5GRJL

Crystal structure of human pd-l1 with monoclonal antibody avelumab
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
108
structure length
108
Chain Sequence
b'SALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSNRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSSSTRVFGTGTKVTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords avelumab H chain
publication title Structural basis of anti-PD-L1 monoclonal antibody avelumab for tumor therapy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 17
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2016-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5grjL00
2CDFB 3AMKA 5IEHA 5CIPB 1C1EH 5KVGL 3BN3B 3DMMA 4LLMB 4HK3J 1Z6JT 1MCEA 3ZTJG 4CDGC 3CVHL 2CD0A 3I2CL 4LLWA 2F5AL 1X6NA 2Q8BL 5J6HA 4Q0XL 5CS7A 1RIUL 3PWJB 4WU5B 1OWRM 4PJ7E 5EU4A 4NC0B 4HXBL 1X5GA 5CFHA 2Z93A 4RRPG 4PFEA 4ZO9A 5KSAA 4PG2C 1DBKL 4WU7B 1K4CB 1XGUB 5ADOL 4IRSB 2ZUVA 1HKLH 3MLZH 1EGJH 2BSTB 3NIFE 3QDMA 4JANB 3O2WH 4FFVC 1VEOA 1Q8MA 15C8H 2DMCA 1G9MH 3K2MC 1YYLH 2VNCA 5ICXB 4YUEH 3TA3B 4MXVE 4MZ2A 1I85C 2OI9B 5IB4B 2C1OA 3EOTH 4ZD3L 3ARDA 1AGCA 4LDOB 5DRWA 3IRZA 3O2VL 1H8NA 4FG6D 4Y5YA 1NEZB 2M8XA 2IH3A 3HS0B 2E7CA 1JWUB 4GOSA 2H9GA 1XCQB 1PSKH 4POZC 2IJ0C 5GRUL 32C2B 1J8HA 3QDGB 4U6VL 4PGEB 4X7DC 4BFGA 1TZIA 3REVB 3GMMB 2CSPA 5EC2A 5B8CC 4DTGL 1ORQA 4XX1G 1EIBA 3JWNC 4I0PD 1LEKA 3ESVF 1I7RA 5FYLL 3I6LD 5IKCA 4J4PC 4R4FH 5IROC 3I85A 1RV6X 4X4ZA 2K9UA 5JQHC 2CUMA 1I8KB 4ELMA 5F1OB 3WFEL 1MF2H 3CC5B 5F7HA 3GJEA 5EO0B 5IGXH 3O2DH 4HK0B 2LQRA 1L6XA 2APFA 4LP4A 1QLFA 1GGYA 2CLVB 2VDKH 4BZ2L 4F80A 5E03A 5C6TH 2BK8A 1EFXB 5HYIA 4LEOB 1DBAL 3LZFH 2YS4A 5I18L 1ZS8B 1DEEA 4P5KB 4U6YA 1MFAH 2X9YA 2ZCKL 4IRSC 4U33A 4BK5A 5EU6B 3TNNA 1J05A 1KTRL 2NY4B 4N9OB 3ZHLA 4EN3D 3CFIC 2A0LC 4I5BB 1JGDB 5D1QA 3FFCE 4ORGA 2FHFA 2O61B 3TA3C 2XZQH 3H8NA 3F65A 4PRHB 4HIEB 3PIQA 3G6DL 2NZ9D 2CGRL 3R1GL 1OGAD 2VDLL 3FQWA 3TJEL 4PRIE 3LKPA 2ITDB 3GJFH 3H9YA 2DQCL 3P0GB 1H3UA 4X8XA 4OLUL 4JY6B 5FHAH 4ZUVB 4NWTL 3AMLA 4G8EA 4PGZA 3QIUD 5EFIB 2BXZA 3FN0H 3HN3A 1A3RH 1NGYA 1BFVL 2P42B 4KTEL 1IGMH 4XBEL 4P5MA 1CGTA 4K94L 2X40A 3O6FB 5C9KA 1F3JA 5EZIH 3A6BH 2LU4A 2Y1VA 3S37H 5DTFA 4QY8B 2W0LA 3VXMA 2YKLH 4XCEB 1Q38A 4Y4KD 4X6BB 4WFED 1TCMA 4K7PL 1SMAA 1QO3A 3I75B 4WHDA 2CO7B 1S7QA 5I19L 3DYOA 1BPVA 2DJ4A 5IFAL 5SWQB 1KCRH 4MD4B 5J8OA 3DVIA 5HY9B 5BCAA 4EXKA 4JFXA 4HZAA 1T6WA 4HCRH 3MRMB 4UUJA 4JFEA 4YDJB 2NY4C 1SM3H 3MRKB 3WD5H 1HHGA 4KI5F 4HH9B 2CMRH 4U6HB 1FNHA 4PP1D 1QFOA 3G6JF 4KQ4L 2MJWA 1W72B 2FL5B 2F58L 4Q9RH 4TSBL 1M05B 3IJYB 1Q9KB 3QCUL 1E4KA 5DRNB 5L2KE 5SX4I 1R3IL 2YRZA 5C0BD 3DRQA 1G7QA 5JPNB 1YN7B 2J8UF 3ELAT 5ANMB 4APQA 2A6IB 3S5LB 2ZPKH 3PP3K 4XNZC 2DMBA 4TSAH 5DYOA 4Y8AA 1IM3A 4XP4L 5E5MB 3VXTB 2HVKA 2Z8WC 3GSWA 1LE9A 1T3FA 1ZHBA 3O6FC 1O7VA 1ND0B 3HNTL 3CXDL 3EYQC 5C09B 5CGYD 3KAAA 3AAZB 1WTGT 1JFQH 2Q7NA 3RVXD 2AK4E 2AP2A 3KPPB 4LSQH 4RGNC 3U6RA 5JORB 4UZGA 1TZGL 1SY6A 4GBXB 4ERSH 1DQMH 5B39A 5E4EB 5CLWA 4M5YL 1FZJB 1K6QL 3O3EA 4WW1B 1C5CL 4D3CH 5M95B 5IB3A 4E41A 4NKOB 4PJ5A 3D69B 2APXA 3VWKD 1G7HA 1S9VA 3MRRA 5D7JB 2BVTA 4Y4FB 1I8MA 1G7MB 2NYYD 2WWMC 4LLVB 1YEEL 1CK0L 4PUBL 4OZFB 4D9RD 2OJEB 3GNMH 3NPZB 2FHBA 4UB0H 4HV8A 2PTUA 1JGEB 3VI3F 2UZIH 1KEML 4Y89A 3VCLA 2IAMD 2YPVH 3BXNB 3UBXB 5HVFB 5CZKA 3GSNA 1L9MA 1KJMA 3QXDA 2VERN 5EU7E 2YPLB 4LSDA 3BJLA 3DHMA 3NZHH 4K94C 4M7JH 1EDQA 1ZEAL 1E4JA 3HG1E 1B0RB 4GKZA 2VXTH 4TN9A 3M45A 4K8RH 4HPYH 3CLFH 4KRLB 5FV2A 3P73A 3MCLH 7FABL 4X6EA 4L9LB 5J6GB 2R4SH 1A7BA 1QQDB 1FL6B 5IVXB 1I8IB 5ESAA 1YNTB 1DUZA 1RD6A 1UYWL 5DI8B 3DX9A 4I9WD 3EYOA 5I71B 3CVIH 1VEPA 3G6AA 3HTLX 3JUYA 3V5KB 3IDIA 4RX4D 1KGCE 3X11B 5D5MB 3EOBB 1FYTB 3PQYB 3KPOA 5FO7B 2JB6A 1B90A 4GBXC 2FBJH 4OLVL 4BQ8A 2R2BB 4QRRE 2I60L 4N9GA 5E4EC 1UM4H 1XH3A 5GGVH 4OFDA 3VXNA 2PTVA 3MJGX 1U36A 3SDYH 5D9SA 5D7IB 1OARL 1RZIB 3QDAA 5C0GA 3QUML 3TBSB 1F45A 3V6OE 1N5AA 1DQJA 4DW2H 2VXSL 5L88L 3WHE1 2DD8H 5E6ZA 4OD1L 3R06B 3GHBL 5D7JC 4Y4FC 3D39B 4R0LA 3OB0H 2QL1A 4MNQA 5ADPH 2RFXB 4U1IA 2ARJB 4OGYH 5DHYA 1AXIB 5ILTH 1QSEE 1TJHH 1T7ZA 1A9BA 3L5JA 3MGAA 1TCRA 1KCVL 3UBXI 4L4TB 1NBQA 2D7PA 5HD8C 4UILL 5H37H 3GSQB 1N64L 4KAQH 5ESVA 2DOCA 1XF2B 1E4WH 4BSJA 1PQZB 2UVFA 4Q6IB 3RPIB 1WITA 1OOAA 1FFNB 5E8EB 3E8UL 4D2NA 4L9LC 5DRZB 3IDXL 1W0WB 5AAMA 1KB5A 3JTSB 5I71C 1HK6A 4UIKL 1E6JH 4FXGA 5F3HA 4AL8L 1IAIL 3QUMB 2AERT 4YO0A 5AG8A 3QUYD 3FO2A 5FA4B 4ZFZA 2P5EB 1IGFL 1FORH 4ONHA 4V1DB 1KTLB 1LHZA 2J2ZA 3F7QA 1JZ2A 1RJCA 4G6KL 5DJ8B 2VLJB 3EYVB 3EDEA 3VXOA 3RWFB 3TESA 4NPYB 2WBJD 5ECJE 3HZVB 1CFVL 1RUQH 5FCUH 1SEBA 4HJGA 3HI6H 4EJ1C 4PLJC 3P9LA 3W11C 1ZHKB 5HPMA 2PYEE 4PJCE 4PJFE 1EA9C 1ZOXA 2IFFH 2ZCLL 4JG0L 2X1QA 2X2YA 4TUJA 2GQHA 2IAND 3IAGC 4JN2B 3Q3GA 5CJQH 5C1MB 4IJ3B 1FPTL 1BQLL 4PRAA 4BZYA 1A1OA 4QRQB 2P8MB 5KBNC 2AJSL 1RJYB 2NNAA 1TJGH 1X4YA 1BIHA 4Q6IC 2MNUA 3HCVB 4KVNH 4BQ9A 1NL0L 4JFPB 1BLNA 4H1LH 5KSBE 1J0ZA 4NQEA 3IU3B 3GSRB 1CVRA 1QFPA 1QRNA 2ZG3A 4H5SA 4J6RL 5D7LD 4Z5RA 2GK0B 4J3VA 1WT5A 3T0AA 1L0QA 1BM3L 5HJ3B 4MQSB 1T6VN 4XZUA 5CJXA 1ZVYA 3UO1H 2A6KA 2DQTL 5F7EH 2R1XB 4RISH 4Y1AB 4LKXB 1CG9A 3V4PH 3RY5A 1KJVA 3I6GA 4GUPA 3VJ6B 2VZUA 5GS0H 3JWDL 2NY5L 3DVNA 5D71H 1IT9L 1GC1L 3R4DA 5GRXG 3MA7B 4WI2A 2YD9A 3H9SE 4OZIF 1I9RH 5B4MC 1A3LL 1ITBB 1M7IA 2NY7H 4KRNA 4MCYA 4S1SL 2JB5H 2VL5B 5I15L 1CFQA 1MCBA 4P2RA 3BUTA 3B6SB 1UCBL 4TULL 5EUOA 3UJIL 1O5DT 4BSWA 5F96H 3NAAL 2J6EA 4HX1B 5GGRB 5EZLA 4IJ3C 1NUFA 3OPZH 3V6ZA 3VI3E 1F6FB 5IM7A 5ACZA 4HIXH 3IJSB 4DJMA 3WSQH 3EDFA 4XPFL 4HEPG 4GW4B 4F7TA 4F7EA 2AGJL 5TDOA 4UTAL 5BS0E 4NT6B 4HGWA 3J7HA 1GGTA 2XWJA 1IAII 2N56A 4RFEB 4JQVC 4Y2DD 2BHZA 3X3GH 3ZL4H 4JFFA 4L3ED 2VDRH 3H0TA 3H7BA 2XNAA 2X4PB 3RDTA 1FIEA 2HT3C 4TUKL 1F4YH 3VRJB 1TZHA 5LBSH 2NY2D 3KPTA 3VXRA 3U4AA 1WEJL 4XMKH 5B22A 4HMEA 1RK0A 4XNUL 1NAML 3NOIA 2AVGA 2O5ZH 3IDNB 4BELD 5JDSA 1U95B 1XF3B 1FZOB 1LO5B 5ICYA 1KEGH 1RPQA 5DD0L 4HKZA 1YY8A 4UDUA 3LAFA 5FHBL 3DXAE 4UV4L 3AREA 1UC6A 1G84A 4Z0BL 1ZWIA 2QBWA 4MHHG 4MX7B 5CCKH 5DJXA 4AEHL 4CU7A 3AROA 2B5IC 2HJKB 3LRSB 4QRPE 4EUPG 3LHPH 5AWNL 1OAZH 1MFEH 5D96B 3DX6A 2ADFL 3T65A 1EXUA 2N1KA 2E9WA 2CDEA 1XR9A 4Z78A 3KWWB 3K74B 3TWCH 4DGYH 2AJZA 4DGIH 3KPQB 1UACH 5D7SH 2DQGH 1G7PB 4JO3H 1D9KA 1BZQK 4PS4H 2X1PA 2WUBL 3MO1B 3KVQA 4ZO8A 3LB6C 2E7BA 5HVWA 4OBRA 5IW6B 5JMOC 2R8SH 1AD0A 1MIEH 4XXCA 3EJJX 4P57B 4RGOH 2WQ8A 4CN4A 3RVTD 2EIZB 3P30H 3LQMA 1DDHA 2JJSC 2Q7YB 4YGVB 3KJ6H 5I1CL 4PV8B 2NZ9C 1NQBA 2HFFB 1AHWC 2BP3A 1Q9WB 4XGZA 2AEQH 4YH6A 5IMLA 1T4KA 4LU5H 1BX2B 3S98A 2QKIA 4OZ4B 5E94A 4PJGE 1GIGL 2AEWA 3Q6GL 2PO6D 3QUXD 4NO2B 2H6PB 3GJFK 3TEUA 3CFKA 1G7IA 3WFHB 4YHPB 1RUPL 4PLNC 5JIHA 3OGOE 5T5NG 5CINL 4LCWB 3TVMA 4NO3A 1GOHA 5KVGH 1YMMA 4FS0A 3BWAB 3P4MA 4ESKA 5IJVA 1EHNA 3D25B 4HIIA 5D96C 3CVHH 1S9KC 3I2CH 2F5AH 3CH1A 2Q8BH 3L9RA 1QPXA 4Q0XH 4FZEL 1RIUH 4OFKA 4XWGL 4CU6A 2BY3A 2ZCHL 4HXBH 3LN5A 3RWDA 1H5BC 5D1XA 1OW0C 1DBKH 4ZG1A 4WW2F 1ZK9A 5ADOH 3J8F7 5JO5B 5I0DA 1NFDF 3NA4A 2DM2A 4I2XA 4EI5A 2C1PB 4PV9B 2ZZUT 4JO2L 4DEPB 5CJ5A 2PYFB 1Q1JL 5HI5D 3UCRA 2V5YA 4ZD3H 2EYSA 3O2VH 4LBEA 5A1AA 2H2PC 2Y36L 4LOUD 4PJXA 3OAUH 2F54E 4F37F 1LK3L 4E9LA 4D9QE 1ZVHA 4QTIL 5DVMA 3ROOB 4M8QA 4E5XB 5GRUH 1HKFA 3P77B 3HE6A 4U6VH 4FP8L 4OZIE 1ZTXL 1RZGA 4F2MB 2H32A 4KWUA 3RTQB 3DTXA 3R8QA 4DTGH 3N1GC 4L5FL 1HCVA 1HHJB 5SX4H 4MAUL 5EORL 1HEZB 3PL6D 4D8PB 1ZLVH 1ZGLM 4UDTA 3S35L 1T1ZA 3OXRA 2CR3A 2VB5A 4K7FB 5IMOA 1HYSD 3WFEH 3FFCD 3RVXC 4YHIB 5B38G 2DQUL 4FZ8L 1WC7B 3C9NB 3VFGL 4NNYA 1GGCL 2AXGA 5BW7A 3TZVD 1ZA6B 1AO7B 2J88L 1KJ2A 3GSUB 3JVGA 4BZ2H 2RCSL 2RHEA 3P4NB 3BZ4B 4KUCD 2BSRB 5I18H 1WK0A 3D2UD 4FQQB 3RVVC 1YECL 4XNMB 2Y25A 4Y5XA 1N6QL 1EHAA 2ZCKH 5F88A 1XIWD 3FB5B 2ICES 1DFBL 2EEBA 2XA3A 4MYWB 1Y6NR 5H2BA 4Z7OE 4DEPC 5C8JA 1H15B 4G9DA 1YEDA 3G6DH 3EOAA 2CGRH 4PREB 1VB9A 1J87A 2VDLH 3AU1A 3TJEH 5K9OB 1QLRB 2R1YB 3G5XB 2BRRL 4XBPA 2DQCH 4OLUH 3U9PL 4NWTH 2NY3D 3O3DA 3VDBA 4KH2A 3WKML 1LD9A 5DD6A 4EQ3A 4PJAB 1AQDB 5D2NA 4X0KA 2ZUWA 3OWEA 1C08B 3RTQC 4P4KD 2VZTA 3MJ9L 1BFVH 1P9MA 4KTEH 4GRLD 3VW3L 3WL9B 1MELA 4XBEH 4WGWB 4K94H 1FL5A 4GRMB 1ITCA 2NW3B 2IBGA 2EDKA 4K3DL 3TPUA 2OMBA 2D7TH 4XP1L 4DFHA 4JY4B 3EDDA 3TBVA 4XCYB 3GO1L 3TBWA 5KS9A 5D2LF 1KLUA 2VDQL 3MV8A 3WLBB 3WJLA 2Y5TA 4AH2B 4K7PH 2DKMA 3QUYB 4JY5L 1TVHB 3HMXA 2V7NA 1TDQA 4GW5A 2P5WD 3O2DA 1FVEA 5I19H 3W0WD 5L2KD 5IFAH 3QNZA 5DD3L 1QEWB 4G9FD 3HZYB 4JGMA 4Y4HA 3ZSSA 1TQBB 3D3VB 4OSUL 4RMTA 3V6FA 3L5HA 2KZ1B 3IFLL 1IQDB 4HMCA 4BM7A 2WSKA 4KQ4H 1R5IA 1YMHB 3OB0K 5IF0B 4RCAA 1DUYA 3WS3A 4WV1B 4U0QB 2F58H 2FEDD 2AK4D 1I7ZA 4TSBH 4X5LA 4NRYA 5TE4H 3QCUH 3MJ8A 3SGJA 4PY8J 1UJ3A 3UTTB 1R3IH 5D1ZD 1CZ8L 2DLTA 1I1AA 3CFDA 4JPVL 3RZCA 1Z2KA 1HIML 4OZGF 1FNSL 1MY5A 3RJQB 1F02I 2AXFA 3CPLA 3CSPA 5BXFB 1U8LA 2EDXA 4XP4H 5K9KA 3EOYG 1B6UA 4DN4L 5D7LB 2A6JA 2VN4A 3O8XD 3HNTH 1T20B 3ARBD 3CXDH 4C58B 4LLQB 1D5BA 4N8VB 5E8DL 1PKQA 1G6RA 2PR4H 1CDIA 3FCTB 1MHEB 3ZKSD 1TZGH 1VCAA 1VPOL 3QUYC 4M5YH 4XPHL 4H20L 3RWEA 4NYLB 4EIZC 4GMTL 1K6QH 3GSOB 1C5CH 2ESVE 4QT5B 3V8OA 4HD9A 2GJZA 2WINB 3BO8A 3HG1D 2GUOA 3ETBF 3KYNA 4HZLB 5FGBA 1U92B 3AM8A 4JFZL 1GSMA 1AKJB 1TQBC 4JLRB 3QIWA 2V17L 4WIQA 5TJWK 4OLZL 3C5JA 1YEEH 1CK0H 4PUBH 3PHOA 3TM6A 3OKKB 3QUZA 3FQRA 4HCRA 5AZEL 4UQ2B 1NGXB 2AABL 1MLCB 1U8HB 4U1SB 1KEMH 4P99A 3X3FL 2A9NL 3MRNA 1N26A 3C08L 3HAEA 4WV1C 4YE4L 5CGTA 5F7MC 1KGCD 4W4OC 3PGDB 5AYUH 5IB1A 1FJ1A 4JG1L 3QFJA 5DJ0A 4AM0B 5C71A 4NN7B 1ZEAH 4NQCB 1WBYA 1A4JB 1I3GL 2HLAA 4HT1L 2W1NA 3TPKA 1MHPL 7FABH 1S9YB 2Q3ZA 5EBMA 5CKAA 1KB9J 5GGSA 2GYSA 4L8DA 3VXSE 4JM4L 5C6WH 4M1CC 4PJ8D 2JKXA 2VJXA 1UYWH 4FQXA 2VAAA 2FIKB 5K59F 4YHKH 4MSWB 1AR2A 1MVUA 2D4DA 4R4BB 1FN4B 1G1YA 1RUAH 4U6XA 4TYUA 4OLVH 5C7XL 2I60H 4PY7B 2IPUG 1U8OA 3MFFB 2NW2A 2B4CL 3O4LA 1R24B 4G6AC 8FABA 3RPKA 1OARH 4JGUA 3QUMH 5FFLA 2VXSH 5L88H 3SCMA 1U8NB 4OD1H 4TOYH 3GHBH 3CSGA 3PG2A 2P7TA 3SE3C 3B9VA 4XNQB 4GAYB 1U0QA 4X6DE 2Q76B 5E7BA 3RWHB 1GZQB 1AGFA 5A2LH 3LS4L 4GSDL 4X5XB 3C5ZA 1U58B 1SJHA 4B5EA 1D6EB 2FIRT 4UILH 2Z92B 1IFHL 2VLRE 1ES0A 1N64H 3KLSA 3QQ9D 3B3IA 4J12A 4YFLI 2VUYA 4NN7C 3L6FB 4W81A 1NLDH 5EO9A 3MRFA 2NX5B 2NXYD 5EIVA 2OYPA 4Z7UF 2FH6A 5F7DB 3IVKA 2EDLA 2G5BA 3E8UH 1Z9OA 5HYFA 1ZT7A 5DMGD 4BK4A 3PV6B 3FAXA 3MRDA 1T1XB 5F1NA 4JFOA 4CW1A 1ZSDA 3IDXH 3S96B 1JUFB 4F33B 2EYTA 3ZYOA 3ARYA 3VD5A 3GMNB 4Z7QE 5AUMB 2PYED 2VITB 2H2SC 4UIKH 2BVQA 2IEPA 2GT9A 1L7TL 4AL8H 1DE4B 2XQBL 1IAIH 3SDDD 1HSAA 4KI5D 2IH1B 1F6AB 2ICWA 1RJZB 2HJLA 1F13A 1KUMA 5D2LE 1OP3H 3STLA 2NY2C 2XG5A 4UMGA 1HWGB 1IGFH 5C0FB 3ZE2F 1CF8L 4G6KH 4NO0A 3WBDA 2JK5B 5JZ7C 4PJ7B 3LEYL 3I50L 2K3TA 4GRWB 1AGEA 4KK9D 1LO2L 3QUXB 1CFVH 4YDVA 5I8OL 5FGCB 1EV2E 2SEBA 1CDCA 5HI3C 4NQDE 1RUKL 2ZCLH 4JG0H 2IADA 4JFYA 1FPTH 1BQLH 4GQPH 2HKFL 3RGHA 2ZNWA 2AJSH 3KPLB 1M7DA 2XKNB 1FG2A 5EZOL 4R8WL 4I3GA 1V7ML 1IC5L 4IMLB 4AQOA 4NM8L 1I7TA 1NL0H 2DKUA 1F90L 3SGEI 4NRZA 1F4AA 3K80A 1ZT4B 3BP7A 1UVQA 5ENWB 2XY2A 4J6RH 5LJYH 4PJIB 3ARFB 3ZE1E 4PJBF 4LRIC 5JHDE 1BM3H 3E1F1 3DARA 4CL7A 4YDIL 2DQTH 4NNXB 1FAKT 2B4CC 4CGTA 5CEYB 4KZDL 1E27B 1UT9A 3KYOB 3RVTC 2Z4QA 4WO4A 4CVZA 3HUJF 1UXWA 4WGVB 4HGMA 3JWDH 2NY5H 1IT9H 1GC1H 3LQZB 1IEHA 3H42L 2D7QA 3NCEB 2WAHA 3RP1A 4BFIB 5T3ZD 1D7FA 3BH9A 4LHUB 1A3LH 5J9PA 1X3DA 1U93B 4S1SH 5BS0D 2PO6C 4NKIL 5I15H 3QUXC 4U1HB 1K85A 1UCBH 2GK2A 4TULH 5GSVB 2QLVB 5DHVB 3UJIH 3MGTA 4HWZA 5DRXA 4P5TD 3NAAH 3QNYA 3K4AA 3TN0D 2GAZB 5HGBA 1MCWW 3FFCB 1NC2A 4H25A 5INDB 1RHHA 3FB7A 1WWBX 1Q94A 3SJVB 1HHHA 3RZWA 1IBGL 1FL3A 4Y19D 4WEBL 4XPFH 3UTQA 4PRIB 5IHZA 2AGJH 3QG6B 3L3OB 4UTAH 5MENA 2GEEA 4P23D 1BP3B 3LOWA 2CKBB 1NCBL 1T0NB 3D2UB 2WIIA 1LILA 4TSCL 1U8QA 5GGSY 3B2VL 1JJUA 1LE5A 1XIWB 4GG6F 4Z7WA 3G5VB 2FYYB 3RNKB 5HYJB 2NQCA 3WYRA 4YHOH 1OTTD 1CD1B 3N06B 3TGXA 2JTDA 2NXZB 2PCPA 4TUKH 5HI5C 3D85A 2VISA 3RA7L 1DZBA 3SDAA 1WEJH 2BZDA 4XNUH 1NAMH 3MV9A 1CE1L 1XF4A 4XPTL 4CAGA 3MJ6A 3O9WB 4RNRA 4ETYA 5IMKA 4I4WB 5JUEH 2EYRB 1P1ZB 3MROB 5DD0H 1NMBL 1RIVL 3DROB 5FHBH 3LS5L 4ODSL 4UV4H 1INQA 5CWSA 4Z0BH 2FATL 5LCVL 3U46A 5E56A 4AEHH 5IUSA 4JFQB 3CCHA 2CPCA 1JPFA 1MJ7L 2YD6A 3NACL 3HE7A 3GMQB 3GB7A 5AWNH 5GGQH 3IDUA 2H41A 1NH6A 5I16B 4Y5VB 1L0XA 1HYSC 3LKNA 5IWLA 2HKHH 2ADFH 2VLKE 2R23B 4HJJL 1C7TA 3MRLA 4AIXA 3MCKA 5LGKA 1M4KA 4GXVL 4U1GC 5I1KL 3MUJA 3SE4A 5I8EB 3CDFA 3C6LD 3PWPE 1AGDA 1F3RB 2BNRA 1E4XL 3HPJA 1FVDA 3KPRB 4I77L 4NCC2 1RY7B 2WANA 5IHLB 3BDXA 4Z7UE 5BJTB 2WUBH 1A7OH 5EOCJ 4OFYD 3LRGA 5CP3A 4KKCC 1KPVA 4F3FA 1KIRA 3ZDZF 1XR8B 1CTOA 5H8DA 4ZDHA 3DO7A 1XIWC 3D0LA 1UM5L 2Y5EA 4UV7L 2W65A 4DZ8B 4KDTA 5F1IB 1XEDA 4GG8B 4CVUA 5FECB 2F53A 1HQRA 4HQQL 3MOBL 5I1CH 2NXZC 4O5LL 4NQVB 4PR5B 4PG2A 3PWUA 3DV4A 3T1FA 4AIZA 4O58L 4L4VA 5D1ZB 5KN5A 3RHWF 3ZE2E 3O9WC 5TF0A 3VGGA 2NY3C 1VADA 1GIGH 3EYSL 3Q6GH 4GO6B 4X7EC 5IFJA 4OV5B 5F7UA 2OTPA 1I85A 1IEBA 4WCYL 4P4RA 5DK0B 4BSVA 1RUPH 3FT3B 2DWEB 4ELMF 1IZJA 4QTHA 3SDCD 5KJRL 4N0UA 2M2DA 4WUUB 5JQ6L 4ODVL 4EUPB 5EO1A 1NC4A 4RAHA 5CINH 1OF2A 4HKBA 4UQ3B 4Y5VC 1QHOA 5C3LD 3BIBX 4WI4A 1JYWA 5B8CA 5I1HL 5TF1L 4FZEH 4XWGH 3BEWA 3EHBD 4R96A 4XC3L 5TH2B 2ZCHH 4J4PA 3TT3L 4F7CB 1PY4A 2CDFA 1DANT 3V5HB 1T7XA 4D9QD 3ZTJH 1MI5D 5CIPA 4WTZA 4X7TB 1JZ5A 3HG1B 4R3SB 4LLMA 1MWAL 3FQNB 4I3SL 2H26B 5IBTH 1Y0LB 3U83A 3DGGB 2OR7A 3PWJA 2P4AB 4YFEA 4JO2H 4WU5A 5IG7B 1Q1JH 4HG4K 1F00I 3HUJE 3QPQD 3V0VB 3MRHB 4WI8A 2FEDC 2Y36H 2FHCA 1LK3H 5DK3A 4WU7A 1K4CA 4JJ5A 1XGUA 2Y7QB 2YD2A 4IRSA 5A3ID 3GMPB 4QHKJ 4QTIH 2BSTA 5D1ZC 2DB8A 4JANA 4QRRB 3CXHK 1OAUL 3RX8A 2P45B 4FP8H 1ZTXH 3EYUL 1OHQA 5ICXA 3MV01 3TA3A 4KU1A 4Q9CA 1CT8B 4MHHI 4L5FH 4NGHL 1LK2B 2GJJA 3MLPA 1NEZA 4MAUH 5EORH 1JWUA 2JCCB 3S35H 3ARBC 1XCQA 1E4XI 4M6ML 4RDQF 2I9LB 32C2A 1QSEB 5F6HJ 3QDGA 3U9UB 4F7PA 1CYGA 1MWAB 1SQ2N 4XVUD 1BVLB 1N0XL 3REVA 3GMMA 3TO4B 4X7FC 3QHZL 2DQUH 4FZ8H 3LPGA 2OP4L 3VFGH 5C9JB 4M61B 4NWUL 4X4XB 1GGCH 3DHJA 1IM9D 5F70A 3VFNB 1LMKA 2J88H 3OKDB 5C07D 2RR3A 2RCSH 1GZPB 5EU7C 3MRIB 1I8KA 1FNEB 4NQXB 3U30C 2J4WL 2Z35B 3SE8L 2AEPL 3MMEB 4IOFD 1YECH 3CC5A 3PV7A 5EO0A 1N6QH 1SVCP 2DS4A 2P1YA 4JPKL 4HK0A 1DFBH 4GG6E 1I3RB 4F15B 5HHVL 4X6CA 1NBZB 4RMQA 2R69L 2CLVA 3BYTA 1EFXA 4LEOA 1ZS8A 5L8JB 2IMNA 2DQHH 3BQUD 5F97E 4P5KA 2BRRH 2VIRB 4L8BB 4WI7A 5EPMB 3U9PH 5EU6A 3I3DA 3MLVL 5FM5O 3WKMH 4LASL 1U3HD 4I5BA 1JGDA 3VFSB 1IGYB 1WIUA 2O61A 1DP0A 2FX9H 3MJ9H 4PRHA 1UADC 4HIEA 4C59B 3VW3H 3HMWL 4DOHE 3OZ9L 4K3DH 2FJGA 4XP1H 1OPGL 2ATKB 4JY6A 3UPRB 1P84J 4ZUVA 2PYEB 1CD9B 2B1AL 4KMQA 4PJCB 5DRWB 4PJFB 3GO1H 4R7NB 3QQ4B 4JM2D 2QQKL 5EFIA 2VDQH 1K8IB 1WZ1L 3TO4C 3T2PA 4JY5H 4PJEE 2DN7A 3L3JB 5DS8A 3VD3A 1T04B 3O6FA 2DDQL 1QA9A 5DD3H 1MUJB 1YJDH 3FRPA 5EC2B 4XHQA 2XA8L 5JW4R 2Q6WB 1CICD 1UENA 4XCEA 3QDME 3QT2A 4OSUH 4KY1L 5BRZE 5KSBB 3IFLH 3P9WB 1F6LL 4X6BA 3T3ME 4DCQB 3I75A 5T3ZL 1BOYA 3O6LL 1UWEL 3KG5A 3P11L 1JNLL 3QIBD 1MRCL 5HY9A 3HR5B 1IGTB 1M71B 5D72L 4RMUA 1FO0L 1NMCB 1CZ8H 2HTLD 1J8HE 1LP9A 2JJUA 3MRMA 4JPVH 2XI9A 1HIMH 4J3TA 3MRKA 1FNSH 3P0YL 2OK0L 3WLWD 2DAVA 3H9SB 5JXEC 2D3VA 4U6HA 2HFGL 1JZ3A 1IC1A 1W72A 2FL5A 4DN4H 4OLXL 1DLHB 1M05A 1Q9KA 4F8TA 5DRNA 4QOKD 3WO3B 2YOCA 2D9QB 3BAEL 5JPNA 1LEGB 1YN7A 4LNRB 5ANMA 2A6IA 3LKPB 3S5LA 3LSOB 1VPOH 1QZ1A 1KXVC 2EKSB 2X44D 4XPHH 4H20H 5E5MA 3VXTA 5I8CB 2VDNL 4GMTH 1EX0A 2W0KA 4P46D 1ND0A 5C09A 1KULA 3AAZA 4UU9B 2EIEA 3QISA 4JFZH 1A6ZB 5JORA 2GJ6D 4MA8L 1T66D 1AJ7L 5C2BH 2V17H 5CAYB 4OLZH 4XVJL 4GBXA 5J89A 3Q0HA 3WFBL 4MCZB 3JUZA 3VXMB 5IIEB 5AZEH 3VXSD 2AABH 4WW1A 3I9GL 2CRYA 3X3FH 2A9NH 1YEFL 5BZWB 4NKOA 4YE4H 3D69A 5IQ7H 5GQBA 4JG1H 5D7JA 1NMCC 4Y4FA 1G7MA 2NTFB 4JN1L 3S9DB 3DYPA 1I3GH 3VXQB 4OZFA 3KXFA 4PRNB 1BQHG 4U1KB 3EYFA 1YNLL 4JFXB 4HT1H 4NQTA 3ARXA 1S78D 5D8JH 1MHPH 4KK5D 1GOFA 2V9RA 1P7KB 3BXNA 3UBXA 4KUZL 4C55A 3LPFA 4LGPB 3DXAB 35C8L 1YPZA 4ZFOL 4TPRL 1MHHA 2YPLA 4G7YL 2ZUSA 2HT2D 2OQJB 1B0RA 4QRPB 1CCZA 1UB6B 3SGEH 3QZWG 5IW3A 1JP5A 3T8XB 3VGDA 3PHQA 5DXWA 1DTUA 3QEQB 4HJ0D 4TNWK 5C7XH 5F93C 5HGHB 4L9LA 5JNYB 4OI7A 3DWTA 5CD5C 1BD2E 1QQDA 2VLRD 1OM3L 2B4CH 4HW6A 3UZEA 5IVXA 5C0CE 1TNNA 5DI8A 3GMRB 1WF5A 4NKMA 5DYOB 3V5KA 2HVKB 3H3KA 4RSVA 3X11A 5D5MA 1LE9B 3CUPB 3EOBA 2X89D 3PQYA 5FO7A 1BVZA 2R2BA 4L4JA 3SEPA 1EAPA 1D5IL 3LS4H 4GSDH 5D7IA 2VDPL 5SX5H 3TBSA 5T1KD 5E7FA 1IFHH 4KVCL 3R06A 3IKCB 1DBJL 1ZA3B 3D39A 2VKWA 3QO0B 2RFXA 3BDBA 3GRWL 2ARJA 3DI2B 4KK8D 2G60L 4JPIB 3MRRB 4XP9H 1JTTA 4OCRH 2UUDH 1NFKA 4PJGB 2IPKB 5HI4C 3HZKB 1PX4A 2IC2A 4L4TA 5GHWL 4HV8B 4OD3L 3NBNA 3GSQA 1KNOA 1XF2A 1PQZA 2V6HA 4EXPX 4NQDD 4Q6IA 1L7TH 2XQBH 3RPIA 2OZ4L 4HFWB 1FFNA 3UTSE 4JVUA 3QXTA 3QDJE 5E4IA 3VE0B 3KHQA 3G9AB 5DRZA 4JPWL 1CF8H 1D6VL 3ARVA 4MGXA 4R4NC 5ISZD 3LEYH 2X7LB 5EUOF 2PW2B 2WMPA 1LO2H 1YEGH 3QUMA 5I8OH 3W5NA 2P47B 5FA4A 2P5EA 1RUKH 3G5ZB 3IDIB 1KTLA 2KUTA 5JHDD 1ROWA 5E6IB 2DL2A 3N9GL 3QA3B 5DJ8A 4GKSA 4HGKC 5HGDB 3EYVA 2HKFH 4IDJL 1E0OB 1T03L 4M3KB 3RWFA 5DLML 3EJZD 4NPYA 1QR1B 4PB0L 5DHVH 3HZVA 4LQFL 3MV7D 5EZOH 4R8WH 1V7MH 1IC5H 4NM8H 4O51B 4IIQB 5DJAB 3TIDA 2F54B 1ZHKA 5FM4A 3GGWB 1MCRA 1S9WA 3QCTL 4R7DB 4TTDC 4KDWA 4WWID 1F90H 4JN2A 1UWGL 3MRQB 2YXMA 4KV5F 4QRQA 2P8MA 1RJYA 3QNXB 3HNVL 4YDIH 3BHBB 1T1WB 4KZDH 2CRZA 3HCVA 2JIXD 4NKQB 2ED7A 1FZKA 4LPUA 5C0ND 4MDIB 1K3ZA 2QHRL 3IU3A 3GSRA 4JQVA 5H37G 3TBYB 3H42H 4UOW0 2GK0A 4JHAL 5HJ3A 1IQWL 1RQ5A 1I3VA 2GITB 4QKXB 2R1XA 5TE6L 3U0PB 4Y1AA 4LKXA 4NKIH 4MNQE 1V8HA 1KB9K 3KS0J 3BPLB 3VJ6A 1QBLL 2VZ3A 3TLRA 3O3UN 3KLAB 3HC0B 3MXWL 5F3HB 5K9QG 5E6IC 2NLJB 3MA7A 5FXCH 1REIA 1LO4L 2FX7L 1A1NB 3FO2B 5FM5M 2A83B 2OX5A 2VL5A 1IBGH 1MEXL 3UC0L 3B6SA 2XT1B 4WEBH 3EHBC 4IIQC 1IM9B 1WISA 1Z9MA 2AJVL 4KMLB 4XTRD 3WNNA 3UJJL 4HX1A 1O0VA 1NCBH 3I3BA 4WTWA 5GGRA 1Z9LA 3OKYA 4G3YL 4OFIA 3W5MA 4TSCH 3ET9F 1EEQA 3B2VH 1XF1A 5FAAA 5L9DL 1BFTA 2EXWD 4TUJB 3IJSA 5IQ9B 5SWZE 4GW4A 4PRAB 3ZKMD 3T0EE 3D5OF 3MLUL 4NT6A 1VDGA 4K3HA 3RA7H 2VLKD 5F3BA 1J9CT 3MSPA 4RFEA 3LVEA 4JJHA 2VQ1B 1CE1H 1H8OA 5LG1A 4XPTH 1HH9B 2B2XL 4QGYA 3L3IB 1CR9L 1YDPB 3PWPD 4MAYB 2YN3A 1C12B 4NQEB 2X4OB 1QRNB 1NMBH 2X4PA 1RIVH 2E6QA 2JJSA 4ODSH 1KN4L 1J1XL 4H1LG 4DZBB 2FATH 5LCVH 3DECA 3RVUD 1AHWA 1WAAE 1MJ7H 2OBGA 3NACH 3QXAB 4HUVA 1H3PL 1U95A 1XF3A 1FZOA 4B41A 5IEKB 4HJJH 4JM2B 4X80L 5IBUG 1IILE 5I1KH 1N0LA 2AAVA 3ULVC 1I4FA 4EUPH 3OJMB 3V7MA 4MX7A 2OSLB 2X70B 4BQBA 1E4XH 1P2CB 5EBLB 5SWSE 2HJKA 4I77H 3LRSA 5C0AE 4C4KT 2I27N 4HDIB 5CILL 1AC0A 4LVHB 5MHSE 1CXIA 1Y6MR 1JWSB 3FO0L 4WHTA 3ZDXF 2J5LB 1UM5H 3B8SA 3KWWA 4UV7H 3FOMB 4X4YB 1LO3L 3KPQA 4PTUB 3MLXL 3VRIB 4DAGL 5E8NB 1G7PA 1VACB 1H8SA 4LCIL 4PJXF 4HQQH 3MOBH 5INCB 3Q5TA 4O5LH 3WN5B 3GSXB 1H5BA 1NGZB 4JO4L 4AEFA 4YEEA 2C7UB 2B8OT 4O58H 4RDQG 3UAJD 5IW6A 3C6SB 3UJTL 4N0FB 3H3PL 1NFIB 3HA0A 3WJJC 3IETB 4FQPA 2A73A 2XWJB 4MAYC 1BZ7B 4MD5A 4P57A 3UYRL 3EYSH 2VZVA 2OL3B 2EIZA 2ESVB 5HDBF 3K1KC 5I1EL 4LLDB 4WCYH 2Q7YA 3MJ7B 4MJ2A 4PV8A 2P48B 5KJRH 2HFFA 5JQ6H 4ODVH 3RU8L 5AD0B 1SYVA 1OP5H 5DC4B 4JHWL 1BX2A 1CGVA 5FO9B 2JJVA 4OZ4A 1K2DB 5A16B 4JM2C 5HTSA 5FDYA 2FZ3B 4NO2A 2H6PA 3C60D 5I1HH 3WFHA 4XC3H 3TT3H 4JCLA 1IKFL 3QFDB 1YY8B 4LCWA 4O2EB 3BWAA 4P2OB 1MCQA 1MWAH 4RQQB 4I3SH 4LVHC 1CICC 3D25A 3NIDF 4JFFE 4KV5E 2J5LC 2YBRB 3DX6B 4D0CB 3T65B 3VXSB 1EXUB 4J3WA 1BECA 3VXRE 3MODL 1XR9B 4NC2B 5GIRB 4WVRA 1WWWX 2AJZB 3WN5C 3VWKA 4ZMAT 3V95A 2DYPB 3HI1B 2BVUA 4QHLB 1A2YB 2LU3A 2GY7B 4KJYB 1FFRA 4QF1B 5JO5A 4KJWD 3KLDA 1T7YA 3VFTB 1TIUA 2C1PA 4LLYB 4PV9A 3EYUH 3S36X 3WLWC 1WIOA 4X99B 2PYFA 5HHNA 1Z5LB 1XGRB 1AD0B 5B3JF 4NGHH 2WBKA 3TO2B 3RVWD 4RAUB 4F8QA 4HKXB 5E2UL 5KS9F 1K9TA 4M6MH 1JN6A 4X6DB 3ROOA 1P7QD 4NO5B 3LY6A 3LKOA 2VO5A 1N0XH 4F2MA 3RTQA 4PJ9B 3QHZH 5DT1H 5IMLB 1VGKB 1FG9C 2OP4H 3IDGB 4NWUH 2EKJA 2QKIB 2K7PA 1HHJA 1QSFE 1HEZA 4MJ4A 2DBLH 1AGBA 5EWIL 1KIQB 2J4WH 5GGRY 3SE8H 2AEPH 4P2OC 4GJTB 5HHOE 3GKWL 3D87B 3F7VB 4U1LB 4JPKH 2OXGA 3QAZB 1YMMB 1AXSB 1WC7A 1MHCB 4HC1A 4OI9A 5HHVH 1WGOA 1YEIL 4I3RL 4HIIB 1MCFA 2MHAA 1A7QL 1ZA6A 2R69H 1NDMB 4F9PC 3KJ4B 3P4NA 4RRPA 3BZ4A 4OB5H 2BSRA 4FQQA 2PUQT 4XNMA 3SKNB 5E0QA 4GXUM 3FB5A 3RWDB 3MLVH 1CI5A 4LASH 1QFHA 1LWRA 3BD5A 4RZCB 5I1AB 1JZ6A 3OXSB 1H15A 2YN5A 4DGVL 1S78C 2EXYD 4C56E 3HMWH 4PREA 4YZFF 3OZ9H 4I2XB 2CJUL 3QDMD 5K9OA 5BRZD 1QLRA 4DVBB 2R1YA 3G5XA 1J5OL 3MUZ1 3SN6N 1RU9L 1OPGH 2NY6D 2B1AH 2HT2C 4OF8A 4XHJC 4PJAA 4DQOL 2QQKH 1J11A 3ARDD 1AQDA 1IC7L 2WLZA 4MJ6B 1WZ1H 4OGAC 4H0HB 1C08A 4PJ9C 4HJ0C 3MLZL 2XTJE 3WL9A 5FYKE 1S7RB 3CZFB 1YEHL 4GRMA 3PXHA 2ZOKB 2DDQH 1RZGB 3JZ7A 1J8HD 2XA8H 4JY4A 1DLFL 4LVEA 4Z95L 4ODUB 4KY1H 3C8KB 3WLBA 2XOTA 5GRWA 3A6CL 4AH2A 3OXRB 3QUYA 3W2DL 3QAZC 3D1MC 1MIML 5E5UB 2HG5B 2Z31B 2HT4C 5T3ZH 5FB8B 3O6LH 1X44A 3JWOL 3WIHL 5LGJB 1MCKA 1UWEH 1AE6L 3RKDD 3UX9B 1FNLA 3KJ4C 3MR9B 1QEWA 3P11H 1JNLH 1H3TA 3P0VH 3HZYA 1MRCH 1U6AL 5DQJB 4LCYA 3NCBB 5DR5L 1FO0H 2OLDA 3D3VA 5SX5K 1NBYB 1RJLA 1IQDA 3P0YH 2OK0H 3UP1A 1MF2L 2IANA 5E1AB 3B5GA 2HFGH 3LH2L 1YMHA 5IF0A 3QRGL 2AJYH 1XAUA 4WV1A 4OLXH 2XG4A 3DYMA 3QUKB 4H0IA 2X9WA 5F8QC 4NOFA 2UUDK 1B4JL 3HPLB 2FJFA 3BAEH 4PBXA 3OGCB 1AD9B 1PLGL 3ZZ1A 3VDAA 1X4ZA 1MFAL 1EJOL 5BXFA 3CFJB 3VFMB 1NAKL 4J8RA 2VDNH 4WFGE 5JW4N 4DVRL 5D7LA 2KQMA 4U7MA 4AJ0A 5HHME 1QNZL 2UZYB 1T20A 1N59A 1IEAB 4LLQA 4X7SL 1V5JA 1OSPL 3WUZA 4N8VA 4NCC1 4MA8H 1FL5B 1AJ7H 3FCTA 4GMSL 4PRBB 4XVJH 3WFBH 3AS3A 5DD5L 3OJ2C 1RZ8B 4I18A 2Z31C 4NYLA 3GSOA 1INDL 4IHOB 3X17A 4PB9L 3I9GH 5GJTL 5J56B 4QT5A 2WINA 1YEFH 4YHNA 4CNIB 3BYYA 4HZLA 1U92A 4M8VA 4A6YL 1AKJA 1J8KA 1I1YB 4JLRA 4OFPA 2M1KA 3SE3A 4JN1H 3QNZB 5KVEL 3MUHL 1S9XB 3PGCB 3OKKA 1BD2D 1YNLH 1OGAE 1UKQA 1MLCA 4U1SA 1F5WA 1EO8L 4KUZH 2IQ9L 5B3JE 3PGDA 35C8H 5BMFL 4TPRH 5DEFB 1I7UA 1B0WA 5I0ZA 4G7YH 1G9MC 5KS9E 4IS6B 4NQCA 3UTPE 1A4JA 3MV8E 3S3SA 1I7ZB 5J06A 3HI5L 1LQSR 1UJ3B 1T5XB 5DJZB 3ZE0F 2VLKB 5C0NC 1S9YA 3RZCB 1WICA 1QBML 4ZOCA 1OM3H 3GJFB 3SQOL 3NGBB 1QFWM 2FBOJ 3PWPB 3Q5OA 5GGTL 3EIFA 2AXFB 4Q9BA 4APQD 2FIKA 4P2QB 4MSWA 3QSKB 4FQIL 1ZHNB 4R4BA 1CFSB 4NCDA 1G9NL 1FN4A 2V5RA 3ARTA 4KKAD 2O5XL 5CEXA 4ACPA 4PY7A 1YNKL 1P84K 4CBPA 3ZYJA 1R0AL 3MFFA 2ADJB 1R24A 4AG4L 1NGPL 3QHFL 4GAGL 2W9DL 2HVJB 4PIRF 4WEMB 3IAPA 1RUML 1U8NA 4KVCH 2W91A 4Z76B 3UTSD 4J7RA 1DBJH 3QDJD 5SV3A 2JJWA 4XNQA 3L3GB 3GRWH 5L2JB 3BO8B 5ESQB 2G60H 3O3AA 3SPVB 3AFLA 4E41D 2N4IA 3EFFB 4XTRC 2QR0B 4PJ5D 1KPRB 3OKNB 5BV7L 4ZAKD 4X5XA 3BGMB 1U58A 5CBEB 4ERSL 5C0BE 1D6EA 1DQQB 2Z92A 5GHWH 3FQRB 4OD3H 4PJHE 1PKQE 3L6FA 1ONQA 4OCWL 2D31B 4BUHA 2NX5A 3ZKMC 3QZWB 2OZ4H 5F7DA 3WXVL 1D3CA 5DJ0B 3PV6A 2ZUXA 1T1XA 4EQ2A 1WBYB 4JPWH 5J12B 1G0DA 3S96A 1D6VH 1B4RA 4LRIA 1JUFA 1CLOL 4F33A 2DIJA 2XWBB 4WWKB 3GMNA 5AUMA 2EDOA 2VITA 4P49A 5EBMB 5CEZE 4NC1E 4RMRA 1DE4A 1EMTL 4P9HL 2IH1A 1HILB 1F6AA 1MFNA 1RJZA 3RVUC 5DA4A 4IM8A 5C0FA 4Y88A 3AS1A 1MNUL 1RAMA 2UY6A 3N9GH 2V2TB 1GPOL 1QHPA 3GIVB 3OF6A 2E6PA 5J11B 4IDJH 1T03H 5DLMH 3WIIL 5BV7B 3QFJE 4PJ7A 2FX8L 4PB0H 2LVEA 1U8OB 2PO6A 1FFPB 3QUXA 4LQFH 3C60B 3FTGA 3VDCA 2COQA 4OT1L 4NFBA 1C5DB 5GISL 3THML 3BRDA 2G5RA 3QCTH 2P7TB 4Z7WF 1J1OL 4WFFE 1UWGH 4EDWL 4OF7A 2QQLL 1QBAA 3KLHD 4M62L 4MNQD 3KPLA 2FJHB 3RWGA 2R2CA 3HNVH 5JIIA 3F6LA 1MFBL 3F6IA 1A6PA 1SJHB 4KROB 4JQXC 3MGOB 4JQIL 4P2CG 4TUOB 4PJDF 3MQIA 2YA2A 1JPGB 2RBLA 1ZT4A 2QHRH 2UWEB 5EO9B 5ENWA 3MRFB 5F72S 4NIKB 3SDXE 4IBLT 3X14B 5J12C 4PJIA 3OKMB 2FR4A 2BERA 4JHAH 1IQWH 1FGNL 4WWKC 4NNXA 3IT8D 1Y6KR 1FV1A 1OTSD 3GHEL 5CEYA 1E27A 5TE6H 2HLFC 3KYOA 3PUCA 3QG7L 5EU3A 4CW1B 5SV4A 3ZT7A 1I9EA 1QBLH 4WHYH 3ZO0A 3IJHA 2J3SA 3ULUE 1DL7L 3MXWH 2GT9B 3LQZA 1YY9C 2ICWB 4BFIA 4GG6B 1A1MB 5J11C 4LHUA 1LO4H 2FX7H 4P3CH 2HMID 5BV7C 4XC1L 1U93A 4U1HA 1OP5K 3KDMB 1BAFH 1MEXH 3C60C 3DUUB 4XPAL 3UC0H 5GSVA 5DHVA 3MYZA 4LVOB 2AJVH 4YDLB 4FOMA 3VMPA 4CRPA 5C08E 3UJJH 3LV3B 1B2WL 3FFCA 4P9ML 2DM3A 3DJ9A 1JHTB 3SJVA 5L9DH 1U8PB 1UM6L 4FQCL 1XGYL 4PRIA 1U8JB 3GMLB 2AK1L 4KROC 3QG6A 3L3OA 3CMGA 4LDEB 3MLUH 3T0XA 4YXLL 3FONA 1T0NA 4P9HC 1SYSB 1M7XA 3TCXA 3D2UA 4K3EL 1XIWA 2B2XH 3WFZA 4PJEB 1CR9H 3G5VA 3QEUB 2FYYA 4MD0B 3RNKA 5J4MA 1CD1A 4K8RC 3RKPA 5C0AD 3F58L 1KN4H 1J1XH 2V2XA 1KCKA 4JKWA 3ZHKA 5MHSD 1UH4A 5JOFB 5BRZB 2Z4QB 3C2AL 2XY1A 1H3PH 2Y06L 2YD4A 3O9WA 4WFHD 1SVZA 3ALWA 1J86A 4I4WA 1OTUD 4HWUA 1P1ZA 3MROA 4X80H 4KJQD 3VWJD 5I1JL 3DROA 1NDGB 5TE7L 4PG9B 5DO2C 5JXAL 1HINL 1SJXA 1JBJA 3BX7C 4GRLA 4FTVE 1MCOH 1CFNB 1U3YA 2NTSP 5KANI 5FUCE 4LVOC 1I9JL 5HPOA 4JFQA 4YDLC 2GIYA 3VGAB 3GMQA 1U91B 3U0WL 5CILH 5I16A 5L7XL 4Y5VA 4P2RD 3FO0H 5BQ7A 1M1SA 3OR7B 5I8EA 1LO3H 1Z3GL 3VMNA 2KPNA 3MLXH 4MVBD 5FF6B 4DAGH 1ED3B 4NJAL 4LCIH 2APTA 5F71A 1IARB 1MLBA 2JE8A 2EH8L 3V5DB 2HH0L 1HHHB 3G08B 3ES6B 2CXGA 5BJTA 2QSCL 1QSZA 3T4YB 4Q97A 5IHZB 1MY7A 3UJTH 2OM5A 1XR8A 3H3PH 4LPCA 1X4XA 1J0KA 3WDHA 2GTWB 3RWIA 4DZ8A 3UYRH 1EHLL 3UXFA 3OPZL 4GG8A 5FECA 1LDSA 4H1LB 5DWUL 5I1EH 1JVKA 3OJVC 2EXYC 1GHFL 1CD8A 4NQVA 5K9QI 4Z9KB 4JFFD 3RU8H 1F11B 2XZZA 5D1ZA 4YHML 3V52L 2AQ2A 4BA8A 2BJML 3LN9A 1INEL 2DI8A 5IBUB 3ISWA 4OV5A 1RZFL 3VXRD 2VRAA 5T5FH 1L4IA 3BSZL 4KQ3L 5FDWA 5DK0A 4DUVA 3FT3A 4NZUL 2DWEA 1IKFH 4WUUA 4EUPA 1KLFA 3ARBA 3VGAC 5DFWH 3ROLB 4UQ3A 3A6OA 3ARED 2EH7L 3S88L 3BESR 4X98B 1BJ1J 1FSKB 1P6AB 4ZQKA 5TH2A 5B3NA 4DWHA 2BOCB 3MRLB 3H9ZA 3MCKB 1OP9A 3MODH 1ZLSL 3V5HA 3RKDC 2BCKB 3HG1A 1KTDB 3K8MA 2BX5A 4PJDE 4IOIB 4L3EE 3FQNA 2H26A 1FVDB 1ORSB 1Y0LA 1P4IH 3OAYK 4M93B 1D9KD 1EK3A 4N1HB 2FO1A 3NN8A 3DGGA 5F7LB 1QSFD 1BD2B 3DVFA 5IG7A 3BPOB 5C0CB 1SY6L 3M8OL 5C0EB 2CQVA 3D0LB 2W65B 3V0VA 3MRHA 3STBA 5HHOD 2ADIB 5E2TL 3BH8B 4Y2OA 5FYJE 3VGEA 5ELIA 5E2UH 2Y7QA 3SO5A 1ZLWH 1QG3A 4QRRA 5TDNB 2ZUTA 4AIZB 5GS0C 1PZUB 4L4VB 3CDCA 1CT8A 2ZJSL 2DMKA 1LK2A 1YEJL 5ALBL 5EWIH 2MPAH 2JCCA 2CRMA 5GS1B 1IEBB 1AQKL 3UYPA 3VFPB 3GSNL 1AXTL 1QSEA 3GKWH 4QYOB 3K81A 4OKDA 1MWAA 4U1NB 5KVDL 1BVLA 4C56D 3TO4A 4PYGA 2ICWJ 5C9JA 3TVMD 4M61A 4X4XA 1FSKC 2Z0BA 3FN9A 1V05A 1YEIH 4I3RH 1A7QH 3OKDA 3VFNA 4MQXD 1GZPA 3MRIA 1KXQE 4NQXA 3C5SB 5JIKA 2Z35A 4PGJA 1B3JA 3MMEA 2MFNA 2GCYB 2NY0B 2QQQA 4M93C 3T09A 4QXGL 5EIQA 2XTJD 1JK8A 5FYKD 1I3RA 3BPOC 4DGVH 5D1XD 1NBZA 4ZAKB 4GAJL 4HULB 2Y07L 3MLTB 3PNWA 1DN2A 1MVFA 4NZDA 3PHSA 3L1OL 2VXVL 4KDTC 4F7MB 2CJUH 2UV3A 4XPGL 3NFPB 2VIRA 1J5OH 1R3KB 1RU9H 4L8BA 5I1GL 5EPMA 4JKMA 1BFSA 1P4LA 1T89C 4DQOH 3VFSA 1IGYA 1IC7H 1NKOA 3RIAF 2BVEA 5DURB 4JJ5B 5JXEA 4UNUA 3HRZB 1DN0A 1YEHH 3BPCB 4LCCC 4RIRB 3U2SA 3HE6D 5GS1C 2EDRA 3UPRA 2ATKA 4YHZL 1DLFH 2PYEA 4PJCA 4Z95H 4PJFA 4R7NA 1VFBB 3GBML 5BZDA 3QQ4A 3OAUL 1IAMA 1K8IA 4ZXBB 3A6CH 5B38A 3CDYA 3W2DH 4KKAC 1EBAA 1MIMH 3U4EB 3DBXB 2HJFB 3L3JA 4I13B 4FFZL 1GGBL 3JWOH 1RULL 1T04A 3WIHH 2IPUK 4F7PB 1AE6H 5I1IL 3WHE0 1PDKA 1S7SB 5JW4M 2EDBA 1MUJA 1QVOB 3MNWB 1U6AH 1DQLL 2Q6WA 2ZUQB 3CVHB 5DR5H 1NLBL 1FAIL 3JV6B 3TNMB 2NY0C 2Q8AL 5KSBA 4M1DL 1KB5L 4DCQA 1X5ZA 4KPHL 4AK1A 4ONGL 4WFGD 4HIJB 1OWWA 3F8UB 5HHMD 3UDWC 5CZVL 3LH2H 4ZAKC 2L4OA 3QRGH 2Q20A 4ZPVB 5I74B 2I25N 3ZMRA 3HR5A 1IGTA 2E9BA 1M71A 4GLRI 4X6CB 4ODWB 1VFAA 1B4JH 3MRBB 3VXUB 4HUWB 2X41A 1PLGH 3BUYB 5IVXF 4YDKL 3H9SA 3W9DA 1EJOH 4FQ1L 3W9EA 1NAKH 1JPTL 2W0FB 4DVRH 1DLHA 1L7IL 2AJ3B 2NR6D 5DUPL 1O7SA 1QNZH 5D5MF 4P2YA 1KELL 4X7SH 2VDML 1OSPH 1H3GA 3RWCB 1LEGA 1S7WB 4XCCL 3WFCL 4LNRA 4EVNB 2A6DB 3ESUF 3LSOA 4GMSH 2FJGB 1A4KB 4ZXBC 3NFSL 2C9AA 3V0AC 5D7IF 5DD5H 4CADB 2EKSA 4Z77B 2L7UA 3KPSE 3X12B 2DQJL 4N90E 5I8CA 1N6UA 1RFDH 1INDH 1PEWA 4TVSa 4C83B 4PB9H 6CGTA 4HIHB 5GJTH 4XNZB 5SWZB 3RUGE 3UTPD 3MV8D 5DS8B 4UU9A 2EZ0D 3T0EB 4A6YH 2ZUQC 5IW1B 4IRZL 5BS0A 1A6ZA 1KF9B 4Q58C 1QA9B 5KVEH 4FQ2L 2D7TL 5IOPA 4OZHE 4MCZA 3K8KA 1K4DB 3MYJA 5IIEA 4AQ1B 4RGNB 5GRYA 4Y4HD 2BMKB 1F4XL 1PG7L 3OKLB 1EO8H 5BZWA 1KCLA 2IQ9H 2W9LA 5DZOA 2QEJA 5I74C 3BVNB 5BMFH 2CUIA 3CSBA 2VOTA 3AS2A 2NTFA 2VKXA 3P2TA 4Z7VB 1OL0A 3VXQA 4PRNA 2FSEB 4U1KA 3HI5H 4P23A 4YBQC 2RAMA 2QSVA 1S7UA 1LP9B 1KACB 1P7KA 1DEDA 1QBMH 3IB4A 2MCPL 3SQOH 1I1AD 4JRXB 3DXAA 2J6EL 4UT9L 4FHBD 5GGTH 5TDPB 3V0WL 2OQJA 5SWSB 5HGAA 4QRPA 1UB6A 4FQIH 2P5WE 2C3VB 3T8XA 3W0WE 2YRPA 5TE4L 4OD2B 1G9NH 3BKCL 2O5XH 3QEQA 1KYOJ 2GSIA 5HGHA 4G9FE 1YNKH 5JNYA 5FK9A 2V7HB 1R0AH 1JV5A 3B4NA 4X83A 2Q1EA 4AG4H 1NGPH 4ETQB 3QHFH 2VC2L 4GAGH 4TQEL 2W9DH 2PF6A 3GMRA 1RI8A 1RUMH 1URLA 3ILQD 3T0EC 3BZDA 3CUPA 4BQCA 1I8LC 4ZSOE 4PLKD 4DKDC 2VWEE 2AV1B 3I6KB 2QQNL 3MZGB 5BV7H 2PR4L 3DNKA 2E8ZA 5CLTA 1PX3A 3UPCA 5CEZD 4D9LL 4Y16D 3DI3B 3FFDB 1QSVA 4Z6AT 2YD7A 4B50A 3S4SG 3IKCA 2X4UB 3QUZD 1ZA3A 4BFEA 1VKXB 1F3DH 4OCWH 1CU4L 3QO0A 4PD4K 3N1PC 2P8LA 4JPIA 3WXVH 4AZ8A 2CO6B 3LQAL 2MWCA 1ZKAA 1N2RB 4PJGA 3QFJD 2IPKA 1KT2A 3HZKA 3KXFB 5DDHA 4HUMB 3EYFB 1CLOH 3FB6A 5HGGS 2B0SL 3EO0B 3IYLW 1LO0L 1FIGL 1EMTH 4P9HH 4HFWA 5AYUL 4DKEL 1YPZB 5HHPB 1MHHB 4WFFD 3VE0A 3MBXL 1CVSC 3INUL 1MNUH 3RGVB 3ARPA 2MQ0A 1GPOH 3PHQB 2IALA 2HN7B 3IS0X 4U0RB 3H7LA 3IFOB 3WIIH 2FX8H 5ACLA 5KVFL 2X7LA 4NJ9L 2PW2A 1HSBB 4U3XA 3VWJC 4L29A 3S36L 2IG2L 4OT1H 5IBLC 2DQFB 4HLJA 5GISH 3THMH 3ARGB 2FDBP 1YEKL 4MS8C 4NKMB 3SDCA 2HTKC 4YHKL 3G5ZA 5T1LD 5E6IA 3SCMD 3RL2A 4NP4L 1J1OH 2P49B 3QA3A 4MA1B 5HGDA 4EDWH 1RUAL 2QQLH 4M62H 1BVKA 1EAPB 1QR1A 5EBGA 2QADD 4NBZB 4TNWF 1BQSA 4R6UA 4RAVB 4C57C 4ZS6D 3ULUD 4S1RH 1MFBH 4MVBC 4O51A 3V4UL 3H9HB 4IIQA 5DJAA 4ZYKA 2F54A 2AEIT 4NUJA 3GGWA 4JQIH 3VFUB 4R7DA 2NY1B 4TOYL 4S10A 5MEQA 3C09B 5A2JH 3MRQA 2FLRT 4MB3A 4MJIE 3H2WA 2PW1B 5BO1L 1MPAL 3QNXA 1FGNH 1MFDL 1NPUA 3BHBA 3CLEH 4XI5D 1ZVSB 1T1WA 1MCLA 3GHEH 3VA6A 3QG7H 1FYTE 1WZMA 3BJ91 1V3MA 4LMQI 4RBPH 5C08D 5JPMB 5I8KL 4EDXA 5DVNA 2X1XR 3QWOB 4GW1B 1KNOB 2FH8A 3VFVB 5E9DE 4MDIA 4J1UB 1DL7H 1NLDL 2BNQB 1QTYT 5D7IE 5C0RL 5FYKL 3RGVC 3REWB 3TBYA 4LF3B 1QKZL 4YPGB 5DFVD 2ZKHL 2GITA 1Q0YL 2YC1A 4U0RC 2D0FA 5C86A 4LL9A 4XC1H 2X42A 3U0PA 1K8DB 4IRJB 4ZUUB 3T77B 4XPAH 5FUZL 3WHXB 3KLAA 3ARGC 5AG9A 4KKLD 4NO0D 3VRLF 3HC0A 4X5WB 5FM8A 1B6DA 2NLJA 4LARL 4Y8DC 4OV6F 4MA1C 1B2WH 1RZ7L 2YD8A 4POUB 3U36A 1HYRC 3FRUB 4OIBA 3TBTB 4P9MH 1A1NA 4ZUTB 2IWGA 1CXHA 2A83A 4EEEA 3K2UL 4YK4B 1NGWB 4QXTB 3VH8G 1QFWL 1UM6H 1NEZG 4FQCH 4UBDD 1XGYH 4GKSB 1FLTX 4KKBD 1IM9A 4O4YL 2AK1H 4L1DA 3WDIA 4ZFGL 4PRDB 1T1YB 4YXLH 2NY1C 3CX2A 1MJJB 3C09C 1ZLUK 4J3SA 3TIDB 4XMLL 2EE3A 5DVOA 4K3EH 1S9WB 2R2EB 4KI5E 4FTVD 4QGTA 3KGRA 5IQ9A 1S7VB 3G6JE 3F58H 2G9HB 4K71B 1HI6B 2WK2A 5J13B 4V1DE 4QO1A 5IB2B 2VQ1A 1KJ2L 2VLJE 3C2AH 1HH9A 2I24N 5D6DC 1FZKB 5EUKB 3WJJA 2Y06H 4CDHA 2J8UE 3L3IA 1YDPA 4MAYA 1C12A 3LKQB 3B9EA 4RWYL 2D2OA 1QD0A 5CSZB 3QI9D 2OCFD 2X4OA 4OF5A 5I1JH 2EC8A 1EERB 5TE7H 4IRJC 4DKFL 5JXAH 5DMIL 1HINH 5GS2D 4DZBA 4LSTL 1I9JH 2VQTA 4QHMB 4OTXL 5FA3B 3QXAA 1N3NB 4PTTA 3U0WH 5L7XH 1U2CA 2VZOA 2DM7A 5IEKA 3GUTA 5DVLA 2KZWA 4JM2A 3OKOB 4YK4C 2BVPB 5H35B 1Z3GH 4U1MA 4FQLL 1OLLA 2OSLA 4NJAH 2X70A 1EO7A 5EBLA 1P2CA 3ECBB 3LKRB 1GRWA 4XCFL 2EH8H 2HH0H 3LEXB 4PRPE 2QSCH 2XQYG 4HDIA 3MXVL 1CICA 4LSVL 4I0PB 4I8DA 1JWSA 2B5IB 3B9AA 1R5WA 5IR1B 4XWOD 1UWXH 1X5KA 4X4YA 3FOMA 3CGTA 3L7FB 1QYGL 3CSYB 4PTUA 5MEND 3VRIA 1T21B 1EHLH 4Q2ZB 4BUGA 5E8NA 1VACA 5DWUH 4KJPD 4HG4J 4XP5L 1JZ8A 1GHFH 5INCA 3JSSA 4M6NL 4K71C 3WN5A 3GSXA 5J13C 1NGZA 3TJHD 3DPBA 5T3ZE 3P4OB 2C7UA 4YNYA 3C6SA 4N0FA 1NFIA 3MZTA 4YHMH 1X5HA 5BOZG 3IETA 3V52H 3CXHJ 4OKVB 1BZ7A 1MSPA 2BJMH 3KYAA 4WJ5B 5F3BB 1INEH 2OL3A 3D85D 3IFPB 1RZFH 2ESVA 3IGAB 1HHIB 3SDAD 3IKKA 4HS8L 4LFHG 4KKNA 4LLDA 3MJ7A 3BSZH 4KQ3H 4ENED 5IFHL 5D70L 4NZUH 1QFWI 4NBXB 4EN3B 5MEPA 1A7RL 4YHOL 5AD0A 4K07A 1X5LA 1F42A 4NHUB 2ZUUA 1NJ9B 5FO9A 1R5VB 4Y19E 1FVCB 2GW5A 1OGAB 2EH7H 1K2DA 1AHWB 4FG6C 5A16A 3RL1B 2FZ3A 3S88H 1I9IL 3Q2CA 4HUVB 3SO3B 3UROR 1DQTA 3HE7D 1TXKA 5FYJD 3QIUB 5JUEL 3QFDA 5C0IB 1ZLSH 3VFRB 3VG9C 2K7QA 1TPXB 4O2EA 1I4FB 4P2OA 4RQQA 4N0YL 2OTUB 4I0PC 2Q86B 4XXDB 5GGQL 2YBRA 4NDMA 3G5YB 1FZMB 1G6RL 2HKHL 4D0CA 3VXSA 4WHTB 4F9PA 1KLGB 4AT6A 1SY6H 4Y4KB 3M8OH 3FN3A 5GIRA 3NA9L 5ERWB 4M9OA 5E2TH 2G75B 1XF5B 3WXWL 2DYPA 3HI1A 4QHLA 4PJAF 1AY1L 1A2YA 4KJYA 3IDMA 3GM0A 5I75B 4QF1A 2C3HA 2F53D 2X1OA 1H5BB 1A7OL 3VFTA 4LLYA 1JI2A 2X09A 4X99A 5CEZL 2HFEB 1Z5LA 1XGRA 5CSBA 3JWDC 4NZJA 2CUHA 1MCDA 3W82A 4GLRH 5EC1A 1FGVL 2NY5C 3VI4F 5DD1L 1NAMB 2A73B 2ZJSH 1GC1C 4MD5B 1YEJH 3TO2A 5ALBH 4EN3C 2NR6C 5CUSL 3KPNB 2XACC 4HBQA 4RAUA 4FFVD 5I1LB 4HKXA 5T3XE 4OZFG 1AQKH 2ZOLB 4X6DA 5I6XB 2B39A 4EBQL 4NO5A 3GSNH 1AXTH 5KVDH 1SYVB 2E6JA 5HDQL 4PJ9A 1R6VA 1VGKA 4JRYE 3IDGA 4LHJB 3SO3C 5C0BB 3L95B 3SBWC 4POZD 1CDGA 2VLRA 1HE7A 3D6GA 3QIUC 4PJHB 5E70A 4S2SB 4HUNB 1BQUA 1KIQA 2X4RB 1TPXC 1CQYA 1NCDL 4GT7A 1S5HA 4K3GA 3F7VA 4U1LA 2X89A 5TGBB 2ORBL 4QXGH 3EAKA 1AXSA 3QWQB 1MHCA 3QEHB 4PGDB 3VU2A 4NQUA 1MAJA 1AP2A 2H3NB 3OTTA 1NDMA 2Y07H 1HCFX 3C8DA 4GAJH 4Y4KC 4V2CB 2EDEA 5EDXA 3L1OH 2VXVH 4PGCB 4RA0C 4XPGH 1ZMYA 5EBWB 2XV6B 3SKNA 2RGSA 2EEAA 3NIGF 5I1GH 5I75C 5TQ2L 3MRJA 3VWKB 4RZCA 4U7SA 5I1AA 3OXSA 4YJZL 5IBTL 2AQ3A 3ARWA 4LCWE 3ULUL 4JFDE 3BIKB 3BKML 4DVBA 2PN5A 4ZOBA 3DUHA 2EE2A 5HHNB 2JELL 3Q5YA 3FHAA 4YHZH 3GZKA 4PP1C 3PE9A 4AIOA 5I6XC 2IAMB 3TA3D 3U7YL 3QULB 5F44A 1IAKB 3GBMH 3NCMA 1IJ9A 5GGUB 4MJ6A 2W59A 1MI5E 1JN6B 3MLWL 3FJTA 2C3GA 4FFZH 1GGBH 1S7RA 1RULH 3CZFA 5AEAA 3LKOB 2ZOKA 4K9EL 5I1IH 4Q7DA 4M4RA 3CDGB 3QDGD 4YHLL 1QPPA 5CJBA 1DQLH 1NLBH 1FAIH 2XN9E 4HXAH 4ODUA 3C8KA 2Q8AH 3HC3L 4M1DH 5LAXB 1AGBB 1KB5H 3QHTC 4KPHH 4ONGH 2VYRE 5CGYC 3SDXB 2HG5A 2Z31A 4ZNEE 2AJXL 4PLKC 4RFNB 3N1QC 5FB8A 4RA3A 1CGYA 5CZVH 2YEZB 5LGJA 1NSNL 1S7TB 4FMKA 3MA9L 2A1WL 1CD0A 1LNUB 3MR9A 4YFLF 5DQJA 4NC1C 1GGUA 2MMXA 2MHAB 1MH5B 1NBYA 3KPSD 4JGJA 4X9BA 4N90D 5JTWA 4U2ZA 3WE6A 3VWKC 1T5WB 5C92A 1EFXD 4D0DB 4YDKH 1KFAL 5E1AA 3MNVB 4FQ1H 2NYYC 2ID5A 3CU7A 1JPTH 2E8YA 1UG9A 2L7JA 2YMXL 1L7IH 3CD4A 3QUKA 5BVPL 5DUPH 5CSGA 2NY4D 1EGJA 1KELH 2VDMH 2RB8A 1F4WL 3HPLA 2IAMC 3HC4H 4XCCH 3WFCH 2JIXA 3OGCA 2GKIA 1AD9A 2R29L 1WV7T 2BY1A 2DQHL 5C07E 3NFSH 3S35X 4MB5A 2DQJH 1AO7E 3CFJA 3VFMA 2ICEB 1YN6B 4ZODA 1JE6A 3M1BB 4G8GE 1IEAA 2FX9L 1JHLL 3LEVL 1OD9A 4XVSL 4IRZH 5CHNB 1RK1B 5CP7B 4PRBA 3A0OA 4FQ2H 4Q9QL 3O6FD 4MA3B 1RZ8A 3BPNB 3EYQD 5FYKU 4RFNC 1Q9OB 4IHOA 1JYNA 3NVQA 5IVZB 3FQUB 1F4XH 1PG7H 3L3HB 4ODHL 3UTZB 4U3CA 4CNIA 3TIEB 4DN3L 2LAAA 1I1YA 4X8JB 4NQSB 3ULUC 4ODTL 3EW3B 1S9XA 4CMMB 1KPUB 4DKAA 1YJDL 3PGCA 4LCYB 4XX1E 2LU7A 1JGUH 2WBJB 4LFHD 4MNGB 3MCG1 4XVTL 2RIKA 3MFGB 4HSQA 3GMOB 1UQSB 5DJYB 1RJLB 5D93B 2MCPH 1U8KB 2J6EH 4UT9H 3KPMB 5DEFA 4FTVB 2IANB 1A7PL 4M6OL 3V0WH 4MMXC 4IS6A 1UKTA 1JWMB 4ZTPL 1SJEB 3BKCH 3E3QE 1T5XA 5DJZA 2VLKA 5AZ2L 4E42B 2FJFB 2OR9L 4PJ7F 2YR3A 3GJFA 4GRWF 3U7WL 2VC2H 3M07A 4TQEH 5JW5B 3PWPA 4ZFFB 4M1GL 2B1HL 3QI9B 3W39B 4J8RB 4RMWA 1ETZB 4P2QA 1ZHNA 1J0JA 1CFSA 3GEWB 4A6YA 1N59B 2VZSA 5HYSG 1Q9LA 3BPNC 4GS7B 3R0NA 5C09D 2LFGA 5E99L 2QQNH 2ADJA 4MXVF 3QR2A 4WEUD 5HHQB 2FO4A 3ZYIA 2HVJA 1S7XB 4QNPF 2EE6A 5EOQL 2O5YL 4D9LH 4I18B 3UTTE 3GIZL 4GBXD 4Z76A 1HXYB 1KV3A 2ILLA 1HDMB 5ID0B 4UBDC 1CU4H 3L3GA 5L2JA 4YHNB 1BQHA 1UA6L 3NIGE 4G6JL 5ESQA 2IMMA 3SPVA 3B5TA 4JDZA 3LCYA 2A77L 4U05A 2WBJC 3EFFA 2BSED 2QR0A 3LQAH 1KPRA 3OAZH 4PJIF 3T0VA 3OKNA 1JRHL 2V9QA 5C2BL 3ZYZA 3BGMA 4QOKE 5CBEA 4Y4FD 3STZB 5D93C 4LNVA 2OTWB 1DQQA 5JA8B 1OAQL 1NFDE 5FYJL 3W81A 5CZXD 4YHYB 4IEFB 2B0SH 3HNSL 1CDYA 1W8NA 1LO0H 2D31A 3FQXB 5FUCC 1FIGH 5GGTA 1G0YR 3QZWA 4JQXA 5ICZB 5IQ7L 3TH3T 4DKEH 5F7NC 3T2QA 1I7UB 3MBXH 5ALCL 3INUH 5LGHL 2F9BT 3UTOA 3CFCL 2GJ6E 2XWBA 4WWKA 3WEXB 3GI9L 5D8JL 2VR5A 5MERB 5KVFH 3DX8B 4NJ9H 4C4KO 3QI9C 5FUOL 4Y2DB 3S36H 2IG2H 1EBPA 1HILA 2WIMA 3SGKC 3V9FA 4LPWA 4X4ME 4L3EB 1R3LA 1YEKH 4MJID 1XFPA 4GS7C 1YJDC 4X6FB 2V2TA 4NP4H 3GIVA 1DANU 2NY2B 1FYTD 2OMNA 3PQYD 2VH5L 5CEXB 4I18C 1W0VB 1FFPA 1WWAX 3S3JA 3C60A 4HWBL 4X9IA 1A9EB 3P40A 5FOBB 5E9DD 4OM0L 1C5DA 4P3DB 3V4UH 1PAMA 4H26B 3T4AB 1R3HB 2XPGB 4CN1A 3F7YB 2YD3A 1JNNL 2Y72A 4Z0XB 4WTXA 1DSFL 3O3AB 2I07B 3OL2A 4PLJD 3W11D 3BD3A 5BO1H 1MPAH 3ZTNL 1MFDH 4XWOC 2FJHA 1N5YL 3QH3A 4YHYC 1FP5A 2BHUA 3MGOA 3U79A 3RY6C 5DZNA 3TV3L 5I8KH 4TUOA 3IU4L 4L4TD 5DEZA 1U3JA 5C6PB 1JPGA 2UWEA 1ONQB 5HHXL 5C0RH 4QRTA 3X14A 5FYKH 3NZ8B 3OKMA 1QKZH 4XP9L 5L6YL 2ZKHH 1Q0YH 1TVBA 4OCRL 2A9ML 4LIQE 2EDWA 5HYQA 4P0DA 2J1KA 1RHFA 4Y2DC 2BSSB 4CJ1A 5KZCD 1UCTA 5FUZH 4HUKB 4ENEC 1M6OB 4LPVA 1AR1D 2O93L 4NM4L 2VR9A 5EG6C 4LARH 5JW3L 1RZ7H 4GG6A 4ALAL 3ALXA 1A1MA 4OJFL 1JRHI 1KYOK 1P53A 3K2UH 4NRXB 1LEIB 1QFWH 2P5ED 3KDMA 3DUUA 4OLEA 4XCNB 4V1DD 1I3UA 4FXKB 4O4YH 5AYQA 5ACMA 2VLJD 4ZFGH 5B4MD 1YEGL 2PO6B 2V5TA 3FTGB 3LV3A 3F7PC 4JVWA 4XMLH 1PD6A 4YR6A 1JHTA 1U8PA 2NPLX 2LV4A 3MTRA 1U8JA 3GMLA 2BOBB 1EO5A 3PWLB 5IB5B 3SOBL 3RWGB 1BHGA 1SYSA 5ISZE 3EO9L 1KJ2H 4OZGE 1EVTC 4PJEA 4XPBL 3QEUA 4GRWE 4RWYH 4MD0A 3NFNB 3O81A 2WZPD 5FGCE 4NSKB 3U0TB 4DKFH 2BVYA 5DMIH 4PRPD 2FR4B 4UAOB 1J1PL 3FQTA 4LSTH 3RIFK 3P3YA 4JB9L 1FV1B 1KN2L 5JOFA 3O11B 4OTXH 5BRZA 5EU3B 2QTEA 1CBVL 4ZUWB 4Y1AD 3EO1B 1HOCB 3IJHB 3MV7E 2HT3D 1LGVA 2P44B 4DUWA 3DO3A 1I1FA 2Q3AA 1TFHA 2AKRB 3MLRL 4L9DA 4QNPE 3VH8B 1NDGA 4WHYG 4PG9A 2E9JA 1FFOB 4FQLH 3QXUA 1CFNA 1RURL 4XCFH 1UEMA 1U91A 4N5ED 4OLWL 3HRPA 3MXVH 4LLAA 4PJIE 4LSVH 1Q0XL 4I0KA 4YEFA 4O00A 3LN4B 2IFGA 3PL6B 1QYGH 3OR7A 5FF6A 1BZ9B 3ARQA 3I02B 1ED3A 3N85L 4XP5H 3V5DA 4U1GB 3G08A 4M6NH 3ES6A 1OY3B 3HMXH 2F5BL 2WWKO 4NN6B 1HH6B 3T4YA 4CMHB 4K23L 5J1TC 1TTGA 3TZVB 4OF6A 3KPSB 5TFSL 5LVEA 2GTWA 3FONB 3O41B 3QO1B 1N4XH 1FE8L 5FGSA 5T5NF 4H1LA 4HS8H 2DQDL 1TLKA 3LB6D 3RUGB 2JCCF 5IFHH 4UAOC 2X4NB 5D70H 3AUVA 1A7RH 3L3DB 4S1DD 1F11A 5K59E 5HVGB 2V2XB 3BI9X 4U6TA 4OZHB 3TT1L 1MJUL 4URTB 4KMTL 3SJVE 4LCUA 2OI9C 5I73B 4LOUC 5T1MB 5DJDB 1JZ4A 1I9IH 2NY3B 1XZ0B 3ORJA 1YQVL 4P4KB 3ROLA 1W72L 4N0YH 4GRLB 1ACYL 5JOEA 3ULSA 5E1HB 4HAGA 4OQ1A 3BRFA 2EC9T 4QWWD 3PL6C 5HYJE 3PP4L 2P24A 4X98A 4MXWL 1G6RH 2BOCA 3F5WB 4YX2L 4ELKB 5BQ7B 5T3XD 4L8SB 1FH5L 4N8VG 1ZLVK 5MI0B 2BCKA 1KTDA 1AH1A 3NA9H 1T0MB 4IOIA 4NN6C 4CMHC 2P5WB 3WXWH 4ZS7L 2V2WB 3W0WB 1AY1H 7CGTA 5DQDH 2IQAB 3TZVC 1ORSA 4HLZH 5L2KB 1MLBB 1PGRB 2X1WL 4JRYD 5JMRA 4G9FB 5D4QA 1B0GA 1BD2A 5C0CA 5CEZH 1P4BL 5C0EA 1FGVH 3E6FB 2XZAL 3ILPB 5DD1H 1AC6A 3RWIB 4LK4A 2ADIA 4PJCF 3BH8A 5CUSH 4PJFF 3MBED 5GZOD 4EBQH 4ZSOB 1T89A 3HAEH 3UZQA 5TDNA 2AK4B 2Z91B 3MREB 5I73C 1I1RA 1KENL 1ZXQA 2H2PD 3A67L 3GSVB 5HDQH 3K3QA 1X9QA 3U1SL 3SKMB 3MRCB 5GGVY 4JREB 3KPRE 3H3BC 4LCCA 1XCTB 2L0DA 3WKNA 4OCLC 1EJ6A 1WBZB 5GS1A 4EI6A 6FABL 5KSBF 4P4KC 5FDWB 4X7CC 4GRLC 3VFPA 1NCDH 1MAKA 4QYOA 3O8XB 4M3JA 3BGFB 4U1NA 2ORBH 3MPCA 3ARBB 3ARRA 3CK0L 4N5UA 4S0SD 4HEME 4LCWD 4JFDD 4DK6A 3G04B 5IVNA 3AXLB 1BJ1H 2C3WA 1DBBL 1F58L 4L8SC 2FLBT 4N68A 1NMAL 3C5SA 5MI0C 4ZQKB 4I0CC 1L0YA 2AS5M 2GCYA 3UTSA 1PYWB 2P43B 3QDJA 2P46B 1NANI 3WUWG 5TQ2H 3U30B 4J2XA 3UDWA 4BH8B 3RVVD 4ZAKA 4XMPL 3MLTA 3NN8B 4S1QL 4WUUE 2ZP0T 4PJBE 3ULUH 2XN9D 4F7MA 5J7CC 3KYMB 3FB8B 3BKMH 5ID1A 3MNZB 1V7NL 3NFPA 4FQHB 2JELH 1R3KA 4AEIL 3U7YH 1X5JA 2VWEC 2OJZL 5EN2B 1JMXA 1SHMA 4QEGA 1NCWL 1UB5A 2EEDA 3MLWH 2ITCB 2VLLB 5C0DB 4JREC 3HRZA 4L8CB 3BPCA 4L3CA 4RIRA 4K9EH 5FYJU 5BVJB 5EIIB 1IL1B 4YHLH 3ALPA 2HRLA 3RTQD 3MUY1 1VFBA 3WNOA 5E8PB 2YUXA 3HC3H 4R90L 3O8XC 4ZXBA 3BGFC 4PJ8B 2HRPL 3U4EA 3DBXA 3MOAL 2HJFA 2AQ1A 4MJIB 1XGQA 2AJXH 3DRTB 5K9JL 2F19L 3BP4B 1NSNH 3MA9H 1S7SA 2A1WH 1A47A 2XIDA 3VD9A 1QVOA 3MNWA 5DT1L 4AENB 1MQKL 1ZHLB 2H1PL 2ENSA 3CVHA 3LPWA 3BZFB 3JV6A 3TNMA 5E9DB 2DBLL 1AO7D 2R0WL 4HIJA 3MRPA 1A22B 4G8GD 1T2JA 4BQ6A 5GRZA 1JI1A 1OSZA 2QHLA 1KFAH 3FAWA 5F89B 1CTNA 1JK8B 2DI7A 5E8OB 4ZPVA 2YMXH 2JCCE 5BVPH 2X05A 4ODWA 3OAZK 5CZXC 1GOGA 5FKAB 2DKSA 2W60B 3PNWB 3MRBA 5IK3B 3VXUA 1K3IA 1F4WH 2H8PB 4HUWA 4OB5L 1CQKA 1MOEA 2R29H 3BUYA 4ONFL 4ODXB 3OX8B 3VFOB 1DQDL 1P4LB 2W0FA 2NXYB 3CFBB 3HZMB 43CAB 1T0PB 2AJ3A 5KOMC 2MQ3A 5H94A 5D6CB 1JHLH 3LEVH 3RWCA 3V6OC 4G7VL 4XVSH 3RQ3A 1S7WA 1DN0B 4EVNA 5KZCB 2A6DA 3U2SB 1A4KA 4Q9QH 4PJ8C 3QJHB 4CADA 4Z77A 4WNQA 1C7SA 3X12A 4CVWA 3RWJA 4LHQB 1U8MB 5BZDB 2W07A 2MQCA 3SDDB 4C83A 4HIHA 3ZDYF 5B38B 5SWZA 4ODHH 3UZVB 5HBBA 5GS2H 3G6JB 3T0EA 5IW1A 4MJ5B 4DN3H 2G2RA 4ODTH 1ZGLP 3VFWB 1I8LA 1NUNB 1DVFD 1XGTB 1HQ4B 4PJGF 1K4DA 3BT2L 3DUSB 3K46A 4XVTH 4GXUN 3UYOD 2C4XA 2J8UB 1EH9A 3FL7A 4LHUG 4M5ZH 4OGZA 5DSCB 2BMKA 2YRLA 3ZDZE 3D3VD 3OKLA 3NMEA 3WNPA 3NCFB 3BVNA 4JHZA 4C54A 4M4PA 1A7PH 4M6OH 4Z7VA 2ZG1A 1WAAA 2QSTA 3P0VL 5K33A 2DIAA 2FSEA 1A3QA 4ZTPH 5DJ6B 4NN5B 4MQ7B 1G1CA 3QQ9C 1VFAB 5AZ2H 5KSVB 3UTTD 4HS6A 2OR9H 2NXYC 4JRXA 3U7WH 3H6JA 5TDPA 4M1GH 5DJCA 3FT2B 3W9DB 2B1HH 5DMGC 1NKRA 3W9EB 2AJYL 3TYFB 5SWSA 2F8OA 5C0AA 5HDLA 4IDLA 4JCMA 1SMOA 2C3VA 3QWRD 4PRPB 4OD2A 4ELME 1SBSL 1JPSL 1A6VL 3D0VB 4M1CD 4BKLB 1AR1C 1X5FA 4E0RB 2DLGA 2V7HA 5E99H 1EUTA 4M00A 5KVMC 1HWHB 5DA0B 1P69B 2FRGP 4KI5C 3SDDC 4ETQA 4EZMA 2CXKA 2IBZY 4M03A 5EOQH 2O5YH 4MDJA 2XRAL 3DETD 4OCYL 3GIZH 3VWJA 2I26N 1OT1A 4M7KL 1NEUA 1UA6H 3L3KB 4G6AD 2D0GA 4G6JH 4GQ9L 1OP3K 5A2IH 4LRNL 3U48A 3QPXL 4P59L 2A77H 4KK9C 2AV1A 3I6KA 5BS0B 2BVOB 3L5WA