3EOYG

Structure of reovirus sigma1 in complex with its receptor junctional adhesion molecule-a
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
102
Chain Sequence
SVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTTRLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/cell adhesion
molecule keywords Outer capsid protein sigma-1
publication title Structure of reovirus sigma1 in complex with its receptor junctional adhesion molecule-A
pubmed doi rcsb
source organism Reovirus
total genus 19
structure length 102
sequence length 102
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eoyG00
4PYHA 2QEJA 1AHWB 3CZFA 4IMKC 5DF0A 3ARGD 2D4DA 3QUZC 1NEZG 3BUTA 3LEVL 2BVTA 1BAFL 3O3BA 1TDQA 2EIZA 4GAYB 4HBQA 4Z78A 5F97E 1WEJL 3GSQB 3MRBA 2PR4H 2E9WA 1BMGA 1WLHA 2ED9A 4G6JH 4RISH 4DAGL 4CMMB 5FA4B 4U1KB 2YBRA 4U7MA 1U91A 3HLAA 2JJSA 1T20B 2Z91B 1G7HA 1RMFL 2XZAH 4LSSL 3ZT6A 1MRFH 4JCMA 1KT2A 1W8OA 4DZBB 5ACZB 3K74B 1S3KH 5DD0L 1UJTA 3RPIB 1D5MB 1T4KA 3VE0A 5EORL 1INDL 2P8LA 2P48B 3EJZC 5TQ0H 1F2XK 3D3VB 1GGIH 1U95A 3NIDF 4GAFB 4JHZA 2NTFB 3CSGA 1S7RB 4HDIB 1BVZA 2NCMA 1C08A 3HR5B 1WF5A 4P9MH 1QLFA 3F58H 5DJXB 4M02A 4QRUB 5FB8B 4MNHB 3C60D 3IU3A 5DZLA 1JYVA 4XCNA 5I76B 5F1KC 1I75A 2P8PB 4PJFF 3TBSA 3MLWH 4HBCL 4Y4KB 5JORA 2R0ZL 2YC1A 1UXWA 3M45A 5JW4Q 5FDWB 5GS0H 3VXSD 4J3XA 2P5WA 3IDXH 4YNYA 5JXEA 3ESUF 2P5EE 4LNRB 5FM8A 5I6XC 3A6BL 5GGTH 3KYKH 5GPRA 4QNPF 3BSZL 1NC4B 5BRZD 2WWMC 1MLCB 1LO0H 4RMTA 1I1YB 5I2IB 5EU6E 5IBUG 1HEZB 1NFDE 4D9RE 3LS4H 1F3JB 4HJJH 1WZ1L 3BX7C 1JFQL 3EZJB 3WL9B 5MEOB 2R4SL 2IAMD 2OP4L 4N1EA 4P2OA 1S5IH 1YYML 4OV5A 4W6WB 3SO3B 1NDGA 2JKXA 1UWEL 3AU1A 3MA9H 2OL3B 3S37X 4JG0L 3LV3B 3V2AR 1MCQA 4LEOA 4P4RA 3WNMA 1EAPA 1JUFB 3ECBA 3RGVD 2ADFH 4OIIH 4YDJA 4U2YA 5M94B 4UTBH 4U1SB 2XQBL 5B38G 3P4MB 3OKLB 3R0MA 4X6DA 5DT1H 2Y5EA 5H94A 2VDNL 4NJ9H 1QLEH 3TV3L 1PSKH 1WK0A 2DAVA 3LRSA 2DI8A 4LDOB 25C8H 2XKNA 3CLEL 3SE8L 1KFAH 5EC1B 3F7PC 5FHBH 1PGRB 1W0WA 3ARDB 2W0FA 4CN6A 3O6MH 4MXQC 4NCC2 5ID0B 4EN3B 1I7ZA 2M26A 1G6RH 4GXVL 3HZVA 3BN9D 2CKBB 4DN3H 4YHYC 4OLWL 4ZSOA 5FF6B 3CX2A 4PRPA 3ARGC 4TVPH 4HCRH 1A6TA 1CI5A 4YH6A 2X4TA 2XKUA 3AM8C 4XCEA 3IDGA 1DLHB 4XWGH 1U6AL 3CFCH 2BMKB 1FO0A 4G80A 4OZFG 3CK0L 3EOTL 3MOBL 3TLRA 5E8EA 3SDDB 3BGFB 5C08E 1ZS8B 3BE1L 3BYYA 4OT1L 4NNYA 4M9PA 1FFRA 2JF1A 5EC2A 4JDVB 5I66B 5JW3H 2EE3A 3GI9H 3ZE0F 3CC5B 4FFZL 2XA8H 3O2VH 2DTMH 5DD6B 1T3FB 4KMQA 3W2DH 5CEXA 2F5AH 2JB5H 4LFHD 4PY8I 2GK0B 2EXYC 4IS6A 4AK1A 4PD4K 1Q0YL 4EBQL 1OSPH 3MV7B 2FDBP 5DR5H 1GOGA 4D0BB 3NIGF 4ZTOH 1CCZA 1INQB 1XCQB 3MLZH 1MCPH 4KU1A 4WI4A 1RPQA 1BZ7B 4XGZA 2AEPH 1I7UB 5ADOL 3KPQB 2Q7NA 3IXAA 4PGEA 3UPCA 3MRGA 5BVPH 3TO4A 1CDBA 4JM2B 1WZMA 3U6RB 4FTVA 4KRLB 4DGYH 1AQKL 3GMLA 2XG5A 2P5WD 1J11A 4HUXB 5JXED 1OTUD 2IMNA 1F11A 4JANA 2BY2A 4HXAH 1NCCL 3SGEI 5FYJH 1OD7A 3JTSA 4AIOA 4HC1H 3MXWH 4D9LH 3ULUD 4LEXL 3V6OC 2AXFB 1H3UA 2VC2L 4UDTB 4OTXL 5HHMD 1K4DB 5F7LB 5GGVL 4BQ8A 2YOCA 4N0UB 3MJGX 4ZTPL 1QLRA 2IAMC 4HWZA 1MHPH 4MX7B 4OKVB 2YA0A 1NAKH 2NY5C 3FO1B 4P2OD 1DVFA 3DV4B 2NW3B 1UZ8A 1U8QA 5BO1L 2GFBB 3V7AE 2DQGH 3MRRA 3KWWB 1ROWA 5JW4N 2X9WA 1DZBA 4PLJC 4E41A 3C09C 1IQDB 3SGDH 3EOAB 5KSBB 4Z0BL 2FJFB 5E1AA 1DQDH 2E8YA 3BP6A 4QY8A 5JDJA 3O3DB 1TVBB 3VXOB 4NWUL 3BN9C 1EO7A 2JTDA 4R26H 3GIVB 4G8FB 3FN9A 1CFSA 5F9JB 2VN7A 1K4CB 3VFRA 1S9VB 4PRPD 1NQBA 5I30L 1XZ0B 3G04A 4LCUB 2JCCB 1U2HA 3PL6C 3V0VA 3OKMB 1N8ZB 1MJUL 1WFNA 3DXAA 3D18A 1FN4A 2FD6H 2XTLA 1D5IH 3IDYB 1YEGL 1T1XB 1MIML 4FQQB 4JDZB 1ZLVH 5CGYD 2C7UB 3C2AL 3DVGA 2JJSC 1HNFA 1IGMH 2WLYA 3D69A 3MA7A 3V6FA 5C1MB 5D72H 2V2XA 5EZJA 3MUHL 4U1LA 4XPTH 2HJLA 5D8JH 5HY9A 4YHYB 3LAFA 1UM4H 1N6VA 5AZEL 3U4EB 2BZDA 1EIBA 4OIAA 5E2TL 3BP7A 5CUSL 2NW2A 3SJVB 1EERB 3JXAA 3PP4L 5EIIA 1KSRA 4LVOC 3SKJL 5A16A 2FZ3B 2LVEA 3UCRA 3W11D 1YEFH 2VE6A 5GGVY 5K93A 5EO0A 3BW9A 1UC6A 5C07E 5I1IL 1GC1H 3NZ8B 3TO4D 5DJ8A 3CFBB 3PP3H 1NFKA 3MRNA 2X42A 3WXVL 5IOPA 1NJ9B 4KVNL 2DQFA 4FTVD 3UTSE 1OTUC 1ZHKB 4PRHE 1BZ9B 4QO1A 4I13B 4WGWB 2LFGA 3UTZB 3GM0A 4YHIA 3MV8A 4KVCH 1MEXL 3PHQA 3P77B 3ULUC 2ZUXA 1FORL 3RNQB 3WKNA 4Y4FC 4MNGA 4WFHD 4F7TA 5IM7B 4BZ1H 1UQSB 3EDEA 1XGYH 3NIFE 1ZV5A 2R2BA 4DKEH 3MNWB 4G3YL 3VWJA 3V4UH 3MGOA 1FPTL 2UYLB 3NCJH 4UV4H 3GMPA 3V0WH 1R0AH 4OM1L 4XP5H 4HIJA 3MGTB 4P2OC 4LPYA 5TFSL 3QUYA 4KZDH 1IQWL 3GFUA 3DX8B 4R9HA 3TWCL 3C60B 2X41A 1DVFD 3RIFK 2QHRL 3GSNL 3O9WA 4KUZL 4U6YB 2NLJB 5DJ6B 3TYFB 4NO5B 3Q1SH 1KJ2L 5GSVA 3VMPA 4YZFF 3T09A 4I18B 4DEPB 3WNNA 2DQIL 5HDLA 3L6FB 3X3FL 3VXSB 1F4YL 3BZ4A 1RU9H 4E41D 4GXUM 4ETQA 4GKNA 4Q58C 4N9GB 2OMNA 1JGDB 1ONQB 1PY4A 1RZGB 4J6RH 1LK2A 1QSEE 4HXBL 4Q2ZA 4NQEE 2Y7QA 4GG6B 2NX5A 1KJ3L 1XH3B 3PWLA 4YXHL 4BK5A 1Y6KR 4K7PL 2E6QA 4MCYA 3X17A 3MJ9H 2IAMB 1U3ZA 3KYAA 2WUBL 4LSTL 2Z9TA 4ZPTA 3TNMB 4OB5L 1CS6A 2D03H 4PLOB 4CVXA 5GRVL 4PUBH 1LO4L 4K3EL 4NRZA 3UYRL 1SY6L 1XAUA 2VITB 5I71C 1HXYA 2VLME 3DXAD 3VGBA 1V7NL 3RGVB 2VLLB 4Z5RB 3LKOB 4LLYB 1MI5E 5JO5B 2BSSB 1UXSA 4WW1B 5I1HH 3D9AH 4CU6A 4CMHB 2XXCB 2G60H 5J1SC 2WM0A 5B38A 2FHBA 4L8CB 1FZOB 1EHAA 1P4BL 3HC3H 5CMAA 4ZNEA 1IKFH 1D5ZA 5J11C 5E8OB 1OHQA 4NCC1 1N6UA 1BLNB 4ONGH 1CXIA 5L8JB 4QT5B 4XBEH 1KYOK 2CUIA 2G5RA 3QWOA 4PJIE 3CXHJ 4JM2F 3N1QC 3QXDB 5HHOE 1X4ZA 1FBIL 1R3JB 2HLAA 4JGUA 3MJ6A 2MQ3A 1A6VH 3CZFB 2CUMA 5HVHB 1DN0A 3TH3T 4JGMA 4KY1L 5ERWA 3O3BB 2L7JA 1WBYB 2EC9U 3UMTA 3W11C 4Z78B 1ZT7A 5DEFA 1JPSL 5KVMC 4OZFA 5EULV 3MRBB 1DQJB 3X11A 2EKJA 3ISWA 5EBGA 3GSVA 3TO4C 1NBVL 2YBRB 1U91B 3HLAB 1ZANH 1G7HB 1CU4L 3ALWA 5IESH 2QSQA 4FABL 4JO1H 4WFFE 5F1NA 1T7WA 4UQ3A 2NY2C 4C4KT 2B4CH 5CJQL 2A77H 1L7IH 1FC2D 2YSSA 3W81A 3DIFB 4UTAL 4XMPH 4PJ7E 3S34H 2P8LB 1NGXA 2WMPA 1FYHB 5EZOH 4B5EA 3MV8D 1OAUH 2I5YH 3AS3A 3K8KA 4GMSL 1RFDL 4E42A 1U95B 5F7DA 5KSBF 1A6AA 3WUWG 1BEYH 3B83A 2AI0H 4LKCA 1C08B 3VWJD 5F96H 3RL1A 5DFWH 3WHE0 5FCSH 2DWEA 2VZ1A 2J5LC 5BZDA 1DVFC 1FFOA 1NCNA 3QUYD 1E27B 3MRPB 4EDWH 1WIPA 3IU3B 1I3VA 4RA3A 4XCNB 3O9WD 1AKJB 3TBSB 3QNYB 4HH8A 4WDIA 1MVFA 2O93L 1OTTD 4UB0L 4NZJA 2Z4QA 5JORB 1J1OL 2YC1B 5IVXE 2R23A 2JCCF 3N85L 4N8CH 4NPYA 2OYPA 1UKTA 5IB5A 3QDMA 1NAMB 2D9QB 3BESR 3CDYA 1K85A 2MHAA 1RZFH 4I2XA 3VFWA 2B1HH 3DYPA 4IOFD 2J12B 1T22A 2NX5D 5HHMB 5CSZB 3HNSH 2CDFB 2F54E 3RKDC 3MOAL 3EHBC 4M4RA 4KK9C 2VL5A 3PWVA 3M17B 3RVUC 4P2OB 4OV5B 3HMXL 3R8QA 1N0LA 4NKMA 5H37H 4Z9KB 3QEUA 2IC2A 4P4RB 3ECBB 3S98A 3GEWB 9CGTA 1T0PB 1JZ6A 2OI9C 3TCLA 2YA1A 5EOQL 5HI4C 3M1BA 2Z93A 5EA0L 5F8QC 4L9LA 3IFNL 4JFDA 5H94B 3KAAA 1AIFA 4UBDD 3LRSB 1VCAA 2EYSA 1NPUA 4C4KO 2H1PH 1W0WB 4XVUD 1T89A 3SDXE 4NGHL 2W0FB 3U1SL 2ZUSA 5EBMA 1O7SA 1T6WA 1I7ZB 3BDBA 4FNLL 1OPGH 1CFTB 4M48L 5KSUB 3HZVB 3ILQD 3INUL 4HKJA 1VGEH 1G9NL 4PRPB 3F6LA 1A6TB 5KW9L 2X4TB 1T7YA 3ILPB 1A7RH 4NQXA 3ULVL 4XCEB 1IC4H 1BX2A 3IDGB 1I3GH 4TTGA 5FGCE 5HHNB 4KH2A 5L6YH 3FO9A 1FO0B 5EU4A 5FHAL 3NABL 4G80B 1MCEA 2ED7A 1NC2B 2FIRT 4N0RA 5HSFA 4TTDD 3HZMA 5LCVH 4K23H 4JZJC 2DF3A 4NNYB 3MYJB 4POZC 3VCLB 3V79C 1UM5H 4NRYA 3G5YA 4PIRF 3I3DA 2BNUB 3PGFH 4U1MA 3VD5A 3GUTA 1IC1A 1JF1A 2E9JA 5FO8A 5SWZA 2V5SA 4WI6A 3C6LA 4IS6B 5T3ZL 1YEJH 5KAQG 4XPHH 5C0BA 3S35L 2MNUA 3QSKB 3QDHA 4YFLI 3NN8A 5IHBA 1JJUA 5JR1L 3LQMA 4WJ5B 4QXGH 2AXGA 5LQBH 2WIIB 3EYFA 3QFJE 3ARTA 3VWJC 1LEGA 2COQA 2WWKT 4UOW1 2BSED 5I8KH 3QUYC 4O5LH 1MCOH 2O5ZH 1BIIB 3ZTNH 4JZNB 3WIHA 3WYRA 3L3JA 5IW3A 4GG6F 1PG7X 2B20A 3IXAB 3O9WC 1OAZH 3GMRB 2BJML 4PGEB 5KVFH 1DBKH 3TO4B 1OSZA 5IHUL 3B5HA 5HI3D 4IBLT 1BBDH 4FQCL 4M8VA 5EG6C 2R8SL 5T1DH 5IG7A 4FTVB 3LRHA 3O11A 4KWUA 3GMLB 2FO1A 1IGIH 1MJ7L 3BI9X 1M71A 3O45B 3QULA 1F11B 2HFEA 4JANB 1CT8A 5TE4H 3QDMD 5D2LE 1ZMYA 4RX4A 3RJQB 2XACC 1IKNA 1OW0A 2PR4L 3RWJA 4IOFC 3TN0A 2R9HC 3TA3B 4RISL 2HJFA 1ZVYA 3DI2B 3FB7A 2ICWA 4QOKE 2F53E 3U36A 2Z31A 3MACL 1KPVA 4PD4J 2E6PA 4HWZB 3VGHA 1MRFL 1NANI 1OT1A 1T0NA 1LQSR 2IPKA 4HJGA 1S3KL 4XB7A 2L7UA 4GFTB 1UZ8B 3L3IA 2YD2A 4O51A 1U8QB 5IFHH 2RAMA 3V5KA 4DQOH 3HE6B 4JZOA 5HI5D 2OK0H 3MRRB 4OGAD 2PNDA 1GGIL 1T7ZA 2MKWA 1I9RH 4BQCA 4E41B 3WFCH 4KUCD 4UBDC 1WSST 4JFDD 4O2EA 3S4SG 2DLGA 3F58L 5C0GA 1OVZA 1V3MA 4ZO8A 4K3JH 3WLBA 2IH3A 3BP6B 2XZQH 3MLWL 1E28A 5KBNC 1AR2A 2V7NA 3IDJA 3BVNB 1CFSB 4PG2A 3VFRB 5GS0L 5E99L 1B0RB 3G04B 3MJ7B 3IDXL 4NOBA 5TF1H 3GJFH 2WWKO 3KLAA 3V0VB 3D39E 3DXAB 3D18B 1TXKA 3KYKL 4PJBA 4QHKJ 4TTDC 2VO5A 2J8UA 2XA3A 5H2BB 3WJLA 2IPTH 1JYXA 2EE9A 2XTJB 4S1SH 5CBAA 3LS4L 3DVGB 4HJJL 5EOCJ 4V2BA 3MA7B 3V6FB 2PF6A 3AS0A 4H0HB 1S5IL 2V2XB 4U1LB 5SWZD 1IFHH 3MA9L 2FEDD 1IEAA 3C6LD 3BWUC 4GJTB 3BGAA 5MI0B 5DK2A 5IGXH 4TRPL 1L6XA 5C0BD 1J0KA 2ADFL 4OIIL 3QDGB 1RULL 5HY9B 4UTBL 2ESVA 3B6SA 2OZ4H 5IUSA 5IJKA 3E6FB 3H6JA 3BP7B 1CYGA 1ZHLA 4HUKB 4X6EA 4MB3A 1XGRB 2NW2B 1EEUA 5DT1L 3QI9A 2HT3C 4NJ9L 1QLEL 5C0IA 1PSKL 4ODXA 3TBTA 2NYYC 4ODSL 2XWTB 3ULUF 1ADQA 5FHBL 3UBXA 5J12C 2KKQA 2VE6B 1IGJA 5KJRH 3ZL4H 1MJJB 2HT2D 5HI3C 2YZ8A 4O4YH 1G6RL 5DJ8B 5ITFA 4DN3L 5DRXA 4MS8C 3W0WA 5IMMA 1INEH 1MCFA 4EXKA 3LN4A 1CTNA 1WCBB 5A2IH 4Z7UA 3RWIA 4I4WB 2Q3ZA 3DMMB 2BNQA 4ELMF 3N0PB 4PLKD 4LGPB 5IB4A 4XNYH 3CFCL 3BKJH 5F9WC 4YHIB 1MCBA 3OKYA 4RX4D 3U2SA 3PHQB 1VEOA 1P7HL 2DLFH 4UNTA 4OI7A 3EFFA 4F7TB 4WW2A 4OQTA 3TN0D 1S7WA 2OS7A 4X7FC 3WUWA 2V2WA 2Z31D 3GMNA 3VWJB 5BJTA 4S2SB 5JW3L 3GI9L 2XICA 2XA8L 3O2VL 1S7XB 4RAHA 1EO8H 4HIJB 4U2ZA 3W2DL 4Y2OA 2JB5L 4G9FE 4ODTL 3F8UB 4ODWA 3VXPA 1KIQB 3PQYA 2XQYK 4MD4A 1GRWA 4JY5H 5F6HJ 1OSPL 3FQWA 4NBYB 3HUJE 5HI5C 5DR5L 2VUOA 5IBLD 3BZ4B 4FQPA 2X9YA 5LGHH 1MQ8A 3AREB 4GKNB 1JWUB 4XXCA 4HG4K 1TJGH 4C56E 3O6FD 1IC5H 3CX5K 4OD1H 3VI4E 1B88A 1EGJA 3MLZL 4Y19E 2NY5H 4D3CH 1UWGH 2X1QA 5CEZD 5KN5A 4P2QA 1Y6NR 5F88A 2Y7QB 4JPVH 1GGYA 5BVPL 3OJVC 5T33H 5JZ7D 1FGVH 4MCYB 1NGQH 3T65B 2BHUA 4ZPTB 3TT3H 2A6IB 4NRZB 2W60A 2VAAA 4HXAL 4H5SA 4RQQA 1EX0A 3FQNA 5CD3A 3HHRB 2LQRA 4U3XA 1KV3A 5FYJL 1MOEA 1B6UA 2J7LA 4YHPA 1B2WH 4HC1L 1UXSB 3DO3A 3MXWL 4D9LL 5E5MA 1F6FB 1FZJB 2DL2A 1H5BB 5B38B 1FNSH 4MNQE 5DD1H 3KPMA 5E00A 2PCPA 4FQHA 3MRDA 1MHPL 3VG0H 3AXLA 2GTZA 1NAKL 4ERSH 4MZ3A 3KPSA 3QWOB 3C6LC 4V1DA 5FDYA 4MXVE 4I77H 4Y5YA 4WY7H 4F9PC 2DQGL 1X5IA 1AP2A 2HLAB 2ESVD 2GCYA 1C16A 1I1RA 1NMBH 2UUDH 1DN0B 2HRLA 2XN9E 5T1LA 2EDXA 4JY6B 4FMFA 5ERWB 3QI9D 1QBBA 1X44A 1L7TH 3K81A 3AGVA 1ZT7B 1DQDL 3N06B 3LN9A 1GSMA 4OLXH 2B2XL 1A9BA 1EAJA 3GSVB 5F70A 4F58H 1J0HA 3LVEA 3MUJA 4Q6IA 5LXGH 1OAYH 5DEGA 5DLMH 2WW8A 4G9DB 3W0WD 4JVPA 1RUAL 3KPOA 4KV5E 1PQZA 5EO1A 4MA8H 1F4HA 2FJHA 3GMMA 5HJ3A 2BNQD 2YSSB 1KC5H 5FYKU 5FXCH 4Z7VE 2FD6L 1NGXB 3ZE2F 1IKNC 3DETD 3QQ4A 5JUEH 4OLVH 3TN0C 3WSQH 4KJYA 4E42B 2NXZC 3I50H 2GEEA 5I1DA 4P4KB 2Z31C 1T2XA 5HVGB 1IGML 3RL1B 3DX7A 4TSAH 3ZE1F 5EO9A 5B3NA 1G7JA 5BZDB 5D72L 4L29A 4P59H 3VFUB 4XPTL 1IEBB 3PQYD 3MV9A 2R15A 2VL4A 2DI9A 2Z4QB 5D5MA 3RIFF 1UM4L 5IBLC 1ZGLP 2CJUL 2DM7A 4OZGE 2GQHA 1M7DB 1OOAA 2DLIA 2BOBA 5IB5B 3VD7A 5JOEA 2IANE 5FO9A 2K9UA 1UH3A 3C5ZB 2XRAH 4WWID 5KG9B 5L2KE 1YEFL 3IFLL 4M62H 6FABH 2X40A 1HYSD 4I2XB 4P2QD 3VFWB 4WEMB 3LD8B 1GC1L 3TT1H 3K4AA 3RWHA 4XPBL 4ZXBC 4KI5D 4PG2C 4HLJA 2ADJB 2VL5B 5IQ9A 1X6LA 4L4JA 3G5ZB 3KR3H 3KYMB 3LQAC 5HYQA 5BQ7A 2FHCA 3QEGH 4NZUH 5ID1A 1KGCD 4KVCL 4NJAH 3A6OA 2YXFA 5JQHC 4XVJH 1A3LH 3N9GL 3M1BB 1PVHA 2Z93B 4BZ1L 1XGYL 5SWSB 1RD6A 4L9LB 3V4UL 4JFDB 2VZSA 3BFOA 3NCJL 4ZUVA 3V0WL 1AIFB 2BX5A 4XP5L 3S4SA 4YWGH 1OGAA 2OTWA 2KBGA 4KZDL 4LLDA 4LGSB 1EV2E 3KPSD 4LHUD 4V1DD 1I9EA 3Q1SL 4XNZB 1FJ1B 1CL7H 5IJKC 2BVEA 4OZHA 3V7AG 1B4JH 4JFEE 4HKJB 4W6XB 5FYLH 5SV4A 1RU9L 5T1LD 1QZ1A 4NQXB 4XI5D 3FB5A 3QI9C 4YBQC 1BX2B 1EUTA 3IFOA 1CXFA 4WV1A 3VFPB 3FO9B 5EU4B 4D8PA 2YPVH 3D0VA 3S37H 3W5MA 4L1DA 1RUKH 4JFZH 4KKCD 4XRCB 3G5YB 3KLDA 2EDRA 3MJ9L 4D0CA 4U1MB 2LTQB 2ZUWA 1JF1B 4PUBL 5FO8B 5SWZB 3V6BR 4F15B 3BZFA 3DETC 3NN8B 5I1HL 1CDUA 3D9AL 5IB1A 2RCSL 3I3EA 4LLUA 4N90D 2G60L 4WW2C 4YGAB 3KJ4B 5EPMA 3EYFB 1X5GA 3HAEB 4JGJA 1VESA 2QBWA 3HC3L 1LEGB 1I1AA 2ZCLL 3VU2A 3LKQA 4ONGL 2HKFH 4XBEL 1CZ8H 5CKGA 2ZPKH 3GKZA 2P49B 3ZDXE 2VDOH 1EEZB 3RWDA 4Y7MA 3MV9D 3DRTA 2BVYA 4XP4H 4X6CA 2LAGB 3O11B 3GGWA 4HV8B 4XXCC 3QULB 3WS3B 1K3ZA 2HFEB 2UWEB 2MOVA 4JFXA 4UU9B 4U0QB 1UT9A 1TZHB 3F62A 1HYSC 4CADA 4GSDL 5C92A 2HJFB 3RUGB 3FB7B 5AYQA 2ICWB 4XBGB 5IK3B 4KI5C 3U36B 2MQCA 1ZANL 5J13B 2HYMA 2DQEH 4KK8D 3QEQE 1KPVB 4LSVH 5HD8D 5IESL 4JO1L 2XFXA 2FBJL 1T0NB 1A7NH 4YPJA 2B4CL 4KTYA 1L7IL 4KROB 4DZ8A 4O51B 3L3IB 3BAEH 3PHOA 1X5XA 4NQTA 4XMPL 3S34L 4CW1A 3O3EA 5DO2D 1OAUL 3Q5YA 5HVWA 2I27N 4UZGA 4JZOB 4P57B 3W39A 1RJYA 1J86A 3UTTA 4J3WA 3VGAC 3ULSA 1BEYL 2AI0L 2DQUH 4HK3N 4NHUA 5F96L 4KXZH 3O6FB 1V3KA 4O2EB 1X9QA 3QIUA 4D0DA 1Y0LA 3WFDH 3JV5A 4G6KH 2Q20A 1OGAD 4PRAA 4EDWL 5T3XE 1HKFA 1QFWM 3WLBB 4AQOA 2IH3B 3MRIA 4F3FA 1I8MA 1E28B 4Y5YC 4GW5B 4MZ2A 5FM4A 2V7NB 4LCYA 1HIMH 2A6KA 3TZVA 3VD4A 5LWYH 3MODH 4N8CL 2DLTA 1I7RA 1BD2E 2QKIA 2P5EA 1UJ3C 3F65A 1KJVA 4R7DA 1XIWB 3O6KH 4PJBB 1ETZB 1RZFL 4PGDA 4JM4H 3VRIA 3VDCA 2B1HL 4B0MM 3PV6A 2J8UB 1KUMA 3DV6A 2V17H 4Q6IC 4R7NA 5GGSA 4OD3H 5EU6A 3HNSL 3U9UA 5CBAB 4IRJA 1NFDA 1TPXB 3RY4A 1WIOA 2PW1B 4H20H 3IRZA 2GIYA 3T04D 2X05A 5IW1B 5CCKH 4K7PX 2FL5A 4HAGA 1GVIA 3WLWD 5DK2B 1EVUA 1DUZA 3BKYH 1JBJA 5FECA 4K71C 4TUJA 2ESVB 3B6SB 1A1MA 3VRLE 1AO7B 2R4RH 3VXNA 2OSLA 5J3HD 2C1OA 4NN7C 3T0EB 1ZHLB 3H7BB 4LSRH 3L7EA 1B0GA 1UGNA 3G5XA 4GH7B 4N5ED 3SKMB 3QISA 3QI9B 1I1AD 4ZUUB 3TBTB 1HHHA 4RDQF 3UBXB 4A6YA 2H1PL 1K5NA 1FLRH 1EK3A 4JKKA 1IGJB 4WFED 3NTCH 1CIDA 1ZT1A 2NR6D 1DSFL 1T2QH 2HKHH 1OPGL 4NO3A 3GSNA 5DRXB 5L88H 3W0WB 5IMMB 5EWIH 3MRQA 5J57B 1VGEL 1TZIA 4XHJC 1CBVH 3D85A 1CGVA 3RWIB 3OKKB 1A7RL 2FNBA 2VISA 4KZEL 3P0GB 1I3GL 4ZODA 3STZA 2BNQB 5F1IA 5IB4B 2NNAA 5I75C 2R2HA 3E6HA 4CL7A 5LCVL 3K2UL 2BK8A 1QA9A 4KHTH 4KUCF 4WW2B 1S7WB 5C08A 4ONHB 4DW2H 2NXYC 5DUMH 1UM5L 3Q0HA 4JKMA 5K9OB 1QQDB 3OAYH 3GMNB 5HDBE 3OG6B 5HD8C 3K1DA 4WGVB 3PGFL 3ZO0A 2JIXA 5IIEA 4PGCB 2AXJA 4M93B 4OGXH 4U6XA 3VXPB 1X7QA 2ZG3A 1YEJL 4AG4H 1T1YA 3PQYB 4XPHL 5DO2C 5DYOB 1CD8A 3LKRB 3FQWB 3V7MA 4UI2A 1CK0H 2E27H 2ICWJ 4NM8H 4UT9H 3BP5A 5DJ0A 2D7QA 1SY6A 2BERA 4QXGL 5LQBL 3MLYH 3MZTA 3IETA 3UTTD 3UYOD 5E4EC 3ESVF 3ZDZF 1CGUA 5I8KL 3QIUD 4O5LL 1MCOL 2O5ZL 3ZTNL 3IRPX 2XWBB 5KN5B 1A2YA 4P2QB 5KVFL 5F88B 3OL2A 1DBKL 1G7IA 4GG8B 1TCRA 5I1LB 4WU5A 4MJID 1A22B 2NY1C 5HYJE 5E5UB 4KK6C 1BBDL 3O3AA 3MRLA 3IGAA 4YUEH 5IFAH 4RMSA 4LVNC 5T1DL 3UPAA 3LPFA 3K7UA 1YEIH 3K8MA 3MLRH 4KJPD 3VMOA 2A0LD 4ZPVA 3QCTH 5LG1A 4YDLB 1YNKH 4O58H 1YN6B 2VAAB 4RQQB 4H5SB 5TE4L 1ZLWK 4WV1C 1J88A 5CD3B 2P5ED 5E95B 1M6OA 5A2JH 2W0PA 4YHPB 1HHGA 4LP4A 1IC7H 4U1JA 5E5MB 1TTGA 4XCCH 2KZWA 2V5YA 2N7BA 1A3RH 5FCUH 3QG7H 2BSTB 1A7BA 3KPMB 5EU6D 3FRUA 3SO5A 2QV2A 4IRJD 4D9RD 2PCPB 4FQHB 5SX4H 3MRDB 1MH5B 3GNMH 4U0RC 1ZOXA 2GTZB 3E2HC 5KZCD 4I3SH 4XX1G 1IAIM 4LHUB 4V1DB 4OCMC 3WLWC 4OZFH 5IFHL 2A2QT 3TVMA 2FYYA 4U4BA 4Y5YB 4TNWK 1IM9D 4DQOL 5J3HC 1DL7H 1L9NA 3ZDYF 2GCYB 2OK0L 4I0CC 3NCMA 3CX5J 1FZMA 1I9RL 2BFVH 5T1LB 2UWEF 3Q6FA 3WFCL 4GKZB 1I1AC 2YD7A 4HIXH 5IF0A 1O7VA 3IF1A 4CDHA 4K3JL 3RUGF 1BJ1J 2NR6C 4KTEH 1A9BB 1OB1B 2PYEE 2XZQL 4X5WB 5E6IA 4Q7DA 1MAMH 2N1KA 3PV7A 5DEGB 5GRVK 5HGHA 3T1WA 3TO2A 2OCFD 2DYPA 3RWCA 1Z3GH 2XV6B 4RFNB 1TNNA 3D85D 1MCLA 2VR9A 1PQZB 5EO1B 3QT2A 5TF1L 4P3DA 3GMMB 3DJ9A 5HJ3B 3OKDB 2BXZA 4XPGH 3TPKA 5ACLA 4ZFZA 3LHPL 4K71B 1HHKA 3RKPA 1MJ8H 5F1SA 5I1DB 5C08D 1BM3H 2IPTL 1RZKC 4PJDE 5HDQH 2VJXA 4H88H 2PN5A 5EO9B 1JNHA 1G7JB 2F19H 3VFOB 3F7QA 2DMKA 2JIXD 4N8PA 1CE6A 4Z0XA 4L29B 1QBLL 3RVTD 3HMXA 5IGXL 2VYRE 1X4XA 4ZD3H 1TJHH 3B5GA 3MV9B 1ZHBB 2OZ4L 4LPUA 2SEBB 5D5MB 43CAB 4LOUC 3BQUC 2NY4D 1N6QH 3QJFA 3S35X 3CVHA 2C4XA 4K94C 1LK3H 1YEDA 1NCUA 1U8KA 1VDGA 4FQXC 2C4FT 2ZG2A 5IVZA 3QIUC 4PJBF 2KL6A 1JRHL 5FO9B 5I75B 5DQ9B 4AEIH 3QHFH 3ZKND 3ZL4L 3ZYOA 3ELAT 2WQ8A 4J3VA 3B2VL 5C07A 4EJ1C 4JDTH 4GRWE 3H0TA 1INEL 3SE4A 3GSOA 5DMGC 1UADC 2YWYA 2FCBA 3TZVC 1YYLL 4KJPC 5IQ9B 2A0LC 4EEEA 1FVCA 4L3EE 3H42H 3UTSA 5FYLE 3LIZH 5HYQB 4LPXA 5BQ7B 3DBXA 3QAZC 2JJWA 4XNYL 5ID1B 5KS9E 3KPRE 4V2CB 4JFFE 2EDLA 1AY1H 3QIBA 2X1XR 3TIDA 4OFPA 4Y5XB 1KTDA 2BCKA 3CDCA 4C57C 4IRJC 4NQSA 1LEIA 4ZUVB 1WWWX 3DHMA 5EH1A 3S4SB 2PXYA 1EO8L 1AQDB 1KTKE 2OMBA 1OGAB 4JO3H 2BNRE 1RZ7H 2FB4H 4ZAKA 1UZ6E 2GJJA 1U92A 1KIPA 1J18A 2YUVA 2C1PA 2NTSP 1OM3H 3MCKA 3U46A 4OZHB 5JHLL 3OB8A 3OX8A 1WZLA 4PJHE 4KQ4H 1P7QA 5LGHL 4BH8A 3FB5B 3RVVD 3IFOB 1IC5L 4OD1L 4MD0A 4D3CL 3CMOH 2NY5L 1UWGL 2Y25A 3JV4B 1LE5A 4D8PB 3D0VB 4WW2F 4KAQH 5FAAA 3RVXD 1N59A 4YIQA 4NZTL 1P53A 3KPTA 1EUUA 5JPMA 4JPVL 3SGJA 3BKCL 1QSEA 5DA4A 5E6ID 4GRMA 4NQEA 1X4YA 1XT5A 3WO4C 1KB9K 1FNAA 5A3IC 4Y5VC 1XR8B 4RFEA 1NGQL 1Z9OA 2DYPD 4RGMB 4D0CB 5D2NA 1FL3A 1GYAA 1CXHA 2A9MH 4QF1A 3KYOA 3I84A 4JG1H 3BZFB 1QFUH 3KG5A 4HIHA 1B2WL 3MRJA 4GAJL 5F7KC 3VXUE 4OZIB 1WIUA 5IB1B 2JB6A 3RDTA 4LLUB 4N8VG 1F58H 1P69B 1FNSL 1G7QB 2CIKB 3MQIA 1PKOA 5DD1L 1UCBH 3TJEH 4B50A 4LIQH 3LKQB 1PLGH 2BC4B 4UAOC 4QRTB 3BZEA 3EDKA 3FQRB 1AGFA 3FHQA 4KI5F 4PJIA 1LEKA 1XF4A 4I77L 2DM4A 3BJ91 3DVNA 2NY4C 2DS4A 2Y23A 4TQEH 4X6CB 1VADA 1NMBL 5C09E 4AM0B 3HC0B 1NSNH 2HWZH 2R0WL 1CXKA 1XFPA 4APQC 2FHFA 2XT1B 4JFXB 2V9TA 2BY3A 5DUPH 3ZKNC 5E08H 4OLXL 4CADB 2AJUH 5IEHA 1P6AB 1MRCH 4LSPH 5C07D 5TQ2H 2EEAA 1OAYL 3QG6B 5LXGL 5DLML 1HN1A 5E8PB 3I02B 2HMIC 4NO2B 1OTSD 4YE4L 4F33A 4IIQC 5JPNA 2MCPH 3QHZH 3UTSD 4NCDA 1DBBH 5CEZH 4LRIA 3NIDE 4FA8A 3IDNA 4DZ8B 1KC5L 3B9EA 3PHOB 4ORZC 1J8KA 3ULVD 3STBA 3EDDA 3KXFB 4PJ7A 3LN5B 4OLVL 2BRRH 1ZVSA 3UTTB 3QIBD 1RJCA 2X4QB 3ULSB 3UTPD 5LGKA 4NHUB 4TSAL 4PJFE 1AE6H 3CLFH 3QIUB 5BV7C 1Y0LB 4HZLB 3L5WA 2PXYD 3LSOA 3LQAH 5JW4R 2ZUQC 3MRMA 4P59L 2RBLA 3MRIB 4MJIB 4ZAKD 3TVMC 4F3FB 1I8MB 4K3DH 2I07B 3BXNA 4GKSA 5T3ZD 4LCYB 4MQXC 4UQ2A 4CNIA 5I73C 3ARRA 4MQTB 1QFHA 4QNPE 3H3BC 5KAQF 5IVXA 1P7QD 5ENWB 2QKIB 1OGTA 2ZG1A 1DLFH 2XRAL 4R7DB 3LS5H 4M7KH 4QRRB 4M62L 4NT6A 6FABL 1YNLL 4PGDB 3VRIB 3PV6B 4PS4L 1BJ1H 5E6IC 3C6SB 3DV6B 1SJEA 1ZAGA 4KJQC 4OKDA 1V3JA 3K2MC 3TT1L 4R7NB 1QSED 5GGSB 4NQED 5EU6B 4RGNE 3U9UB 4I9WE 4IRJB 1NFDB 5F3BA 1F3DJ 2F54A 3DUSA 3G6JB 1G6RA 3A67L 3WN5C 4YHZH 5CBEA 1SEQH 1ADQH 1TZGH 3QEGL 4NZUL 1FZKA 2FX9H 5D5MF 1L0YA 1DUZB 2Q8BL 3MBEA 1IM9B 5FECB 3QBTB 2Y6SC 2VLMD 1A1MB 3B43A 3ZHLA 4XVJL 2R39A 2OSLB 2ERJB 1A3LL 3RDTD 3TBYB 3CVIH 4YFLF 3QCUH 3G5XB 1AJ7H 4WU7A 5IWLA 2FECI 4NM4H 1HHHB 4KHXL 5DJYA 4YWGL 1ZHNB 2J1KA 2OR8A 4OLUH 3F7VA 1ZT1B 3V6ZA 5GJTL 3SDXA 3ARVA 1C12B 1ZSDA 4NO3B 4F57L 1UEMA 5D1QB 5GZOD 3GSNB 4OQTH 4BQ6A 1B4JL 3MRQB 1BQHG 2GUOA 1TZIB 1KJ2B 1MY5A 1X5HA 3MLSH 5FYLL 3FFCE 3ROLA 2VISB 3MGAA 5IV2A 3CSBA 5F1IB 3W9EA 1D6VH 2NNAB 1QUNA 4DN4H 1MQKH 2R2HB 2YPVL 4EXPX 4JQVC 5D7JA 3ZE0E 2OJZL 1D5BB 3R06B 3BEWA 1QA9B 1KCVH 4RIRA 1C5BH 4JFZL 2JJTA 3I3BA 3KS0J 3P0VH 3SE4C 2XOTA 3EOBA 1OTSC 1FNFA 2HTLC 5CD5D 2CH8A 5ICYA 4UAOB 5CILH 1G9NC 4WFFD 1EGJH 1X7QB 4XNMA 5K9QG 1T1YB 4NNPH 5GS0D 3NH7L 1OQXA 3NIGE 3SN6N 4EUPB 3V9FA 5DJ0B 3BP5B 2NY4B 3MLUH 3QIBC 2G5BA 3MTRA 4HC1A 1BGXH 2VXTH 3QFJA 5J89A 4MQ7A 4I8DA 2PTTA 3WFEH 2A6DA 2FJGA 4ODHH 2HKFL 1OF2B 1CZ8L 2ZPKL 4LPTA 3G9AB 2IGFH 2MKLC 2VLKA 4JB9H 2EE6A 4ZAKC 1YMHA 2DBLH 2VDOL 1G7IB 5CP3H 4WU5B 5H37G 4NO0D 2AEWA 3NAAH 4WHYH 2LE9A 4PP2A 3EO9H 3T2QA 5DSCB 4DAGH 4ZPVB 4BUHA 2Q6WA 3ZKMD 4EIGB 4X4MA 3P0YL 4W4OA 4OZIF 2VQ1B 4JY4A 5D2LA 5D9SA 2MQ0A 1HHGB 2FGWH 2P7TB 4G43A 4G7YL 5DD0H 3VXRD 3B9KA 4WI2A 2Z8RA 2F53A 2IEPA 1WBXA 1WITA 2F54D 4DKAA 1A7NL 3JV6A 4F2MA 2ARJQ 1U3YA 5T5NF 2ZUQB 3PGCA 2H3NA 3BAEL 2ICCA 4BYHA 2FYYB 2B5IB 3DGGA 4X6CF 5DVMA 1IRAY 3GHBL 3MBED 4Z18A 2D31A 4NQUA 1JV5A 2X7LA 3P4LA 1FZMB 1QYGL 5I73B 3Q6FB 3T8XA 1FVDA 4G6FD 4PJCB 3WFDL 5DUBB 3IF1B 5LVEA 1A7QL 4LF3A 3BD3A 4Y4HC 5HYSG 4H0IA 3TP4A 5DD5H 5TDOA 4PJAA 4S1RH 3BH8A 3O4OC 5FKPB 4R4FH 4M03A 3NOIA 1WBZA 4F80A 3OR6A 1TCMA 5HGHB 1HIML 1XGUB 3EYVA 3PXHA 4EDXB 2DYPB 1M7XA 3RWCB 3D3VE 5LWYL 4QRSA 4LPVA 1X5LA 2YD4A 3EZ8A 1LDPH 4ELKA 4WUKL 2O26U 4P3DB 3FN0H 4RMUA 3HZKB 3CPLB 3RA7L 3D39A 5I0DA 4FQ2H 3O6KL 1SBSH 4FOMA 2APFA 3DRQA 4QHUA 5CZVL 2OP4H 4GBXA 5D7JD 3AROA 2B0SH 1HHKB 4J2XA 4TYUA 4PRDA 4N8VA 3E8UH 4NZDA 2Y36H 2CK0H 1XGTB 4OD3L 3O8XA 4S10A 3WFHA 4HPOH 4L3CA 4OF8A 1IAKB 2BVQB 5CD5C 2I9LA 1NFIA 3IJSA 3CNKA 4JFPA 1NMCB 5CCKL 1CE6B 4Z0XB 5SV3A 4LRIC 3DYMA 4P9HC 3BKYL 2B1AH 3PWUA 5D7IB 3GO1H 2GAZA 1QRNA 2R4RL 1H9VA 4DCQA 3HRZB 4O2CB 2J4WL 1N3NA 1JCKA 3CU7A 5E6ZA 5FYJD 1Q38A 1YEDB 1HK6A 4KK5D 1AC6A 3ALPA 3QFJD 1OAQH 4OLWH 1BJ8A 4LSDA 2Q7YA 1HYRC 1FLRL 1JI2A 4PRBA 2VLKD 1T1WA 2FWOA 3NTCL 3LY6A 5D96B 1NFDF 1T2QL 2YUXA 2HKHL 5HYEA 3D2UA 3DO7A 1NBQA 3H0TB 5L88L 3G6JF 1FNEA 3DPBA 5E70A 5EWIL 3GSOB 4DTGH 1AGBA 1CBVL 5IP4A 3HC4H 4XVTH 1S7UA 1FVCB 4UT7H 4LDLB 3QNXA 3ZKMC 3UTSB 1A4JA 5C6PB 3K1KC 4MMZC 1UG9A 4TUOA 3DBXB 1CG9A 3QO1A 1CFQA 1ZLVK 4NYLA 2YN3A 4R4ND 3Q3GB 1CDCA 2RB8A 4KHTL 3RI5K 5DUML 4M5YH 2BCKB 3R8BB 3B9KD 4NQSB 5KTEH 3QUML 2F53D 4RBPH 4K3GA 5C6WH 4ZOEA 3RTQA 4MHHI 1F3DH 2PXYB 4MB5A 4YZFE 2CLRA 4OGXL 5JLZA 4CU7A 3BEVA 1JHTA 3MJ9A 4AG4L 1CN4A 4ZAKB 4FFVD 5JQ6H 2BDNL 3MBEC 1ZTXH 2WZPD 3UTQA 3WBDA 1U92B 1CK0L 1H3PH 2E27L 2WANA 2C1PB 4NM8L 4UT9L 3MCKB 2GI7A 3U46B 3HUJA 4PJ5B 5ADOH 3MLYL 4JJ5A 3H3KA 5IVOA 4FG6D 5IVNA 4TNWF 2YN5A 1Q9LA 1RJZA 3NPZB 2VIRA 3BJLA 1N26A 5IMLB 5C0FA 3ZSSA 3QJHA 1DTUA 4Y19A 3PP3K 4S0SD 1QR1B 1UB6A 2FH8A 5C3TA 4X9GA 5JPMB 2BXYA 2C3VA 4GRMB 1Z0NA 4YUEL 2CLZA 1DFBH 1LO2H 2HFFA 3DURA 3AVEA 3MV7E 5IFAL 4RFEB 1YC8A 3GMOA 3VG9B 4PLNC 2K7PA 5D2NB 4DOHB 4OCYH 2D7MA 3QCTL 1LO5A 4PV9A 4QF1B 1YNKL 4O58L 5F89A 3KYOB 4GT7A 4NWTH 4EQ3A 1QVOB 4IOSD 2VLJA 5E2VH 4HIHB 3D39D 5D7JC 1FGNH 1HHIA 4UDUA 1JE6A 3OQ3B 1IC7L 4GBXD 3RDTB 4XCCL 1GGTA 1JF6A 1K2DA 4KRPD 1VFMA 4OAWA 5FCUL 3QG7L 1KCLA 5IEKB 3O8XD 4MNQA 4HKXB 4LAJH 3KS0H 3GNML 1MPAL 3JWOC 4KKNA 4KKLD 3BZEB 4AH2A 4G5ZH 5T1KA 4WWKA 2IQ9H 3L3OA 4OUUA 1JMZA 1XF4B 1BFOB 4YPGA 4M6AA 4XXDA 3T4AA 3VH8A 1BQHA 1QRND 1VADB 2BFVL 1RZKH 4G42B 3WNOA 3I6LE 4KK5C 5CINH 5IJVA 1MHCB 4HIXL 4MJ5A 4N0UE 1A6UH 4MAYB 4PTTB 4DFHA 3U0PA 1KB9J 4J4PA 1SJVA 4KTEL 2AS5M 5IEHB 1MY7A 5D7LA 1MAML 4KJWD 3D2UD 3OMZA 4S1QL 4K94H 4F33B 3T0WA 2VTFA 1Z3GL 4M00A 1YEGH 5JPNB 3T3PF 3BUYA 3RJDA 5CJOL 2YRLA 1YNTA 2PW2A 4W4OC 5F7FA 3TBWB 5KSBE 2WBKA 4GQ9L 4XPGL 4HK0B 1JPFA 1VEPA 5E9DB 1F2QA 3CFKA 1VGKA 1EBAA 4PJ7B 1NUDA 4LSUH 4AJ0A 1BREA 2W38A 1Q94A 4HT1H 1KG0A 2ATPA 4OSUH 3TYGH 1BM3L 4JRYE 1TQBC 3BDYL 2DM2A 5GRJH 4PJCF 4TULL 4JFHE 4QTIH 1CLCA 1UH4A 2YD6A 4H88L 4JAMB 5EIVA 2F19L 2XWJA 3RTQD 5IMKA 4BSWB 3L5WB 3LSOB 3FQXB 3VMNA 1T7XA 5B22A 3MRMB 1JHKL 4FFVC 4R97B 4KC3B 3AB0C 2JCCE 4NO0B 2VDPH 5DRWA 1CR9L 4ZD3L 1TJHL 3SKNA 3BXNB 4PY8J 3R4DA 4RWYH 3QPQC 1N6QL 3MO1A 1HCVA 2VABA 3VXMA 1U8MB 4GKOA 5J6HA 2D7OA 4OZGA 5DRNA 4XPFH 5FYKE 4PRIE 1OGTB 1H3VA 4WUUB 3KNBA 5F6IB 2IANA 1REIA 1IEHA 4AEIL 4DGVL 4Y19D 4BSVA 3IKCA 3QHFL 5C0JB 4HWBH 1CDIA 1ZGLA 3PNWB 5EFIA 5LKNA 3VXRB 3ZYZA 4NDMB 5FUOL 4JDTL 4R2GD 2PO6A 3MV01 5ITBH 2QSTA 5F3BB 4ZFGL 4P23A 1GGBL 2F54B 3RAJL 3DUSB 1G6RB 4C59B 1DQMH 5CBEB 3H42L 1MCWM 2IMMA 2VUYA 1UWXH 2ORBH 2DQJH 2G2RA 3SJVE 1TQCC 5D7IF 1M05B 4I48B 4A6YH 4ONFL 2VLJD 3MBEB 4OM1H 3ARXA 4GBXC 3VWKC 5EUOF 4KRPC 1AY1L 4R90H 3ZHKA 1AH1A 5C6TH 3O8XC 5IHZA 4H8WL 4HUMB 4G6FB 4MNQD 3QH3B 4LMQI 1FSKC 4N1CA 3ZKXB 4LLQA 1JK8A 4KKLC 4BM7A 5DJYB 2DQIH 4IMKA 4JO3L 1F4YH 1QFWI 1RZ7L 2FB4L 4AT6A 3F7VB 5HYSA 3LB6D 3SDCC 3QUZA 4JN2A 2P1YA 5T1KD 5FUZH 3BO8A 2P8MA 3CU1A 1PX3A 4DWHA 3D48R 1OM3L 3AY4A 1NBZB 3IJHA 5KOMC 4JFEA 5I74C 4HXBH 1PD6A 4FZ8H 3ULVF 3DUUB 3O6LH 3CMOL 3I6GA 5AZ2H 1F4AA 3SCMA 5EU3A 4JVWA 4OCLC 4KAQL 4YFEA 3C08H 5D7JB 1B3JA 4J4PD 3FKUS 4OB5H 4PY7A 4BJLA 2DQCH 4RIRB 1LO4H 1EJ6A 4K3EH 3IFPA 3QO0B 3UYRH 5J0BA 5JMOC 2EEDA 2X4OA 5D7LD 1V7NH 4NOFA 5DGQA 5EOTA 4ENED 1M7IA 4NC2B 4UIMA 1YEEH 1O0VA 4KI1A 1AGEB 2E7LC 3VXSE 2A9ML 4W70A 4MMXC 4XNMB 1GCFA 2FIKB 3DX9B 4B7LA 5EZIH 4JG1L 3WO3B 1QFUL 5SX5H 5J4MA 3TJHD 3CUPA 4WNQB 3X13B 1JWMB 1F58L 1SMAA 2G5BB 3QEHA 4GG6E 4PG9A 1UCBL 3CDGA 3TJEL 4QRPA 1S7SA 12E8L 3RTQC 4LIQL 3RY5A 3VFVA 2PTTB 2A6DB 1BVKA 2VWEE 2X1OA 5GGRY 2VLKB 1CL7I 5B8CA 1YMHB 4P99A 3U4AA 3WHE1 1GZQA 4TQEL 1DBMH 3NCYS 2ZOLA 3GRWL 4PP2B 1K8IA 2HWZL 3VXMD 1JPTL 3JTTB 4Z7OF 5BV7H 3U79A 4KKAD 3FT3A 1CGSH 3CJJA 2PYFB 5D9SB 5CLTA 2FH6A 5DUPL 2IAND 4FABH 2AJUL 4MAUH 3GBMH 4G43B 4LSPL 1MRCL 4R2GC 3B9KB 5TQ2L 5BXFA 2F53B 2PO6D 3BPLB 1CLOH 1YJDC 1WBXB 3MRCB 1XGPA 4GMSH 4P23D 1RFDH 1C5CL 2AEQH 1RK0A 5I1JH 4N0CC 2MCPL 3JV6B 4F2MB 3QHZL 4OM0H 4ODUB 4F7EB 5BZWA 1SEBA 1DBBL 3S36H 4GW1A 2H3NB 2HJKA 1GAFL 3AB0B 1KB5L 4LPWA 5CJ5A 3GJFA 4YX2H 2D31B 3WFZA 5INDA 5DHYA 3QUXB 4UIKH 1NGWA 2BRRL 4C55A 5MERA 3EO1A 5ACMA 2WP3O 4XNUH 2VH5H 2AABH 3W9DA 1ZKAA 3VFTA 1EA9C 4QTHB 1KPRA 2VDRH 4XB8A 2C3WA 4G8GB 4MDIA 3L95A 2GJ6A 3LQAL 2ICEB 4LF3B 3LB6C 1NL0H 5I1CH 2YPLA 5K59F 3U83A 2LU4A 3AM8A 4WWKC 3QUZD 1NLBH 2QSCH 4X7EC 4PJAB 4TOYH 4L8BA 3BH8B 1GOFA 4K3DL 3WIIH 1MHHA 3NGBC 4OCSH 3PWPB 3OR6B 5B39G 2V7HB 4X80H 3GIZL 4JFED 4QRSB 2OZ4A 2Z35A 2CRIA 4YAQA 1DLFL 4I0PA 4WVRA 4JFQA 4AL8H 3LS5L 3SCMD 4J4PC 4QHUB 5BS0A 3BPOC 4TSCH 2MFNA 1JWSB 1P84J 3QWQB 3O8XB 4RMVA 2NPLX 5C3LD 1N2RA 4L3CB 3T1FB 4ENEC 3CVHH 5H35A 2I9LB 1NFIB 4YHZL 4LBEA 4CAGA 4X7SH 5GS1A 1SEQL 4KKBD 1IAII 1RUPL 1ADQL 1TZGL 4XBPA 2FX9L 4LMQE 1A7OH 3C8DA 3PWUB 4PJEA 3IDIA 2GAZB 1NGPH 1QRNB 4U6TA 1D9KB 3KPLA 4X83A 1N3NB 2D7TH 1IVLA 5T1MA 1RSFA 3QCUL 4YGVA 3U1SH 5HHME 4B7IA 1AJ7L 4FNLH 4JKPH 4QRPD 4FQIL 4BUGA 4NM4L 1QSFE 3CXHK 3B3IA 2Q7YB 1G9NH 1A5FH 3MBXH 4PJ9B 3K4ZA 4LSQH 4OLUL 5KW9H 4PRBB 4U6VH 1T1WB 2FWOB 4F7CA 4F7MB 5JHDB 4BQ9A 1J05A 3MROA 3D2UB 4UMGA 3SKUD 4F7PB 4ELME 1ORSA 1FNEB 4YR6A 3GJFK 4FQ1H 1AGBB 3MLSL 3QNXB 4QHNA 1A4JB 1NCDH 1OARH 1HDMB 4KKAC 5E56A 1N4XH 1CG9B 1D6VL 1KBGL 1IMHC 1CFQB 2YRZA 2VKXA 4DN4L 4NYLB 5ALBH 5J1TC 4L1HA 5F8RC 3F6IA 1KCVL 2D9CA 3PABA 2BVPA 2PO6C 3P0VL 5DMKA 2Q86A 4JHAH 1TIUA 2APXA 1CDJA 3RTQB 4PRPE 2CLRB 2V2TB 5FUCE 3WV0A 1HOCA 5CILL 3BRGC 1EGJL 1JHTB 2VDMH 4NNPL 5E8NB 1VENA 5J8OA 4M43L 3ZZ1A 1S5HA 4JJ5B 1TETH 1WFOA 1NCWH 1Z5LA 1BGXL 3SGEH 2VXTL 2ZNXA 4MXQD 5IHUH 4ETYA 3WFEL 5HGBB 5ISZA 5C0FB 3L5JA 5HPOA 2GJ6D 3FT2A 8CGTA 2IGFL 5TH2A 4JB9L 2YPLD 1MJ7H 1YC7A 4L8SB 2DBLL 2L4OA 4WIQA 3RWGA 5F9DC 4YK4C 3PL6A 4MGXA 5HYJA 2HFFB 3NAAL 2D7PA 3AY4C 5CZXC 4IM8A 3GMOB 4PYGA 3IVKA 3EO9L 4LKXB 1LO5B 4PV9B 5F89B 4Z6AT 3SCMC 4I0PD 2VLJB 3MACH 4L4VA 3IXTA 5D7KD 5BS0D 2FGWL 1G1CA 3NCCB 4ACPA 1QEWB 5C0ND 2IADA 1I9IH 1QR4A 1K2DB 3UEZA 3P9MA 2EXYD 3FHAA 4K3HA 4LCWA 3PXJA 1T04A 5DQJB 4KTDH 1VEMA 1SQ2N 5ABDE 1WUNT 4KKBC 4BH7A 1V05A 1CD1B 5T1KB 3IDMB 5E2JA 4OUUB 3L3OB 1GOHA 2CSPA 2PKDA 1ACYH 3HS0A 4YPGB 2F58H 3NGBB 5EB9A 4XXDB 1QKZH 3VH8B 1BQHB 2A74A 2WV3A 3MRHA 1OCWH 3AMKA 5IJVB 1S8DA 2E7CA 1N0XH 4X5XA 1EBPA 5I8CB 3U0PB 2IQAA 2X4SA 5E99H 2R1YB 4R6UA 5B8CC 2E9BA 3EFDH 4P9HH 4RGOH 5DD5L 4S1RL 4XCFH 4R4FL 2PYEA 5D7LB 1B4RA 4POUB 1RHHA 3BWAB 5DK0B 2JJVA 4OCNC 1D6EB 5KSAB 4N9OB 3ZE2E 4Y4FA 1LDPL 3BUYB 4E41E 1IM3A 3KYNB 3OR7A 1YNTB 2PW2B 5AYUH 3FN0L 1JPFB 4OD2A 4FQ2L 4AQ1B 1SBSL 1MCKA 1T21B 1KF9B 3HE7A 2B0SL 4L4TB 3ZE1E 1YA5A 3E8UL 1CDGA 1Q94B 2Y36L 1KG0B 2CK0L 4NN5C 4ODVH 1U8NB 2HH0H 2X44D 4HPOL 1NGYA 3MREA 4TRPH 1JYNA 4PP1D 1RULH 5CJXA 4HEME 4PJDA 2XWJB 3DROA 2K7QA 4DKDC 2CLVA 3RI5F 1HNGA 3NCYP 2VNCA 3AAZA 2H6PA 4PJAF 4MWFB 4LASH 4PLJD 1NGZA 4YC2B 1G84A 2UUDK 5DRWB 3DXAE 2B1AL 3GO1L 1SJHA 4ODSH 3L3DA 3CFIC 4ZYKA 1YN7A 4G7VH 3AS1A 2VABB 3VXMB 5J6HB 4I5BB 1WQVT 5DRNB 5EU7E 2XTJE 3O41B 1HXMA 3S5LG 4DK3A 1OAQL 1Q9WA 1WAAF 3C87A 5ISZD 2X70A 4JQIL 4E0RB 4ZUSB 4Z7QF 8FABA 3KPNA 4P5MA 5KSVA 4CJ0A 5EFIB 2IALA 3PL6D 3P4NA 1CVRA 2PO6B 5L8LB 3QDGE 2E8ZA 4DTGL 3DI3B 2GHWB 4P23B 1I4FA 3MJ8A 3C2SA 3HC4L 4XVTL 4ZDHA 2QQKH 3IAPA 4UT7L 4HUVA 4GUPA 1LWRA 3U0WH 1CQKA 1W72H 2ZZUT 4JPIA 2CO6B 5LGJA 3LEXB 4MA1B 1EFXA 5DHVH 4I0PC 4GS7B 5MENA 1DEEA 3BYTA 1HH9A 1BECA 4JFYB 2FATH 3FZUC 4L4VD 4ZQKA 5KS9A 2P43B 1XCTA 3KPRA 4P46A 1MSPA 4QHLA 5C0NC 3UPRA 4EI6A 3VFSA 4ODTH 1UFUA 5HHPB 5ESAA 3ARFC 4M5YL 2HRPH 4MDJA 5KTEL 5IHZB 1KJMB 2YKLH 4LCWD 5JDSA 4LLQB 1JK8B 3NFPA 4NFBA 2QADD 1JNJA 5GS1C 1FP5A 5DHXB 4PJXB 1ITBB 4X5LA 5FIEA 3L1OH 3QUZB 4JN2B 1A7PL 4HJ0D 5INCB 4B53A 5JQ6L 5IFJB 3RWEA 4R8WH 4YK4B 1ZTXL 2P8MB 4LCCA 1H3PL 3ZSTA 3B5TA 5B39A 4M7JH 3IJHB 2M1KA 4M7LH 4JFEB 3QIWC 1BBJA 5E2WH 3JVGC 5HXMA 4N1HB 1LP9A 2EO1A 3F12A 1I8IA 3I6GB 3JWOH 3SCMB 5EU3B 4CVZA 4DUWA 1CE1H 3SQOH 1I7TB 1KELH 3OXRA 4NQCB 4PY7B 1IL1A 1J0IA 3IFPB 4L8DA 1KXVC 2X4OB 2PYED 1DFBL 1LO2L 3FTGA 4FZEH 5EOTB 1R5VA 4UIMB 4OCYL 2CDEB 4Y4FD 1Q0XH 3ARPA 5KVEH 5HVFB 2RR3A 4NWTL 1C8PA 3OXSA 4RZCA 4J3OC 2VKWA 5I9QC 5E2VL 3UJJH 3X14A 3CUPB 2XXMB 4RMQA 4M7ZC 1A1OA 1JF5A 1FGNL 2OJEA 4P2RB 3HE7D 3RVWD 3VXUA 4NP4H 3MRFB 3KPPA 3QEHB 1RI8A 4PG9B 3CDGB 4PP1C 3ARWA 1KEMH 3EJYD 4QRPB 3AUVA 3B9VA 3VGEA 5C8JA 1WFUA 4JPWH 2F8XC 3VFVB 1BVKB 3KVQA 5D1XC 1B9ZA 1UB5A 2AJSH 4WTWA 4OZ4A 4G5ZL 4O2FB 5B8CB 2A38A 2IQ9L 3CGTA 5ANMB 1HHJA 5HGDA 3EDJA 3VFMB 1J0YA 5I6XB 4WI7A 32C2B 2ZOLB 4X6FA 3DNKA 1RZKL 1K8IB 2B2XH 5C09A 3RZCC 4IHOA 5CINL 1A6UL 4X6BA 3WS6A 4F9LA 1RIUH 3FT3B 3DOSA 2EYRA 1RUAH 2GT9A 1VACA 3VDBA 3MNZA 2FGZA 4RNRA 3BMVA 5AD0A 1IGTA 5BXFB 2DTSA 4K94L 5DC4B 1TENA 1XGPB 1A1NB 2AJYH 3GSWA 1U36A 1JHLH 2X5PA 5BZWB 4D2NA 1I3UA 4Y1AB 2HJKB 1EFXD 5FYLD 5MEND 1YMMA 3F7RA 4X7DC 5DWUH 2DIJA 3GJFB 4GLRI 4Q9BA 2OM5A 4LSUL 2BSRA 5DHYB 1NGWB 1JZ8A 3KPRD 5BVJA 4HT1L 3EO1B 1S9WA 3DYOA 1JTOA 4OSUL 3TYGL 4LK4A 5GRJL 3W9DB 1JVKA 3SE9L 5GGQH 1XMWA 4QTIL 3VRJA 2ZSWA 2OQJA 1FG9C 2QADC 3L95B 1IGYA 3U7WH 4PJFA 2GJ6B 4BSJA 3SDAA 2CJUH 3ARGB 3DSNA 2X4NA 2YPLB 4HJ0C 4NFCA 4BZYA 1NEZA 2QLVB 5AWNH 4IOIA 3BMWA 2VDPL 2ICWI 4L8BB 5GRXG 3S6CA 1MHHB 5TPWL 1DANT 4RWYL 2XZCH 3IFLH 5JW5B 2HP4A 2D0HA 3SY0B 1S7VA 1QPPA 1JPST 5IKCA 1YPZB 2Z35B 2A83A 2W9LA 4JZJA 4XPFL 1N5YH 1Z9LA 3T77A 4CU8A 2UV3A 4XPBH 1PZUB 4I0PB 4U1IA 1JGVH 4JFQB 2OR9L 5BS0B 4ZNCD 3OJDA 4HWBL 1J8HE 3NVQA 2YZ1A 2NY2D 3QXWA 4LLAA 1PEZA 1D5XB 4NKOA 5T5FH 1T0MA 4UNUA 5ITBL 3I9GL 1N2RB 3R0NA 2FSEB 5F7MC 1EZVX 1DQML 1UVQA 4LBEB 1ZVHA 3N9GH 2XIDA 3D0LA 2ORBL 5IMOA 3SBWC 2A73B 2DQJL 2Z0BA 1R6VA 3FOMA 1T6VN 2C3XA 3RZWA 4A6YL 4U1GC 5F7WC 2DQTH 2R2EB 5D70L 3HE7C 4PJEB 4X98B 3IDIB 3RVWC 3BIKB 4P5KA 4AENA 4R90L 1TVHA 4I2XE 3VXUD 15C8H 5C6TL 3KPLB 2HVKB 2IBZX 3PWJB 4YGVB 4QYOA 3EJYC 5CJXC 3MR9A 4BFIA 4HFWB 3QUMA 3DARA 3MNVA 3O2DH 1Q9KA 3IS1X 3ES6A 4LU5L 1MLBB 3HN3A 4F7CB 4I1NB 3OV6A 1R5WA 3T2NH 5FUZL 1KPUB 4UT6H 4FFYH 1J05B 1VKXB 1X5JA 2NZ9D 2YEZA 2OX5A 1ORSB 3NMEA 4YR6B 3H9SE 3RWFB 4EI5C 5BRZB 1HQ4A 1W2KT 2ZUUA 1AGDA 4X8JB 4Y2DC 5SWSE 4JO2H 4HHAA 4FZ8L 5C09D 3FFCA 3GB7A 4FQLH 2PUQT 4JFDE 1U93B 3O6LL 5E4IA 3ABZA 5AZ2L 3NZHH 3RKDD 5JOFA 3EHBD 4KK9D 3C08L 5GJSH 3QNZB 2CKNA 2DQHL 3BN3B 3ZYIA 3RVUD 2DQCL 1T2JA 4PPTA 1LHZA 4MJ4A 3PABB 2BVPB 3QDJE 5DMKB 5J6GB 1T03H 4PJXF 1YEEL 2RCSH 3WMSA 3UBXI 3MMEA 1HOCB 5HI4D 2EKSA 2N4IA 4HUWB 5EZIL 3C09B 1E4XI 1BVLB 4M8QA 1I9JH 2ZCLH 4BELD 1YMMD 3ZDZE 1KXQE 4P46C 5DA0B 1S5HB 1A3QA 4MD5A 3NA4A 5EZLA 5DFVC 5DTFA 1DQQA 5H8DA 3PWNA 1YJDH 3TF7C 1MCHA 3S5LA 2PTVA 2AK4E 5ISZB 3SDAD 1MREH 1MAJA 3GI8H 4ZMAT 1F6AA 5TH2B 4X4YA 2XKSA 3LDBC 4MA3A 1AC0A 1T66D 2X09A 3UJTH 3PL6B 4LCCC 1NANH 1CD0A 1RVFH 4MYWB 1RZJL 2EIZB 1DBML 1PKQA 3IVKB 3OKNA 4GSDH 4MXWH 3T08A 1EHLH 1A8JH 1S9XA 4L3AA 5BV7L 4POZD 3LMJH 4U3CA 3T0AA 1CGSL 3GM8A 4ZG1A 4L4VB 1G7LA 4WFGE 3FO2A 3TNNA 3OAYK 2FBJH 1U8PA 1KT2B 4XMLH 2AK1H 4MAUL 2IADB 3GBML 2FEEI 5ESVA 4GO6B 3D87B 3RHWK 2ZCKH 1T4KB 3VE0B 2YD3A 5E03A 4LCWB 1CLOL 3U0TA 1T04B 2AEQL 5MHSD 2QADB 5I1JL 3RL2A 4OM0L 3ZDYE 3S36L 5M95B 4R0LC 1P6FA 2NY6D 4NIKB 2UWEE 1G1YA 2LVCA 4WTZG 1QLFB 4UINH 1HCFX 4YX2L 4LVOB 3HS0B 2GW5A 4UIKL 3MYZA 5D7SH 3WE6A 2A74B 4XNUL 2VH5L 3GSQA 2YS4A 2AABL 2UVEA 5F9OH 3RUGE 2AQ1A 3RIAK 2VDRL 4CMMA 4AMKH 5DVNA 2EH7L 4K55A 1UXWB 2Z91A 5CFHA 1NL0L 2IQAB 5I1CL 5IB2A 2P5WB 4YNYB 3FJTA 1NLBL 2QSCL 5DJ2A 4TOYL 2NZ9C 2PYEB 3RPIA 3WIIL 4OCSL 1OP9A 2E6JA 4OLZH 2Y5TA 3LEYH 2XG4A 3M07A 4X80L 2MTPA 1IAOA 1A14H 4Y4FB 2R9HD 3FO0H 3FFCD 1WCQA 2UY7A 2NTFA 3WS6C 1S7RA 5C2BL 4F9LC 2ZUYA 4F37K 3HR5A 2GITA 4AL8L 3QRFM 3HE7B 4TSCL 1NDGB 4QRUA 5FB8A 3AU1B 3WXWL 4GRLC 3LPGA 1TVDA 4LEOB 3LKSA 1EAPB 1NGYB 3MREB 3CVHL 4YDJB 5JIIA 4XH2A 4GW4A 3DROB 4XZUA 5GGRA 3NFSH 4X7SL 3OZ9H 3AAZB 4WHYG 4FN0A 2D0GA 5FDWA 1NGZB 1QFPA 4X6DB 4PGJA 4CGTA 4LNRA 1A7OL 4K07A 2XKNB 1UACH 1NGPL 3G6DH 4J8RA 3L3DB 4ZYKB 1YPZF 1ZE3C 5DQDH 1NC4A 2VAJA 3B2UC 2D7TL 1PFCA 1C5DA 1I1YA 1DSFH 2DICA 5D71H 1HXMB 4JKPL 2A1WH 1Q9WB 4ZSOB 4OF3A 3SDAC 4NQDA 1A5FL 2X70B 4R96A 3MBXL 1S78C 4LSQL 4YHML 3REVA 4YDKH 1KEGH 3KPNB 4M1DH 4P5MB 4U6VL 1T66C 3PF2A 2D4FA 1IAMA 2DKMA 3THMH 4KZEH 1WT5A 4P48A 2CD0A 3B8YA 5C0AE 3T0VA 3O2WL 1TMCB 1HILA 3P4NB 5I71B 4FQ1L 3ALXA 5E8EB 1AO7E 1I4FB 1T5XA 2ILLA 3MJ8B 4ZDHB 2WQRA 3T0EE 3K2UH 2VXUH 4JPIB 4U1SA 1NCDL 1K6QL 1VFUA 5GXBB 3OKLA 5LGJB 1OARL 1WVZA 5EC2B 1EFXB 5MENB 1N4XL 4PJEF 2GYSA 4OF0A 1DEEB 1HH9B 4WTXA 5DC9B 4N0FA 5J11B 5ALBL 1MCJA 3U7YH 3KPRB 5CEXB 1KCSH 4EI6B 1KIUA 3VFSB 2IFGA 1QP1A 4XWOC 3WNKA 2V9RA 4MDJB 4JHAL 5ID0A 4EN3A 4RGNC 3ARBA 3W0WE 4F9PA 2VQTA 1YQ2A 2CKBA 1X5FA 3NFPB 5FM5O 2CDGA 4W68A 2NY6C 4DVRH 2VDML 2BNQE 3EYOA 4XMKL 2HT3D 1H3TA 2NYYD 2FBOJ 4XGZB 5E7FA 5B39B 1TETL 3S3PA 1NCWL 2IJ0C 2JELL 4HFUH 4YHNA 3J7HA 1ZS8A 1R3IL 3MRGB 4PV8A 4BFEA 1OL0A 4XVSH 1LP9B 1Z2KA 3F12B 3U9PH 4MS8D 2Y07H 3OXRB 5DD6A 1T3FA 4Z76A 3M8OH 2NY2B 2JLLA 3JWDC 3PQYE 2AKRA 2DL9A 4L8DB 1AGCA 3FTGB 5IQ7H 3JTSB 1R5VB 4J12A 3Q5TA 4OF5A 1DDHA 3EO0A 2YD8A 3GRWA 1MFDH 3MFFA 4TUKH 4U3HA 5DJCA 4D0BA 3OXSB 2ARWA 3X14B 1QLRB 2J5LB 1A1OB 4FXKA 1XCQA 2OJEB 1DVFB 1I9IL 1I7UA 3PDDA 3WEXA 1E4WH 3HNTL 4KI5E 4ODBD 5C8JB 1OP3H 4E5XA 3FOLA 4JM2A 4KTDL 4DFIA 3SKOA 1UB5B 2LU3A 1W0YT 3OAZH 1F4WH 1UKSA 4HUXA 1HHJB 1RUMH 4NNXA 1ACYL 2KQMA 1ORQA 2F58L 5E1AB 1QKZL 1KB5A 4X6FB 1BFTA 1NC4D 4QY8B 2AXFA 1OCWL 4M7LT 4UDTA 2E7MA 1FAKT 1N7MH 1K4DA 1N0XL 4ZXBA 4N0UA 4PBVC 4NQDD 1ZK9A 1EHXA 1P5UA 1VACB 4WI5A 3EFDL 4MX7A 4OKVA 4P9HL 3MNZB 4RGOL 4V1DE 3FO1A 4HS3A 4RNRB 4XCFL 3O4LE 5AD0B 3DV4A 2WUCH 1IGTB 4KFZC 3VGFA 1FN4B 2GFBA 2VZVA 1FCGA 3LHPH 5AG8A 3SOBL 2OI9B 5TE7L 1EEYA 1YZZA 2W92A 5AYUL 4YO0A 1YMMB 2QR0A 3D69B 2YD1A 5T3XH 4M4PA 2BSRB 2NY3C 5EZJB 2QQQA 5BVJB 2FJFA 1S9WB 4ODVL 1QBLH 2HJLB 2Q1EA 2HH0L 3GMQA 4JRYA 2ZSWB 4EN3D 3ARBD 1KCUH 2DD8H 2MCG1 3GIVA 1IGYB 3SDAB 1K4CA 2J8OA 2V5TA 4LASL 1EEQA 1NEZB 3C5JA 4IOIB 5EIIB 3UTOA 4LCUA 2JCCA 1JL8A 1JPGA 1JRHH 1N8ZA 3OKMA 5A16B 4G7VL 4N90E 5EO0B 3BW9B 3IT8D 5IKCB 1DBJH 4DUVA 3V5DA 2A83B 2D0FA 4JZJB 3B2VH 4JDZA 3MRNB 2H2SD 4PRIA 4ZUWA 5IOPB 1P1ZA 1YYLH 1S9KC 2DQFB 2H32H 4EZMA 3OJDB 5CS7A 5HBBA 3P11L 4NKOB 1T0MB 4K8RL 3MV9E 3MV8B 5D5ME 2ENYA 5GISL 1MF2H 3VA6A 2QQKL 1UVQB 4MNGB 4X6DF 1R24A 3U0WL 1W72L 5IMOB 2NXZD 2R2BB 3FOMB 4G8EA 2VR4A 4O02L 3D5OF 4L5FH 3SJVA 3MGOB 3RFZC 3GMPB 2FATL 1A6PA 1K8DA 3QUYB 4P5KB 4AENB 2X1WL 1TVHB 5ECJE 3O9WB 4HAFA 2HRPL 3QXTA 2AJVH 5GSVB 4K2UH 3TESA 3NZ8A 2YKLL 3CFBA 3MR9B 4Y4KC 4BFIB 2IBGA 1IZJA 5JHLH 1AD0A 1FDLL 3MNVB 3HI6L 3L1OL 3ES6B 4HMCA 4ETQB 3BIAX 4R8WL 1BZ9A 2YEZB 5JIKA 1MRDH 2EIBA 3UTZA 4M7JL 3QXVA 1HQ4B 3QB7C 4M7LL 1AGDB 1Z6JT 4NZTH 1LK2B 3P77A 4ZS6D 1MWAH 5E2WL 4Q2ZB 1BF2A 2NX5B 4HHAB 3BKCH 5IBUB 3U4BL 1UQSA 3PWLB 3I6LD 3JWOL 2J6EH 5F72S 5B3JF 4ZXBD 3EYUH 4H8WC 1CE1L 3SQOL 1KELL 3L3KA 3MGTA 2DWDA 2F5BH 5ADPL 4CVXB 1WT5C 3DX8A 3RX5A 3SO3C 4JQXA 1MCRA 2H26A 1HXYB 1ZWIA 3TYFA 4NO5A 4FZEL 5CP3A 4GAJH 4ZFOL 1LNUA 2WINA 4XP1H 4YHOH 4I18A 2H2PD 3EYSH 1Q0XL 4WO4A 5KVEL 4J3UA 3L6FA 1S7TA 5CMAB 4M8QB 5GZND 5I15H 3L3GA 1D5ZB 1GH7A 2ZKHL 3UJJL 3PHSA 1ED3A 4AEEA 1WWBX 4KDTC 4NP4L 4MD5B 2ATKA 5DTFB 3ARDC 1DQQB 1ND0A 1LP9F 3QHTC 4Z7WA 4XP6H 1KEML 4EN3C 3ARBC 4JRYD 1EPFA 3S5LB 4JPWL 1E4KA 4HEPG 2AJSL 3OAUH 1ZLUK 5JIPA 1F6AB 4X4YB 3TNMA 2R0WH 4MA3B 1ES0A 3D6GA 3LOWA 4YBQD 1UJ3A 5DEFB 4OZIE 3RGVA 4OZFB 1PKQB 3DUHA 3MCLH 3LKOA 4LLYA 3ET9F 5JO5A 2BSSA 4WW1A 3X11B 1FE8H 3T2OA 1H8SA 2H2SC 4L8CA 1FZOA 5GHWH 1RIUL 4PRID 3ARUA 1G7LB 4X99A 3FO2B 4YE4H 1XF2A 3TNNB 1GXEA 1BLNA 1U8PB 5F1NB 2AP2A 4UQ3B 4QT5A 4WFEE 3AMLA 5KANG 1WTLA 3QXDA 3U0TB 2Q8AH 4X6CE 1R3JA 1HWGB 2AJYL 4CKVX 1JHLL 3GSXA 3RL2B 5F7DB 1A6AB 4NKQB 4D9QD 1IT9H 4S11A 2AQ2A 4LKCB 3SJVD 5DWUL 2DWEB 1DQLH 2I9TA 1WBYA 3LPWA 1CWVA 2XNAA 1FFOB 3HA0A 3QPXH 3WE6B 5J12B 4U1NA 1DQJA 4QGYA 5GGQL 2D2OA 4PJGA 3JV0A 4WDIB 1YY8A 5K33A 2K3TA 4OLYL 4RFOL 4JM2C 3U7WL 2GSIA 4AIXA 2EZ0C 5IB2B 2R23B 4RAUA 1G0XA 4NPYB 5AWNL 5DJ2B 2VDQH 1U58A 3QDMB 4Z7NF 1NCBH 2BHYA 3DIFA 3DWTA 4CBPA 2XZCL 3KXFE 5F9WB 2MHAB 2K1MA 2Y5TB 1BQSA 4ZS6C 1YNLH 4OFVA 1IAOB 3STLA 3UTTE 4PS4H 1N5YL 1T22B 2JK5A 4PR5A 5GS2H 1JGVL 1V7MH 2GITB 3FN3A 3PWVB 3S88H 1KACB 5DD3H 3A67H 3C5SA 1N5AA 2UZXB 4NKMB 1E27A 3MRPA 4MJIE 5T5FL 1CXLA 3QEUB 2DLEA 3BDXA 5EN2A 3LKSB 3WNLA 2Q8BH 1AKJA 4U7SA 3QNYA 4XH2B 4GW4B 2CMRL 2H2PC 3BOVA 4XZUB 5GGRB 3TCLB 4LHQB 4WO4D 5KVDH 5GZNC 4NUGL 1A4KA 2DQTL 1GPOH 4PBXA 1NAMA 4J8RB 4K7FA 4KHXH 5J9PA 4QRRE 2EYSB 4QXUH 15C8L 1RY7B 1QBMH 4GRWH 1C5DB 5EBMB 5GJTH 4CRPA 4F57H 3BKMH 5CSZA 3ZT7A 3AS2A 2CDFA 2Q76A 3PUCA 4NQDB 3G6JE 4R96B 1QSFA 3M17A 3O2DL 4H26A 3REVB 1C1EH 1YQVH 3T2NL 1VSCA 2D7NA 3MZGB 5C0CA 4UT6L 4FFYL 5CP7A 1HILB 2OXHA 1DN2A 3HFMH 4ELMA 5FGBA 1T5XB 2OJZH 4ZO9A 4JJHA 3HZMB 3IDYC 1JI1A 4JO2L 2WSKA 4FQLL 4J3TA 4NRYB 3NZHL 4N0FB 1TTFA 4JKWA 1Q1JL 5GJSL 3GUTB 3C9NA 3AC0A 3C6LB 3K0WA 5C0BB 3NH7H 3PIQA 3ARBB 1LDSA 5JOPD 1CFTA 1T03L 5KSUA 4CN1A 3CZJA 4Z95L 4LHJB 3RHWF 2AXGB 5FGSA 4X7TA 2CDGB 1CTOA 4JE4B 3HG1E 5C9JA 3ILPA 4AZ8A 1I9JL 3EYOB 3VFNA 2VDLL 1ITCA 4PB0H 5HHNA 1EFQA 2AJXH 4Q97A 3L3JB 3FQTA 2EDWA 4YHNB 1NC2A 1DE4A 1YJDL 4PV8B 1OSZB 2GY5A 3MYJA 3QQNA 3VCLA 3ARZA 3E1F1 1SMOA 1ZEAH 3TFKD 5IG7B 1VPOH 1MREL 3P73A 4XHJD 3GI8L 5TE6H 2BNUA 3RIAF 1RJLA 4Z76B 1M71B 3UJTL 3EUUA 3KLHD 1CT8B 2C4FU 2AKRB 3CDFA 3P0YH 3QQ3A 1AGCB 3QWRA 1RVFL 3MX0A 4FHBD 4JPKH 1I1FA 4UILH 1F5WA 3RWJB 1JMXA 4MXWL 3TN0B 1EHLL 3ETBF 4WJ5A 2NXZB 4G7YH 2R1XA 1A02N 3X3GH 2WIIA 5FO7A 1DDHB 3LMJL 3EO0B 2Z31B 2NXYD 5DJCB 3MFFB 2JE8A 5EBLA 4FXKB 1FFNA 1U3JA 4XMLL 5GRWA 2AK1L 2IPKB 1BIIA 1GGCH 4HJGB 4JZNA 4RBPK 1Y6MR 4JQXC 3C60C 3WEXB 1P2CA 2ZCKL 3GMRA 4F37F 3ZMRA 2MWCA 5IW6A 3OWEA 4NKIH 3WJJC 1AKJD 4E5XB 3GHBH 3FOLB 3BIBX 3V5KB 5ICXA 4UV7H 4NC1E 4I18C 3BQUA 4DEPC 2E9IA 3SKOB 1QYGH 4WO4C 4YHLH 2R56L 1OAXH 4XCYA 4FQXA 5GQBA 3O45A 4NNXB 5AAWA 1YEHH 4UINL 1ORQB 4U05A 4PREA 2YXMA 1A7QH 5C0GB 5D7SL 4Y0GA 1KB5B 1T1ZA 5HHXH 4RDQG 5C0RH 5F9OL 3TA3A 2NY1D 2DRUA 4AMKL 4KK6D 1E4KC 4ZXBB 3IDJB 3SEPA 5MP6H 3UDWA 3K3QA 1QSFD 2VWEC 3MLTA 4HS3B 4WUKH 1QNZH 4HLZH 3T3PE 3KLAB 5C0CD 5JW4M 3RA7H 4OLZL 3RGVC 3LEYL 4HSQA 4OCWH 5CZVH 4OCXH 3E0GA 3HE6A 4K9EC 1A14L 4CMHC 3FO0L 1EEYB 3NBNA 5IT2H 1T83A 4PJCE 4YO0B 1TFHA 2QR0B 4PB9L 3NCBB 4XTRD 3QCVH 3P9LA 1V5JA 1RQ5A 1LO3L 2EXWD 4NZRH 1IEAB 3GMQB 4HWBA 4JRYB 3QFDA 5FV2A 5F44A 4ZOAA 3NFSL 3BVNA 3OZ9L 5C0EA 2O5XH 1OY3B 5HVHC 4ZS7L 2J4WH 4X6EB 1B0RA 3MJ7A 3C5JB 3P3YA 5C0IB 4ODXB 4M3KB 1I3RA 1JPGB 1UACL 4O00A 3G6DL 5ILTH 1DUYA 5DQDL 2OTUA 3OB0H 1NC2D 5D71L 3V5DB 5DRZA 1XF3A 2A1WL 5H2BA 5ITFB 4TPRH 2XY2A 3TFKC 4Y5VA 4PRIB 5E8DH 3LN4B 4ZUWB 3CFJA 1P1ZB 3S96A 4Z7UB 3HMWH 3HCVA 4YDKL 1KEGL 4M1DL 3THML 1LGVA 4H1LH 1R3LA 3KLHC 1BQUA 1MCCA 1CD9B 3QWRD 5D7IE 3E3QE 3U2SB 3QDGA 3EFFB 2VXUL 1D3CA 1R24B 3E6FA 5EUOE 1CF8L 3HAEG 4G8EB 3WUWB 2V2WB 1XGRA 3QUMH 2DLHA 5BJTB 4KGJA 1PEWA 5AG9A 4FXGA 1WWAX 4Q0XH 1K8DB 3U7YL 2XWTA 3JWDH 1KCSL 1HI6A 5JTWA 1JZ2A 4ODWB 5HYFA 5EUKA 2HA1A 4MD4B 2BDNH 1MJJA 2MMXA 2CIIA 1MCSA 1F90L 2WBWB 3ARYA 4LOUD 1AD0B 3BQUD 1WCBA 2EC8A 4DVRL 3J8F7 5JXEC 4I4WA 4FQXD 4GAGH 3DMMA 4APQA 3ULVE 5LBSH 3S36X 4LL9A 1JYWA 5IHLB 4HFUL 2YR3A 3TA3D 4BK4A 2R69H 3UTPE 4XVSL 5FK9A 3U9PL 4S2SA 5DMGD 2HVJA 3HI5H 3V4PH 2Y07L 4WI3A 3L3KB 4DJMA 1S7XA 1WFTA 4IIQA 3TZVD 1JNNL 2F9BT 2DWDB 3M8OL 4Q9RL 3GJEA 3EDFA 2W60B 2HAZA 3CSYA 1KIQA 4EQ2A 4ONOA 2H26B 3FQNB 2APTA 1ZWIB 1UWXK 1RV6X 5F93C 5IQ7L 5T3ZE 4YDVA 5FGBC 1X5YA 1PBYA 4PJ5E 1LNUB 2WINB 3TEUA 2VZTA 3HE6D 1V3LA 4WO4B 2HT4D 3NACL 3VGAB 1MFDL 1S7TB 2G75A 4TUKL 3AREA 5E00B 1JWUA 3L3GB 5F3HA 4XTRC 2ICES 4OF6A 1ED3B 5DS8A 4C83A 1MPAH 3AXLB 4O9HH 5IBTL 3G9VA 2VXSH 4P3CL 3KPSB 2EXWC 4JO4H 2ATKB 1E4WL 1ND0B 3P40A 4QRQA 4Z7WB 4RAVA 3BT2H 2NY0D 1AP2B 3MC0A 1XF1A 1DQTA 2C3GA 1C16B 3A0OA 5D2NE 4DOHE 3T65A 3SGKA 5FUCC 3N1MC 3RQ3A 1F4WL 5CJBA 1RUML 2XQYG 3CMGA 1ES0B 2A6IA 4Z7OE 3GK8H 1UJ3B 4HD9A 1SYVA 3T3ME 2WNGA 2FR4A 3MFGB 1WTGT 3Q48A 1FZJA 5CGYC 1H5BA 4Q6IB 1N7ML 2XTJD 5A3ID 3VDAA 5CWSA 5GGSY 4S1QH 1BF8A 4X99B 1XF2B 3KPOB 3WN5A 4JHWH 5GGUA 3DGCR 5CJOH 2RQ8A 1FRGH 2FJHB 2RHEA 4N0YH 4GQ9H 2WUCL 2APBA 1B0WA 4JKLA 1IGCH 3UO1H 4NN6C 3QQ4B 3QDGD 2CK2A 4KJYB 1NCTA 1NLDH 3QUKA 5SX5K 3GSXB 1KENH 4NN7B 4XPAH 3BDYH 2ZJSH 3LH2H 5CZKA 4TULH 4JY6A 3DX7B 5T3XL 2I9TB