3EOYG

Structure of reovirus sigma1 in complex with its receptor junctional adhesion molecule-a
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
102
Chain Sequence
SVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTTRLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of reovirus sigma1 in complex with its receptor junctional adhesion molecule-A
pubmed doi rcsb
source organism Reovirus
molecule tags Viral protein/cell adhesion
molecule keywords Outer capsid protein sigma-1
total genus 19
structure length 102
sequence length 102
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eoyG00
1ADQA 4ONOA 4FQHA 1MI5B 2E9IA 4IIQA 2JIXB 2DQDL 5E9DA 3GRWA 4TRPH 1I7RB 3UTTA 5L2KE 4APQB 2VH5L 4MDJB 3I3EA 5IGXL 4HKJB 3O11B 4BQ9A 3TT3L 4Z0BH 3FAWA 3VD3A 1DEDA 2BMKB 1HHGA 1FORH 3GIZL 5I1EL 3ARBB 3LQZA 1EAPA 4Z7UB 3QXDB 4XMKL 4NQXB 3UTSD 1CZ8L 3B3IB 2YRZA 3AU1B 1I9IH 1B0GB 1KXTB 2EYTB 3NACH 3MYJB 2N7BA 1NLBL 2AV1A 1R3KB 4NO0A 1FORL 2FJGB 2XOTA 3BP7A 1JGVL 1V7ML 4U7SA 2QHLA 2QQNH 4XPHL 1F90L 2VE6B 1G9NL 4ZOEA 4JQIH 1JPFB 4IMKC 3PXJA 5E0QA 1JRHI 2XWTA 1GZQB 4FQIH 1TVDA 3RHWF 1VFAB 2Q76B 2YMXH 2HAZA 2YA2A 3GBNL 4WO4D 3V6OC 4GG6A 3T0XA 3H9SD 3K4ZA 5AEAA 4LLWA 1C1EL 1XEDA 2WINB 4JY6A 3GUTA 2PYFB 1DN2A 5DC9B 3BHBB 1BD2B 3F58L 4GBXB 3TA3D 4CMHB 4L8BA 4X9FA 3HKFA 4CU7A 5F7EL 3K4AA 3MLXH 2F74A 2HWZH 3QXWA 4P2OC 4YHKH 4KQ4L 3G04B 1G7HB 2MPAH 1F8TH 4EOWH 1NEZG 4OFDA 2IH3A 2ZG1A 4YHOL 3QO1B 1T5WB 3X14A 1JV5B 1HI6A 2BNRD 3X17A 1N6VA 5DHVH 3SQOH 3LB6C 4DVBA 1T03L 1A3LL 1T04A 4EVNB 3LHPH 5B3NA 3SDDB 5C0CB 1U8LB 1DBAL 3ECBA 1XT5A 1NJ9A 1U8LA 4CADA 4RNRA 4LQFH 1VFBA 2VL5A 3MUJA 4UAOB 1CDGA 2GK0A 3QEHB 3HRPA 2XZAL 2X89A 3S34L 4JREB 4H1LH 1CD9B 4CDHA 1LEGB 3NCMA 3AREA 4OUUA 1OSZB 4YHPA 5FDWA 1OTUD 3GMMB 1KJMB 3B8SA 1CK0H 3DVNA 1G7IB 1I7UB 4QTIL 1GGTA 4FQQB 2WZPD 3TBTB 1KJVA 4P3CH 1OW0A 4R6UA 1J1XL 1QSEA 2NPLX 3CVHA 4JG1H 1NCAL 3V5DA 7CGTA 1KIUA 4PJ5A 5LCVH 2APXA 1XCQB 3CXDH 4PV9B 5IBLC 2UVEA 5FUZL 1F6FB 1K6QL 2M2DA 5KSVB 4CAGA 4C56A 4PG9B 3VGDA 4K8RD 4PY7A 5D71H 3SDXE 1IAIL 4FN0A 1OM3L 4WFFE 1A6TB 3GKWH 4AJ0A 4FQPA 2GQHA 5BCAA 3LD8C 3FQUB 4MAYB 1HYSC 2EEDA 3INUL 3U36B 2IPUK 3WV0A 3DARA 1SY6L 3L1OH 4NRYA 2B5IC 4Z0XA 4D0DA 2JLLA 1DFBH 3EHBC 1NFIB 4OLUH 1TQBC 3D85B 4H25A 2XA8H 4OZFA 3D0VB 3O2DH 3H9HA 4ZPVB 2VNCA 1LHZA 4N0RA 3ULUL 1CQKA 1S7WA 1A7OL 1BAFL 4NPYA 4X6CA 5E7FA 2WAHA 5DK0B 4M93C 4JFPB 1QOKA 3Q0HA 5F6HI 2QHRL 2FX8L 2X05A 4PJAE 2OL3B 1K5NA 1QA9B 3QCUL 1WSST 3BGMA 3NACL 4HH9A 1DVFB 4ZYKA 3IAQA 1CZ8H 2J5LB 3P4NA 3QNXA 1PYWB 1VKXB 2EDJA 4PP1D 5AD0B 5E2WH 2E6QA 2GSGB 4HWEH 1EEZA 1ZVHA 3IDJB 3MGTB 4RBPK 5C08D 1KCUL 1IILE 2BERA 4M9PA 4P0DA 3DX6B 3FO0H 1G7JA 2CIKB 1NEZB 3IS0X 2IAND 5EORL 5BOPA 4N9GB 1BVZA 4PFEA 1PDKA 2YZ1A 1U93A 5FXCH 2AJSH 4P2RA 5JPNA 2JCCB 2IAMA 4DZ8A 5GGQL 5B38G 5D1ZD 2FX7L 2NX5A 5DS8B 3BEWB 2ZZUT 3D3VE 2P8LB 1XGRA 4X8JA 2M1KA 5E2UH 4QXTB 5DEFB 5AYQA 1DLFH 1XIWC 5KAQF 1YNTB 1MRCH 3RVXD 2MNUA 4I13B 4L9DA 5IKCB 3W0WB 4G8GA 3VI3F 3H8NA 1RHHA 3QT2A 2X1QA 4V2BA 3NPZB 4X8XA 3TT1L 2BX5A 5IB1B 3RVWD 1BFTA 4LCYB 5EA0L 3MV7B 2EXYD 2G5RA 2H32H 3L7EA 4JB9H 4XNMB 2E7BA 5DDHA 1RUKL 3T0EB 4XP5L 5ID1B 3PWLB 2W65B 4CNIB 1ZEAH 3VCLA 3O6KL 2CRZA 5DHYB 4Y5XC 3JTSB 4PJBE 2G5BB 2EYRB 4DKFL 1BLNB 1S9WB 2NY2B 3LEXB 3L7FB 1WZ1H 3PWPD 2P5WD 4HUKB 5IHLB 3WFEL 5ECJE 1MSPA 1IC5H 3EO0B 4CVWA 2BMKA 5C0AE 3MBED 4P46A 1YEHL 1WCQA 2R8SH 4PJ7B 1A6ZA 4PJXB 2IC2A 5C07E 3FB6B 3WKNA 1QFUL 2QKIB 4PJXF 2ERJB 2WBWB 2QSVA 3STZA 3TGXA 4TUJB 4K23L 3O4LB 3WE6A 3RGVD 1NCBH 4X7DC 4HLZH 1F4YH 2VKXA 5E6ZA 6CGTA 5T5FL 2DQCL 5I1IH 2J8UE 4OF7A 3Q5YA 1I8KB 4HLZG 4GOSA 3VFWA 3O6LL 1IM3B 1R3IL 4E41D 1N8ZA 3DRQB 3P0VH 1SYVA 4QXGH 4UUJA 5TGBB 4MA7L 5E6IA 3VFGL 4JFHD 3WXVH 1R5WB 3PQYD 3ZDYF 4U6TA 1T3FA 5GISH 4YXLH 2VXQL 3BIKA 3CXHK 3HCVB 3FOMA 5E08L 1FNHA 2EDBA 3D18A 2Z91B 3ARDD 3QI9A 3RTQC 3VFGH 3WXVL 1LK3L 3EOBA 4HQQL 2VZ1A 3WEXB 4XBGB 1CLZL 4B50A 1T83A 2GKIA 3DUUB 4ZOBA 2W9DL 3IRZA 2BOBA 1A7RL 3TBVB 1DQDH 1J5OH 4IJ3C 3CFCH 3QDGB 4Y4HD 1KLUA 2Q6WA 1LO4H 1N5AB 5KS9B 1HH9B 4OSUH 1LGVA 1GIGH 3C2AH 4JRXD 3QUZB 3MV7D 4X9BA 4I48A 4LDLB 2R4SH 4Q9QL 2XZCL 2Z31A 3PWJA 3LY6A 3ARFC 5KANG 4EUPH 3QDJB 4LBEA 3JTTA 3PWNA 4O51A 4M7LH 5T3XD 2LU3A 5C08B 5I16A 5KVDH 3KXFB 3JWDC 2W9EH 3QJHA 2OX5A 2R8SL 3KS0H 1W72H 2D9QB 2BFVH 4X6DE 4PTTA 1YNKH 1SMAA 1MCNA 3NCCB 5KSAA 4Y5YB 4JAMA 5H2BB 3S4SB 1P5UA 2AEPL 4FTVE 4OI7A 3S35H 1HIMH 4RFEB 1LEIA 2ARJB 4XVJH 1MCPL 3P3YA 1RZ7L 1JN6A 4L4VE 4F58H 5KTEL 3NZHH 1NMBL 3DPBA 4EN3B 3WJJC 1Z5LA 2OQJB 3AMKA 3VXME 4JRWA 4W4OA 2RJMA 4D8PB 4JB9L 1FJ1A 2NXYD 4JY6B 1ZTXH 3BKCH 4NSKA 5C0RL 3CUPB 3AROA 2WWKO 4GW1A 4KROD 3RPKA 5FM4A 4MXVF 4NN6C 4WIQA 1F3JA 3K74B 1JK8A 2GJ6E 1A0QH 4P5MB 3VXRD 1SEBA 3NOIA 1QPXA 1HK6A 1ZT4A 3TPKA 2HRLA 3QEQE 4UT7L 1WQVT 2B0SL 1A8JH 3G5VA 3IT8D 4XMLH 5C0CE 3P40A 5KSAC 3H9SA 3OG6B 4ELKA 2ZCHL 3VXUB 3QUXC 1BP3B 3MNVB 3VW3L 2VIRB 1D9KD 3S36L 3T2PA 1A6UH 1T1XA 2YKLL 1MREL 4PRPE 2YEZB 3ROLA 4YX2H 2L4OA 3ULUE 3G5YB 3UC0H 3OB8A 4Y1AE 2CKBL 3W0WA 3DVIA 1PW3A 1P7QA 1FZJB 5HDBE 1EEUA 3PL6B 1I9RH 2CLVA 4UMGA 1EHLL 2IMNA 2XWBB 4MB5A 3UO1H 1OARL 2ITDB 4PJIB 4WGWB 5CJOL 5DUBB 5EBLB 1P6AB 4PR5B 2VLKA 1NMCB 1FO0L 2DQEL 4PRHD 1BBJA 2MCPH 5ITFB 3SDDD 3RVUC 4HUVA 2G2RB 3I2CH 5FF6A 3OAYK 3U0TB 3S98A 1MOEA 4LSRH 2X09A 5F9JA 2YBRA 5JXAL 1NEZA 3KPOB 4J4PD 1K3IA 3VFTB 3RX7A 1CICD 3EYUH 3BJLA 4MJ5A 1IEAB 4X5WA 3MV9E 3SDYL 1NCWL 1KOAA 3DXAD 2JJSA 1XGYL 4NHUB 4RGNB 4QRTB 4J8RB 1MIML 1ZV5A 1VACA 5F1KC 4OTXL 1MCHA 1FGVL 4MWFA 4H8WL 1IBGH 1I1AB 1L7IH 1QFOA 4ZSOE 4XZUA 3HNVH 5GRXG 1HH9A 3Q3GA 4KHTH 1F00I 1RY7B 3U9UA 3TJHC 5EO0B 3ZE2E 1K6QH 3DROB 2BNQE 2HFTA 3R8BB 5J9PA 3DMMB 1JZ5A 3HNSH 5JXEC 1RZIB 5D2NE 2WWMC 5JIPA 2YR3A 1YEJH 1D6VH 1OPGH 1T1ZB 5I8KL 1UZ6F 1Z3GL 5DJ2A 2E7HA 3CVIH 1XCQA 2PETA 3TO4D 4KK8C 4X98A 4PP1C 3VA6A 1ZGLA 3X12B 1ZK9A 5D8JL 3S97C 4UOW1 1IM9B 1EGJA 4JM2C 1OF2B 2ZOKB 3RP1A 3S34H 1P2CB 4AIZB 2XZAH 4H8WC 1HKFA 4TSBH 4L3CB 1IGIL 5E99L 5KVFH 3IETA 3BPLB 3TIEB 4XAKE 3AXLB 5SX4I 3O2VH 2AK1H 3BIAX 5E4EB 4YE4H 1X5GA 4N8VB 4S0TD 1ZGLM 1LD9B 1KT2A 2Q3ZA 4YUEL 5H8DA 4NN5C 5H94A 5DJYB 5FCUH 4NQDE 1AKJB 3RDTA 1HHKA 2OBGA 3ZTJG 3KLSA 3EHBD 4YHIA 2E6PA 1J0YA 3PWUB 1QLRB 1OWRM 1HINH 2V5RA 4GKNA 5C0GB 4HWNA 3SBWC 4RX4D 1EEYA 2P24B 3VMOA 3NFSL 1OAQL 1CDYA 2EKJA 1SYSA 1HOCA 2VN7A 3HAEB 4NP4L 1HIML 2WBJC 4HS6A 2AVGA 1CFNB 1NSNL 4HXAL 3HMXA 5BO1H 4L4VD 1NANH 3TC9A 1YC8A 5JIIA 2Z8SA 5EBMA 3ARGD 3RL1B 1P7QD 4HUUB 2LQRA 4YBLB 3O3AB 4APQD 3EYSH 3QB7C 2PYFA 1KN2L 3SY0B 4XC1L 2E5EA 1W2KT 1WT5C 4JKWA 5I1LA 1B6UA 1WVZA 1J1OL 3C2AL 3IAGC 2J3SA 3FN0L 1C5CL 2QQNL 3ME0A 1MFDH 2VYRE 4P9HH 5KVGH 1ACYL 5LQBL 2H9GB 3BHBA 5CS7A 2VDPH 3U6RB 2Y7QA 3TO4C 3QDHA 3TVMB 1P6FA 2VXQH 2DYPD 1U8MB 3DXAA 3BGAA 1T5XB 1CWVA 3SDAB 4N1HB 4PJ9B 1MJ8L 1UCTA 1I7TB 3O3EA 5KZCB 3IF1A 1A6WL 3TN0B 1JUFA 2K3TA 3QG6A 4TSBL 5K9QG 1BIIA 5SWZE 4HKZB 4WCYL 3MMEA 5T1LD 5T1KD 2VH5H 4PJFA 5EPMB 5C0NC 2EKSA 3BQUA 2H26A 3WUWA 1U8OB 1J8KA 5IUSA 1KIPB 4JHAH 2FECI 3G08B 2EKSB 4J6RH 1RUQH 1M6OB 3MO1B 5TPWL 5JW4Q 3FRPA 4MDJA 5J4MA 1P4IH 1A02N 2OR7A 2IPUG 2P8MA 4H1LB 4RMTA 1RIHL 1ZMYA 4OZHE 1ZLVH 1A5FL 1TQCC 4DVRH 3KS0J 2VZTA 3WFEH 5CD3B 4LSVH 5L9DH 4D0DB 2R0WH 4ODUB 4K3DH 3QPXH 4LP4A 4GRWH 4QHMB 5EUKB 4Y4FC 3K4DA 1AI1H 2FYYA 5TQ2H 3RWFA 5DMYA 5HYIA 4X9IA 4I18A 2B1AL 3WKML 3MLSH 3QIBB 3QQ9C 2X2YA 3JWOH 5C0AB 3MLPA 1KPRA 4WUKH 3CK0H 4KJPC 4Y1AB 2NY6B 2Y36L 5A2FA 4L5FH 12E8H 4WUUE 3GSRA 2NY6C 1CFSB 3OHXA 1RIVL 3MUY1 1TPXB 1D9KC 3X11B 4HEPG 3K8LA 4FXGB 4KJWC 4OB5H 3HPJA 5HHXL 2EH8H 4F37K 3SO3B 1AXIB 3PABA 3HS0A 2XN9D 1A7NL 4IOIA 5CFHA 3GMRB 1H8OA 3O81A 4TNVK 1B3JA 3TCLA 1K5NB 1QA9A 4G9DB 4LHUB 5EOCJ 3WNKA 5A1AA 5EB9A 3MV8D 1WF5A 1UH3A 3TCLB 4XP4L 3LH2L 3RWJA 2HJLA 1F2XK 1O0VA 3ZT5A 4XNQA 2PW2A 5DURD 4X99B 3QIWD 1HDMA 2UWEE 2FR4B 2DD8L 3I02B 2XN9E 5SWSB 2C3WA 4QHUA 3VW3H 4ZUWB 5CGTA 4KJQD 3MXWH 5IHZB 3W9EA 2KBGA 2BHUA 5IJKA 4FFVC 4FQXB 2F54B 1NGXA 2J88H 4IRZH 3GNML 5TQ0H 2A0LC 2FX8H 3FQTB 5HGHB 5FIEA 3QEUB 5C71A 4LK4A 4ZOAA 4YIQA 1NAKH 4IRJA 4X4XB 5GPRA 3LRHA 5FM8A 1CQYA 5CP7A 1XF4A 4HDIB 1GHFL 3QQ3B 1KULA 1S7SA 4JFFA 1GL4B 3OXRA 1J0IA 3WN5C 4PJGB 4ODTH 3GO1L 3KXFE 2V5TA 4JCMA 3X3GL 4XX1G 3G5VB 3TO4B 3VG0L 1RZ7H 1GZPA 4UBDD 4JPWH 2BVEA 1AE6H 3NGBB 5KAQG 4AMKH 3TH4T 4NJ9L 4DCQB 2GTZB 3HNTH 2Q7NA 3VD4A 4NIKB 5I18L 1JWSA 5C6TL 4N0UE 5T3XE 1R6VA 4HC1H 1T1YA 1NJ9B 4LNVA 2DIJA 4PGCB 2JB6B 1I8LA 5SX4H 3MROB 2XXCB 4LPUA 5IK3B 2Q8BH 1CE6A 1GH7A 3GJEA 3M45A 1T0PB 1IQWL 4X6BB 4A2MA 3RPIB 5I66B 4NRZA 4DVBB 2QR0B 3DO7A 4LPCA 5ETUA 3SDXB 4D0CB 5L88H 3VFTA 2WLZA 5DT1L 4ODSL 2WBJB 4C56E 1GC1C 1B2WL 3SDXA 4D0CA 3FONB 4LQFL 1OSPH 1PQZB 5MEQB 5D4QA 4KDWA 5BS0E 5MENA 1XGQB 5EN2B 1ZLWK 1R3LB 4I8DA 2YPKB 4J1UA 3I50L 3KPPA 4NM4L 5DQDH 1T83C 2EIEA 5C0BE 2DTML 4X4YB 2PR4H 2XPGB 3M07A 3PF2A 2GJ6D 1KCLA 5JIKA 4MAUH 2CKBA 4JFDB 5TF0A 2NY6D 4K9EC 2WINA 5IT2L 3RUGE 1HHHA 2GCYA 4JGUA 1J10A 1U2CA 3JWNC 1J1OH 1CN4A 2DQCH 1U8IB 1GAFH 4OQTH 6FABH 3TM6A 4GQ9H 3UEZA 3FOMB 1U8PB 5T3XH 2EDOA 3SPVA 1BF8A 1I3VA 3PWPE 3T2NH 4U0RB 3ZKMD 5TDOA 3GSVB 2C3VB 1GSMA 4OJFH 3DOSA 1V05A 4GUPA 1BFVH 2DLGA 1E4WL 5I6XC 1NGPL 1HYRC 2BVUA 2DICA 5JQ6H 3STLA 3HC0A 1VA9A 1EXUA 3IKCA 4HS3B 5IB4A 2XQBL 3ULVD 1UA6H 5DGQA 2R15A 2X5PA 1IEBA 1BVLB 5ESAA 4DKEL 4M43L 1IAKA 3HZVA 3UAJC 4NQEE 5FO8A 2AJVH 3S36X 3G5ZB 4MSWA 1NGXB 3RA7L 4IHOA 3O11A 3D3VA 2VDMH 3HC0B 1CDCA 3WNOA 2ZCKL 4MSWB 3RJDA 5DYOB 2MKWA 4RAUB 3MRQA 5BS0D 1MCWW 2HA1A 5CSZA 1MHEB 1BVLA 3IU3B 2FWOA 5HVGB 3UDWC 4WJ5A 4M6MH 3OR7A 3ZT6A 3D0LB 1G6RA 3BPOC 3LEXA 1X5HA 4D0BA 1CT8A 1YN7A 4R4ND 5IHBA 3T3PF 3BE1L 4D9LH 1P4LB 5AZ2H 3KPMB 5J6GA 5I1EH 5I74C 5IB3B 4GS7C 5E5MA 2FATL 5J9PB 4MQTB 1MCRA 5EU6E 3WS6C 4FZ8H 1HHHB 5TDNB 4K94H 3KGRA 1UWEH 3D25A 4ALAH 3E3QC 2GUOB 2PCPB 4TPRH 5JDJA 4S2SA 2CLRB 3V4VH 2B1HH 4PRNB 4KI5C 4NO3A 1KG0A 2KL6A 1A6VH 1JZ8A 5T3ZE 3MRFA 4WI7A 3OAZK 4ETQA 4LCWA 3OSKA 3T0DA 4JRXB 3S35X 5DJ0B 1BREA 5C0AA 3K0WA 1JTOA 4JPIB 4MQSB 2CLRA 1TZIA 4JGMA 1LE5B 3HE7A 4NZUL 5D70H 1VFOA 1DUZB 2P7TA 2QR0A 2FECL 3LAFA 5DRZA 2A9ML 2WBKA 2NW3B 5D7JA 1HSAB 5F3BA 4P23A 1YQ2A 3U7WH 4ONHA 3ROOA 2EDEA 2LABA 5CJ5A 4IHOB 3QUMH 2ZWLT 4JDZA 2Y07H 3S5LG 3RWEA 4G8EA 1K4CB 1Q0YH 3U0TA 5TE4L 15C8L 1MCCA 1PJ9A 5FM5O 2NY1C 4LSDA 3U0WL 4G8FA 1ORQA 3MNZA 3UPAA 2ICCA 2IG2L 5LGHH 5JLZB 3RZCD 1JGEB 4NC0B 2Z9TA 1ADQH 4P2QD 3RZCC 4IRZL 1A4JA 2J88L 1QLFB 2DI9A 5DEGA 3H7BB 3JV0A 1U6AH 5HBBA 5EPMA 4PJ8A 5DFVD 4K71C 3HA0A 1KN4L 3EO1B 4CU8A 4Q9CA 1YPZA 3P2TA 2ICEB 4JFFB 3KHQA 5JOEA 3TFKD 2AGJL 3MREA 4ZUSA 2W65A 5IQ9A 4CNIA 1JNNL 5CEZE 5IT2H 5AYUH 1ED3A 4P4KA 5IKCA 4XNMA 2ADIB 2XG4A 4FA8A 2H9GA 5FV1L 4HKBB 2I07B 1S7TA 1JBJA 5CIPA 2NX5B 5CD5C 1F3JB 4E42B 4JHBA 3B9EA 3QI9C 4U1JA 3ZKXC 3MLWL 3WFCL 1UACH 3C6SA 2EO9A 1WFOA 5GSRB 1RIVH 5CIPH 4DZBB 4P2RB 4OFVA 1YNTA 4DN4L 4MNHB 2Y9RT 3DTXA 4FG6D 1A0QL 5F1IA 5H2BA 4NBYB 3VXMA 4PJ8C 3QWRD 3L3JB 3ARPA 1QFWH 5CEZH 1UCBH 1C7SA 2XQYG 4TN9A 4AZ8A 5DJXB 1ROWA 3C6LD 1JF6A 3FCTA 2IAMB 3PL6D 4FQLH 3HS0B 5FYJH 4DZ8B 1G84A 5K9KA 1U9KA 5CHNB 4ZXBA 4LLAA 4MA3A 2E9JA 1HQRA 3O45A 5ERWB 5F3HA 5IK3A 4CN1A 1B6DA 2NLJA 3I6GB 1P5VA 1HOCB 2ATPB 4Q6IA 5L8KB 5GJSL 3B8YA 2F19H 3SQBA 1KENH 1D5XA 1L9NA 5E1HB 3UPRA 3P0YL 1JGUH 5TE6H 1QEWB 2CK2A 1JV5A 4F8QA 3OHXB 1OT1A 3V6FB 1CYGA 4HFUL 1ZA6B 1G6RL 1NGQL 4GXUN 1TTFA 2CIIA 3FFCE 3G04A 4TPRL 3VXPB 4NNXA 1MUJA 4RWHA 2XRAL 1G9NH 3FL7A 1JFQH 1SY6A 1V7MH 1LNUB 1NPUA 1ZE3C 2ZNXA 1CGSH 3S4SG 3RI5F 3DURA 3R4DA 1BM3H 2HFEA 4YHYC 4Z7VE 2FATH 1GPOH 2X4UB 3RVVD 4BFBD 4HZAA 1HCFX 3T3ME 3O4LA 5EU7E 3PG2A 4ZTPH 3EYOA 2NR6C 1IAOA 1F97A 1TZHA 2C4FT 4K7PY 2O61A 2XY1A 3RBGA 3E6HA 4IM8A 1MVUA 3ZDXE 5ACMA 5SWSA 3V7MA 1BQLL 1U3HB 4H88H 1S7VA 2C26A 4MS8C 2FEDC 3U9UB 2HJLB 5DR5H 2PXYC 4JRYB 4IMLB 5HD8D 1U3HC 4EIZC 1U8OA 5GSVB 1ZT1B 3RZWA 5C1MB 1XGUB 1U8MA 5GRUH 3CVHL 5CEXB 5J13C 2VLME 3ULUF 5DRNB 1RZJH 1A7QL 1RJZA 1KNOA 4DN3L 1M7IB 5GGSA 2ZUVA 4UI2A 3FFDB 3JZ7A 5FA3B 2ATPA 4R4NC 1NCCH 1FPTL 4JPKL 2DOCA 5EOQL 4TUKL 3MLZL 5T3XL 1LP9A 1AD9A 4HIIB 4YHYB 2GJ6B 3UTTB 3SCMD 2AERT 5IB5B 3MR9B 1KPRB 4G6MH 3BYTA 3AC0A 2WSKA 5E9DD 5EBMB 1UM4H 3B9VA 2FBOJ 4DUXA 2VDOH 5HHNB 2DMKA 4CW1B 2FL5A 4L4VB 1YEFL 3TEUA 2BHYA 1MJ7L 4UT6L 4HJ0C 1ZSDB 4M93B 1MNUL 3CDFA 1F3DJ 4BH7B 1MFAL 5AWNH 3OJDA 1S8DA 2CGRL 2YZ8A 3GMOB 4Z7WE 1YEIL 2F58L 5I19H 3VXNA 3FO2B 3WN5B 2C1OA 4LHQB 1G9MC 1JHLH 4PRHE 3DWTA 4O9HH 4X6BA 3HUJE 5JMOC 3MRMA 3BN9C 3FB5A 3PWPB 3ZE2F 1I7ZA 1DANU 4U49A 4DKAA 4P49A 1U3YA 4YHZL 3LD8B 2FRGP 2YPLE 2PTTA 2A1WL 1IGFL 4MNQE 3OKMA 5FYKL 4Q9BA 1MJUL 2HT3D 4G8FB 3BD4A 3Q1SH 4E9LA 1Q1JH 3LS5H 5GRZA 1WTLA 3RWHA 3U9PH 1DBMH 1M6OA 4CJ1A 1INDH 1MQKH 1EPFA 1ZT1A 4IDJL 2NZIA 5I1HH 2ZG2A 1HWGB 5A16B 1MNUH 2MOVA 5C0BB 5CJQH 4JG0L 4E41E 3ZKXB 4OLXH 4WTXA 4QRQA 1UZ8A 4QT5B 3ZTNH 5FYJE 3AGVA 1IBGL 1L7IL 4ODXA 1INEL 1JF1B 5J12B 1T7VA 2OMBA 3O3EB 1UT9A 3C87A 5DVOA 5ICYA 4HGMA 1T2XA 2FSEB 3ARFD 4X9HA 2O5ZL 5L7XH 4KC3B 1BBDL 4K3JL 1FYTE 3BDXA 4XWOD 3QBTB 4NDMB 5D93C 2YN5A 5D9SB 2C4XA 2F54A 4K3EH 3OGOE 3QULA 1NCCL 1P69B 2NZ9D 4ZAKB 2ZPKH 2IAMC 5JA8B 4KRMB 4P2QA 5JPMA 3TWCH 2XZQL 4RGND 5FEBA 3V5DB 1FFOB 4L1DA 5ISZD 4O4YL 3RVUD 1JNLH 4GKSA 3FQWA 1OAQH 4PJFE 3S88H 2DYPA 1KJ3L 4MNQB 1ND0B 3UZVB 3QI9B 3SGJA 4JFEB 2XKUA 5F1SA 4GG6E 4FMFA 1A6UL 2AK4D 4WI2A 4R96A 4DN3H 2Y06H 4PP2B 1MCWM 1IAMA 4JY5L 2P43B 2VZ3A 3PUCA 5DK3A 5GRUL 4OZHA 1BEYL 3MRKB 4Y1AD 3SJVD 5J6GB 4QGYA 1RZKL 4MCZB 1T89C 1GGBL 1S7VB 5BMFL 3PL6A 3UTPD 1T4KB 4K94C 4ZXBD 1J8HB 4XVTH 1P84K 2AI0L 1FLRL 5DT1H 12E8L 1MLBB 1XIWD 4X7EC 3QWRA 1U8HB 4CN4A 4LHUG 2AJXL 2JB5H 3SKJL 3MRLB 2ZOKA 1KLGA 1NMAL 3TN0C 2P45B 3BDYL 3R0NA 5H94B 2A6DA 4PLJD 3O6FD 1Z0NA 4GUPB 1XR9A 1TIUA 4NQSB 1K3ZA 1U8KA 4PJ9D 2X7LB 5IM7A 2H32B 1EX0A 3L3IB 5T1LA 4HBCL 1KJ2L 4HS3A 3SDXF 2P46B 1P2CA 2DRUA 2PYEB 3QDMD 4YXHL 4B7IA 1CLCA 1CGSL 3U46A 3KR3H 4RMSA 4F7PB 3HE6C 5I75B 4XPTL 4GO6B 4NZDA 5TDOB 1HYSD 3TLRA 2OLDA 3CCHA 4FQ2H 1VFAA 2Q76A 4RRPA 4Y4FA 1G6RH 3X3GH 4P9HC 3MA9L 4JO4H 3I75B 1S9VB 4PJFB 4OF8A 3O8XA 1H3VA 1NCWH 3SDYH 5IHUH 3SDCD 5C07D 5KSUA 1FCGA 2XN9A 3ARGB 3LV3A 4PJ5E 4QHKI 4ZNEE 5CEZL 5TDPA 4G8EB 4OSUL 1BMGA 3MQIA 4ZODA 2XICA 1WZKA 4ZDHA 1VACB 5CGYC 1A7RH 1UB5B 4APQA 4JJHA 4JFZL 3REVA 1NLDL 4PRDB 4QWWD 5B39B 2BVTA 1RUPH 2RCSH 4OCXH 2EIDA 4U1IA 3D5OF 1JWMB 4F7EA 4KJQC 2VXVH 3CC5B 3X13A 3QG7L 1G0DA 2Y06L 5DUBA 5HHMB 2Q86A 4AT6A 1U58B 4PRAA 4JQXC 5EZOL 5D6DA 5C0ND 2ENSA 5I74B 1O7SA 3ZKQD 3ELAT 1PX4A 1P7QB 1GOGA 3V5HB 3KJ4B 4UIMB 1FRGH 4N8CH 1KG0B 2VB5A 1IGCH 4X6CE 2AS5M 1CE6B 1EUTA 2Z93A 1UACL 2DJSA 4PGJA 3VFVA 2VZUA 2DAVA 4LPWA 1WISA 3KJ4C 2X6MA 4KK5C 4ZOCA 4OCSH 1KN2H 2IQAA 3FHQA 4OM1L 1YY9D 3BIKB 2L0DA 5DZNA 3VI3E 2D7OA 3MRFB 5C09D 4JO2H 2W0FA 5LXGH 2R0ZH 2UWEF 2XTJB 1ACZA 4YAQA 2OR8A 4D9QD 3L95B 1A1MB 3WNNA 3LQAC 1DBKL 2ID5A 3D39D 5I17B 5M94B 2OCFD 2RQ8A 4OZFB 1CF8H 1XF4B 4YHLL 4PJHB 1AKJD 3H2WA 4S1DC 5KSBF 4V1DE 4ELKB 2VDLH 3CMOL 4CKVX 2F5BL 3BN9D 4KK9D 3QQ9D 3PWVB 4M48H 2F8VA 4XCEB 5BQ7A 5I6XB 3C9NA 1HINL 4QTHB 4BUGA 4P9MH 3QCVL 3REWB 1FNFA 5BZDB 4N5UA 3RY4A 3SGEI 2WWKT 4F9LC 1EGJL 3D0LA 5DMGC 4C4KT 1ZHLB 2EDRA 2IG2H 2H1PH 4MD5A 4F7MB 5MENE 4HK3J 1DQQB 4WW2A 1ETZA 2HP4A 4I77H 2R0WL 3RRQA 2FR4A 4RAUA 1R3HA 1QVOB 5ADOL 2DLIA 4R4FH 3RWEB 1IE5A 4IDJH 5FYLL 4LPTA 5C0BA 2HTKD 4JDVB 3OQ3B 1KIQA 1HH6A 1YC7A 1Q9WA 3ARRA 4AIOA 5FYKH 2JE8A 3I02A 1IKFH 4F2MA 3RUGA 2FX7H 3LB6D 1ZLSL 3VD5A 4A6YA 4M3KB 3PIQB 2QLVB 2R0KH 1KTDA 5DHYA 3C5ZB 3VXQA 4NQUA 5KOMC 2QADB 2Z0BA 1OWWA 3M1BB 4ZUTB 3KPTA 4QGTA 5IVOA 4HS8H 4U6XA 1MQKL 1WC7A 3FT2A 3N06B 1X5JA 5DVKA 1KLUB 3GGWA 1DBML 4P3WA 3CSYA 1E6OL 2EE9A 1QR1A 3HN3A 3ARGC 4HS8L 2G60H 4Z77A 1W72A 4P5TD 4WHDA 2A1WH 5GISL 2BK8A 4U33A 2ADJB 4YJZL 4I9WE 5LGJA 1CD8A 3MJGX 2VZOA 3QA3A 3DX7A 1JPTL 4MD4B 5EUKA 3KPRD 3E2HC 3G9VA 5JPMB 2P48B 1JGLH 1REIA 4HC1A 1FO0A 5HXMA 5HHOA 2CMRL 2P1YA 1AY1L 2NY5H 1K8IA 5JW4M 3HE6B 5I75C 1ZKAA 5AZ2L 3EZJB 5DQJB 3AAZB 2OSLA 2OTWA 1F6LL 3GIVB 5JR1L 2OTUA 1RURL 2FHCA 4I4WB 1H3TA 2C9AA 3QHZL 4J4PA 3MR9A 3EJZC 3GSNH 5CBEA 1HILB 4TUKH 2BCKB 2V17H 4QHKJ 3NN8A 3C08L 3IDNA 4GRMA 4HT1H 1L4IA 1YEFH 4GLRI 1NGPH 1E4WH 3GSNA 1EFQA 3WLBB 3FT4B 2A6JB 2D31A 1BGXH 1IAIH 4JFPA 1OM3H 3PP4H 1KBGL 5KSUB 3ZYIA 3K46A 3M17B 4WY7L 3RWHB 1D9KB 3VXTB 1IQDA 4WNQA 3B83A 3HR5B 1EHLH 1KFAH 2DQJL 2YXFA 1EV2E 2G5BA 5A16A 2Q7YB 1UKQA 2EDXA 3B2UC 5E2VL 4LGRB 2AAVA 4TTDD 4FQXC 3OJMB 3ESUF 1Q9KA 3ISWA 2UZXB 5ILTL 3O41A 3QG6B 2PUQT 4LCWE 4FQJH 3K81A 4ZPVA 3B5GA 3VE0B 4X6DA 1FL3A 1WAAE 5FCUL 1EFXD 4GRWF 3FO2A 3WN5A 2V2WB 2WANA 2GY7B 2R1XA 2HVJB 4NJAL 3C5JB 2E7LA 4FTVA 4LIQH 3KNBA 5KVMC 4BH7A 3FB5B 4NNYB 5FK9A 5DJZA 3FQTA 3MRRB 1DBAH 1FV1B 1FRGL 3U6RA 1IGMH 1ZVSB 1T7ZA 4OFPA 43CAA 4PGBB 5DS8A 4EQ2A 1NBQA 3B5TA 4NWUL 4KK8D 4OV6F 4ZQKA 1TPXC 5JW3H 5MENB 4ZTPL 3VXRE 1TZGH 1DP0A 2ZSVA 1NAML 2AJ3B 4JJ5A 4WU7B 3GFUA 5D93B 1IL1A 3VXOA 4OLYH 4H5SA 5IHZA 4L4TD 5KG9A 5BJTA 3QR2A 3LKQA 3TJHD 3A67L 5JXEA 4ZO6A 3IDYB 2XRAH 3H9SE 4UB0H 5DK2A 1WICA 1FZKA 1RZKC 5BRZB 5I15H 5AZEH 5J12C 3O0RL 5JMRA 1QBLH 1IKFL 1YPZE 4HF5H 5DD1H 5A3IC 5JOFB 3TVMC 5CZXC 4QHNA 3VXOB 2ERJC 4TSCH 5A2KH 4PRPA 3SGDH 5IV2B 1XCTA 1WITA 1G6VK 1MAMH 3IFPA 4ODTL 2FX9H 1KT2B 1D6EB 5IW3A 4WEUD 4PJAF 3RKDC 3U7AA 1JNHB 4OLUL 4WI9A 2Z8RA 3D0VA 4OQ1A 2XY2A 1LO5A 3BO8B 4JPWL 2CUIA 3G5XB 4PJ7F 4CVUA 5J6HB 3EYOB 4KXZI 5CJXA 3I2CL 4AG4L 1S3KL 1TENA 3RY5A 5DJZB 1I8IB 3Q6GL 5EULV 4P2QB 4NHCL 3H9HB 4ZFGH 5ALBH 5CIPB 5CJOH 5DQ9B 1ZHBA 3E8UH 1NDGB 1T1WA 5LCVL 3EDEA 2LV4A 3FB8B 2WUBL 4JG1L 3VGEA 4KMTH 3D39B 3FZUD 1O5DT 5DVLA 1DDHA 2PXYB 1M1SA 5I1IL 3IDMB 5ADPL 2R0ZL 3B2VL 1KIPA 2DQDH 3T77A 1J87A 4OUUB 4YHPB 2D4DA 5EIQA 4QRRA 4ZSOA 5KSAD 4TVPE 4X6FA 1JI2A 4QT5A 3KWWB 2B0SH 1KJVB 3MTRA 1YEDB 3S5LB 2AABL 3WNMA 1T66C 4R4BB 3P4MA 5CJXC 2VAAA 3HFMH 5D2NA 5FKPA 4ZPTB 4U1NA 3LPWA 2Y36H 2R9HC 1EJOH 5HHMD 3E0GA 3KJ6H 1CBVH 3E8UL 1BVKA 4O4YH 1S5HA 4XNXL 3FFCA 1J05A 3GSOB 4J3XA 5IB1A 3C60B 3OKDA 3IXTB 3ZYJA 1RUKH 1DQTA 4AG4H 5JHDD 3DV6A 1MVFA 4WDIA 4GKOA 5K59F 4Z7UF 2Y23A 1CVSC 1E27B 1G7LB 3SY0A 5D70L 3CMGA 3O4LE 5M7QA 2E3VA 2C7UB 4CW1A 2VC2H 5DZLA 3HMXH 1G1YA 3BESR 1RURH 4IBLT 2P5EA 4KMLB 5B4MC 5HPMB 4PJXE 1JWUB 1R5VA 5C07B 2YXMA 1ZLUK 1LE5A 4NQDA 3D6GA 4HKBA 4W81A 2APVA 5I30L 4GAJH 1C08A 4LHUD 5EUOA 1C1EH 3CPLA 2JCCA 1OOAA 4NKIL 2XN9B 5SWSE 2VLRB 1EO8L 4FQIL 5IW6B 4NZRL 4LLUA 5CAYB 4RGNC 2R1XB 1M4KA 1S7TB 4YBQD 4GLRH 3NH7H 4NZUH 1S9KC 1U8NA 5AD0A 3WHE0 3WXWH 4HWBL 2NY3D 2BOCA 5IFJA 2X4OB 1A5FH 3MRRA 4YNYA 5HYJE 5CGYD 4PJ8B 1TCRB 1KJ2H 1MQ8A 2BP3A 2BVQA 3V4PL 3CFKB 4KJWD 4NSKB 2DQHL 3QNZA 1FC1A 2VAAB 3D69A 4L9LC 3V7AE 2R23B 4JQVC 4UBDC 3QCUH 4NPYB 3CDGA 3B4NA 1WFTA 2R0KL 4MA7H 4R3SA 3GIZH 1NMCC 3LSOB 1ETZB 2JB5L 4BQBA 2GFBA 9CGTA 3R06B 4O00A 3IJYA 5FB8A 1A3RH 2V5MA 4J23A 1NFIA 4KZEL 2N7AA 4O2CB 3MRLA 1MCKA 3MCLH 4XPGL 4N0YH 3UYRH 1I1AC 4Y2DA 2BSSA 2NW3A 3ARFA 1Z9OA 3BP6A 5A2JH 5T3ZL 4RFEA 1LEIB 5HHPB 1PLGH 4ZFOL 3DXAE 3FT4A 1J0ZA 1GGCH 1MLCB 3VFRB 5BO1L 2E9BA 3N1FC 1A1MA 1RUAL 3DETC 3T2NL 3QCVH 2ICWB 3CVHB 2X4UA 3MRPA 5SWZA 5DRZB 4AQ1B 5I8CA 4G9FB 5BXFA 5FUZH 1SBBA 3N85H 1QP1A 4O51B 1UA6L 1P1ZA 3K7UA 1K4DA 3VU2A 5IW1A 5C0DA 4UV4L 4JO3H 4U7MA 1MELA 2YPLA 5CEYA 5ALCH 3DMMA 4HIJA 4PBVC 5DJ6B 3UROR 4NHUA 1NANI 2DL9A 2NYYC 3BIBX 4H26B 5HYFA 2ZPKL 2EXYC 3DHMA 1ZA6A 3MRPB 1QFHA 3MJ9L 5J8OA 4PRAB 5CBAA 1I1AA 4F33B 4M6OH 4NP4H 1MAJA 5F89A 2G75A 2V2TA 5DRWA 1S7RA 1I8KA 2ZCLH 1HQ4B 1ZA3A 3RAJH 3FT2B 5JO5B 2CUMA 3IFOB 4PJGE 4OBSA 4FQCH 4WI4A 5KG9B 3QUXB 4K71B 4X4MA 1MFCL 4GRLA 5A40E 2LU4A 1XGPA 3X13B 5IQ7L 3L5WB 4TNWF 3GKZA 1LK2B 1J1PL 2MHAB 3DV4A 5ITBH 3I3DA 2P5ED 3CVIL 3GM0A 2V9QA 2EDFA 4LLMB 4MNQD 3ARFB 3MOAL 5F70A 1QRND 2V6HA 1YN6B 2F54E 4NGHL 2BVOA 3RWDA 4WUUA 4L3CA 4NN6B 4GG8A 2FZ3B 1CXLA 2MWCA 4KUCD 2A74A 4RAVA 5I71B 2PXYD 3BWUC 2UWEB 2EIZB 4XPBL 1N7ML 1TNMA 4MX7B 2A2QT 1Z9LA 4QF1B 4JCLA 3BZ4A 4ZAKC 2F54D 2VABA 4BM7A 3ROLB 1QSED 5J57B 4KPHL 3U0PA 4L29A 4WEBL 4ACPA 1F2QA 2CDFB 2YD3A 3BD3A 3O41B 1YJDL 3JWDL 1L6ZA 3CZFA 1OY3B 2UWEA 3QHFH 5EH1A 3VRJB 3WFZA 2QSCH 4TUOB 2BY0A 3BUYA 3DRTA 3NIGF 4XPTH 5GJSH 3EO1A 4YHNB 3VRLF 1L0QA 2VLJB 2DWEA 1PG7W 4PJEB 3N9GL 3BKJL 3L95A 3RHWK 1Z5LB 2OQJA 3SGEH 3K8KA 1K2DB 1MCDA 4V1DD 4OCLC 5EG6C 1FYHB 5FO9A 5BVPL 3QYCA 4NKOB 3MBXL 1P4BH 1S78C 2DI7A 3MXWL 5DHVA 1QBML 1H9VA 3LRSA 4OGXL 4YPGB 4U1GC 1CF8L 2IADA 3VFUB 1RUML 1EEZB 4IIQB 4M5ZH 4P48A 2DI8A 1JHKL 1XGQA 1OAUL 2MTPA 3KXFA 1WCBA 1I3UA 4HH9B 1YY9C 1BF2A 2W0KA 2B39A 1QFPA 5HSFA 3MRCB 5DTFB 3GSXA 2MCPL 5EU5B 4F57H 3QQ4A 5EZLA 1AIFA 5GRJH 3K1DA 3FFCB 4G6KH 1EO5A 3GMRA 4WHTB 1OGTA 3M8OL 1RJZB 3TNMA 1FBIH 1MCSA 4LU5L 4N0UA 4U1SA 1UB5A 3BRFA 1GGIL 1IGCL 5C0EB 4JPIA 3ZTJH 4EI5A 5FKPB 5J3HC 2KQMA 3MOBH 4LCWD 2ZG3A 1RK0A 3E6FB 2NY5C 3ZE0F 1FE8L 3IDMA 5INCB 3ALPA 1WIPA 4J3SA 1UJ3A 3OXSA 1KLFA 3C60C 3MZTA 4ZNEA 1U6AL 4L29B 2HRPL 3TYGL 3RX8A 1KV3A 1QSFB 2I5YH 4U7KA 4TVPH 5LBSL 1AO7D 5DVNA 5FGCE 4RIRA 4F7TA 4PJCF 3CX2A 1MCFA 4TQEH 5HI3D 1C5BH 4TUJA 3WE6B 2XQYK 4TOYL 2XACC 1QRNA 5HGAA 3QDAA 1H3UA 2F8XC 4DVRL 1S7SB 3K2UL 3T0EC 1JYVA 2J5LC 1ZTXL 3BZFA 4LLQB 2WQRA 4M8QB 4KUZL 4JLRA 1EVTC 3ARXA 3NGBC 2W9EL 1HEZA 5DLMH 2RR3A 3NA9H 4C83B 4DOHE 1NQBA 1XCTB 2HTLC 3ZTNL 3BO8A 4PJ8D 1J12A 5CJQL 2AXJA 1MHPH 1UXWB 3ECBB 5E8NB 3RI5K 5IMKB 2UUDK 4FG6C 5MEOA 3LKSA 4LSVL 1XIWB 4LHUA 3R06A 5IBTL 5BV7B 3CGTA 5JDSB 3PWPA 3FQXB 3BVNB 2DKUA 4DQOH 3UYPA 2J8OA 4TVSa 3DECA 1KELH 4HBCH 5GGTH 5J1TC 3WD5H 3H6JA 4MAYC 2J1KA 4FQLL 2BC4A 4J6RL 1EJ6A 5KVEH 4KRLB 3OBAA 2PO6D 4IOIB 4V1DA 1HE7A 1NFKA 2VDKL 1OQOA 4LLYB 4PJCA 3B9AA 4XHJD 5HGBA 5EIIB 1IC1A 4K94L 4OZFG 3I9GL 4NQEA 5E5RB 4NQDB 4OZFH 1U8IA 1DVFC 3MX0A 3WLWD 4S11A 1CLZH 2IPKB 3C6LB 5D7JD 1YEKL 4CUCA 3IRPX 4LIQL 3D2UD 4LP5A 5KN5A 35C8L 2C7UA 2ZUSA 2YPKA 1D5MA 4R2GD 1J7VR 2VLRA 1I8MB 2RFXA 1CIUA 4NDMA 1U93B 1WFUA 4OUOA 3RIFK 1TFHA 3JV5A 4FQJL 4ZQKB 5DFTA 4Y4KA 5GGVH 5ILTH 3HLAB 3OKKA 5D7KD 3SO3C 5ACZA 1IKNC 4UAOC 1KCSH 2GJZB 3CZJA 3RA7H 1OB1A 5JW4N 2ADFL 3WFHB 1E27A 1TQBB 5EU6A 4R26H 1WWCA 1MY5A 3RWCB 4HZLA 2Y6SC 1ZXQA 3ULVF 5GZOD 1CXIA 1WBZA 4Z6AT 2ARWA 2XQBH 2IAMD 4GFTB 2EC9U 2GITB 3SKNA 2APBA 2X4PB 1T1YB 1FFNB 3BP4B 1SEQL 1BZ9B 3TPUB 5I8OL 1BGXL 1DCLA 5DJDA 1DVFA 5GZND 5I1CL 3B6SA 4TULL 3U82B 1RJYB 5ICZB 2CR6A 2DBLL 4I3SL 5IMKA 3OB0K 3FQRA 5MEOB 4Y4FB 3U83A 5EOCL 1HKLH 3VFOB 4M9OA 3KPNA 5DJYA 4KVCH 4HKJA 4FNLL 4N0CC 3SE8H 3O6KH 1MRCL 1NFDF 3HI5L 4GAYB 4P99A 4U05A 2FJFA 4AEHH 5JTWA 1O7VA 3DLQR 4N8VA 3UAJD 3LIZL 4EDXB 4I0PD 3WUZA 3BFOA 4CMHC 2VSDA 5CSBA 1I7TA 4IRSD 2NY4D 3IDGA 3GMQB 2O61B 4HIHB 3D85A 3PJSB 4NQCB 4Z7WF 3OJDB 2Z92A 4URTB 2C3XA 1PEWA 4Q9RH 1KB5L 2JJWA 1Z3GH 4NQSA 1HSAA 5F3BB 3VXSA 1FFQA 1D6VL 2IBBA 4CMMB 3SDDC 2L7JA 3FO0L 3G6DL 3C6LA 4M1GH 2CJUL 1BM3L 1FG9C 1HCVA 4KWUA 3I6KB 5EO9B 3QPQC 5IIEB 1IGIH 1RZGB 3RZCB 3NH7L 2ATKA 2YC1A 4PJ9C 4HG4K 5KS9F 4JANA 3CU7A 5IJKC 4EDWH 25C8L 5IV2A 4KDVA 4NUJA 5DJ8A 2NY1B 3RL1A 4PIRF 1A21A 3FN3A 1Q94A 1XGYH 5B3JF 4GKNB 5DRXB 1T6WA 2GK0B 3P0YH 4KRNA 1N5YH 1DQLH 3NCJH 4JN2B 2B8OT 5SX5H 5GRWA 2ZUXA 1MFAH 1EZVX 2YHGA 3V8OA 5IESL 3HNTL 4AK1A 1CGWA 4AENA 3X11A 4D9RE 3MRGB 3PHSA 3QIWA 2X89D 1FHGA 4OZHF 1T5WA 4L8DA 3VFSB 3MLRL 3D2UA 1YEGH 3CDYA 2ZOLA 3EJYD 1A47A 2VDML 5E8PA 3RUGB 4D3CL 2HN7A 5GSRA 5IR1B 2ED8A 5K9OB 3B9KB 5BJTB 3S37L 4MZ2A 5E8NA 1SVCP 3QZWB 3L3JA 3CXDL 2VKWA 5BZWB 4DTGL 2AJ3A 4JJ5B 4XNYH 3MA7A 2QADC 3EAKA 1DBKH 3SDAC 1D5BA 4LSRL 3C5ZC 5IBUG 4I1NB 3HB3C 4AEIH 4UQ2A 1OHQA 4X6DB 4X5XA 1C7TA 1I4FA 1MEXL 1LMKA 3WHXB 3VXSB 4K8RL 5JA9A 4GS7B 3QFDA 2DM2A 4M1DH 4Z95L 3MRJA 5IJVA 1Q38A 3F7VB 5DR5L 2V7HA 3BPOB 3ILQC 3O6FB 3MREB 5I1GH 5J1SC 5C8JB 4U1LB 5ELIA 1RZIA 1HXYA 4FXKB 3RY6C 3SOBH 3UBXA 1VB9A 5EZOH 2Z93B 5I2IA 3B6SB 4WHCA 4YBLC 1Y6MR 1QSFD 3BPLC 3WYRA 3DSNA 3OAUH 4OIBA 4LDEB 2AJYH 2ZCHH 5GS0L 3GBML 1CDUA 4U3HA 3IFLL 3UCRA 3SDAA 1DQJA 3BSZH 3U7YH 4NYLB 4JFZH 4OAWA 1CTOA 5DMKB 5IFAL 4MGXA 4XHJC 2EDDA 2NY7L 1G9MH 3EO9H 1M7XA 4KVCL 4LGSB 4HUNB 4NFDA 3JV6A 1HKLL 5EOCH 5D6CA 3S35L 3FZUC 4Q0XL 2E8YA 4OCRL 2OSLB 3DGGA 3GIVA 3MLXL 1FYTB 3C5SA 4U4BA 3D1MC 4TSAL 4PRBA 5DTFA 1IQWH 3VGGA 1I9EA 4U0RC 1KXQE 1M71A 3J8F7 3LKRB 4JFXB 4MCYA 1WCBB 3VDCA 4PD4K 1AD0A 1YDPA 1U42A 4BSVA 1JGDB 4E41B 4LKXB 4R26L 1UM5H 3ARUA 2DQFB 5E4EC 4ZDHB 3QPXL 2IWGA 2AEPH 1KIRA 5F7EH 5FM5M 2V5SA 4TUOA 4EBQL 2IFFH 5FYJD 5IFHL 3OG4B 4S10A 1V3KA 4LCCC 4ODHH 4G6JL 1NGYA 4F37F 1QNZH 2WIIA 4PJBB 1FN4A 5FA3A 4WFEE 1G0XA 3D18B 2ADIA 4D0BB 2LU7A 3HMWH 3QFJA 3GHEH 3V4VL 1LP9E 5E6YA 1YEKH 1F4AA 3UJTH 3G6JA 3W39A 1M05B 1UZ6E 2NY2D 4ZUTA 3TT3H 2YD2A 3S7GA 2R1YA 1R3KA 1JGVH 5DYOA 1N8ZB 1FZOB 1SJEB 4BSWB 4HXBH 3QQ3A 3PV7A 4GG8B 3T08A 3Q5TA 4S1SH 4BJLA 2VABB 4OZGE 1MFNA 2UVFA 3OMZA 3QH3A 1AP2A 1RZKH 2X7LA 4NN7B 2LE9A 2NCMA 2NW2A 4HFWA 5JW4R 3DV4B 4PB9L 4OLZL 2J4WL 5K9JL 2P5EE 2DD8H 3GSNB 2Z8WC 4FOMA 4PJXA 1IM9A 4BSWA 3HC4L 3S96B 3HZMB 4AL8L 2PW1A 4PGEB 2JCCE 4UV7L 3MV8B 3QEQD 1DUZA 1YECL 4LMQI 3SPVB 3CDGB 4AEEA 1LE9B 2J8HA 4LBEB 4BUHA 2DLFL 3RNKB 5C09B 3BH9A 3N1QC 5FECA 2APWA 5CLWA 4JRXA 2R2BB 2BY2A 5KANI 3I3BA 1FFPB 2H45A 3DVGB 3VFPB 2A6IB 1YQVH 5EA0H 3OKOB 2OZ4H 3ARQA 3UP1A 4XI5D 1W8NA 4K3EL 5DRXA 3HE7B 3PL6C 1DR9A 4YWGL 1XF5B 2EICA 2XTLA 5F1NA 5IF0B 1FH5H 4PY8J 1D5XB 2I5YL 1OGAD 4HWUA 4OD3L 5EO0A 1BJ8A 1PKOA 4G80A 4ZUUA 4R2GB 1L9MA 2AXGB 3Q6FA 3UTTD 1A7PL 4X7TA 5E2TL 5GS0H 1SBSL 4DGYH 2GAZA 1ZWIB 1KTDB 4LPXA 4X0KA 3OAUL 5L8LB 1OL0A 4POZC 2NTFB 4YQXL 4HJ0D 1E4KA 4OI8A 3QUYB 3TNMB 3GSWB 4HCRA 1EJOL 3C8HA 2AJSL 4L4JA 1FYTA 3EJZD 4GW5B 4H20H 4I0PA 1TJHH 3UJIH 5CUSL 4Z7VB 3QUZC 4CVZB 1RIHH 2AK1L 1FBIL 1L7TH 2MKLC 1DBBH 4LU5H 4OQTA 2CO6B 2ICES 2ITDA 4J3VA 4PJIA 2D7PA 3OKDB 3MYZA 4JRYD 4IJ3B 2DF3A 4YO0B 4P2QE 4P46B 1T2JA 5AUMA 4NUGH 3UPCA 4RWYL 5L88L 2DLTA 3D48R 4KXZH 4NRXB 1BVKB 1TVHB 2PTUA 4I5BA 1T1XB 2I07A 3OKMB 1H3WM 4B5EA 1UJ3C 3QJFA 4PJ5D 1FDLH 3P4MB 4XNYL 1Q9OB 4OGXH 3VGHA 2HKHH 2YWZA 1KCUH 1PZ5A 3PV6A 1B88A 5ICZA 2E27H 5E2JA 1KB9J 5SWZD 1CDHA 1U8PA 2VLJA 4PJEA 2BOCB 5IFJB 1BLNA 3WS3A 3KDMA 1AGCB 1MIEL 2HFGL 1PG7H 4BQ8A 1IGTB 1QNZL 5FUCC 3WS3B 2V9TA 3L3GA 1UWXK 5T5NG 2XIDA 4Z0XB 3BEVA 4RA3A 5IJVB 1NBZB 2CKNA 2C1PB 1PZ5B 3H42H 3PV6B 4RQQA 4PJGA 3DX8A 1TQCB 4ZS6D 3CFDB 5IESH 1OAYL 2FL5B 3HG1B 5E94A 1J8HD 4PY7B 3QHFL 2VXSL 1SEBB 5EZIH 1JHTB 3RWDB 3O2DL 5J1AB 2NY2C 1DLHB 4Y7MA 3T1FB 5D96B 3LMJL 1JNJA 1JN6B 1AC6A 3RTQB 5TH2A 4Y5XB 3T4YB 5HJ3B 3CPLB 5JIHA 4X99A 2VR5A 5FHAH 1T80A 1TNNA 4NCC2 4D8PA 3LQAH 1KLGB 2Y5TB 4XWOC 2AXFB 3CC5A 4UZGA 2XFXA 5T1DL 1JWUA 1R5VB 2LAAA 4UB0L 1G7MB 4D9QE 2X4NB 3MGTA 2R29H 4GW5A 5DO2D 1LEGA 4EI6B 1ORSB 2WMPA 4OZIA 1CD1B 4B0MM 4LF3A 4MXWH 4V1DB 1NAMH 3HPJB 4K9EL 4XCFH 1VFBB 2VL5B 4ZD3H 5ISZB 3LH2H 4Y2OA 1CLYL 5LJYH 2OTPA 5FUOH 2FH8A 4OM0H 3FKUS 3S36H 3KLHD 1VGKB 4KU1A 4WW2F 4R96B 1A3LH 2I27N 4HD9A 4UDUA 3VD9A 2NXZC 1V3JA 4CU6A 5FUOL 3HE7D 2CRIA 5H37H 1SM3L 3LZFH 4UTAH 3HZYA 4PJGF 2C5DC 1MFBL 2CDGB 5E00B 5F1NB 3I75A 1DQJB 4XMLL 5D1XD 5C2UB 1OGAB 4HJJH 4JKPL 4FABL 5GGSY 5I1JH 3EJYC 1E4XL 2R29L 3KLAB 5E7BA 1R24A 4YFLF 1EIBA 2DBLH 2VLJD 3N50A 1N6QH 2BSTB 2HKFH 1DN0A 3TO4A 5JW5A 4HUXB 4QXUL 3L3KB 1NGZB 5J13B 1TETL 4LPVA 4J2XA 2Q8BL 1YYLH 4O02H 4JZNB 5CZVL 2BSSB 5CD5D 3F62A 4X98B 3LOWA 3NZHL 3CX5K 4KI5E 4MQXC 4J3OC 3RU8L 3UTZA 4NBZB 1FNSL 3F6LA 2I60L 4CVXA 4M1CD 4ODUA 1QLEH 1LO5B 1D5IH 5CP7B 2R4RH 4K3DL 5D7KE 1GVIA 4NJ9H 3QIUD 5FDWB 1XH3A 3H42L 1YNKL 1JTPA 3F58H 5HGHA 2VLLB 2DS4A 4P2OA 4AIXA 1RULL 4XWGH 2F9BT 4NN5B 43C9B 4MDIA 4L8DB 3VFSA 4G6AC 4PRIA 3DYMA 2BRRL 1BZQK 3FQRB 1H3PH 3WO4B 5DFVC 1JPSL 5K9OA 1H15B 5KSBB 1RJYA 4GAFB 3GK8L 3W39B 2HKHL 5F8QC 4WCYH 1N64L 3NFNB 2COQA 3PHQB 4JM2B 3TPUA 1NAKL 3W81A 3BPNC 5IMMB 4FXGA 3D69B 3DHJA 3VXNB 1KCVH 5A3ID 4LLUB 1I1YA 2FD6H 1LO0H 3BW9A 2W0LA 5DJAA 3ETBF 5MERB 2NMSA 4NC1C 3ES6A 4N0FA 4U3CA 1NCTA 3T0VA 1WGOA 3KYAA 4RZCA 1T04B 1W0YT 2CH8A 4XMKH 3OKEA 3V4PH 4WRLA 5I1AB 4PLJC 2EZ0C 3L5IA 3DMMC 1Y6NR 2GIYA 1CGUA 5IFHH 3UJIL 4P9HL 2ZSWB 1FCCA 2BY1A 4GRWB 4X7SL 1WK0A 4U0QB 3MV01 4LLVB 3MJ7A 5IGXH 3W5MA 1BJ1J 4RMRA 5F7YC 1BZ7A 5IG7B 3ZDXF 3GI8H 2YD9A 4TRPL 4WI6A 2B5IB 2AV7A 4GMSL 5IVXF 4NWTH 5IIEA 1JRHL 2ADJA 3N1GC 4K55A 3L3GB 1QD0A 4YHNA 2VXUL 1HSBB 5I0DA 2GSGA 3FFDA 2SEBA 4WENB 3HAEH 2OI9C 1A2YA 4LSUL 4H1LA 2VLKD 1AO7E 1ZS8B 3BMWA 4PJHE 3BP7B 1LP9B 2OJEB 4M7KH 4LASH 1QBBA 1FNEA 1JZ3A 2VC2L 1LDPH 32C2A 4FZEL 4OGYH 1H8NA 1J05B 2ICEA 2BJML 5DEZA 5C0FA 3KYMA 1AGCA 4DAGL 3EOYG 3BQUD 5I8OH 4PJFF 3WIIL 3WFBL 4PPTA 4PJCE 4XP5H 5DJDB 3MRIB 2EXWD 2UYLA 1NMBH 3CUPA 1A4JB 4NO0B 3SE4A 4YFEA 1KXVC 1X4XA 1A4KB 3BZEB 1CE1H 32C2B 5HHOE 2BHZA 4MYWB 4KKBD 3VRIB 1ZGLB 1QVOA 1MCOL 5L9DL 3MOBL 3HFML 3RDTC 4G5ZH 3T0AA 3WHXA 1AQDA 1INDL 5DJ2B 5CINH 1U41A 3TN0D 3UZEA 1FFNA 4OLEA 2DQIH 4JZOB 5DO2C 4LSUH 2AKRA 2O26U 5DD5L 1RMFL 1UJTA 4JHZA 3WLBA 5F72S 3W5NA 4YLQT 3PHOB 4FXLA 4PLNC 5DC0A 5TPWH 1BQSA 1EMTH 5IWLC 1IGFH 3T3PE 3MLUH 3TVMA 4NWTL 1RZJC 3VWJD 2I9LA 1LO0L 4ETQB 4KZDH 1B0RA 1XZ0A 3FRUB 1OAUH 3JTTB 3PWNB 1JHKH 1A9BB 3VJ6A 1F11B 2WUBH 1DUYA 3TBYA 4ORGA 3CSYB 4D9LL 3GHEL 2HMID 1OVZA 5DVMA 4GBXC 5IVZA 5L0QB 3FJTA 1IAIM 5EC2A 3KPLB 4PG2C 4XC3H 4EN3C 3GJFA 1WAAA 3PQYA 4P5TC 1S3KH 3KPMA 1OSZA 1B90A 4XWGL 4WW1B 5BW7C 5LQBH 1Z9MA 4MD0A 1MCLA 3LKPB 1OGTB 5TDNA 1FFPA 5JDSA 1C16B 4BKLB 4Y5YC 5HYJB 4JZJC 5IWLA 1D5IL 2X4NA 4KGLA 1UWXH 2HFFB 1SYSB 5GGTA 5FECB 4P2RD 3KPOA 3GSRB 1RSFA 3EYSL 4X83A 4QLRA 5IEKA 5DLML 3SKMA 3FQXA 4LHJB 4NKOA 4JPKH 4Y5XA 2DB8A 3MA9H 1IAKB 5EU4A 4MVBC 2GI7A 3VXRA 1BFVL 4HV8A 3KPSA 3LN4B 2FIKA 4UNVA 2MQ0A 2AXFA 2VWEE 1IL1B 3KAAA 3L9RA 1BD2A 4GBXA 2MJWA 4KFZC 5D71L 1EUUA 2W60B 3MJ6A 2MQ3A 1OARH 4J12A 2FJHB 3ARDB 1I3GL 2PF6A 1BQHG 4HJJL 3GSVA 1I9RL 3HI1B 5C6WH 5DMGD 2X1WL 2F15A 5D2LB 1EERB 5JW5B 2WQ8A 3MOAH 4H88L 4QOKE 3LVEA 4Y8DC 4QXUH 1MUJB 4MAUL 1J1PH 3MACL 1U95B 4Y4FD 3ZSSA 4NQCD 3TT1H 3AS0A 1E28B 3EUUA 5IQ9B 4JFEE 1WIOA 3VDBA 4LNRB 4XVSL 3UTOA 1TITA 2A74B 4RAVB 3T0ED 1KPVA 4K8RC 4LCUA 4I18C 1NGYB 3ZHLA 2EDHA 4NT6A 4MHHI 5BV7L 2R0LH 3L3IA 3QXDA 4KJPD 1WIUA 4J1UB 4UIMA 3GMPB 1H0DB 4NCC1 5AUMB 4FQ1H 1WBYA 2P5WB 1G9EA 1G1CA 5HYSG 5T1KA 3B3IA 4KKAC 3BEWA 1TVHA 1W0VA 4P57B 4KK6D 3F5WB 5FUCE 2OYPA 5L2JA 5DSCB 2E7MA 4YDJB 1F8TL 3JV6B 2R56H 5SV4A 5D5MA 3BP5B 1LEKB 5D7SL 2IGFH 2F19L 3LEVH 2D7QA 5F7DA 4OZHB 2XZQH 1MF2H 1CGYA 3QIWC 4QRRE 2QSTA 5D7JB 1DTUA 3WDHA 1YEGL 4DZBA 3OF6D 4Q6YA 2QQQA 5IB2A 3BPCA 3GJEB 3QRGL 4JVUA 3C08H 3GEWB 4NO2B 4U2ZA 3VFNA 5D1XA 1MAKA 3WUWG 1N5YL 1Y18B 4XPGH 2B7DT 1D7FA 4U6HA 3SJVA 4XBEH 1KYOK 2DMBA 5D72H 1DQML 1FDLL 4M7JH 3L3DB 4LKCA 4OI9A 1S7WB 4KKCC 1DQDL 3RBSA 4R7DB 3SDCB 3CFBA 4NKQB 5E8OB 4PREA 3ULVL 3P9LB 4HX1A 1T3FB 1MIEH 4WJ5B 1FC2D 3EGSA 4BQ6A 5I1HL 5L8JB 1KELL 2W9LA 5AG8A 1P4LA 3C2SA 3G6DH 3FB8A 3ZYOA 1NDGA 1Q9LB 1T1WB 4TNVF 4MAYD 1KB5A 4GKZB 1ZT4B 4JY4B 3BD5A 4JZOA 1WWBX 1E6JL 3W9EB 3EO0A 5EUOE 3VXRB 3QDMB 4JN1H 2R2EA 1N3NB 4PV8A 2CD0A 5E8PB 3WFDL 1YJDC 2F53B 3MRHA 3RWJB 1I7UA 4NUGL 4RWYH 4ONHB 2CPCA 3LIZH 3FHAA 3QO0B 4O9HL 5HHVH 4EXKA 1YN6A 2WP3O 3MUZ1 4YHML 4MJ6B 4Y5VB 4KUZH 5CP3H 5HYJA 4DEPC 3QDMA 5JO5A 5FDYA 5D7LB 4NNPH 3IVKA 3P30H 1GC1L 5C0CD 4H20L 4PB0L 1MH5A 4XT1C 1L0XA 5CP3A 3MUGB 4MNGA 3S4SA 4TOYH 1XGPB 1U8NB 4WGVB 4OD2A 5F71A 5FOBB 1ND0A 1I85C 2EC8A 5C0RH 5I1KH 3PWLA 5D1ZA 3QFJE 1F4WL 3FQNA 4LARH 3SJVB 3G6JE 2A83B 2QQKL 5KZCD 5F96H 4MJ2A 3ARVA 1Q72H 2Y5EA 4P59H 4P2YA 2AK4B 4HMCA 5C92A 4XMPL 3GI8L 4NKDA 3HCVA 4FZEH 4YWGH 5BXFB 2WBJD 5IG7A 4LRNL 1F11A 3FB7A 5D1QC 1AJ7L 1PLGL 5F7UA 1V7NH 4LVHC 4ZAKA 4L8BB 1RUQL 1CDIA 4K7PL 5CSZB 1CFBA 4R90L 3MCLL 4GAYA 3HUJF 1M71B 3LKRA 4JFXA 5F7NC 4YC2B 2DKMA 2QADD 4KZEH 3WSQL 3C09B 3GRWH 3UBXG 4NYLA 3I84A 5DMKA 2W38A 5C2BH 5IVXA 4L8CB 4PJ7A 4PRBB 4QYOA 1FVDA 3EZ8A 1BQHB 3IDJA 1EZVY 1J5OL 4X7FC 4NRZB 2OL3H 1H0DA 4JRXE 2LVCA 3QIBC 3QG7H 3VWJC 1WEJH 1PGRB 5DRNA 4JDTL 1AGEB 3O8XB 5FYLD 1P4BL 3Q6GH 3KYMB 2AV1B 5C8JA 3ARBD 3BKMH 3MLTA 5F7HA 3MRIA 2ZJSL 3KWWA 4PY8I 3DVFA 4OZGF 4OLVL 4Y2DD 1GXEA 3RWCA 1LO2H 3TA3B 2APFA 4HMEA 1CICC 2XI9A 4I2XA 1P9MC 3UDWA 1HSBA 4X4ME 3MSPA 4R90H 4P4KD 3HB3D 2CO7B 4OCWH 1H3PL 4DUWA 4Z7NF 1V8HA 4YK4B 2EDLA 3HI1A 4HFUH 4QRRD 2AQ3A 3MFFB 4FMKA 4MAYA 4RMWA 5DD1L 4HF5L 4X4ZA 2JCCF 5I30H 4ODVL 4L8SB 1FVCB 1QSEB 5AZEL 5GS1A 3KYOA 4FQ2L 1OAKH 1QQDA 1DL7H 1IZKA 4EBQH 4LSPL 2JIXD 1HN1A 1KENL 1IM9D 2P5EB 3F6IA 3CXHJ 4PJIE 2F53E 5IW6A 3MC0A 2XTJD 4GW4B 5JZ7C 4LLMA 1D5BB 2LAGB 2FJHA 3ARDA 3BXNA 4UIKL 3PGDB 1LO3H 3RU8H 2EDQA 2ZOLB 3LEYL 4C55A 4NGHH 4OZGB 5JNYB 3UTSB 5GXBB 3IFLH 1NGWB 1QR4A 4PRPB 1K9TA 2ITCA 5HY9B 3HG1E 2EXWC 3SEPA 3DMMD 1DSFL 1BOGA 1OLLA 2HKFL 1NC4A 2VDQH 5GGSB 4O58L 2VO5A 4EVNA 3LN5A 1NCDL 4Q0XH 4AH2A 2Y6SD 4N1EA 4M61B 4L4TB 2H2SD 5FGBA 2R0LL 4NNPL 3DO3A 3QUMB 1AR2A 5DJ8B 4IMLA 4YHMH 4H1LG 43C9A 3S5LA 4MXQC 3QO1A 3PHQA 4JM2A 2IFGA 4HK0A 3QDGA 1JYXA 4JFQA 2J7LA 2OMNA 2B2XH 3DNKA 4F57L 5CEXA 1E4JA 3RGVC 3FOLA 4XAWL 2EEAA 3GJFB 4OM0L 3CU1A 4LEOA 1G9NC 5AYUL 2DIAA 4NRYB 1JNNH 3TZVB 3UTZB 4RMUA 2I24N 4WI5A 4GMTL 1SYVB 3GZKA 3TV3H 4JGJA 3VFRA 4F7MA 4R0LC 1FGNH 1JNLL 1HNGA 3U30C 1KN4H 5C7XL 4FTVB 4M4PA 2DQGH 2HH0L 2FHBA 4G9FD 4KQ4H 5EWIH 1TTGA 5ACLA 1DN0B 2XKNB 1KTLB 3BZDA 1T22A 3CJJA 3PP4L 4CVXB 3RWFB 3SKOA 2Q1EA 1JF1A 3GI9H 4HCRH 1A7BA 3FQUA 2VE6A 3HI6H 1FGVH 5FHAL 1MCQA 4ODVH 4LVEA 1F58H 2D7MA 1DQMH 2FJGA 3QHZH 1B4JH 4M5YH 4XBEL 2JJVA 3RWGA 1BBDH 2CSPA 4EUPB 2YK1L 5HVHB 3KHOA 4QWWC 5TF1L 2FJFB 4GQPH 1B4JL 2HLFD 4M5YL 5FYKD 3RIFF 2BNUA 2GT9A 4JR9L 1UEMA 5HDLA 3TBSB 3TN0A 3H7BA 1BQUA 1SY6H 3BP4A 1II4E 4CADB 1QBLL 4WV1C 1KC5L 2P47B 4OCYL 4XH2B 4R7NA 3MCG1 3VI4E 4WWID 2CRMA 4NO2A 4XC3L 4NQXA 3LN5B 4QNPE 1OP9A 4RDQF 5EU6B 2XT1B 3M17A 3V5HA 1X5XA 4POUB 3KXFD 3AAZA 1QRNE 3BT2H 5C09E 4YPGA 1FVDB 1HI6B 4XB7A 2VITB 2X4RB 2PYEE 1INQB 1CG9B 4HIXH 2YPLD 2DLHA 4GRMB 4P3CL 2VERN 3FB7B 2PN5A 4HZLB 2DWDA 4U6YA 4KRPC 2JIXA 4KH2A 3IYLW 4Y16C 1FZJA 2OTUB 3B2UD 1G7PB 1DLHA 1RJCA 5INDA 3OL2A 4Y4KB 1S8DB 1CLOH 2ESVE 4HPYL 2ZKHH 5MI0B 2AV7B 3GB7A 2ZSVB 3BISA 4EI5D 3BE1H 1JIBA 2Q8AL 4LLVA 4GT7A 4YBHA 4ZFFA 3HMXL 3PJSA 4PRIE 3CK0L 1Z6JT 3ILPA 5FYKE 2XWTB 5IMMA 3U0PB 2FLBT 5LGKA 3BUYB 3SGKC 4AY0A 1UQSB 3DBXB 5F9WC 4ZYKB 4P59L 2GK2A 3BZ4B 2A83A 4LCIH 4NM8L 1CXKA 3BEVB 2BC4B 4F7PA 4G42A 5D1QD 1GZQA 2R2HB 2YA0A 3CLFL 1GCFA 3PIQA 3QSKB 4ONFL 4YDLC 3MBEB 1ORQB 4YHLH 3MMEB 4Z78B 1LDPL 1KBGH 4JO1H 2VLRE 1FPTH 5HI3C 2D3VA 2NY0C 1MWAA 3QXTA 1YQVL 1XGUA 5D1XC 3HC4H 5I1CH 2CR3A 4KI5F 3WIFA 1KF9B 5HHVL 3ET9F 2V17L 5KSAB 4G7VL 4C83A 3A6OA 3T8XB 1EAPB 4I0PB 3WFHA 1FAKT 3TCXA 1I8LC 2R4SL 1BPVA 3NCBB 1F6AA 4X80L 5IVXB 4L8CA 1U91B 1OF2A 4P5KB 4K2UL 1BQLH 1Q9LA 3V5KA 4Y19A 2VDKH 3VG9B 3DI3B 4DGVL 1XMWA 3UJTL 5DD3L 1SJHA 3PGCA 3MZGB 4JZNA 3V4UL 1D5MB 1DBJL 1AQKL 4OF3A 1AO7A 3P9LA 2DBJA 3F8UB 4HX1B 4OCXL 1V3LA 5DUML 4PJAB 3SCMA 3UTPE 2IQAB 1FO0B 3OKNA 1A6PA 4DGVH 3JV4B 5EIIA 2B20A 4XB8A 4YFDB 1J0JA 5I8CB 1WC7B 1PEZA 4QKXB 5F44A 1N2RA 5TE7H 3QWOB 4P23D 4Q6IB 5T5FH 2BSED 4POZD 1FZMA 4OD1L 2YPLB 4NZRH 3C5ZA 5CEYB 3BH9B 5KVEL 1XAUA 4FRWA 3AS3A 4NO5A 4K7PH 1FZKB 4W70A 4U1SB 4OKVA 4U31A 1QSZA 4UDUB 3FCTB 4ODHL 3VXSE 2F5AL 1HHKB 4PGEA 4UQ3B 5I15L 3QO0A 3U2SB 4DKDC 5MEND 4LVNB 3QEGH 1LEKA 4KKCD 4HWZA 4OCRH 2CK0H 1MH5B 1WBYB 4X6EA 4XXCA 4ONFH 3IJYB 5DMIH 4IOSD 3PGDA 5C0JB 1BWWA 4XMPH 5F88B 1TXKA 3V6ZB 2IEPA 5F9OH 3LRSB 4XCNA 5CZVH 3WFBH 2X1PA 5EBLA 3TO2A 1ZVSA 3EKCA 2AJYL 1WZMA 1A1NB 1FVCA 2CUHA 1VCAA 3QNYA 3KJ6L 1CBVL 3RNQB 3SKJH 4KVNH 2AJXH 4M62H 3ZKND 2H2PD 5B8CB 4YUEH 4DN4H 4PJDA 1C12B 3OR6B 2Q8AH 1VSCA 3SDCA 5MEPB 1WAAF 4BZYA 3CFKA 1EA9C 4FTVD 3TA3A 5JUEL 4PLOB 1GGBH 3L3DA 5J56B 4FFWC 3LZFL 3AB0C 3Q3GB 1OT2A 1T0NB 1VGEL 1XR9B 3ALXA 3F12B 4XXCC 4AYFA 2NYYD 4JE4B 3MACH 4KAQH 4X5XB 4RGOH 4LCYA 3ZE0E 5ADPH 3OR6A 4Y8AA 3HZKA 1NUGA 3QIUA 5B39G 1RHHB 4XP4H 1ZT7A 1JVKA 2KUTA 1ES0B 1HHGB 2EEBA 2GEEA 4NO0D 4QRUA 3O3DB 8FABB 4XP6L 4M6NH 3KPSE 3PP3H 3PXHA 2JJTA 3HRZB 5C0IA 3H3PH 4X8JB 2UV3A 1E4XI 4WWKA 1UEYA 4IS6A 1BD2E 1MRDH 5HHXH 5D5MB 3H7LA 3IXAB 4HPOH 1XF3A 3ULVH 5BVPH 1Q0XH 3GSOA 1XF1A 3REVB 5C0JA 1PZUB 2BNQD 1HHJA 1AGDB 1LK2A 4WDIB 5FGCB 1OTUC 1RUMH 2A9NL 1D5ZA 5C6PB 3BP5A 3QUXA 5D2NB 2HFFA 1B9ZA 3DO7B 2CLVB 1CR9H 1YPZF 3DGGB 1IC7L 4JN2A 3S37H 2A9NH 2P7TB 1FIGH 2B1AH 3GJFH 1F58L 4JFEA 3BRGC 4WU5B 2AK4A 2D7NA 1INEH 4ZAKD 4G43B 2VQTA 4UILL 7FABH 3NBNA 3VXUA 2JJTC 1FNLA 3H3PL 5SWQB 2QSCL 4ORGB 1NAMA 4OLYL 5C7XH 2E27L 2R56L 4LCUB 3WIHH 5F6IB 4ZS7L 3CIQA 2BVPB 1Q1JL 1P1ZB 3LS5L 3MUHL 3T2OA 4J4PC 5IMLB 3VFWB 3EDJA 5D2LA 3BH8A 1FNGB 4G6FB 4F2MB 3K3QA 1I1CA 3DI2B 1CK0L 4LLDB 4XCYB 3BGFB 3QNYB 4Y2DB 4KZDL 3EYVA 4XVUD 5D5ME 4FQQA 4KMQA 1BD2D 4GBXD 1VEMA 4PLKC 5CMAA 3KPSB 1C5DA 1JHLL 1N26A 5DD5H 1T7YA 2BXZA 1MWAB 1T4KA 3SKMB 1IGJB 1AGFA 2CGRH 2W60A 3QEHA 1UZ8B 4M6OL 2H41A 4LEOB 3JTSA 3LHPL 4GRLB 2OK0H 2O5YH 4Z7OE 4ZUWA 1IGYB 2VDOL 4HH8A 2GHWB 5ID1A 4DGYL 4UNTA 5EZJA 2Z31D 1ZS8A 3G6JB 3NIFF 3SJVE 3KG5A 4RDQG 3FN0H 5DRWB 1JUFB 1S5IL 2H6PB 3D2UB 5DD0H 1QO3B 2VXTL 2GTWA 4LVOC 1ONQA 4YEFA 2EYRA 5I17A 4OD3H 4RNRB 4M48L 1Q94B 1SJXA 4S1RH 1TTUA 1FH5L 5KOVC 3QWOA 2YPVH 1FNEB 2C3VA 5CKAA 1EHNA 3ULSA 2OP4H 1R0AH 2ADFH 1QHPA 4OZGA 5JNYA 3B43A 1RUAH 2IH3B 4LSPH 5DJCB 1KGCE 1NSNH 4HXAH 1NC2B 1CFSA 4JREC 3ZSTA 1YMMD 1MHCB 2OP4L 4JO3L 1R0AL 3W2DH 3IJHA 1WFNA 3GBNH 3ORJA 4MQ7B 3DTXB 5F1IB 5DA4A 3ZL4L 3BQUC 5GS1B 5E6IB 1OCWL 2ICWA 5EDXA 3IDIA 2YSSA 3BWAB 2UUDH 5GZOC 3T1WA 1F4XH 2Q86B 5TE7L 1NUDA 3EYFB 3VGBA 1A3RL 2IPKA 4QY8A 5GRYA 5F6HJ 2J4WH 5DFWH 3RPIA 2I9LB 3ZKSD 1X5YA 1G7LA 4EDXA 4RQQB 2HT4D 1AD9B 1I9IL 4HIIA 5E56A 4ORZC 2RCSL 4X9GA 5C08E 1Y0LA 4MNGE 1VPOL 2P5WA 3WBDA 4HKXA 5T3ZD 5GS0D 1IEHA 4M1CC 2Y72A 1Y6KR 3IKKA 3P4LA 3LS4L 4JEGB 1RPQA 4P2OB 5E1AA 3O9WC 5C2BL 1BIIB 4NT6B 3OV6A 4UDTA 4OFYA 4B41A 1XIWA 4YHZH 1UADC 1X7QA 1UFUA 2KZWA 3NA9L 2GW5A 4X7CC 4G7VH 5I8KH 1FP5A 2EDKA 1OPGL 3F7VA 4JM2F 1UH2A 4WVRA 5FGSA 4KROC 5I73B 3STBA 4JO4L 1RMFH 3A6CH 4F9PC 4U1HB 1V5JA 4EEEA 1AHWC 5CUSH 5H35B 1IJ9A 5E8DH 3TIEA 1XGTA 3ILPB 2IMMA 3HE6A 2UZIH 2G9HB 1CU4L 2X70B 4ZFOB 1CXHA 5CBEB 2RGSA 2FB4H 2QQLL 2ED7A 2BNRA 2XKNA 4NKIH 1G7IA 4O02L 4P9ML 4IRSC 2P49B 2VSCA 5FYJL 3RIAF 4IRJB 4PJ7E 4X4XA 1IAII 3ARBC 1A6AA 5JQHC 3K2UH 4PJ5B 3IDIB 1NAMB 3TF7C 5C3LD 5IEKB 4HIEB 3GMLA 4GSDL 2VLJE 4PJEE 4APQC 3DX6A 3QZWA 4EKXA 5ANMB 5IF0A 2DL2A 5E6ID 1MPAL 2X4SA 1T21A 2YUVA 3P9WB 1P7HL 4HPOL 1DLFL 2YS4A 4LDOB 4MA3B 2H6PA 3BI9X 3OZ9H 1QHOA 1YZZA 3T0EE 1NC4B 1JRHH 5FOJA 4PRPD 1DZBA 3MPCA 5DJXA 1UYWH 4JM4L 3QEQB 4I2XE 2Q20A 5JOFA 5ANMA 5ICXB 1SMOA 4BFEA 5F3HB 3AUVA 2HVKA 2V2XB 1AGDA 4LF3B 3AS1A 3KPQA 5I1GL 1QLRA 5HHOD 3HC3H 5C0BD 4MVBD 3MODH 5DHXB 1MY7A 4YXKH 5TH2B 4BA8A 2N4IA 4JM4H 1HEZB 2DTSA 4HWEL 5E2WL 4RBPH 4E42A 1PSKL 1BBJB 4PGBA 4ZO8A 2XWJB 4NHCH 1B0RB 4F15C 3UTSA 4S1SL 5KJRH 4HJGB 4KKLD 2FYYB 4UT9L 4ZO9A 3DX9A 3MV11 2L7UA 3S3PA 3AVEA 1MPAH 1WZLA 3QAZC 4P4KB 4P2CG 4W6YB 4OZIE 1AXSB 1R5IB 2D0FA 1OAZH 3JWOC 3QIUB 3LMJH 5D7IA 1N6UA 4U6VH 1NH6A 3HG1A 5E94B 4DTGH 1KJ2B 4LAJH 3QFJD 1JPFA 1QRNB 4WFHD 1B0WA 1R24B 5ALBL 4MXQD 2BRRH 1PKQB 2E7LC 4JHWH 1VERA 1S9YA 3G08A 3L3KA 4FP8L 1CDJA 3V6OE 1A4KA 4XCCH 5HDQH 3MCKB 5J3HD 3TJEL 1U92A 4QEGA 4HWBA 1PY9A 1C8PA 1EFXA 1PG7L 1JK8B 4P5MA 5GJTL 3KLAA 1UM5L 3QDGE 2GSIA 2GCYB 4OKDA 1GYAA 2ADGB 4FQXD 3PDOA 2BFVL 1VESA 5EU3B 4CGTA 1JGEA 1N0XL 1LP9F 3Q1SL 4GJTB 3VFNB 3T0WA 4D2NA 2VDRH 1TETH 4G9FE 1JWMA 3WO3B 3NABH 3SGJC 4OGZA 1UKSA 4KQ3L 3VGAB 1G7MA 1D5ZB 2A38A 5D1ZC 5HHQB 4Z8FH 3DXAB 3QRFM 4MA8H 2YD8A 4PTTB 2KZ1B 4B53A 4MLIA 4X7TB 1HHJB 4BFIA 4RX4A 4OZIB 1FIEA 1MJ8H 4HQQH 3TIDB 4XVSH 5DGRA 1TZGL 1TJHL 3F5WA 5L2JB 4QY8B 2BSRB 5E08H 5LGJB 5AWNL 4NFCA 5KN5B 3QUYA 5ITFA 1NC2A 4R8WL 1VFUA 3R8QA 5LAXB 1FV1A 4PTUB 1SBSH 2FNBA 3GGWB 1NL0H 1JWSB 4JVWA 1KPUA 5HI4D 1CXEA 2BOBB 3TBVA 4PGDB 1CL7L 4FFVD 1KSRA 4HUUA 1LO3L 1I3GH 5TJWK 2VISA 4NJAH 1YN7B 3HG1D 3KLDA 5IOPB 2JELL 4Y0GA 5BRZE 2EIBA 3L5HA 3VRJA 5J11C 4MJ6A 4Y5VA 2HT2D 3FTGA 5MP6H 5JXED 3DRQA 1FVEA 4HUWA 1IC5L 2B4CC 5C09A 1AR1D 3ALWA 1RZJL 3P11L 3WS6A 2YD7A 4UTBH 4HW6A 1OP5K 5DUPH 5K93A 4Z5RB 2EIZA 4EI5C 3OAYH 1OAYH 3SN6N 4GRWE 2CMRH 2ESVB 2A6JA 3FN9A 3D3VB 4D3CH 4O2CA 1U3HD 4OLVH 4NZTH 2ESVA 1JPTH 1BX2A 1OAXH 2AEIT 2HN7B 4P4RB 4RFNB 2DMCA 5C9JA 4PJHA 4WO4C 4YO0A 4WTZG 4CJ0A 3MBEA 4P46D 1YMMB 4WW1A 2NTFA 4MLSA 3ROOB 3V0VB 4PBXA 2AJUL 1K8DA 2KQNA 2OL3L 3U9PL 4QTHA 5I1DB 1RI8A 5DJ0A 1FAIL 4P23C 2FH6A 3LDBB 4M6AA 4AENB 4I9WD 1N2RB 4YR6A 3EOTH 1A6VL 3VA2C 2NY1D 1TCRA 1W0WB 3GRWL 1HXMA 1T1ZA 4H26A 1TLKA 4KQ3H 3U48A 1WV7T 1X5AA 4ISVA 4KJYA 5L6YL 3U1SL 1H5BB 4NO3B 3ZDZF 2FO1A 3F65A 4F33A 4N90E 1IZJA 2KH2B 1PBYA 4YAQB 1F3RB 3DROA 1U8JB 2DQHH 3ULVC 2EH7L 1ZLVK 1E6OH 4WWKC 3A6BL 2X4TA 1GGUA 2VR9A 2X9YA 4CN6A 1JGUL 2ZUUA