KFAL 3C6SB 5GGUB 2APXA 2BNUB 2ZUQB 3NCYP 4MD4A 1OSPH 3U4BH 5TDNA 1NDMA 1EHLH 4QYOB 1JK8B 3LRHA 1FC1A 5F9WC 3DIFA 1MRCH 1T0MB 3EYSH 1UEMA 3CFJA 3QEQB 4KQ3L 4L9LB 3OX8A 4N68A 5GGVY 4HXAH 1QBAA 2X4PA 1ORSB 3LB6D 5E56A 3NA9L 4I1NB 1CGXA 4F37F 4PJ8C 3MNWA 3SOBL 1NCCL 3RDTC 3MLTA 5FO8A 4YXLL 3HTLX 4WTXA 3RVTD 3S37L 3QO1A 4FTVA 4I4WB 5HTSA 1KB5H 2CSPA 4NNXA 5E8DL 3NZHL 1BQSA 1WGOA 2OTWA 3GIVB 4DVRH 2HKFL 3HE6C 2J88L 2YBRA 5H2BB 3GMRB 2F19H 1S7VB 4EI5B 1CF8L 3L3IB 3MGTB 5KANI 3C6LC 5DDHB 1WFOA 4C57C 2NLJB 5T3ZL 5EBMB 2R69L 4PP1C 1AO7E 1CDBA 3C5SA 3T4YA 1N7MH 4MDJA 3C60D 1IAII 1O7VA 2BRQA 4GT7A 3QXAA 5DMGD 4EDXB 3QQ9D 3G9VA 3QG6A 4GG8B 4K94H 1E27B 1I8LC 3BP4B 3P30H 2X10A 4OCSL 4XI5C 5EU4B 1JYNA 3O6KH 4BKLB 2D7MA 1DEDA 3H0TA 1CFVH 2X70A 1CDHA 4XVJH 1MFEL 3PE9A 1VKXA 4HGMA 2UUDK 4OZ4B 4YHYC 3P4LA 2YN5A 2P8MB 5IWLC 3RTQC 3KPNB 1RVFL 3QIWC 1MI5E 4DW2H 2YEZA 5EOCJ 2DQGL 4LHUB 4YHPB 3NGBB 3OB8A 3NIFF 5EC1A 3LRSB 1C1EL 2CJUL 3C6SA 5GGUA 1DBBL 2BNUA 2Z9TA 3PG2A 3DMMB 1NLBH 2DLFH 4QYOA 1ADQH 1U8HB 1JK8A 5IEKA 1U8PB 5E2WH 5B8CB 1D7FA 3G6JF 1E6OL 3O8XC 4D9RD 1T0MA 3KYMB 1FBIH 3Q1SH 3QEQA 4L9LA 4PUBH 4WO4C 3GSUB 1MCEA 3GBNL 4OLXH 3FB8B 3EIFA 5HHXH 1JZ4A 1ORSA 2CKBB 4HS8L 2F53B 3RX5A 3VXSD 4P57B 1GPOL 1MJUL 3PGFH 2B0SH 5HDQL 3D39B 4UIMB 4GBXD 1FL6B 4I4WA 4TQEH 1F5WA 3PQYD 3CVHL 1F11B 1PEWA 3GIVA 3SJVB 3ARGB 3NFPB 2X1OA 2EO1A 3QP3A 4U1JB 2X4QB 4ZUWB 5H2BA 5HPMB 4AIZB 3TJHC 3GMRA 1DSFH 1S7VA 4EI5A 2ID5A 3L3IA 4EDWH 3H42L 3MGTA 3U0WL 5DDHA 5B4MD 3RWCB 4WRLA 4MWFB 2NLJA 5EBMA 3K46A 3TO4C 3KAAA 4NN7B 2NY6D 3VFSB 1V7NH 3MJ6A 2E6QA 5D1ZA 4EDXA 1P2CB 5F1IB 4GG8A 4ZFOL 1E27A 1BWWA 5JLZB 3D3VB 3BP4A 4FXGB 2A0LD 3LCYA 4WW1A 2ESVE 1OGAD 3U83A 5EU4A 4BKLA 1YN6B 3OGOE 3N1MC 2J8UE 1A7BA 4OZ4A 3NFSH 1CK0H 2P8MA 3I3DA 4LLVB 5FYLL 1FV1B 3KPNA 5DUPL 1A6ZB 2G2RB 5D72L 4P5TD 3ZE2F 4LHUA 4YHPA 1LVEA 3RX7A 1DLHB 3QXVA 2PYED 2NY5H 2D7OA 2DQTH 3LRSA 2J6EA 1IAIM 4M03A 4NT6B 2KZ1B 4G8GD 3DMMA 5DHVB 3HZMB 5CSGA 2PTVA 1U8HA 1VESA 3VGAC 1U8PA 5B8CA 3IAQA 3VI3E 3KYMA 5EFIB 3ARBB 1TFHA 2VWEE 3FB8A 4Q0XH 4RISL 2CKBA 1QRKA 2F53A 4N0UE 4P57A 4WI3A 3G5VB 2YD5A 5J3HC 5ADOH 1P4BL 2C4FU 2W0KA 3D39A 4S0SD 1M05B 4UIMA 4GXUM 1FL6A 1UCBL 3LN4B 4XP4H 3O2WH 1KEGH 2X4TB 1F11A 3SJVA 1OAXL 3PWUA 3ARGA 3NFPA 1U0QA 3DGCR 1CIDA 4MD0B 2UV3A 5IVXF 1ZXQA 2RQ8A 4U1JA 2GEEA 2X4QA 4ZUWA 5HPMA 4AIZA 2ARJQ 2MTPA 3BN9C 4OLZL 3LDBC 2ORBL 4I9WD 3LMJL 3RWCA 3L95B 4MWFA 3ES6A 1MSPA 4QXUH 3Q48A 3BGFC 1QZ1A 3VFSA 4N0YL 1U42A 3LPFA 5I30H 4CVXB 2FJGB 1V7ML 1P2CA 5F1IA 1P84K 5JLZA 3D3VA 1QP1A 4FXGA 3R06B 2ICWJ 1CD0A 5E6IC 2DS4A 1C5CL 1RIVH 1YN6A 4U3CA 4NQTA 3S36L 1CTOA 5TE7L 4PGZA 4LLVA 1K8IB 1FV1A 1HWHB 2FLBT 1A6ZA 2EDQA 5C07D 2R1XB 2G2RA 5IKCA 1KN4H 1N4XH 3QUYA 4NM4L 1RHHB 4IS6B 2XIDA 4NT6A 4D9RE 3DTXB 4B7LA 2IG2L 1DJSA 1DR9A 1J11A 5DHVA 4DQOL 1PVHA 3STZB 4XCYB 4Y16C 5JOPD 2X41A 3MOAL 2UUDH 3D9AH 3QDMA 5I19L 5L9DH 2PCPB 1MF2L 4XPHL 5T5FL 5EFIA 3ARBA 3OKKB 4PJ7F 3S4SG 4OZHF 4HWEH 1EZVX 1RZJH 5HHPB 5GS0D 3MLUH 1YJDH 1KIRB 3G5VA 1NCAL 4M7KH 5I1KH 1AY1L 3K2UH 1M05A 3H3PH 1C7TA 2Y72A 2MCPL 4KH2A 2DQCL 3LN4A 4TNWK 5EORL 4JPVH 3NPSB 3QRGL 3MC0A 2IBZX 3MR9B 1J1XH 5DJ8B 4OGZA 1NGXB 4Z95H 4MD0A 3H7BA 4DJMA 3C9NA 3KYOB 2VXUH 5HVHC 1Q8MA 2E7LC 2NY0C 4M5YH 3JWOH 5SWSD 1G9NL 2WBJD 43CAB 3L95A 3OBAA 2HYMA 3MA9H 4CL7A 4M7JL 1G9NC 1JYWA 2QR0B 2AI0H 1CICC 3SKUD 5ACLA 4CVXA 1N0XH 1YECH 2FJGA 2ZUWA 3GK8L 5SX4H 5CEZH 3WNMA 1A14L 3WDJA 4XBPB 1JGDB 4EXPX 3BPNC 2FYYB 3R06A 3FT4B 4OQTH 1IAKB 4QTIH 1A5FH 5D96B 3SQOL 3CDCA 2ZNXA 4U1GC 5LGHH 3REVB 4JZJB 3QFJB 1CZ8L 1T2JA 4JPIB 2DWEB 4GJTB 5I1JL 1K8IA 2Q3AA 3FMGH 5BRZB 2R1XA 4G8GE 2J12B 1OP3K 3QEUB 3R1GL 4JM2B 1G84A 1RHHA 4MS8D 4P59L 4X6FB 1FSKB 3V4UL 3SGDH 4IS6A 1JZ2A 2VYRE 1QSED 1EERB 4G5ZL 4PJCE 4UQ2B 2BHYA 4U33A 2DQIH 3DTXA 1OTUC 3QUZB 4PD4J 1NGQL 2WWKT 4KVCH 1OAUH 4XBGA 3STZA 4XCYA 4YHOH 5J7CC 1DVFC 1ODAA 1QEWB 2PCPA 5B3NA 1NFDE 4WNQB 5E99L 3OKKA 2DQJH 3CNKA 3RNKB 1VCAA 3S8WA 5F7EH 3U7WH 4UBDD 2M2DA 5HHPA 2ADJB 5KAQG 5KZCB 4YHKH 1KIRA 4PRPD 4JGJA 3DVNB 3FQRB 3VWJC 2BX5A 1JPTH 2FX7H 1QFOA 1U3HC 2PW2B 4LHUG 3MR9A 4NOBA 3H9YA 5DJ8A 4HK3N 1X3DA 1LO3L 5C08D 5CZVH 1WLHA 1NGXA 3TESA 3KYOA 4FQJH 4OIIL 2OI9B 1KJ3H 4U6YA 3ZTNL 5DEFB 4KV5F 2BSSB 1VGEH 3RWGB 43CAA 1BBDH 4NQCB 2DYPB 2QR0A 3PNWB 4G80B 3TYGH 2ARJB 5J12B 5I1EL 1YMMB 4O2FB 3RHWF 1KC5L 2EDRA 4JPWH 1SYVB 4XBPA 1JGDA 4LRNL 2Z8RA 1HK6A 3QULB 3SGKA 2FYYA 3FT4A 1IAKA 4GSDH 2X9WA 2ZG2A 5C07E 4I48B 3BISA 3MQIA 4MAUL 3REVA 4JZJA 3QFJA 4GMSH 2EDDA 3LD8C 5IOPB 4JPIA 2DWEA 3LKPB 1MCPH 4J3WA 5IFJB 1YQVL 3FQWB 4P0DA 3RKDD 4XBEH 4MQXC 5BRZA 2X05A 1NUDA 4I3GA 2DBLL 4I0PB 4P23B 4D8PB 3QEUA 4UNUA 3HN3A 4JM2A 1JPST 4V1DE 4X6FA 1I9RL 3MX0A 5JOPE 4LQFL 4UQ2A 2D4FA 5C2BL 3QUZA 3DO3A 4HIXL 1PG7L 4R8WL 4HF5H 2I07B 2X4UB 1U92B 1PGRB 1QEWA 4PJAA 4XH2B 4WNQA 1T03L 2BVYA 1T7WA 3RNKA 4PJIF 1GGYA 1TZHA 2ADJA 5F1NB 4R90L 3B2UC 4HEME 4J6RH 2J4WL 3HUJF 3CFCL 3CX2A 4EI6B 3DVNA 3FQRA 3UTSB 5BV7L 3TWCL 5M7QA 5C0CD 5BV7C 2PW2A 5DMYA 5C0BD 3FO9B 2VSCA 5GZOD 4TSBL 4HWUA 3FQNB 3BZDA 5JR1L 5DEFA 3WNKA 4YEEA 1QBMH 5TDOB 2NXYC 5FYJD 2BSSA 2QHRH 3RWGA 4GRLB 4NQCA 2DYPA 2HTLD 1DBAH 3E6FB 3PNWA 2FB4H 4G80A 2ARJA 2HT4C 1DUYB 4PTTB 3SCMB 5IBUG 2MJWA 4O2FA 4XCNB 1SYVA 5E5MB 3QULA