5I75B

X-ray structure of the ts3 human serotonin transporter complexed with s-citalopram at the central site and br-citalopram at the allosteric site
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
218
structure length
218
Chain Sequence
b'EVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKQSHGKSLEWIGNINPNNGGTSYNQKFKGKATLTVDKSSTTAYMELRSLTSEDSAVYYCTRSPVRPYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sodium-dependent serotonin transporter
publication title X-ray structures and mechanism of the human serotonin transporter.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 36
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2016-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i75B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i75B02
5D1QB 1CD8A 2DTSA 5FGCE 5GS1B 1UZ8A 4H0GA 5I15L 5I1JL 2PYFB 3P4OB 2D31A 1BQHB 4I3SL 4YZFE 3AROA 2DYPB 4Y4HD 1QR1A 4WW2C 4ZFZB 1OARL 3IDGB 1IKNA 3D39E 1WWWX 4U6HA 4JFOB 2R0LH 1AIFB 4BA8A 3TFKD 3V6FB 1QFPA 3UTQB 5BRZD 5HVHC 4NRZA 1ZLSL 5F1NA 1CXLA 4I48A 2CLRB 3SDAB 2A77L 3QDJA 4X4XB 3U1SL 3WIIL 4JAMA 1F6LL 3SDCB 2IPKB 2AS5M 3OKOB 5D7IE 2X7LA 4RWYL 3IETB 3DRTB 1LD9A 4L3CB 3QXVA 4ZG1A 5T3XH 2P24B 3MUJA 5JHLH 2DQDH 1G7IA 4O4YL 1NFDB 1T0PB 3JTTB 1QRNA 2GTZA 4CVUA 4QTHB 3O81A 1WC7A 3OJ2C 2YPLE 2F5AL 4RISL 4PJ7F 2A74A 2ESVE 4LF3A 3OGCB 4OFYA 3FB8A 2AXHA 5DD5H 1BP3B 3WYRA 1KELL 3RKPA 2YA2A 1A1NB 2E6JA 4JZNA 3CX5K 1XIWD 1CDJA 5SWSE 4KK6C 4M8QB 3VGEA 3Q1SL 1MH5B 3OWEA 4DZ8A 2JKXA 3AXLA 2KBGA 4XP9L 3VI3F 2R0WH 3GMMB 4HS8H 4Z0BL 4W4OC 3T2OA 3T1WA 5E1AA 2HT2D 3I9GL 3P73A 4EEEA 1K8DB 4EI5C 2CGRH 5E9DE 3BZEA 2X89A 4MAYA 2WV3A 4HDIB 3HLAA 2DQUL 5I8OL 5IB2A 1NGQL 1YPZE 1MCKA 5DEZA 5BZDA 1GHFH 1VEMA 4H8WL 4ODHH 2Z4QB 5IW1B 4HJGB 2NTSP 1O7VA 4FQIL 4K9EC 3GSOA 5F1SA 1F5WA 3S88L 2IG2H 2PO6C 3CSPA 4ZO6A 1MAML 4N0YL 3FO1A 4XPTH 5IESL 1DBBL 4AK1A 5CIPA 4C55A 4JKMA 4F2MA 4RGMB 1I4FB 2J7LA 4LAQH 4XHJC 5JZ7D 5DJZA 4N5ED 2GAZA 3MQIA 1XF4A 2MNUA 2F53E 1TENA 4YGVA 1A7OL 4K9EH 3P9LA 3B2UD 3GI9H 3MLYH 4P5TB 1JF6A 1T1ZB 3Q6FA 3BISA 1A7QL 3V5KB 2V9RA 1UM5L 3ARBC 3L6FB 2EZ0D 4DCQA 1D3CA 2GJ6D 1I3RB 3HNVH 3TZVB 3E8UL 2NR6C 2BXYA 3MA9H 4OM1L 3G5ZB 4BKLB 2DQFA 4WRLA 2EDHA 1ZA3A 5ANMA 1IQDA 5C7XL 3BP6A 3VWJC 4MA1B 4LSUL 4MX7A 1M05A 4GQ9L 4MMZC 1R3IH 4FTVA 3QH3B 4R96B 4PJGA 5ADOH 3VGHA 5D7SL 1EZVY 1W0WA 2DLIA 4FQHB 3M8OH 1JF1A 1FFOA 4OI8A 3NCYP 1PAMA 1JGEB 5F9OH 4M1GL 4JFFE 1P6AB 1QSFD 3JV4A 2NW3A 1P6FA 5HJ3A 1GSMA 3BZFB 4M7ZB 3C6LB 4PRPD 2GSGA 3IRZA 1H3VA 1XF1A 1N5AB 5HYJD 1JZ7A 3HE6C 1ZGLP 1QSED 1T5WB 3LKNB 5EU7E 43CAA 4RQQA 2XNAB 3DX8B 1X5YA 5KVMC 3ULUH 1Q9WA 2QR0B 5C70A 1K4CB 3PWLA 3EFDH 2BOCB 4KJQC 3FT3A 1RUQH 1U3JA 2D0HA 4R90H 1HH6A 2Y07L 1U92B 2PXYA 3V79C 4UMGA 4YDKL 2IH1B 3OXSA 4KK5D 4NQDB 1DDHB 4CMHC 2FYYA 3LMJH 3DIFA 1F4HA 1DBJH 1TPXB 1OP3H 3WJJA 3A67H 1OWWA 2QQKH 3DJ9A 3QUXA 1J1PH 1J1XH 3DRQB 3VD9A 1I1FA 3ORJA 2AJXL 3QFJB 3WN5A 3HNSL 2OTUB 4ELME 3IXTA 3PWUA 4JG1L 4EKXA 2COQA 2A6JA 1H0DA 4QWWC 2IPTH 2EDJA 4DEPC 1K4DA 3ZE0F 5JHDB 4MD5B 1NFIA 3VXUA 4KI1A 3O41A 4Z7UB 4G9FD 3QIBC 1T1YB 5FOBA 3GO1L 4LVHC 4X7FC 4MXWL 3U4AA 2J6EH 3IDNA 4NWUH 1UADC 4OZHF 3RWFA 5JW5A 3QUYC 1INQB 1U8OB 3EUUA 3UYPA 2R1WB 5ACLA 3MUHL 5L9DH 2Z91A 4PLJD 5JXEA 5M94B 3GMRA 4W4NA 1ZHKB 1IGTA 1T5XA 1NC4D 1HHKB 3NIDE 5BOPA 5EUKA 3X3FH 1N3NA 2A9ML 3VXME 5EOQH 1J7VR 2ZP0T 4OD2B 5CGMA 1GIGL 5CZVH 4ZUWB 1CFNB 3JV0A 4TRPL 1NJ9A 4JN2B 5F3BB 3IDYB 2V2TB 1DE4B 2MKWA 1NGWA 4PJ8D 2EE2A 2RJMA 2UVEA 3RKDD 3S37H 2Q20A 5FB8A 3GMNA 2PCPB 2ERJB 4OFPA 3C9NB 4KZDL 5IVZA 3MCKA 4POZD 4LHUD 3MOAH 1YEGH 1JRHI 2HTLC 5C0CA 4NKQB 3GMOB 1GYAA 5SWZD 5KSVA 2XWBB 4LPWA 4WUUE 4G8GB 3HZVB 1JPSL 5HDOA 3KS0H 2XG4A 2F54A 1MCQA 3CH1B 5I1KL 3WO4B 1T7XA 2EEBA 3AVEA 2Q8BL 3EYFB 2YMXL 3GJFH 5GRXG 3H9YA 3U9PL 4JVWA 5A2IH 5TE6L 4Y5XA 4UINL 4YHOL 5D72H 1JP5A 3TC9A 5J1TC 2QHRL 2SEBA 2OBGA 1OSPL 4ZAKA 3BPCB 5HXMA 1EUTA 1KN2H 3SDXF 4A6YH 2YC1B 2BY2A 4XTRD 4DKDC 5D6DA 1ZANL 4XGZB 4LVOB 3F7PC 1LEGA 5D2LF 4U6XB 1G7LB 1QR1B 2FEDD 2VDML 2M8XA 4U6HB 4DWHA 1UA6H 5IBUG 4F7PA 3LCYA 3OV6A 1ZLWH 3UJJL 1A6ZA 2P45B 3LIZL 4U1LB 4WHDA 3BQUD 4I48B 4GUPB 2EXWD 3KJ6L 3QDJB 2LTQB 3J7HA 5LGJB 4X6DA 4JAMB 4OCSL 3D6GA 4GG6A 5IB3B 3BT2H 1TFHA 4EXKA 4X5LA 1D5MA 5B8CA 2IBZY 5HHVH 1I8LA 4KGJA 4C54A 3SBWC 5I1AA 1LD9B 1UM4H 4GW5B 3PL6D 2AK4E 2GITA 3I02B 5IMOA 4JANA 3BKJH 1CGUA 3U46B 1CD1B 3F8UB 4FG6C 3GRWA 4P23B 5ID1A 2AXGB 4Z0XA 3RTQB 2A74B 3BIAX 3O4LA 1CZ8L 4LF3B 5TE7H 1LO0L 4NKDA 1KLGB 4S1DD 4OCWH 2HYMA 1MLCA 2NMSA 2V6HA 5DQDL 3WNOA 4IDJL 3RAJL 25C8H 4LGPB 2EEDA 2DL2A 1LO2L 3AXLB 4R2GC 5DD6B 5DC4B 3K0WA 4F9PA 4NRXB 1WFTA 2YXMA 5D1XC 4OSUL 5IFAH 5E8OA 4R7DA 1KIUA 1YQVL 3P73B 4UV4H 5E1AB 3GMLB 4HBCL 5DD0H 1EGJA 3TV3H 3HI6H 4P46B 3P11H 3ARVA 2VXSH 4XBEL 3ZHLA 3HLAB 3TBSA 3RVWC 4I77H 4HKBB 3BPNB 1G7PA 4EI6A 2AJSH 3DUSA 2NY5H 1FIGH 5ERWA 4FQ2H 5K9JL 3MRJA 2OM5A 4WUKH 3QUZA 1KJVB 1S7TB 2BNQD 3HG1A 4S0TD 1MFAH 4I9WE 1RFDL 4U2YA 3GSOB 4WI5A 5D93C 3LEVL 2R2EB 4Z78B 3FO1B 1JZ8A 4ONOA 2HFGH 5HVGB 3SCMD 1UT9A 5CIPB 1NEZG 4HG4K 4F2MB 4X8XA 1NGZB 3L5XH 3ZHKA 3GSNH 2BRQA 5DJZB 1W8OA 4PPTA 1QRNE 1BD2D 3S5LG 1XF4B 1DANU 2R29L 3LPGA 2R8SL 2D3VA 1A6WH 1EH9A 5KS9E 4PREA 1WUNT 5EU3B 3SPVA 4WO4B 3P9LB 4M6AA 4ZYKB 2AJZA 5IB4A 2ZPKH 4XNZB 4N0CD 1X44A 2YK1H 2WQRA 5T1LA 3RVTD 1X7QA 5BCAA 4IOSD 4XWOD 1FGNL 1FZOB 3CCHB 3PWPE 3PWJA 4DCQB 1FNAA 4G7VL 4HKJA 2OX5A 4WIQA 4XNMB 5KAQF 2JIXB 4PY8J 3U4EB 5KVGH 2DQFB 2HVKA 3NFPA 4HFWA 1ZA3B 5ANMB 3H7LA 4NC0B 2H8PA 4OLUL 2P8PB 4S2SA 3B9KC 1J11A 4MX7B 2FD6H 4N8CL 5GS0L 4U1KB 2WBWB 1G6RL 4OZFA 1CFVL 3S97C 3K7UA 1W0WB 4NNPL 2OP4H 2NY0C 2QSCH 1U6AH 5EUOF 4WI3A 3OR7B 4F8TA 3FB7B 3H3KA 5EN2A 1S7UB 5INCA 5C0RH 5IQ9A 4PBVC 3OJVC 4LQFL 2FX9H 3IRPX 4HXBL 3C60D 2F8XC 5FA4A 3ARSA 5BO1H 4TQEL 1ZMYA 2GK2A 4ONHA 2GSGB 4HULB 3MOBL 2Q1EA 5F44A 1OTUD 4RQQB 3RVUD 2ZOLA 1Q9WB 3CU1A 4UNTA 2XRAL 2ESVD 5J06A 4WCYL 5KG9A 3OKDA 4ZOAA 1FNGA 1X9QA 4UQ2A 3FT3B 4P5KB 2ZUXA 3NOIA 4QRTA 3O2DL 3VFSA 4LLUB 5E00A 4PJCA 3RA7L 1MCSA 4KTDL 3IU3B 3MZTA 2FYYB 4KMLB 4NYLA 3X3GH 5J9PB 3GHBL 5D1QD 5C0NC 2VXVH 3QAZC 4V2BA 1BBJB 4LKXA 3QUXB 1CLOH 4M48H 4LRNH 2OZ4L 1NKRA 5IVXF 2DYPD 3WLBB 1WQVT 4PJAB 5D1ZA 5IIEB 1FYHB 2X42A 3BWAA 4YHPA 1UACL 1AFVH 4V1DA 3WN5B 4F57H 3IXTB 3PWUB 4QT5B 3HZYA 3IGAA 3TH2T 4XCEB 4LARH 4P2YA 4HUWB 1P1ZA 4AM0A 1H0DB 1SEQH 1TVBA 3SDAD 4FTVE 2Y1VA 5C0IA 4OF3A 3O45B 5F71A 3WFDL 5I1IH 4U1HB 3MPCA 3VXUB 4LSTH 4L3EE 1ZHNA 3TESA 2FEEI 3PE9A 5JR1H 3A6OA 2XZAH 2DQIH 4LOUC 5K9QI 3MLVH 1INDL 5CGTA 1MJUH 1HILB 2CK0H 5GZOC 3DURB 1RHHA 1PQZA 4QHKJ 3MMEB 2Z91B 2F53D 4Q97A 1F6AA 3GMRB 5J1SC 1IGTB 3SDDA 5DJCA 4X6FB 5HSFA 4L8BA 1CDBA 1G1CA 4KUZL 1N3NB 2J1KA 2NCMA 4J23A 3INUH 1TIUA 4LVEA 4AMKH 3T8XB 2UWEA 2ED8A 4QOKA 5FYKH 3TVMA 4HGMA 5F8RC 4WU5A 5D7JC 5AZEL 1QYGH 3D18A 5FF6B 1OGAB 4PG2C 3RHWK 5FB8B 3QIUD 3TPKA 4OIIL 1JYNA 1J9CT 2AVGA 2P8MB 3MCKB 1KLUA 4D9RE 1VKXB 3ZT6A 1YMME 5C0CB 2BVQA 5FHBH 1DQQB 3VH8B 5C0DB 1CFSA 5KSVB 1JNNH 3RDTD 3KGRA 4G6FB 3KPLA 1JGUL 4JO1L 5EO0A 1SYSB 1QD0A 1T6WA 4Q58C 3UXFA 1R3LB 5TJWK 2AJVL 3RWGB 4HQQL 4WFHE 3FB5A 3STZA 4PJDA 1MHPL 3NFSH 3W9EA 2J4WH 1H3PH 1HINL 3UBXB 1PY9A 4BELD 4CBPA 5B3NA 5AYUH 2NZIA 1UFUA 4XPAL 1S9YB 5D71L 2SEBB 4TUJA 1QBLH 3PHOA 1LILA 1KIRA 4GSDH 5E24E 3MLZL 2PYEE 1NQBA 3OBAA 2Z0BA 4KQ3L 4PGBA 1T80A 5CJ5A 2V5RA 1YNLL 2E7LA 1LEGB 4XNYH 3ROOA 5SX5H 3SQBA 3AS0A 4ZSOB 2A1WL 2Q86A 4M5ZH 5KVFH 4G7YL 1FBIL 1PG7H 5LCVL 4WTZA 2FIRT 4H1LG 4HT1L 4P5TD 4F7PB 3LPWA 1B0RB 6FABL 4LCWA 5KSAB 4FS0A 1PVHA 4GRLD 1FC2D 4LBEB 3VA2C 4Z77A 4FQ1H 3GMQA 2AQ1A 2OJZH 1RIHL 5GGVH 3IKCB 4HCRH 4HH8A 2BP3A 3TZVD 1QLEH 1XGYH 4HW6A 4X6DB 3FCTA 2YD6A 4JDTH 2MKLC 1D5MB 4TULL 3LKOB 5B8CB 4HXAL 2CK2A 2CDFB 2G60H 4LASH 4RMSA 3SOBH 4ZODA 5FECA 5L2KE 3MLUL 3EOTH 4I13B 4YQXL 4KKCD 3MREA 3VFGH 2A6DB 4I3SH 2FEEL 2R56L 1OW0C 1I7ZA 4UBDC 5ID1B 3E6HA 4Z0XB 1JPGB 2VXTL 2F54E 4HH9A 2A83A 3O4LB 2V9QA 5F3HB 3QDGB 1RZKL 4NKDB 1ZS8B 3Q48A 2JCCF 5TH2A 4CADB 2MFNA 3H3PL 4G6JH 3C2AL 3QCTH 4N90E 5FO8A 1SMOA 3U1SH 1FO0B 4NT6A 4FXKB 3SGEI 1MHCA 3WIIH 5F9AC 2DMBA 5EO9B 5ADPH 5F21B 1MRDL 3JXAA 4ZXBA 2EO1A 4Z95H 5KSBE 1FH5L 3PWNB 1NMCC 4OKDA 2GCYA 3AS3A 3TBSB 1VSCA 4BYHA 1BEYL 2EXYC 1C08B 2DTML 4FFZL 2XQBL 4Y89A 5BVJA 4MA7L 1FYTA 5DJDB 4EI6B 2JB5H 5ERWB 4XPGH 1RJYA 3QUZB 3G6JF 4WUUD 2C26A 3O6ML 3I50L 3O8XA 1IILE 2VWEC 4H25A 3ZTNL 2H41A 3NIFF 3BDYH 4KI5D 2E7BA 4YO0B 4GG6E 1AGEA 3JWDL 1UXWA 1K3ZA 4XP9H 2WW8A 3SE4C 4O58L 1P2CA 5C07E 4JFEA 3IFPA 3BOVA 3IVKB 4Y2DA 1S7RA 1N4XL 1LQSR 1EFXD 4WFGE 3ARZA 1MCEA 4PREB 3SPVB 2AJZB 4MJIA 4QO1A 4MDJA 3MV7B 4HC1A 3QEQE 2CIIA 5T1LB 4CVXB 4JO2L 1YEHL 1OTTD 4F7EA 3PWJB 3FAXA 3NTCL 2VE6B 2OR7A 3WFBL 4Y4KA 5C0BD 2HVKB 2FL5A 3K4AA 3NFPB 4HFWB 4L9DA 5BS0A 3S88H 2H8PB 4YXLH 1MAMH 3H9SA 1F02I 5ITBH 3BMWA 4J4PA 4WW2F 5T1MA 4JM2C 1MRFL 5IESH 3ZDYE 1DBBH 3KDMB 3T04D 1VPOL 5CEYA 1DQJA 4K71C 4LCIL 2NY4C 4E42A 3EJYC 4OCYH 3GM0A 1I1AC 1SM3L 1NUDA 2DLGA 4LLVB 1I3GL 4BFGA 1RMFH 2UVFA 5IQ9B 1BQSA 5TDOB 2DKUA 1K3IA 5DUPH 3I6KA 5GRWA 2AK4D 1RSFA 2FATL 1FHGA 3WS3A 3DX6A 4R3SA 5D8JH 1A7QH 4U1JB 4RAVB 1UM5H 3EYOA 3RX7A 4FA8A 3FONB 3AUVA 2ATKA 2ZOLB 3OR6B 1NCBH 3LDBB 4P4KC 5DR5L 2DQJL 1LP9A 1DUZA 5C2BL 5AUMA 3U7WH 3RIFK 3OKDB 1FNGB 2OTWA 4UQ2B 3RWJA 3T3PF 1GOHA 1UEMA 4D0CB 4QRTB 1NC2D 4IHOA 4JREC 3S4SA 2Y5TA 1EA9C 2Y06L 3H6JA 2CD0A 4PJCB 1SJEB 5C0AA 2EO9A 4NYLB 4Y19A 4LNRB 2P46B 1PJ9A 5E56A 1C1EL 4WWKC 3RZWA 3LRSB 4LKXB 3BDXA 4XP1H 1A4KB 1FNEA 4QCIA 3LHPL 4JZJC 5L0QC 4YHPB 3DO7B 1HOCA 3ARFA 3T0EA 4S10A 3OKLA 4BK4A 1H5BA 3NCFB 4JB9L 2G9HA 4XPFH 4Y4HC 2B4CL 5C0IB 4LSQH 3QDJD 4I9WD 1L0QA 4Y4FA 4Z7WB 3TFKC 1ZHNB 2DDQL 4PY8I 1WBXB 4MNGE 4P2QA 3PV6A 2R2BA 1D9KB 1FSKC 1CXFA 1FRGL 3ETBF 4O5LL 4JQXC 4H1LH 2EDBA 1NAML 2Y6SC 1QRND 3C09B 3EDKA 3CUPA 1F6AB 3WUWG 3QI9B 2VDRH 3D85A 3VW3L 1EV2E 4BSJA 1B90A 2AJXH 3GSUB 5E8DL 4GLRI 5LBSL 2GTWA 4FFYH 5I73C 3IJSA 2JJTC 3CFBA 4JG1H 4OAWA 2UWEB 1O0VA 1JPFB 3B9AA 3TVMB 4DTGL 1UZ6F 2FX8L 3LSOA 3U7YL 1HK6A 1T0NA 3RZCB 1GZQB 4WU5B 4H5SB 4YHYB 4PJBB 4KV5F 1XIWC 3SKOB 4JY4B 4MXWH 1T21B 1JZ2A 4PRDB 4P2RB 1R3HB 2BVQB 3H0TA 2VXQL 2X89D 4MAYD 4LEOB 4PB9H 1AO7A 2NY2B 1Z0MA 4K2UH 5JUEL 3KPLB 3RVVD 4V1DE 3T4YA 5CEXB 3TH3T 4LHUG 5AD0B 3V6OC 3VD7A 5FYJU 3LQAC 1EEZA 3F5WA 3NAAL 2HT2C 5JOPE 1JK8A 3FB5B 3LB6D 3ULUF 4ZFFB 4MNQE 2AP2A 4F58L 4PJDB 1GIGH 5D5ME 2QSVA 5JW4R 4ZQKA 1DQML 5J13C 3F12A 2H3NB 3TEUA 2V9TA 4TRPH 2FH8A 1IM9A 3VWKC 3I2CH 4UIKL 5AG8A 1Q9OA 4TSAH 4X7EC 3W11D 3PHOB 1Q72L 5F7DA 3VU2A 3P30L 1X5FA 3KPQA 3VRLF 1DN0A 4X80H 3BN9D 3RJDA 4NDMA 3EO1B 3F7YA 4G3YL 3RUGF 2C1OA 4DKAA 5DURD 4JPKH 1F8TL 2VH5L 3HAEA 3HPJA 1W72L 3MXWH 1TNNA 5F96H 1A9EB 3T0WA 1KFAH 4LCWB 4QLRA 1MPAH 4N0RA 4QHKI 3B83A 4U0QB 5I1KH 2I9LA 3U0WL 3FCTB 2AXFA 1QBAA 4UINH 5I75B 4LHQB 4YHOH 4LHJB 3OTTA 1K9TA 4FTVD 2EZ0C 3W9DB 4QXGL 3O9WC 5EZLA 5GGQL 3ZDZF 1ZANH 4PRHA 2BVPA 3SKMA 2D0GA 3MREB 2CLVB 2DWEA 3F7VA 4Y5YB 1OAQH 1I7ZB 2ADIA 3ZKSD 2A83B 2XZQL 2UY6A 3U83A 5I16A 1CG9A 1IC5L 5HD8D 3VRJB 4HAGA 4ALAH 4PJ5E 4KROD 5DVLA 1P9MC 1TZIA 1K6QL 1OCWL 4JKPH 5FO8B 1DEEA 2PW1B 4TPRL 3T0XA 2VDQH 4NFCA 4NT6B 4RGNB 3SKNB 1AD0A 4OCSH 3G9AB 2IEPA 4GJTB 5I30H 4YHLL 1U8MA 2QEJA 3MNWB 1WZ1L 3OKKA 2PXYD 3TBWA 3LEXA 3MJ7A 4NN5C 1AR2A 4I0PB 2R1YA 3U2SA 4H0IA 4CMMB 1T04A 1ONQA 2GCYB 4LFHG 4MQTB 3D48R 3BRGC 1MJ8L 1CIDA 4BH7B 1CICD 4FQCL 3FFCB 1TDQA 1QRKA 4M5YH 5BQ7A 1OB1A 1S78D 1ZT1A 3QUXD 3SJVA 3S6CA 4FQJL 4XX1E 3V0VB 4NNXA 1PLGH 1RJYB 3V4PL 1C5CH 4DFHA 5LWYL 4H25B 2MPAL 2EDEA 1NLDL 5DQDH 5FOJA 4AJ0A 4IDJH 1UKTA 4O2FB 2LU3A 5E7BA 1UXWB 4LVNB 1LO2H 4F15C 4JFDE 2R23A 3OMZA 3SKJL 2AJ3A 2H6PB 1VACA 3QUMH 3VXUD 5E5MA 4XCCH 4MXQD 3C8HA 1CD9B 1YQVH 4I18A 4ERSL 3WIFA 1A3RH 4OLWH 1CVRA 3A6BL 5C92A 5HI3C 1KTDA 1JE6A 2F8VA 3STLB 1ZKAA 3R1GH 4ODXA 4MJIB 4GAYA 4R97B 2D9QB 2CIIB 4EJ1C 3SGKA 4Z7OF 2QQLL 3EO9H 1CGXA 1MCFA 3K1KC 5JXED 4MNHA 4F7EB 3WJLA 4JR9L 3UPAA 1BHGA 4O00A 3DVNB 3HMXL 3L3JB 5I1DA 3E2HC 4OZ4A 5HHMB 1EHLH 3D9AL 4MB3A 5CD3A 1NGYA 2FJHB 1RZ7L 2AEPH 2ZJSL 1LDSA 4YK4C 1ZLVK 3FRPG 4OLVL 3VGFA 2R8SH 5IV2A 3DUUA 1J5OL 1SJXA 2IAMA 3MRQA 3UZVB 4UILL 1QR4A 5C0CD 1PYWB 5L2KD 2BSTA 5FUOL 2L4OA 4OZGA 4PBWD 4PG9A 1A1OB 5D4QA 4PY7A 1OL0A 3WS3B 3DX6B 2R9HC 4R3SB 2RCSH 4EUPA 3EYOB 1SBSL 1FL5A 1WWAX 5GJTL 1JMXA 1QLFA 2F54D 4UT7L 4XP4H 1N0XL 2WSKA 4JHBA 5AUMB 2XWJB 3RWJB 2XY1A 1I9JH 5CD5C 3RNKB 3AFLA 4OLUH 3W2DL 4JFEE 1V7NL 3UTZA 3P4NA 4N90D 2Y5TB 1VDGA 2VLJA 5C8JB 2FH6A 4NZDA 4BQ8A 3U6RA 5C0AB 4ZAKD 3QO1A 5GSRA 4NNPH 2HJFB 4Y19B 4YHMH 1YY9C 1KCKA 1V8HA 3GM8A 4X9IA 3R4DA 4LLAA 3ARTA 3NZ8B 3LKRA 4X9GA 4FFVD 1B6DA 3MLXL 2O26U 2R69L 3O0RH 3O4OB 4QCIB 4HXBH 5EC2A 5HI5D 4JVUA 5EO1B 1HHGA 2FGWL 3MOBH 5DSCA 3VJ6A 3CDYA 1A9BA 3O11A 1HZHL 4OJFL 5FAAA 4PRAA 2HJLA 4CU6A 5DJ2A 5BS0E 1AC6A 2BHZA 3FOLA 3U0PA 1IE5A 5ACZA 1A0QL 3H9ZA 2XRAH 3B2VL 4OUOA 4OCXH 3C5SA 3U36A 1RUPH 3AS1A 1ZLUH 2BJML 4WEBL 4Y4FB 3MOQA 1YPZF 3O2DH 4PGDB 5F9WB 3MJ8A 4IOIB 1QO3A 2CDEA 3RA7H 3QHZL 3VXPB 4TYUA 3MR9B 1I85C 3BQUC 1FIEA 2FIKA 3LN5A 4KTDH 2EDYA 4PGCA 3NZHL 1OM3H 1IMHC 1HWHB 3QIWB 4H26A 1XF3B 1EMTH 4L4VA 3DETD 2FJFA 4I8DA 1JPTL 1I3UA 4OKVB 4Y5VC 2OZ4H 1T1XA 4WFGD 2IBGA 1RZGA 2HLAB 1UQSA 2P5WB 4F33B 1BZ7B 3O4LD 3N1MC 1Q94A 4L8SC 4PUBL 1LP9E 1AHWB 3MRNB 5J3HC 5D9SA 3IJSB 3R0NA 2CKBA 2O5ZL 2EH7L 3MRLA 5CKAA 1IEAB 5TDPA 4XXCA 1T0NB 2OJEB 4JRXA 2I60L 2VDKH 3LH2L 4BFIB 2AABH 4EDWH 5I1CL 5D7LA 3T2PA 1LO3L 4P2OA 2CMRH 1U42A 4NC1E 1RY7B 4XP5H 4KFZC 2QBWA 2Z93A 2J3SA 1INDH 1J18A 1KJ2L 3KXFB 4IDLA 2X4UA 2E9IA 3S3PA 1AO7B 5DS8A 3VD3A 1AI1L 5IB5B 2B1HL 4X98A 2YWZA 3T0EE 5IMMB 1W0VA 4Y16C 1TITA 1R5IA 4M1DH 3WL9A 3QWOA 3C8KB 2P1YA 5GS0D 4KUZH 4UTAL 4HWNA 5GSVA 2Y5EA 3HG1D 1IBGH 2BVUA 4NZJA 4OZHA 4Y1AB 2R4SL 3N1PC 1TQBC 3FT4A 1XFPA 3WFEH 4P2QE 1J05A 1FGVL 5C09A 3EO0B 5F7DB 4K94L 3HC0A 5TGBA 2Z35A 3RWEA 4KKNA 3SE3C 5EBLA 2CKBL 3THMH 3C5ZB 2NY3C 2WUCL 1GOFA 4NDMB 1JYWA 2C1OB 2CRIA 3KR3L 5FM5O 3MCLL 3LS4H 1BLNB 3D5OF 1U9KA 3HPJB 3SCMC 4QHNB 1VFBA 3L1OL 3RNQA 3NABL 4JO1H 1CGYA 5T1LD 1IFHL 4MA8L 5IKCA 1BECA 3ZYOA 3UO1L 4DGYH 2AJVH 2WP3O 3UC0H 2EDDA 3TT3H 4P9HC 2I24N 2I9LB 1JTOA 1RZFH 1ITBB 1MHPH 2AXFB 1HINH 4XH2B 2X4QA 3RVTC 1MCOH 2VAAA 4DKFL 2BY3A 4P4RB 1UH4A 2LE9A 2HG5B 1EAPB 2H26A 4LLYB 4JFHE 5DMKB 3O3DA 3SN6N 4KQ3H 1AGBA 5EZLB 3N0PB 3V0AC 1UWXK 3KYOA 4ELMF 3HFML 5B4MC 1YNLH 2DWEB 5IBLD 3TM6A 1RZIB 3F7VB 1IAKA 4P9HH 4EOWH 5F7EL 2ADIB 4KKLD 1MFBL 5BZWA 4ZFGL 3MO1B 3GKWL 4R4BA 4WI7A 5D7KD 1B3JA 5I16B 2DICA 2A9NL 3SDXA 2JJUA 1UJ3C 3BH9B 1KACB 1Y18B 1BIIA 4YC2B 5TQ2L 1I8MA 2AI0L 1DVFB 5GGRY 1G9NL 5FYJD 5D2LA 1TZIB 1DEEB 2HFTA 3HZMA 5ACMA 1AD0B 3FO2A 5DJYA 1HCVA 4L1DA 2XTLA 2VABA 1FORL 5FGRA 4TULH 3Q3GA 4DAGH 1KB5L 2D9CA 1MOEA 3LEXB 3MJ7B 1C12A 3RVUC 4ZDHA 2R1YB 1IGIL 1SJHA 1T04B 2O5YH 1F2QA 1FNFA 4YQXH 4D9QE 1A3QA 1X4YA 3F58L 4K3EH 5BQ7B 2R56H 1FQ9C 4WNQA 1UB5A 1T22B 5EC1A 3KJ4C 1GGCH 3SJVB 4PJ9A 4NQCB 5D1ZD 3AC0A 3ZL4L 4V1DD 5D1QC 3MRHA 3C2AH 3QULB 5GS1C 3CLEH 3TBYB 3AREA 1HE7A 2ARJA 1HSBA 3QNXA 3TT1H 5HPMB 5DMIL 5HGHA 5JOPD 3D25A 2R23B 3E3QE 3PNWA 4XC1H 4TOYL 5CWSA 2OK0H 4BZ2H 2AJ3B 5CSBA 1GXEA 4PRHE 3CJJA 3DXAB 4I18B 4M3KB 3WIFB 3QDMB 3P2TA 1HHHA 4UB0L 2W59A 4XZUA 1JUFA 1TVHA 1KTDB 4M02A 4BSWB 2EYSA 4XVSL 3SDAC 1CK0H 1J0IA 5IHBA 4GAYB 2DTMH 2R1XB 1B88A 3BIBX 4MA7H 4NOFA 3PQYA 3SDCC 3AM8C 4RSVA 5IMLA 3K74B 1ED3A 5HY9A 2NYYC 5F7NC 4MJ5A 3G08A 4K8RC 4LLMA 4TVPL 5IP4A 3X12A 3I50H 3SDDD 2IFFH 4L8CA 5DT1H 5FK9A 5C6TL 5CSGA 1BVKA 1NMAL 1W0YT 1IGJA 1B2WH 4K07A 5CBEA 5I1DB 1G1YA 5E6YA 4OZ4B 3JWDH 1CI5A 4QOKD 4KDTA 4O51B 1MCPL 3TVMD 2YD7A 5CD3B 1NGYB 1F4YH 3BW9A 3VMPA 1H15A 3OX8A 4RDQG 1N4XH 2R0KL 4K8RH 5IV2B 2CLZA 3DUUB 3MRQB 5EOTB 5K9OB 3DSFL 1YEEL 3R8BB 1A7PL 3L5JA 5D2NB 3QJFA 4OZGB 1Z2KA 2FHBA 4KVCL 1JHLL 2X10A 4PY7B 1KSRA 3T09A 2HTKC 2NY2D 4OF6A 2GHWB 1KCUH 5JOFA 5DJ0A 2CIKA 1HQRA 3MNZA 5FDWA 3IB4A 1YEIH 3WFBH 1U3HA 4PJ7E 3T1FB 5DUMH 4GBXA 5ENWA 4B5EA 2G2RA 4HK3N 4JKLA 3UTZB 3P4NB 2EDNA 1MRFH 2QADD 5JOEA 1WAAF 2D4FA 3DMMA 3KPTA 4JG0L 1NCAL 3EJZD 4WJ5B 4V2CB 3RGVA 1U91B 1JYVA 4GFTB 4LIQL 2E9BA 2IC2A 1SM3H 4GAGH 3VFOA 3LKRB 2UUDK 3IJHB 5T3ZD 3VXRE 1DL7H 3E0GA 5FKPA 1K8IB 3KPSE 4DJMA 2FATH 5EC2B 4JDVA 5E03A 3K46A 4XNQB 5EU4B 3VJ6B 1A9BB 3OAZK 2ZCLH 4RGMC 4YDIL 2APWA 2HJLB 1G7HA 5EUOA 3FOLB 2W9LA 3U0PB 5J89A 1J86A 5DR5H 5GS3A 1GGIL 5C2BH 1OT2A 3GEWB 1N2RA 1NAKH 3U36B 3LD8B 4OIBA 2NX5A 4KJPC 4LSSH 4P5TC 4FQLL 2Q6WA 2P5EA 3MJ8B 4S1QH 2Y06H 1QO3B 5DHYB 5JW3L 1MLBA 2Q7NA 4JFDD 1FNHA 3WSQL 3ROLA 2I9TA 1C16A 3TZVC 3EYVA 1S5IL 2FJFB 1C1EH 5IMKA 2XV6B 1FFQA 5F89A 3L9RA 1MCBA 4EBQL 4HF5L 3LHPH 4MA1C 5FKAA 1FVDB 4YXHL 3HNTL 5JIIA 3V0WH 4UDTA 2C4FT 3MLTA 2V2WB 3LKSB 4KKCC 1SBBA 5CJQL 2HRLA 5LXGL 4OBRA 5I18L 3RWHB 1UCBL 2YUXA 3RJQB 5TDPB 2VLJE 3WFCL 5IVXA 4RGND 3TO4A 4X99B 1A6PA 3PGDB 3EGSA 4M7ZC 3C6LC 4ZXBD 1A5FL 3B6SA 2Z93B 4NGHL 3EKCA 2APBA 2OMNA 4Y8AA 5A43C 2MCG1 2YOCA 2X4UB 3EOYG 4C83A 5JIPA 1NAMH 5DS8B 1M7IA 4PRNA 2APTA 1JHTB 1KPUA 4X98B 4CDGC 5IM7B 3E6FA 1FYTD 3NACL 4OLYL 1YYML 5JDSA 1ODAA 4EN3B 4IRSB 4LCCA 4OQTL 4JM2F 2XFXB 4NWTL 4S1SL 4LQ1A 3VD5A 3GBML 2WBJA 5GSVB 4BZ1L 3O8XD 1TPXC 3IXAA 5FGBC 3JWOC 3BHBA 3MC0A 2ADFH 5EBMA 3SE9L 1VADA 3S7GA 3IDXH 3KS0J 3VGAB 3VFVA 3X11A 3CNKA 3BGAA 1BF2A 1J05B 5ID0B 3EIFA 4RAUA 3IDIA 5CAYB 5CMAB 2NLJA 3FQTB 4U3XA 2XKSA 4KJWD 4DK6A 5I19L 1D5XA 4JFED 3PP4L 4NZTL 3CFDA 1VEPA 4Y2DD 4KI5C 2JB6A 4X9FA 3HUJF 5GIRB 3JWOH 3MRKB 4KK8D 5JUEH 4OF0A 1AKJA 1XGRB 1Z0NA 1ORSB 2GK0A 3UX9B 1NANH 1EXUB 4GRMA 1Y6MR 5JQ6L 4KQ4L 2UZIL 3ARRA 3UPCA 1U58A 3UJIL 4F58H 4JRXE 4TNVF 5ISZB 1NLBL 4EZMA 3P9WB 3OB0H 4Y4KD 5D7LE 1UVQB 3HE7A 4ZS7L 3V4VH 1AH1A 4PRIA 1BX2B 5BS0D 2GJJA 4BSVA 3K8MA 3EDJA 1CE1H 3H9SD 4J4PD 1Q72H 3GB7B 1I7RB 5FUZL 3Q5OA 1AGBB 3CSBA 1K5NA 2W9DL 3P30H 4X6CF 5GGTL 2X70B 4WW1A 5DK0A 4ZOEA 3ZE0E 1PKQA 4I4WA 4DN3L 1K2DA 1WBZA 2FZ3A 3Q5TA 1YN7A 4LRIA 2VH5H 4K3DL 1W72H 2V17L 3IDYC 3H3BC 3VXQA 3ZKND 4OZHE 2ERJC 4Q9QL 1OGAE 3U7AA 2JJSC 5JW4Q 1XAUA 3U0WH 1DFBL 2J88L 3QXWA 4M6NL 3HZMB 1X5KA 4HIEA 1LNUA 1N7MH 5C09E 3AAZA 3FO2B 4P3CH 3ZZ1A 4PS4L 4KJYA 1CF8L 3ZLQC 5AZ2H 2C7UB 5DJ8B 4Z7QF 1A22B 5FM5M 1LO5A 1FZJA 2Q3ZA 1MF2L 1ZTXL 4XPBL 1YA5A 2PTUA 1KBGL 5C0AD 2IANA 3KYNA 3WO4C 5IW6A 1YNKH 4NHCL 2HFFB 3RBSA 1EX0A 1JZ5A 1RK0A 4XVTL 4ODVH 2MTPA 4WNQB 1UB5B 1ADQA 5HGDA 1HYSD 1L0YA 4PJ9B 2XZQH 3CFCL 5ESAB 2K1MA 4YX2H 2DL9A 2BY1A 2P44B 3DOSA 3O3BB 5F7HA 4YJZL 1IC5H 3MRHB 2QQNH 2YUZA 3ARFD 3T0ED 3MTRA 2XQYK 4LVOC 4HWBH 1HSBB 1K6QH 1OCWH 4UDUB 2XACC 4HG4J 4TPRH 3BWUC 4PJEB 1A6UL 3ESVF 4W6XB 5CWSB 2AGJL 3PNWB 4NQSB 2Y7QA 2YPKA 4YHLH 4BFEA 4Y4FD 3WE6A 1MCRA 5MENA 2JCCA 3ARXA 3D69B 4P2QD 4XZUB 5FO9A 4J6RL 1JUFB 1TVHB 2IQ9H 3EOBB 2EYSB 4M43H 5MHSE 3FHQA 1MJ8H 2LTQC 2A0LD 3RI5K 1IAOA 1WZLA 2VLLA 1OVZA 3EW3B 3P9MA 4P3DB 3VXSB 3OJDB 4WHTA 1ED3B 2IWGA 3D85D 4MXVE 3MV9A 3ABZA 1MCHA 3X12B 8FABA 5LWYH 3UTSA 1MIMH 4LLWA 1I1RA 3O2VH 1NLDH 4JHAH 1WZKA 4PJFF 1ACYL 5ESVB 2X4OA 2GUOB 4ZS6D 4P23C 3MV8A 3RTQC 1I9RL 3SKJH 2HVJA 1YEKL 3G6JA 4TVPE 5DD1L 3ARDA 3OKNA 3A6BH 2ITDA 3WS6A 5EFIA 3MLRH 2HAZA 4L8DA 1OTSD 3B8SA 1DLHB 4AIZB 5MEQA 1BZ9A 1L0XA 1LK2A 2HT4D 4PLKD 1KNOA 4DN4L 4CVZA 1IARB 5IVOA 5JOFB 2CIKB 1HQRB 1YEDB 4YUEH 2HP4A 4LGSB 1KN4H 5FDWB 1U8PB 2O5XL 3HMXH 1XMWA 4P46C 2WWMC 1U3HB 1MCDA 1PEWA 3P0YH 4GBXB 4IRZL 1UC6A 3L5WB 4UUJA 4OZIF 3D9AH 1NCDH 4UIMB 3BPNC 1MAKA 4X6BA 1KG0B 1IM9D 2K3TA 5IBTL 1AXIB 1RD6A 4X6EA 5DC9B 3UBXG 2VC2H 5ICXA 4G42A 4BM7A 4M7JL 1N6QL 3PQYE 3GIVB 4U6VL 4UILH 3M1BB 3VCLA 3ISWA 2AEIT 2VIRB 5EBWA 2VLRA 3B4NA 5FUOH 5TE4L 3MGTA 5C9KA 5JTWA 4I0CC 4LLQB 4E41B 4HPOL 1QEWB 2XZCL 4YHNA 1F4XH 3FHAA 1AGCB 3G9VA 3QEHA 3WXWH 4LIQE 4JCLA 2EYRA 3PJSA 1PZ5A 3GK8L 3JTSB 1N2RB 4KKBD 2JK5A 3C08L 4WO4C 4XNZC 2X1XR 2MMXA 2P5EB 1OY3B 2OL3B 2HMID 5DJ6B 4OV5A 1AP2B 5FUCE 3W39A 4I2XA 2YRPA 2I9TB 1S9XA 1IEBA 4OCMC 1KYOJ 4PRHD 5IMKB 4D3CH 5E99L 5BW7C 1FNLA 1C5BH 5F89B 2R0LL 3L9RB 1KCVL 5HYJA 5HYIA 1IGFH 4PTTB 2EDFA 3HRZA 4NQEB 3MFFB 5DQJA 3PDGA 3B3IB 2FGWH 4UDTB 3MLTB 1HZHH 3QEGL 4OJFH 2VDPH 3ZKMD 4FXGA 2QKIA 5T1KA 1A0QH 3B2VH 2PN5A 2YKLH 5B39A 2M1KA 4YDLB 3FQUA 5IVXB 2CQVA 3DTXB 4FABH 2BJMH 3REVA 3EGSB 1P7QB 5T3XL 1RZ8B 2DQDL 3QHZH 4YPGA 3ZYIA 2DLTA 4HZAA 3FRUB 2OXHA 3BH8B 3DO3A 4EI5A 4C83B 3O3AA 5EU5A 4Q9RL 4JKKA 4PRNB 3WIHH 3CFJA 3D0VB 2UZYB 3E6FB 2PXYC 3VGGA 1KLFA 5EUOE 3CAFA 3ZDYF 2LVEA 1IEHA 4X7DC 1EERB 1HEZB 1GGBH 2O5ZH 3BHBB 2NXYB 2EH7H 2NY6B 1VADB 2X4SB 3X11B 5HYQB 1CDIA 3JUYA 1KF9B 1RIVH 3QUXC 2I60H 3LH2H 5I1CH 4R4ND 2PO6A 1WTGT 5E8NA 5MEOA 3VGBA 3TA3B 3FAWA 3GBNH 4NPYA 3BX7C 3WN5C 2IQAB 3CFDB 5DRNA 5ESQA 1YEJH 4MLSA 5J6GB 2JB6B 3RGHA 4UT9H 1D6EB 3SY0A 5C6WH 1AI1H 2B1HH 4ODHL 4LAJH 3ARGA 1RI8A 1RUKL 5F7WC 5ITFA 5LGHH 2XZZA 1G9MC 3T4AA 3LN9A 2Q8AH 4HLZH 4Q7DA 1O7SA 3ARBA 5D6CA 1A2YA 2NNAB 1Q9LB 2R4SH 1REIA 2DKMA 2VO5A 4XPTL 4PRIB 5F7LB 1AXTL 4PLOB 3MYZA 1A4JA 4PJIF 3VWJA 4IMLB 4AH2B 2X6MA 2FSEA 3D3VE 5SWZA 5HBBA 5EU6B 1G9MH 4X5XA 4K9EL 4S11A 1UXSB 3GI9L 3O6KH 4I4WB 2ZSWA 2VNCA 2W0KA 3KR3H 1WBZB 2IAMD 1BIHA 5CGYC 2LAAA 3PABA 1GCFA 3HNVL 1IFHH 4MA8H 2NY1B 1HHIB 3MA9L 4P5MA 3VXQB 4QRUA 4DVRL 4N9GB 3HE6A 1UB6A 3KWWA 4HIEB 4NN6B 2Z31A 4RZCA 4FHBD 1WFUA 5ADOL 4DKFH 3ECBA 5A16A 4CU7A 5AAMA 3PIQA 1X6NA 1LO5B 2VLJD 4NO3A 4HHAA 2IANB 5GRJH 1BOYA 4U6YB 2XKNB 1CU4L 1U8IA 3GSVB 4QHMA 1ZHBB 3GJEB 4POUB 2BNRA 5HPOA 2EDOA 3LRHA 5BRZB 1MFBH 3NCMA 5F1KC 3WD5L 3GKWH 1A47A 4U1MB 4PRBB 2D7TL 2A9NH 4OFDA 1NBZA 1CFQB 3HMWH 4C56A 2LVCA 2AI0H 1DLFH 1G9NH 2PTVA 4EVNB 2BCKA 3K4ZA 1MUJB 2WMPA 1ZHLA 1RJZA 5EOCH 1I7TA 3CXDH 2Y7QB 2YPKB 1OP5K 3F6IA 3UEZA 4ZOCA 1DBJL 3PHQA 5MENB 5FA3A 2JTDA 2UYLA 4MCZA 4MB5A 5KSAC 1PKQE 2QQKL 5DLMH 5FO9B 3QIBA 1IGIH 5CZXC 1RURH 4F7CB 1J1PL 4NNYA 1J1XL 3UTTE 4HV8B 1VFOA 3F58H 5D5MF 4L4VD 2D7QA 1IAOB 4UOW1 4CKVX 1B0GA 2ICEA 2X4NA 5GQBA 4TTDD 5C6PB 2ED9A 3CVHA 4WHTB 4MQ7B 5B8CC 2P7TB 1NCUA 5JNYA 3ZL4H 3OHXB 2XTJB 4WI8A 4HFUL 2IPTL 1FV1A 2Z92B 1V7ML 2BERA 3BMVA 4A2LA 1JZ3A 3VE0B 5DMIH 4PJXF 1T89A 1FE8H 4TOYH 4N0FB 4JRXD 2V2XA 1KPRA 2HVJB 1ZT7A 3G6JB 5D7LD 2J6EL 1A02N 4MDIA 4P2OD 3ARDB 3OKNB 3LZFH 5INDB 1S5HB 3GJFA 3I75A 3LOWA 1HNFA 1X5ZA 1P4IL 2CRYA 1LK2B 3ES6B 4ETYA 4F9PC 5TF1L 3X3FL 3GRWH 1CCZA 5EOQL 4A6YA 3GMPA 4RMWA 4R4FL 4TVPH 5CZVL 1G7QA 1NMAH 3ZE2F 2A73A 4R6UA 1DBAL 1CGWA 1FVCB 5JLZA 3S37L 1VFMA 3FFCE 2LFGA 4R7NB 4XI5D 4JFXA 1PKOA 1FO0H 5BJTA 3QXAA 5C09D 3QUZC 1YEGL 4NO5B 3UAJC 1TMCB 2YD5A 4X6EB 4XC3H 5CHNA 2R0KH 5DQ9A 4GMSH 2WIIB 5ICXB 4G42B 2VTFA 3DSFH 3VCLB 2BXZA 5GISH 4KRLB 3MROA 4Z18A 4LCYB 2GJ6B 4OCLC 3D39A 4NCDA 3UTSE 4L4TA 5E8PA 2EYRB 3PJSB 4PR5A 3QEUA 4AYFA 2ZUQB 2OYPA 2X4RA 2CDGA 3DVFA 3MV8E 1FZMB 3MJ6A 4CUCA 2JK5B 5HYSB 3H7BA 4YDJA 4DW2H 4QXUH 1Y0LB 4A6YL 3SQOH 5CJOL 1NCAH 1QFUH 3NIFE 4OV5B 1U8QA 1N0LA 4ZOBA 4I2XB 4PGEA 4X4YA 3BP7A 4PJHB 1S9XB 1F90H 4FRWA 1N6UA 1QSFB 3V95A 4GKNB 3MRRA 4HX1A 1YEFH 5IG7B 4QXTA 5HYJB 1F3DH 4ZFOA 3R06A 3NN8A 3WDIA 2YPLA 1KXTB 5MHSD 2HRPH 5F88A 2EIBA 3V7AG 1I1YA 3ULVL 3DROB 4YDIH 4AIOA 1JFQH 2Q76B 5IBLC 5T1KB 5SWSA 5MEPA 3BJLA 4DUVA 1GGIH 1E6OH 3BT2L 5B39B 3FQUB 1P53A 5HHVL 3REVB 1J0JA 3MGOA 2XICA 2VUOA 4FQLH 4HPYL 4AZ8A 5KANI 5D1XA 4GAFB 3S36L 1OQOA 3BKJL 4AEFA 4JFPA 3WSQH 4OFKA 5E9DA 1CLCA 1XZ0A 1CL7H 3LDBC 1S5IH 5IROC 3RY6A 3L95A 5EU5B 2P42B 2VOTA 4HUUA 2VR5A 5TE7L 2RAMA 3CFJB 1YPZA 4NO2B 1NFDF 4I1NB 4HF5H 4ZUUB 5T3XE 4YXHH 3GSQA 4OCWL 3RU8L 4PJ9D 4QRRA 3QP3A 3GSNA 1IVLA 5CJQH 3DGGA 5LXGH 1CLYL 4LEXH 2VQ1A 1JV5A 1UCBH 5FYJH 4ZFOL 3ARED 1AJ7H 4G9FB 3MCG1 4OLZH 5E8NB 3T3ME 1IZJA 5DD0L 2N4IA 3P11L 2YHGA 1GAFL 4NPYB 2ZCKH 3TWCH 1FJ1B 2VXSL 4NGHH 3JUZA 3T3PE 1GC1C 5ESQB 5EPMB 4KKAC 4AENB 3FMGL 2YRZA 3QDAA 3L3OA 2Z9TA 2F19H 1NC4B 5CLTA 1T03H 3MA7A 4WI6A 3RWIB 3JVGA 3ULSB 2AXJA 3ARGB 1EVTC 5A2LH 2VB5A 1QOKA 1MFAL 2CRMA 3PQYD 4OQTH 3TNMA 2W9EL 2HJKB 2CXKA 4G8FA 1D9KC 4J1UB 2AV1A 1A2YB 1SY6H 4HBQA 4PJ8B 1QFWM 1GC1H 1OF2A 5GZND 3ZYZA 2ITCA 2J8UB 3G04B 5GRVK 5MP6H 3C09C 4HIHB 3L5XL 3TNNB 1MRCL 1AGFB 1WGOA 3GSNL 3QI9C 4LHUB 1IAMA 1H3XA 3BEVB 5SWZB 5C2UB 4K7PH 4NZTH 3M45A 3DI3B 2ZPKL 2WBKA 5E2UH 2BFVH 4HUVA 1QSZA 4F3FA 1WBYA 3N06B 4J3WA 3TVMC 4JFFA 4CJ1A 3BUYB 3RZCC 3P4LA 3PABB 4Q6IA 3L3DB 5IB1A 4F37F 4HKZA 1P84K 2P4AB 4OIAA 4YHYC 4Q0XH 1T7YA 1LHZA 5HYFA 4HUMB 4KQ4H 4ZUVA 4OUUA 2FR4A 4HWEH 3KWWB 5F93C 2Z31B 1U3HD 4JQVA 5A3ID 2EYTA 3V7MA 4GBXD 2AERT 2EECA 2NY2C 5KN5A 5A16B 4M03A 2OP4L 2AJUH 1U6AL 2H2PD 3TYGL 5FUZH 3DMMD 1RJLB 3RGVD 5GGTH 3TPUA 3WFHA 1IJ9A 1KEMH 4QHMB 3IDJA 4DN3H 1YUHB 5EH1A 1BQUA 3BJ91 5BO1L 5CCKH 1SYVB 2RQ8A 4IIQB 4DGVH 4HEME 4Y1AE 3L3GA 3ZT7A 3MRBA 5ILTL 1NDMA 1NBZB 4JGMA 1DANT 4F7MA 4Q9QH 4S1RH 4C56B 1NCCH 4ELMA 5BV7B 1TNMA 4M62L 3RL1A 2F9BT 4X83A 1HH9A 2E6PA 2J88H 2BCKB 4M6NH 3KVQA 3EHBC 1RJZB 2P8LB 4BH8B 4GKSB 2HN7B 5C3LD 4X4ZA 2NX5D 3PL6B 3DWTA 1JWSB 5IJVB 4YEEA 5DHVA 3PHQB 5FA3B 2F15A 5HHNA 3RVXC 5IQ7L 2K7QA 1KBGH 1WEJL 3QQ9D 4M48L 4JRYA 4LRNL 4NNYB 5I1LB 1F3RB 4XT1C 3PGFL 5DXWA 4O02H 3P3YA 4G8IA 5CBAA 2BHYA 2AV7A 5CUSL 2ICWB 5T3ZH 4JPWH 1B0GB 2X4NB 1AFVL 4XNUL 5I75C 4M6OH 3CVHB 4JJHA 4XBPA 3VRLE 3L7EA 1JZ4A 3HCVA 4LARL 4PTUA 2ICES 5JNYB 3ARQA 3RUGE 5JORA 3DUHA 4Q9BA 3VXMA 3FT2B 4R8WH 5TDNB 4Z8FL 2CRZA 3K8LA 4Y5YC 1P4BL 3TCLB 5JR1L 4Y88A 2XZAL 2A6IB 3I3EA 3TO4D 2BOBB 1QA9B 5D7JA 3N9GH 3S3SA 4Q2ZA 4O2CA 2CK0L 1A6VL 3VFUA 3AB0B 4PG2A 1H3UA 1HCFX 4Z7UF 2BNRE 4JFYA 3V6ZA 3U48A 2H32A 2BSSB 4H20H 1F3JB 1XCTA 2CUHA 4RGNC 1LEIA 4EIGB 1TJHL 2BNQB 2W92A 1JF5A 4AQ1B 1J87A 2AW2A 3BPOB 1G7MA 3ZDZE 3BKYL 3CMOH 4AMKL 3BKCH 4I3GA 1G7QB 5FYKL 4I0PC 4C57C 2A73B 3RL2B 2WBJD 1LK3H 1U8JB 2R2HA 4PP1C 5JLZB 2NXYD 4YNYA 1ZVSA 9CGTA 4M7LL 4L29A 4RDQF 1BD2B 3QXAB 2BRRL 5F8QC 1YEKH 4D9LL 4YEFA 4C58B 2XQYG 5FHBL 5CHNB 4HCRA 3AY4A 5JIHA 2KKQA 3TN0A 4NJ9L 5KW9H 2VLKE 1U93A 3BIKA 3KLHC 4LVNC 3D39B 4FQQA 3S5LA 4DN4H 1MWAB 1AKJD 1QFWH 2YUWA 2G75B 2WANA 1NGXA 4JPVL 5E8PB 3NFSL 5T5FL 3EDDA 2FBOJ 1QP1A 2XA8H 2CDGB 1I9IL 3OAZH 4CN6A 3OKEA 3U0TB 1QBLL 4R97C 3HE7D 1P5UA 4PRID 2EIDA 2VYRE 5AWNH 5D7IB 1T6VN 1IM3A 1Q9KA 4E5XA 4XNYL 2YD4A 4YHZH 1U8QB 4NO0A 4PGEB 4X4YB 3ALPA 3FQRA 1EO5A 4YHIB 2YS4A 2AK4A 3C60B 4M00A 1PG7L 2YD8A 3MRPA 4M7JH 3EYQD 1N6QH 4U6VH 1AR1D 4QXTB 5L2JA 4ODTL 1B9ZA 3NN8B 2YPLB 1OW0A 3CDFA 5F88B 1CE6A 4HPOH 1WAAA 3O6LL 3QPXH 2ESVB 4FQ1L 4HC1H 4OGAD 4HCRL 5J6HA 2M2DA 1QLEL 4UTBH 1NDGB 5SWSB 1ZA6B 1YQ2A 1NC2A 3QB7C 4QGYA 1T2QH 4G6AC 4JDTL 3GK8H 1KTLA 5J56B 1N8ZA 2AK1L 1S7XA 1DBMH 2VUYA 1D5BB 1IGYA 5D2NE 3SOBL 4WV1A 1AGDA 3EOTL 3NGBB 3FOMB 3ULVE 1RIUH 2HKHH 4MD4A 4JFPB 3VFGL 5E9DB 2J12B 1XZ0B 1CGSH 1FAIL 3AGVA 2IAND 2W65B 1IZKA 5E99H 2ID5A 3S96A 1KCVH 1S7SB 5IHZB 2N7AA 4L4TE 1GJIA 3QZWA 4G6JL 1QFHA 1RULH 3QCTL 3LKPB 3VFMB 2WUBL 2GIYA 1KJMB 3QEGH 2GI7A 3DGGB 3UJTL 1CFTB 1UWGL 4HS6A 2VISA 5EIVA 3I6GA 5ADPL 3B9DA 1S8DA 3DLQR 1LEKB 1AD9B 3PXHA 5C08E 4D0DA 4POYA 1HYSC 5KSUB 4Z95L 3O4OC 5HDBF 3BZ4A 1A64A 3RIFF 4F80A 5IF0A 3PDOA 1J0ZA 1VHPA 5GGRB 3SE4A 1GGUA 1J8HA 4ENED 5MEND 1OD7A 1PSKH 1QG3A 2OL3L 2F53B 3OXRA 4Z5RA 2YWYA 3HPLA 3MRFA 2JB5L 5KS9A 5GS2H 4Q9RH 4XPGL 1JPST 3VFNA 3MA7B 2W60B 1ORQB 3VA6A 2YA0A 4Y4FC 1PGRB 3UZEA 5CEZD 5HHOA 5F9WC 1OD9A 3MYJB 4U3CA 1P7HL 1KB9J 2XWTA 3PWPA 1UGNA 3BDYL 3MV9D 2Z8WC 4ONFH 2XTJD 2DQHH 3KPPA 4JZOA 3UTSD 4ZO8A 3QIWC 3HZKA 3QXDA 3QIUB 4I5BA 3S98A 4HIIA 2IADB 4ZNEA 2ITCB 1LO4H 1H8SA 2DI9A 3LAFA 1XGTB 4FZEH 1YN6A 3MV8D 2YBRA 2DN7A 1BWWA 4JM2A 2YEZA 5GGUA 5FGSA 3RDTB 1AHWC 4HJ0D 1E4WH 4ODSH 3ARDD 2GJZA 4HUVB 4F3FB 1HYRC 1WBYB 3TYFA 4NP4H 1WIUA 1I1AA 3X13A 4ZPVB 4JFFB 3PUCA 4QRRE 3QQ3A 1NCWL 3KYMA 4Q6IB 5IB1B 4F7TA 1RUKH 4HKZB 3MV01 5I6XB 1SVCP 1R3KA 4JCMA 2VXUL 4GKZB 1CT8A 5HDQH 4YXLL 2FR4B 1VGEL 1OTSC 5K9KA 5ITBL 2VL4A 2FRGP 3HUJA 1N5YL 5KN5B 1U8HB 4EUPG 1AXTH 3DVGB 4GW4A 4FXLA 5DO2C 3D2UA 2FX7H 4OCYL 4LCUA 2EDLA 1RMFL 2ZKHH 4JM4L 5DUPL 5B38A 3V4UL 3IDJB 4HGWB 2HH0H 3F7QA 4MSWA 4WWKA 3L3GB 1KT2A 5D8JL 4GRLB 3OL2A 1SHMA 4LPXA 4YIQA 4U7MA 2VLRD 1OAUL 2BVOA 5I66B 3CZFB 1NCBL 4JZJA 4TN9A 1T0MA 3U7WL 4DVRH 1X4ZA 4ZUTA 1KULA 5T3XD 4D0BA 3RL1B 1A1MB 3C5ZC 4OD3H 4DUXA 5DZOA 4H1LA 4HKXB 2AQ3A 3BXNA 4NKIL 2V5TA 1RVFL 2LV4A 5DYOB 2FECL 5JIKA 1V05A 5KVDH 2VSCA 1OGTA 4L3EA 3AU1B 5DHVB 5A2FA 2WM0A 5HHNB 3OG6B 5E5RB 2PTTA 1XH3A 3SE8L 4QHLA 3G6DH 4TSCH 4XP1L 2A6KB 4L9LB 1CU4H 5DWUH 4GMTL 4GXVH 5CBAB 4QHUB 3G5VB 1T20B 2XN9E 5E2WL 3JWNC 5F7MC 5DFTA 5EG6C 3WD5H 4CDHA 4FP8H 3EAKA 4NKMA 5GGSA 2AKRA 2D7TH 4X7TB 1D5ZA 4NN7B 3VRIA 4FOMA 4NQVA 4PJAF 4XPFL 5DI8B 1Z3GH 5EULV 4M61A 4LSQL 4XCYA 3VXMB 1L7IH 5CINH 3HR5A 4TVSa 4OT1H 4ODWB 5T1KD 1TETH 2DWDA 5B3JF 2Z8VC 4KK6D 3V5DB 1PX3A 3BE1H 1DUYA 4DUWA 3MUY1 3WHXB 4O2CB 4AEIH 1CICA 1CGVA 1CVSC 4J12A 3ZKMC 4KHTH 3L3KA 2DM7A 4P57B 2BZDA 2R39A 3SGDH 1H8OA 5ABDE 1ZEAH 4YC2C 1VFAB 1DVFC 1XGPB 1YMMA 5EWIH 2H32B 2VDRL 5GJSH 2N56A 4EI5D 4ETQA 4YE4H 4WUUB 1U8NA 1KUMA 1R24A 7CGTA 5GRZA 1G7MB 3KLAB 4FFYL 5I8EA 5IEKA 4G8EB 3V6OA 4Z7VE 1OP3K 4HFUH 5ICZA 2X4TB 4L3AA 2IFGA 1V7MH 3IF1A 3MRDA 4YNYB 1ZVSB 2RHEA 1HKLL 5FYLH 4WGWB 1TCRA 5I74B 4L29B 1EFXB 3QHFL 3ARPA 2ENYA 2PO6D 4Z9KB 1IC1A 1N64L 3VWKA 4JRYE 2PYEA 3VFWB 5FYKE 3TBVA 1BOGB 4PB9L 3TN0B 2ILLA 4K2UL 4LP4A 3T2NL 1P4IH 3NCJL 1U93B 3TIEB 3OKYA 3K2UH 4FQQB 4PJEE 5TF1H 3MLSL 2MHAA 3KPRE 2PR4H 3ARGD 5C0BB 1KCLA 4X9HA 4R4FH 4I18C 4U1NB 7FABH 1FFPB 1YY8A 2L7JA 5CKGA 4ACPA 1DBAH 2QV2A 3ARBD 2G5RA 3G5YA 3I2CL 3OAYH 3QJHA 3DBXA 3VXOB 4TSAL 3OF6A 3C8DA 1VB9A 3CC5A 2XA3A 2ATPA 3SGKC 1JGDA 3LQAL 4PD4J 5A2JH 4QYOA 4X80L 3VWJD 1U8LA 1CDHA 4NO0B 3VXSE 5CILL 2IBBA 5L2KA 1OAKH 3UPRA 1MI5E 1FL3A 5HHQA 2AK4B 4AIXA 4JPKL 4P99A 4W6WB 1AXSB 3ULUD 3FN0L 3FQWA 3MXWL 2CUIA 1XR8A 5F96L 4E0RB 2C1PB 4OZIA 3MFGB 5CP3H 5L8LB 1KFAL 1CE6B 1MPAL 3VXTA 5LAXA 3KPOA 3F7RA 5J6HB 4DOHE 2GW5A 3ZHDA 2DM2A 4AEHH 3W0WE 3TIDA 1NC2B 2IPUK 3HE6D 2VZSA 4BUGA 1A6AA 4Y2OA 2FJGA 3QRGL 5D2NC 5FIEA 2Z31D 1IGYB 1WTLA 4WTWA 4WV1B 3ULVC 4X6DF 4M93B 1UZ8B 2C3VA 4KJQD 5CJOH 4MD4B 5KSBA 3QG6A 4MXVF 2D31B 4M3JA 1D7FA 3GJFK 3BZDA 1OAQL 4OM0L 4OD1H 2ENSA 2ADGA 2MWCA 1J1OH 4MYWB 2V5SA 1TQCB 2R4RL 2BNRD 4NRZB 5F1NB 3QZWB 3HS0A 3GSRA 4ALAL 3ULVH 2EDXA 4JKPL 5I0DA 1MEXH 2W0FA 1WT5C 2VDQL 2WZPD 3WNLA 4C56D 3EOAA 3I6GB 2FO4A 4XCNA 1ZV5A 5I30L 5F9DC 2X7LB 3I3BA 4OTXH 4N5UA 4MQXC 1ZLWK 4PIRF 4HPYH 4HK0A 5F70A 3PDOB 5C07A 1N59A 2HT3D 4BQBA 3L7FA 3S36H 1G7IB 3QFDA 1N26A 1QRNB 2ZG2A 3DV4A 2GTZB 4M5YL 3HPLB 3WBDA 1WC7B 3QIBD 5KS9B 4ZMAT 5EA0L 3SGJA 4X5WA 1WAAE 3LD8C 1PLGL 3FB8B 3QEQA 1MREL 4UOW0 1C5CL 4JZNB 1TLKA 3RU8H 2XKUA 3ZT5A 3FQXA 3PWPB 2XWTB 2QSQA 4DZ8B 3DVIA 1NBYA 1CLYH 3HZKB 3QXDB 1YZZA 5EZOL 2NW2A 2PW2A 3UTPE 1I3VA 3QUML 4XCCL 4M1CD 1A3RL 2YBRB 4OLWL 3IT8D 3BZEB 2YEZB 5T1DH 1GAFH 4ONGL 1IT9H 4MAYB 4NQEE 4YDVA 1A3LL 3R1GL 2W38A 1INEL 2GJZB 5IB2B 3DX7A 4HIJA 1WCBA 2I07A 3FMGH 2HLFC 3X13B 5BZDB 3EO9L 3QQ3B 4UQ3A 2XPGA 2HTLD 4B0MM 1DR9A 3GHEL 3KYAA 5JA9A 1JJUA 1G6RA 1CDUA 3Q5YA 3TO2A 5E6IA 2W9EH 2VWEE 3ZYJA 3MNVA 3BPLB 3F65A 3VMNA 1EHLL 4MA3A 3QPQC 5K9KB 4YR6A 2AEPL 5GRUL 4HD9A 3VFPA 2I5YL 1NMBL 4GW4B 1MRCH 4MZ3A 1J8HE 1HQ4A 4R26H 2GAZB 4EN3C 4IRSC 2VZVA 4LCUB 5DURB 4YGVB 2VDLH 5T5NF 5B38B 2ARJQ 4GT7A 3IAPA 3ILQC 4JFQA 3Q6FB 3M17A 4MSWB 3C6SA 4XNXH 5HHOE 3VGAC 2RCSL 4LSPL 3HR6A 3O2DA 4PJIA 3IFOA 4U1SA 5E2VH 5H35A 3QNYA 3D39D 4XP4L 4D2NA 1U8KA 3LEYH 1T0MB 2YSSA 4ZUTB 1NCTA 4L4TD 4D0BB 3GUTA 2AEWA 1I9JL 4ZNEE 1IQDB 2DJ4A 3BP6B 1BGXH 1M05B 4FTVB 5C0GA 2OZ4A 3CXHJ 4PJGB 1H9VA 1OGTB 4L3EB 4YHML 5DRWA 5C08D 3TYGH 4MNGA 1JNHA 1JF1B 4D94A 1FFOB 1XH3B 1TZHA 4PJCF 1F6FB 1I85A 3O0RL 2ZUYA 3JV4B 2NW3B 5HJ3B 5IEHA 4PYHA 5T33L 3GSWA 4NKMB 4M9PA 43CAB 4KROB 2YPLD 5ILTH 1DN2A 4FG6D 3B8YA 4OCXL 4XWGL 3U9UA 3OPZH 3PWLB 2GYSA 1E28A 4L8SA 4XCYB 2IALA 3HR5B 1RUPL 3HUJE 4M62H 5CSZA 4EQ3A 3V5HA 3NCCB 5D96B 5EU6E 5SWSD 2DWDB 1HH6B 2EKJA 2PXYB 1KIPA 4XBGA 2KL6A 5I1HL 4JJ5A 4KRPB 3OXSB 5DEFA 5BXFA 1VENA 4J8RA 3DIFB 1OM3L 1CICB 5C0JA 4Z7WF 4IRJA 3F6LA 1X5LA 1EMTL 2EE6A 5D1XD 2DI8A 3L3KB 4LDLB 4OI9A 5IQ7H 1C7TA 2X2YA 1QPPA 1WEJH 1YMMB 1WV7T 3PV7A 5E9DD 4U31A 3B5TA 4RIRA 3PGFH 1HXYA 1I1FB 1U8NB 5ICYA 4RNRA 5CUSH 3KPMA 5DTFA 3KYKH 4XNUH 2HFEA 3LQZA 3NCEB 4X6CE 3RVWD 4LSDA 2VQUA 2D03L 1TZGH 5HGAA 5I8CA 3DNKA 4Y16A 4QRRD 2A6JB 4IMKC 5TQ0H 5ICZB 5I9QB 3GBLA 4MNQA 1F11A 2VDKL 4U05A 1K4DB 1OAXH 2AABL 5D5MA 4EDWL 4Z8FH 1NFIB 2H2SC 5F6IB 1P4BH 3ZKQD 2EC9T 3O41B 2CMRL 4FZ8H 4KHXH 4PJ9C 2ADJA 4XP5L 5FOBB 3IDMA 4GS7B 1IL1A 3IDNB 2PYEB 1A6VH 3TBVB 1FPTL 4J3UA 3RWFB 5JW5B 4B50A 4HZLA 3SE3A 4PJBF 5EIQA 3NPSB 4NQXA 2XG5A 3BVNA 1KYOK 4Z7QE 2ZUVA 3EFFA 4PJXA 1EEUA 5JW4N 1TJHH 4M1DL 2IMMA 1T5XB 1RUML 5EUKB 4K3JL 3K8KA 2WIMA 1IBGL 3BKYH 2ZCHH 1BBDL 1QNZH 2DQGH 5FEBA 1NJ9B 3WFEL 4TUKL 1NGWB 3MX0A 1GRWA 1JGLH 4PJDF 1WVZA 3GMNB 4RFOH 4M7LH 4XAWL 3THML 2BRRH 3VG0L 5IVZB 1U0QA 1YDPA 3N50A 2VKXA 1FDLH 1U8LB 4D9LH 3B9KD 1QQDA 5L2KB 3UPRB 1A6TA 1KC5H 4JHWH 4K3HA 3LS4L 4D8PA 4YWGH 3FQWB 4NJ9H 1XR8B 2NY0D 1Q1JL 4KDTC 3FRPA 4KVNL 2F54B 3V6OE 2OSLA 4JFFD 4DGYL 3UC0L 3TT3L 5LAXB 3KPOB 1M6OA 35C8L 4JPVH 1RZFL 5T5FH 3DX9A 3WMSA 4BQCA 4Y5XB 4PJ5A 1ETZA 1I9IH 1MCOL 1LDPH 4ZD3H 5MERA 2FJGB 3N1FC 4ZAKB 2ZOKA 4TSBL 3CSYA 3BRDA 3OSKA 4JO4L 4J2XA 1CXIA 2QLVB 1EZVX 2C3VB 4N8PA 1NGPH 5KSBB 4PJFE 4J7RA 2Z8SA 3QDHA 2IF7A 4P9HL 4EOWL 2ADGB 3VFRA 5JDJA 2FHFA 3LRGA 4OFIA 1X6LA 2NTFA 1MNUH 1S7QA 1U3HC 3S37X 4GBXC 4L5FL 5C0ND 4ODTH 1OLZA 4M6MH 1A6ZB 5B21A 4ZPTA 4NSKA 3O6LH 3GSRB 3HI1A 3ALWA 1HXMA 3UROR 1V3JA 5SX5K 1EEQA 3Q2CA 2FO4B 1LWRA 3S35L 4GG6B 5GS1A 2AK1H 1EAJA 4DAGL 1UG9A 4MJ6A 2PYFA 4Z7NE 1BQHA 4JFDA 3TBTA 5I1AB 2XXMB 2C5DC 5DDHA 4HK0B 3IDGA 3A6CH 1N59B 2O5YL 3L7FB 2GITB 5C0EA 3ZE1F 3QFDB 1FC1A 4JANB 5IMOB 4NM4L 1YYLH 4K3EL 1PBYA 3LKQA 3V6FA 4S0SD 3CD4A 4OZIE 1FAIH 3UTQA 2QJDA 4IBLT 4LOUD 1GGCL 4JRYD 2YPVL 3P0VH 4JLRA 3DYOA 2CLRA 4X4XA 1BAFH 2APFA 4U6TA 3MACL 2M26A 4RBPH 4HSQA 3SDCA 1MLCB 2IPKA 3CLEL 2WUBH 3TT1L 3SDYL 3UJTH 1UWGH 4UNUA 4TTGA 3KPRD 3DRTA 4L3CA 3DHJA 2P24A 4XC1L 3VXMD 2NW2B 4OGXL 2OK0L 4BZ2L 3DSNA 4OLXL 5K59E 1AQDA 3JTTA 4PRPE 5E8OB 4R7DB 2VL5A 2FWOA 3PP3H 1DP0A 1QSEE 2VDNH 3QG7H 4YDVB 2CO7B 2EH8H 5D7JD 1CK0L 3OGCA 5H2BA 2OL3H 3JV5A 3MSPA 3K81A 4HIJB 1WCBB 1G7PB 2E8ZA 5CJ8A 4M4PA 3BGFB 3DUSB 5DA0B 1E4XH 3MRJB 4M8QA 4NZUL 1MI5D 4UQ3B 1BJ1J 4U49A 4YDLC 1MH5A 4G6MH 3HG1B 3S36X 1G6RB 2IFFL 5F7KC 5DT1L 5E6IB 1JI1A 2LABA 5TPWH 1B2WL 3CZJA 4RMVA 2X5PA 3PF2A 5HI4D 4N8VA 4U1GB 1K8DA 1F4YL 3O3UN 3VFPB 4HDIA 4K3GA 1HQ4B 5JQHC 1UJTA 4ZO9A 3B9VA 1QBBA 2E27L 4O9HL 4K8RL 4QNPF 4IOFC 3HB3D 4XHQA 5IB4B 2W07A 1GPOL 4HJGA 1X7QB 2NXYC 2NY6C 3TN0D 1KCUL 1NCWH 1TTUA 4G9FE 4U1SB 4HKJB 2OI9B 3RWDA 3TA3C 1YEIL 2VXUH 12E8H 4I0KA 5DUML 3KHQA 1I4FA 1VGEH 1NPUA 4S2SB 3MXVL 1QACA 1CR9H 5I71B 4UT6L 1N5YH 2OLDA 4A2MA 4OZFB 1CBVH 4WENB 4MNGB 5EN2B 4GAGL 1EEYA 5EOCJ 5INCB 4HS3A 5HYSG 4NO0D 1NANI 5HYEA 1DL7L 4JM4H 4P3WA 2VAJA 3L6FA 3V4UH 5FA4B 4ONHB 4K23H 3U79A 4BKLA 3GSWB 3T65A 5LQBH 3KHOA 2ZCLL 1OAUH 1X5IA 2GY7B 1RUAL 3T3MF 5FCUL 3ARWA 1KENH 5KG9B 1NAKL 5CSZB 2XOTA 3EYQC 1RQ5A 1T83C 1DTUA 1NAMA 5J4MA 4LSSL 3VFSB 2BSED 4NKIH 3HN3A 4S1QL 1RVFH 5E00B 5BXFB 2IBZX 1J10A 1JGEA 4WGVB 4N0UE 5IWLC 3TJHD 4IRJB 3UTPD 2NY1C 3RBGA 3C6LA 3SE8H 5B39G 3Q6GH 1FN4A 1N5AA 1T5WA 3LKNA 5IW3A 4GMTH 1OAZH 2V5MA 5SV3A 4PJIE 4RIRB 5D1ZB 1HXYB 4NN6C 2QR0A 2CSPA 3BWAB 5E2WH 1DCLA 5DTFB 3V0WL 4V1DB 1K4CA 2DOCA 3CK0H 4E9LA 2BOCA 3HZYB 3IGAB 5HGAB 5JPMA 1P1ZB 4GRWB 4AM0B 4AY0A 1TVBB 1W8NA 2IH1A 4MNQB 1F11B 1DDHA 3FZUD 5D5MB 5EDXA 4KZEH 3KG5A 5J12B 2KQMA 5HHPA 2VRAA 3WFZA 4DKEH 5FM8A 3MV11 3DRQA 1IL1B 4QRPE 4FFWD 2OQJA 5EZIH 1RHHB 1PQZB 4HZLB 4TNVK 4CVWA 1KV3A 1J8HD 3H2WA 4NQXB 2EC8A 4F8QA 5SWQA 3CDCA 3EFFB 1IAIM 3SDDB 5DJCB 2WINA 2PKDA 4L8BB 1HKFA 5ETUA 3DYPA 5JHDA 1DQTA 2JELH 3CX2A 4MD5A 1EO8H 5HHOD 4ENEC 4QOKB 1AE6L 2ADFL 4KUCF 2E8YA 4Z7UA 3PWPD 2DIJA 3IDXL 4LDOB 2FB4L 5FHAL 1R0AH 3D18B 4WU7A 1HKLH 1W72A 5E7FA 1INQA 1U8OA 3QHFH 2R1WA 1EBAA 1KLUB 4EIZC 1N64H 1QQDB 4JM2D 2XTJC 1CFSB 1A6TB 3P4MA 5KTEH 1ZHKA 1S9WA 3JWOL 5F6HI 2PNDA 1JMZA 3T2NH 1JCKA 3K4DA 3NCJH 2NY4D 5EO0B 4Y8DC 1IC7H 3EJYD 4CJ0A 1I1AD 2B39A 4ZUWA 4EDXA 3MLSH 4CW1A 1F00I 1M6OB 3STZB 5F3BA 5CEZH 4XXDA 1DE4A 2HWZH 3GSXA 4HJ0C 3DX9B 2R0ZH 1E4KC 3ARDC 3W9EB 2PCPA 3V4VL 1F3DJ 3WS6C 1I8IA 4PJ5B 3C9NA 1ETZB 1KPVA 2QADB 1KJ3H 4TUJB 1CE1L 4L4JA 2DS4A 1MQKL 1MFDL 1KIRB 3CSYB 5DD3H 3UP1A 4PGBB 4KTEL 1E0OB 3LQAH 5BVPH 4G8GA 1LGVA 3D2UD 3HZVA 1FLTX 5CILH 3ROOB 2Q86B 1JZ6A 4HWBA 3WHE1 4PJXE 5ALCH 5E95B 1NEUA 3RWCA 3FN0H 1A21A 1U2CA 5ALBL 5JZ7C 4M7KH 4WWKD 4N5EC 4NSKB 4Z77B 5HVFB 3GMQB 5DC0A 1BD2E 2VLME 3A0OA 2ARWA 3IJYA 5KVEH 4X4MA 3BPCA 3B2UC 3W5NA 1N7ML 1TCMA 2YC1A 3E1F1 1HN1A 4P3CL 1L9NA 4XGZA 1G0XA 5AZ2L 3QRGH 2UZXB 4MJ6B 4U6XA 5IFHL 1G7LA 4JFDB 3TBTB 1T66D 3NA9H 5DDHB 4APQA 5FECB 3ZE2E 4OV6F 4L3ED 5C0EB 1ZAGA 1YNKL 3OQ3B 2EICA 5SX4H 3LKQB 2ZUWA 3C87A 4ODVL 4OM0H 2ZUQC 3E6HB 2FGZA 3WCYA 4U1LA 4HH9B 4JLRB 1JHKH 4GUPA 3BO8A 2R4RH 5LGJA 4YX2L 2Y6SD 3BFOA 5TH2B 5GHWL 2QQNL 4BUHA 5IB3A 4JO3H 4HWBL 2X9WA 1MVUA 4KWUA 1PG7X 1MHCB 4O2EA 1M7XA 4HUXA 4GW5A 4ZXBB 5CZKA 3I02A 1AQDB 2VL5B 3U46A 2FWOB 5IGXH 1UENA 1CD1A 4WHYG 1M4KA 2RB8A 4KRPD 4P23A 2AXGA 2IQ9L 1UYWL 3RTQA 4M43L 3HMXA 2IPUG 5H2BB 3F62A 1OLLA 1NBQA 5BVJB 1FYTB 1KLGA 4D9RD 3EYSH 1P84J 1YMMD 5EA0H 4KK5C 3UCRA 2X41A 4OGYL 1MREH 2KH2B 4B53A 1X4XA 3O8XB 1MIML 5DD6A 4RFEA 3O2VL 4NRXA 4JHAL 1YECL 1AGEB 1MY5A 4MWFA 4N8VB 3B5GA 3GMLA 4WFHD 2CKNA 1ZXQA 4PJ7A 4P46A 5EZOH 2CJUH 1P2CB 1TVDA 4JFEB 3R8QA 1P4LA 3IFPB 4Y2DB 1S7RB 4HKBA 5E5UB 5GPRA 1D6VL 4C59B 3MLRL 1QFOA 2B0SL 4AL8L 4ONGH 5CP7A 1IAIH 4WDIA 3VWKD 4U2ZA 1A3LH 4FMFA 2PYED 1INEH 1KJVA 4MDJB 1S7TA 2W0LA 5JO5A 2ICCA 3VXRA 3K2MC 2AAVA 3KPSA 4YUEL 5IT2H 3GHEH 1KN4L 4BQ9A 1CD0A 1RZJC 2R2EA 4Z78A 4OZGF 3RWDB 3ULVF 4Y4KB 2FL5B 5BMFH 5BS0B 3P0YL 3QR2A 4I3RL 1NGZA 1Q0YL 1NCDL 4PLJC 1NFDE 3H9SB 5T1MB 4P48A 2C9AA 4R0LA 4LDEB 5GRUH 4U0RB 2I5YH 1S9VA 1NMBH 3OF6D 5EU3A 4WO4A 5CEYB 1CXEA 3ARGC 1DQJB 4ZYKA 3MLWH 4YH6A 3DI2B 4E42B 2VC2L 1EEYB 1RZJH 2NXZB 3ALXA 4HS3B 1FZOA 4WWID 2FLBT 5J57B 3MBEA 3CCHA 3RIAF 1Z6JT 3I6KB 1JGVH 1IGML 3FKUS 3O9WD 4PJ8C 4XNMA 3RKDC 2JIXA 5ELIA 1FL6A 3U4EA 3T65B 5BW7A 1F4XL 4LSPH 1PFCA 4MCYA 3WXWL 4POZC 5DGRA 2ATKB 2P8PA 2DMKA 4K7FA 4NFDA 1LP9B 1DUZB 4WI4A 3TGXA 4CGTA 4U1KA 2OTWB 3DPBA 3ULUC 3MRIA 1NAMB 4IHOB 1YC8A 4HWZA 3S4SB 3OR7A 3WIHA 3FB7A 3WXVH 1S7UA 5ECJE 3WDJA 2DD8H 3QQNA 2UV3A 32C2A 4YGAB 2WQ8A 1MJ7H 4KY1H 4D3CL 1FN4B 1C5BL 4MAUL 3IFLH 1FNEB 1IGFL 4FQXA 2OR9H 2Z31C 1S3KH 2EC9U 5T33H 3ZO0A 3MRGA 2ZG3A 1HOCB 4XTRC 3ARFB 3T0EB 2I25N 1E4JA 2VDPL 3OKLB 4P5KA 5JPMB 1H5BB 3BSZH 2G9HB 4P49A 4XMPL 2FEDC 2YKLL 4XWGH 3IKKA 1KJ2A 4JQIH 4LLUA 1NKOA 3NPZB 4PB0H 4FABL 3IU3A 3CFEA 5HHPB 1GVIA 5J9PA 1FNSH 1WFOA 4IIQC 5I1HH 5I1EH 1BBJA 4P2QB 3PV6B 2R2BB 4H88H 1DBKH 1PDKA 3NA4A 3CPLA 2VZTA 1ZSDA 1UM6H 2OQJB 2EXWC 3WLBA 4PJAA 5C07D 5IIEA 4LP5A 3LV3A 5BV7C 3ET9F 2J2ZA 4KDVA 1ZLUK 3WIHL 4QT5A 1CDCA 3CUPB 4XCEA 5SWQB 3D85B 3OKMA 4RRPG 1CWVA 5HI3D 4HUWA 2P47B 3UYOD 1OOAA 1EUUA 2WINB 1JNLH 5ETUB 2EIEA 3QEQD 2HT3C 2OR8A 3PL6C 2GTWB 4KK9D 2D03H 3O45A 4U1HA 3CFBB 4OAWB 3GDBA 1GGBL 3UBXI 3MODL 3PHSA 5FFLA 3LSOB 1ZOXA 5E2TL 2VQTA 5L6YH 1RIVL 3KLDA 2P43B 4WU7B 5BV7H 1HILA 3UYRH 3DURA 1W72B 3GBNL 4GAJH 4S1DC 2OS7A 3MMEA 3CLFH 1YEJL 4RGOL 3H0TB 1FPTH 3S34H 3P4MB 1VERA 4UT9L 4X6FA 1HIML 1S9WB 1LVEA 5KANG 1QBML 4PLNC 1FZKA 3T4YB 5M95B 2CXGA 5LGHL 1EEZB 1F45A 3F5WB 3T8XA 1S7VA 4M1CC 3BAEH 2X44D 1T89C 1RUMH 4GG8A 4EDXB 4K3JH 2Q8AL 4CW1B 4WFEE 1JK8B 4NQDE 4XXDB 3GSXB 3J8F7 5E6ID 2EDWA 5J1AA 3AB0C 1OGAA 3CVHH 4OF5A 4ZQKB 5FF6A 4RFNB 2IGFH 2R9HD 1IKFL 1I8IB 3F12B 1BBDH 3IFNL 4R9HA 1KPVB 5FCSH 1IM9B 2P8MA 1J0HA 4WHYH 1VKXA 2GT9A 4TUKH 1Q9OB 1BFSA 1DQQA 3VH8A 5C0DA 4KAQL 4XAWH 3KPQB 3VG0H 1DN0B 3BPOC 5CD5D 1G9ML 4F9LC 3QFJE 2HA1A 2MQCA 3O6KL 3F7YB 2F58H 4KI5E 1SYSA 3T0AA 1R3LA 4DZBA 3HAEB 3RWGA 3RWCB 4JPIA 2GSIA 4XRCA 1L6ZA 4NQUA 4BZYA 1YY9D 3QRFM 2N7BA 1Q1JH 2FBJH 2PUQT 5DRXA 5JHDE 3MZGB 4KVNH 4C4KT 1QLRA 1KB5A 3UBXA 4M9OA 2JJWA 3NVQA 4Z7UE 1MIEH 3IYLW 3IJYB 35C8H 1S9YA 1KB9K 4N0CC 2E9WA 3RFZC 4XWOC 4JDZA 2AJYH 5DMJB 3VG9B 2MOVA 5TFSH 4TSBH 1Z9OA 4ZSOA 1VFUA 4JO4H 4APQB 4HJJL 4P9MH 4PRHB 5GRJL 3L3IA 2BVPB 3SKMB 4Z7VF 5C0BE 3FFDA 1B0RA 1MQ8A 5KSAA 4QRPD 4LBEA 3V52H 1S7WA 3IKCA 4L5FH 3BO8B 5LVEA 4HIXL 3MGAA 3HMWL 4W81A 1CG9B 1ROWA 4TNWF 1DLFL 1IC4L 1MVUB 3LKOA 1MWAH 3GNML 3ZDXF 1TJGH 2CDFA 1R5WA 5DJAA 5EOCL 4O2EB 3C60C 3CXDL 3S35H 4HUXB 2B5IB 4J3XA 1U8MB 5J3HD 3OKKB 2A6DA 4G8GE 3TBWB 1OTUC 5F9JA 3RX5A 4PJEF 4U4BA 5DLML 5LG1A 5KBNC 3U2SB 1JPGA 1RURL 3RQ3A 1ONQB 4NBZB 5F3HA 3QDGA 4NM4H 4WTXA 4IRJD 1YJDC 1OB1B 1ZS8A 1ZT1B 3VMOA 1QPXA 1HWGB 4CADA 2YPVH 3SO3B 4NNXB 1B4RA 1FO0A 2B1AH 2NY5C 3MACH 4FXKA 4X4ME 4LU5H 4YAQA 3GGWA 4X9BA 4RFEB 3NGBC 5EO9A 4LFHD 5LKNA 5EZJA 3SDYH 4Y16D 4MWFB 5H37G 4NUGH 2X40A 4PP2A 1VCAA 4PJ7B 3RY6C 1FCGA 1FE8L 2IMNA 1CL7I 3PWNA 4MNQD 1YJDH 4MVB