5I75B

X-ray structure of the ts3 human serotonin transporter complexed with s-citalopram at the central site and br-citalopram at the allosteric site
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
218
structure length
218
Chain Sequence
EVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKQSHGKSLEWIGNINPNNGGTSYNQKFKGKATLTVDKSSTTAYMELRSLTSEDSAVYYCTRSPVRPYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures and mechanism of the human serotonin transporter.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Sodium-dependent serotonin transporter
total genus 36
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2016-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i75B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i75B02
1G9NC 4PJBE 1EGJH 3MBEC 5D7LB 4GFTB 4Q6IA 5IB4A 3LMJH 1J1PL 5HDOA 2GJ6D 4UI2A 3LMJL 5E6ID 5EORH 5HHQB 3QHZH 2V5RA 1URLA 3LIZL 2VNCA 4NQDB 5GGUA 3KHOA 2BOBB 4HBQA 1INDH 4X6CA 5IHUL 2VABA 2YZ1A 1RIUH 2IH1B 3W82A 2GSGA 3KYKL 3GDBA 1VEMA 3NTCL 4KZEH 4PJCB 3MBED 2P5WB 1GGYA 1GZPA 15C8H 3VD3A 5I6XC 1FLRL 2Q87A 4OSUL 2ENYA 5DLMH 2XICA 5KS9F 3UBXG 4RMWA 3EFDL 1SEBA 2XTLA 3CC5B 4JM4H 1FC1A 1SYSA 2EKSA 1CFTA 2L0DA 1A4KB 1OP5H 2ESVE 2VL4A 1KJ2A 5IB3A 4W68A 2OR8A 3L95B 5IB5A 2FLRT 1PZ5A 3ULUF 2WSKA 1OP3K 3AS1A 4WO4D 4K7PL 3IVKA 3C2AH 3C08H 4PIRF 1W0VA 4MSWA 3MXVH 3RHWK 4OCWL 4IOIA 3CVHB 1T1WA 3MUZ1 5M7QA 1BQLH 3BDBA 3JVGC 1QBMH 4M4RA 3Q6FA 3GZKA 4O2FA 1RIHH 2EE3A 5DC9B 5FDWA 3SDYH 4HIIB 1TQBC 1QFWI 5GSRA 3KPMA 4YDVA 2FIKA 2GHWB 5BV7C 1NLBL 1YY8A 1WVZA 1WV7T 1KN4H 3QIWD 2X4PB 4RWYL 4QOKE 1KGCD 1KN4L 4RMTA 1YY8B 1MAML 2GJ6E 4ZUTB 2ED7A 5FCUL 4L8DA 1J5OL 4HCRA 1A9BB 3LOWA 5JW4R 3T0BA 2I9TB 3EJZD 2UYLB 4P23C 4S1QL 2PTUA 4HG4K 4S11A 1S5HB 3F7QA 3L3DB 2Y5TA 5HYSG 4AM0B 3QAZC 3GFUA 4U6HA 1CFSA 3KPSE 4KUCF 1R3HA 4JRYE 4ODBD 3V52L 2H8PB 1AR1C 4JGJA 2HTKC 4EOWL 3NFNB 3HNTL 4Q58C 3GJEB 2C9AA 1LGVA 1T66D 1FGNH 4IS6B 3EDDA 2AP2A 4L4VB 4EUPG 1R5WA 4HIXL 1P6FA 3GGWA 4N8CH 5HBBA 2UZIL 4HZLA 4JZJA 2NY6C 3H9SD 5DA4A 3FCTA 4FFZL 2JELH 4JCMA 3SDAA 2AEIT 4PD4J 3JWOC 1AHWC 4Z95L 1EEZA 5FM4A 4G6JH 1MAMH 4X6DE 1U9KA 3QFJA 1CD1A 2XI9A 1DVFA 4LHUB 2D4DA 5KTEL 3WO3B 4MNHA 1ZT7A 5LCVL 4X5XB 1KEGL 1S9KC 1I9IL 1KCVH 4PG9B 4QRUB 4P2QE 1A4KA 2IALB 4F7TB 4XPBL 5IOPB 3V95A 1TZIB 4XPBH 4CADB 1C12B 5D5MA 5INCA 3DVGA 1L6XA 5E0QA 4BA8A 1YEIH 3DRQB 4G7YL 3MJ9A 5I30L 4EUPB 3L5XL 5FUZL 4XC1L 4XP5H 3L5XH 1YZZA 3QA3B 4PUBL 4X6CF 3LB6D 4RAHA 3H7LA 3MLWH 2Q8AL 3S5LG 4DTGH 4X7TB 2J12B 4I2XE 1DEEB 3P0VL 2IBBA 1AIFA 1QZ1A 3TGXA 2E8YA 5TDPB 2R0KL 1AGFA 1LVEA 4ZDHB 3SO3B 4WFHE 1BVLA 5FDWB 2M1KA 1CICA 1Z5LA 4XNYL 3U0PB 1MELA 3KPMB 4XB7A 2A9NL 1OGTB 2Q3AA 3U0PA 3S4SG 5JPNB 3REWA 5EU6D 2AJVL 4RMQA 4RQQA 3BP7B 4NZRH 3RAJL 4EQ3A 2YUXA 4RA3A 2W9EL 4Y2OA 1DLHA 1FG2A 4GO6B 5E4IA 2D9CA 4OCMC 4NRZA 5ID0B 1NCAH 4MQ7B 5IJVA 2JJTC 4M7JH 1NFKA 4QT5B 1CXKA 3MRBB 4Z7VE 4JFHE 3OKMA 1A2YB 3MACL 3TPKA 2IEPA 2NTFB 2FATL 4YK4B 2MKLC 4GKSB 2HT4D 2KZ1B 4L4VD 2WBWB 3CVIL 4GKSA 3QQ9D 3RVXD 5ICYB 1N8ZA 3QQ3A 4QF1A 4JY5H 3WFCH 1IM9A 4QF1B 3EJYC 5HDQL 3HNSH 3U0TB 4KI5D 4WUUA 4FQLL 3AVEA 2Y6SD 5D7KD 3QQ4A 5JHDE 3CFJA 3MMEB 3QQ4B 3AB0B 3WKML 3CFDB 1KB9K 3CUPB 2DLIA 5F7DB 3JBG7 4OM0H 5EOQH 2Q6WB 3V0WH 4D9QD 1CE1L 4K7FB 2ZCLH 4FA8A 3VWKA 4U1MA 4HGWB 4YDJB 3HMXA 1OAZL 4WHYH 4IMKC 2MQ0A 2XA8H 4JAMA 2VDRH 4NQEB 4WI7A 5LKNA 2HFEB 1T0NB 4L3EE 4JFED 2WBJA 1I1YB 4JO3H 3JXAA 1S5IH 1TETL 5IW6A 2GQHA 5TF1H 3I75A 5DD0H 4DK3A 3PWPB 3E1F1 1DBAH 3SGKC 2HVJA 1QACA 2JIXA 2VLRA 2X5PA 2HMIC 3D48R 5DJ0A 1NAMB 2YPKA 4NQCB 1KTDA 3BESR 4AMKH 1YEJL 1IT9H 3BKYH 5LBSH 1LP9A 2WBJD 1CGVA 3BJ91 1K8IA 1XGTA 5SWZA 3SDXE 3MXWH 3D69B 4O51B 1RURL 2WUBL 4TSCL 4JFZL 5GGRB 2D0HA 1FL3A 3TA3A 4ZAKD 2BVUA 5CWSB 4F7PB 4N1CA 3FO1B 1NL0L 5ETUA 3GSOB 4FQJL 3FQRB 2FSEB 3U36B 4KRPC 2HT3C 2PCPB 4GQ9H 1WFUA 5B21A 5HY9B 3DMMD 5JIPA 3PWLA 4TVPH 4Z7VA 3H9YA 3RVWD 1DBML 4PJEB 3CVHL 1U8IB 5E7FA 2VERN 1I3UA 1T1XA 2ZOKB 4NHCH 5F44A 3PG2A 1SVZA 4J6RL 4JFOA 4KRPD 1J0HA 4UNUA 1R3KB 2E6PA 3BGFB 4TYUA 4GBXD 1N4XL 5EC2B 2YWZA 4J3WA 4PB0H 4NN7C 3RP1A 5I73C 4MJIE 4NGHL 1LK2B 4L4TD 4K2UL 2N56A 1OT1A 4N1HB 3GK8H 4AH2B 1HIMH 2A73A 1TCRA 4ZO6A 2DQUL 4AH2A 4M9PA 3ROLB 1MRCH 1T21A 2I60L 3I50L 4POYA 3QO1B 4OFIA 3S97C 1LDPL 3B3IB 5KSUA 1WWAX 1FFPA 4OZHB 4ALAH 3DO7B 5I1JH 1CXFA 1EHXA 5EU6E 4IRZH 4EIZC 5EUKB 4NUGH 5E2TH 4P4KC 5MERB 4MDJA 3TZVD 4YDLB 4OGYH 5E08L 5DZOA 4HX1A 3TNMB 3LKPA 1FNLA 4RAUB 2EDLA 3C09B 3VXUD 4OFYA 2AERT 2X4OB 4DVBB 3G6DH 1AO7A 4CJ1A 4UZGA 4JPWL 4WU7B 2DQJL 1WQVT 3KYOA 4KY1H 3ALXA 1BHGA 5FDYA 2X9WA 5IR1B 5JR1H 5E5UB 5GIRA 2Y5EA 4PTTB 2C4XA 4X6BA 2A9NH 1YUHA 2FECL 4WCYH 4IJ3B 2CD0A 4GLRI 2P7TB 1MRFL 4Q9QL 3MFGB 3MR9B 1I7UA 4XRCA 1G0XA 4H26B 4IIQB 2I60H 3I50H 4D8PA 2VQTA 5EUOF 2DMKA 3PDGA 1KTKE 5FHAH 2L7UA 2DD8L 4L1HA 4YHIB 3H3BC 5LCVH 5GSVB 1I1AB 5FGCE 3WXWH 5I1LA 4ZYKB 3OX8A 1YEKL 3QNZA 1BIIA 1ACYL 5I8EB 4OTXL 3DETD 3BUTA 5H35B 3OX8B 4FRWA 3DMMB 1KPVB 3MUHL 4RISL 5HI5C 3O45B 2OL3B 1JHTB 1EO7A 4PLJC 4HJJL 4OIIH 5IF0A 1KYOJ 4WVRA 3GI8H 1EERB 1A0QH 3D3VA 4XP4H 4HPYH 4Y4HC 3SY0B 1R3KA 1WC7B 2NR6C 2Y72A 1JUFA 5FF6A 4X9FA 1X7QB 1JUFB 1FSKB 1ZT1A 1S9WA 4JDZA 3GUTA 2VXUH 4OLUH 2AQ3A 1VGKB 3MACH 4A6YB 3PGFL 4LLDA 4Y16A 1JN6A 1ZLVH 3UTZB 1KB5L 1G6RA 4LLDB 2P8PB 1GC1L 2NNAB 1OVZA 3BPCB 1UZ6E 2MJWA 3KXFD 4PJGB 4WWKB 5CHNB 1RK0B 4ZO8A 1CDCA 1SQ2N 2NY2B 4K3JH 1XF2A 3RIFF 2DLHA 2Y1VA 3C60B 1AKJD 4L8SC 4Z5RB 1BPVA 1BJ8A 3FT2B 4YR6A 1Z2KA 4Y89A 3QUXC 2VL5B 5C92A 5F3BA 6CGTA 3I6LD 1T83C 2VXVL 4FZEH 3WKMH 4PGJA 3LKNA 3DBXA 2W91A 1N59A 2IAND 4CMMB 4YHYC 4BFIB 4I18C 5DD6B 4LKCA 1ORSB 3MRKB 1BQHG 1A1OA 1I1FB 3MUGB 1VFAA 3ZYJA 1NANI 2BC4A 4WV1B 4YDIL 4K71C 2RCSH 2VE6B 3U6RB 3OKDB 3OZ9H 3RL2A 3T4YB 2DMCA 4MAUL 1NGWA 4K7PH 4WGVB 3HUJA 2P43B 5AYUL 1UCBL 2DKMA 1T0PB 2VXUL 4ONHB 4TTDD 1AD9A 1KELL 4U1HB 2W0FB 4P3CL 3BYTA 3KPNA 3EO1B 4ZOAA 2OCFD 1FVEA 2P4AB 3ZE1F 1F4YL 5EZLB 1NAKH 32C2B 4ZPVA 4X4MA 4P9ML 1KJ2L 2B5IB 3BGFC 2BNUA 3PDOA 4KK8C 5JW4Q 4KROD 4RDQF 3OSKA 3PDOB 3P4LA 3QRGH 4X7SL 4X7SH 2YR3A 5H35A 3QUYC 4LLQA 5ICZA 1HDMA 5E7BA 4GG8B 1WAAA 1CT8B 2HLAA 1BJ1H 2A6IA 4UTBH 3S88H 3RGVA 3VFPA 5GSRB 4WW2F 4QXWA 1ZA3B 4KKAC 1I9JH 4EEEA 5EFIA 1AHWA 1T2QH 2VUOA 1CWVA 4TPRH 3ZKNC 2OZ4H 3RU8H 3I9GH 2FGZA 3G5VA 4JFZH 2DIAA 3D39E 2EEBA 1RQ5A 5FGRA 3MLPA 4NIKB 3ULUE 3RY4A 3MA9H 3KPSA 4XNUL 2HH0H 1INQA 5CEXA 1I7ZB 2I5YH 1YMHA 1ED3A 3GSNB 1JZ5A 1EH9A 4FQHB 2Y5TB 2A1WH 4G8GD 4BZ1L 3S4SB 2AXFA 3FO9A 1I4FA 3WYRA 3WHXB 1C8PA 1QHPA 2AXFB 3FO9B 4OGYL 5BVJA 1R3HB 1RJYA 4UQ3B 4DVRH 3EJYD 1L9NA 2OZ4A 3KPPA 2X1QA 3BE1L 1ZHBA 2ZJSL 5HHOB 5MEQB 5FEBA 1BWMA 1AI1L 2IBZX 5FA4B 3GJEA 4CKVX 5E24E 2G75A 1ZHNB 3M07A 1RHHA 4AYFA 4LBEA 2G75B 4F8TA 5CSBA 1LEGB 3IDYC 4LBEB 3H9HA 4LKCB 4JR9L 1LK3H 2ATPA 5K9QG 4P5TB 4DGVH 4V1DA 3HS0B 1INEL 4M48H 1ZLSL 3RVUD 2AXJA 1NCUA 5I16B 1KLUA 4U1IB 4X4YB 3HS0A 1PDKA 2NY1C 4OI9A 5JOPE 1MFNA 4X4YA 1GIGL 1F90L 1OGAD 1ZT7B 5C0IB 1QNZH 3LS5H 3IKKA 1Q9LB 4PJAA 2J2ZA 4TN9A 5HI3C 9CGTA 3RNKB 2Z31D 2ED9A 3S3JA 2R2EB 2Z31A 4K55A 5E5RB 4XBGA 5CZXD 4OLZH 2VLLB 3KXFE 1KJ2B 4C4KO 4NP4H 4QY8B 3QDMB 1CE6A 3V5DB 1VKXA 3GBMH 3NIGE 4JM2B 4NQDD 4GJTB 2HRLA 4YAQB 4XI5D 3T65A 2OK0H 3BE1H 4XH2A 1Q0XH 2SEBA 2C7UA 3QDAA 4HPYL 3VGGA 5DK2A 3ZT7A 4XH2B 4P59L 5DEZA 3MRLB 4UIKH 3MOBH 5CZXC 1IBGL 4JGMA 3N1GC 4X5WB 1ZAGA 4P4KB 3S96B 4ELMB 2IH3A 1UWXH 2AJXL 35C8H 1I7RB 1MH5A 3B2VL 1S7TB 3G5XA 5HHPB 1N7ML 4UOW1 4X8JA 4XPAH 3G5VB 3FB8A 4XMKH 4XC3H 4R8WH 1VGEL 2HTKD 1OWWA 2V5TA 1T5WB 5IIEB 2B1HH 3RWJB 5IVOA 4LSTH 1NLDH 1DP0A 2Z8WC 3ULSA 4YDLC 4DQOH 3UTOA 3HRZB 5GRUL 1AQKL 5BMFH 1DBKH 1E4KA 4GRWB 4PREB 3S4SA 3ULSB 4HPOH 1MIMH 4HWZA 4Q6IC 1D5MA 2B7DT 4MYWB 3TESA 3CLEH 4Y2DD 3TT1L 4H0HB 1B2WL 3HC4H 5CD3B 3UROR 3WIHH 1ADQH 1C5DA 3E6FB 4GW1B 2ESVB 5D2NC 3FT3B 3FQUA 2XQYK 3VFOA 1OAKH 4M7KH 4ORGA 2JJWA 2Q3ZA 4RGOL 5DMIL 2PW1A 1F3DJ 5C0NC 3QAZB 2FWOA 1KIPB 4RSVA 4Y19D 1IBGH 2J4WH 4Y2DC 4JVPA 2YPLD 1CVSC 2IMMA 5E94B 4MLIA 5JOFA 1O7VA 2N7AA 5SX4I 1F45A 1A6TA 3PHOB 1DBBL 5D8JL 4JZJB 4POZC 4R2GC 3FB6B 3FN9A 3D25B 4EUPH 1YEHH 4ONFH 1JPST 1NC4B 1ADQA 1OSPH 5ID1A 4O2EA 5GS3A 2BRQA 2LAGB 2HFGL 4M1GH 2QR0B 3SDYL 4UBDC 5C09A 5T3XD 4G6AC 4P9HH 1HHHB 4OJFL 3T0WA 2FIRT 4F7TA 4NZUH 5CINL 3AROA 1LMKA 5BMFL 4KHXH 2HJLA 2CMRL 4JFEE 3VRIA 3VJ6A 1A7OH 3FT4B 3CLEL 1MJ8H 1NGQH 1PKQB 5DJ0B 4EUPA 5CJOH 4X8XA 5C71A 2NYYC 3U0WL 2L7JA 5T3ZH 4L1DA 1NFDF 5T1LD 5HHME 3RDTB 1QEWB 3QIUB 4JKKA 4I48B 1T89A 1SJHA 4PV9B 1AGFB 2NY1B 2FX8H 1JVKA 4P46D 5HDLA 3C5ZC 1KT2B 2V17L 5DMKA 2DQTL 2X4RA 1ZVSB 2A2QT 2QBWA 4ZTOL 4Z9KB 3V8OA 2BX5A 1FYHB 2ZSWA 3B9KC 1R3JA 4GOSA 1HQRA 1QYGL 4J3UA 1ACZA 5DR5H 1JZ7A 4M00A 3QP3A 3HC0B 4BZ1H 1SHMA 3SDXB 3BPLC 3W9DB 3VFMB 4JFYB 2XWTA 3KXFA 2MNUA 5CBAA 4Z7WB 2XWTB 2Y7QB 1NUNB 4HH9A 1A6WH 5B39B 2DQFB 4OZIA 5IB1B 2GTWB 1YC8A 3HE7C 3FKUS 4G6JL 4L3CB 1LDPH 2R1WA 4F9LC 2R69L 1YNTB 4BZ2L 3TH4T 2NTFA 4J3OC 4YHNA 1UH4A 3V6BR 2YHGA 2BNRB 4MB4A 4POUB 1MWAH 4GRWE 4JHAL 1NCCL 1FIGL 2RR3A 4PJ8B 2ZKHH 3MO1A 4GKOA 1IM9B 5L0QB 4AZ8A 3HE6A 1FPTH 1KG0A 5TQ2L 2R8SL 1ZGLA 4DOHB 5J6HA 5DFVC 2GJ6B 3A6BL 4J6RH 1A3RL 2PO6B 4EOWH 1OD9A 3OL2A 3GMPB 1A3RH 4OLVL 3EYVB 4S0SD 2CKBA 4ZAKA 4UMGA 5EPMB 3VH8G 1NKOA 4PB0L 4OLEA 1FGNL 1UWGH 4DGVL 3SOBH 2A6JB 5C09B 3MV8D 4O02H 3G08B 3MROA 1X5LA 4RWHA 1QFWH 4PJCE 4IRSC 3IDXH 5MEPB 2R39A 3ABZA 1JBJA 1RUKL 1CXEA 4JFDE 1GAFL 5DF0A 5CFHA 3VFWB 3GGWB 3QDHA 3RPIA 1B3JA 2WK2A 2X7LB 3DUHA 3PV6A 4WTZG 2VAJA 5J89A 4YBHA 3LQAL 3HR5B 3QEQE 3HA0A 4HEME 1JNNH 4FNLL 5GIRB 5KVMC 5MI0B 1J0IA 2VR5A 1NCAL 1UJ3A 5C0DA 3WHE1 3MNZB 1KYOK 3VH8B 3OB8A 5C0DB 3DVIA 1R0AH 3LHPH 3W2DL 4X5XA 4M93B 3O6LH 1I3GH 1RPQA 1T1ZA 1FL3B 3TA3B 2EH7L 3ULUH 3MYZA 2Q76A 4R8WL 1KOAA 12E8L 4F7PA 5JUEH 4H20L 4TUKH 1QNZL 3LS5L 1CDUA 3FQRA 4HFUL 1ZEAH 2MHAB 3QEUB 4ZNEE 1DBKL 2X42A 3SDXA 3CCHA 4WUUD 4XGZB 2OL3A 2MWCA 1A3LL 4PJEA 4OLUL 3NFSH 5HSFA 5H8DA 2DWDA 1NGZB 4KPHH 1FV1A 1KB5H 4NFBA 5D2LF 4PJBA 3RHWF 2Y7QA 2VDKH 5B3JE 1T1XB 1ERNA 2K7QA 2MQCA 4XMKL 4P57A 3CVIH 2PYED 3PL6A 4BSWB 4GXUM 3C6LC 3T4AA 1CD0A 3T04D 1S9YA 1I8MA 5JLZB 2PYFB 1M71B 3NTCH 2A0LC 5FO8A 3KJ6H 1ONQB 2XZAH 1CU4H 2WWKT 4B0MM 3BP7A 2X4NA 5DJZB 1REIA 1ONQA 1WWBX 4TUOB 4LSQL 4XAKD 3VE0B 1DQMH 2D3VA 3IGAB 2P24A 3TBYA 1F4XH 1F4XL 5E8OB 1QO3A 1JPTH 1FZMB 4H0GA 1ZS8B 2AK4A 4JO2L 4MA1B 4Y4KC 5MEOB 1OM3L 1PSKL 2AEPH 3LY6A 5EPMA 1X3DA 3PL6C 3FTGA 5JHDA 3GSNH 5BJTA 1H8SA 1U3HC 4XNXH 1UEYA 2XN9E 4RGND 4J3VA 3I02B 3PGCB 3C2AL 4F7MB 2DQEH 2K9UA 4W70A 3CFBA 2DWEA 5LG1A 4YK4C 1T4KA 3BPLB 4ZS6C 3DX7A 4AQ1B 3FONA 4BUGA 4U6XB 4PJGE 1FORL 1XGQB 1ND0A 5SWSE 1CGWA 3MRKA 3K1DA 1JFQH 2IPTL 5D70H 1JWMA 1JFQL 1YEEH 2IPTH 2J6EA 3M17A 4AEIL 4TOYL 4JRXE 2OBGA 5GS2D 3VFRB 3EYOB 2NY0B 2M8XA 2YMXH 3QZWB 2R0LH 3S37H 3T0EE 3G6JF 3QRGL 1U8QA 3ARDA 1B4JL 2HT2D 4D0CA 5CEYB 3BIKB 3QIBC 4RNRA 5HI5D 2UUDK 4CBPA 3KPNB 4HXBL 1NL0H 4OFDA 4PJ7E 3BGMB 1T1YB 4Y4FD 5F89A 5D7LE 5EUOB 5EZLA 3VFNB 4JFFA 4C57C 1UZ6F 1JPTL 3SE9H 3JV5A 2PXYA 3PWPA 2Z92B 3MGOA 5IHZB 2XZCL 1Q9OB 5ESAA 1T7ZA 3LRGA 4CN1A 5FUZH 1BBJA 3QCVH 2MQ3A 4MA3A 1MFBH 5T5NG 4N68A 1F3JB 1Q72H 3O11A 2J5LC 2NY0C 4GXVL 2R2CA 3QPQD 4X9BA 1NCTA 4XVJH 5E2VH 3HNTH 2JCCA 2ICCA 1UM6L 4IHOB 3OHXB 2BMKA 4P3CH 5D1QC 1XH3A 3ARUA 2DI9A 1ZA3A 3JV4A 4G6FB 3ULVH 3DETC 2MPAH 2ZUXA 5DRNB 1S9YB 1I8MB 5DRWA 2J88H 4P5KB 3UTPD 3TFKD 3BRGC 4XP6L 1RIVL 5F9OH 1XIWC 3LRSB 1D5ZB 2UZXB 3KR3L 3REVA 3SDCB 5EZOH 2W07A 3OTTA 4DKFL 1LP9E 3EOYG 4FQHA 4PGZA 1OAXL 4PJXA 5KZCB 2R9HD 3LSOB 1FVDA 1EXUA 1KUMA 4S1RH 1K2DB 2WWKO 5FO7B 2GTZB 1KXQE 2VDMH 3QR2A 4JLRB 1S7SB 3HAEG 1LE9A 5BJTB 4FQPA 5IB2A 4N1EA 1LE9B 1EHLH 3PGCA 4N0RA 1MCWW 1FZJB 5ERWB 2WLYA 4L3EA 2R69H 1JZ3A 1WCBB 5HYEA 3MRNB 3P77A 3JTTA 3O9WA 5ACZA 5I1JL 4OFKA 1U8PB 4NM8L 3M17B 3C2SA 4PV8A 1U3HB 3B3IA 4WV1A 1AFVH 2Y4SA 3MLRL 3CFCH 2GK0B 3MRFA 1BP3B 2VDQL 4KROC 3VFTB 1JMZA 2F54B 2XA8L 4MD4A 3LN9A 4H8WL 4HS6A 1D5BA 2BSTB 4NKMB 3GHBH 4LOUD 4LPVA 4JY6B 3QNXB 2AJXH 5DD0L 3S5LB 3VXTB 1TZGH 3KS0H 2PYEE 3BSZL 4BFGA 4ZUVA 4Z78B 1OAUL 3MV8A 3KYOB 4XPAL 4HDIB 5GHWL 4Z0XA 3QUYA 2AABL 1HSAB 5HYSB 3MRLA 4Q6YA 4ISVA 4MVBD 3ET9F 3MLVL 4KTEL 3IJSB 1NFDB 2I07B 3RGVB 2H2PD 1RAMA 3BJLA 1YY9C 1U0QA 1YEGL 5LAXB 4PJIF 4EBQH 3L3OA 3DVNA 5HYQA 2KUTA 2AK4E 2FHCA 2W9DL 1CZ8H 2FGWH 1A9EB 1RZJC 4MX7B 3U30C 4KK5C 1WITA 4IMKA 4KDVA 5E6IB 4P5KA 1FNAA 3EHBD 4PGEA 4DZBB 4WIQA 4TVPL 3CX2A 4PGEB 4D0DB 3TH3T 2VZVA 2B2XL 3NMEA 5C6WH 3DV6B 3P9WB 3EGSA 2P44B 3OPZH 4HWUA 2FJFA 3GJFA 3OB0H 3IJYA 4JO4H 1BZ9A 3GBLA 3FQTA 4ZD3L 4HWZB 4B7LA 4JO3L 1FFQA 4KI1A 4E41D 1IC4L 1S7SA 2BNQA 2J3SA 2DICA 4HC1L 4HKXB 1LO0L 5DK0B 4HC1H 3KAAA 3O6MH 2BNQB 1AQDB 1TTUA 5I75B 2AJZA 5T3ZD 1CN4A 2AVGA 4JG0H 3T1FA 4JRXB 1KIPA 5DZNA 3QXDA 4PRIA 3LS4L 1BF8A 1MJUH 4X6DB 4UDUA 1ZTXH 4P9HL 4ZNEA 4N0FA 1A6TB 4RA0C 4LDEB 4I9WE 2Z35A 1DUYB 2UWEE 2MCG1 2CPCA 4NQVA 5D2NA 4HC1A 1NGQL 3HG1A 4EDXA 2W9DH 4HK0B 4PY8I 5F7NC 3CDGA 3CLFL 2D7MA 3U0WH 3BT2H 4XI5C 2FNBA 4WEMB 1E4XL 2DI7A 2LAAA 4HV8A 1K5NB 4I0KA 3ARRA 1TPXB 1UFUA 1JHLL 5EOTB 5DRXA 5KN5B 2B39A 3GSNL 1MUJA 4R96B 2FBJH 4TQEL 1I8IA 4JRYB 1IAMA 5CZVH 5C86A 5ECJE 3NFPA 1RUPL 5GGSA 1UGNA 4OLVH 4QHUA 2OI9C 4CW1A 2QHRH 3MXVL 4Z7NE 4KUZL 1HYSC 2DAVA 1H5BB 1OSPL 4P2RD 4PJCA 2GAZA 4O02L 1U93B 4NC0B 2HG5B 3MV01 1CGUA 3MGTA 4MJIB 1BFOB 1PQZB 3EJZC 4U6YB 2OTUB 5C0FA 1AGCA 4WWID 3SKOA 1I9RH 2X4RB 5HVWA 1SYSB 2EKSB 3SKOB 5IBLD 1YEFL 1AI1H 4KHTH 3N1MC 3WS6C 1OTSC 1MH5B 3E3QC 4CVWA 1R3JB 4G9FD 3S3PA 5DTFA 3DX9A 1CICC 1H3GA 3L3HB 3S36H 3SO5A 4P4RB 3GSUA 4FMFA 2B0SL 1KSRA 3KNBA 5CP7A 3GM0A 2JKXA 2N4IA 5HYJD 1I3GL 3SJVA 5HYJA 2XN9B 3WS3A 5B38B 1YNTA 4DEPC 3QIBB 4G42A 5J12B 3CSPA 3LEVL 5GRVL 3LEVH 1MHPL 1DQDL 5D1ZC 4JPWH 5SWZE 2YXFA 2OJEA 4ZTOH 1AQDA 2FIKB 3P0VH 5I2IB 1AO7D 5L8JB 4UAOB 5CMAA 2ESVA 3UYOD 1IEAB 1K4CB 4JKMA 3CPLA 3MLSH 4QKXB 5IFAL 4F33B 1K4CA 4NZTL 3WNKA 2NX5A 4YUEH 3IDXL 4QGTA 2A83A 4YE4H 1KG0B 4RAVA 3RTQD 2BY2A 2BNQE 1UKTA 5FUOL 5I8KL 1RUKH 3DJ9A 4RAVB 4PRHA 4CU6A 2UYLA 5J4MA 5HVFB 5I17A 1N5YL 4IOFD 5D2NB 1V7NL 1EDQA 1YEFH 4DGYH 2AQ1A 5BVJB 2CKBL 3R06A 1JGDB 3U9PL 2AK1H 3EYUH 4DK6A 4ZUSB 4ZSOE 3JWDC 4PJ5A 1OAQL 2GIYA 3NA9H 4OTXH 5MEQA 3S34L 4RFEA 2O61B 4M7JL 2YUWA 3IDJA 4O5LH 1P4LA 2V6HA 4YQXL 1DSFH 3NFNA 3F62A 2ZKHL 2ZG1A 4LP5A 4PY7A 4OGAD 1J12A 5INDA 2X40A 4TVSa 1VCAA 3B9VA 4Q6IB 2DM3A 4PLKD 1R5WB 3PNWB 1KBGH 1R5VB 5IVXB 4OKVA 5TQ0H 5GGUB 1R3LA 2HA1A 2ADFL 3SDDB 5KSAD 4XPFL 1MF2L 3IXTA 4HEPG 3QIUA 2W59A 3WS6A 5C0AE 1CXLA 4JZOA 4PRBB 5DMGD 1U8LB 1C5CH 3QCUH 1E27A 5BO1L 1P2CA 3QCUL 2DIJA 5EORL 2HKFL 1U36A 2EO9A 4KTDH 4LCIL 4Q74A 1QSEA 3K4AA 3OGCB 3SCMB 4WNQB 2Z91A 1NCDH 1CE6B 4Z0BH 3V5DA 4OT1H 1AD0A 4GS7C 1M7IA 5GGQL 3TA3D 5F9WC 4D9RD 3T65B 3KNBB 1EAPA 5CP7B 2FO4A 4MNQB 3F12B 4LSPL 5DD5L 1W0VB 5JNYB 3WIHL 1IE5A 4LPWA 2OTWB 5HHVH 2B20A 1S7RB 2XZQL 1ZLUH 4KJPC 1RFDL 1CICB 1Z5LB 4H25A 4XNMB 5T1KD 3I3BA 3SJVD 5DFVD 3OAUH 4LAQH 3MJ6A 1J8HA 3SGEI 4H25B 4XNMA 5JPNA 1G7JB 5IROA 3GIVB 5HDQH 2G5BA 1CDHA 1AE6H 3CSBA 1V7MH 1ITCA 3D2UB 5GGTA 5CKAA 4LEOB 5EDXA 2QSCH 5IW1A 4UUJA 4XX1E 3S8WA 1AC6A 5KVGL 4UDTB 2GT9B 2MPAL 2D7OA 2C3HA 4XP1L 1UWXK 4P2QB 5KS9E 1R5IB 4RBPK 4OJFH 4U6HB 4RFOL 4NO5A 2V7HA 3MBEB 4FQXB 5IMMA 2A9MH 3QXAA 3IDJB 3DROB 4ONGH 4TNWK 3KPQB 4FXKB 3TBTB 4R4ND 3FONB 3QEQB 2H32H 2YA2A 3KPQA 4U1NA 3PXHA 5F7MC 2F58L 4G7VH 4WUUB 1FO0B 2WM0A 1P9MC 1E4XH 3PNWA 2P8LB 4L4VA 3MMEA 5CP3A 5IESL 5A2JH 5J06A 4BK5A 3U2SB 4P3DB 1MHCB 1MRDL 2HT3D 1A3QA 4GRLA 4OZ4B 3U2SA 4TPRL 1X4XA 4L3AA 2OR9L 1I8LA 1GGIH 4J3SA 2V2TA 5DT1H 2FEDD 2X70A 1RVFL 2V2XB 4NN6B 1UQSB 3QFJB 2O5YL 3VXUB 1T6WA 4EI5A 1XCTA 3UTSA 5AZ2L 5BVPH 3LQZA 4J1UA 3HG1D 2I27N 1UM5L 4I2XB 5HYJE 1X6NA 4QXUH 4X80L 1WZ1H 5DJXA 2VLKE 3KLSA 1GL4B 1NPUA 4NSKB 5A16A 5I8OH 3QYCA 3SE8L 2DKSA 3TCLB 3BH8A 4QHKI 1Q0XL 1G0YR 3UJTH 2XY2A 4JQIH 3RKDC 3D5OF 1MVUA 4M8QA 4MNQA 4Y19E 3HZMA 1NCWH 1RI8A 1DQDH 5ESVB 3Q1SH 5TDPA 4PJBB 1G7MB 1G7PA 1LP9F 1MCJA 3HZMB 4WI3A 1R24A 1BVLB 5ESVA 1DQJA 2B5IC 3EDJA 3QG6A 5FM5O 4E42B 5F6IB 4JM2D 3FB5B 5FKAA 4L8SB 4JDVA 3T2OA 1HXMB 3HZYA 2PYFA 3FO1A 2J7LA 1MI5E 3EOBB 1U8HA 3P4OA 1E6OL 1VADA 1WFOA 4NHUA 3VI3E 1QFHA 2P5EA 1GIGH 3HC0A 1N5AB 3QULB 4B7IA 4BH7B 3TYFA 4NRYA 1WIPA 4OZIB 3SOBL 3EW3B 3OKMB 4C55A 4PJ9D 3NA9L 2YBRB 2R2BB 3Q5YA 5IV2B 3ALWA 4YZFF 4MQ7A 4LHJB 3VXSE 5IJVB 2AJSH 3ECBB 2E7HA 4L4VE 3QHTC 1F6AA 1ZHKA 1B6DA 2FB4L 2VDQH 5T5FH 3JVGA 4HS3B 3WUWG 4M7ZB 1MLCA 5TE4H 3LD8C 2ZJSH 4PGCA 1TFHA 1TCMA 3GKZA 3QUXB 3QUZB 2X4TB 2W0PA 4R0LB 3DX7B 5D7KE 4M1DL 1OWRM 3JTTB 4H8WH 3Q1SL 3IDMB 1QRND 1S9XB 1TZGL 1D9KB 4PBWD 4XCFH 3U0TA 4HKBB 5E4EB 3HE7A 3MLSL 4HUMB 3F7PC 3TNNA 4HKBA 5EULV 3QO1A 4K7FA 4OZ4A 3NCBB 2PO6A 1IARB 2DLFH 3EYVA 1Y18A 3LKRB 1HKLH 4TNVF 1NC2B 3U7YH 5MENA 2EYTB 4BKLB 2PF6A 2AI0H 5CIPH 4FTVE 2AI0L 1CGTA 4MD4B 1CFBA 3BVNA 1F58L 1P7HL 1F58H 4QXGL 4JFEA 5D6DC 3HUJE 3BGMA 1UENA 5JDSA 5CBEB 3V4PL 2WUBH 2W0LA 1IKFL 4DQOL 4U0RB 3OAZK 4XTRC 5DJXB 1I1YA 3PWVB 3QB7C 4LEXH 2QADD 1IM3B 4B41A 3I75B 4D0BB 1BEYL 1EGJA 2YEZB 2CRMA 4HWNA 4YBLC 4YHOL 1R0AL 1S7UA 4LGPB 3C8HA 3OMZA 3GBML 1M1SA 4JY4B 3G6AA 5DHVB 3UXFA 5KVEH 2A77H 2RAMA 5SWZB 1U95B 1A4JB 1RZKL 4YPGB 4ZD3H 4JO4L 2QADC 4HQQH 2ZSVB 1XGUB 3TWCH 4NBZB 2F19H 4HAGA 4J8RA 5IG7A 1E4WH 5IQ7L 4GG6E 1JGLH 2EDTA 1EEYB 4M3JA 4H1LH 3QG7H 3N9GH 4KKLD 2AKRB 1HXYA 5DHVH 5C2BH 3LZFH 1HXYB 4R7NA 5C0AA 1QQDB 4B5EA 1LEIA 1ZE3C 5FCSH 5D1ZD 1BZ9B 5K9QI 5C0AB 1U8NA 2IADA 1CLOL 5D2LE 1FV1B 3CNKA 1HWHB 2X1XR 3SDDD 3HNSL 5D6CB 3RWCA 1NBZB 3SY0A 4H1LA 2ID5A 4IDLA 5BZDB 3U48A 5EU6B 4M6ML 2ICES 5C6TH 3TC9A 2EIZB 3LN4A 4LNRA 2VISB 2DMBA 1IGTA 2VISA 3ULUD 2OMBA 3C9NB 3IKCA 1LD9B 4ZPTA 1MCIA 3O9WB 1S9XA 4WFFE 5D1XA 2FX8L 3SBWC 5J7CC 1JCKA 3SE3C 1CTOA 2IPUG 3G04A 5TPWL 1ZSDA 3EO9H 1KNOA 1WEJH 4I0PD 2VLRD 4HUNB 1W72L 1DN0A 3CGTA 5EIIB 1MHHB 3WHE0 3MV9E 1I8IB 4PJXE 3TO4A 3TCXA 3B8SA 1AO7B 5C8JA 4M9OA 3O2DA 3TO4B 2IAMB 4RMUA 4ZUVB 4Z78A 3P11L 2H32A 5DXWA 2YK1L 1KIRA 5DMGC 2R0WL 2AJUL 4PRIE 4N5EC 1MI5D 1MNUH 1FYTE 4DN3L 4OB5L 5DD1H 3ULVL 5CSGA 1NDMA 1GGBH 4M6OL 3LDBB 4OIIL 3IJSA 3KDMB 4G8GE 1DVFC 1Q1JH 5D7LD 3CX5K 1A0QL 3DX6A 3K8KA 2R8SH 1EHLL 3O2DH 1OARL 2JCCE 3ESVF 2AXGB 5ENWB 1MHEB 2EYRA 3BH9A 4IIQA 3Q6GL 1NMCC 5DTFB 2ITCB 3GSRB 4NQCE 5BVPL 2ITCA 5GRWA 5I9QB 5IJKA 3AM8C 1UJ3C 4WRLA 1PEWA 1JZ4A 4U1KB 1UWGL 5JORB 4HD9A 1F3JA 3OKNA 3RVXC 3ARBA 4L8CA 4NT6A 5LGJA 4W4NA 1QLEL 2UY7A 3MLRH 1AGBA 2UUDH 3DX8A 2NQCA 3MOAL 2EEAA 5KW9H 4CJ0A 3V7AG 1AKJB 3BN9C 3MLXL 4MXQD 2ZUUA 2H6PA 4M5ZL 3AREB 3UO1L 1BZQK 4QO1A 2EDKA 3RWHB 5DJCA 3T0EA 4BZ2H 3U9PH 4XMPL 1NGYB 4WV1C 3VXNB 5AZEH 2BVOA 4NM8H 2YA1A 4JRXA 4WHTB 3RWEB 4Q9BA 2P8PA 4EXKA 3LHPL 3W2DH 3SCMD 2PKDA 3H0TA 1PVHA 1JWSA 1XIWB 3WNMA 3DUUB 4RGNE 5EBWB 5CEZH 1X5XA 2C3XA 1EHNA 4M1DH 3RRQA 2R2HB 4XCNB 3CDGB 3MRQA 1R3IH 5TQ0L 5CD5D 1IFHH 3FRUB 2VL5A 4LSTL 2QLVB 5I74C 4XCNA 1NMBH 1FG9C 4WFEE 4X98B 3WLBB 1CCZA 3C60A 4ODHH 1P4LB 3CU7A 2E27H 3F6IA 4PRDB 1EVUA 1MHHA 5FYLH 2ARJA 1JE6A 5INDB 5IFHL 4BFIA 3KYAA 1MUJB 4R96A 3P73A 3R8QA 1I7TA 3NAAH 1FAIL 1G9MH 1CLYL 2VTFA 5T3XH 5HDBF 3E8UL 2OQJB 4FQ2H 4S0TD 4TTDC 3OPZL 5DVKA 4KXZH 5ICXA 2EZ0D 1IAIH 3WXWL 5FIEA 4K3DH 3ARYA 4HH8A 3FQXB 4JDTL 1JGLL 2W0FA 1DBBH 5D8JH 4HS8L 1YPZA 4IIQC 1G0DA 5TH2A 4P2QD 3WFZA 1FL6A 1YEHL 4ONFL 4QHLB 4QRRB 1YECH 3HMXH 4Y88A 3QUYD 3ZE2E 1LILA 4PJEE 3QH3B 4PP2B 1QR1B 32C2A 4MCZA 4NDMB 3QCVL 1QSFA 5K33A 1JF1B 4OZGB 5E9DB 3IVKB 1XCQA 4YAQA 4TSCH 1XF3B 4EBQL 5HVGB 3F6LA 3VFPB 5F71A 3ZKXC 5F6HJ 4WY7H 1NFDA 4KPHL 4V1DE 2NW2A 5I1DB 3FQWA 4NYLA 2BFVH 1FRGH 2HTLD 2VN4A 1DDHA 1AHWB 1YEEL 5I9QC 3QNYB 4NYLB 4X6EA 1FQ9C 4XVSH 2NLJB 1J0KA 1S7TA 5E4EC 1I85C 2VDRL 1NGYA 4X6EB 4YDVB 4JJ5A 2XTJD 4Y4KD 3X3FL 3C5SB 4DAGH 3VG9C 1MY5A 3DWTA 4WTZA 4D0DA 5SWQA 1RZJH 2UV3A 3BZDA 5T33L 1WGOA 3RWFB 5DGRA 1LO0H 3H9SE 1N4XH 3RWJA 1A22B 3MCLL 2VLKD 1I4FB 3ZO0A 3HRZA 5F6HI 1YMHB 5TGBA 2I9TA 4U7KA 2ORBH 4Y1AB 3P9LB 3PJSB 3KYNA 4H88L 4XWOC 2GFBA 4K94L 3IFPB 2WWMC 2RFXB 3QI9D 3V0AC 1YJDC 2P47B 5CD3A 1JHKL 4R4BA 2NXZC 4PJHB 4RFEB 1RVFH 1QR4A 3FQUB 2AXHA 5DT1L 1Q72L 4CVZB 1RZFH 3HB3C 4LVOC 4MJ5A 5K93A 4QWWC 1MJ8L 1G7LB 1RV6X 1TNNA 4ZUWA 3OF6A 3IYLW 2MSPA 3KG5A 3MOQA 5JQHC 1ES0B 1FNFA 5ICXB 2X4QA 2VLMD 1HH6B 4HK0A 2AGJH 1Q1JL 3Q5OA 2YN5A 3PE9A 1FJ1B 4XP6H 1I1RA 3HPLA 1UQSA 1KLFA 1AO7E 4XVTL 4QRUA 2R2EA 4XWGL 3ORJA 3BKJL 3KLDA 1T3FA 1CFTB 4XCYB 3EO9L 2CIIB 2A6KA 3O6FB 4OGZA 5KSAC 3OB0K 4K2UH 4XBGB 3DRQA 4HZAA 1HK6A 2MOVA 5A16B 4F9PA 5GRJH 4YUEL 4FQ1L 4F58H 4CADA 1BF2A 1JTOA 1PKQA 2YSSB 3UBXB 1MRFH 4Q9QH 1XCQB 5ADPL 3TV3L 4NOFA 4QTIL 4FP8H 4QXGH 1G7MA 1G7PB 1NLDL 1T1WB 2V5MA 4GW4B 1MFAL 5L7XL 3N0PB 3MRJA 1UM6H 2EDFA 2I5YL 1JIBA 3A6CL 4LEXL 4X5WA 4KKNA 3G5XB 4PPTA 4N5UA 4PYHA 1YMMD 4GMTH 4JN2B 3QUMH 2VQUA 5JDJA 2I9LA 2XKNA 4LRIA 4JFFE 3X12A 3CFCL 1SY6L 1HQRB 1KFAH 4Z7UB 3AMLA 4JHWL 5CZKA 4Z95H 1TVBA 1WICA 3H2WA 4KDTA 1CK0L 3VI3F 1DN2A 2ARWA 1JPGB 4DKFH 1WBYB 4U1SB 4AENB 2V7NB 3FO2B 3T0VA 1VPOL 2EYSB 3MRBA 3HI5L 4E0RB 5GGVH 5KVDH 5E8PB 1ZWIA 3OR7B 1DSFL 1XMWA 3QT2A 3HAEA 5I71B 1MCSA 3K4ZA 1MCDA 3FT3A 5EBLB 1FC2D 3HAEB 1F97A 5GPRA 1FNSH 1CL7L 1Z0NA 4LDLB 3QUZA 4Y7MA 1QHOA 4KTEH 5CLTA 4V2BA 3UO1H 2P5ED 2GYSA 3NIGF 3HE6C 3O6FD 3LD8B 4MDIB 1FZOA 4IRJD 3EYUL 5E94A 2AW2A 2NY3C 4L8BB 3IU3B 3L6FA 5EN2B 1KC5L 4L8BA 3LKRA 5GGTL 3HC4L 2AJSL 5EN2A 3R06B 1NMCB 5TE7H 1FJ1A 3WDHA 3LH2L 3OAYH 1EFXD 4QRPD 3VWKB 3UJJL 3CU1A 1FHGA 4MNHB 4G5ZL 1DUZB 2HN7B 2DBLH 1PG7L 3NCYP 3LEYH 4DCQB 1CK0H 2ZCKL 4I2XA 1R3IL 1OTTC 5IQ7H 3FT4A 1C12A 1JWUA 4HMCA 2DQIL 2FEDC 3DVGB 2HJLB 4HIHB 3VXQB 4XZUB 4KRNA 1K4DA 4JY4A 3RTQA 3ZKND 3O3AA 1TNMA 3F7VB 5EO9A 5C2BL 3E2HB 5K9OA 5KVGH 2EDRA 3NZHL 4M8QB 2AABH 3BX7C 3VWJD 3ARWA 2R1YB 4GW4A 4X6FA 4HK3J 5HGAB 1AXTL 4P2OC 4ZDHA 3AXLB 1V8HA 1JNHB 1AE6L 4X99B 1AQKH 4G9DB 3V0VA 1F02I 5CJXA 4Q0XH 3CFIC 4L8SA 4JZNA 3VD4A 3V5HA 5ETUB 5T33H 4JN1L 4S1SL 3RX5A 5CWSA 2EC9T 3MCLH 2HKHH 2ZCLL 2BFVL 1TITA 4NC1C 4YDKL 3TH2T 1Y0LB 5FO9B 4PTUB 4OUUB 1NGZA 1F11B 1MRDH 1P9MA 2AV1B 1HOCA 3K2UH 2PR4H 4NHCL 5KSVB 3Q6GH 1BLNB 1HEZB 3H3PH 5C08D 5CGYC 4WI5A 3RGVD 3WFBL 3VXRA 5E2VL 3IDGB 3PQYA 1G7JA 2R15A 4HS3A 3V6OE 5ICYA 1RMFL 4PJ8A 3QUXA 2NPLX 3GK8L 4EI5C 4PGDA 1G7QA 2VXSH 4YHZH 4O00A 1LO5B 4K23L 4ELMF 1HHKA 1Z9SA 5HI3D 3QDJE 5GS0D 3WN5B 2J8UA 1X5GA 3CIQA 5ILTL 1I1AC 5E8OA 1HNGA 1J8HD 2NZIA 3TNNB 3A67H 1JGEB 1P84K 2R0WH 3BOVA 4EN3B 4TULH 5EIQA 2Q6WA 4HXBH 2AK1L 2J8UE 2Q86A 4J7RA 3OF6D 1MWAL 3DGGA 4DN3H 2HKHL 4FFWD 3QPQC 3F5WA 4S1RL 4JQXC 4F7MA 4JAMB 4WENB 4YDKH 5TE6L 4G8FB 5JDSB 2DQHH 2IBZY 5HHOD 4I4WB 2DQHL 2PUQT 5I8OL 3STZA 4LSSL 5C8JB 4P49A 5DMJB 4X4XA 3B2UC 3BRFA 4YHPB 3QI9A 3KPTA 3B83A 4LRNH 1KPUA 2OI9B 2M26A 3UTPE 5CUSL 3EZJB 1KCLA 3UZQA 3VFRA 2JJTA 5AZ2H 2V5SA 4HUWB 4BQ9A 1V3MA 4YFLI 4OZIE 5JIKA 1KTDB 1WEJL 4GS7B 3TN0B 3MV9B 1KLGB 2X9YA 3HLAA 3W9EA 1F4HA 1BVKB 5BV7H 3B2UD 4ODXB 5AWNL 1XCTB 5DJYB 1FH5L 3UTSB 4Y5XC 5GRYA 5F89B 2HYMA 5I19L 5DJYA 1T80A 3OXRA 4QRPB 4U0RC 1T1ZB 3X14B 4MNGE 5F7EL 3SGJC 1S8DA 3KPRB 2COQA 2CRIA 4WW1B 1NBYB 1YEKH 4JRWA 3DRTB 1F3RB 5DVOA 1OP5K 4IRZL 1LEIB 5J56B 4OZGF 3LPWA 3CCHB 3RDTD 3RZWA 1IGML 1CS6A 1A21A 3VRLE 3TN0C 3HMXL 2K7PA 3DXAE 3CSYB 5GHWH 1JV5B 3JV0A 1L6ZA 5EOCJ 3RPKA 1B9ZA 3QDMD 3FB5A 3MRRB 3UTTD 3ETBF 5JLZA 5EC1A 3T2NL 4G6KL 2FH8A 4HFUH 4R2GD 3QXVA 3EOBA 4C56E 3P4MA 2X89A 4TUOA 3RBSA 4ESKA 1TPXC 4UOW0 3WE6A 1OAYL 3CMOL 4IJ3C 1DLFH 3A6OA 3IKCB 3ULVD 3MLZL 3RVVC 3ROLA 4W4OA 5D1XB 1IJ9A 4C83A 5EBWA 5EU3A 1G6RB 3T0EC 3TBWA 3W11D 4E41E 4I3GA 3U9UA 3E8UH 4Z5RA 4HUKB 3MRGA 4PJ7F 3DO7A 8FABA 1KNOB 5FUCC 5FOJA 3X3FH 3D18B 5FYLD 4PRDA 1A02N 4RGMC 3MREB 3MLYH 3GSXA 3QFDB 1Z0MA 3R0NA 4JHZA 3MREA 5BW7C 2DLFL 1GOHA 4K8RD 4NKOA 1IGFH 5IJKC 1UA6H 3U4EB 4AL8L 3QUZC 4LMQE 1KPUB 3SE9L 4D9QE 4I0CC 2CIKA 5DD6A 3VWJA 1WF5A 5C0GB 5JXED 1KBGL 5LBSL 1XGPB 5AEAA 1H9VA 5K59E 2BVEA 5C3LD 3K81A 1HWGB 1OGAE 4X7EC 4KHXL 3GSWA 1E4XI 2F54A 4ODXA 4BQCA 2IPKB 3U46A 2P7TA 4JFEB 1UXWB 4KDTC 4JFFB 3DX6B 3IF1A 2CQVA 3MLZH 3EYQD 4H26A 5EOQL 2FJHB 2J8UF 3V0WL 1AH1A 1A47A 5FGSA 4D9LL 3OG6B 1JGVL 2ZZUT 3RWGA 5F6IC 1Q9OA 1IM3A 1XEDA 1CGXA 1H3XA 4QGYA 2JJSC 5DSCB 5I8EA 4HULB 4GSDL 1IQDA 3KLAA 4MMXC 3H9ZA 2NW3A 4QNPE 4Z7WF 3DGCR 3H3PL 4NUJA 5LGJB 2BMKB 4GG8A 1NAMH 2W65A 4LVNB 2E8ZA 3DX8B 2YS4A 4WFGD 2B4CL 4S1QH 1B88A 4G7VL 4OFVA 4RRPA 1J0YA 4OCXH 2IQAA 4J8RB 3SQBA 2CLZB 5J3HD 4LQFH 3MRIB 4GUPA 2HFGH 5AD0B 2W0KA 3SKNB 1BECA 4K23H 1WT5A 1G7IA 2PR4L 4NKQB 5EFIB 5FA3A 3L3GA 4NNYB 4J12A 5JMOC 4FQIH 3OZ9L 4NNYA 1J05A 2FYYA 3JZ7A 4A6YA 1MFAH 3T0DA 4UQ2A 4WJ5B 1EXUB 5D7IA 1JWSB 4I0PB 2WANA 3DTXB 5F1KC 1MI5A 3S36L 4KMTH 1AP2A 4PJXB 3PWPD 3NN8A 4HG4J 5IVNA 1OTUC 1NEZB 3ZHLA 2HJKB 5TE6H 2ARJQ 3I84A 1CLZL 4PRNA 2JTDA 5I1EH 3OG4B 4LSSH 3W39B 1S7VB 2YD3A 2EO1A 4A6YH 4OF6A 2DYPA 3WIFA 5D1XC 3DV4A 2ARJB 4KU1A 2VKXA 3ZE1E 4L3EB 3SQOL 1ZHNA 1BGXH 1S9VB 4M61A 4NBYB 3RKPA 5IBLC 1JTPA 5T5NF 2JJVA 3IB4A 1XGRB 3BZFB 2BRRH 1CBVL 1Y6MR 1RZ7L 4YHMH 4NWUL 5I1GL 4HUVB 5I30H 4RX4D 5IFJB 3SDAD 3G04B 5I16A 4APQD 2VZOA 4NBXB 2OJZL 2R0ZL 3GSQB 5D1XD 3PWUA 3VCLB 1JJUA 1RZ8B 2CXKA 1MFBL 3I9GL 3RVWC 4J4PA 1F4WL 5IEHB 3GMNB 1F4WH 5D7SL 4QOKD 3D39A 4NO3B 3WO4B 5EIIA 1DFBH 4TULL 1QSEE 5DRXB 4OLZL 2EDEA 1WZLA 3EYFA 1FCGA 2BSRB 2IAMA 1KC5H 3S34H 3C8KB 3WFHA 2GKIA 2YSSA 3UBXA 5IEKB 1KXVC 4NQSB 1IGIH 3VXMB 1BMGA 2X4UB 4XXDB 3VRJA 4L5FH 4XHJD 1QFWM 2VXQH 2LVEA 5EOCL 4H8WC 4FXLA 3FAWA 5DURB 4FABH 2A6IB 4OUOA 3CVHA 5JUEL 3GJFH 4WFFD 4GG6B 1SYVB 3D0VA 3FOLA 2DQJH 2VO5A 4LIQH 1JMXA 1KPRA 4HIIA 3VXMD 5IFAH 1EA9C 3EOTH 3O8XD 2D31B 3X11B 1SJEB 1U8OA 3STBA 2G60L 4WTXA 5HHPA 2AV7B 4LVHC 4JG0L 3TZVC 1T5WA 1YYMH 1UM4H 4MD0B 4L3ED 1XT5A 1OY3B 1PY9A 2ENSA 5FGBA 3TLRA 1A9BA 5DVMA 3M1BA 5E56A 1ETZB 1Q9KA 1EHAA 4Q0XL 3WUWA 5AZEL 2OL3H 3HI1A 5A2IH 4LFHD 1BEYH 1PKQE 3FFCD 4OM0L 4KV5E 3KPPB 4XPTL 2R4SL 1C5DB 4XPHH 4CAGA 3W39A 2WIMA 5HHOA 3JV6B 5TE7L 1UA6L 4WI8A 3ZKSD 1NBVH 1KFAL 1CG9B 2J6EH 5IMLB 2WAHA 4MDIA 4B53A 5JXAL 3LEXB 3LEYL 2E6JA 3PUCA 4KRLB 1PG7X 2VZSA 4NQVB 4K3DL 1TMCB 2H2SD 4HZLB 1T22A 3IAPA 5C0BE 2BVQA 5HHMD 4M7ZC 3OQ3B 4FN0A 2XNAB 4KUZH 4MA7H 4Z7NF 4LLUA 3QXTA 1RZ8A 3LZFL 1KN2H 4F15B 2E7LC 1ZANH 4NO3A 1G9EA 4FQ2L 4LVOB 1C1EL 3MJ8B 4WFGE 4N9GB 2XYCA 1IILE 3IRZA 5C08A 5D1QB 3E2HC 2XWBA 3Q5TA 2XZAL 5D1QA 2AJUH 4NQSA 4WW2B 3QDGE 1QVOA 4K9EC 4FQJH 4X6CB 4XXDA 1MEXL 5CJBA 1T89C 3STLA 4OB5H 3X3GH 2GSGB 2VLJA 1ZOXA 1QG3A 3WCYA 2NZ9D 4JFXB 5HI4C 3V6OA 1A7PL 2P5WA 1EO5A 3CSGA 3ILPB 2VLJB 5JW3H 5HGAA 1DBMH 4RGOH 5DMIH 1SYVA 2J6EL 3CK0L 5C2UB 4R9HA 1RJLB 4NN5C 4U7MA 2IH3B 1KPRB 1T7WA 1U8LA 2FBJL 4U6YA 1RZIA 4UU9A 5C0CE 5J11C 4W6WB 1T04B 2EDQA 4P3WA 4LSVL 5C7XH 3C08L 1MCNA 2GJZA 1U8OB 3ZMRA 2F8XC 5HI4D 1G9NL 4PRHE 4YXLL 5JOEA 3FB8B 5JQ6H 1QBML 4GKNB 1EBAA 5AWNH 5F96H 2VLKB 2QTEA 5ACMA 4H1LG 5HYJB 4E0RA 5B39A 3SE3A 4DAGL 2BCKA 1F4AA 3A67L 3O3BA 3L5HA 4YO0B 4ZOCA 3RVTC 4TNWF 3EO0B 3CD4A 2PTVA 5DQDL 1B0RB 1PZUB 2B0SH 4E5XB 1J18A 5C6TL 4XXCC 3VA6A 4R7DB 4ZXBC 1X44A 4YGAB 4OZFB 4OCXL 4LLWB 3HE6B 4OLWH 4LEOA 3U4AA 4PRHB 4XP5L 1OARH 1T83A 1JGEA 1WT5C 1FNGA 2JB5L 3MRMA 3ES6A 1J0JA 4LSVH 3CFDA 1DJSA 4PJ8C 1RZFL 1QTYT 3MRMB 4X9HA 4ZUSA 3WFEL 1ZKAA 3M8OL 2VSDA 4O2EB 4OCRL 1YNKH 4NQDE 2O61A 4Y0GA 4Q2ZB 4FTVD 1NGPH 2A1WL 4QRTA 4I4WA 1N64L 4LASH 4N8VB 3MJ9L 3DXAD 3GMRB 4M4PA 1GPOL 4CU8A 4Z8FL 4NPYA 1G6RL 5AUMA 4I13B 4XNQB 1IKNA 1A6VL 4ZMAT 1X5KA 1QRNE 4NPYB 4PY7B 1R5VA 3MOAH 5KW9L 1KCRH 4OCLC 3IDIB 5HHQA 5DS8B 3D39D 3KR3H 2CKBH 3QXUA 5DHYB 2BK8A 5DS8A 3G9AB 4AK1A 4FG6C 5DHYA 2LTQB 1PX3A 1CR9H 1NEUA 3EHBC 3HR6A 3ILPA 3PP3H 2UVFA 2ESVD 2V2TB 2R1YA 3DIFB 1DVFB 1PFCA 4JE4B 4LHUA 3NOIA 1K8IB 4Y4FA 4H5SB 3MNZA 3TJHC 2B1AH 1FBIL 5SWSA 1I8KA 2YC1A 1RD6A 1CL7I 4X99A 1I3RB 1FNSL 3HPJB 4ZFZA 3T2PA 5I1KL 4N8VG 1E27B 3ULUL 4BJLA 4Y5VC 2FJGB 5T1KA 1IAOB 4JO1L 3QEUA 3OGCA 5CILL 2JJSA 2Z91B 3DRTA 3K8MA 3I6LE 4U05A 1RJZA 2FZ3B 3BIBX 4LCUB 2R0KH 1JI2A 3TBSA 3RJDA 4ODHL 2UVEA 2YPVH 1Y0LA 5JNYA 5FO9A 4XGZA 2OTWA 2R4SH 4XPHL 1R24B 1NDGB 3BP6A 2VJXA 3PXJA 2DBJA 3RVUC 2XXCB 3Q6FB 5F7YC 5LJYH 3ZE0F 2EECA 4XMLH 5FO8B 4F37K 2CDGB 3MLUL 4GXUN 2Q7YA 1T5XB 5DURD 2DQCH 1CU4L 2Q7YB 4P23B 5DDHA 5CD5C 1KEMH 4HS8H 3BSZH 1EMTL 3IGAA 1EMTH 4NO2A 4FTVA 3QXWA 1YN7A 3VXPA 2NX5E 2P8MA 5C9JA 5I8CB 4MAYA 4BH7A 3HZVA 3AB0C 5E2WL 5I8CA 3O9WC 2P24B 3TBYB 4MAYB 1RFDH 3MZTA 1IC7L 4ODVL 4M1GL 1ZWIB 3WV0A 2KDGA 1H3WM 1MWAB 4F57L 1CYGA 1CGSH 4JCLA 1G84A 5JIIA 4PJEF 1II4E 3C6SA 3G08A 1N8ZB 3QQ3B 3ZYZA 1G1CA 4AIOA 2X4TA 1SJVA 4N0UB 5F7WC 3V79C 4S1SH 3LKPB 2VLME 4D9LH 3QI9B 1BJMA 1T7VA 4O9HL 4CDHA 2HVKB 3INUH 1CI5A 3X13A 1OAKL 4M7KL 3EYOA 5DVNA 5FKPA 1ZT4A 1J1XH 2QV2A 3BMVA 3ZKXB 2R0LL 3MJGX 1N0XL 4PRHD 2V9QA 3L1OH 3FJTA 2OSLA 3L1OL 1B4JH 1PW3A 3MFFB 1UXWA 5C7XL 3UYRH 2NY2D 2DTSA 3K2MC 3PWPE 4X9GA 4PJGF 4MXWL 3D1MC 5KSBA 4MJ2A 5F1SA 2Q76B 4NWUH 3LAFA 4WTWA 4I3RL 4AMKL 1I9JL 4H88H 1HIML 5IMOA 3OJVC 1ZVYA 4XZUA 5MEND 1ZTXL 2BVTA 4QTIH 2YPKB 4NQCA 1VB9A 4JM2C 4EI6B 1A8JH 4Q97A 5J9PA 2BVYA 3ULUC 4MQSB 2W65B 2A0LD 3ULVC 4OD2A 1DEEA 1NDGA 3JV4B 3QG6B 3VDBA 5DRNA 3INUL 3H42L 3V5HB 4M6OH 1LO4L 2QQNH 2CKNA 3DURA 3L3GB 3I6KA 2O26U 4HT1L 4L5FL 2AGJL 4I0PC 4IRJB 2GCYA 3ZTJH 4OV5A 4RFOH 3REVB 3SDCA 3QULA 1CDJA 3ARVA 3KJ4B 4Z7VB 3S35X 2PNDA 3MRHA 4M62L 1JK8A 3WFBH 2EC8A 3LKQB 3WFEH 2WQRA 3HI5H 2ZUQC 4JFDD 4PLKC 2ORBL 1BD2E 3ZT5A 4FQCL 3ZZ1A 4ZFGH 1HHJB 4LPCA 5JXEC 1VFMA 2ZCHL 4JPIB 4A2MA 1F6AB 1ZHKB 3AAZA 5I19H 4LVNC 5CIPA 2GUOB 4BSVB 3DV4B 1IMHC 2EE2A 3BQUA 4FP8L 3GSXB 2C26A 3JSSA 5DMYA 3BQUB 2O5YH 1H3UA 2NY1D 3NCCB 1D9KA 1LD9A 2MKWA 2VRAA 3WN5A 1FFOA 3OKEA 3A6CH 3GSVA 2IBGA 4M7LT 1LE5A 4LARL 4M3KB 3RUGF 4EN3A 1K3IA 4OI7A 3GSQA 3WN5C 2NTSP 3CUPA 2NCMA 4XVUC 2VSCA 4JHWH 2G9HA 4YHKH 1MCWM 2Q8BH 1OOAA 2ICWJ 4A6YL 1N6VA 1P7QA 4WU5B 4MJ6B 2VDOL 4PJXF 3KPLB 2XQBL 4LIQL 3PWVA 5E9DD 3KS0J 3DHJA 4FMKA 1J0ZA 1UB6B 5EBMA 2AEQL 1I1CA 4O58H 4HDIA 4D0BA 4DZ8B 2VDLL 2JB6A 4MA3B 4L4TA 2E9WA 3DUSB 5E1AB 1WFNA 4EVNB 3V6OC 5GJSH 2ZWLT 2NW3B 4NUJB 2I07A 2X05A 2JCCB 4DW2L 2BOCB 5FHAL 3ZDXE 5IVZA 4JFDB 1WSST 3OR6B 5E00A 3O8XB 2WP3T 3KJ6L 1BWWA 2F74B 5TDOA 5ENWA 1CZ8L 2FGWL 1IGYB 1KEML 1FL5B 5GGTH 3SKNA 4ODUA 4LSQH 4UNVA 4DZBA 4HCRL 3RBGA 3VDCA 1NBYA 4ENED 5E6IA 5GXBB 4MXVE 4ZYKA 4U1GC 5DJ6A 4M7LH 1YECL 4GRWH 5HHXL 1BX2A 4GLRH 3T3PF 2E9IA 3OAUL 3UJIL 1U8NB 5D7IB 1BQUA 3FZUC 1N6UA 4DOHE 1MI5B 2YD5A 2XFXB 4HWBA 1NBZA 3O0RL 2GTZA 1IL1B 4OLYL 5D6CA 1KB5B 2KL6A 5AYUH 5IM7A 3MRRA 3BXNA 1RJYB 4UQ3A 5E8NB 1FVCB 4OCYH 4ENEC 2VOTA 2BHYA 2XA3A 3QISA 3NFSL 4G8GA 4U3HA 4ETQA 5DZLA 4HW6A 3B9DA 4UNTA 5BRZA 1NH6A 1A7NH 2AJYL 1O0VA 3QXDB 2VITA 2EIZA 4MB5A 4GG6F 4JDZB 3RY6A 1WBZA 4WHTA 2VITB 3LEXA 3CXHJ 5C0CD 4PJ5E 4PLOB 3VFGL 4HIJA 1U3JA 5B8CB 1LEGA 3VFGH 2BY0A 3ZDYE 4PUBH 5CSZB 4R3SB 5F1IB 4LNVA 3MYJB 5FYJE 3N1QC 2BJMH 4P48A 4D3CL 3J8F7 4I3SH 4WWKC 1NAML 3MRGB 4M6MH 1HI6A 5IVXE 5TJWK 4GRMA 1FNHA 4IOSD 3B5TA 4KQ4H 3VWKD 4N0YL 3LN5A 4XHJC 3BO8A 2Y36L 1KIQA 1MLBB 3MCKA 3TZVA 1XR8B 4R4FL 1VENA 1A7PH 3LN5B 5HHXH 4HXAH 3D39B 2Q7NA 1IC7H 4ODVH 2EKJA 3RNKA 4LAQL 2YD8A 4JY6A 3UDWA 2QQKH 3EYFB 3PIQA 3RAJH 5FB8B 1ZXQA 4M03A 4J2XA 1GGIL 1QVOB 4JREB 1I3VA 2G2RB 2DQEL 2QHRL 4DZ8A 4Y1AE 5C0GA 3S6CA 2DQGL 3AS0A 2X4UA 4OF3A 2BC4B 3O6ML 3N9GL 3QUYB 4U33A 25C8L 3RL2B 3T4YA 25C8H 5HGHA 2C7UB 3KDMA 4ISVB 3HUJB 5C0AD 4YH6A 1J11A 4YHZL 3Q48A 3L9RB 3QJFA 1JYXA 1IC5H 1P69B 4YFDB 3C5ZA 3C5JB 4JG1H 5HYQB 3ARSA 2A9ML 3P11H 3D0LA 2AXGA 1XGYH 4XCEA 1NCWL 4U31A 4MS8C 4PJ5D 5BZWB 1U3HD 4HKZA 5AG8A 4LCCB 1FNEA 3HRPA 5EB9A 1HSBA 5GSVA 1U6AL 4JB9L 3X3GL 5IGXL 3L3HA 4I77L 3BEWB 1HSBB 3FRPG 2FX9L 4K8RL 1ZVHA 3BEWA 3K80A 5F88A 5K9JH 5KSBF 5KSBE 5F97E 3GIZL 4EJ1C 1G7HB 1N2RB 1JHKH 4P2CG 5CEZL 2WBKA 4U0QB 4C59B 2OTPA 4KKBD 5JXEA 1FVCA 5JIHA 4O4YH 2BNQD 3O3DA 3SCMC 1BGXL 2P48B 5EG6C 2AJZB 2A6DA 2DQGH 3TPUB 4E41A 1YC7A 1HHGB 3NBNA 2O5XH 3L3JB 5FK9A 3S36X 4NCDA 5I2IA 3NABL 1KXTB 2YRPA 4L4TE 1WZ1L 1RZGA 4K7PY 1L7TL 2XOTA 4GMTL 4QCIB 4LGSB 2E5EA 3H6JA 1RZGB 4BYHA 4Z7OE 2WINB 5JOFB 3QEGH 4I0PA 5LGHH 3HC3H 3CH1A 4C56A 3MA7A 5ILTH 4Y16C 4BQ8A 3FFDB 3L3DA 4LSRL 5IBUB 4KHTL 5J1AA 4ZXBA 1A1NA 1RJCA 4LLUB 4KWUA 4XWGH 4IM8A 1U2CA 3WKNA 1MJ7L 1XF2B 3RIFK 3TZVB 1JL8A 4MD5A 1K5NA 4I5BA 4Z7UE 5GGVL 5KVDL 3N85L 2PETA 4X0KB 1S3KH 3D85B 1NGXA 3VFVB 4G7YH 2G60H 4KKCD 1YMME 1M6OB 3GIZH 4W81A 2R0ZH 3BZFA 3P73B 5JHDD 1L0YA 3O2DL 1EBPA 3QHFH 5L88L 4OKVB 1Z6JT 2JB5H 1N26A 1TJGH 3MLVH 3QIWC 4DW2H 2OQJA 1ZA6A 3L5JA 1DFBL 5A1AA 1ZA6B 2UWEF 4UT9H 1P5UA 3RDTA 2H9GB 5GGRY 5ESQB 5J6GA 4PRBA 1GZPB 4I48A 3EOAB 4O58L 4NP4L 1SJHB 2LV4A 2OYPA 1I3RA 3MLTA 4GBXB 1LEKA 4NN6C 4JZOB 1QLEH 1L0QA 3L7FB 3MQIA 4P2OB 3EZ8A 3PABA 1U92B 4Y19B 5DUPH 1IAOA 3L7FA 3WD5H 4K3HA 4F7EA 1V7NH 4GT7A 5DFTA 5D5MB 1X5ZA 4RCAA 2C5DC 3PL6D 3L7EA 4WNQA 3GSUB 4OBSA 5GGVY 4OZGA 5E9DA 4MNQD 3UAJD 1KJMB 1MOEA 5MHSD 1SVCP 2VDPH 3FFCB 1GXEA 2LQRA 3MLYL 4JKPL 3F12A 1LWRA 1N7MH 1IGFL 1HKLL 2ERJB 5D96C 7CGTA 1VFUA 4L9DA 1OSZA 3VXME 5ITFA 5E08H 4MXVF 3FO0L 1EVTC 4OD1L 1I7RA 1UM4L 4LLVB 4OD1H 4M8VA 1RK1B 2H3NB 1D5XB 1T5XA 3TPUA 5EZJB 1PY4A 3C5SA 5KJRL 4M6NH 3IFOB 5SWQB 3D2UA 3C09C 2X10A 1YEGH 3IFOA 5HHNB 2IPUK 2HT2C 4Z76A 5DO2C 2P8MB 3ESUF 3CMOH 5IIEA 3WEXB 3EYSH 4HK3N 4L8DB 5ELIA 2OX5A 1MEXH 3KWWA 1TVDA 1J86A 1W72A 4M7LL 1J88A 2P49B 3QPXH 1ZANL 3VMNA 1R5IA 1OAZH 4ZXBB 1W72B 3GMPA 2DLTA 4Y1AA 1A2YA 4R4BB 3OXSB 1DE4A 4AG4L 3CZFA 1A6ZA 4QLRA 4PJ5B 4FXKA 2PYEB 4OQ1A 2BXYA 1KIUA 3DYMA 3ARBC 5HTSA 5MEPA 4WI9A 4XBEL 4PJ8D 5AUMB 2F58H 1TJHH 3P9MB 1IAKB 4Y4HD 5D1QD 3SHSA 3G5ZA 1OL0A 4IS6A 2CO6B 3Q0HA 3H9HB 5GGSY 4ZUWB 1NSNL 1MVFA 1OCWH 2VDNH 4P5TA 4ZQKB 3GI8L 1OGAB 2EDBA 1GOFA 3GNML 5E1HB 2OJZH 3V4VH 4APQA 5F9JB 2QQKL 3TFKC 1RUAL 2G5RA 1RURH 3MV7D 5SV4A 4RZCA 2L4OA 4YDJA 3O2VH 5C0EA 4NOBA 4JVUA 4KI5F 2E7BA 2MTPA 1J7VR 5EZIL 1W2KT 3CLFH 3LQZB 3BP4B 5C08B 1QSEB 3P2TA 2VKWA 3RGVC 3BT2L 1UWEH 3D87B 2A6KB 4HF5H 1GGBL 3DI3B 3VJ6B 2HJFA 3QUMA 5I76A 5J13C 3TJHD 1UT9A 1P4IL 3BZ4A 4EI6A 5J9PB 4PJDF 3UJTL 3R1GL 3BZ4B 5K9OB 1G9MC 3PWNB 1DR9A 3FMGH 2XKUA 2J8OA 3CAFA 1GHFH 1J8HE 5JW5B 4X7TA 4GW5B 1RJLA 3ARED 3QDJA 5KAQG 5F1OB 2BRRL 1GH7A 4JN2A 3OKLB 4PRAA 3HZYB 5IESH 4JZNB 4PJFA 2ZSWB 1F3DH 3V6ZA 5IBTL 1EO8L 3HAEH 1M71A 4HBCH 1B90A 3UPRA 1P4BL 4R2GB 2D9QB 4I18B 4RQQB 5DJAB 3K8LA 3NPSC 3LKQA 1VDGA 2V7NA 3FO2A 1O5DT 4XX1G 5BOPA 2VWEC 4OUUA 5L2KA 1U8IA 3HMWH 5KOVC 1DLHB 5TF0A 4U3XA 4ZO9A 4QT5A 3BDYL 4K3EL 1NGPL 1KTRL 4NKIL 4AM0A 1FAKT 4I77H 4KK8D 3B6SA 2GEEA 3WJJA 2N7BA 5J8OA 2KZWA 3O6FC 3IDGA 3KPRE 2PYEA 2C3GA 2EZ0C 4JJHA 1NFDE 5EOCH 4YC2B 5TE4L 2VXQL 5C3TA 3WJJC 2Y07L 4ZNCD 3QHFL 4LLWA 4MVBC 2UWEA 3A6BH 2ZCKH 3GEWB 2DLEA 3RFZC 3CDCA 3BHBA 1GZQA 1ORQA 3L3KB 7FABL 2IAMD 4OLYH 3G6JE 1BM3H 1B6UA 4YHML 4P3DA 3PV7A 1CICD 5T3XE 1J9CT 4MA7L 3CMGA 3VDAA 3MRPB 3D25A 5KANI 4DKDC 1KN2L 2FBOJ 3DMMC 3NAAL 1CD1B 2CDEB 1N6QH 3NGBB 3O4LE 4Q2ZA 5FYLE 1N5YH 3MLXH 5T3XL 4NQTA 4G8FA 1DUZA 2HN7A 1OQOA 3V4PH 4PG9A 5HHMB 5SWZD 3S98A 4NQEA 2XXMB 3TNMA 2HFEA 4UB0L 5DQ9B 1BAFL 2WIIA 3IDIA 4OCSL 3DECA 1TJIL 2J5LB 4XPTH 3F7VA 4NM4L 1FYTD 2N1KA 4K9EL 3H7BB 5JW3L 5GS0H 4QRRE 5FXCH 2EH7H 2BOCA 5KG9B 3ARGC 2EC9U 1BVKA 5DJDB 1V3KA 1JNHA 1XFPA 4ODSL 5HGGS 1A4JA 4V2CB 1WZMA 5IG7B 3MR9A 3D69A 3L5WA 4R97C 1OGTA 1QOKA 4XPFH 2YPVL 4OCYL 2AKRA 4MA1C 4XP9H 4LKXB 1XF4B 5CKGA 4QYOB 2X1WL 4WW1A 2DRUA 5BO1H 4NQXA 2VXSL 4OZHE 5ANME 1N6QL 4PTUA 3QHZL 2OMNA 2DI8A 3FOMB 1IM9D 1DTUA 4HMEA 3RWCB 4ZS6D 1SBSH 1XF5A 1F90H 1HEZA 2DQCL 3N1PC 5E8NA 3ZTJG 2Z93B 4FZEL 4WO4C 4JN1H 4TUJA 4YNYA 5DEFA 3T1WA 3MNWA 5EU4B 4PGDB 5DEFB 1I1AD 2OXGA 4KQ4L 2JCCF 3UDWC 3BEVA 5DJ8A 1A1MB 2ADIA 4S1DC 1NBVL 5B3NA 1HHKB 3L3IA 4QXTA 4IRSA 1VGKA 4NO2B 1OM3H 1YNLH 4AIZB 2IJ0C 3E0GA 1ODAA 4M6NL 3PP4L 4FFWC 3S35H 1K3ZA 4MAUH 5I1IL 4OAWB 3ZE2F 3VW3H 4NJ9L 5MEOA 4QOKB 3MV9D 4YC2C 4XVJL 1EZVY 2FLBT 3TA3C 4KZDL 1Q8MA 4YJZL 1M05A 3G6JB 4KZDH 2YD1A 2CDEA 4OIAA 3CJJA 3VD7A 2XG4A 4HX1B 4KQ3H 3NZHH 5D5ME 3TYGL 3BWAA 3W0WD 5BV7B 4XP1H 1X5HA 4HS6B 4N0UA 3OGOE 1GOGA 3ARFA 2GI7A 1BQSA 4CRPA 2YMXL 3S37L 3PHQA 1U8KB 3I2CL 4RAUA 4X4XB 5I1AA 2HVJB 2JIXB 3VFWA 2YEZA 3VFUB 4PD4K 5E6ZA 43CAA 4X4ME 5FYKH 4GAJL 1OAXH 3HR5A 2NY7H 4X6BB 2JF1A 2D03H 5BXFB 2IWGA 1CE1H 5F3HB 2FR4B 1RUML 4XCCL 1XGUA 5DEGA 1YUHB 4LFHG 3UYPA 3FZUD 4S2SB 4KGLA 3BISA 4HWEH 2OR9H 4YBQD 3L5WB 4KJQC 5C0RL 2RJMA 3L3OB 4GRLC 4MMZC 3V6FB 1FL5A 1D3CA 4KJWC 4XBPA 3LDBC 3SKUD 2BSSB 3IXAB 4O4YL 1TLKA 3QNZB 4JVWA 5IMOB 3BW9B 1G9NH 1CGYA 1KPVA 1QQDA 1BX2B 2MCPH 3THMH 1U58B 3CDFA 4FQQB 5TFSH 4MJ4A 4FQQA 4YBQC 4BM7A 4MQXC 1G6RH 1IEBA 4CMHC 3HE6D 3BAEH 4JFOB 2C1PA 4DKEH 1RHFA 3B5GA 4H1LB 5FF6B 2F54E 4TUJB 4YNYB 1MFDL 3Q3GA 5DJCB 4LSRH 5EC2A 4PYGA 4ETQB 1ITBB 1XGYL 3VXNA 3I6KB 2NY6D 5AAWA 1H3VA 5D71L 4JANA 3RWHA 3WE6B 1Z9MA 4OV5B 1CBVH 4Y16B 1S9WB 4QXTB 2VMFA 4MB3A 5FECB 1INEH 1S3KL 1KCSL 4M48L 1ZLSH 5I1GH 3WSQL 1U91B 1JN6B 4PJGA 4NO0D 3H0TB 3HZKB 5I1KH 3FHQA 4OAWA 1K2DA 1QPXA 4LRNL 4JLRA 4D9RE 3D18A 4UAOC 4ZUUB 4OM1L 5J1SC 5L7XH 4U2ZA 4OGAC 4HIEA 1F2XK 3NVQA 3QFDA 4NZJA 4UT6L 1JYWA 4OCSH 2OM5A 4JRXD 1FE8H 1FSKC 2Q20A 4YHOH 5HXMA 1ORSA 3QIUD 1S9VA 1F6FB 3D9AH 4KTDL 4LCIH 4CMMA 4NQDA 2HT4C 1FO0L 2A74B 4KKAD 5ALCH 1EIBA 4G5ZH 5E5MA 4DUVA 4CDGC 2NXYC 4TSBL 4HUUB 5ADOH 1HZHH 5IBUG 1E4JA 5GGQH 1HKFA 4XMPH 3VGAB 5GJTH 1EEUA 3QIUC 5IEHA 5F3HA 4GBXA 3QG7L 4KC3B 4ORZC 2OTUA 5C0FB 1IGMH 3WNOA 3EDEA 3E6HA 3C5ZB 3C5JA 3SDCC 5E2WH 3IF1B 3IU4H 4ZPVB 2EYRB 4ZODA 4QHLA 2GITA 5JHLL 4WW2C 4JZJC 5BZWA 2XACC 2PXYB 2Z92A 5JPMB 1A5FL 4LQ1A 3GRWA 4QHNA 1IQDB 1JNJA 2VC2L 3KLAB 2VC2H 1U58A 3O0RH 4P0DA 4EVNA 2NY5L 4MNGA 4X7CC 2SEBB 4NT6B 5IF0B 3SEPA 3RL1B 3UCRA 1CT8A 3MRCB 3FQWB 4KV5F 1OSZB 1DDHB 2PXYD 5H37G 2Z4QA 4LLVA 3WO4C 5I1DA 2F53E 1L4IA 3OWEA 2OJEB 1A9EA 5CJXC 4YX2H 1ZHLA 3QNYA 5AG9A 3PWJA 3ZTNL 3NIDE 1J05B 5C1MB 5ISZE 3ZE0E 5C0CA 3GUTB 1B4RA 4Z76B 2Z8VC 2BJML 3TVMD 5C0CB 2FJFB 5D6DA 4MXWH 4L9LC 1XIWA 3DUUA 3WHXA 4YHLL 2Y36H 1D6EA 4ERSL 5DI8A 4LQFL 3QWOB 1JZ6A 2J1KA 3IFPA 5DI8B 1IT9L 1DE4B 4ZUUA 4HKXA 1W0YT 1YNLL 2DQDL 3LS4H 1CLOH 4AEEA 4OFYD 3VXSB 2H8PA 1T6VN 3RY6C 4KK9D 1OD7A 4FQIL 1A7QH 5HD8D 3WFDL 2XN9D 1RHHB 4UILH 2ZG3A 4P46B 3MV11 3GB7A 4KI5E 1MCPL 3ZYOA 3QCTH 3GB7B 2NY2C 3C6LD 2QJDA 3ME0A 3DLQR 4Y4HB 3GBNL 5F9JA 1IC5L 3PGDB 2VE6A 2ADGA 4ODWA 5DRZA 3AU1B 1RUMH 3BUYB 5LXGH 4HT1H 3SDDA 1AY1H 3FQXA 4GSDH 2H9GA 3V8CA 4FABL 1X5YA 1MY7A 4LRIC 4X83A 4AT6A 3W5NA 2RB8A 2FEEL 4JKWA 3TBVA 1UG9A 2E9BA 1Q0YH 4P2RB 3PABB 3WFHB 3C87A 1SJXA 1RMFH 1BVZA 5JQ6L 2H26B 4KRMB 4UT7H 2EIEA 4Z7OF 4FQCH 4ZFGL 3C8KA 4RGNC 1AD0B 5IEKA 3QA3A 1FH5H 2HTLC 3WDJA 4ZTPL 4HKJA 3PWNA 1WTGT 3BPNC 1P7QD 2HWZH 1YYLH 2HLAB 5D7SH 4DGYL 2GSIA 4ZS7H 3L9RA 4PV9A 1X5JA 1AGCB 3HMWL 2OL3L 3NCJH 4LU5L 1WLHA 5LAXA 4PJFB 2I9LB 1EGJL 2XKNB 2H3NA 3P0GB 4LLMA 1BBDL 3TP4A 4JQVA 2EH8L 5M95B 1HNFA 3WIHA 2XTJB 4WFHD 4MD0A 2X4SA 4M1CC 4UBDD 1M7DB 3UX9B 1MHPH 5L2KB 1KACB 1GHFL 1M7DA 3OBAA 3GSNA 2CLVA 1C08B 2XWJB 1D5MB 4YHYB 3BKJH 3WS3B 5E8PA 2K1MA 1G7HA 1N2RA 2AS5M 2O5XL 4QWWD 4WUKL 2ZNWA 2JIXD 4WI2A 4MJID 3ZDZF 1QLRB 4FQ1H 4F58L 3VGHA 2YWYA 1CL7H 3UTTB 2ZCHH 3QWQB 2HRPL 1B0RA 4DN4L 4LIQE 4QNPF 5EA0H 2EXWD 4XVUD 3FN0H 3QEQA 5FYJD 1YYLL 1MFDH 1HHIA 5I75C 3PF2A 4Z0BL 4XNZB 1FN4B 3I6GB 1JGUH 3CDYA 2X89D 4YGVB 1FDLH 4KVNL 2EIBA 5HGBB 3CH1B 3NCJL 3BDYH 4Y4HA 4G3YL 4G3YH 5F7DA 3P0YL 5JZ7C 1F6LL 5ITBH 1T22B 4EDXB 3QUKB 2EXWC 4ZAKB 5F70A 2XNAA 3GMMB 1BIHA 3ZHDA 3EKCA 3WNLA 1JI1A 4Y5YB 1CFVL 1H3TA 4XP4L 3EDFA 1Q9LA 2IMNA 1RZKH 4EI5B 3TBVB 4Y5YA 2Q8BL 2YXMA 1NANH 1OLZA 4HHAB 4P23D 5IW6B 3FN3A 3BP4A 4XNQA 4XXCA 4ZO7A 4DCQA 4DFIA 5KN5A 3O4LB 4NC2B 5J3HC 3VFSB 1SEQH 2BOBA 4KXZI 4JM2A 3VFSA 3VXQA 3LPGA 4KJQD 3PHSA 5F8QC 1PLGH 3STLB 3VXSD 3U79A 4DN4H 3JWNC 1UJ3B 5ESQA 4YEFA 1E6JL 2IANB 1AIFB 3BMWA 3OJDA 4LLYB 4KKLC 5ISZB 3OJDB 1PQZA 4AG4H 3I2CH 1SEBB 3WXVH 2YZ8A 4JGUA 4NO0B 1ZVSA 2QHLA 5ISZA 4F15C 3O41A 3HPJA 1JRHI 1OTUD 3ZKMD 5EIVA 3REWB 4GAGL 3TVMB 5FHBL 1LO3L 4GAGH 5IKCB 5SX5H 3QDJD 4LPTA 1DQLH 1R6VA 4ERSH 5BS0E 3JWOL 3UJJH 4IRSD 3MTRA 1DANT 4GKNA 2JELL 2PO6C 4RGNB 3PP4H 4Z7WA 2Z93A 3HKFA 5I1IH 2NY4B 3ZHKA 4L29A 5CJQH 5H94B 1KF9B 3T4AB 2B8OT 1A6PA 2BHZA 1TDQA 4OCRH 1F2QA 3GIVA 4MAYD 2D7QA 4N5ED 5E99H 2XIDA 2MCPL 1ROWA 1WFTA 3DYOA 5KZCD 3CPLB 4R26H 2DF3A 4P9MH 3BHBB 3V5KB 1IQWL 1M7XA 2FECI 1FNGB 1C1EH 5ABDE 2XV6B 2CXGA 2HLFC 3ILQD 2GJ6A 4UDTA 3NA4A 4JPVL 5KSUB 4DUXA 2ZUYA 4QOKA 5FYJU 2NXZB 5EUKA 5J57B 3WJLA 4MDJB 3I02A 2X6MA 3V2AR 4ONOA 3UTQA 3TBTA 5LWYL 2A6JA 3F5WB 1P6AB 2WBJB 1U8KA 1KTLB 2F5AL 3RZCC 2W9LA 3MX0A 1H0DA 1P7KB 1JWUB 4OV6F 4PJIB 2WIIB 1JYVA 4HIHA 4HUWA 5CJQL 4TRPL 4NJ9H 1AGDB 4R90L 1MQ8A 4YXLH 1V3JA 1AJ7H 4N8PA 3HLAB 5K9KA 4W6YB 5T1DL 4OF8A 4UT6H 1GYAA 3TN0A 4KQ3L 1FP5A 5K9KB 5DUBB 4HF5L 3F58H 5CGTA 4LF3B 5BQ7B 3QEGL 4PLNC 2VWEE 5SV3A 5DMKB 5LGHL 5CAYB 1SY6H 5T5FL 5DUPL 2IQ9L 5L9DH 3QIWA 3BKYL 5IT2L 1TZIA 4N90E 2BSSA 4EN3C 1U8JA 3B4NA