5GRJL

Crystal structure of human pd-l1 with monoclonal antibody avelumab
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
108
structure length
108
Chain Sequence
SALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSNRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSSSTRVFGTGTKVTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords avelumab H chain
publication title Structural basis of anti-PD-L1 monoclonal antibody avelumab for tumor therapy.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2016-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5grjL00
4MMZC 4IOFC 4XP5H 2WNGA 4G7VL 1BF2A 2WV3A 5DUMH 3WXWL 4E0RA 2G75A 3LMJL 2EYSA 3OB0K 5LAXA 3ZE1F 1TENA 4PB0L 5D72H 1E4WH 2D2OA 2E9WA 3MRIB 3RWFA 4HS8H 3WFBL 3B9DA 4TOYL 5IW1A 2HVJB 4RGNE 3BDYL 4YDVA 2Q76B 3TA3C 1K6QL 4O51A 4JFFE 4M62H 3WEXA 4Y8AA 5F88A 3GSWA 3SO5A 1NGXB 2BRRL 4Z5RB 5L8KB 1J10A 5TDPA 2Y07L 2WZPD 5GS0L 1TCMA 1X5YA 4M93C 3HI6H 2VITA 2ARJQ 1KN2H 5CUSL 1MRFL 4PJEA 4LCWE 5EIIA 4HIEB 3O6FC 1NUGA 1UFUA 1N3NA 4W6XB 4FQ1H 5I19L 1A4KB 1NGPL 3DRQA 3P11L 1PVHA 5JW4M 5IV2B 2NTSP 3GEWB 4QOKE 3O4LE 3GMQA 3CXDH 2QHRH 1WQVT 4KK8D 4OCWL 3BKYL 2R9HD 2X1PA 3BGFC 4NWUH 3U30B 3TFKC 1PZ5B 2C7UB 3H0TA 1UWEL 3NCJL 3V6OC 1FV1A 2C9AA 4Z7UE 4MJ6B 1S7TB 1MLBB 5DI8B 4UT7L 1FAKT 1X4YA 3WFEL 1P5UA 3QA3A 4P2QB 1C5CH 4UAOC 5FECB 3V4PH 2EDHA 2XN9B 2VLKA 1GH7A 3VDBA 2RJMA 1G6RL 4BQCA 3QIBD 4YHKL 4N0YH 3ZT6A 3BKMH 2FATL 4EUPA 1HEZB 3SQOH 2Q8BL 2EIEA 4CVXB 1RUQH 1MOEA 5EOCH 3JV4B 1ADQA 4NOBA 5E5UB 1FGVH 2DIJA 4P4KC 2MHAB 4AJ0A 2O61A 1UC6A 3ARGD 3OWEA 1J88A 5CSBA 3CLEH 3RZCB 5LWYH 1F8TH 3QDGE 4DEPC 4ZUUA 4QHKI 5D1ZC 3S37L 1E4JA 4GMTL 3BZ4A 4M1CD 1FCCA 4P9HH 2XY1A 4NWTL 4OKDA 4PJCF 3WHE1 4QKXB 1OAZH 4QXWA 3WO4C 5D2NA 43CAB 1D9KA 3H9ZA 4QRRE 3IU4H 1TQBC 5JO5A 5IB4A 4X8JA 2J4WH 1VSCA 2D7TL 1RIHH 3ILQD 4V2CB 4NYLB 4H5SA 3IAQA 1W72L 3QI9B 3N06B 3PWPA 4NQUA 4L4TD 2FHCA 4S1DC 1JPST 3O8XB 3RQ3A 1XF3B 1T20B 2ICEA 4KKNA 4TYUA 3O45A 2DMCA 3DROA 3VFSA 1NMAL 1FL5B 1PG7W 3NCFB 2WWMD 3MNWA 1MCOH 2HTLC 5FHAH 2O5YL 4J6RL 3O9WC 3ULUE 4TULL 4WV1A 3O11B 2GT9A 3D18B 1LEKA 4ZPTB 1YEJH 1OF2B 1X5FA 4JO2H 4OKVA 3FFCE 4P9ML 3TCXA 3RY6A 3LQAL 5SWSD 1C1EL 4KI5C 1BM3H 3D3VA 4LARH 5J6GA 4OLEA 3ARPA 3SGEH 5HGHB 4Z7WA 3MUGB 1SYVA 4RFEA 3HC4L 5DD1H 2XQYG 2ZUTA 2VDRH 3KPOB 4O2CA 5J1AA 3V6ZB 5I2IA 3P4MA 2NYYD 4U1NB 3MLTA 4LSTH 4M43H 1FNHA 4LSDA 2N56A 3MLSH 2Y6SD 5DQ9A 1WC7A 3MA7A 1MJJB 4OD1H 2IPKB 3AREC 1SBSL 4E41D 4MJ2A 5DJXA 5EZLB 1X6NA 4WENB 3DTXA 3UZEA 3F12B 1FHGA 1KENL 1RMFL 4B41A 4OFKA 2NCMA 1MCNA 4MDJB 4KK9C 2W0LA 3EZJB 2YPLB 4G8GE 4FQHB 4WW2C 4F9LC 1FC1A 1XGRA 5ADOL 5ANME 1CXEA 1FCGA 2W07A 2XXCB 3W0WA 1EEZB 5DC4B 1Q8MA 1A6VH 1IQDB 1V3MA 4PJIB 1MVFA 1YEIL 3QFJE 4FG6C 2P24A 1CE1H 3KJ4B 4MHHG 5JIHA 4KI5E 4NQDD 4WU7A 4NCC2 2EH8H 4MNGA 2V2WB 5IK3B 1IFHL 1JRHH 1PLGL 3RHWF 5IQ7L 3HI1B 1MNUH 3SCMB 5T1KA 4JG1H 2LAGB 1QFPA 4KDTC 4LU5H 3HNTL 2CK2A 2Q20A 3VG0L 4L4VA 2NY3B 3ZDZE 1FVCB 5DJYA 1VERA 4YX2H 4HUUA 2H32A 2VWEC 2OL3H 4D94A 3QUYC 2JJTA 3TIDB 3TPKA 1CXHA 3VH8B 3CVHA 2BVOA 2NXYB 3CFDA 4LIQL 4EZMA 3VFPB 4KRLB 3QO1A 5HHOA 4PJ9D 1EFXA 4NQCE 1YMMA 5DK3A 3NZ8B 1ONQB 4NCC1 4WTZA 3P4NA 2A83A 1FFNB 2V17L 1CGSL 1P7QB 2VLME 2PF6A 1DDHA 1YJDH 4O58L 3F6IA 5INCB 4JQIH 2R1XB 1C12A 5CZKA 2DLGA 1OTSD 5BCAA 4NUGL 3U9UA 4ZSOA 4M7ZC 4Z78B 1BJMA 1U95A 5ESVB 2EKJA 1MREH 1GGBL 4N0UB 1Q1JH 3GMRA 5E1HB 3FO0H 1IL1A 5IESL 2AJ3A 2OTUA 5GSRA 3MUJA 2YZ1A 3V7AE 4KMTH 2WQRA 1K8IB 3L3HA 4PTUB 4NBYB 1NEZB 4ZOAA 1P4IL 2QADD 2VWEE 4Z7VE 1EUTA 2C3HA 3MSPA 3I75B 4UILL 3VI4E 5J6HB 3VGHA 5F1IA 1UCBH 1PKQA 3ZDXE 4PRHE 1TZHB 3SDDD 3WLWC 1XGPB 4NHUA 4S1RH 5H2BA 5IHZA 3B2VH 4U6TA 2X4PA 1RV6X 5JHDB 3MRMA 2IH1B 1I8MB 4WWID 1FVDA 4ETQA 4XHJC 2K7PA 5C9JA 2PNDA 3P73B 1HNFA 4NNYA 1D5BA 4HXBH 1KLFA 4OQTH 2IH3A 4GRMA 4OZHE 1DQML 1PKOA 5H94B 3QYCA 1C7TA 1OAQH 5AD0A 1KT2B 1H3TA 5IMLA 1MI5A 5HHVL 3WN5B 3TN0A 3LB6C 1SJHB 1HH9B 4HLZH 3PDOA 1MUJB 1B6UA 5DJCB 5CD5C 3MFFB 4YO0B 1W2KT 2GW5A 1Z9SA 2OTWB 3L7EB 1V3LA 3QRGL 4G43A 5IVXB 3W82A 3HZVA 1IAKB 1CLYH 5E6IA 3BYTA 3N85L 4NNPL 3SOBH 5I76A 5ESQB 4AZ8A 3RVUC 1W0WA 5F9DC 1G9ML 5GS2H 2J2ZA 3WCYA 4H0IA 4QWWD 4AH2B 1J1OL 3E8UL 3OAUH 4E5XA 5KN5A 1JJUA 3QXVA 4XNXL 3ZDYE 1MHHA 1F11B 3IB4A 2MCPL 4PRDA 4RDQF 2O5ZH 1XGQB 4KKLD 1D7FA 3ULUH 4QXGH 4P2QD 1UXWB 4ONGL 1FLRH 1L7IH 3FQUA 5FA4B 5D7JC 2H26B 2XN9D 4NP4L 2FB4H 1BREA 1S9XB 3S5LA 5IFAH 1IM9A 4GRLC 1FFOA 1FGNL 2HH0H 1S7WB 3QEQB 1F4WH 1QRNB 1URLA 3IJSB 5L2JB 2DLFL 3PP3K 4UDTA 3SDYL 2AXHA 4L3CA 3RVVD 3MRKB 1QLFA 1CICB 1MWAH 1KTLB 2NW3A 2YD9A 3E1F1 3UYRL 1DVFC 3QEUB 5KVFL 2HMID 4TRPL 1MJ7H 1TMCB 4Z77B 2VMFA 1U8JB 4BYHA 4TUKH 3RZCD 1LK3L 3LS5H 4KI5F 1S8DA 5GZOC 5DTFB 4G5ZL 1YPZA 2MQ3A 3GBLA 3TO4C 1MQKH 3HMXA 1DANT 5BO1L 2PW2A 2X4QB 1EAPB 4YR6B 4I3GA 1S9YB 5C92A 1JBJA 2ZUYA 4ZPVB 1S7VB 4J23A 3QDJB 3OGCA 1IAII 3U46A 1EO8H 4NT6A 4C56E 4UTAH 3LN4B 3TNNB 2G60H 3L3DA 3DXAB 4RFNC 1LK2A 3K4AA 1X5AA 3AU1B 4M48L 1L9NA 5DJ0B 1UZ6F 2R4RH 3QI9D 2Z8WC 4S1QL 3UDWA 5I1KH 3M1BA 4NQEB 3VXMB 1WFNA 3UAJD 3IFOA 4GSDH 2LE9A 1A7NL 1U8KB 3O8XD 2EEBA 1NFDF 3HUJB 1ZHBA 2IBZX 3RTQA 5I30H 3I02A 4WW2F 5TQ2L 3IAGC 2E5EA 2D9CA 5D2LA 1BX2B 3H9SA 2XZZA 2VLJB 4LNVA 3TZVB 4QEGA 5EFIA 4NUJB 1MHCA 4Y5VC 2ERJC 3HG1A 1TNNA 4KDWA 1AGDA 1MHPL 3JWOC 3FZUD 2V5MA 5FYJE 5BOPA 3FAWA 1NCTA 2YC1B 4S0SD 3TT1L 5BVJB 4XTRD 5TF0A 5GRJL 5IW6A 5HYSG 3FOLA 2DBLH 4F2MB 1DEDA 2JJUA 3LKSB 4LMQE 3REWA 4I13B 1A64A 1YEHL 1IAIL 1OP3K 4PJHB 4RZCA 5D7SL 5E08H 5EA0L 1Q9OB 1VGEH 4YLQT 4UV7L 1ZA3B 3VFMA 4F7MB 1VFMA 3QNZA 4DOHB 3VW3H 3LS4L 4JDVA 1NBZB 5I75C 1ZT1A 3MBEC 1AC0A 2DQHL 4ZO7A 2ESVB 3ZDXF 3BUTA 1MEXH 4JHWH 3OXRB 2DQEL 4X7EC 2FBJL 4ODTL 3SPVA 5F21B 1R3KB 1UADC 3K7UA 4HWEH 4EI5C 3QCTH 4D0CA 5F89A 1IT9H 1T2XA 1ZEAH 3RPKA 3WDIA 5BVPL 1IAOA 1K4DA 1FNGA 4WTXA 1UYWL 1G7IB 3UX9B 1IEHA 1FZMA 2DTMH 3QXTA 4JPVL 2YPLD 2FEDC 4P59H 2BNQB 2DI8A 5BMFH 5CEYB 1LQSR 1JZ6A 3DX9A 2BSSB 1KXQE 4X5LA 2SEBB 4JREC 4AEHH 5EORH 3MNZB 2OZ4A 1N4XH 2Z4QB 5J7CC 1JMXA 2V9RA 4OI7A 3CCHA 1OAUL 5ITFA 3T1FB 1XF5B 3MLPA 3RIAK 4HWZB 4XAKE 4PJBE 1ZHNA 2PKDA 3GRWA 5KVGL 2IWGA 3SCMD 4M6NH 4AIOA 2QKIA 1HZHH 1R3IL 5KS9B 3BMVA 1XGUA 5HSFA 1OWRM 3HRZB 4UIKL 3NH7L 3EJYC 5I1JL 1YYLH 2NY3D 2DQJL 1JZ8A 3BP7A 1U8NB 1MELA 4NO0A 3LZFH 3PXJA 5E8EB 3QXUA 3G6AB 5E5RB 1WBXA 3QG6A 5EU4B 4JHAL 2X09A 1XGTA 3AAZB 3HPJA 3ZDYF 4Z8FL 3W9DA 2NXYD 2YSSA 1C16B 1NC2B 2FH8A 3V6FB 1VADA 3IFLL 5CJOH 3MRFA 5EO0B 2Y5TA 1OLLA 1UH3A 2DQFB 4M5YH 2ATPB 1IC4H 5MERB 3CDFA 2AVGA 1P7QD 1EEYB 1DBJH 3S3PA 3RAJL 4XVJL 4W6YB 3DUHA 1F58L 5ACMA 4JFZL 3ZHKA 1ACYH 1S7RB 1FNSL 4F7PB 4E42A 3G6DH 1JTTA 1L4IA 2GJ6B 5K9QG 5EN2B 5KJRH 1VACA 4NO2A 3O3DB 2XZCL 4OF7A 2CDEB 2Y7QB 5IGXL 3ZKXC 2BERA 3WNMA 4G6MH 4QRUB 3OR6B 3DOSA 4LL9A 4Y16C 5FFLA 4XPGH 2AEIT 2YBRB 3SKNA 3HI5L 1FZJB 1Z5LA 4TPRH 5JR1H 2VLRB 3VXRE 3T3PF 4LCCB 1BF8A 5AEAA 3U48A 2D03L 2RR3A 4X4YB 3FB8A 4PYGA 3I3EA 5D7LA 4IIQA 1YNTB 1QSFE 3HAEA 5AUMA 5JHDD 4YPGA 1BPVA 2WW8A 3EYUL 2FGWH 3J7HA 4MNQB 3CC5A 4JY5L 1UJ3C 1UH4A 4IMKA 4OB5H 4P23B 2PYEA 3X3FH 3FCTA 3WJJA 2EDLA 1UQSB 4P49A 3VGEA 5FA3B 2QBWA 2AV7A 5DJ2B 1PZUB 4PJXB 2FYYA 1P1ZA 4EOWH 2DJUA 3CX5J 4M9PA 4KJYB 4HMDA 4JZOB 4WHYG 2M2DA 3IU3B 3G04A 3M45A 4HG4J 2ZJSL 4X0KB 5KSBF 4MHHI 5D7KE 1E6JL 4NN5C 4NDMA 3D39B 2GTZA 2PTTB 3KLAB 4U3HA 2AEPL 1FH5H 5F9OH 4K8RC 7FABL 1QFWI 4RRPG 4NKMB 5E9DA 1OOAA 1CXFA 2HFTA 5CEXB 3K4ZA 2BP3A 5JMOC 1JF1A 4LSQL 4IMLA 4MA8H 5ICXB 4N1EA 4U6VH 1BJ8A 1G6RA 4RISH 5E94B 4I77H 4RBPH 4Y5YB 2BSED 2YPVH 4BUHA 3I2CL 4H1LH 3Q6FB 3ROOB 1N64L 1QLEH 1OP5H 4EDWL 1U8IA 1NFKA 5B8CB 3EYOA 4BM7A 5E2JA 2XWBA 5HYJE 2DN7A 3VD5A 3QWOA 3RI5K 4DUVA 3FB6A 3JXAA 5DGQA 3TCLA 4RGMB 3MOAH 3F7VB 2VL5A 1I85A 3QEQD 4NZUL 3I84A 1FN4B 1QRND 1HHJA 1F42A 1KB9J 1CXLA 3GSQA 4HJ0C 4AEEA 4IBLT 2DDQH 3WHE0 3E6HB 1CICD 4G9FB 1UM5H 1R5IB 3RVXD 2XKNB 5BZWA 1QFWL 1MVUB 1W72A 3OAZH 3UP1A 1P4BL 5EUKA 5DMGD 2XZQH 5IMMB 3MPCA 1TZGL 4MX7A 5DJZB 4NFBA 3RWGA 2XG5A 4AQOA 4H8WL 1U93B 1T5WB 1FPTL 1D5IL 4R3SB 4YZFF 1UEYA 3H42H 3T4AB 1I8KA 3QDJD 4D0DA 2Y36H 3QIBA 4WDIB 3A6CH 4P57B 3DXAD 4F9PA 4QTHA 3MRRB 2COQA 5DRWA 4JQVA 2VDLH 4N8CL 3F5WB 3U4AA 3SQBA 1NDMB 4NQED 4CVZB 2QQQA 4U0RB 3VXMD 3DX8A 3RUGE 1P84J 2IFFH 5C08E 1JGEA 4P2RB 1A4JB 4I2XB 3ARGA 3EKCA 4HIXH 2KZWA 1HWHB 2ZCHH 4LSPH 3HZMA 2X4UA 3AS0A 4RMVA 2VLJD 2YA0A 3TZVD 1NPUA 2GK0B 4N5UA 4U1MA 2D9QB 3F7YB 5EZIH 1MLCB 4LSVH 2G5RA 4QHUB 1Q72L 2ED9A 4NIKB 5FUOH 5E2UH 2FIRT 1FZOB 3VRLE 3OZ9L 4GXVL 4IEFB 2XTJB 4HX1B 1TVHB 2ADGA 4NM4L 4Q6YA 1A7RL 5C3TA 3T0WA 2EC8A 2IGFL 2HWZH 5JXAH 3PHSA 1SEBB 5LCVL 4GJTB 1DUYA 3HFML 1C5DA 4L4TA 1ZANH 3P9LB 1D6VH 3GO1L 1VEOA 1UWXK 4Y5XA 2DICA 5TH2B 4MA7H 3WIIH 3HNVH 2F74B 1UWGL 4QT5B 5F6IB 2ESVD 5K9KA 3EOTH 3VU2A 1F45A 4HEME 4M61B 1BHGA 5C07B 1KTDA 2FO4B 3HR5A 1G7QB 1KJ2B 1FJ1B 4HLZG 2D31B 2R0KH 2ZCKL 3F58L 3NFPB 3LAFA 2EDYA 4X7SH 1D9KC 5D2NC 2BOCB 2B8OT 5GIRA 4YXLH 3IGAA 4EVNB 4UT9H 3MLRH 2BNQD 1LD9A 4NZRH 2DF3A 2EIZB 2VXTL 3LQMA 4HC1L 1S5IH 1CZ8L 2FLBT 2B39A 1JZ7A 3DO7A 3ULVC 4OLWL 5I8OH 3MLYL 5GGVL 1R0AL 3OKMA 1UG9A 3C8KA 3NPZB 1JWMA 3OJMB 1Q9KA 4P5TB 4LDLB 2BY0A 2GFBA 4FP8L 2OBGA 4CJ1A 4GBXB 2WP3T 3GIVB 5TE4H 1WSST 5IFHH 5DSCA 4GS7C 5T1MA 4E41A 5B39A 3ULSA 1GIGL 1EFQA 4PJAB 4AT6B 4L8BB 2JELL 3MGOB 2CD0A 1PEWA 3PHOB 2GQHA 1M7XA 4WHDA 4WV1C 4LOUC 5BZDB 2XYCA 5HGGS 1CFSA 1RZIB 4EKXA 1IGJB 1RI8A 2Z93A 1GCFA 1X5JA 3ALWA 3O2DH 5D2NE 2DIBA 4Y2DB 4MJIB 3RY6C 3TV3L 4X9HA 4CRPA 3T0AA 4D9RD 3UYPA 4GQ9L 3HS0B 3DX6B 1NC2D 5L7XH 3UJTH 3GJFH 4XT1C 5FO7A 1ED3A 4HFWA 4BKLB 3N50A 4NQDA 1CN4A 1I3RA 3PWPE 3DO3A 5C1MB 5GXBB 2D0FA 3SE8L 3U1SH 1CG9B 2R1WA 4DWHA 1DBML 2YR3A 1KPRA 3VJ6B 2HKFH 1DCLA 4M7KH 5C0JB 4PGEA 2GJ6D 4BSVA 1LDSA 3EFFB 5HHPA 3QCVL 3A67H 5F3BA 4GW1B 1NDGB 4IOSD 1NFIA 2R1YA 3UC0H 4XCEA 4FXKA 5I8KH 4AEIH 2AV1B 1Q0YL 4PJ9A 4ZFFB 1T1XB 4AYFA 1I7UB 4YNYB 2VLRD 4R4ND 1CF8H 2HJFA 2JCCA 2H8PB 3I50L 4CADA 4DZ8B 1BECA 3L5XL 4POZD 1MQ8A 3P9MB 3D3VE 4EN3B 3O41A 5B4MD 4NQXA 1KG0B 1HDMA 3IDIA 4KUCD 4Z7WE 5C6TH 1EAJA 4HGKC 5KVEL 4MNQD 1ZVHA 1DFBH 4MJ5B 35C8L 3HE6B 3EYVA 1DUZB 4P23D 4CNIA 1T6WA 2CJUH 4XNZB 5MI0C 1QBAA 4XCYA 4FQQA 3MLXL 3BT2L 1BBJB 2JJTC 5C0IB 1J5OH 2DQUH 4U1HB 3PWJA 1A1NA 5DUML 1AKJB 1T7VA 1KCUH 3QNXA 5DQDH 2QQLH 3QNYB 4HW6A 3U0WH 3MRDA 3SDDA 4GG6F 5D72L 1E4WL 2VXUH 3LN5B 3DI3B 3D39D 3R4DA 5JQ6H 3VXSB 3N9GH 2YD6A 1A6TA 4PRBB 1KBGH 4Y1AB 2H2PD 3MRIA 4M62L 1MWAB 2HVJA 4ZAKA 1E27A 3O6KH 4PRIB 4PJEF 5E2TL 5IB2B 4OI9A 5HD8D 3RWDB 2R15A 3UBXG 3CZFB 3WFZA 1NGWB 1RULH 4NJ9L 3MCKB 1FNLA 4L4VE 3T2PA 1MFEL 3HI6L 3WJLA 1J05B 1I9IH 1KN2L 1NGXA 4ZMAT 5TQ0H 3EO9H 2E27L 4Z5RA 3TBYB 3U0TA 4G6AC 2CDFB 2VDOH 3CX5K 3R1GH 1MFCH 1Z9MA 5SX5K 2BNUB 4HG4K 1AO7A 3KWWB 4PLKD 5D8JH 5JW5B 2BVYA 1GXEA 3NGBB 4HIEA 4M8QB 5DZOA 4PJGB 3CXDL 5HHOE 2AJSH 1BQSA 1GOHA 1YMME 2HJLA 3QDMB 1A4KA 1R3LA 3CGTA 2DQIH 4NWUL 4QRPB 3CFJB 1ZLWH 5K9QI 5SWZB 2ILLA 2JK5B 3JVGA 4G9FD 5E95B 4AMKH 2EXYC 1A2YB 2AQ1A 4L3EB 4ZS7L 3RBSA 4OZFH 4MQSB 2C7UA 1C5CL 1RJYA 3D5OF 5DVOA 4MJ6A 1S7TA 5DI8A 3OX8B 5E70A 4P2QA 2P7TB 1DL7H 4N0YL 3TN0C 5A2FA 5JIIA 3BKML 2XN9A 3T8XB 4RX4D 4HWBL 3SQOL 5J4MA 3FN3A 1RUQL 2VDQL 3FKUS 8FABB 3WL9A 2CMRL 3DUSB 1N0XH 4M3JA 2FRGP 3HLAB 1NGYA 3PG2A 5E6IC 3CLEL 1KB9K 1HEZA 1F8TL 1PKQE 3GGWB 4CVXA 5ALBL 4X6CA 1NCCH 2X2YA 4Y4KB 3JV4A 2QJDA 1GGUA 4LEXH 3QQ3B 4P9HL 4PJ7A 4R7DB 3CFCH 4P2RD 5AAWA 5IJKA 3KJ6H 1NJ9B 1OAZL 2NTFB 5T3ZH 3RZCA 4MGXA 3IU4L 4UUJB 4YGAB 4OGYH 3ULVF 1HYSC 2J4WL 4L8DB 15C8H 1UM4H 4DGVH 3LSOB 4G8FB 1JGUL 4JZJB 3SGEI 3FO2A 4U6XA 43CAA 3X14B 5SX4I 4CJ0A 3HRPA 2XTJD 3UBXB 1LO0H 2PUQT 1MCWW 3QI9A 2FH6A 1G84A 1U8HB 1E4KC 3FB7B 3RX7A 5DUBB 1SY6H 1JWUB 6CGTA 2W38A 4BZ2H 4Y4FB 4FRWA 3FB5B 5I1CH 5DFWH 3OXSB 1XF3A 1GAFL 4K9EC 5I73B 1P84K 2ZOKB 1T20A 3KPPB 1YMHB 1FL5A 3S35X 5ISZE 5KVDH 4FQLH 4X4MA 1YEJL 4Z7QE 1OT1A 3TJHC 5D96C 5C07D 3RVTC 5IFJB 4N8VG 1IGTB 4Z7WF 1J11A 1G9NC 3O11A 3D18A 5H35B 5CAYB 4JFQB 1VHPA 3OJ2C 4Q9BA 4NKIL 1BM3L 4HKXB 2GCYB 4LARL 1Q9LB 4PR5B 3LY6A 4IHOB 5F7MC 1Z0MA 2OQJB 1JRHI 4LLAA 3VGBA 4OLZH 2VXQH 1KXVC 1F6FB 2VDRL 2XG4A 3LIZH 4LSTL 4OV6F 5IVOA 4M43L 3MLSL 3IFPB 5IW3A 3NCCB 5HGHA 3MUGA 1XMWA 3EO0B 4OD1L 4R96A 2VN7A 4KAQL 3KPOA 4P5TD 3RTQC 3V6ZA 2HT4D 4H1LG 4U1NA 1JHTB 4GBXD 2CKBB 4FTVB 3ARDB 1MJJA 1BOYA 2IPKA 1MFDH 3LRHA 4WHCA 4JPWH 1DEEA 5EZLA 2XZAH 1TDQA 3F12A 4X5XB 4XPBH 2FJFA 4MDJA 1YPZE 2OMNA 1A6VL 5J3HC 2YPLA 2OJZH 5D5MA 4FQHA 5D7IF 1M7DB 4LGSB 2OYPA 2V9TA 3UTPD 2EH8L 4Y2DD 1EEZA 4MJID 2EDXA 1MPAL 2YA1A 1JRHL 4MQXC 4Z0BH 5GGQH 1MNUL 1X5IA 3RY4A 4PJIA 4JG1L 3HCVA 4QRTB 1KJ2L 4XBGB 3OKEB 1TQCC 5LBSH 3KPLB 5IK3A 1YYMH 2FWOB 2V2WA 5JW4N 2UWEF 3VFUB 4XNUL 4FN0A 4XP9H 5CD3B 4YDIH 3SCMA 4LSSH 1ZGLM 4HXAH 1FP5A 3BAEH 1BJ1H 4DZBB 1T89C 4RMUA 1CVRA 3BO8B 4KJWD 5D2LE 1T66C 4P3CH 1I1CA 3QHZH 5L6YL 4OBSA 5FCUL 3V8CA 5MEPA 1EMTL 3HG1E 4Y8DC 3TIDA 3P4OA 3QDGD 3WS6A 2WBJB 3BYYA 4TUOB 3VFPA 1YJDL 1U58A 1PY9A 1YN6B 5EBWB 4JQIL 3NAAH 5L0QC 4N8VB 3NZ8A 1ONQA 2H32H 5CEZD 1AFVL 4R9HA 4ALAH 1NBVH 2APBA 1YNKL 1FFNA 1P7QA 4PIRF 4YPJA 1JZ5A 1MREL 1BQHG 4PB9L 4LLMA 4RMWA 5INCA 3WKNA 2R1XA 4EN3D 1Q1JL 5K9OA 5F9WB 5ILTH 2V2TB 3IETB 1A47A 3CDGA 4KMTL 4Z78A 4KMQA 2MCG1 5F3HB 4YHNB 4U1LB 1S78D 5ESVA 3AY4A 3HE6D 4N0UA 2PYFB 3OAYH 4BH7B 3DSNA 2R29H 1X9QA 4U31A 1P53A 5I9QB 4H1LB 2BHYA 2JJWA 3JV6B 3VI3E 1K8IA 1UCBL 1QA9A 2VZSA 4PTUA 1A9EA 3IDGB 4S1RL 4I5BB 2B4CC 3U79A 1ROWA 4Z7OE 3UMTA 5GS1B 2DB8A 1FNAA 1AKJD 2ZNWA 4IJ3B 5J6HA 3BD4A 4OFVA 4ESKA 1TZHA 1H3PH 5CIPH 1OM3H 1Z3GL 3GSXB 4DUWA 4ZS6C 2UVFA 3VXSD 3BSZH 4ORZC 4HXBL 4KV5F 1I3GL 3IDYC 2IH1A 3MQIA 1I8MA 1OAQL 4UOW1 4Y1AD 5FOBB 1AD0B 5C0EB 1WFUA 3U7YL 4PRID 4XNQA 5FV2A 3T0EA 2OX5A 5I74B 5CEZL 3EDDA 5H94A 3QULB 3A6BH 1KT2A 3I3DA 3MV01 1YEFL 3WN5A 4ZXBB 1SJHA 1CLYL 1MUJA 4H88H 2PTVA 5DJCA 4MXQD 3MFFA 2ORBH 4F37K 4YO0A 3SOBL 1CTOA 2OTWA 3GKWH 4D9QE 4RMTA 1OAYH 2HN7B 5IVXA 1FL6B 3NOIA 4IIQC 3VFGH 3VGGA 4WEBL 3QDMD 1H5BC 1S7UB 2GTWB 3OAUL 4QRPD 2UUDH 5ESQA 3GMMB 2OLDA 2CIIB 4K3GA 5HDQH 1KJMB 5SWZD 4LBEA 3HZKB 5I1GH 4IMKC 5HGDB 4QXGL 5JNYB 4AH2A 4L3ED 1FLRL 1L7IL 3TH4T 3WJJC 2W65B 1RJZB 2R56H 1BQHB 4R2GB 4OSUH 2FB4L 2DWEA 2I60H 5IFAL 4PJDB 1XGQA 2HH0L 4GXUM 1F4WL 1DP0A 1V8HA 2GYSA 4MCYB 5FA4A 4Z7NE 4XVUC 1EO7A 2H26A 5EBMB 4APQB 3RBGA 1FBIH 1MWAL 1CLZL 1S9XA 1T1YB 2VH5H 1S7WA 3QEQA 2Q6WB 3BDXA 2FBOJ 1QRNA 3IT8D 1MJ7L 4XI5D 1T03H 3CLFH 4OFYA 1ZHKA 1WCQA 3O3BA 3MRKA 5E00B 1A7PH 1G0DA 1CICA 3QPQD 5KOMC 1H3GA 1KTLA 5D7LE 4Y4KD 1AE6L 3PWNB 1MQKL 3QEUA 1YN7B 4Z77A 1ZE3C 1U8JA 5ENWB 2F58L 3CH1B 1BBDH 4ORGB 2VLMD 3W9EB 2BFVH 1J1PH 2G60L 1MSPA 1EAPA 1NMCC 4LCYB 3QIUC 5K59F 1UACH 4NN7B 4YUEH 1S9YA 3MRGB 2R4RL 4ZPVA 1S7VA 5I1KL 3QDJA 5D2LF 4X98B 4I3RH 3KPSB 4GSDL 3HMXH 4UMGA 3TNNA 1D5XA 5C0CB 5I30L 3AU1A 5DJ0A 1I85C 3TT3H 3DYOA 5C0FB 1CDYA 1OD7A 4DGIH 4NQEA 1IC5H 4UNVA 3G08B 4JO4L 4Y4FD 3MJ8A 5F1KC 1U8KA 3BOVA 3HUJA 1CLCA 1BWWA 3ZTNH 3BISA 5FYKU 4MMXC 3UBXI 4JJ5B 1ZSDB 1BX2A 4HC1A 5TF1L 4W81A 2VLJA 1LP9B 4JKKA 1K5NB 1QLRB 4NUJA 4HWUA 3BHBA 2DBLL 2FJHB 2FZ3B 3WIFB 1FYTB 2MKWA 4MB3A 3LVEA 1OCWL 4RNRB 2YC1A 5BVJA 2IEPA 3OKOB 1A8JH 2OP4H 5E08L 3ZKQD 1VGEL 4AL8H 4JFEA 4F2MA 3VW3L 4K7FA 5CZXC 3QIBC 3H9HB 2CRMA 4F9PC 5CSZB 1ZT7B 4HH8A 2DLHA 4JQVC 4PJHA 4GG8B 2DQTH 1Q9OA 1RZGB 3OSKA 1GGIH 1MEXL 1PQZB 3MLWL 3PGCB 4JDZB 5I17B 2IPTH 1CK0H 4JHWL 1ZA3A 3C5SB 4F7MA 3KYAA 3JUZA 4Z7OF 3H7BB 4HWEL 1NBZA 3ARGC 1IT9L 2C26A 2JB6B 1ZLWK 3VGFA 2ESVA 2OJEB 3SDCD 1ZEAL 3BP6B 3LQAC 4FTVD 3ARDD 4L29B 3OXRA 3WNOA 2DTML 1UKTA 2PW1B 4E9LA 2EDBA 1Y0LA 5F7UA 1I9EA 1R3KA 4M1CC 4P59L 2PXYA 3PL6B 4GO6B 4D2NA 3RPIB 4CW1B 1FDLH 4NRXB 1FAIL 2YRZA 3QZWG 5I71C 5FKAB 1YEEH 1G7IA 1JWSA 3OMZA 4LDOB 4NQSB 1X3DA 3ILQC 4MLSA 5DFVC 1FRGH 5ICZB 3PIQB 5CEYA 2BSSA 2X5PA 2SEBA 5EU3B 3MNZA 3SKUD 1JYVA 1LNUA 1RZKH 4M6NL 4YBHA 1HZHL 4TVPE 2NXZB 4Y5XC 3MLVH 4I3SH 3T1FA 4OZFG 1XF5A 1YYLL 3WFDL 2WWMC 5J12C 5KS9A 5ID1B 2WSKA 1MFAH 4OCXH 2Q86B 3MLUH 5E7BA 2XNAB 1TCRA 1IGCL 4Y88A 3MTRA 3E3QC 4B7LA 5E8EA 1IRAY 2APVA 4ZD3L 1RK1B 1SMOA 5H8DA 4R7NB 5GISH 3IJYB 4NN6C 3AAZA 4M5YL 1MIEH 1IC4L 5A40E 2WBJD 1DBJL 5IQ9B 1QACA 3DV6A 4FS0A 1OD9A 3AFLA 3V6FA 4XXDB 3KGRA 1ACYL 3INUL 5EO0A 4KXZH 3EFDH 1EJ6A 1P7HL 2DQFA 5HDLA 2ATPA 1WWCA 1OTTD 4Z7NF 3C09B 5MERA 4L4TE 4QXUH 5HYSA 2NYYC 1T7XA 2Y6SC 1S7RA 2DKUA 4F7PA 4BELD 3BPOC 5EN2A 3D25B 4G6ML 4DK6A 2CXKA 2HFEB 4PG9B 3O3DA 5HI3D 5EUOB 3K3QA 3V4VL 1U8PB 2CDEA 2Y7QA 1GJIA 1KFAH 3VXUB 3QCUH 4TPRL 5JR1L 1LEIB 4M03A 4YQXL 4U7KA 2XTLA 1A22B 1NH6A 4GAYB 1PD6A 3LQZB 4QRUA 3OR6A 3PP4L 2E3VA 2H1PH 3GI9H 2LABA 2YBRA 4LLUB 1FZJA 3LMJH 2DWDB 2VLRA 1LMKA 5J13B 4LCCA 4AM0B 5BQ7B 4PB0H 2FGWL 2KDGA 3IJHB 3QZWB 4X4YA 5HHMB 5DURB 2YUVA 4LAQH 5SWSE 2BOBB 2ZZUT 4OB5L 3X3FL 4YH6A 4I18B 3TP4A 1YNTA 4TNVF 4MNQA 3B4NA 5DO2C 1CFNB 3CSYA 3UJJH 4LIQE 3LD8C 4P23A 2BRRH 4G8IB 5F70A 1JPSL 4EOWL 4E41E 3MACL 2JJSA 3I85A 3N0PB 1QBLH 4OZFB 1UQSA 5GS0H 3W5MA 5FA3A 2E7BA 5DJ2A 5FOJA 3EYFB 3S36H 4PJXA 3DLQR 5CILH 1EV2E 5J9PB 1FH5L 4ZXBD 1KULA 4KJYA 4JZOA 5F9OL 4PJ9C 3CFEB 4X0KA 4K7PX 3P11H 1WBYB 4P4RB 1QOKA 5L2KA 3D39A 4MA8L 2PTTA 2UY6A 4WEMB 4C58B 4U6VL 2GJZB 4I77L 3BKYH 4LK4A 3GBML 4NKMA 4HLJA 4NBXB 3QDHA 1OTSC 5CEXA 4NQDE 3VFVB 4HWBA 4JRXB 3RWIA 2JB5L 1J87A 4UV4L 5I8EB 5ICXA 1QLEL 3ARSA 1KV3A 5E94A 4M7JH 3WFEH 5KSVB 4Y5YA 3L9RB 3Q6FA 3ROOA 3WUZA 2FD6L 4LPVA 3KG5A 4ZDHB 4R2GD 2NPLX 1BZ7B 3NIFE 43C9B 2WBKA 1A1OB 5B8CA 4XVSL 2ICWJ 3EOAB 5J56B 5HVHC 1FYHB 1CCZA 2XWTB 3THML 1R24B 2DDQL 4APQD 3MV9B 4KI1A 1UM5L 3SDDC 3D0LB 4NRZB 4K94L 4YHYC 2VDMH 5BV7C 5HJ3B 4PP2A 2VE6A 2JCCE 4GKNB 4FFWC 3G9AB 4JFPB 2XZQL 5C0DB 3S37H 4G9FA 3IDXL 1R5IA 2XKNA 4OAWB 3X17A 3RKDD 4ZAKC 5AG9A 1WV7T 1MVUA 4PP1D 1X5HA 1N7MH 2UZXB 2IPUK 1DSFL 4PYHA 4IRSB 5IMMA 4BSWB 3H42L 5DJZA 3LHPL 1Y18B 1SYSB 3LEXB 2Y36L 3KPQB 1U93A 1NLBL 3A6CL 4Q9RH 1OT2A 1T5WA 3L6FB 2VDLL 4R3SA 3MRJB 4RX4A 4DN4L 3W2DL 3RHWK 1C8PA 3KPSD 5EU7C 4WDIA 4P57A 5C0CD 4LSPL 4DTGL 3B6SB 3F5WA 2J8UF 2IPUG 4J3WA 4YE4L 4CVZA 4GW5B 3H2WA 4PJCB 4I2XA 4P2CG 3JVGC 4Q2ZA 4TVPH 4FNLH 4XB8A 5EZIL 4TULH 4LSVL 3ES6B 4QWWC 1TITA 4ZTPH 4IM8A 2XICA 3U30C 5E2UL 3STLB 4XP6H 5FB8A 1AR1D 1K3ZA 5MENA 1QSFD 4RRPA 1T7ZA 4KKLC 1MLCA 4FQXB 5JXAL 4M6MH 4QHUA 4JG0L 5HHQB 1FYTD 1IQWH 1ZANL 1FZOA 1D6VL 2BVEA 1L9MA 4HH9A 4HX1A 1TVHA 3D2UB 4RMSA 4MA7L 4FABH 5D1QB 1SEBA 3WIIL 3EYSH 3W11C 3HNVL 1B88A 1FORL 3P9LA 2NY4D 1V05A 3K81A 5TH2A 1SBSH 2EIBA 4YIQB 2YD2A 2F74A 2CSPA 2NMSA 2HMIC 5IJKC 5F44A 2R0KL 1KENH 3ISWA 2EXWD 4QT5A 3RZCC 4X7SL 3ESUF 5B3NA 4M61A 5C07A 4YXLL 1G7QA 3WFHA 1FJ1A 2OS7A 3MLRL 4UT9L 2D31A 2BNRB 3PL6D 4HJJL 4NZRL 1UM6H 3NFPA 2YN5A 4MYWB 2QSQA 3MV7B 4WWKB 5GJSL 4BFBD 2FECI 4P2QE 4WI4A 4EVNA 3FOMB 1XR8B 2OL3A 5EOQL 4U6HB 2YWYA 2V5YA 2F8XC 2XN9E 3QI9C 2W9LA 5A2KH 1AHWB 1QFOA 4JY4A 1T2QH 3UAJC 2D0GA 3PHQB 5IFHL 1G9EA 2NXZD 4P5TA 1AP2B 2WANA 4MA3A 4GBXA 4M8VA 5FHBL 3GIVA 4PV8B 2FO1A 4RAUB 3I6LD 2ZP0T 3UEZA 4CAGA 4PJAA 4AT6A 4X9GA 1G7JB 4YHOL 2HTKD 5DRXB 2CUHA 3MGOA 2APWA 5C0RH 3O2DL 3PHOA 2R0LL 2WP3O 4LIQH 5BZDA 4MAYB 5KG9B 1RZIA 3HPLB 4XTRC 2AXGB 3R0NA 3UJTL 3RWCA 5LKNA 1IGJA 2GITB 1HHHB 1W8NA 2QQKL 4MJIA 3EO1B 1RIVH 4L8SB 3IXTB 4R4BB 2FECL 3NIFF 3HS0A 3DX6A 2ENSA 3DX7B 1V7MH 2HT3C 5CGMA 5F72S 2QSVA 1REIA 4NUGH 5DHVH 5EOTB 4M7KL 1B90A 4LHUG 1GGBH 5F9JB 5CIPB 5AZ2L 1H3VA 3A67L 2DTSA 2P4AB 5IESH 1CG9A 3CNKA 1OSPH 3VJ6A 2F53B 4OZIF 4BK5A 5C0JA 2JCCF 1CL7H 3CZJA 2DKSA 4X4ME 1OB1B 3KYOA 2AGJH 1YY8B 1GGCH 3MGAA 4GW1A 1NDGA 4OQTA 2HP4A 2XRAH 3VXUD 3KPTA 1CF8L 3QDGA 2AV1A 4UOW0 3FHAA 2FSEB 3K4DA 2P5EB 4RDQG 4ZFFA 1I1YB 1KPUB 1I7UA 4YNYA 2VERN 1PX3A 5DFTA 4OUUB 5C6TL 1ZOXA 5ESAB 1J12A 4DZ8A 2X4SB 5HHMD 1DFBL 5DURD 3KJ4C 2VAAB 1KTRL 3P9MA 4NNXB 3NCBB 4QYOB 4EN3A 2L4OA 4UNTA 5MHSD 2CRZA 1TLKA 3PNWB 2O5XH 1DQMH 1C7SA 4PV9B 3RIFF 4KK6D 4WUKL 2HAZA 4MJ5A 3CFBB 1DUZA 2NY3C 1J5OL 3IYLW 2DQUL 3D6GA 1U91A 1EBPA 4G8EB 1SJEB 1KCUL 4JKLA 4PD4J 3GSNH 5DQDL 2QQLL 3U0WL 1S9WB 2QV2A 3OHXB 2VXUL 1BBJA 2P5WE 3T2OA 4K71B 5C0IA 4LRNH 3WS6C 2NXYC 5H37H 5EPMB 3CU7A 1AKJA 2YPLE 3N9GL 1YY9D 3WUWG 4UAOB 4OCMC 5GGVY 1KBGL 2FCBA 5JA9A 4FXGB 3LN5A 3SO3C 4K8RH 1QBML 2R0ZH 4PJIE 1BIIA 4PRBA 5FYLH 3FL7A 1RULL 4KKAD 4Y1AA 3EDKA 1MWAA 4JRXD 1I9IL 5TQ0L 3EO9L 5IB2A 1YEGH 1MAML 3AY4C 1NBYB 3RWDA 2VDOL 1NGWA 3CXHJ 1MFCL 3MCKA 4LHUB 5T3ZD 5E1AB 4IRJA 1J05A 1VFBB 5D8JL 1PYWA 2CDFA 2AJSL 4I0PB 4PPTA 3BH8B 5BW7C 1F3DJ 3ZKND 2DQIL 1TQBB 3F6LA 2BNUA 1T80A 3UTZB 3NCMA 3KWWA 4TUJB 3MV9D 5JW5A 1BLNB 5IIEB 4AMKL 3UYRH 4PJGA 1UB6B 1X5GA 3QDMA 5CS7A 4D8PB 4P5KB 4P3WA 4QRPA 3CFJA 4UINH 4CU8A 1AGCA 3TM6A 1YECH 1LEGB 4HDIB 4G5ZH 4HMEA 1GOFA 3DMMB 3KPMB 5C2UB 1A2YA 1T5XA 4L3EA 1G1YA 2XKSA 3T0EC 2M26A 4IRSD 4LRIA 2FGZA 3O9WB 4NRYB 3MRPB 1W0VB 3OX8A 4N0UE 4X6CF 3ZYZA 3UROR 1J86A 1N0XL 1ES0B 2P7TA 3WN5C 1RZ7L 3FFDB 4PJ7F 4NFDA 2R2CA 3T8XA 1VCAA 3EUUA 1TJGH 1NCCL 8FABA 1A7NH 5C0AB 2FNBA 4LEXL 4WFFD 5CGYD 2EDQA 3CFCL 3HLAA 5TQ2H 3KAAA 3KJ6L 4NC1E 1C08B 1EZVX 4HUWB 5T3ZL 1QR1B 4N1HB 3GGWA 5KANG 5J11B 5DJAB 4Y4KA 3C2AH 4HKJB 3WUWB 15C8L 3QQ3A 4N5ED 4R7DA 3SDXF 1UM4L 2ITCB 5JHDE 4DGVL 2AI0L 5ETUB 1NJ9A 2NTFA 3SN6N 5KVMC 4MZ2A 4UUJA 2Z91B 5GRJH 1LO0L 3LSOA 4G8FA 4JZJA 3RWEB 4FQXD 3B43A 5HYEA 2APFA 3X14A 1YEHH 5GGSY 1SY6L 1I75A 4BZ2L 2CXGA 1TTGA 5I1CL 3UBXA 4FQCL 1CGVA 3D2UD 2EYTB 3FQNB 4J3VA 4WO4B 1R3HB 4G9DB 1IEBB 1U8HA 5D1QD 2J8HA 1JWUA 4M00A 2XIDA 4NZTL 4Y4FA 3FB5A 5IVXE 4W4OA 1XCQB 4F15C 5IB1B 1CICC 3OXSA 1LDPH 2R2BB 3GSUB 3FN0H 1AGEB 2ZOKA 4EI6B 3QUZC 3KPPA 4BFIA 3TBWB 3PJSB 2O93L 1OW0A 1YMHA 4PRHA 1A6WH 3UTTB 5BVPH 2A0LD 5DMGC 1UYWH 1T04B 2E7LC 4R6UA 3MMEB 1IC7L 3MUHL 1S5HB 3OB0H 3KS0H 5IFJA 1IGTA 4OLZL 3KDMB 5H35A 3NFNB 2BNRD 3GSOB 4HKXA 5LJYH 2GCYA 3MV7D 1Q9LA 4PR5A 4WWKD 2OQJA 3OJVC 4OZHA 1FZKB 3T4YB 2E6JA 1U36A 1OAUH 4LHJB 3ULVH 4J3UA 4WGWB 3ZT7A 4W70A 3IFPA 2AQ2A 4NO3B 3QEQE 1R3IH 4NPYB 1QRNE 1R5WA 4UIKH 1MFDL 5D5MF 4JPWL 4YFLF 5JUEL 2XZAL 4HMCA 3SDCA 1JHTA 1S7XA 3VMOA 4XPBL 3ARDA 1J0YA 2WUCL 1ZT4B 2OJZL 3GMOB 4OF3A 1MJUH 4X5XA 1XH3B 4Z8FH 2F5BH 3NA4A 4KC3B 5FF6B 2JJVA 4MAYD 1DQDH 5GGQL 1HYRC 4OIBA 4OGZA 3IFLH 2VXVH 3UZQA 1FG2B 5GRVK 4YXKH 4GKSA 1M7DA 4PJ8B 2AJYH 1NCAH 3C60B 2HFGL 4MQ7B 1CD0A 3QDJE 5E03A 2DM7A 1ETZA 3RAJH 4XP9L 3C5ZA 5F8RC 3DXAE 4JFZH 4QRTA 4XBGA 3T3ME 3U36B 3OKEA 3BAEL 4K3EH 4U3CA 1ORSB 4NQEE 3VXME 2FWOA 3VFUA 5E5MB 5CD3A 4P3CL 5E7FA 3CPLB 3B8YA 3QHZL 3OJDB 3HUJE 4F7TB 1T22B 3VXPB 4DZBA 1QD0A 2CKNA 3CK0L 2F53D 3BO8A 4HKBA 4GRWH 2PXYC 1EO5A 1RUML 4X4XB 4X99B 2YK1H 3ARUA 4DKDC 4U6YB 4GLRH 1G1CA 1FFQA 4PLOB 2W1NA 3OKYA 2D03H 1HSBB 4ALAL 1NBVL 2IMMA 3PE9A 1KJ3H 4I4WA 2WBJA 2A73B 1JYXA 4TUOA 5IBLC 4FQ2H 5EBWA 4B5EA 4N8VA 2P5ED 3SJVB 1EERB 3N1PC 4HT1H 1U8QB 4GKZB 3QISA 1F00I 4JY5H 4OI8A 2KZ1B 4S10A 3M17B 5KTEL 1T6VN 4PJHE 5F8QC 4YHZL 3WDJA 1WWWX 2LQRA 4LCUB 2V2TA 3IETA 1QP1A 4DOHE 2W0KA 5F3HA 3BPLC 3GJEB 4Q6IB 4JFOB 4U1LA 3MV8B 2ESVE 3OG4B 4BH7A 4PGCB 5KAQG 1QKZL 5C09B 5B3JE 4LLWA 2WWKT 4H1LA 2ZJSH 1SQ2N 3JV6A 4NKQB 2ITDB 1NKOA 3UYOD 4LKXB 1RJLB 1H3PL 3IDGA 4HUNB 1INEH 2AEPH 4I5BA 4MD5A 2IBGA 2GK2A 1ZVYA 2KUTA 5TDNA 1OM3L 5GS1A 1N2RA 1UENA 5D7JB 4ODUB 3CFKB 1XGYH 2BNQE 4CU6A 3VFRB 1OAXH 2Y72A 4R8WH 4OD2B 3L7FB 1OWWA 4LSQH 3BEWB 3E2HC 4GAJH 3GSXA 3ARYA 2AK1H 4L4JA 2CLVB 4FZEL 4XPHH 1CIUA 1ZLVH 3CSPA 3A6BL 4IOIA 1LO2L 1MCJA 3MBXH 3NCYP 5C0EA 4LLYB 3SGJA 1CWVA 4OLYL 1SVCP 1I3UA 4H88L 3MRLB 5KS9E 3V0WL 5KSBB 3QULA 2ORBL 4LHUD 4PD4K 3GKWL 3H9YA 1OAYL 5TDOB 4U05A 1FO0H 1DQTA 4HV8A 2I5YH 4JJHA 4NZUH 3VFGL 1UCTA 5FGCB 4I0PD 5I1EH 3RL1B 3C5JA 4WRLA 1DN0B 4X4ZA 4LCCC 1BVZA 2HN7A 5HDQL 4POZC 4D9RE 4RA3A 5IR1A 1A6UL 4A2MA 3QPXH 2FX9H 3D0VB 5CWSA 5B4MC 4Z18A 1I1FB 1S7UA 5F6HJ 3GMMA 2GI7A 3QH3B 4J1UB 1Y6MR 4OSUL 4EIZC 1KJMA 3KYMB 2I60L 3HZKA 4H8WH 4PTTA 4P23C 3BZFB 3DMMD 5HGDA 3GKZA 1N5AB 2BSTB 4HPYH 3SDAB 2C4XA 3SE3A 2LU7A 1D5IH 1RJZA 2W65A 1BQHA 2JJSC 3CXHK 1CIDA 1FBIL 2GJ6E 4R26L 4HIJB 4BSJA 2N1KA 4CN4A 5J1SC 4PJDA 1WITA 3O9WD 3DNKA 2ERJB 2VH5L 5DQJA 5IHUL 4M5ZH 3VWKB 4MCYA 1T03L 2YEZB 4ZUTA 5HDBF 5EBMA 4APQA 1A7PL 1V5JA 1T1YA 2X42A 2YD8A 3V5KB 4Z0XB 4J2XA 2VO5A 4WFHD 3PXHA 1S7SB 3W81A 1MCIA 5I8CB 2QHLA 5E00A 1J0KA 3K1DA 2H2PC 3GMLB 2I07A 1SHMA 3PWNA 5F93C 1FC2D 2BFVL 1J1PL 2NX5B 5HD8C 4NO5B 5ENWA 4MNQE 4Y5YC 1IC1A 4XBPB 4UQ2B 4ORGA 3X12A 9CGTA 1P69B 4I3RL 3W9EA 4QHNB 4NM4H 1M71B 3D9AL 4LCYA 3QXDB 5D6CA 3ZSTA 3HUJF 4P9HC 4JCMA 1FQ9C 3S6CA 1XCTB 3MRGA 3RJQB 3CU1A 1IC5L 4KK9D 2A9MH 3ILPB 4X98A 3KPSA 1MCFA 4PJXE 1I8LA 4PLKC 4A2LA 4LSUH 4RGMC 3BJ91 5C0CA 3DVNB 3ZTNL 3VD3A 4YBLB 1DQQB 1ZA6B 4WO4D 5C0FA 4JREB 4K3JL 1KIUA 2X4OB 3D39E 3VFTB 3G08A 1NGQH 5F1OB 2BJMH 4FG6D 2C4FU 1N8ZB 4JJ5A 4U1SB 4ZFOA 2ZCKH 3Q5OA 3F58H 3UTTD 3WHXB 2OP4L 3SGKA 3FT3B 4PJHF 3G9VA 1QSFA 1K5NA 1QLRA 2KQMA 4AL8L 1WT5A 2L7UA 2FJHA 2FZ3A 5H37G 4O02L 2NZ9C 3WIFA 1FYTA 4DFHA 2VXTH 4RNRA 3O2VH 3OKOA 2DQTL 3MLYH 1GGIL 1XZ0B 2X70A 2IPTL 5CP7B 5BJTB 5B3JF 4NHCH 3H9HA 2V9QA 3L3IA 3O2DA 1ODAA 1ZT7A 3ZYIA 5F1NB 4GG8A 3PGCA 3BIBX 2PR4H 1PQZA 4KPHH 4JDZA 5I17A 3C5SA 3GJFA 5HGBB 2FJGB 3H7BA 4FQJH 3RDTB 2JB6A 5DHVB 3QHTC 2OJEA 1FDLL 5JOFB 4UBDD 3BP6A 4G9FE 4P2YA 2YHGA 4L29A 2PW1A 3DYPA 5LG1A 1AGFA 1CDUA 3NIGE 1ZGLB 1FRGL 3PL6A 2DJSA 1TZIA 3RPIA 4CW1A 4KXZI 1QQDA 2ZG3A 4FFVC 5FKAA 3TH3T 2OK0H 3V4UH 3VXNA 4GQ9H 1A3RH 3F7RA 3O3AB 4NQSA 1IEAA 5T1LA 3IXAB 3G5XB 4F7EA 1T7YA 5ICZA 5KS9F 4PJ8D 4PLJD 2F5AH 4I3SL 3MR9B 3C60D 4Z95H 5KANI 5EU3A 3JV0A 3U83A 2XKUA 1JGVH 1XF4B 4KTYA 5HYJA 4PGZA 1QHOA 4OCXL 1DBMH 3MLUL 4XRCB 5EIQA 3EYQC 4NKOA 4PREA 3QO0B 4WUUB 3QCVH 4M3KB 1PG7X 4P2RE 3FQWB 4I2XE 1I9RL 2N4IA 3BGAA 2Q86A 1CS6A 3PP3H 1FIEA 3TYGH 1JZ3A 1J9CT 3JTSB 3KXFB 4P99A 2ICES 1KEMH 1Q0YH 5E6ZA 1RK0B 1RK1A 4R7NA 3IJYA 4GXUN 3I50H 1KF9B 3GSNB 1EHLH 4X9BA 4JY6A 4U1JB 1WGOA 1BD2B 2XTJE 3P0YH 4H26B 1HSAB 4XXDA 3SJVD 1R6VA 4GH7B 4XX1E 3D87B 5IVZB 5J1TC 5T5NG 1F4YL 4G80B 4OFIA 4P5TC 2HT4C 2YUXA 4GBXC 1YJDC 3QIWB 1YUHB 1KFAL 3QCUL 3DURB 4R0LB 5DT1H 1VFOA 2IALB 5TGBB 4CUCA 2JIXB 5A2IH 1MH5B 3O3EA 3MV8D 3MLXH 3D25A 2HFEA 1F6AB 5EUOA 2H1PL 5C08A 2VQ1B 3I9GL 3GI9L 1U8PA 5C07E 5C09D 4OLVL 1D3CA 1I7RB 4QNPE 1BZ9A 3MRQB 5I1LB 1B2WL 1FFPB 4LAQL 4LFHD 4GAYA 4U2YA 1BOGB 3LQZA 2X10A 4WI7A 2DL9A 4LLUA 2W59A 4OCSL 2DWDA 3IF1B 5D7JD 4AM0A 5BQ7A 4TTGA 2BSRB 3QZWA 4Y19B 2BOBA 3UJJL 4I18A 4JGUA 5E2TH 4UB0H 4PJXF 3IDJB 2EYSB 4WHTA 1QBLL 1YDPB 4NJ9H 4U4BA 1MFEH 1CFNA 1OP3H 3S36L 4G8IA 2E27H 3VFNB 2I9TB 5CILL 1NL0L 1JYNA 3AS1A 5EZOL 3DVFA 1WEJL 4OZFA 4PJAE 5BRZB 4GG6B 3PDDA 1WAAF 3WEXB 2AJVH 3EYFA 1N26A 8CGTA 5J9PA 3LKRB 1AI1H 3GIZH 3VXQB 4S11A 2RCSL 3CFEA 5B21A 1EHNA 1P6FA 1WBYA 4P4RA 2KKQA 3UTPE 3AVEA 2A6DB 4MJIE 2VITB 3RNKB 5KW9H 1J8KA 1CXIA 1T1ZB 1YNLH 2GJZA 5EIIB 4M7JL 4PGDB 2MJWA 2V7HB 4EN3C 4ZS7H 1HQRA 3VA6A 2VUOA 3HE7C 3K80A 3DRQB 1WLHA 3VFVA 4JRXA 2VKWA 5I8EA 1JF6A 2M8XA 5IOPB 1S78C 3HN3A 5KSVA 4HAGA 3L9RA 4TVPD 5C6WH 3SDAD 4ZDHA 5E8DH 3Q2CA 4HWBH 4JKMA 1BZ7A 43C9A 2A2QT 2VDQH 4YDJB 1A1OA 1FV1B 2CO6B 2CMRH 1MCQA 2VDML 3V5HB 3EOAA 3QAZC 4CU7A 3VWKD 3MLZH 3ULUC 4H0GA 5FYJU 2XWTA 3TJEH 1R24A 5ALBH 3MV9A 4LVNC 3MJ9H 3D0LA 4NRZA 1ZHLB 3K74B 3QQ4B 5HJ3A 4J4PA 5C6PB 1GZQB 5CEZE 2NW2B 1N7ML 1TVDA 4GKNA 1R3JB 4JFPA 5C0DA 1SY6A 4X6BB 4HBCL 1LO4L 2RBLA 3TESA 1IKNA 2CLZB 1ZAGA 3GMPB 4OAWA 2NX5D 4Q9RL 1JGUH 1JHLH 5GRVL 2O61B 4UT6H 4OGAD 2B1AL 4IRSA 3SE4C 4BSWA 5F7WC 3MXWH 2J5LB 4IRJC 1SYSA 3ZHLA 4XNYH 3KPQA 1JN6A 3BZDA 3L6FA 3MRJA 2PETA 1D9KB 2HFFA 1AXTH 4B7IA 4X8JB 3VH8G 4NGHL 3KR3H 1GAFH 1DBKL 3P30L 2EDDA 3AMKA 5FO8B 4BQ9A 3NGBC 4TVPL 3GUTB 4FNLL 4H5SB 3BPNC 3B6SA 4ZTPL 4X6FB 3WE6B 1A6ZB 4GW5A 4XP6L 3VXSE 4PJCA 5F7DA 4FA8A 5JOPE 2EE6A 1J0IA 4M6ML 3ES6A 4LPTA 1ZLVK 4Y1AE 3DROB 1Q94B 1IQWL 3STLA 2HKHL 4NKIH 4GS7B 4KVNL 5DZNA 4WHYH 4LRIC 4PRIE 5JPNA 2LU4A 4FQXA 4FABL 3EJYD 3EYSL 5SX4H 5HHQA 1ZV5A 4WV1B 5DC0A 2ZUXA 1NAMH 4JDTH 2BCKA 3D2UA 3QXAA 3O6ML 1NEZG 5CLTA 3VRJB 5D1QA 2AKRB 4KAQH 5FEBA 4OF6A 2EICA 5D71H 1T83C 2BC4B 2P5WB 3QJFA 3QPQC 5IBTL 3NA9H 3UXFA 2P8LB 5GRUH 4PJGE 4HAFA 4Y4KC 5CZVH 3LKQB 3QDME 4QRPE 3RDTD 4G42B 4I1NB 1UM6L 4X5WB 3OKLA 1QTYT 5SWZE 4JFHD 3IDMB 3MA7B 5LXGH 4L3EE 3KPRB 4JPIB 2BNRA 4JKPH 1WUNT 5C0BB 4WCYH 4JZJC 4GRWB 3G5VB 1NMBL 1MPAH 3MV7A 5C9KA 4WWKA 4J3TA 4BZ1H 1M6OB 1T2QL 4NCDA 3RKPA 1NUDA 1U3ZA 2WAHA 3WD5H 3FOMA 1XR8A 1KJ2H 1HH6B 4X7DC 4U6HA 1XGRB 4U33A 3D85B 4XNUH 1AHWA 3W0WB 1NEUA 1CL7I 3PHQA 4W4OC 5I73C 1OAKH 1BQLH 5C0RL 4BQBA 4PV8A 1OW0C 2BHZA 3EJJX 4RAUA 4WUUD 4Z7UF 4POUB 4F8TA 5L6YH 5FCUH 1EMTH 5D7IB 1G7JA 5DRXA 5JZ7D 4RAVA 1V7NL 4X6EB 3KXFD 4DAGH 3S88L 1RIVL 3S96B 3NACH 4MAYA 5KG9A 1B0WA 3LPFA 5E8NB 2VDKH 3HPLA 2AXGA 1V7ML 2GITA 3AUVA 1AFVH 1AC6A 4HF5H 1YNKH 2XQBH 1I7ZB 3EO1A 2UWEB 4L8SA 3CVHB 3IXTA 4PB9H 2R23A 1BD2D 4JHZA 3L5WB 3DX7A 4ONHB 4KJQC 4QHKJ 3U0PB 1OSPL 3ALXA 1NCUA 5AYUL 3P4NB 2A83B 1CL7L 5F9JA 1A02N 2Q1EA 5CIPA 1AXSA 3SDCC 2AGJL 4K8RD 1GGCL 1IAMA 1C12B 3ARDC 3BRDA 2XRAL 3QIWD 1KLGB 5FYLD 2F53A 1HXYB 2JIXD 4ZSOB 4QXTB 4DW2L 1OB1A 3DGCR 4XAWL 1YY8A 4XPTH 4AENB 4Y4HB 3J8F7 4ELME 1YEDB 4O5LL 4F8QA 2W9DL 3L3HB 1Z3GH 5GSVB 1FO0B 2AXFB 2FSEA 3WO3B 2DQCH 4AK1A 1I1YA 3KHQA 1I3GH 5F7EL 3U7AA 2O5XL 1KJVB 4OUUA 4Z76B 3CMOH 5ESAA 3C5ZC 1KXTB 2X4SA 1X5ZA 4Y19D 2VAAA 4RIRB 3I3BA 2ADFL 4QYOA 2Y25A 2R0WH 1PFCA 1EHAA 1NQBA 2FLRT 3U7YH 1A7BA 5CEZH 4PV9A 3ULUF 3X3GH 4WFED 4TNWF 3GSNL 4XH2B 5K33A 1YEFH 4CN1A 3CFBA 5E6YA 3AB0B 4FTVE 4LP5A 4LRNL 4PY8I 1UWXH 3EDEA 5AYQA 5HVGB 4OTXL 1SJEA 3V6OA 5BRZD 3OHXA 5J8OA 1JZ2A 5ISZA 3LV3B 2UZYB 4K2UH 3V2AR 5IMLB 2WBJC 4K8RL 5EPMA 2NY2C 5GGTH 3UCRA 2R0ZL 4KHTH 1XR9B 3SBWA 3CAFA 4WEBH 5FYLL 2W60B 4MLIA 4FXGA 5GHWH 4WI2A 1QVOB 5CFHA 1OQXA 1YEGL 1B4JH 2FR4B 4JFYA 5I76B 4WNQB 3OTTA 2E6PA 1W0WB 4CKVX 3BMWA 1A5FH 5MP6H 5T5FH 1NBYA 1BMGA 1CFTB 5CMAB 2BMKB 3VWJC 1RHHA 4LHUA 5E1AA 5I9QC 2BK8A 4YEFA 2EE2A 1MHHB 1CLZH 1VFBA 4HCRH 2YD3A 3S7GA 2Z9TA 3T0VA 4I0PA 1G7HA 4N90D 1UVQB 2J88L 5E2WL 3UTZA 2EO1A 4UINL 4TUJA 2DJ4A 1YECL 2I9LB 1BLNA 1K85A 1MJ8H 5IIEA 1AE6H 3M8OH 4HK3J 2LTQB 4LNRA 3IRZA 4X6DB 4D8PA 4P5KA 1UGNA 5CBAB 3JTTB 1P2CB 2F58H 3I6GB 3D48R 2EE9A 1LEGA 1QLFB 3ET9F 4HDIA 5HBBA 5LGJB 1GVIA 3ZDZF 2YD5A 3HNSL 2NW3B 4PBWD 1IGYB 3DMMA 3KPMA 5DK2A 3ZSSA 3SGJC 2IANB 2R8SH 1VFAB 4C54A 2K3TA 3FAXA 5C2BH 1TJGL 2ADIB 3O9WA 4NRYA 4HIHB 3WIHH 4J3OC 3S9DB 1ES0A 1CD1B 2PW2B 1JL8A 3FFDA 3MO1B 2NY5H 4ZUSB 4XCCH 4LCIL 2C1OB 4LPCA 5DUPL 3MOBH 1D9KD 1T21B 4POYA 4HSQA 4JO4H 3C2AL 3U46B 4NT6B 2EDFA 2OSLB 2P48B 3DGGA 2NQCA 1C08A 1N5YH 1GYAA 1QR1A 4HUWA 2AJZB 4OZ4B 5TF1H 3EOBB 3ULVD 5DJAA 3WUWA 2X4RB 2VUYA 1JPFA 3VCLB 5SV4A 2EDJA 2VZUA 2ITCA 4ODHH 5ETUA 3Q1SH 2DI9A 4A6YH 3O0RL 1OCWH 3H9SB 1XAUA 2Z91A 4YEEA 3SE3C 5KSUB 1U6AH 2LU3A 3ZE2E 5DD0H 2K9UA 1B4RA 1JNHB 1TVBB 1BVKA 1H3WM 4QCIB 1WIPA 4Z7VF 3RWEA 1D5ZB 4RAHA 4YHIA 2OR9H 3QT2A 4M02A 3VI4F 1ZVSB 1T0MA 2VLLB 1Q0XL 4DUXA 2Q3ZA 4APQC 1K9TA 3MLWH 4P46B 2CLRB 4KH2A 4F9LA 2EYTA 3FQNA 1LDPL 4NQVB 3FN0L 4WO4A 1R3HA 2BY1A 4G9DA 3K1KC 1A6WL 5IBUG 2P5WD 1DQJB 4RZCB 5IB1A 2GSGB 3RJDA 4YWGH 4XCNB 2R2BA 3GSUA 1AGEA 1ND0B 4EI6A 3RKDC 1K8DB 1YEKH 1MCSA 2FHBA 4OZHF 1TQCB 3TBWA 4PP1C 4DCQB 3UTTA 1NGZB 4EJ1C 1FAIH 1T04A 3WFCH 3MMEA 1VFUA 1S5HA 3BKCH 4OV5A 3KDMA 3KPRD 4MQTB 3NFNA 4UIMA 5C0BD 4NN7C 3GSOA 3ULVL 2YS4A 1K4DB 4PJDE 4L5FH 1P7KB 3S36X 3C6LA 4TNVK 1FZMB 5F7LB 1FZKA 5GZND 3G6JB 1I8LC 2AEQH 3BI9X 4H25B 1LWRA 4XBEH 1EBAA 3EGSB 3GI8H 4NFCA 5D4QA 4Z9KB 4M1GH 5EDXA 5E2VH 3D85D 4XZUB 3WFDH 1QYGH 4NO3A 4LF3A 4NPYA 1KCSH 3TNMB 4GLRI 3CSBA 1MJUL 2D7NA 5SX5H 5DMKB 4N9GB 1IGCH 2JTDA 2F5BL 5MEQB 4MXWH 4HFUH 5ACLA 4KZDH 1DQDL 2DL2A 4ZD3H 1ZT4A 1AGBB 2W91A 1AR1C 4XP4H 2QKIB 2VXVL 3SGKC 1AH1A 4YXKL 2AJYL 1NCAL 4Y89A 1XH3A 5CCKL 2AABL 1N6QH 5FF6A 1HXMB 4ZTOH 2CKBH 3LDBC 4C55A 3VDCA 1CBVH 5GGSB 1FG2A 1WBXB 3INUH 3GB7B 4PJ8A 1H9VA 3Q0HA 3C60A 4K3EL 4N1CA 4MQ7A 3TWCH 1QSVA 3KPSE 2NY4C 2YSSB 3KVQA 4YGVB 5C0CE 3U36A 1VESA 4OLXH 1CGTA 3CFIC 2F19H 1ORSA 5D1XB 2NR6D 2F9BT 5E8OB 5E5MA 4LDEB 2Z8VC 2YK1L 4MJ4A 3S37X 1TPXB 5C8JB 3CPLA 3V4VH 3OJDA 4F7TA 2DLIA 1T22A 3VXPA 5C86A 4MB5A 5C0GA 4YQXH 5IBUB 2QSTA 3WBDA 1E0OB 1M7IB 4HGWB 1KJ3L 2C3VB 4QTIH 4X4XA 3PL6C 1T0NB 1LP9E 3PP4H 4FQ2L 5CLWA 4KJPD 4OZGE 1I9JH 2X7LB 4MA1B 1XIWA 4Y4HD 3P77B 1JV5B 3CJJA 5CJ8A 4HT1L 1HSBA 3C08L 3FRPG 1FYTE 3QBTB 4K3DL 1OHQA 2A73A 1G7PB 2PO6B 5I0DA 3SJVA 4UI2A 2RAMA 3QHFH 3EDJA 4GKZA 2VR4A 1KCKA 3M17A 4WIQA 3FB8B 1UKSA 3NBNA 5K9JL 5JW3H 4D0BA 3F8UB 5EO1B 1JPSH 4LCUA 1H5BB 2GAZB 3MACH 5KSAB 2EEDA 3GJEA 4Q6IA 4JFOA 3S35H 3MV8A 2HTKC 4S1SH 4X9IA 1H15B 2EXYD 2PYEB 4YBQD 1INEL 4PGCA 3VGAC 5E8PB 5C09A 2Y1VA 2MTPA 5BXFB 1HILB 3K46A 5IHBA 1XGYL 1OAXL 3TYFB 4R8WL 2ITDA 1S7QB 4LKXA 1JPGB 1RJLA 4GAJL 3TO2A 1HHKB 2LAAA 2AK1L 1P1ZB 5D7JA 3ZE2F 3L5JA 4ODUA 5I1DB 5L8LB 2BVUA 2WWKO 3CFKA 3GBMH 2ZSVB 4XPHL 3VFRA 4W6WB 4OD2A 1GOGA 3L7FA 4XX1G 2JB5H 3BEWA 4UV4H 3MBXL 1M05B 3F7PC 3C09C 1TFHA 2ZWLT 5LGKA 1CDGA 2ED8A 2CLVA 1KELH 4OF0A 2AQ3A 1J1XH 3O4OB 5E9DB 4J3SA 2FD6H 2B2XH 1PJ9A 3QB7C 4QF1A 2V7NB 4LLYA 3STZB 3I6LE 1FO0L 2QSCH 2I5YL 4WJ5B 5FDWB 2DI7A 4XVSH 1OGAB 3MRLA 4RGOL 5I1EL 4KU1A 1K4CB 5HYIA 3THMH 1RUAH 3U6RB 5TDOA 3QPXL 2DS4A 4K94H 2FX9L 3QIUB 5IROA 3MUZ1 2GIYA 1HI6B 1OARH 2AERT 3UTSB 5D9SB 1UB5A 3RL1A 3CDYA 5DMYA 2AJUH 3FB6B 1HINH 3IDXH 3LRSB 3TCLB 4PJBF 3C9NB 2X1QA 4PJDF 3DETC 4YDLB 2X6MA 1U8LB 1I1FA 1HHJB 4OCNC 4HPYL 1DSFH 3QRFM 1F5WA 3QH3A 4J1UA 1ACZA 4KK6C 2OMBA 3LHPH 1U3HB 3KYMA 3QEHA 4KTEL 2W0FB 5C7XH 3BZFA 1NLBH 4XPFH 1N5AA 1IZJA 2BSTA 2IAND 1W72B 4M5ZL 3SDAA 1IVLA 1CDCA 4KRNA 5EUKB 1RAMA 4DN4H 3W2DH 4HIJA 3OF6D 3HHRB 5EUOE 3GSRA 4H0HB 5CBEB 3VWKA 3VXUE 3P4LA 1YY9C 2DLEA 4DTGH 4Q9QH 4YE4H 3SE9H 1NAMB 3EHBC 5ECJE 1EEQA 4Z0XA 3H3KA 1S7SA 3RGVB 5I8CA 2WK2A 3ZKSD 5HHME 2F8VA 5IUSA 3PGFL 3GMLA 2ID5A 4HZAA 5MHSE 2NX5A 5TFSH 1LE5B 5HY9B 1T0PB 3WLBB 4HS3B 4NO5A 3QR2A 5EB9A 1MCRA 4XBPA 4JG0H 1ZLUK 3CIQA 4G6KL 4XNMB 5D70L 1WFOA 2A9NH 3H9SD 3GHEH 1IILE 2A9ML 4RQQB 1L0QA 4QHNA 2A6IB 1WTGT 1M71A 4LSUL 3QXDA 1KSRA 1XCTA 3BFOA 2J8UB 1FORH 5CKGA 2VC2H 4JZNB 3ILPA 2N7BA 5J3HD 1IKFH 4P46D 4O2FB 1NGQL 2BJML 3DVNA 3BVNB 3OKDA 3ZE1E 5EBLA 1ZA6A 3DSFH 5ACZB 4J4PC 4F7CB 1MCCA 4OM1H 2X4OA 3SHSA 4HIIB 4Y5XB 3BW9A 4DKFH 5L9DL 1G9NL 2H45A 1I3VA 1N8ZA 5F71A 1ZWIB 5FDYA 4HJJH 2K7QA 4U1SA 1BP3B 1EEUA 5SWSA 4JRXE 2CRYA 4MD0B 3WHXA 3O2VL 4IRSC 1TNMA 3O2WH 3FT3A 5GJSH 1E6OH 1MHEB 4ERSH 1KTDB 4NJAH 3O3UN 4TSAH 3L3JB 6FABL 2CH8A 5EOQH 4NHCL 5T3ZE 3KLHD 2AEWA 1D5MB 5DYOB 4JR9H 4KHXH 1NAKH 1XZ0A 2PR4L 4KPHL 4NN6B 1KNOB 5CP7A 3X13B 1RUPL 3RIFK 5BJTA 4FQJL 5CGYC 1MF2H 2H6PA 1LD9B 5FHBH 2CUMA 5F1NA 2D0HA 3MV9E 2UZIL 2MQCA 1JF5A 3ARTA 3QUKB 5HGBA 2FJGA 4EQ3A 4N5EC 5E24E 3RDTA 4YHOH 5DHVA 1KN4H 2GFBB 2R0LH 4OJFL 4XMKH 5JOFA 4KKCC 2OK0L 3V4UL 1A3RL 3PDGA 5DSCB 1F90H 5EU6E 4RSVA 1ZGLA 4EIGB 3EOYG 2F5AL 2WINB 4FQXC 2QQKH 4ODSH 3VFOA 3VXTB 3FQRB 4HS6A 5A2LH 4Z95L 2WIIA 3K0WA 3JSSA 2DYPB 1TETL 3EDFA 3O3AA 1JGVL 1RZ8B 3IXAA 3G5XA 2ZKHH 4LPUA 3WV0A 1KLUB 4HHAA 3MR9A 2VABB 5D1QC 4NM8H 2VZOA 5AZ2H 5IM7B 3RU8H 4GUPB 1XF4A 4WFFE 1T2JA 5HPOA 1E28B 4ISVB 2YRLA 3RWJB 3KYNB 5FO7B 1GZPB 4C83B 4HFWB 3TYGL 4XRCA 5HI5D 1P5VA 4HKZB 5F96L 5D1XD 3WS3B 1CGWA 4ZS6D 1KEML 3QO0A 4WUUA 2FX7H 4PJCE 3FQWA 1CFVH 5I16A 3JTSA 4KMLB 1EHLL 1F4XL 1RK0A 1F4HA 3P0YL 4LVOB 3VG9C 1JUFB 4U1IB 1HNGA 4XWOD 3GSNA 1U3YA 3ARZA 1PAMA 5HPMB 4PJFB 1QEWB 4U1JA 4OCLC 2PO6D 3LKOB 1U42A 3N1QC 1BD2A 3ZZ1A 4DJMA 4JM2B 3RUGF 1SJVA 4H26A 1HSAA 5EUOF 1IM3B 4ZOEA 5AG8A 4OZIB 4JVWA 5IVZA 5DT1L 4WUKH 3ZYJA 3ROLA 2H2SD 4G80A 4AIZB 1SBBA 3VFWB 4MVBD 4FFZL 2NLJB 2ICCA 1WK0A 3QIWA 1YUHA 3DURA 4PRNB 4R0LA 5KSAD 2IALA 1XF1A 2JIXA 1BFOB 1MH5A 3U2SA 3B3IB 5CJQH 3TLRA 3VRLF 2V6HA 2PYED 3PV6B 4MAYC 2HJKB 1I7RA 2BNRE 5I1LA 3A0OA 1BOGA 4KQ3H 3MV7E 1QBMH 4P5MB 3ARBB 3GSVB 2YD1A 4UB0L 3DUUB 3IF1A 5DF0A 5HVHB 2Q76A 3UPAA 2Q7YB 2BSRA 4MS8D 3RWHB 4Y19A 1N59B 4ZOBA 3T77B 3IDNB 4KGJA 2J6EH 3PWVB 3BWUC 5DR5H 4YHYB 2J3SA 3VD9A 5BV7B 2R39A 2J7LA 3IDJA 1MAMH 3VXOB 1YDPA 1A6TB 2G5BB 5E9DD 5DMIH 2Q8AH 2R69L 2AJVL 4ZAKB 1MCHA 3VFNA 2I9TA 3OL2A 3WYRA 1E27B 2Z0BA 1AI1L 3GIZL 3CVIH 1OGAD 4ZQKB 2XXMB 5BRZA 2ARJB 4F57H 4GG6A 4WU5B 5IV2A 1IJ9A 5KW9L 5JDSB 2RGSA 1YNLL 3LKRA 1GHFH 3U0TB 1S3KL 3QIUD 3VXQA 2VISB 3UTSD 1PZ5A 5CP3H 5JLZB 5LQBL 1EHXA 2A6DA 3RNKA 1AO7B 4JLRB 1SM3H 1E4XL 1LO5B 1MLBA 1T1ZA 1H3UA 4PGDA 2V7HA 1AD9B 1NANH 2YKLH 2HJLB 4XP1H 1R3LB 4N0FB 2NY0B 1P6AB 5FECA 5E8DL 2ATKB 5IVNA 1U3HD 5IOPA 4WGVB 3LEYH 3QEGH 1RZ7H 3FHQA 4FFYH 4HWNA 5I66B 2VQUA 2MWCA 3MRHB 1F6LL 2F53E 4A6YB 3MLZL 4KDVA 3TJEL 1RJYB 3FQTB 4XWGH 4YDJA 3MJ9L 5DXWA 4EXKA 5DJDB 4K71C 1AY1H 2MHAA 3V5HA 4MAUH 3L3OB 3BPCB 3V5DB 3W39B 3SBWC 5I1IH 4NSKB 2VZ1A 1ZHLA 3WL9B 2ZG2A 3QQ4A 3FT4B 2P5EE 5CZXD 1GZQA 2AI0H 2NW2A 1JHLL 1NGYB 1RZJH 4UT6L 3RGVD 1R3JA 4W68A 4X6BA 3MXWL 4X6CB 1EZVY 4EDXB 2CLZA 2AK4B 3GMPA 4PJ5B 3MC0A 3TBSB 4XNYL 4G6JH 3B2UC 4PJ7B 4NYLA 1JGDB 2F15A 4LVHB 4PBVC 4AG4H 3QSKB 1H8OA 3SKMB 1AXTL 3O8XA 3KR3L 5HYFA 4FQCH 2BVQB 2X41A 3B83A 4WY7H 3V6OE 4I0PC 3FO2B 4U6XB 5IF0B 4NZTH 4HBQA 3NABH 3SDXB 5DFVD 5FO8A 4ELMB 1WZKA 3GUTA 5JMRA 5C3LD 4PGBB 1QR4A 1VKXB 4X6FA 3WE6A 4ZPTA 1A6ZA 2VSCA 1AXIB 3NCEB 1OF2A 1CXKA 5HGAB 1CI5A 1IC7H 5I1HL 1BFSA 3WNPA 4OLUL 2I26N 2VZ3A 3DMMC 4KROB 1UT9A 3MFGB 1Q94A 2X44D 3L95B 3SKJH 2X9XA 1NAML 4JDTL 3UDWC 1B3JA 2XQYK 5I6XC 2YUWA 3T2NH 2A74B 5D71L 3CH8A 2FL5B 1WZ1L 4WI6A 3NA9L 5GRUL 2FX8H 3FRUB 3VRJA 4K7PH 5CZVL 1KEGH 2AKRA 5JUEH 3B9EA 3JZ7A 5B22A 2BC4A 1GC1H 1J8HB 2P5WA 1JTOA 5I15H 2NY6B 2P8LA 2WUCH 5J11C 5LXGL 4JO3H 1GRWA 3LKQA 4R96B 1PY4A 1F13A 1CVSC 4XCFH 4HGMA 4G42A 4JKPL 4WCYL 4X5WA 5EOCJ 2YD7A 3AS2A 4JGJA 1EJOH 3D69B 3EBAA 1IQDA 4BZ1L 3IDMA 3WD5L 5GGRB 3KPRA 4JPIA 1FLTX 2FDBP 1DEEB 2P8PB 5C0BA 2HFGH 4ZO6A 3G5VA 3OR7B 3V0AC 4PBXA 4LQFL 2FJFB 3HI1A 2DYPD 1M6OA 3WSQH 3C8DA 2ZG1A 5D5MB 3T0DA 1HH6A 5EG6C 1RPQA 4YK4C 4ZYKB 1OAKL 4FMKA 4L9DA 1KIPB 1BQLL 4WO4C 1CDBA 1NUNB 3D85A 32C2B 1FVCA 5C0AE 5EC2B 1GGTA 1G0YR 4WFHE 2WUBH 1AQDB 3BE1H 3OBAA 3M07A 3QP3A 3VD7A 3HCVB 3CK0H 1RZKC 4P0DA 4HUXB 3VH8A 1RUMH 4DAGL 4BQ6A 3NACL 3AGVA 2VDKL 1L6XA 3GBNH 3CDCA 3GNMH 5HVFB 1HE7A 4EBQL 5D7IA 5DO2D 3T0BA 1BIHA 4YC2C 5FO9B 4HF5L 4PFEA 2XQBL 4X6EA 3S96A 3DIFB 5M94B 3U4EB 3VDAA 5E8NA 3JWDH 4JFDB 4M7LT 3MZGB 1UZ6E 5MEPB 3C6LC 4JPKL 3BEVB 1I7ZA 5KTEH 3P4OB 2UWEA 1KCRH 2HRPL 4YHZH 1U58B 1NFDE 3L5WA 4JM2D 4ONHA 4BUGA 4CL7A 3U0PA 2ZPKL 5EC1B 2NZIA 3SO3B 5ADPH 3ARFB 3FO1B 4JAMB 4G7YH 4KKBD 2XFXB 4D3CL 4PRPB 1NEZA 4LLMB 4UBDC 2IMNA 2RB8A 4XPTL 3B9KB 1QKZH 5K9OB 3UJIH 4Q0XL 3I75A 1KLGA 4CDGC 1HXYA 2CR3A 3CDGB 4QXTA 3UTTE 4RFOL 2EZ0D 1U2CA 1XGPA 4AENA 2JF1A 4Y4HA 2EDWA 1MRDH 2DQCL 5JOPD 1YEDA 5JHDA 3ZL4H 2IAMB 3CMOL 2XA8L 3HTLX 1IGML 1IGFH 4PJ8C 1T3FB 1QA9B 4PLJC 3C60C 1A9EB 2YUZA 2R0WL 1FO0A 2AXFA 1F3JB 3P73A 4TN9A 1YC8A 5GSVA 3ARBD 2EH7H 1JFQH 1KJVA 1UXSB 4FZEH 4Z76A 3X3GL 1RHFA 1F3RB 1LO2H 3BGMB 4RIRA 3WDHA 3MX0A 3O6LH 4HZLB 1SJXA 2CO7B 4Z7QF 3OKNB 1HH9A 4OLYH 5JW4Q 5TPWH 1OL0A 5IEKB 1UJTA 4Q74A 3V0WH 4AEFA 2E8YA 4FFWD 2DMKA 5F97E 4XH2A 1EXUB 3L7EA 1WIUA 5E0QA 1JGLH 5C0ND 4K3HA 3NFSL 4K2UL 4ZAKD 1IAKA 5GGTL 4XNQB 3T0EB 4KHTL 2G9HB 5E4IA 1XIWC 2KQNA 2ZUQC 5DK0B 3HC3L 5GS0C 3LV3A 4Z6AT 2VDNH 5GHWL 1A6UH 1KACB 5A3IC 1XR9A 1B4JL 2X9YA 4L1HA 3C6SB 2W60A 1YC7A 1YQVH 4UZGA 1F11A 1AO7D 1QVOA 5IT2H 4IRZH 1A5FL 5MP6L 1WCBB 5T5FL 3F62A 1UXWA 2FR4A 1W0YT 3HA0A 2NY0D 4WNQA 5B38G 3UPCA 5I18H 4R26H 1FG9C 4HCRL 3OPZL 3EJZD 4Q6IC 3NVQA 4LBEB 1BVLB 2RFXB 1WTLA 1YPZF 4O2EB 4TVSa 2JLLA 1CFTA 5IHUH 5CMAA 3IJSA 5L2JA 2BMKA 5FYKD 3RVWD 5T33H 4GMSL 4CMMB 4R4FL 3UTQB 5BV7L 2DWEB 1MJ8L 3M8OL 1AJ7H 2EC9U 4Y0GA 1UVQA 1L7TH 4R97B 3BESR 1CR9H 2I9LA 5DTFA 4HK0B 3OV6A 4MWFB 2WLZA 3BXNB 2X4QA 1E4KA 3SJVE 4KTDL 4YR6A 3W11D 4X6DA 2R8SL 4N0CD 3JTTA 1P2CA 5CBAA 3K8LA 3I6GA 3ZKMD 5AWNH 4M4PA 1ZHKB 3O3BB 4F15B 5C2BL 5LGJA 2AK4D 1S9VB 1IGYA 3HMWH 3LN4A 4PJ5D 3QUZB 3WIHL 3D9AH 3DXAA 4JM4L 3PWUB 2IANA 3LRGA 1VFAA 2NY5L 5IMOB 4YHMH 4XCCL 1JNNL 3MV8E 1OY3B 3EAKA 4JRYB 3VXMA 3OF6A 3MOBL 1DLFL 2ADIA 4ZUVB 3TBVB 4HIHA 3TBTB 2EE3A 1CD1A 5DEFB 5C09E 3GM8A 3T3PE 3MO1A 1ZGLP 4ZUSA 5IROC 4KK8C 1N5YL 2R9HC 5L88L 1K2DB 2C1OA 4LPYA 4K3JH 1T21A 3TZVA 4OZGB 2OSLA 5EBGA 1LILA 2J12B 3BIAX 2Y4SA 1D5XB 4KFZC 2P44B 3BWAB 4ODHL 5FYKL 3Q1SL 2AJZA 4A6YL 4OZ4A 1DBAH 4GW4B 3EOBA 5IB5B 3QJHB 3F7QA 2X4RA 1L6ZA 1U6AL 3VCLA 4DQOH 3MJ8B 5DD0L 3LKSA 3GMNB 4O02H 4MSWB 4KROD 2OR9L 2ENYA 3AROA 3VI3F 1BFVH 3SDAC 5KSUA 2A38A 4PRAB 1JNHA 4OCYH 1TVBA 2HG5B 3BHBB 4QCIA 5KSBE 1D5ZA 5B38B 1ZVSA 3VWKC 5K93A 2C5DC 1BAFH 2V2XB 1P4LB 2VLLA 4LLVB 1HIML 2OI9B 4P46A 1X7QB 3S3JA 2CLRA 5IB3B 4YWGL 4QLRA 4JFEB 4NQVA 5FGCE 1MAJA 1YEKL 4K7FB 3ABZA 1GSMA 4ZFZB 3P3YA 2AJXH 1J8HD 3MRCB 1MFNA 1DQJA 5IEHB 5JHLH 2GSGA 2NY6D